data_6BHG
# 
_entry.id   6BHG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BHG         
WWPDB D_1000230844 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BHG 
_pdbx_database_status.recvd_initial_deposition_date   2017-10-30 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Qin, S.'                              1 ? 
'Tempel, W.'                           2 ? 
'Dong, A.'                             3 ? 
'Bountra, C.'                          4 ? 
'Arrowsmith, C.H.'                     5 ? 
'Edwards, A.M.'                        6 ? 
'Min, J.'                              7 ? 
'Structural Genomics Consortium (SGC)' 8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                2057 
_citation.page_last                 2057 
_citation.title                     'H3K14ac is linked to methylation of H3K9 by the triple Tudor domain of SETDB1.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-02259-9 
_citation.pdbx_database_id_PubMed   29234025 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jurkowska, R.Z.'  1  
primary 'Qin, S.'          2  
primary 'Kungulovski, G.'  3  
primary 'Tempel, W.'       4  
primary 'Liu, Y.'          5  
primary 'Bashtrykov, P.'   6  
primary 'Stiefelmaier, J.' 7  
primary 'Jurkowski, T.P.'  8  
primary 'Kudithipudi, S.'  9  
primary 'Weirich, S.'      10 
primary 'Tamas, R.'        11 
primary 'Wu, H.'           12 
primary 'Dombrovski, L.'   13 
primary 'Loppnau, P.'      14 
primary 'Reinhardt, R.'    15 
primary 'Min, J.'          16 
primary 'Jeltsch, A.'      17 
# 
_cell.entry_id           6BHG 
_cell.length_a           37.709 
_cell.length_b           72.363 
_cell.length_c           52.501 
_cell.angle_alpha        90.000 
_cell.angle_beta         104.750 
_cell.angle_gamma        90.000 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6BHG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase SETDB1' 27670.734 1   2.1.1.43 ? 'UNP residues 190-410' ? 
2 polymer     syn 'Histone H3.1'                              1813.113  1   ?        ? ?                      ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                       ?         40  ?        ? ?                      ? 
4 water       nat water                                       18.015    223 ?        ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;ERG-associated protein with SET domain, ESET, Histone H3-K9 methyltransferase 4, H3-K9-HMTase 4, Lysine N-methyltransferase 1E, SET domain bifurcated 1
;
2 
;Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MHHHHHHSSGRENLYFQGGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDY
HPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRD
FIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALE
;
;MHHHHHHSSGRENLYFQGGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDY
HPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRD
FIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALE
;
A ? 
2 'polypeptide(L)' no yes '(ACE)KQTARKSTGG(ALY)APRKQ(NH2)' XKQTARKSTGGKAPRKQX B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  ARG n 
1 12  GLU n 
1 13  ASN n 
1 14  LEU n 
1 15  TYR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLY n 
1 19  GLY n 
1 20  GLU n 
1 21  LEU n 
1 22  SER n 
1 23  LYS n 
1 24  ASP n 
1 25  GLY n 
1 26  ASP n 
1 27  LEU n 
1 28  ILE n 
1 29  VAL n 
1 30  SER n 
1 31  MET n 
1 32  ARG n 
1 33  ILE n 
1 34  LEU n 
1 35  GLY n 
1 36  LYS n 
1 37  LYS n 
1 38  ARG n 
1 39  THR n 
1 40  LYS n 
1 41  THR n 
1 42  TRP n 
1 43  HIS n 
1 44  LYS n 
1 45  GLY n 
1 46  THR n 
1 47  LEU n 
1 48  ILE n 
1 49  ALA n 
1 50  ILE n 
1 51  GLN n 
1 52  THR n 
1 53  VAL n 
1 54  GLY n 
1 55  PRO n 
1 56  GLY n 
1 57  LYS n 
1 58  LYS n 
1 59  TYR n 
1 60  LYS n 
1 61  VAL n 
1 62  LYS n 
1 63  PHE n 
1 64  ASP n 
1 65  ASN n 
1 66  LYS n 
1 67  GLY n 
1 68  LYS n 
1 69  SER n 
1 70  LEU n 
1 71  LEU n 
1 72  SER n 
1 73  GLY n 
1 74  ASN n 
1 75  HIS n 
1 76  ILE n 
1 77  ALA n 
1 78  TYR n 
1 79  ASP n 
1 80  TYR n 
1 81  HIS n 
1 82  PRO n 
1 83  PRO n 
1 84  ALA n 
1 85  ASP n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  VAL n 
1 90  GLY n 
1 91  SER n 
1 92  ARG n 
1 93  VAL n 
1 94  VAL n 
1 95  ALA n 
1 96  LYS n 
1 97  TYR n 
1 98  LYS n 
1 99  ASP n 
1 100 GLY n 
1 101 ASN n 
1 102 GLN n 
1 103 VAL n 
1 104 TRP n 
1 105 LEU n 
1 106 TYR n 
1 107 ALA n 
1 108 GLY n 
1 109 ILE n 
1 110 VAL n 
1 111 ALA n 
1 112 GLU n 
1 113 THR n 
1 114 PRO n 
1 115 ASN n 
1 116 VAL n 
1 117 LYS n 
1 118 ASN n 
1 119 LYS n 
1 120 LEU n 
1 121 ARG n 
1 122 PHE n 
1 123 LEU n 
1 124 ILE n 
1 125 PHE n 
1 126 PHE n 
1 127 ASP n 
1 128 ASP n 
1 129 GLY n 
1 130 TYR n 
1 131 ALA n 
1 132 SER n 
1 133 TYR n 
1 134 VAL n 
1 135 THR n 
1 136 GLN n 
1 137 SER n 
1 138 GLU n 
1 139 LEU n 
1 140 TYR n 
1 141 PRO n 
1 142 ILE n 
1 143 CYS n 
1 144 ARG n 
1 145 PRO n 
1 146 LEU n 
1 147 LYS n 
1 148 LYS n 
1 149 THR n 
1 150 TRP n 
1 151 GLU n 
1 152 ASP n 
1 153 ILE n 
1 154 GLU n 
1 155 ASP n 
1 156 ILE n 
1 157 SER n 
1 158 CYS n 
1 159 ARG n 
1 160 ASP n 
1 161 PHE n 
1 162 ILE n 
1 163 GLU n 
1 164 GLU n 
1 165 TYR n 
1 166 VAL n 
1 167 THR n 
1 168 ALA n 
1 169 TYR n 
1 170 PRO n 
1 171 ASN n 
1 172 ARG n 
1 173 PRO n 
1 174 MET n 
1 175 VAL n 
1 176 LEU n 
1 177 LEU n 
1 178 LYS n 
1 179 SER n 
1 180 GLY n 
1 181 GLN n 
1 182 LEU n 
1 183 ILE n 
1 184 LYS n 
1 185 THR n 
1 186 GLU n 
1 187 TRP n 
1 188 GLU n 
1 189 GLY n 
1 190 THR n 
1 191 TRP n 
1 192 TRP n 
1 193 LYS n 
1 194 SER n 
1 195 ARG n 
1 196 VAL n 
1 197 GLU n 
1 198 GLU n 
1 199 VAL n 
1 200 ASP n 
1 201 GLY n 
1 202 SER n 
1 203 LEU n 
1 204 VAL n 
1 205 ARG n 
1 206 ILE n 
1 207 LEU n 
1 208 PHE n 
1 209 LEU n 
1 210 ASP n 
1 211 ASP n 
1 212 LYS n 
1 213 ARG n 
1 214 CYS n 
1 215 GLU n 
1 216 TRP n 
1 217 ILE n 
1 218 TYR n 
1 219 ARG n 
1 220 GLY n 
1 221 SER n 
1 222 THR n 
1 223 ARG n 
1 224 LEU n 
1 225 GLU n 
1 226 PRO n 
1 227 MET n 
1 228 PHE n 
1 229 SER n 
1 230 MET n 
1 231 LYS n 
1 232 THR n 
1 233 SER n 
1 234 SER n 
1 235 ALA n 
1 236 SER n 
1 237 ALA n 
1 238 LEU n 
1 239 GLU n 
2 1   ACE n 
2 2   LYS n 
2 3   GLN n 
2 4   THR n 
2 5   ALA n 
2 6   ARG n 
2 7   LYS n 
2 8   SER n 
2 9   THR n 
2 10  GLY n 
2 11  GLY n 
2 12  ALY n 
2 13  ALA n 
2 14  PRO n 
2 15  ARG n 
2 16  LYS n 
2 17  GLN n 
2 18  NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   239 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SETDB1, KIAA0067, KMT1E' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       18 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SETB1_HUMAN Q15047 ? 1 
;GELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYK
DGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLK
SGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALE
;
190 
2 UNP H31_HUMAN   P68431 ? 2 KQTARKSTGGKAPRKQ 5   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6BHG A 19 ? 239 ? Q15047 190 ? 410 ? 190 410 
2 2 6BHG B 2  ? 17  ? P68431 5   ? 20  ? 4   19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6BHG MET A 1  ? UNP Q15047 ? ? 'expression tag' 172 1  
1 6BHG HIS A 2  ? UNP Q15047 ? ? 'expression tag' 173 2  
1 6BHG HIS A 3  ? UNP Q15047 ? ? 'expression tag' 174 3  
1 6BHG HIS A 4  ? UNP Q15047 ? ? 'expression tag' 175 4  
1 6BHG HIS A 5  ? UNP Q15047 ? ? 'expression tag' 176 5  
1 6BHG HIS A 6  ? UNP Q15047 ? ? 'expression tag' 177 6  
1 6BHG HIS A 7  ? UNP Q15047 ? ? 'expression tag' 178 7  
1 6BHG SER A 8  ? UNP Q15047 ? ? 'expression tag' 179 8  
1 6BHG SER A 9  ? UNP Q15047 ? ? 'expression tag' 180 9  
1 6BHG GLY A 10 ? UNP Q15047 ? ? 'expression tag' 181 10 
1 6BHG ARG A 11 ? UNP Q15047 ? ? 'expression tag' 182 11 
1 6BHG GLU A 12 ? UNP Q15047 ? ? 'expression tag' 183 12 
1 6BHG ASN A 13 ? UNP Q15047 ? ? 'expression tag' 184 13 
1 6BHG LEU A 14 ? UNP Q15047 ? ? 'expression tag' 185 14 
1 6BHG TYR A 15 ? UNP Q15047 ? ? 'expression tag' 186 15 
1 6BHG PHE A 16 ? UNP Q15047 ? ? 'expression tag' 187 16 
1 6BHG GLN A 17 ? UNP Q15047 ? ? 'expression tag' 188 17 
1 6BHG GLY A 18 ? UNP Q15047 ? ? 'expression tag' 189 18 
2 6BHG ACE B 1  ? UNP P68431 ? ? acetylation      3   19 
2 6BHG NH2 B 18 ? UNP P68431 ? ? amidation        20  20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'        ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE'   ? 'C8 H16 N2 O3'   188.224 
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'         ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BHG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.65 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG5000 MME, 0.1 M Bis-Tris' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97944 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97944 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.entry_id                     6BHG 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             41.560 
_reflns.d_resolution_high            1.400 
_reflns.number_obs                   53270 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.300 
_reflns.pdbx_Rmerge_I_obs            0.035 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.900 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.700 
_reflns.pdbx_Rrim_I_all              0.042 
_reflns.pdbx_Rpim_I_all              0.022 
_reflns.pdbx_CC_half                 1.000 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     196395 
_reflns.pdbx_scaling_rejects         0 
_reflns.pdbx_chi_squared             ? 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1 1.400 1.420  ? 6838 ? ? 0.826 ? ? ? 2.800 ? 1.400  ? 2436 ? ? ? ? 93.100 1.025 0.594 0.591 
1 2 7.670 41.560 ? 1179 ? ? 0.019 ? ? ? 3.400 ? 68.900 ? 344  ? ? ? ? 98.900 0.022 0.012 0.999 
# 
_refine.entry_id                                 6BHG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.4500 
_refine.ls_d_res_low                             41.5600 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6500 
_refine.ls_number_reflns_obs                     45714 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  
;We thank Aiping Dong for collection of diffraction data. Water sites were picked with PHENIX. COOT was used for interactive model building. Model geometry was evaluated with MOLPROBITY. Uninterpreted density in the aromatic cage of Tudor domain three may have arisen from the K9 side chain of bound histone peptide or from the R384 side chain of SETDB1.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1352 
_refine.ls_R_factor_R_work                       0.1330 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.1761 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  2428 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               20.6310 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.5900 
_refine.aniso_B[2][2]                            -0.2900 
_refine.aniso_B[3][3]                            -0.0700 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.4200 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9760 
_refine.correlation_coeff_Fo_to_Fc_free          0.9630 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.0540 
_refine.pdbx_overall_ESU_R_Free                  0.0550 
_refine.overall_SU_ML                            0.0380 
_refine.overall_SU_B                             2.2830 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      
'earlier version of coordinates of nearly isomorphous crystal structure (see PDB entry 6BHE)' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                89.440 
_refine.B_iso_min                                10.080 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.4500 
_refine_hist.d_res_low                        41.5600 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               2013 
_refine_hist.pdbx_number_residues_total       224 
_refine_hist.pdbx_B_iso_mean_ligand           36.09 
_refine_hist.pdbx_B_iso_mean_solvent          33.54 
_refine_hist.pdbx_number_atoms_protein        1750 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       1857 0.016  0.020  ? ? 
'X-RAY DIFFRACTION' r_bond_other_d         1735 0.003  0.020  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    2529 1.662  1.966  ? ? 
'X-RAY DIFFRACTION' r_angle_other_deg      4024 0.996  3.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 240  6.509  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 72   30.706 23.194 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 320  10.372 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 10   15.850 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         283  0.111  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   2043 0.009  0.021  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_other     389  0.002  0.020  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            916  2.650  1.849  ? ? 
'X-RAY DIFFRACTION' r_mcbond_other         915  2.563  1.845  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           1145 3.049  2.780  ? ? 
'X-RAY DIFFRACTION' r_rigid_bond_restr     3592 2.185  3.000  ? ? 
'X-RAY DIFFRACTION' r_sphericity_free      148  26.859 5.000  ? ? 
'X-RAY DIFFRACTION' r_sphericity_bonded    3656 13.059 5.000  ? ? 
# 
_refine_ls_shell.d_res_high                       1.4500 
_refine_ls_shell.d_res_low                        1.4880 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9100 
_refine_ls_shell.number_reflns_R_work             3337 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2040 
_refine_ls_shell.R_factor_R_free                  0.2430 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             182 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3519 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                     6BHG 
_struct.title                        'Crystal structure of SETDB1 with a modified H3 peptide' 
_struct.pdbx_descriptor              'Histone-lysine N-methyltransferase SETDB1 (E.C.2.1.1.43), Histone H3.1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BHG 
_struct_keywords.text            'structural genomics, Structural Genomics Consortium, SGC, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 4 ? 
RA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 83  ? LEU A 87  ? PRO A 254 LEU A 258 5 ? 5  
HELX_P HELX_P2 AA2 ASN A 115 ? LYS A 119 ? ASN A 286 LYS A 290 5 ? 5  
HELX_P HELX_P3 AA3 THR A 135 ? SER A 137 ? THR A 306 SER A 308 5 ? 3  
HELX_P HELX_P4 AA4 LYS A 148 ? ILE A 153 ? LYS A 319 ILE A 324 5 ? 6  
HELX_P HELX_P5 AA5 ASP A 155 ? TYR A 169 ? ASP A 326 TYR A 340 1 ? 15 
HELX_P HELX_P6 AA6 LEU A 224 ? SER A 233 ? LEU A 395 SER A 404 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? B GLY 11 C ? ? ? 1_555 B ALY 12 N ? ? B GLY 13 B ALY 14 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale2 covale both ? B ALY 12 C ? ? ? 1_555 B ALA 13 N ? ? B ALY 14 B ALA 15 1_555 ? ? ? ? ? ? ? 1.332 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           169 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            340 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    170 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     341 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       13.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 20  ? LEU A 21  ? GLU A 191 LEU A 192 
AA1 2 TRP A 42  ? VAL A 53  ? TRP A 213 VAL A 224 
AA1 3 GLY A 56  ? PHE A 63  ? GLY A 227 PHE A 234 
AA1 4 LYS A 68  ? SER A 72  ? LYS A 239 SER A 243 
AA2 1 GLU A 20  ? LEU A 21  ? GLU A 191 LEU A 192 
AA2 2 TRP A 42  ? VAL A 53  ? TRP A 213 VAL A 224 
AA2 3 ARG A 32  ? LYS A 36  ? ARG A 203 LYS A 207 
AA2 4 ILE A 76  ? TYR A 78  ? ILE A 247 TYR A 249 
AA3 1 LYS A 23  ? ASP A 24  ? LYS A 194 ASP A 195 
AA3 2 LEU A 27  ? ILE A 28  ? LEU A 198 ILE A 199 
AA4 1 ALA A 131 ? VAL A 134 ? ALA A 302 VAL A 305 
AA4 2 PHE A 122 ? PHE A 126 ? PHE A 293 PHE A 297 
AA4 3 TRP A 104 ? GLU A 112 ? TRP A 275 GLU A 283 
AA4 4 ARG A 92  ? TYR A 97  ? ARG A 263 TYR A 268 
AA4 5 LEU A 139 ? PRO A 141 ? LEU A 310 PRO A 312 
AA5 1 LEU A 182 ? TRP A 187 ? LEU A 353 TRP A 358 
AA5 2 THR A 190 ? ASP A 200 ? THR A 361 ASP A 371 
AA5 3 LEU A 203 ? PHE A 208 ? LEU A 374 PHE A 379 
AA5 4 CYS A 214 ? TYR A 218 ? CYS A 385 TYR A 389 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 21  ? N LEU A 192 O ILE A 50  ? O ILE A 221 
AA1 2 3 N ILE A 48  ? N ILE A 219 O LYS A 60  ? O LYS A 231 
AA1 3 4 N TYR A 59  ? N TYR A 230 O LEU A 71  ? O LEU A 242 
AA2 1 2 N LEU A 21  ? N LEU A 192 O ILE A 50  ? O ILE A 221 
AA2 2 3 O GLY A 45  ? O GLY A 216 N ILE A 33  ? N ILE A 204 
AA2 3 4 N LEU A 34  ? N LEU A 205 O ALA A 77  ? O ALA A 248 
AA3 1 2 N ASP A 24  ? N ASP A 195 O LEU A 27  ? O LEU A 198 
AA4 1 2 O SER A 132 ? O SER A 303 N ILE A 124 ? N ILE A 295 
AA4 2 3 O LEU A 123 ? O LEU A 294 N ALA A 111 ? N ALA A 282 
AA4 3 4 O TRP A 104 ? O TRP A 275 N TYR A 97  ? N TYR A 268 
AA4 4 5 N VAL A 94  ? N VAL A 265 O TYR A 140 ? O TYR A 311 
AA5 1 2 N THR A 185 ? N THR A 356 O TRP A 192 ? O TRP A 363 
AA5 2 3 N ARG A 195 ? N ARG A 366 O LEU A 207 ? O LEU A 378 
AA5 3 4 N ILE A 206 ? N ILE A 377 O GLU A 215 ? O GLU A 386 
# 
_atom_sites.entry_id                    6BHG 
_atom_sites.fract_transf_matrix[1][1]   0.026519 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006982 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013819 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019696 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A  1 18  ? 77.287 -40.513 68.896 1.00 59.39 ? 189 GLY A N   1 
ATOM   2    C CA  . GLY A  1 18  ? 78.508 -39.740 68.539 1.00 45.75 ? 189 GLY A CA  1 
ATOM   3    C C   . GLY A  1 18  ? 78.173 -38.285 68.235 1.00 33.38 ? 189 GLY A C   1 
ATOM   4    O O   . GLY A  1 18  ? 77.005 -37.876 68.216 1.00 39.17 ? 189 GLY A O   1 
ATOM   5    N N   . GLY A  1 19  ? 79.217 -37.505 68.003 1.00 34.28 ? 190 GLY A N   1 
ATOM   6    C CA  . GLY A  1 19  ? 79.069 -36.112 67.657 1.00 29.47 ? 190 GLY A CA  1 
ATOM   7    C C   . GLY A  1 19  ? 78.797 -35.157 68.819 1.00 27.57 ? 190 GLY A C   1 
ATOM   8    O O   . GLY A  1 19  ? 78.651 -34.015 68.584 1.00 23.43 ? 190 GLY A O   1 
ATOM   9    N N   . GLU A  1 20  ? 78.769 -35.628 70.060 1.00 24.26 ? 191 GLU A N   1 
ATOM   10   C CA  . GLU A  1 20  ? 78.468 -34.757 71.194 1.00 21.19 ? 191 GLU A CA  1 
ATOM   11   C C   . GLU A  1 20  ? 79.667 -33.840 71.446 1.00 19.52 ? 191 GLU A C   1 
ATOM   12   O O   . GLU A  1 20  ? 80.822 -34.311 71.404 1.00 24.12 ? 191 GLU A O   1 
ATOM   13   C CB  . GLU A  1 20  ? 78.265 -35.588 72.438 1.00 25.33 ? 191 GLU A CB  1 
ATOM   14   C CG  . GLU A  1 20  ? 77.086 -36.561 72.408 1.00 26.27 ? 191 GLU A CG  1 
ATOM   15   C CD  . GLU A  1 20  ? 77.439 -37.976 71.859 1.00 33.35 ? 191 GLU A CD  1 
ATOM   16   O OE1 . GLU A  1 20  ? 78.554 -38.215 71.295 1.00 33.04 ? 191 GLU A OE1 1 
ATOM   17   O OE2 . GLU A  1 20  ? 76.588 -38.862 72.005 1.00 43.17 ? 191 GLU A OE2 1 
ATOM   18   N N   . LEU A  1 21  ? 79.397 -32.566 71.784 1.00 20.32 ? 192 LEU A N   1 
ATOM   19   C CA  . LEU A  1 21  ? 80.426 -31.581 72.069 1.00 20.63 ? 192 LEU A CA  1 
ATOM   20   C C   . LEU A  1 21  ? 80.090 -30.829 73.330 1.00 20.63 ? 192 LEU A C   1 
ATOM   21   O O   . LEU A  1 21  ? 78.913 -30.584 73.620 1.00 21.51 ? 192 LEU A O   1 
ATOM   22   C CB  . LEU A  1 21  ? 80.533 -30.598 70.910 1.00 21.69 ? 192 LEU A CB  1 
ATOM   23   C CG  . LEU A  1 21  ? 81.046 -31.174 69.609 1.00 25.21 ? 192 LEU A CG  1 
ATOM   24   C CD1 . LEU A  1 21  ? 80.811 -30.255 68.421 1.00 28.65 ? 192 LEU A CD1 1 
ATOM   25   C CD2 . LEU A  1 21  ? 82.538 -31.537 69.716 1.00 31.73 ? 192 LEU A CD2 1 
ATOM   26   N N   . SER A  1 22  ? 81.128 -30.445 74.092 1.00 19.38 ? 193 SER A N   1 
ATOM   27   C CA  A SER A  1 22  ? 80.910 -29.558 75.218 0.70 19.48 ? 193 SER A CA  1 
ATOM   28   C CA  B SER A  1 22  ? 80.956 -29.543 75.243 0.30 19.63 ? 193 SER A CA  1 
ATOM   29   C C   . SER A  1 22  ? 81.032 -28.070 74.894 1.00 19.77 ? 193 SER A C   1 
ATOM   30   O O   . SER A  1 22  ? 80.580 -27.232 75.667 1.00 19.74 ? 193 SER A O   1 
ATOM   31   C CB  A SER A  1 22  ? 81.828 -29.931 76.381 0.70 21.64 ? 193 SER A CB  1 
ATOM   32   C CB  B SER A  1 22  ? 82.003 -29.810 76.317 0.30 18.88 ? 193 SER A CB  1 
ATOM   33   O OG  A SER A  1 22  ? 83.185 -29.781 75.993 0.70 25.98 ? 193 SER A OG  1 
ATOM   34   O OG  B SER A  1 22  ? 81.894 -31.117 76.806 0.30 18.84 ? 193 SER A OG  1 
ATOM   35   N N   . LYS A  1 23  ? 81.650 -27.768 73.754 1.00 20.61 ? 194 LYS A N   1 
ATOM   36   C CA  . LYS A  1 23  ? 81.838 -26.424 73.305 1.00 22.17 ? 194 LYS A CA  1 
ATOM   37   C C   . LYS A  1 23  ? 81.891 -26.429 71.777 1.00 22.33 ? 194 LYS A C   1 
ATOM   38   O O   . LYS A  1 23  ? 82.180 -27.446 71.145 1.00 26.16 ? 194 LYS A O   1 
ATOM   39   C CB  . LYS A  1 23  ? 83.125 -25.820 73.889 1.00 26.21 ? 194 LYS A CB  1 
ATOM   40   C CG  . LYS A  1 23  ? 84.414 -26.377 73.347 1.00 34.39 ? 194 LYS A CG  1 
ATOM   41   N N   . ASP A  1 24  ? 81.575 -25.272 71.221 1.00 20.37 ? 195 ASP A N   1 
ATOM   42   C CA  . ASP A  1 24  ? 81.754 -24.965 69.797 1.00 24.64 ? 195 ASP A CA  1 
ATOM   43   C C   . ASP A  1 24  ? 82.194 -23.516 69.794 1.00 21.28 ? 195 ASP A C   1 
ATOM   44   O O   . ASP A  1 24  ? 81.359 -22.632 69.822 1.00 22.14 ? 195 ASP A O   1 
ATOM   45   C CB  . ASP A  1 24  ? 80.424 -25.108 69.040 1.00 24.96 ? 195 ASP A CB  1 
ATOM   46   C CG  . ASP A  1 24  ? 80.500 -24.521 67.639 1.00 27.25 ? 195 ASP A CG  1 
ATOM   47   O OD1 . ASP A  1 24  ? 81.595 -24.478 67.074 1.00 28.02 ? 195 ASP A OD1 1 
ATOM   48   O OD2 . ASP A  1 24  ? 79.457 -24.076 67.149 1.00 33.05 ? 195 ASP A OD2 1 
ATOM   49   N N   . GLY A  1 25  ? 83.500 -23.266 69.809 1.00 23.09 ? 196 GLY A N   1 
ATOM   50   C CA  . GLY A  1 25  ? 84.010 -21.916 69.930 1.00 25.29 ? 196 GLY A CA  1 
ATOM   51   C C   . GLY A  1 25  ? 83.536 -21.334 71.256 1.00 24.34 ? 196 GLY A C   1 
ATOM   52   O O   . GLY A  1 25  ? 83.664 -21.972 72.291 1.00 30.60 ? 196 GLY A O   1 
ATOM   53   N N   . ASP A  1 26  ? 82.911 -20.168 71.204 1.00 23.63 ? 197 ASP A N   1 
ATOM   54   C CA  . ASP A  1 26  ? 82.401 -19.522 72.405 1.00 26.68 ? 197 ASP A CA  1 
ATOM   55   C C   . ASP A  1 26  ? 81.025 -20.025 72.865 1.00 24.81 ? 197 ASP A C   1 
ATOM   56   O O   . ASP A  1 26  ? 80.474 -19.502 73.822 1.00 26.57 ? 197 ASP A O   1 
ATOM   57   C CB  . ASP A  1 26  ? 82.440 -18.000 72.263 1.00 29.77 ? 197 ASP A CB  1 
ATOM   58   C CG  . ASP A  1 26  ? 81.480 -17.486 71.232 1.00 32.90 ? 197 ASP A CG  1 
ATOM   59   O OD1 . ASP A  1 26  ? 80.914 -18.271 70.455 1.00 33.76 ? 197 ASP A OD1 1 
ATOM   60   O OD2 . ASP A  1 26  ? 81.319 -16.276 71.158 1.00 44.65 ? 197 ASP A OD2 1 
ATOM   61   N N   . LEU A  1 27  ? 80.480 -21.060 72.211 1.00 17.90 ? 198 LEU A N   1 
ATOM   62   C CA  . LEU A  1 27  ? 79.228 -21.640 72.648 1.00 19.82 ? 198 LEU A CA  1 
ATOM   63   C C   . LEU A  1 27  ? 79.628 -22.798 73.539 1.00 18.96 ? 198 LEU A C   1 
ATOM   64   O O   . LEU A  1 27  ? 80.209 -23.801 73.090 1.00 20.53 ? 198 LEU A O   1 
ATOM   65   C CB  . LEU A  1 27  ? 78.373 -22.113 71.474 1.00 17.61 ? 198 LEU A CB  1 
ATOM   66   C CG  . LEU A  1 27  ? 77.951 -20.956 70.576 1.00 18.73 ? 198 LEU A CG  1 
ATOM   67   C CD1 . LEU A  1 27  ? 77.328 -21.496 69.317 1.00 18.70 ? 198 LEU A CD1 1 
ATOM   68   C CD2 . LEU A  1 27  ? 76.986 -20.030 71.303 1.00 24.61 ? 198 LEU A CD2 1 
ATOM   69   N N   . ILE A  1 28  ? 79.289 -22.665 74.808 1.00 18.36 ? 199 ILE A N   1 
ATOM   70   C CA  . ILE A  1 28  ? 79.743 -23.620 75.860 1.00 18.15 ? 199 ILE A CA  1 
ATOM   71   C C   . ILE A  1 28  ? 78.503 -24.213 76.521 1.00 16.72 ? 199 ILE A C   1 
ATOM   72   O O   . ILE A  1 28  ? 77.654 -23.470 76.981 1.00 18.32 ? 199 ILE A O   1 
ATOM   73   C CB  . ILE A  1 28  ? 80.651 -22.882 76.877 1.00 22.44 ? 199 ILE A CB  1 
ATOM   74   C CG1 . ILE A  1 28  ? 81.926 -22.355 76.162 1.00 26.09 ? 199 ILE A CG1 1 
ATOM   75   C CG2 . ILE A  1 28  ? 81.080 -23.812 77.990 1.00 27.25 ? 199 ILE A CG2 1 
ATOM   76   C CD1 . ILE A  1 28  ? 82.694 -21.293 76.933 1.00 39.60 ? 199 ILE A CD1 1 
ATOM   77   N N   . VAL A  1 29  ? 78.433 -25.557 76.616 1.00 15.90 ? 200 VAL A N   1 
ATOM   78   C CA  . VAL A  1 29  ? 77.345 -26.185 77.345 1.00 17.66 ? 200 VAL A CA  1 
ATOM   79   C C   . VAL A  1 29  ? 77.339 -25.628 78.790 1.00 15.64 ? 200 VAL A C   1 
ATOM   80   O O   . VAL A  1 29  ? 78.396 -25.531 79.424 1.00 18.35 ? 200 VAL A O   1 
ATOM   81   C CB  . VAL A  1 29  ? 77.462 -27.701 77.340 1.00 18.96 ? 200 VAL A CB  1 
ATOM   82   C CG1 . VAL A  1 29  ? 76.491 -28.337 78.350 1.00 19.13 ? 200 VAL A CG1 1 
ATOM   83   C CG2 . VAL A  1 29  ? 77.201 -28.208 75.906 1.00 17.96 ? 200 VAL A CG2 1 
ATOM   84   N N   . SER A  1 30  ? 76.134 -25.245 79.221 1.00 14.29 ? 201 SER A N   1 
ATOM   85   C CA  . SER A  1 30  ? 75.749 -24.606 80.495 1.00 15.90 ? 201 SER A CA  1 
ATOM   86   C C   . SER A  1 30  ? 75.534 -23.090 80.421 1.00 17.30 ? 201 SER A C   1 
ATOM   87   O O   . SER A  1 30  ? 75.042 -22.507 81.362 1.00 19.24 ? 201 SER A O   1 
ATOM   88   C CB  . SER A  1 30  ? 76.647 -24.951 81.668 1.00 16.49 ? 201 SER A CB  1 
ATOM   89   O OG  . SER A  1 30  ? 77.905 -24.309 81.596 1.00 18.64 ? 201 SER A OG  1 
ATOM   90   N N   . MET A  1 31  ? 75.926 -22.464 79.313 1.00 15.81 ? 202 MET A N   1 
ATOM   91   C CA  . MET A  1 31  ? 75.780 -21.030 79.185 1.00 18.87 ? 202 MET A CA  1 
ATOM   92   C C   . MET A  1 31  ? 74.317 -20.632 79.096 1.00 16.89 ? 202 MET A C   1 
ATOM   93   O O   . MET A  1 31  ? 73.454 -21.400 78.687 1.00 18.40 ? 202 MET A O   1 
ATOM   94   C CB  . MET A  1 31  ? 76.550 -20.498 77.963 1.00 19.47 ? 202 MET A CB  1 
ATOM   95   C CG  . MET A  1 31  ? 75.864 -20.775 76.630 1.00 18.89 ? 202 MET A CG  1 
ATOM   96   S SD  . MET A  1 31  ? 76.861 -20.388 75.189 1.00 24.18 ? 202 MET A SD  1 
ATOM   97   C CE  . MET A  1 31  ? 76.756 -18.612 75.156 1.00 28.59 ? 202 MET A CE  1 
ATOM   98   N N   . ARG A  1 32  ? 74.065 -19.403 79.504 1.00 16.82 ? 203 ARG A N   1 
ATOM   99   C CA  . ARG A  1 32  ? 72.811 -18.722 79.259 1.00 17.49 ? 203 ARG A CA  1 
ATOM   100  C C   . ARG A  1 32  ? 72.669 -18.442 77.779 1.00 17.33 ? 203 ARG A C   1 
ATOM   101  O O   . ARG A  1 32  ? 73.643 -18.124 77.112 1.00 18.01 ? 203 ARG A O   1 
ATOM   102  C CB  . ARG A  1 32  ? 72.804 -17.402 80.004 1.00 19.02 ? 203 ARG A CB  1 
ATOM   103  C CG  . ARG A  1 32  ? 72.831 -17.561 81.536 1.00 21.52 ? 203 ARG A CG  1 
ATOM   104  C CD  . ARG A  1 32  ? 71.610 -18.312 82.089 1.00 23.43 ? 203 ARG A CD  1 
ATOM   105  N NE  . ARG A  1 32  ? 70.401 -17.551 81.893 1.00 24.80 ? 203 ARG A NE  1 
ATOM   106  C CZ  . ARG A  1 32  ? 69.158 -18.038 81.979 1.00 26.15 ? 203 ARG A CZ  1 
ATOM   107  N NH1 . ARG A  1 32  ? 68.930 -19.311 82.241 1.00 29.01 ? 203 ARG A NH1 1 
ATOM   108  N NH2 . ARG A  1 32  ? 68.127 -17.229 81.742 1.00 36.65 ? 203 ARG A NH2 1 
ATOM   109  N N   . ILE A  1 33  ? 71.442 -18.512 77.280 1.00 15.76 ? 204 ILE A N   1 
ATOM   110  C CA  . ILE A  1 33  ? 71.216 -18.424 75.807 1.00 15.87 ? 204 ILE A CA  1 
ATOM   111  C C   . ILE A  1 33  ? 69.794 -17.988 75.558 1.00 15.78 ? 204 ILE A C   1 
ATOM   112  O O   . ILE A  1 33  ? 68.929 -18.172 76.418 1.00 18.82 ? 204 ILE A O   1 
ATOM   113  C CB  A ILE A  1 33  ? 71.520 -19.797 75.151 0.50 16.11 ? 204 ILE A CB  1 
ATOM   114  C CB  B ILE A  1 33  ? 71.593 -19.750 75.105 0.50 18.23 ? 204 ILE A CB  1 
ATOM   115  C CG1 A ILE A  1 33  ? 71.930 -19.675 73.665 0.50 16.13 ? 204 ILE A CG1 1 
ATOM   116  C CG1 B ILE A  1 33  ? 71.970 -19.527 73.623 0.50 19.39 ? 204 ILE A CG1 1 
ATOM   117  C CG2 A ILE A  1 33  ? 70.392 -20.801 75.354 0.50 18.77 ? 204 ILE A CG2 1 
ATOM   118  C CG2 B ILE A  1 33  ? 70.524 -20.816 75.272 0.50 20.16 ? 204 ILE A CG2 1 
ATOM   119  C CD1 A ILE A  1 33  ? 73.314 -19.097 73.438 0.50 15.23 ? 204 ILE A CD1 1 
ATOM   120  C CD1 B ILE A  1 33  ? 72.847 -20.620 73.048 0.50 20.21 ? 204 ILE A CD1 1 
ATOM   121  N N   . LEU A  1 34  ? 69.522 -17.435 74.364 1.00 17.23 ? 205 LEU A N   1 
ATOM   122  C CA  . LEU A  1 34  ? 68.136 -17.267 73.916 1.00 16.12 ? 205 LEU A CA  1 
ATOM   123  C C   . LEU A  1 34  ? 67.882 -18.279 72.796 1.00 14.89 ? 205 LEU A C   1 
ATOM   124  O O   . LEU A  1 34  ? 68.764 -18.535 71.983 1.00 17.12 ? 205 LEU A O   1 
ATOM   125  C CB  . LEU A  1 34  ? 67.888 -15.881 73.391 1.00 19.06 ? 205 LEU A CB  1 
ATOM   126  C CG  . LEU A  1 34  ? 67.843 -14.666 74.347 1.00 22.09 ? 205 LEU A CG  1 
ATOM   127  C CD1 . LEU A  1 34  ? 69.014 -14.577 75.250 1.00 27.32 ? 205 LEU A CD1 1 
ATOM   128  C CD2 . LEU A  1 34  ? 67.764 -13.399 73.511 1.00 21.36 ? 205 LEU A CD2 1 
ATOM   129  N N   . GLY A  1 35  ? 66.669 -18.798 72.753 1.00 14.93 ? 206 GLY A N   1 
ATOM   130  C CA  . GLY A  1 35  ? 66.296 -19.748 71.711 1.00 15.56 ? 206 GLY A CA  1 
ATOM   131  C C   . GLY A  1 35  ? 64.981 -19.367 71.055 1.00 15.69 ? 206 GLY A C   1 
ATOM   132  O O   . GLY A  1 35  ? 64.093 -18.781 71.701 1.00 16.41 ? 206 GLY A O   1 
ATOM   133  N N   . LYS A  1 36  ? 64.845 -19.734 69.781 1.00 14.74 ? 207 LYS A N   1 
ATOM   134  C CA  . LYS A  1 36  ? 63.641 -19.437 69.029 1.00 15.41 ? 207 LYS A CA  1 
ATOM   135  C C   . LYS A  1 36  ? 62.616 -20.539 69.224 1.00 15.90 ? 207 LYS A C   1 
ATOM   136  O O   . LYS A  1 36  ? 62.880 -21.708 68.909 1.00 19.91 ? 207 LYS A O   1 
ATOM   137  C CB  . LYS A  1 36  ? 64.006 -19.289 67.554 1.00 15.57 ? 207 LYS A CB  1 
ATOM   138  C CG  . LYS A  1 36  ? 62.826 -18.754 66.681 1.00 15.15 ? 207 LYS A CG  1 
ATOM   139  C CD  . LYS A  1 36  ? 63.249 -18.662 65.237 1.00 16.73 ? 207 LYS A CD  1 
ATOM   140  C CE  . LYS A  1 36  ? 62.193 -18.046 64.393 1.00 17.42 ? 207 LYS A CE  1 
ATOM   141  N NZ  . LYS A  1 36  ? 62.601 -17.949 62.978 1.00 17.28 ? 207 LYS A NZ  1 
ATOM   142  N N   . LYS A  1 37  ? 61.433 -20.172 69.713 1.00 18.38 ? 208 LYS A N   1 
ATOM   143  C CA  . LYS A  1 37  ? 60.318 -21.122 69.800 1.00 20.70 ? 208 LYS A CA  1 
ATOM   144  C C   . LYS A  1 37  ? 59.517 -21.168 68.488 1.00 21.35 ? 208 LYS A C   1 
ATOM   145  O O   . LYS A  1 37  ? 59.666 -20.286 67.585 1.00 21.98 ? 208 LYS A O   1 
ATOM   146  C CB  . LYS A  1 37  ? 59.439 -20.825 70.995 1.00 22.05 ? 208 LYS A CB  1 
ATOM   147  C CG  . LYS A  1 37  ? 60.120 -21.163 72.335 1.00 23.11 ? 208 LYS A CG  1 
ATOM   148  C CD  . LYS A  1 37  ? 59.118 -21.197 73.472 1.00 25.41 ? 208 LYS A CD  1 
ATOM   149  C CE  . LYS A  1 37  ? 59.765 -21.589 74.796 1.00 28.49 ? 208 LYS A CE  1 
ATOM   150  N NZ  . LYS A  1 37  ? 58.763 -21.595 75.887 1.00 30.79 ? 208 LYS A NZ  1 
ATOM   151  N N   . ARG A  1 38  ? 58.653 -22.178 68.390 1.00 24.21 ? 209 ARG A N   1 
ATOM   152  C CA  . ARG A  1 38  ? 57.815 -22.359 67.193 1.00 27.44 ? 209 ARG A CA  1 
ATOM   153  C C   . ARG A  1 38  ? 56.832 -21.191 66.945 1.00 24.39 ? 209 ARG A C   1 
ATOM   154  O O   . ARG A  1 38  ? 56.356 -20.998 65.840 1.00 30.45 ? 209 ARG A O   1 
ATOM   155  C CB  . ARG A  1 38  ? 57.120 -23.733 67.210 1.00 35.52 ? 209 ARG A CB  1 
ATOM   156  C CG  . ARG A  1 38  ? 58.108 -24.876 67.072 1.00 38.14 ? 209 ARG A CG  1 
ATOM   157  N N   . THR A  1 39  ? 56.556 -20.413 67.983 1.00 23.88 ? 210 THR A N   1 
ATOM   158  C CA  . THR A  1 39  ? 55.737 -19.203 67.879 1.00 27.56 ? 210 THR A CA  1 
ATOM   159  C C   . THR A  1 39  ? 56.490 -18.070 67.179 1.00 23.46 ? 210 THR A C   1 
ATOM   160  O O   . THR A  1 39  ? 55.924 -17.019 66.969 1.00 26.32 ? 210 THR A O   1 
ATOM   161  C CB  . THR A  1 39  ? 55.413 -18.685 69.279 1.00 28.65 ? 210 THR A CB  1 
ATOM   162  O OG1 . THR A  1 39  ? 56.649 -18.545 69.986 1.00 29.00 ? 210 THR A OG1 1 
ATOM   163  C CG2 . THR A  1 39  ? 54.482 -19.657 70.006 1.00 32.83 ? 210 THR A CG2 1 
ATOM   164  N N   . LYS A  1 40  ? 57.792 -18.285 66.890 1.00 21.74 ? 211 LYS A N   1 
ATOM   165  C CA  . LYS A  1 40  ? 58.723 -17.282 66.358 1.00 20.06 ? 211 LYS A CA  1 
ATOM   166  C C   . LYS A  1 40  ? 59.156 -16.201 67.346 1.00 19.31 ? 211 LYS A C   1 
ATOM   167  O O   . LYS A  1 40  ? 59.862 -15.294 66.980 1.00 21.71 ? 211 LYS A O   1 
ATOM   168  C CB  . LYS A  1 40  ? 58.190 -16.597 65.071 1.00 23.75 ? 211 LYS A CB  1 
ATOM   169  C CG  . LYS A  1 40  ? 57.601 -17.493 64.017 1.00 29.97 ? 211 LYS A CG  1 
ATOM   170  C CD  . LYS A  1 40  ? 58.528 -18.606 63.583 1.00 33.95 ? 211 LYS A CD  1 
ATOM   171  C CE  . LYS A  1 40  ? 57.968 -19.344 62.382 1.00 46.18 ? 211 LYS A CE  1 
ATOM   172  N NZ  . LYS A  1 40  ? 58.421 -20.774 62.365 1.00 51.50 ? 211 LYS A NZ  1 
ATOM   173  N N   . THR A  1 41  ? 58.765 -16.327 68.607 1.00 17.76 ? 212 THR A N   1 
ATOM   174  C CA  . THR A  1 41  ? 59.261 -15.488 69.674 1.00 17.31 ? 212 THR A CA  1 
ATOM   175  C C   . THR A  1 41  ? 60.437 -16.216 70.331 1.00 17.52 ? 212 THR A C   1 
ATOM   176  O O   . THR A  1 41  ? 60.534 -17.436 70.268 1.00 16.85 ? 212 THR A O   1 
ATOM   177  C CB  . THR A  1 41  ? 58.164 -15.160 70.686 1.00 21.24 ? 212 THR A CB  1 
ATOM   178  O OG1 . THR A  1 41  ? 57.613 -16.370 71.243 1.00 23.04 ? 212 THR A OG1 1 
ATOM   179  C CG2 . THR A  1 41  ? 57.066 -14.362 70.005 1.00 24.58 ? 212 THR A CG2 1 
ATOM   180  N N   . TRP A  1 42  ? 61.307 -15.441 70.949 1.00 15.86 ? 213 TRP A N   1 
ATOM   181  C CA  . TRP A  1 42  ? 62.525 -15.967 71.525 1.00 15.94 ? 213 TRP A CA  1 
ATOM   182  C C   . TRP A  1 42  ? 62.496 -15.849 73.037 1.00 17.25 ? 213 TRP A C   1 
ATOM   183  O O   . TRP A  1 42  ? 61.951 -14.924 73.597 1.00 17.87 ? 213 TRP A O   1 
ATOM   184  C CB  . TRP A  1 42  ? 63.735 -15.253 70.968 1.00 15.34 ? 213 TRP A CB  1 
ATOM   185  C CG  . TRP A  1 42  ? 63.924 -15.390 69.458 1.00 13.32 ? 213 TRP A CG  1 
ATOM   186  C CD1 . TRP A  1 42  ? 63.099 -14.930 68.472 1.00 14.80 ? 213 TRP A CD1 1 
ATOM   187  C CD2 . TRP A  1 42  ? 65.095 -15.883 68.815 1.00 13.85 ? 213 TRP A CD2 1 
ATOM   188  N NE1 . TRP A  1 42  ? 63.634 -15.226 67.241 1.00 14.66 ? 213 TRP A NE1 1 
ATOM   189  C CE2 . TRP A  1 42  ? 64.901 -15.739 67.425 1.00 14.12 ? 213 TRP A CE2 1 
ATOM   190  C CE3 . TRP A  1 42  ? 66.301 -16.448 69.271 1.00 15.98 ? 213 TRP A CE3 1 
ATOM   191  C CZ2 . TRP A  1 42  ? 65.831 -16.126 66.524 1.00 15.48 ? 213 TRP A CZ2 1 
ATOM   192  C CZ3 . TRP A  1 42  ? 67.261 -16.794 68.369 1.00 15.20 ? 213 TRP A CZ3 1 
ATOM   193  C CH2 . TRP A  1 42  ? 67.025 -16.640 66.985 1.00 15.44 ? 213 TRP A CH2 1 
ATOM   194  N N   . HIS A  1 43  ? 63.118 -16.832 73.690 1.00 17.62 ? 214 HIS A N   1 
ATOM   195  C CA  . HIS A  1 43  ? 63.011 -16.998 75.133 1.00 18.03 ? 214 HIS A CA  1 
ATOM   196  C C   . HIS A  1 43  ? 64.350 -17.407 75.724 1.00 18.03 ? 214 HIS A C   1 
ATOM   197  O O   . HIS A  1 43  ? 65.144 -18.111 75.111 1.00 19.36 ? 214 HIS A O   1 
ATOM   198  C CB  . HIS A  1 43  ? 61.899 -17.983 75.464 1.00 18.66 ? 214 HIS A CB  1 
ATOM   199  C CG  . HIS A  1 43  ? 60.587 -17.567 74.903 1.00 19.85 ? 214 HIS A CG  1 
ATOM   200  N ND1 . HIS A  1 43  ? 59.687 -16.810 75.612 1.00 23.52 ? 214 HIS A ND1 1 
ATOM   201  C CD2 . HIS A  1 43  ? 60.092 -17.669 73.639 1.00 21.50 ? 214 HIS A CD2 1 
ATOM   202  C CE1 . HIS A  1 43  ? 58.668 -16.498 74.819 1.00 25.64 ? 214 HIS A CE1 1 
ATOM   203  N NE2 . HIS A  1 43  ? 58.893 -17.013 73.620 1.00 23.66 ? 214 HIS A NE2 1 
ATOM   204  N N   . LYS A  1 44  ? 64.556 -16.986 76.963 1.00 19.20 ? 215 LYS A N   1 
ATOM   205  C CA  . LYS A  1 44  ? 65.806 -17.276 77.649 1.00 20.13 ? 215 LYS A CA  1 
ATOM   206  C C   . LYS A  1 44  ? 65.824 -18.711 78.176 1.00 17.70 ? 215 LYS A C   1 
ATOM   207  O O   . LYS A  1 44  ? 64.807 -19.286 78.537 1.00 19.67 ? 215 LYS A O   1 
ATOM   208  C CB  . LYS A  1 44  ? 66.044 -16.296 78.795 1.00 23.52 ? 215 LYS A CB  1 
ATOM   209  C CG  . LYS A  1 44  ? 66.319 -14.866 78.303 1.00 31.06 ? 215 LYS A CG  1 
ATOM   210  C CD  . LYS A  1 44  ? 67.069 -13.989 79.283 1.00 36.45 ? 215 LYS A CD  1 
ATOM   211  C CE  . LYS A  1 44  ? 67.264 -12.612 78.658 1.00 36.42 ? 215 LYS A CE  1 
ATOM   212  N NZ  . LYS A  1 44  ? 68.159 -11.737 79.445 1.00 38.80 ? 215 LYS A NZ  1 
ATOM   213  N N   . GLY A  1 45  ? 67.015 -19.261 78.182 1.00 18.87 ? 216 GLY A N   1 
ATOM   214  C CA  . GLY A  1 45  ? 67.249 -20.613 78.677 1.00 18.16 ? 216 GLY A CA  1 
ATOM   215  C C   . GLY A  1 45  ? 68.702 -20.931 78.866 1.00 16.69 ? 216 GLY A C   1 
ATOM   216  O O   . GLY A  1 45  ? 69.533 -20.026 78.929 1.00 17.27 ? 216 GLY A O   1 
ATOM   217  N N   . THR A  1 46  ? 68.970 -22.238 78.951 1.00 17.25 ? 217 THR A N   1 
ATOM   218  C CA  . THR A  1 46  ? 70.312 -22.759 79.139 1.00 17.19 ? 217 THR A CA  1 
ATOM   219  C C   . THR A  1 46  ? 70.666 -23.653 77.951 1.00 15.73 ? 217 THR A C   1 
ATOM   220  O O   . THR A  1 46  ? 69.857 -24.479 77.559 1.00 17.23 ? 217 THR A O   1 
ATOM   221  C CB  . THR A  1 46  ? 70.376 -23.550 80.477 1.00 17.14 ? 217 THR A CB  1 
ATOM   222  O OG1 . THR A  1 46  ? 69.995 -22.649 81.502 1.00 23.38 ? 217 THR A OG1 1 
ATOM   223  C CG2 . THR A  1 46  ? 71.773 -24.025 80.738 1.00 20.94 ? 217 THR A CG2 1 
ATOM   224  N N   . LEU A  1 47  ? 71.888 -23.528 77.466 1.00 15.20 ? 218 LEU A N   1 
ATOM   225  C CA  . LEU A  1 47  ? 72.415 -24.446 76.461 1.00 16.01 ? 218 LEU A CA  1 
ATOM   226  C C   . LEU A  1 47  ? 72.813 -25.747 77.163 1.00 16.23 ? 218 LEU A C   1 
ATOM   227  O O   . LEU A  1 47  ? 73.747 -25.740 77.947 1.00 17.21 ? 218 LEU A O   1 
ATOM   228  C CB  . LEU A  1 47  ? 73.646 -23.850 75.725 1.00 16.50 ? 218 LEU A CB  1 
ATOM   229  C CG  . LEU A  1 47  ? 74.258 -24.673 74.612 1.00 17.44 ? 218 LEU A CG  1 
ATOM   230  C CD1 . LEU A  1 47  ? 73.257 -24.956 73.498 1.00 17.79 ? 218 LEU A CD1 1 
ATOM   231  C CD2 . LEU A  1 47  ? 75.530 -24.017 74.113 1.00 18.24 ? 218 LEU A CD2 1 
ATOM   232  N N   . ILE A  1 48  ? 72.096 -26.820 76.913 1.00 15.22 ? 219 ILE A N   1 
ATOM   233  C CA  . ILE A  1 48  ? 72.293 -28.054 77.638 1.00 16.25 ? 219 ILE A CA  1 
ATOM   234  C C   . ILE A  1 48  ? 73.075 -29.142 76.850 1.00 16.36 ? 219 ILE A C   1 
ATOM   235  O O   . ILE A  1 48  ? 73.585 -30.116 77.438 1.00 18.69 ? 219 ILE A O   1 
ATOM   236  C CB  . ILE A  1 48  ? 70.992 -28.601 78.260 1.00 16.74 ? 219 ILE A CB  1 
ATOM   237  C CG1 . ILE A  1 48  ? 69.984 -29.046 77.218 1.00 19.64 ? 219 ILE A CG1 1 
ATOM   238  C CG2 . ILE A  1 48  ? 70.381 -27.655 79.280 1.00 17.98 ? 219 ILE A CG2 1 
ATOM   239  C CD1 . ILE A  1 48  ? 68.864 -29.886 77.763 1.00 22.76 ? 219 ILE A CD1 1 
ATOM   240  N N   . ALA A  1 49  ? 73.231 -28.976 75.542 1.00 16.89 ? 220 ALA A N   1 
ATOM   241  C CA  . ALA A  1 49  ? 73.959 -29.959 74.723 1.00 16.56 ? 220 ALA A CA  1 
ATOM   242  C C   . ALA A  1 49  ? 74.275 -29.355 73.373 1.00 16.54 ? 220 ALA A C   1 
ATOM   243  O O   . ALA A  1 49  ? 73.532 -28.440 72.895 1.00 17.83 ? 220 ALA A O   1 
ATOM   244  C CB  . ALA A  1 49  ? 73.139 -31.259 74.524 1.00 17.25 ? 220 ALA A CB  1 
ATOM   245  N N   . ILE A  1 50  ? 75.376 -29.821 72.806 1.00 16.30 ? 221 ILE A N   1 
ATOM   246  C CA  . ILE A  1 50  ? 75.784 -29.512 71.414 1.00 15.09 ? 221 ILE A CA  1 
ATOM   247  C C   . ILE A  1 50  ? 76.024 -30.844 70.735 1.00 17.33 ? 221 ILE A C   1 
ATOM   248  O O   . ILE A  1 50  ? 76.691 -31.718 71.282 1.00 19.78 ? 221 ILE A O   1 
ATOM   249  C CB  . ILE A  1 50  ? 77.025 -28.649 71.342 1.00 16.62 ? 221 ILE A CB  1 
ATOM   250  C CG1 . ILE A  1 50  ? 76.851 -27.333 72.138 1.00 17.70 ? 221 ILE A CG1 1 
ATOM   251  C CG2 . ILE A  1 50  ? 77.433 -28.372 69.924 1.00 18.78 ? 221 ILE A CG2 1 
ATOM   252  C CD1 . ILE A  1 50  ? 78.120 -26.579 72.409 1.00 20.03 ? 221 ILE A CD1 1 
ATOM   253  N N   . GLN A  1 51  ? 75.499 -31.022 69.518 1.00 18.24 ? 222 GLN A N   1 
ATOM   254  C CA  . GLN A  1 51  ? 75.704 -32.259 68.805 1.00 20.47 ? 222 GLN A CA  1 
ATOM   255  C C   . GLN A  1 51  ? 75.887 -32.018 67.339 1.00 18.56 ? 222 GLN A C   1 
ATOM   256  O O   . GLN A  1 51  ? 75.128 -31.282 66.721 1.00 20.67 ? 222 GLN A O   1 
ATOM   257  C CB  . GLN A  1 51  ? 74.558 -33.210 68.997 1.00 25.59 ? 222 GLN A CB  1 
ATOM   258  C CG  . GLN A  1 51  ? 74.957 -34.640 68.533 1.00 27.38 ? 222 GLN A CG  1 
ATOM   259  C CD  . GLN A  1 51  ? 73.941 -35.690 68.834 1.00 35.70 ? 222 GLN A CD  1 
ATOM   260  O OE1 . GLN A  1 51  ? 72.791 -35.385 69.157 1.00 42.98 ? 222 GLN A OE1 1 
ATOM   261  N NE2 . GLN A  1 51  ? 74.343 -36.951 68.692 1.00 42.27 ? 222 GLN A NE2 1 
ATOM   262  N N   . THR A  1 52  ? 76.879 -32.669 66.755 1.00 20.64 ? 223 THR A N   1 
ATOM   263  C CA  . THR A  1 52  ? 77.024 -32.675 65.314 1.00 20.37 ? 223 THR A CA  1 
ATOM   264  C C   . THR A  1 52  ? 76.016 -33.688 64.762 1.00 22.16 ? 223 THR A C   1 
ATOM   265  O O   . THR A  1 52  ? 76.015 -34.847 65.150 1.00 23.77 ? 223 THR A O   1 
ATOM   266  C CB  . THR A  1 52  ? 78.480 -33.042 64.924 1.00 25.84 ? 223 THR A CB  1 
ATOM   267  O OG1 . THR A  1 52  ? 79.389 -32.082 65.480 1.00 28.35 ? 223 THR A OG1 1 
ATOM   268  C CG2 . THR A  1 52  ? 78.633 -33.059 63.400 1.00 29.58 ? 223 THR A CG2 1 
ATOM   269  N N   . VAL A  1 53  ? 75.139 -33.217 63.861 1.00 20.06 ? 224 VAL A N   1 
ATOM   270  C CA  . VAL A  1 53  ? 74.134 -34.039 63.250 1.00 21.48 ? 224 VAL A CA  1 
ATOM   271  C C   . VAL A  1 53  ? 74.176 -33.695 61.750 1.00 20.06 ? 224 VAL A C   1 
ATOM   272  O O   . VAL A  1 53  ? 73.938 -32.563 61.334 1.00 22.25 ? 224 VAL A O   1 
ATOM   273  C CB  . VAL A  1 53  ? 72.736 -33.755 63.852 1.00 24.50 ? 224 VAL A CB  1 
ATOM   274  C CG1 . VAL A  1 53  ? 71.703 -34.711 63.299 1.00 27.01 ? 224 VAL A CG1 1 
ATOM   275  C CG2 . VAL A  1 53  ? 72.760 -33.841 65.373 1.00 30.17 ? 224 VAL A CG2 1 
ATOM   276  N N   . GLY A  1 54  ? 74.565 -34.663 60.933 1.00 24.41 ? 225 GLY A N   1 
ATOM   277  C CA  . GLY A  1 54  ? 74.581 -34.432 59.506 1.00 21.63 ? 225 GLY A CA  1 
ATOM   278  C C   . GLY A  1 54  ? 75.584 -33.327 59.174 1.00 20.67 ? 225 GLY A C   1 
ATOM   279  O O   . GLY A  1 54  ? 76.718 -33.414 59.588 1.00 28.18 ? 225 GLY A O   1 
ATOM   280  N N   . PRO A  1 55  ? 75.146 -32.274 58.443 1.00 22.05 ? 226 PRO A N   1 
ATOM   281  C CA  . PRO A  1 55  ? 76.060 -31.265 57.958 1.00 24.65 ? 226 PRO A CA  1 
ATOM   282  C C   . PRO A  1 55  ? 76.514 -30.212 58.975 1.00 26.77 ? 226 PRO A C   1 
ATOM   283  O O   . PRO A  1 55  ? 77.345 -29.370 58.639 1.00 27.46 ? 226 PRO A O   1 
ATOM   284  C CB  . PRO A  1 55  ? 75.239 -30.536 56.893 1.00 25.26 ? 226 PRO A CB  1 
ATOM   285  C CG  . PRO A  1 55  ? 73.809 -30.672 57.323 1.00 24.50 ? 226 PRO A CG  1 
ATOM   286  C CD  . PRO A  1 55  ? 73.728 -31.958 58.114 1.00 25.01 ? 226 PRO A CD  1 
ATOM   287  N N   . GLY A  1 56  ? 75.952 -30.208 60.181 1.00 21.95 ? 227 GLY A N   1 
ATOM   288  C CA  . GLY A  1 56  ? 76.251 -29.139 61.096 1.00 19.60 ? 227 GLY A CA  1 
ATOM   289  C C   . GLY A  1 56  ? 75.952 -29.493 62.534 1.00 19.47 ? 227 GLY A C   1 
ATOM   290  O O   . GLY A  1 56  ? 75.726 -30.612 62.868 1.00 25.26 ? 227 GLY A O   1 
ATOM   291  N N   . LYS A  1 57  ? 75.923 -28.484 63.353 1.00 19.29 ? 228 LYS A N   1 
ATOM   292  C CA  . LYS A  1 57  ? 75.695 -28.678 64.771 1.00 17.30 ? 228 LYS A CA  1 
ATOM   293  C C   . LYS A  1 57  ? 74.262 -28.283 65.135 1.00 16.40 ? 228 LYS A C   1 
ATOM   294  O O   . LYS A  1 57  ? 73.657 -27.351 64.517 1.00 18.88 ? 228 LYS A O   1 
ATOM   295  C CB  . LYS A  1 57  ? 76.660 -27.837 65.583 1.00 21.02 ? 228 LYS A CB  1 
ATOM   296  C CG  . LYS A  1 57  ? 78.146 -28.202 65.412 1.00 23.97 ? 228 LYS A CG  1 
ATOM   297  C CD  . LYS A  1 57  ? 79.058 -27.195 66.073 1.00 27.93 ? 228 LYS A CD  1 
ATOM   298  C CE  . LYS A  1 57  ? 80.524 -27.620 65.933 1.00 33.50 ? 228 LYS A CE  1 
ATOM   299  N NZ  . LYS A  1 57  ? 81.017 -27.408 64.541 1.00 38.27 ? 228 LYS A NZ  1 
ATOM   300  N N   . LYS A  1 58  ? 73.739 -28.978 66.117 1.00 18.56 ? 229 LYS A N   1 
ATOM   301  C CA  . LYS A  1 58  ? 72.477 -28.639 66.727 1.00 17.89 ? 229 LYS A CA  1 
ATOM   302  C C   . LYS A  1 58  ? 72.723 -28.318 68.203 1.00 16.04 ? 229 LYS A C   1 
ATOM   303  O O   . LYS A  1 58  ? 73.625 -28.939 68.840 1.00 18.91 ? 229 LYS A O   1 
ATOM   304  C CB  . LYS A  1 58  ? 71.473 -29.757 66.605 1.00 22.97 ? 229 LYS A CB  1 
ATOM   305  C CG  . LYS A  1 58  ? 70.899 -29.912 65.163 1.00 30.26 ? 229 LYS A CG  1 
ATOM   306  C CD  . LYS A  1 58  ? 69.769 -28.906 64.920 1.00 31.40 ? 229 LYS A CD  1 
ATOM   307  C CE  . LYS A  1 58  ? 68.880 -29.236 63.709 1.00 38.63 ? 229 LYS A CE  1 
ATOM   308  N NZ  . LYS A  1 58  ? 68.189 -28.006 63.179 1.00 36.03 ? 229 LYS A NZ  1 
ATOM   309  N N   . TYR A  1 59  ? 71.916 -27.405 68.719 1.00 16.08 ? 230 TYR A N   1 
ATOM   310  C CA  . TYR A  1 59  ? 72.077 -26.841 70.033 1.00 15.66 ? 230 TYR A CA  1 
ATOM   311  C C   . TYR A  1 59  ? 70.825 -27.101 70.815 1.00 16.08 ? 230 TYR A C   1 
ATOM   312  O O   . TYR A  1 59  ? 69.755 -26.673 70.397 1.00 17.53 ? 230 TYR A O   1 
ATOM   313  C CB  . TYR A  1 59  ? 72.351 -25.332 69.883 1.00 15.54 ? 230 TYR A CB  1 
ATOM   314  C CG  . TYR A  1 59  ? 73.589 -25.073 69.046 1.00 15.46 ? 230 TYR A CG  1 
ATOM   315  C CD1 . TYR A  1 59  ? 74.830 -24.985 69.612 1.00 17.30 ? 230 TYR A CD1 1 
ATOM   316  C CD2 . TYR A  1 59  ? 73.506 -24.910 67.658 1.00 16.33 ? 230 TYR A CD2 1 
ATOM   317  C CE1 . TYR A  1 59  ? 75.973 -24.775 68.862 1.00 16.53 ? 230 TYR A CE1 1 
ATOM   318  C CE2 . TYR A  1 59  ? 74.613 -24.691 66.896 1.00 16.28 ? 230 TYR A CE2 1 
ATOM   319  C CZ  . TYR A  1 59  ? 75.852 -24.596 67.459 1.00 17.45 ? 230 TYR A CZ  1 
ATOM   320  O OH  . TYR A  1 59  ? 76.926 -24.362 66.648 1.00 18.80 ? 230 TYR A OH  1 
ATOM   321  N N   . LYS A  1 60  ? 70.942 -27.808 71.938 1.00 16.19 ? 231 LYS A N   1 
ATOM   322  C CA  . LYS A  1 60  ? 69.800 -28.148 72.724 1.00 16.82 ? 231 LYS A CA  1 
ATOM   323  C C   . LYS A  1 60  ? 69.650 -27.131 73.825 1.00 18.14 ? 231 LYS A C   1 
ATOM   324  O O   . LYS A  1 60  ? 70.579 -26.915 74.622 1.00 18.85 ? 231 LYS A O   1 
ATOM   325  C CB  . LYS A  1 60  ? 69.917 -29.567 73.298 1.00 17.25 ? 231 LYS A CB  1 
ATOM   326  C CG  . LYS A  1 60  ? 68.619 -30.076 73.902 1.00 20.60 ? 231 LYS A CG  1 
ATOM   327  C CD  . LYS A  1 60  ? 68.728 -31.495 74.450 1.00 28.40 ? 231 LYS A CD  1 
ATOM   328  C CE  . LYS A  1 60  ? 68.645 -32.521 73.360 1.00 36.51 ? 231 LYS A CE  1 
ATOM   329  N NZ  . LYS A  1 60  ? 68.771 -33.878 73.948 1.00 44.08 ? 231 LYS A NZ  1 
ATOM   330  N N   . VAL A  1 61  ? 68.467 -26.553 73.900 1.00 16.39 ? 232 VAL A N   1 
ATOM   331  C CA  . VAL A  1 61  ? 68.149 -25.471 74.842 1.00 15.80 ? 232 VAL A CA  1 
ATOM   332  C C   . VAL A  1 61  ? 67.021 -25.862 75.760 1.00 17.48 ? 232 VAL A C   1 
ATOM   333  O O   . VAL A  1 61  ? 65.972 -26.299 75.290 1.00 18.46 ? 232 VAL A O   1 
ATOM   334  C CB  . VAL A  1 61  ? 67.787 -24.136 74.108 1.00 17.42 ? 232 VAL A CB  1 
ATOM   335  C CG1 . VAL A  1 61  ? 67.375 -23.040 75.086 1.00 17.71 ? 232 VAL A CG1 1 
ATOM   336  C CG2 . VAL A  1 61  ? 68.960 -23.646 73.267 1.00 18.47 ? 232 VAL A CG2 1 
ATOM   337  N N   . LYS A  1 62  ? 67.260 -25.752 77.089 1.00 17.11 ? 233 LYS A N   1 
ATOM   338  C CA  . LYS A  1 62  ? 66.193 -25.895 78.084 1.00 17.37 ? 233 LYS A CA  1 
ATOM   339  C C   . LYS A  1 62  ? 65.756 -24.478 78.448 1.00 17.86 ? 233 LYS A C   1 
ATOM   340  O O   . LYS A  1 62  ? 66.538 -23.702 78.995 1.00 18.50 ? 233 LYS A O   1 
ATOM   341  C CB  . LYS A  1 62  ? 66.651 -26.666 79.341 1.00 17.72 ? 233 LYS A CB  1 
ATOM   342  C CG  . LYS A  1 62  ? 65.577 -26.806 80.428 1.00 24.63 ? 233 LYS A CG  1 
ATOM   343  N N   . PHE A  1 63  ? 64.511 -24.149 78.132 1.00 17.69 ? 234 PHE A N   1 
ATOM   344  C CA  . PHE A  1 63  ? 63.995 -22.804 78.394 1.00 20.46 ? 234 PHE A CA  1 
ATOM   345  C C   . PHE A  1 63  ? 63.717 -22.629 79.879 1.00 21.94 ? 234 PHE A C   1 
ATOM   346  O O   . PHE A  1 63  ? 63.384 -23.602 80.575 1.00 21.71 ? 234 PHE A O   1 
ATOM   347  C CB  . PHE A  1 63  ? 62.760 -22.560 77.553 1.00 21.23 ? 234 PHE A CB  1 
ATOM   348  C CG  . PHE A  1 63  ? 63.066 -22.453 76.101 1.00 19.61 ? 234 PHE A CG  1 
ATOM   349  C CD1 . PHE A  1 63  ? 63.627 -21.282 75.593 1.00 19.04 ? 234 PHE A CD1 1 
ATOM   350  C CD2 . PHE A  1 63  ? 62.811 -23.528 75.248 1.00 21.68 ? 234 PHE A CD2 1 
ATOM   351  C CE1 . PHE A  1 63  ? 63.924 -21.186 74.238 1.00 21.76 ? 234 PHE A CE1 1 
ATOM   352  C CE2 . PHE A  1 63  ? 63.134 -23.446 73.910 1.00 20.47 ? 234 PHE A CE2 1 
ATOM   353  C CZ  . PHE A  1 63  ? 63.687 -22.265 73.411 1.00 19.94 ? 234 PHE A CZ  1 
ATOM   354  N N   . ASP A  1 64  ? 63.869 -21.400 80.369 1.00 19.98 ? 235 ASP A N   1 
ATOM   355  C CA  . ASP A  1 64  ? 63.597 -21.128 81.766 1.00 23.31 ? 235 ASP A CA  1 
ATOM   356  C C   . ASP A  1 64  ? 62.162 -21.405 82.140 1.00 27.49 ? 235 ASP A C   1 
ATOM   357  O O   . ASP A  1 64  ? 61.898 -21.981 83.223 1.00 32.78 ? 235 ASP A O   1 
ATOM   358  C CB  . ASP A  1 64  ? 63.896 -19.680 82.115 1.00 23.25 ? 235 ASP A CB  1 
ATOM   359  C CG  . ASP A  1 64  ? 65.345 -19.339 82.102 1.00 23.06 ? 235 ASP A CG  1 
ATOM   360  O OD1 . ASP A  1 64  ? 66.232 -20.248 82.019 1.00 25.63 ? 235 ASP A OD1 1 
ATOM   361  O OD2 . ASP A  1 64  ? 65.602 -18.107 82.204 1.00 32.24 ? 235 ASP A OD2 1 
ATOM   362  N N   . ASN A  1 65  ? 61.227 -20.997 81.294 1.00 29.19 ? 236 ASN A N   1 
ATOM   363  C CA  . ASN A  1 65  ? 59.809 -21.065 81.667 1.00 33.98 ? 236 ASN A CA  1 
ATOM   364  C C   . ASN A  1 65  ? 59.282 -22.478 81.402 1.00 34.26 ? 236 ASN A C   1 
ATOM   365  O O   . ASN A  1 65  ? 58.981 -23.212 82.337 1.00 41.33 ? 236 ASN A O   1 
ATOM   366  C CB  . ASN A  1 65  ? 58.983 -19.988 80.939 1.00 38.32 ? 236 ASN A CB  1 
ATOM   367  N N   . LYS A  1 66  ? 59.209 -22.863 80.134 1.00 34.39 ? 237 LYS A N   1 
ATOM   368  C CA  . LYS A  1 66  ? 58.704 -24.196 79.746 1.00 33.72 ? 237 LYS A CA  1 
ATOM   369  C C   . LYS A  1 66  ? 59.451 -24.661 78.533 1.00 29.68 ? 237 LYS A C   1 
ATOM   370  O O   . LYS A  1 66  ? 59.740 -23.838 77.676 1.00 31.61 ? 237 LYS A O   1 
ATOM   371  C CB  . LYS A  1 66  ? 57.225 -24.116 79.360 1.00 39.41 ? 237 LYS A CB  1 
ATOM   372  N N   . GLY A  1 67  ? 59.725 -25.968 78.451 1.00 26.25 ? 238 GLY A N   1 
ATOM   373  C CA  . GLY A  1 67  ? 60.138 -26.624 77.209 1.00 27.79 ? 238 GLY A CA  1 
ATOM   374  C C   . GLY A  1 67  ? 61.624 -26.804 76.910 1.00 23.43 ? 238 GLY A C   1 
ATOM   375  O O   . GLY A  1 67  ? 62.500 -26.247 77.551 1.00 24.49 ? 238 GLY A O   1 
ATOM   376  N N   . LYS A  1 68  ? 61.889 -27.633 75.922 1.00 28.60 ? 239 LYS A N   1 
ATOM   377  C CA  . LYS A  1 68  ? 63.245 -27.851 75.396 1.00 25.06 ? 239 LYS A CA  1 
ATOM   378  C C   . LYS A  1 68  ? 63.109 -27.855 73.911 1.00 27.66 ? 239 LYS A C   1 
ATOM   379  O O   . LYS A  1 68  ? 62.065 -28.289 73.394 1.00 32.17 ? 239 LYS A O   1 
ATOM   380  C CB  . LYS A  1 68  ? 63.862 -29.209 75.825 1.00 28.73 ? 239 LYS A CB  1 
ATOM   381  C CG  . LYS A  1 68  ? 64.171 -29.409 77.323 1.00 36.63 ? 239 LYS A CG  1 
ATOM   382  C CD  . LYS A  1 68  ? 65.008 -30.691 77.568 1.00 42.19 ? 239 LYS A CD  1 
ATOM   383  N N   . SER A  1 69  ? 64.155 -27.382 73.238 1.00 21.51 ? 240 SER A N   1 
ATOM   384  C CA  . SER A  1 69  ? 64.230 -27.410 71.771 1.00 20.76 ? 240 SER A CA  1 
ATOM   385  C C   . SER A  1 69  ? 65.604 -27.761 71.280 1.00 19.36 ? 240 SER A C   1 
ATOM   386  O O   . SER A  1 69  ? 66.581 -27.412 71.919 1.00 20.62 ? 240 SER A O   1 
ATOM   387  C CB  . SER A  1 69  ? 63.878 -26.049 71.164 1.00 21.89 ? 240 SER A CB  1 
ATOM   388  O OG  . SER A  1 69  ? 62.563 -25.689 71.394 1.00 25.72 ? 240 SER A OG  1 
ATOM   389  N N   . LEU A  1 70  ? 65.665 -28.457 70.130 1.00 19.99 ? 241 LEU A N   1 
ATOM   390  C CA  . LEU A  1 70  ? 66.917 -28.687 69.420 1.00 17.79 ? 241 LEU A CA  1 
ATOM   391  C C   . LEU A  1 70  ? 66.951 -27.737 68.244 1.00 17.30 ? 241 LEU A C   1 
ATOM   392  O O   . LEU A  1 70  ? 66.110 -27.826 67.335 1.00 20.82 ? 241 LEU A O   1 
ATOM   393  C CB  . LEU A  1 70  ? 67.011 -30.143 68.959 1.00 19.78 ? 241 LEU A CB  1 
ATOM   394  C CG  . LEU A  1 70  ? 68.346 -30.606 68.401 1.00 23.00 ? 241 LEU A CG  1 
ATOM   395  C CD1 . LEU A  1 70  ? 69.417 -30.645 69.489 1.00 26.21 ? 241 LEU A CD1 1 
ATOM   396  C CD2 . LEU A  1 70  ? 68.195 -31.987 67.765 1.00 25.26 ? 241 LEU A CD2 1 
ATOM   397  N N   . LEU A  1 71  ? 67.927 -26.848 68.243 1.00 16.40 ? 242 LEU A N   1 
ATOM   398  C CA  . LEU A  1 71  ? 67.949 -25.687 67.367 1.00 16.34 ? 242 LEU A CA  1 
ATOM   399  C C   . LEU A  1 71  ? 69.221 -25.598 66.538 1.00 15.56 ? 242 LEU A C   1 
ATOM   400  O O   . LEU A  1 71  ? 70.300 -25.971 66.986 1.00 17.87 ? 242 LEU A O   1 
ATOM   401  C CB  . LEU A  1 71  ? 67.905 -24.425 68.266 1.00 16.01 ? 242 LEU A CB  1 
ATOM   402  C CG  . LEU A  1 71  ? 66.590 -24.302 69.049 1.00 16.82 ? 242 LEU A CG  1 
ATOM   403  C CD1 . LEU A  1 71  ? 66.669 -23.215 70.063 1.00 16.80 ? 242 LEU A CD1 1 
ATOM   404  C CD2 . LEU A  1 71  ? 65.413 -24.090 68.151 1.00 18.47 ? 242 LEU A CD2 1 
ATOM   405  N N   . SER A  1 72  ? 69.090 -25.090 65.308 1.00 15.08 ? 243 SER A N   1 
ATOM   406  C CA  . SER A  1 72  ? 70.270 -24.661 64.546 1.00 15.63 ? 243 SER A CA  1 
ATOM   407  C C   . SER A  1 72  ? 70.889 -23.387 65.130 1.00 15.10 ? 243 SER A C   1 
ATOM   408  O O   . SER A  1 72  ? 70.244 -22.645 65.882 1.00 15.54 ? 243 SER A O   1 
ATOM   409  C CB  A SER A  1 72  ? 69.943 -24.476 63.075 0.60 19.27 ? 243 SER A CB  1 
ATOM   410  C CB  B SER A  1 72  ? 69.916 -24.514 63.047 0.40 17.13 ? 243 SER A CB  1 
ATOM   411  O OG  A SER A  1 72  ? 69.567 -25.699 62.549 0.60 24.47 ? 243 SER A OG  1 
ATOM   412  O OG  B SER A  1 72  ? 68.726 -23.742 62.846 0.40 17.63 ? 243 SER A OG  1 
ATOM   413  N N   . GLY A  1 73  ? 72.116 -23.113 64.739 1.00 14.89 ? 244 GLY A N   1 
ATOM   414  C CA  . GLY A  1 73  ? 72.901 -22.035 65.293 1.00 16.37 ? 244 GLY A CA  1 
ATOM   415  C C   . GLY A  1 73  ? 72.379 -20.653 64.965 1.00 15.21 ? 244 GLY A C   1 
ATOM   416  O O   . GLY A  1 73  ? 72.755 -19.673 65.585 1.00 16.34 ? 244 GLY A O   1 
ATOM   417  N N   . ASN A  1 74  ? 71.550 -20.576 63.931 1.00 14.50 ? 245 ASN A N   1 
ATOM   418  C CA  . ASN A  1 74  ? 70.862 -19.330 63.580 1.00 13.69 ? 245 ASN A CA  1 
ATOM   419  C C   . ASN A  1 74  ? 69.565 -19.096 64.362 1.00 13.47 ? 245 ASN A C   1 
ATOM   420  O O   . ASN A  1 74  ? 68.957 -18.048 64.193 1.00 14.77 ? 245 ASN A O   1 
ATOM   421  C CB  . ASN A  1 74  ? 70.614 -19.243 62.054 1.00 14.55 ? 245 ASN A CB  1 
ATOM   422  C CG  . ASN A  1 74  ? 69.755 -20.350 61.537 1.00 17.70 ? 245 ASN A CG  1 
ATOM   423  O OD1 . ASN A  1 74  ? 69.944 -21.520 61.894 1.00 17.67 ? 245 ASN A OD1 1 
ATOM   424  N ND2 . ASN A  1 74  ? 68.805 -19.998 60.655 1.00 17.07 ? 245 ASN A ND2 1 
ATOM   425  N N   . HIS A  1 75  ? 69.217 -20.043 65.217 1.00 16.25 ? 246 HIS A N   1 
ATOM   426  C CA  . HIS A  1 75  ? 68.031 -19.990 66.001 1.00 15.24 ? 246 HIS A CA  1 
ATOM   427  C C   . HIS A  1 75  ? 68.328 -19.983 67.499 1.00 15.42 ? 246 HIS A C   1 
ATOM   428  O O   . HIS A  1 75  ? 67.457 -20.218 68.298 1.00 15.48 ? 246 HIS A O   1 
ATOM   429  C CB  . HIS A  1 75  ? 67.110 -21.143 65.607 1.00 15.48 ? 246 HIS A CB  1 
ATOM   430  C CG  . HIS A  1 75  ? 66.527 -20.980 64.255 1.00 15.99 ? 246 HIS A CG  1 
ATOM   431  N ND1 . HIS A  1 75  ? 66.076 -22.050 63.550 1.00 20.13 ? 246 HIS A ND1 1 
ATOM   432  C CD2 . HIS A  1 75  ? 66.290 -19.882 63.491 1.00 15.28 ? 246 HIS A CD2 1 
ATOM   433  C CE1 . HIS A  1 75  ? 65.570 -21.637 62.400 1.00 21.06 ? 246 HIS A CE1 1 
ATOM   434  N NE2 . HIS A  1 75  ? 65.703 -20.328 62.333 1.00 17.10 ? 246 HIS A NE2 1 
ATOM   435  N N   . ILE A  1 76  ? 69.555 -19.606 67.807 1.00 14.37 ? 247 ILE A N   1 
ATOM   436  C CA  . ILE A  1 76  ? 69.981 -19.224 69.154 1.00 13.70 ? 247 ILE A CA  1 
ATOM   437  C C   . ILE A  1 76  ? 70.676 -17.883 69.114 1.00 13.81 ? 247 ILE A C   1 
ATOM   438  O O   . ILE A  1 76  ? 71.215 -17.497 68.068 1.00 14.88 ? 247 ILE A O   1 
ATOM   439  C CB  . ILE A  1 76  ? 70.924 -20.289 69.808 1.00 15.06 ? 247 ILE A CB  1 
ATOM   440  C CG1 . ILE A  1 76  ? 72.035 -20.720 68.841 1.00 15.88 ? 247 ILE A CG1 1 
ATOM   441  C CG2 . ILE A  1 76  ? 70.101 -21.514 70.219 1.00 15.38 ? 247 ILE A CG2 1 
ATOM   442  C CD1 . ILE A  1 76  ? 73.201 -21.437 69.497 1.00 16.47 ? 247 ILE A CD1 1 
ATOM   443  N N   . ALA A  1 77  ? 70.586 -17.141 70.229 1.00 14.12 ? 248 ALA A N   1 
ATOM   444  C CA  . ALA A  1 77  ? 71.220 -15.806 70.343 1.00 15.42 ? 248 ALA A CA  1 
ATOM   445  C C   . ALA A  1 77  ? 71.891 -15.727 71.695 1.00 16.43 ? 248 ALA A C   1 
ATOM   446  O O   . ALA A  1 77  ? 71.424 -16.371 72.645 1.00 17.41 ? 248 ALA A O   1 
ATOM   447  C CB  . ALA A  1 77  ? 70.231 -14.658 70.173 1.00 16.14 ? 248 ALA A CB  1 
ATOM   448  N N   . TYR A  1 78  ? 72.965 -14.952 71.763 1.00 16.74 ? 249 TYR A N   1 
ATOM   449  C CA  . TYR A  1 78  ? 73.616 -14.722 73.019 1.00 18.02 ? 249 TYR A CA  1 
ATOM   450  C C   . TYR A  1 78  ? 72.735 -13.917 73.985 1.00 20.67 ? 249 TYR A C   1 
ATOM   451  O O   . TYR A  1 78  ? 71.982 -13.073 73.579 1.00 20.87 ? 249 TYR A O   1 
ATOM   452  C CB  . TYR A  1 78  ? 74.916 -13.966 72.795 1.00 20.39 ? 249 TYR A CB  1 
ATOM   453  C CG  . TYR A  1 78  ? 75.942 -14.702 72.006 1.00 22.50 ? 249 TYR A CG  1 
ATOM   454  C CD1 . TYR A  1 78  ? 76.731 -15.698 72.578 1.00 22.63 ? 249 TYR A CD1 1 
ATOM   455  C CD2 . TYR A  1 78  ? 76.177 -14.372 70.679 1.00 23.61 ? 249 TYR A CD2 1 
ATOM   456  C CE1 . TYR A  1 78  ? 77.709 -16.357 71.819 1.00 27.42 ? 249 TYR A CE1 1 
ATOM   457  C CE2 . TYR A  1 78  ? 77.149 -15.016 69.933 1.00 25.88 ? 249 TYR A CE2 1 
ATOM   458  C CZ  . TYR A  1 78  ? 77.917 -16.009 70.507 1.00 27.18 ? 249 TYR A CZ  1 
ATOM   459  O OH  . TYR A  1 78  ? 78.901 -16.649 69.728 1.00 33.10 ? 249 TYR A OH  1 
ATOM   460  N N   . ASP A  1 79  ? 72.937 -14.145 75.282 1.00 19.48 ? 250 ASP A N   1 
ATOM   461  C CA  . ASP A  1 79  ? 72.236 -13.435 76.334 1.00 23.01 ? 250 ASP A CA  1 
ATOM   462  C C   . ASP A  1 79  ? 73.081 -12.266 76.781 1.00 27.22 ? 250 ASP A C   1 
ATOM   463  O O   . ASP A  1 79  ? 73.473 -12.128 77.976 1.00 32.24 ? 250 ASP A O   1 
ATOM   464  C CB  . ASP A  1 79  ? 71.938 -14.378 77.494 1.00 27.24 ? 250 ASP A CB  1 
ATOM   465  C CG  . ASP A  1 79  ? 71.134 -13.714 78.572 1.00 31.83 ? 250 ASP A CG  1 
ATOM   466  O OD1 . ASP A  1 79  ? 70.354 -12.793 78.273 1.00 33.41 ? 250 ASP A OD1 1 
ATOM   467  O OD2 . ASP A  1 79  ? 71.311 -14.108 79.736 1.00 35.44 ? 250 ASP A OD2 1 
ATOM   468  N N   . TYR A  1 80  ? 73.407 -11.423 75.840 1.00 23.60 ? 251 TYR A N   1 
ATOM   469  C CA  . TYR A  1 80  ? 74.086 -10.174 76.155 1.00 23.20 ? 251 TYR A CA  1 
ATOM   470  C C   . TYR A  1 80  ? 73.839 -9.237  75.010 1.00 24.21 ? 251 TYR A C   1 
ATOM   471  O O   . TYR A  1 80  ? 73.449 -9.670  73.914 1.00 22.77 ? 251 TYR A O   1 
ATOM   472  C CB  . TYR A  1 80  ? 75.595 -10.366 76.403 1.00 26.34 ? 251 TYR A CB  1 
ATOM   473  C CG  . TYR A  1 80  ? 76.438 -11.038 75.311 1.00 25.75 ? 251 TYR A CG  1 
ATOM   474  C CD1 . TYR A  1 80  ? 76.713 -10.393 74.100 1.00 27.90 ? 251 TYR A CD1 1 
ATOM   475  C CD2 . TYR A  1 80  ? 77.035 -12.296 75.532 1.00 28.95 ? 251 TYR A CD2 1 
ATOM   476  C CE1 . TYR A  1 80  ? 77.494 -10.974 73.110 1.00 30.65 ? 251 TYR A CE1 1 
ATOM   477  C CE2 . TYR A  1 80  ? 77.849 -12.880 74.555 1.00 35.15 ? 251 TYR A CE2 1 
ATOM   478  C CZ  . TYR A  1 80  ? 78.075 -12.193 73.340 1.00 28.87 ? 251 TYR A CZ  1 
ATOM   479  O OH  . TYR A  1 80  ? 78.840 -12.744 72.337 1.00 35.24 ? 251 TYR A OH  1 
ATOM   480  N N   . HIS A  1 81  ? 74.088 -7.974  75.240 1.00 24.89 ? 252 HIS A N   1 
ATOM   481  C CA  . HIS A  1 81  ? 73.912 -6.943  74.254 1.00 22.97 ? 252 HIS A CA  1 
ATOM   482  C C   . HIS A  1 81  ? 75.235 -6.696  73.648 1.00 27.53 ? 252 HIS A C   1 
ATOM   483  O O   . HIS A  1 81  ? 76.205 -6.577  74.369 1.00 37.67 ? 252 HIS A O   1 
ATOM   484  C CB  . HIS A  1 81  ? 73.391 -5.679  74.911 1.00 21.93 ? 252 HIS A CB  1 
ATOM   485  C CG  . HIS A  1 81  ? 72.147 -5.908  75.689 1.00 23.92 ? 252 HIS A CG  1 
ATOM   486  N ND1 . HIS A  1 81  ? 71.022 -6.490  75.130 1.00 26.38 ? 252 HIS A ND1 1 
ATOM   487  C CD2 . HIS A  1 81  ? 71.885 -5.759  77.010 1.00 27.97 ? 252 HIS A CD2 1 
ATOM   488  C CE1 . HIS A  1 81  ? 70.105 -6.634  76.071 1.00 29.37 ? 252 HIS A CE1 1 
ATOM   489  N NE2 . HIS A  1 81  ? 70.613 -6.215  77.224 1.00 26.93 ? 252 HIS A NE2 1 
ATOM   490  N N   . PRO A  1 82  ? 75.296 -6.575  72.308 1.00 32.60 ? 253 PRO A N   1 
ATOM   491  C CA  . PRO A  1 82  ? 76.625 -6.437  71.686 1.00 40.87 ? 253 PRO A CA  1 
ATOM   492  C C   . PRO A  1 82  ? 77.249 -5.083  72.000 1.00 39.53 ? 253 PRO A C   1 
ATOM   493  O O   . PRO A  1 82  ? 76.504 -4.152  72.247 1.00 34.92 ? 253 PRO A O   1 
ATOM   494  C CB  . PRO A  1 82  ? 76.333 -6.565  70.193 1.00 47.44 ? 253 PRO A CB  1 
ATOM   495  C CG  . PRO A  1 82  ? 74.894 -6.221  70.045 1.00 49.94 ? 253 PRO A CG  1 
ATOM   496  C CD  . PRO A  1 82  ? 74.195 -6.527  71.336 1.00 39.75 ? 253 PRO A CD  1 
ATOM   497  N N   . PRO A  1 83  ? 78.599 -4.974  72.042 1.00 43.68 ? 254 PRO A N   1 
ATOM   498  C CA  . PRO A  1 83  ? 79.145 -3.607  71.906 1.00 43.45 ? 254 PRO A CA  1 
ATOM   499  C C   . PRO A  1 83  ? 78.685 -3.085  70.548 1.00 39.14 ? 254 PRO A C   1 
ATOM   500  O O   . PRO A  1 83  ? 78.814 -3.816  69.561 1.00 38.64 ? 254 PRO A O   1 
ATOM   501  C CB  . PRO A  1 83  ? 80.667 -3.821  71.936 1.00 48.55 ? 254 PRO A CB  1 
ATOM   502  C CG  . PRO A  1 83  ? 80.841 -5.106  72.672 1.00 54.36 ? 254 PRO A CG  1 
ATOM   503  C CD  . PRO A  1 83  ? 79.649 -5.963  72.319 1.00 52.34 ? 254 PRO A CD  1 
ATOM   504  N N   . ALA A  1 84  ? 78.100 -1.882  70.500 1.00 39.29 ? 255 ALA A N   1 
ATOM   505  C CA  . ALA A  1 84  ? 77.492 -1.332  69.255 1.00 42.26 ? 255 ALA A CA  1 
ATOM   506  C C   . ALA A  1 84  ? 78.367 -1.510  67.990 1.00 46.38 ? 255 ALA A C   1 
ATOM   507  O O   . ALA A  1 84  ? 77.877 -1.988  66.948 1.00 53.08 ? 255 ALA A O   1 
ATOM   508  C CB  . ALA A  1 84  ? 77.090 0.140   69.418 1.00 48.40 ? 255 ALA A CB  1 
ATOM   509  N N   . ASP A  1 85  ? 79.646 -1.133  68.130 1.00 39.81 ? 256 ASP A N   1 
ATOM   510  C CA  . ASP A  1 85  ? 80.749 -1.355  67.172 1.00 40.82 ? 256 ASP A CA  1 
ATOM   511  C C   . ASP A  1 85  ? 80.813 -2.759  66.502 1.00 37.25 ? 256 ASP A C   1 
ATOM   512  O O   . ASP A  1 85  ? 81.424 -2.906  65.459 1.00 54.01 ? 256 ASP A O   1 
ATOM   513  C CB  . ASP A  1 85  ? 82.108 -1.071  67.898 1.00 51.66 ? 256 ASP A CB  1 
ATOM   514  N N   . LYS A  1 86  ? 80.250 -3.785  67.140 1.00 37.64 ? 257 LYS A N   1 
ATOM   515  C CA  . LYS A  1 86  ? 80.334 -5.161  66.666 1.00 41.31 ? 257 LYS A CA  1 
ATOM   516  C C   . LYS A  1 86  ? 79.248 -5.472  65.647 1.00 38.69 ? 257 LYS A C   1 
ATOM   517  O O   . LYS A  1 86  ? 79.347 -6.481  64.967 1.00 48.21 ? 257 LYS A O   1 
ATOM   518  C CB  . LYS A  1 86  ? 80.231 -6.148  67.844 1.00 45.47 ? 257 LYS A CB  1 
ATOM   519  N N   . LEU A  1 87  ? 78.206 -4.625  65.549 1.00 29.58 ? 258 LEU A N   1 
ATOM   520  C CA  . LEU A  1 87  ? 77.116 -4.875  64.631 1.00 24.89 ? 258 LEU A CA  1 
ATOM   521  C C   . LEU A  1 87  ? 77.232 -3.960  63.422 1.00 23.34 ? 258 LEU A C   1 
ATOM   522  O O   . LEU A  1 87  ? 77.759 -2.833  63.486 1.00 31.39 ? 258 LEU A O   1 
ATOM   523  C CB  . LEU A  1 87  ? 75.759 -4.691  65.321 1.00 24.46 ? 258 LEU A CB  1 
ATOM   524  C CG  . LEU A  1 87  ? 75.341 -5.662  66.435 1.00 26.33 ? 258 LEU A CG  1 
ATOM   525  C CD1 . LEU A  1 87  ? 74.003 -5.261  67.039 1.00 29.70 ? 258 LEU A CD1 1 
ATOM   526  C CD2 . LEU A  1 87  ? 75.312 -7.124  65.971 1.00 29.32 ? 258 LEU A CD2 1 
ATOM   527  N N   . TYR A  1 88  ? 76.736 -4.474  62.312 1.00 20.83 ? 259 TYR A N   1 
ATOM   528  C CA  . TYR A  1 88  ? 76.788 -3.799  61.043 1.00 19.75 ? 259 TYR A CA  1 
ATOM   529  C C   . TYR A  1 88  ? 75.386 -3.883  60.390 1.00 16.68 ? 259 TYR A C   1 
ATOM   530  O O   . TYR A  1 88  ? 74.552 -4.687  60.761 1.00 18.12 ? 259 TYR A O   1 
ATOM   531  C CB  . TYR A  1 88  ? 77.772 -4.506  60.112 1.00 23.13 ? 259 TYR A CB  1 
ATOM   532  C CG  . TYR A  1 88  ? 79.147 -4.659  60.589 1.00 30.28 ? 259 TYR A CG  1 
ATOM   533  C CD1 . TYR A  1 88  ? 80.118 -3.666  60.346 1.00 33.36 ? 259 TYR A CD1 1 
ATOM   534  C CD2 . TYR A  1 88  ? 79.528 -5.809  61.248 1.00 36.94 ? 259 TYR A CD2 1 
ATOM   535  C CE1 . TYR A  1 88  ? 81.440 -3.831  60.788 1.00 33.02 ? 259 TYR A CE1 1 
ATOM   536  C CE2 . TYR A  1 88  ? 80.823 -5.950  61.707 1.00 40.53 ? 259 TYR A CE2 1 
ATOM   537  C CZ  . TYR A  1 88  ? 81.752 -4.939  61.466 1.00 34.94 ? 259 TYR A CZ  1 
ATOM   538  O OH  . TYR A  1 88  ? 83.012 -5.092  61.893 1.00 43.59 ? 259 TYR A OH  1 
ATOM   539  N N   . VAL A  1 89  ? 75.189 -3.105  59.333 1.00 14.82 ? 260 VAL A N   1 
ATOM   540  C CA  . VAL A  1 89  ? 73.980 -3.217  58.523 1.00 15.11 ? 260 VAL A CA  1 
ATOM   541  C C   . VAL A  1 89  ? 74.011 -4.621  57.886 1.00 15.24 ? 260 VAL A C   1 
ATOM   542  O O   . VAL A  1 89  ? 74.999 -5.013  57.264 1.00 18.90 ? 260 VAL A O   1 
ATOM   543  C CB  . VAL A  1 89  ? 73.874 -2.081  57.498 1.00 15.81 ? 260 VAL A CB  1 
ATOM   544  C CG1 . VAL A  1 89  ? 72.747 -2.375  56.502 1.00 17.21 ? 260 VAL A CG1 1 
ATOM   545  C CG2 . VAL A  1 89  ? 73.622 -0.773  58.238 1.00 17.39 ? 260 VAL A CG2 1 
ATOM   546  N N   . GLY A  1 90  ? 72.919 -5.341  58.074 1.00 13.21 ? 261 GLY A N   1 
ATOM   547  C CA  . GLY A  1 90  ? 72.826 -6.761  57.699 1.00 12.45 ? 261 GLY A CA  1 
ATOM   548  C C   . GLY A  1 90  ? 72.999 -7.744  58.811 1.00 13.42 ? 261 GLY A C   1 
ATOM   549  O O   . GLY A  1 90  ? 72.658 -8.932  58.660 1.00 15.28 ? 261 GLY A O   1 
ATOM   550  N N   . SER A  1 91  ? 73.454 -7.273  59.971 1.00 12.79 ? 262 SER A N   1 
ATOM   551  C CA  . SER A  1 91  ? 73.598 -8.210  61.081 1.00 14.28 ? 262 SER A CA  1 
ATOM   552  C C   . SER A  1 91  ? 72.279 -8.821  61.532 1.00 13.25 ? 262 SER A C   1 
ATOM   553  O O   . SER A  1 91  ? 71.239 -8.139  61.564 1.00 13.43 ? 262 SER A O   1 
ATOM   554  C CB  . SER A  1 91  ? 74.268 -7.520  62.307 1.00 14.35 ? 262 SER A CB  1 
ATOM   555  O OG  . SER A  1 91  ? 75.645 -7.194  62.092 1.00 18.42 ? 262 SER A OG  1 
ATOM   556  N N   . ARG A  1 92  ? 72.346 -10.116 61.867 1.00 14.15 ? 263 ARG A N   1 
ATOM   557  C CA  . ARG A  1 92  ? 71.225 -10.885 62.269 1.00 13.92 ? 263 ARG A CA  1 
ATOM   558  C C   . ARG A  1 92  ? 71.090 -10.799 63.805 1.00 12.98 ? 263 ARG A C   1 
ATOM   559  O O   . ARG A  1 92  ? 72.009 -11.188 64.526 1.00 15.50 ? 263 ARG A O   1 
ATOM   560  C CB  . ARG A  1 92  ? 71.359 -12.323 61.790 1.00 13.95 ? 263 ARG A CB  1 
ATOM   561  C CG  . ARG A  1 92  ? 70.064 -13.105 61.663 1.00 14.68 ? 263 ARG A CG  1 
ATOM   562  C CD  . ARG A  1 92  ? 69.292 -12.694 60.449 1.00 14.59 ? 263 ARG A CD  1 
ATOM   563  N NE  . ARG A  1 92  ? 68.184 -13.568 60.143 1.00 13.44 ? 263 ARG A NE  1 
ATOM   564  C CZ  . ARG A  1 92  ? 66.922 -13.380 60.504 1.00 13.75 ? 263 ARG A CZ  1 
ATOM   565  N NH1 . ARG A  1 92  ? 66.565 -12.353 61.241 1.00 13.87 ? 263 ARG A NH1 1 
ATOM   566  N NH2 . ARG A  1 92  ? 65.988 -14.224 60.094 1.00 13.93 ? 263 ARG A NH2 1 
ATOM   567  N N   . VAL A  1 93  ? 69.944 -10.331 64.276 1.00 12.34 ? 264 VAL A N   1 
ATOM   568  C CA  . VAL A  1 93  ? 69.726 -10.048 65.683 1.00 14.22 ? 264 VAL A CA  1 
ATOM   569  C C   . VAL A  1 93  ? 68.370 -10.465 66.142 1.00 14.19 ? 264 VAL A C   1 
ATOM   570  O O   . VAL A  1 93  ? 67.453 -10.693 65.330 1.00 14.50 ? 264 VAL A O   1 
ATOM   571  C CB  . VAL A  1 93  ? 69.932 -8.552  65.980 1.00 15.06 ? 264 VAL A CB  1 
ATOM   572  C CG1 . VAL A  1 93  ? 71.375 -8.089  65.688 1.00 16.22 ? 264 VAL A CG1 1 
ATOM   573  C CG2 . VAL A  1 93  ? 68.936 -7.691  65.230 1.00 14.98 ? 264 VAL A CG2 1 
ATOM   574  N N   . VAL A  1 94  ? 68.247 -10.564 67.479 1.00 14.91 ? 265 VAL A N   1 
ATOM   575  C CA  . VAL A  1 94  ? 66.972 -10.648 68.144 1.00 15.24 ? 265 VAL A CA  1 
ATOM   576  C C   . VAL A  1 94  ? 66.793 -9.316  68.846 1.00 14.08 ? 265 VAL A C   1 
ATOM   577  O O   . VAL A  1 94  ? 67.738 -8.819  69.438 1.00 15.92 ? 265 VAL A O   1 
ATOM   578  C CB  . VAL A  1 94  ? 66.961 -11.806 69.156 1.00 16.01 ? 265 VAL A CB  1 
ATOM   579  C CG1 . VAL A  1 94  ? 65.720 -11.797 69.986 1.00 16.01 ? 265 VAL A CG1 1 
ATOM   580  C CG2 . VAL A  1 94  ? 67.061 -13.126 68.440 1.00 17.89 ? 265 VAL A CG2 1 
ATOM   581  N N   . ALA A  1 95  ? 65.595 -8.729  68.764 1.00 13.86 ? 266 ALA A N   1 
ATOM   582  C CA  . ALA A  1 95  ? 65.339 -7.429  69.369 1.00 13.65 ? 266 ALA A CA  1 
ATOM   583  C C   . ALA A  1 95  ? 63.979 -7.358  70.033 1.00 14.14 ? 266 ALA A C   1 
ATOM   584  O O   . ALA A  1 95  ? 63.048 -8.142  69.736 1.00 15.47 ? 266 ALA A O   1 
ATOM   585  C CB  . ALA A  1 95  ? 65.482 -6.323  68.336 1.00 16.73 ? 266 ALA A CB  1 
ATOM   586  N N   . LYS A  1 96  ? 63.874 -6.421  70.983 1.00 17.73 ? 267 LYS A N   1 
ATOM   587  C CA  . LYS A  1 96  ? 62.596 -6.203  71.630 1.00 18.97 ? 267 LYS A CA  1 
ATOM   588  C C   . LYS A  1 96  ? 61.631 -5.576  70.616 1.00 19.16 ? 267 LYS A C   1 
ATOM   589  O O   . LYS A  1 96  ? 61.969 -4.567  69.977 1.00 23.32 ? 267 LYS A O   1 
ATOM   590  C CB  . LYS A  1 96  ? 62.773 -5.267  72.806 1.00 22.34 ? 267 LYS A CB  1 
ATOM   591  C CG  . LYS A  1 96  ? 63.611 -5.903  73.909 1.00 24.52 ? 267 LYS A CG  1 
ATOM   592  C CD  . LYS A  1 96  ? 63.405 -5.187  75.233 1.00 32.20 ? 267 LYS A CD  1 
ATOM   593  C CE  . LYS A  1 96  ? 64.342 -5.772  76.291 1.00 35.39 ? 267 LYS A CE  1 
ATOM   594  N NZ  . LYS A  1 96  ? 64.208 -5.015  77.556 1.00 39.32 ? 267 LYS A NZ  1 
ATOM   595  N N   . TYR A  1 97  ? 60.493 -6.238  70.435 1.00 18.78 ? 268 TYR A N   1 
ATOM   596  C CA  . TYR A  1 97  ? 59.493 -5.874  69.473 1.00 20.46 ? 268 TYR A CA  1 
ATOM   597  C C   . TYR A  1 97  ? 58.384 -5.370  70.336 1.00 26.51 ? 268 TYR A C   1 
ATOM   598  O O   . TYR A  1 97  ? 57.721 -6.158  71.028 1.00 27.65 ? 268 TYR A O   1 
ATOM   599  C CB  . TYR A  1 97  ? 59.105 -7.117  68.654 1.00 20.13 ? 268 TYR A CB  1 
ATOM   600  C CG  . TYR A  1 97  ? 58.097 -6.998  67.508 1.00 20.83 ? 268 TYR A CG  1 
ATOM   601  C CD1 . TYR A  1 97  ? 56.821 -6.453  67.680 1.00 26.43 ? 268 TYR A CD1 1 
ATOM   602  C CD2 . TYR A  1 97  ? 58.395 -7.539  66.266 1.00 17.88 ? 268 TYR A CD2 1 
ATOM   603  C CE1 . TYR A  1 97  ? 55.882 -6.453  66.631 1.00 26.49 ? 268 TYR A CE1 1 
ATOM   604  C CE2 . TYR A  1 97  ? 57.454 -7.539  65.223 1.00 19.44 ? 268 TYR A CE2 1 
ATOM   605  C CZ  . TYR A  1 97  ? 56.219 -6.986  65.400 1.00 22.04 ? 268 TYR A CZ  1 
ATOM   606  O OH  . TYR A  1 97  ? 55.346 -7.060  64.329 1.00 21.85 ? 268 TYR A OH  1 
ATOM   607  N N   . LYS A  1 98  ? 58.172 -4.043  70.262 1.00 29.20 ? 269 LYS A N   1 
ATOM   608  C CA  . LYS A  1 98  ? 57.183 -3.360  71.043 1.00 30.71 ? 269 LYS A CA  1 
ATOM   609  C C   . LYS A  1 98  ? 56.112 -2.894  70.091 1.00 30.88 ? 269 LYS A C   1 
ATOM   610  O O   . LYS A  1 98  ? 56.445 -2.290  69.047 1.00 45.05 ? 269 LYS A O   1 
ATOM   611  C CB  . LYS A  1 98  ? 57.809 -2.140  71.732 1.00 37.23 ? 269 LYS A CB  1 
ATOM   612  C CG  . LYS A  1 98  ? 58.971 -2.497  72.634 1.00 36.89 ? 269 LYS A CG  1 
ATOM   613  C CD  . LYS A  1 98  ? 59.548 -1.278  73.296 1.00 39.43 ? 269 LYS A CD  1 
ATOM   614  C CE  . LYS A  1 98  ? 60.908 -1.546  73.874 1.00 36.97 ? 269 LYS A CE  1 
ATOM   615  N NZ  . LYS A  1 98  ? 61.311 -0.342  74.671 1.00 33.85 ? 269 LYS A NZ  1 
ATOM   616  N N   . ASP A  1 99  ? 54.869 -3.227  70.416 1.00 36.22 ? 270 ASP A N   1 
ATOM   617  C CA  . ASP A  1 99  ? 53.666 -2.858  69.610 1.00 43.17 ? 270 ASP A CA  1 
ATOM   618  C C   . ASP A  1 99  ? 52.449 -2.592  70.513 1.00 52.94 ? 270 ASP A C   1 
ATOM   619  O O   . ASP A  1 99  ? 52.252 -3.273  71.531 1.00 53.43 ? 270 ASP A O   1 
ATOM   620  C CB  . ASP A  1 99  ? 53.345 -3.970  68.603 1.00 43.80 ? 270 ASP A CB  1 
ATOM   621  N N   . VAL A  1 103 ? 55.406 -6.408  74.627 1.00 44.22 ? 274 VAL A N   1 
ATOM   622  C CA  . VAL A  1 103 ? 56.801 -6.696  74.238 1.00 31.25 ? 274 VAL A CA  1 
ATOM   623  C C   . VAL A  1 103 ? 57.212 -8.221  74.126 1.00 31.32 ? 274 VAL A C   1 
ATOM   624  O O   . VAL A  1 103 ? 57.020 -9.014  75.034 1.00 37.86 ? 274 VAL A O   1 
ATOM   625  C CB  . VAL A  1 103 ? 57.794 -5.960  75.159 1.00 35.33 ? 274 VAL A CB  1 
ATOM   626  C CG1 . VAL A  1 103 ? 57.745 -6.523  76.577 1.00 44.98 ? 274 VAL A CG1 1 
ATOM   627  C CG2 . VAL A  1 103 ? 59.204 -6.028  74.602 1.00 32.30 ? 274 VAL A CG2 1 
ATOM   628  N N   . TRP A  1 104 ? 57.818 -8.561  72.995 1.00 25.85 ? 275 TRP A N   1 
ATOM   629  C CA  . TRP A  1 104 ? 58.319 -9.886  72.693 1.00 24.47 ? 275 TRP A CA  1 
ATOM   630  C C   . TRP A  1 104 ? 59.718 -9.731  72.157 1.00 18.77 ? 275 TRP A C   1 
ATOM   631  O O   . TRP A  1 104 ? 60.100 -8.675  71.681 1.00 21.11 ? 275 TRP A O   1 
ATOM   632  C CB  . TRP A  1 104 ? 57.466 -10.593 71.617 1.00 26.16 ? 275 TRP A CB  1 
ATOM   633  C CG  . TRP A  1 104 ? 55.972 -10.601 71.830 1.00 31.51 ? 275 TRP A CG  1 
ATOM   634  C CD1 . TRP A  1 104 ? 55.224 -11.611 72.410 1.00 34.87 ? 275 TRP A CD1 1 
ATOM   635  C CD2 . TRP A  1 104 ? 55.018 -9.594  71.403 1.00 32.55 ? 275 TRP A CD2 1 
ATOM   636  N NE1 . TRP A  1 104 ? 53.875 -11.273 72.407 1.00 39.48 ? 275 TRP A NE1 1 
ATOM   637  C CE2 . TRP A  1 104 ? 53.726 -10.053 71.787 1.00 41.06 ? 275 TRP A CE2 1 
ATOM   638  N N   . LEU A  1 105 ? 60.463 -10.822 72.176 1.00 16.74 ? 276 LEU A N   1 
ATOM   639  C CA  . LEU A  1 105 ? 61.749 -10.869 71.482 1.00 15.25 ? 276 LEU A CA  1 
ATOM   640  C C   . LEU A  1 105 ? 61.541 -11.557 70.132 1.00 15.63 ? 276 LEU A C   1 
ATOM   641  O O   . LEU A  1 105 ? 61.006 -12.675 70.047 1.00 15.11 ? 276 LEU A O   1 
ATOM   642  C CB  . LEU A  1 105 ? 62.796 -11.618 72.303 1.00 18.31 ? 276 LEU A CB  1 
ATOM   643  C CG  . LEU A  1 105 ? 63.128 -11.013 73.648 1.00 18.55 ? 276 LEU A CG  1 
ATOM   644  C CD1 . LEU A  1 105 ? 64.118 -11.899 74.380 1.00 21.37 ? 276 LEU A CD1 1 
ATOM   645  C CD2 . LEU A  1 105 ? 63.704 -9.619  73.488 1.00 22.34 ? 276 LEU A CD2 1 
ATOM   646  N N   . TYR A  1 106 ? 61.983 -10.875 69.076 1.00 14.66 ? 277 TYR A N   1 
ATOM   647  C CA  . TYR A  1 106 ? 61.719 -11.328 67.720 1.00 14.49 ? 277 TYR A CA  1 
ATOM   648  C C   . TYR A  1 106 ? 62.958 -11.067 66.874 1.00 14.58 ? 277 TYR A C   1 
ATOM   649  O O   . TYR A  1 106 ? 63.699 -10.124 67.103 1.00 14.86 ? 277 TYR A O   1 
ATOM   650  C CB  . TYR A  1 106 ? 60.513 -10.534 67.150 1.00 15.10 ? 277 TYR A CB  1 
ATOM   651  C CG  . TYR A  1 106 ? 59.715 -11.228 66.117 1.00 19.80 ? 277 TYR A CG  1 
ATOM   652  C CD1 . TYR A  1 106 ? 58.694 -12.085 66.458 1.00 20.74 ? 277 TYR A CD1 1 
ATOM   653  C CD2 . TYR A  1 106 ? 59.925 -10.955 64.750 1.00 20.34 ? 277 TYR A CD2 1 
ATOM   654  C CE1 . TYR A  1 106 ? 57.932 -12.706 65.469 1.00 23.86 ? 277 TYR A CE1 1 
ATOM   655  C CE2 . TYR A  1 106 ? 59.209 -11.592 63.773 1.00 21.65 ? 277 TYR A CE2 1 
ATOM   656  C CZ  . TYR A  1 106 ? 58.202 -12.473 64.129 1.00 20.91 ? 277 TYR A CZ  1 
ATOM   657  O OH  . TYR A  1 106 ? 57.419 -13.066 63.152 1.00 26.12 ? 277 TYR A OH  1 
ATOM   658  N N   . ALA A  1 107 ? 63.156 -11.907 65.862 1.00 12.96 ? 278 ALA A N   1 
ATOM   659  C CA  . ALA A  1 107 ? 64.329 -11.807 65.007 1.00 13.66 ? 278 ALA A CA  1 
ATOM   660  C C   . ALA A  1 107 ? 64.176 -10.717 63.949 1.00 12.44 ? 278 ALA A C   1 
ATOM   661  O O   . ALA A  1 107 ? 63.082 -10.403 63.480 1.00 13.60 ? 278 ALA A O   1 
ATOM   662  C CB  . ALA A  1 107 ? 64.611 -13.130 64.320 1.00 13.95 ? 278 ALA A CB  1 
ATOM   663  N N   . GLY A  1 108 ? 65.299 -10.188 63.565 1.00 12.36 ? 279 GLY A N   1 
ATOM   664  C CA  . GLY A  1 108 ? 65.380 -9.191  62.547 1.00 12.36 ? 279 GLY A CA  1 
ATOM   665  C C   . GLY A  1 108 ? 66.779 -8.964  62.028 1.00 11.73 ? 279 GLY A C   1 
ATOM   666  O O   . GLY A  1 108 ? 67.740 -9.757  62.241 1.00 12.79 ? 279 GLY A O   1 
ATOM   667  N N   . ILE A  1 109 ? 66.896 -7.883  61.274 1.00 12.07 ? 280 ILE A N   1 
ATOM   668  C CA  . ILE A  1 109 ? 68.109 -7.475  60.607 1.00 10.72 ? 280 ILE A CA  1 
ATOM   669  C C   . ILE A  1 109 ? 68.408 -6.021  61.010 1.00 12.34 ? 280 ILE A C   1 
ATOM   670  O O   . ILE A  1 109 ? 67.533 -5.181  60.980 1.00 12.72 ? 280 ILE A O   1 
ATOM   671  C CB  . ILE A  1 109 ? 67.904 -7.546  59.063 1.00 12.99 ? 280 ILE A CB  1 
ATOM   672  C CG1 . ILE A  1 109 ? 67.721 -9.021  58.615 1.00 14.34 ? 280 ILE A CG1 1 
ATOM   673  C CG2 . ILE A  1 109 ? 69.025 -6.809  58.315 1.00 15.16 ? 280 ILE A CG2 1 
ATOM   674  C CD1 . ILE A  1 109 ? 68.995 -9.741  58.425 1.00 16.07 ? 280 ILE A CD1 1 
ATOM   675  N N   . VAL A  1 110 ? 69.664 -5.728  61.282 1.00 11.50 ? 281 VAL A N   1 
ATOM   676  C CA  . VAL A  1 110 ? 70.103 -4.355  61.528 1.00 12.37 ? 281 VAL A CA  1 
ATOM   677  C C   . VAL A  1 110 ? 70.089 -3.600  60.193 1.00 11.19 ? 281 VAL A C   1 
ATOM   678  O O   . VAL A  1 110 ? 70.820 -3.956  59.256 1.00 12.54 ? 281 VAL A O   1 
ATOM   679  C CB  . VAL A  1 110 ? 71.472 -4.281  62.197 1.00 13.84 ? 281 VAL A CB  1 
ATOM   680  C CG1 . VAL A  1 110 ? 71.971 -2.839  62.313 1.00 14.01 ? 281 VAL A CG1 1 
ATOM   681  C CG2 . VAL A  1 110 ? 71.412 -4.937  63.566 1.00 13.90 ? 281 VAL A CG2 1 
ATOM   682  N N   . ALA A  1 111 ? 69.264 -2.551  60.141 1.00 11.40 ? 282 ALA A N   1 
ATOM   683  C CA  . ALA A  1 111 ? 69.122 -1.724  58.926 1.00 10.49 ? 282 ALA A CA  1 
ATOM   684  C C   . ALA A  1 111 ? 69.936 -0.409  58.997 1.00 11.33 ? 282 ALA A C   1 
ATOM   685  O O   . ALA A  1 111 ? 70.162 0.264   58.002 1.00 12.92 ? 282 ALA A O   1 
ATOM   686  C CB  . ALA A  1 111 ? 67.655 -1.402  58.698 1.00 12.56 ? 282 ALA A CB  1 
ATOM   687  N N   . GLU A  1 112 ? 70.311 0.010   60.228 1.00 12.40 ? 283 GLU A N   1 
ATOM   688  C CA  . GLU A  1 112 ? 70.972 1.270   60.465 1.00 12.89 ? 283 GLU A CA  1 
ATOM   689  C C   . GLU A  1 112 ? 71.618 1.163   61.828 1.00 13.79 ? 283 GLU A C   1 
ATOM   690  O O   . GLU A  1 112 ? 71.001 0.621   62.742 1.00 14.25 ? 283 GLU A O   1 
ATOM   691  C CB  . GLU A  1 112 ? 69.959 2.418   60.448 1.00 14.09 ? 283 GLU A CB  1 
ATOM   692  C CG  . GLU A  1 112 ? 70.467 3.818   60.323 1.00 15.31 ? 283 GLU A CG  1 
ATOM   693  C CD  . GLU A  1 112 ? 69.303 4.767   60.202 1.00 14.42 ? 283 GLU A CD  1 
ATOM   694  O OE1 . GLU A  1 112 ? 68.948 5.404   61.220 1.00 15.07 ? 283 GLU A OE1 1 
ATOM   695  O OE2 . GLU A  1 112 ? 68.702 4.817   59.068 1.00 13.94 ? 283 GLU A OE2 1 
ATOM   696  N N   . THR A  1 113 ? 72.850 1.668   61.948 1.00 14.53 ? 284 THR A N   1 
ATOM   697  C CA  . THR A  1 113 ? 73.549 1.636   63.225 1.00 15.82 ? 284 THR A CA  1 
ATOM   698  C C   . THR A  1 113 ? 73.461 3.005   63.927 1.00 14.18 ? 284 THR A C   1 
ATOM   699  O O   . THR A  1 113 ? 73.071 3.995   63.312 1.00 15.69 ? 284 THR A O   1 
ATOM   700  C CB  . THR A  1 113 ? 74.981 1.252   63.012 1.00 20.22 ? 284 THR A CB  1 
ATOM   701  O OG1 . THR A  1 113 ? 75.578 2.216   62.148 1.00 21.38 ? 284 THR A OG1 1 
ATOM   702  C CG2 . THR A  1 113 ? 75.068 -0.160  62.418 1.00 25.71 ? 284 THR A CG2 1 
ATOM   703  N N   . PRO A  1 114 ? 73.782 3.059   65.223 1.00 16.68 ? 285 PRO A N   1 
ATOM   704  C CA  . PRO A  1 114 ? 73.619 4.303   65.957 1.00 16.12 ? 285 PRO A CA  1 
ATOM   705  C C   . PRO A  1 114 ? 74.354 5.518   65.392 1.00 16.92 ? 285 PRO A C   1 
ATOM   706  O O   . PRO A  1 114 ? 75.515 5.440   65.048 1.00 17.87 ? 285 PRO A O   1 
ATOM   707  C CB  . PRO A  1 114 ? 74.134 3.924   67.358 1.00 17.41 ? 285 PRO A CB  1 
ATOM   708  C CG  . PRO A  1 114 ? 73.782 2.478   67.495 1.00 19.68 ? 285 PRO A CG  1 
ATOM   709  C CD  . PRO A  1 114 ? 74.037 1.932   66.143 1.00 19.72 ? 285 PRO A CD  1 
ATOM   710  N N   . ASN A  1 115 ? 73.640 6.633   65.338 1.00 16.66 ? 286 ASN A N   1 
ATOM   711  C CA  . ASN A  1 115 ? 74.190 7.912   65.002 1.00 17.42 ? 286 ASN A CA  1 
ATOM   712  C C   . ASN A  1 115 ? 73.403 8.995   65.713 1.00 17.04 ? 286 ASN A C   1 
ATOM   713  O O   . ASN A  1 115 ? 72.335 8.709   66.302 1.00 17.92 ? 286 ASN A O   1 
ATOM   714  C CB  . ASN A  1 115 ? 74.316 8.062   63.482 1.00 18.22 ? 286 ASN A CB  1 
ATOM   715  C CG  . ASN A  1 115 ? 72.994 7.971   62.751 1.00 17.37 ? 286 ASN A CG  1 
ATOM   716  O OD1 . ASN A  1 115 ? 72.042 8.628   63.105 1.00 18.54 ? 286 ASN A OD1 1 
ATOM   717  N ND2 . ASN A  1 115 ? 72.946 7.156   61.724 1.00 19.48 ? 286 ASN A ND2 1 
ATOM   718  N N   . VAL A  1 116 ? 73.912 10.208  65.763 1.00 20.62 ? 287 VAL A N   1 
ATOM   719  C CA  . VAL A  1 116 ? 73.193 11.240  66.506 1.00 24.05 ? 287 VAL A CA  1 
ATOM   720  C C   . VAL A  1 116 ? 71.769 11.463  65.969 1.00 22.48 ? 287 VAL A C   1 
ATOM   721  O O   . VAL A  1 116 ? 70.815 11.583  66.762 1.00 20.41 ? 287 VAL A O   1 
ATOM   722  C CB  . VAL A  1 116 ? 74.012 12.539  66.545 1.00 24.25 ? 287 VAL A CB  1 
ATOM   723  C CG1 . VAL A  1 116 ? 73.149 13.703  66.996 1.00 24.38 ? 287 VAL A CG1 1 
ATOM   724  C CG2 . VAL A  1 116 ? 75.204 12.343  67.498 1.00 25.80 ? 287 VAL A CG2 1 
ATOM   725  N N   . LYS A  1 117 ? 71.631 11.431  64.632 1.00 20.23 ? 288 LYS A N   1 
ATOM   726  C CA  . LYS A  1 117 ? 70.331 11.669  64.008 1.00 22.92 ? 288 LYS A CA  1 
ATOM   727  C C   . LYS A  1 117 ? 69.264 10.640  64.299 1.00 20.17 ? 288 LYS A C   1 
ATOM   728  O O   . LYS A  1 117 ? 68.098 10.963  64.180 1.00 25.07 ? 288 LYS A O   1 
ATOM   729  C CB  . LYS A  1 117 ? 70.468 11.801  62.501 1.00 22.04 ? 288 LYS A CB  1 
ATOM   730  C CG  . LYS A  1 117 ? 71.046 13.144  62.083 1.00 29.52 ? 288 LYS A CG  1 
ATOM   731  C CD  . LYS A  1 117 ? 71.310 13.154  60.571 1.00 30.45 ? 288 LYS A CD  1 
ATOM   732  N N   . ASN A  1 118 ? 69.652 9.404   64.636 1.00 18.40 ? 289 ASN A N   1 
ATOM   733  C CA  . ASN A  1 118 ? 68.706 8.429   65.114 1.00 17.43 ? 289 ASN A CA  1 
ATOM   734  C C   . ASN A  1 118 ? 68.694 8.243   66.628 1.00 17.31 ? 289 ASN A C   1 
ATOM   735  O O   . ASN A  1 118 ? 68.109 7.312   67.126 1.00 18.14 ? 289 ASN A O   1 
ATOM   736  C CB  . ASN A  1 118 ? 68.814 7.108   64.349 1.00 17.66 ? 289 ASN A CB  1 
ATOM   737  C CG  . ASN A  1 118 ? 70.131 6.363   64.587 1.00 14.45 ? 289 ASN A CG  1 
ATOM   738  O OD1 . ASN A  1 118 ? 70.727 6.500   65.684 1.00 16.34 ? 289 ASN A OD1 1 
ATOM   739  N ND2 . ASN A  1 118 ? 70.592 5.578   63.600 1.00 14.58 ? 289 ASN A ND2 1 
ATOM   740  N N   . LYS A  1 119 ? 69.299 9.198   67.340 1.00 18.53 ? 290 LYS A N   1 
ATOM   741  C CA  . LYS A  1 119 ? 69.380 9.185   68.800 1.00 21.31 ? 290 LYS A CA  1 
ATOM   742  C C   . LYS A  1 119 ? 70.129 7.965   69.304 1.00 18.61 ? 290 LYS A C   1 
ATOM   743  O O   . LYS A  1 119 ? 69.794 7.368   70.347 1.00 19.33 ? 290 LYS A O   1 
ATOM   744  C CB  . LYS A  1 119 ? 67.971 9.387   69.452 1.00 24.26 ? 290 LYS A CB  1 
ATOM   745  C CG  . LYS A  1 119 ? 67.302 10.687  68.919 1.00 31.46 ? 290 LYS A CG  1 
ATOM   746  C CD  . LYS A  1 119 ? 66.046 11.125  69.680 1.00 42.63 ? 290 LYS A CD  1 
ATOM   747  N N   . LEU A  1 120 ? 71.142 7.578   68.533 1.00 16.77 ? 291 LEU A N   1 
ATOM   748  C CA  . LEU A  1 120 ? 72.029 6.464   68.860 1.00 16.09 ? 291 LEU A CA  1 
ATOM   749  C C   . LEU A  1 120 ? 71.321 5.146   69.065 1.00 16.72 ? 291 LEU A C   1 
ATOM   750  O O   . LEU A  1 120 ? 71.584 4.383   70.000 1.00 18.43 ? 291 LEU A O   1 
ATOM   751  C CB  . LEU A  1 120 ? 72.933 6.842   70.064 1.00 17.42 ? 291 LEU A CB  1 
ATOM   752  C CG  . LEU A  1 120 ? 73.928 7.976   69.759 1.00 19.04 ? 291 LEU A CG  1 
ATOM   753  C CD1 . LEU A  1 120 ? 74.603 8.424   71.052 1.00 18.26 ? 291 LEU A CD1 1 
ATOM   754  C CD2 . LEU A  1 120 ? 74.981 7.652   68.692 1.00 21.39 ? 291 LEU A CD2 1 
ATOM   755  N N   . ARG A  1 121 ? 70.428 4.847   68.120 1.00 15.44 ? 292 ARG A N   1 
ATOM   756  C CA  . ARG A  1 121 ? 69.654 3.611   68.142 1.00 14.55 ? 292 ARG A CA  1 
ATOM   757  C C   . ARG A  1 121 ? 69.962 2.768   66.927 1.00 14.33 ? 292 ARG A C   1 
ATOM   758  O O   . ARG A  1 121 ? 70.543 3.247   65.926 1.00 15.54 ? 292 ARG A O   1 
ATOM   759  C CB  . ARG A  1 121 ? 68.134 3.918   68.216 1.00 15.39 ? 292 ARG A CB  1 
ATOM   760  C CG  . ARG A  1 121 ? 67.683 4.443   69.542 1.00 17.29 ? 292 ARG A CG  1 
ATOM   761  C CD  . ARG A  1 121 ? 66.256 4.869   69.591 1.00 19.50 ? 292 ARG A CD  1 
ATOM   762  N NE  . ARG A  1 121 ? 66.087 5.950   68.629 1.00 18.24 ? 292 ARG A NE  1 
ATOM   763  C CZ  . ARG A  1 121 ? 64.958 6.442   68.191 1.00 21.21 ? 292 ARG A CZ  1 
ATOM   764  N NH1 . ARG A  1 121 ? 63.796 5.962   68.587 1.00 22.79 ? 292 ARG A NH1 1 
ATOM   765  N NH2 . ARG A  1 121 ? 65.029 7.429   67.332 1.00 22.78 ? 292 ARG A NH2 1 
ATOM   766  N N   . PHE A  1 122 ? 69.545 1.520   67.016 1.00 14.46 ? 293 PHE A N   1 
ATOM   767  C CA  . PHE A  1 122 ? 69.632 0.612   65.860 1.00 12.93 ? 293 PHE A CA  1 
ATOM   768  C C   . PHE A  1 122 ? 68.264 0.571   65.183 1.00 12.77 ? 293 PHE A C   1 
ATOM   769  O O   . PHE A  1 122 ? 67.261 0.400   65.861 1.00 13.80 ? 293 PHE A O   1 
ATOM   770  C CB  . PHE A  1 122 ? 69.955 -0.809  66.321 1.00 14.64 ? 293 PHE A CB  1 
ATOM   771  C CG  . PHE A  1 122 ? 71.407 -1.012  66.756 1.00 17.30 ? 293 PHE A CG  1 
ATOM   772  C CD1 . PHE A  1 122 ? 72.396 -1.311  65.837 1.00 18.18 ? 293 PHE A CD1 1 
ATOM   773  C CD2 . PHE A  1 122 ? 71.766 -0.837  68.062 1.00 23.33 ? 293 PHE A CD2 1 
ATOM   774  C CE1 . PHE A  1 122 ? 73.717 -1.527  66.220 1.00 24.39 ? 293 PHE A CE1 1 
ATOM   775  C CE2 . PHE A  1 122 ? 73.074 -1.025  68.447 1.00 26.75 ? 293 PHE A CE2 1 
ATOM   776  C CZ  . PHE A  1 122 ? 74.042 -1.358  67.529 1.00 27.48 ? 293 PHE A CZ  1 
ATOM   777  N N   . LEU A  1 123 ? 68.222 0.691   63.855 1.00 13.50 ? 294 LEU A N   1 
ATOM   778  C CA  . LEU A  1 123 ? 66.968 0.436   63.135 1.00 12.45 ? 294 LEU A CA  1 
ATOM   779  C C   . LEU A  1 123 ? 66.911 -1.054  62.822 1.00 11.26 ? 294 LEU A C   1 
ATOM   780  O O   . LEU A  1 123 ? 67.868 -1.585  62.285 1.00 13.01 ? 294 LEU A O   1 
ATOM   781  C CB  . LEU A  1 123 ? 66.936 1.214   61.819 1.00 11.99 ? 294 LEU A CB  1 
ATOM   782  C CG  . LEU A  1 123 ? 65.657 1.136   60.997 1.00 13.18 ? 294 LEU A CG  1 
ATOM   783  C CD1 . LEU A  1 123 ? 64.427 1.578   61.803 1.00 13.98 ? 294 LEU A CD1 1 
ATOM   784  C CD2 . LEU A  1 123 ? 65.855 1.956   59.718 1.00 13.85 ? 294 LEU A CD2 1 
ATOM   785  N N   . ILE A  1 124 ? 65.813 -1.679  63.211 1.00 11.12 ? 295 ILE A N   1 
ATOM   786  C CA  . ILE A  1 124 ? 65.585 -3.109  63.016 1.00 12.07 ? 295 ILE A CA  1 
ATOM   787  C C   . ILE A  1 124 ? 64.464 -3.310  62.017 1.00 12.00 ? 295 ILE A C   1 
ATOM   788  O O   . ILE A  1 124 ? 63.396 -2.757  62.201 1.00 12.54 ? 295 ILE A O   1 
ATOM   789  C CB  . ILE A  1 124 ? 65.246 -3.856  64.338 1.00 13.21 ? 295 ILE A CB  1 
ATOM   790  C CG1 . ILE A  1 124 ? 66.282 -3.547  65.426 1.00 14.34 ? 295 ILE A CG1 1 
ATOM   791  C CG2 . ILE A  1 124 ? 65.113 -5.348  64.068 1.00 13.45 ? 295 ILE A CG2 1 
ATOM   792  C CD1 . ILE A  1 124 ? 67.751 -3.838  65.062 1.00 14.86 ? 295 ILE A CD1 1 
ATOM   793  N N   . PHE A  1 125 ? 64.754 -4.115  60.997 1.00 10.80 ? 296 PHE A N   1 
ATOM   794  C CA  . PHE A  1 125 ? 63.743 -4.623  60.097 1.00 11.14 ? 296 PHE A CA  1 
ATOM   795  C C   . PHE A  1 125 ? 63.485 -6.074  60.553 1.00 10.73 ? 296 PHE A C   1 
ATOM   796  O O   . PHE A  1 125 ? 64.369 -6.936  60.409 1.00 12.17 ? 296 PHE A O   1 
ATOM   797  C CB  . PHE A  1 125 ? 64.170 -4.573  58.640 1.00 10.41 ? 296 PHE A CB  1 
ATOM   798  C CG  . PHE A  1 125 ? 64.322 -3.193  58.069 1.00 11.08 ? 296 PHE A CG  1 
ATOM   799  C CD1 . PHE A  1 125 ? 63.822 -2.036  58.673 1.00 11.74 ? 296 PHE A CD1 1 
ATOM   800  C CD2 . PHE A  1 125 ? 64.985 -3.055  56.862 1.00 11.75 ? 296 PHE A CD2 1 
ATOM   801  C CE1 . PHE A  1 125 ? 63.970 -0.787  58.060 1.00 12.55 ? 296 PHE A CE1 1 
ATOM   802  C CE2 . PHE A  1 125 ? 65.126 -1.829  56.286 1.00 11.95 ? 296 PHE A CE2 1 
ATOM   803  C CZ  . PHE A  1 125 ? 64.605 -0.720  56.875 1.00 11.45 ? 296 PHE A CZ  1 
ATOM   804  N N   . PHE A  1 126 ? 62.339 -6.290  61.195 1.00 11.56 ? 297 PHE A N   1 
ATOM   805  C CA  . PHE A  1 126 ? 62.012 -7.593  61.752 1.00 12.35 ? 297 PHE A CA  1 
ATOM   806  C C   . PHE A  1 126 ? 61.567 -8.554  60.641 1.00 11.19 ? 297 PHE A C   1 
ATOM   807  O O   . PHE A  1 126 ? 61.105 -8.137  59.560 1.00 12.09 ? 297 PHE A O   1 
ATOM   808  C CB  . PHE A  1 126 ? 60.910 -7.476  62.828 1.00 13.15 ? 297 PHE A CB  1 
ATOM   809  C CG  . PHE A  1 126 ? 61.376 -6.794  64.097 1.00 14.25 ? 297 PHE A CG  1 
ATOM   810  C CD1 . PHE A  1 126 ? 61.322 -5.440  64.239 1.00 14.82 ? 297 PHE A CD1 1 
ATOM   811  C CD2 . PHE A  1 126 ? 61.915 -7.540  65.101 1.00 14.74 ? 297 PHE A CD2 1 
ATOM   812  C CE1 . PHE A  1 126 ? 61.704 -4.847  65.408 1.00 13.01 ? 297 PHE A CE1 1 
ATOM   813  C CE2 . PHE A  1 126 ? 62.320 -6.940  66.306 1.00 14.66 ? 297 PHE A CE2 1 
ATOM   814  C CZ  . PHE A  1 126 ? 62.233 -5.597  66.437 1.00 15.98 ? 297 PHE A CZ  1 
ATOM   815  N N   . ASP A  1 127 ? 61.629 -9.849  60.939 1.00 11.76 ? 298 ASP A N   1 
ATOM   816  C CA  . ASP A  1 127 ? 61.329 -10.894 59.972 1.00 12.58 ? 298 ASP A CA  1 
ATOM   817  C C   . ASP A  1 127 ? 59.919 -10.869 59.382 1.00 14.73 ? 298 ASP A C   1 
ATOM   818  O O   . ASP A  1 127 ? 59.719 -11.434 58.325 1.00 17.20 ? 298 ASP A O   1 
ATOM   819  C CB  . ASP A  1 127 ? 61.558 -12.284 60.612 1.00 13.74 ? 298 ASP A CB  1 
ATOM   820  C CG  . ASP A  1 127 ? 63.021 -12.639 60.749 1.00 14.26 ? 298 ASP A CG  1 
ATOM   821  O OD1 . ASP A  1 127 ? 63.899 -11.754 60.621 1.00 15.44 ? 298 ASP A OD1 1 
ATOM   822  O OD2 . ASP A  1 127 ? 63.284 -13.860 60.951 1.00 15.25 ? 298 ASP A OD2 1 
ATOM   823  N N   . ASP A  1 128 ? 58.963 -10.271 60.078 1.00 13.19 ? 299 ASP A N   1 
ATOM   824  C CA  . ASP A  1 128 ? 57.590 -10.176 59.604 1.00 16.74 ? 299 ASP A CA  1 
ATOM   825  C C   . ASP A  1 128 ? 57.303 -8.937  58.810 1.00 15.73 ? 299 ASP A C   1 
ATOM   826  O O   . ASP A  1 128 ? 56.159 -8.796  58.326 1.00 20.04 ? 299 ASP A O   1 
ATOM   827  C CB  . ASP A  1 128 ? 56.623 -10.253 60.778 1.00 19.60 ? 299 ASP A CB  1 
ATOM   828  C CG  . ASP A  1 128 ? 56.700 -9.050  61.715 1.00 19.18 ? 299 ASP A CG  1 
ATOM   829  O OD1 . ASP A  1 128 ? 57.687 -8.346  61.714 1.00 17.25 ? 299 ASP A OD1 1 
ATOM   830  O OD2 . ASP A  1 128 ? 55.702 -8.822  62.448 1.00 21.12 ? 299 ASP A OD2 1 
ATOM   831  N N   . GLY A  1 129 ? 58.297 -8.043  58.681 1.00 14.89 ? 300 GLY A N   1 
ATOM   832  C CA  . GLY A  1 129 ? 58.109 -6.757  58.001 1.00 16.03 ? 300 GLY A CA  1 
ATOM   833  C C   . GLY A  1 129 ? 58.038 -5.510  58.865 1.00 13.61 ? 300 GLY A C   1 
ATOM   834  O O   . GLY A  1 129 ? 58.103 -4.407  58.357 1.00 14.24 ? 300 GLY A O   1 
ATOM   835  N N   . TYR A  1 130 ? 57.905 -5.699  60.187 1.00 13.54 ? 301 TYR A N   1 
ATOM   836  C CA  . TYR A  1 130 ? 57.843 -4.573  61.131 1.00 12.87 ? 301 TYR A CA  1 
ATOM   837  C C   . TYR A  1 130 ? 59.171 -3.852  61.174 1.00 12.10 ? 301 TYR A C   1 
ATOM   838  O O   . TYR A  1 130 ? 60.208 -4.448  60.930 1.00 14.46 ? 301 TYR A O   1 
ATOM   839  C CB  . TYR A  1 130 ? 57.462 -5.118  62.507 1.00 14.67 ? 301 TYR A CB  1 
ATOM   840  C CG  . TYR A  1 130 ? 57.204 -4.111  63.588 1.00 15.11 ? 301 TYR A CG  1 
ATOM   841  C CD1 . TYR A  1 130 ? 56.086 -3.333  63.590 1.00 17.40 ? 301 TYR A CD1 1 
ATOM   842  C CD2 . TYR A  1 130 ? 58.063 -4.006  64.650 1.00 16.88 ? 301 TYR A CD2 1 
ATOM   843  C CE1 . TYR A  1 130 ? 55.853 -2.428  64.606 1.00 22.93 ? 301 TYR A CE1 1 
ATOM   844  C CE2 . TYR A  1 130 ? 57.868 -3.108  65.669 1.00 21.30 ? 301 TYR A CE2 1 
ATOM   845  C CZ  . TYR A  1 130 ? 56.752 -2.318  65.640 1.00 24.54 ? 301 TYR A CZ  1 
ATOM   846  O OH  . TYR A  1 130 ? 56.530 -1.427  66.645 1.00 33.54 ? 301 TYR A OH  1 
ATOM   847  N N   . ALA A  1 131 ? 59.133 -2.556  61.489 1.00 13.18 ? 302 ALA A N   1 
ATOM   848  C CA  . ALA A  1 131 ? 60.324 -1.778  61.663 1.00 13.10 ? 302 ALA A CA  1 
ATOM   849  C C   . ALA A  1 131 ? 60.222 -0.957  62.943 1.00 13.56 ? 302 ALA A C   1 
ATOM   850  O O   . ALA A  1 131 ? 59.165 -0.404  63.257 1.00 14.21 ? 302 ALA A O   1 
ATOM   851  C CB  . ALA A  1 131 ? 60.557 -0.832  60.480 1.00 14.76 ? 302 ALA A CB  1 
ATOM   852  N N   . SER A  1 132 ? 61.355 -0.857  63.645 1.00 12.36 ? 303 SER A N   1 
ATOM   853  C CA  A SER A  1 132 ? 61.450 0.036   64.777 0.70 12.61 ? 303 SER A CA  1 
ATOM   854  C CA  B SER A  1 132 ? 61.449 -0.019  64.832 0.30 13.06 ? 303 SER A CA  1 
ATOM   855  C C   . SER A  1 132 ? 62.888 0.354   65.077 1.00 11.04 ? 303 SER A C   1 
ATOM   856  O O   . SER A  1 132 ? 63.797 -0.391  64.705 1.00 13.79 ? 303 SER A O   1 
ATOM   857  C CB  A SER A  1 132 ? 60.818 -0.578  66.027 0.70 16.10 ? 303 SER A CB  1 
ATOM   858  C CB  B SER A  1 132 ? 60.907 -0.753  66.077 0.30 15.98 ? 303 SER A CB  1 
ATOM   859  O OG  A SER A  1 132 ? 61.624 -1.615  66.491 0.70 15.78 ? 303 SER A OG  1 
ATOM   860  O OG  B SER A  1 132 ? 60.926 0.091   67.231 0.30 17.03 ? 303 SER A OG  1 
ATOM   861  N N   . TYR A  1 133 ? 63.069 1.485   65.751 1.00 13.02 ? 304 TYR A N   1 
ATOM   862  C CA  . TYR A  1 133 ? 64.340 1.785   66.367 1.00 13.56 ? 304 TYR A CA  1 
ATOM   863  C C   . TYR A  1 133 ? 64.364 1.167   67.768 1.00 13.98 ? 304 TYR A C   1 
ATOM   864  O O   . TYR A  1 133 ? 63.390 1.262   68.506 1.00 16.07 ? 304 TYR A O   1 
ATOM   865  C CB  . TYR A  1 133 ? 64.586 3.329   66.466 1.00 13.76 ? 304 TYR A CB  1 
ATOM   866  C CG  . TYR A  1 133 ? 65.060 3.987   65.189 1.00 12.10 ? 304 TYR A CG  1 
ATOM   867  C CD1 . TYR A  1 133 ? 66.323 3.771   64.718 1.00 12.34 ? 304 TYR A CD1 1 
ATOM   868  C CD2 . TYR A  1 133 ? 64.239 4.869   64.455 1.00 14.82 ? 304 TYR A CD2 1 
ATOM   869  C CE1 . TYR A  1 133 ? 66.819 4.377   63.566 1.00 14.02 ? 304 TYR A CE1 1 
ATOM   870  C CE2 . TYR A  1 133 ? 64.727 5.470   63.345 1.00 13.69 ? 304 TYR A CE2 1 
ATOM   871  C CZ  . TYR A  1 133 ? 66.015 5.249   62.902 1.00 12.07 ? 304 TYR A CZ  1 
ATOM   872  O OH  . TYR A  1 133 ? 66.468 5.905   61.752 1.00 13.31 ? 304 TYR A OH  1 
ATOM   873  N N   . VAL A  1 134 ? 65.505 0.574   68.105 1.00 14.35 ? 305 VAL A N   1 
ATOM   874  C CA  . VAL A  1 134 ? 65.720 0.012   69.415 1.00 15.50 ? 305 VAL A CA  1 
ATOM   875  C C   . VAL A  1 134 ? 67.027 0.517   70.005 1.00 16.98 ? 305 VAL A C   1 
ATOM   876  O O   . VAL A  1 134 ? 67.943 0.853   69.294 1.00 16.17 ? 305 VAL A O   1 
ATOM   877  C CB  . VAL A  1 134 ? 65.687 -1.548  69.427 1.00 15.47 ? 305 VAL A CB  1 
ATOM   878  C CG1 . VAL A  1 134 ? 64.395 -1.999  68.824 1.00 16.87 ? 305 VAL A CG1 1 
ATOM   879  C CG2 . VAL A  1 134 ? 66.921 -2.137  68.784 1.00 14.80 ? 305 VAL A CG2 1 
ATOM   880  N N   . THR A  1 135 ? 67.142 0.468   71.338 1.00 18.49 ? 306 THR A N   1 
ATOM   881  C CA  . THR A  1 135 ? 68.387 0.914   71.936 1.00 19.12 ? 306 THR A CA  1 
ATOM   882  C C   . THR A  1 135 ? 69.414 -0.235  71.955 1.00 18.35 ? 306 THR A C   1 
ATOM   883  O O   . THR A  1 135 ? 69.105 -1.402  71.730 1.00 18.72 ? 306 THR A O   1 
ATOM   884  C CB  . THR A  1 135 ? 68.169 1.445   73.369 1.00 22.74 ? 306 THR A CB  1 
ATOM   885  O OG1 . THR A  1 135 ? 67.814 0.354   74.215 1.00 23.92 ? 306 THR A OG1 1 
ATOM   886  C CG2 . THR A  1 135 ? 67.083 2.486   73.386 1.00 21.90 ? 306 THR A CG2 1 
ATOM   887  N N   . GLN A  1 136 ? 70.629 0.119   72.353 1.00 22.62 ? 307 GLN A N   1 
ATOM   888  C CA  . GLN A  1 136 ? 71.732 -0.798  72.386 1.00 26.58 ? 307 GLN A CA  1 
ATOM   889  C C   . GLN A  1 136 ? 71.461 -1.938  73.406 1.00 23.81 ? 307 GLN A C   1 
ATOM   890  O O   . GLN A  1 136 ? 71.903 -3.080  73.218 1.00 30.80 ? 307 GLN A O   1 
ATOM   891  C CB  . GLN A  1 136 ? 73.024 0.008   72.628 1.00 36.09 ? 307 GLN A CB  1 
ATOM   892  C CG  . GLN A  1 136 ? 73.354 0.944   71.414 1.00 36.04 ? 307 GLN A CG  1 
ATOM   893  C CD  . GLN A  1 136 ? 74.324 2.096   71.712 1.00 38.57 ? 307 GLN A CD  1 
ATOM   894  O OE1 . GLN A  1 136 ? 75.294 1.914   72.418 1.00 53.33 ? 307 GLN A OE1 1 
ATOM   895  N NE2 . GLN A  1 136 ? 74.061 3.293   71.117 1.00 24.18 ? 307 GLN A NE2 1 
ATOM   896  N N   . SER A  1 137 ? 70.641 -1.671  74.409 1.00 21.50 ? 308 SER A N   1 
ATOM   897  C CA  . SER A  1 137 ? 70.326 -2.682  75.393 1.00 22.96 ? 308 SER A CA  1 
ATOM   898  C C   . SER A  1 137 ? 69.063 -3.496  75.088 1.00 22.87 ? 308 SER A C   1 
ATOM   899  O O   . SER A  1 137 ? 68.558 -4.234  75.924 1.00 23.91 ? 308 SER A O   1 
ATOM   900  C CB  . SER A  1 137 ? 70.283 -2.039  76.797 1.00 26.21 ? 308 SER A CB  1 
ATOM   901  O OG  . SER A  1 137 ? 69.224 -1.133  76.899 1.00 27.38 ? 308 SER A OG  1 
ATOM   902  N N   . GLU A  1 138 ? 68.581 -3.408  73.845 1.00 19.38 ? 309 GLU A N   1 
ATOM   903  C CA  . GLU A  1 138 ? 67.336 -4.047  73.448 1.00 18.55 ? 309 GLU A CA  1 
ATOM   904  C C   . GLU A  1 138 ? 67.523 -5.071  72.325 1.00 17.70 ? 309 GLU A C   1 
ATOM   905  O O   . GLU A  1 138 ? 66.532 -5.497  71.703 1.00 18.82 ? 309 GLU A O   1 
ATOM   906  C CB  . GLU A  1 138 ? 66.312 -2.981  73.037 1.00 18.88 ? 309 GLU A CB  1 
ATOM   907  C CG  . GLU A  1 138 ? 65.842 -2.174  74.222 1.00 20.34 ? 309 GLU A CG  1 
ATOM   908  C CD  . GLU A  1 138 ? 64.840 -1.088  73.914 1.00 20.91 ? 309 GLU A CD  1 
ATOM   909  O OE1 . GLU A  1 138 ? 64.849 -0.535  72.792 1.00 21.56 ? 309 GLU A OE1 1 
ATOM   910  O OE2 . GLU A  1 138 ? 64.033 -0.778  74.825 1.00 27.78 ? 309 GLU A OE2 1 
ATOM   911  N N   . LEU A  1 139 ? 68.762 -5.410  72.027 1.00 17.16 ? 310 LEU A N   1 
ATOM   912  C CA  . LEU A  1 139 ? 69.077 -6.356  70.976 1.00 18.56 ? 310 LEU A CA  1 
ATOM   913  C C   . LEU A  1 139 ? 70.173 -7.353  71.424 1.00 19.89 ? 310 LEU A C   1 
ATOM   914  O O   . LEU A  1 139 ? 70.936 -7.098  72.352 1.00 20.53 ? 310 LEU A O   1 
ATOM   915  C CB  . LEU A  1 139 ? 69.280 -5.633  69.605 1.00 23.32 ? 310 LEU A CB  1 
ATOM   916  C CG  . LEU A  1 139 ? 70.647 -5.110  69.292 1.00 22.62 ? 310 LEU A CG  1 
ATOM   917  C CD1 . LEU A  1 139 ? 70.667 -4.467  67.904 1.00 23.83 ? 310 LEU A CD1 1 
ATOM   918  C CD2 . LEU A  1 139 ? 71.021 -4.084  70.309 1.00 28.77 ? 310 LEU A CD2 1 
ATOM   919  N N   . TYR A  1 140 ? 70.170 -8.497  70.767 1.00 17.57 ? 311 TYR A N   1 
ATOM   920  C CA  . TYR A  1 140 ? 70.991 -9.655  71.124 1.00 17.98 ? 311 TYR A CA  1 
ATOM   921  C C   . TYR A  1 140 ? 71.489 -10.244 69.816 1.00 15.89 ? 311 TYR A C   1 
ATOM   922  O O   . TYR A  1 140 ? 70.681 -10.380 68.891 1.00 17.87 ? 311 TYR A O   1 
ATOM   923  C CB  . TYR A  1 140 ? 70.190 -10.712 71.851 1.00 17.56 ? 311 TYR A CB  1 
ATOM   924  C CG  . TYR A  1 140 ? 69.458 -10.243 73.077 1.00 18.56 ? 311 TYR A CG  1 
ATOM   925  C CD1 . TYR A  1 140 ? 68.223 -9.649  72.987 1.00 19.21 ? 311 TYR A CD1 1 
ATOM   926  C CD2 . TYR A  1 140 ? 70.026 -10.417 74.354 1.00 22.67 ? 311 TYR A CD2 1 
ATOM   927  C CE1 . TYR A  1 140 ? 67.538 -9.211  74.103 1.00 24.84 ? 311 TYR A CE1 1 
ATOM   928  C CE2 . TYR A  1 140 ? 69.348 -10.001 75.481 1.00 26.29 ? 311 TYR A CE2 1 
ATOM   929  C CZ  . TYR A  1 140 ? 68.113 -9.388  75.350 1.00 26.12 ? 311 TYR A CZ  1 
ATOM   930  O OH  . TYR A  1 140 ? 67.450 -8.992  76.473 1.00 33.93 ? 311 TYR A OH  1 
ATOM   931  N N   . PRO A  1 141 ? 72.781 -10.539 69.691 1.00 16.55 ? 312 PRO A N   1 
ATOM   932  C CA  . PRO A  1 141 ? 73.314 -11.088 68.444 1.00 17.37 ? 312 PRO A CA  1 
ATOM   933  C C   . PRO A  1 141 ? 72.973 -12.560 68.293 1.00 17.20 ? 312 PRO A C   1 
ATOM   934  O O   . PRO A  1 141 ? 73.109 -13.332 69.219 1.00 17.33 ? 312 PRO A O   1 
ATOM   935  C CB  . PRO A  1 141 ? 74.827 -10.852 68.545 1.00 20.92 ? 312 PRO A CB  1 
ATOM   936  C CG  . PRO A  1 141 ? 75.103 -10.625 69.991 1.00 26.18 ? 312 PRO A CG  1 
ATOM   937  C CD  . PRO A  1 141 ? 73.805 -10.398 70.724 1.00 21.98 ? 312 PRO A CD  1 
ATOM   938  N N   . ILE A  1 142 ? 72.470 -12.953 67.112 1.00 15.04 ? 313 ILE A N   1 
ATOM   939  C CA  . ILE A  1 142 ? 72.268 -14.373 66.813 1.00 14.97 ? 313 ILE A CA  1 
ATOM   940  C C   . ILE A  1 142 ? 73.657 -15.057 66.719 1.00 15.99 ? 313 ILE A C   1 
ATOM   941  O O   . ILE A  1 142 ? 74.634 -14.511 66.212 1.00 15.95 ? 313 ILE A O   1 
ATOM   942  C CB  . ILE A  1 142 ? 71.349 -14.524 65.557 1.00 16.00 ? 313 ILE A CB  1 
ATOM   943  C CG1 . ILE A  1 142 ? 69.887 -14.370 66.036 1.00 15.60 ? 313 ILE A CG1 1 
ATOM   944  C CG2 . ILE A  1 142 ? 71.537 -15.878 64.902 1.00 16.64 ? 313 ILE A CG2 1 
ATOM   945  C CD1 . ILE A  1 142 ? 68.832 -14.121 65.002 1.00 17.55 ? 313 ILE A CD1 1 
ATOM   946  N N   . CYS A  1 143 ? 73.731 -16.261 67.286 1.00 15.28 ? 314 CYS A N   1 
ATOM   947  C CA  . CYS A  1 143 ? 75.052 -16.880 67.496 1.00 16.95 ? 314 CYS A CA  1 
ATOM   948  C C   . CYS A  1 143 ? 75.768 -17.236 66.185 1.00 14.94 ? 314 CYS A C   1 
ATOM   949  O O   . CYS A  1 143 ? 76.956 -16.933 66.029 1.00 17.18 ? 314 CYS A O   1 
ATOM   950  C CB  . CYS A  1 143 ? 74.900 -18.109 68.379 1.00 16.39 ? 314 CYS A CB  1 
ATOM   951  S SG  . CYS A  1 143 ? 74.184 -17.789 70.014 1.00 17.81 ? 314 CYS A SG  1 
ATOM   952  N N   . ARG A  1 144 ? 75.053 -17.928 65.279 1.00 16.76 ? 315 ARG A N   1 
ATOM   953  C CA  . ARG A  1 144 ? 75.658 -18.420 64.044 1.00 16.72 ? 315 ARG A CA  1 
ATOM   954  C C   . ARG A  1 144 ? 74.735 -18.074 62.870 1.00 16.10 ? 315 ARG A C   1 
ATOM   955  O O   . ARG A  1 144 ? 74.070 -18.941 62.333 1.00 16.45 ? 315 ARG A O   1 
ATOM   956  C CB  . ARG A  1 144 ? 75.943 -19.920 64.130 1.00 16.47 ? 315 ARG A CB  1 
ATOM   957  C CG  . ARG A  1 144 ? 76.951 -20.290 65.249 1.00 16.80 ? 315 ARG A CG  1 
ATOM   958  C CD  . ARG A  1 144 ? 78.377 -19.849 64.950 1.00 19.67 ? 315 ARG A CD  1 
ATOM   959  N NE  . ARG A  1 144 ? 79.309 -20.245 66.009 1.00 23.97 ? 315 ARG A NE  1 
ATOM   960  C CZ  . ARG A  1 144 ? 79.541 -19.594 67.129 1.00 23.91 ? 315 ARG A CZ  1 
ATOM   961  N NH1 . ARG A  1 144 ? 78.948 -18.413 67.429 1.00 23.89 ? 315 ARG A NH1 1 
ATOM   962  N NH2 . ARG A  1 144 ? 80.417 -20.152 68.006 1.00 26.71 ? 315 ARG A NH2 1 
ATOM   963  N N   . PRO A  1 145 ? 74.706 -16.819 62.501 1.00 16.37 ? 316 PRO A N   1 
ATOM   964  C CA  . PRO A  1 145 ? 73.912 -16.428 61.352 1.00 16.62 ? 316 PRO A CA  1 
ATOM   965  C C   . PRO A  1 145 ? 74.402 -17.047 60.080 1.00 16.58 ? 316 PRO A C   1 
ATOM   966  O O   . PRO A  1 145 ? 75.575 -17.406 59.960 1.00 18.02 ? 316 PRO A O   1 
ATOM   967  C CB  . PRO A  1 145 ? 74.083 -14.908 61.278 1.00 19.82 ? 316 PRO A CB  1 
ATOM   968  C CG  . PRO A  1 145 ? 75.181 -14.559 62.156 1.00 28.32 ? 316 PRO A CG  1 
ATOM   969  C CD  . PRO A  1 145 ? 75.468 -15.685 63.057 1.00 19.67 ? 316 PRO A CD  1 
ATOM   970  N N   . LEU A  1 146 ? 73.525 -17.068 59.084 1.00 15.59 ? 317 LEU A N   1 
ATOM   971  C CA  . LEU A  1 146 ? 73.941 -17.492 57.764 1.00 16.78 ? 317 LEU A CA  1 
ATOM   972  C C   . LEU A  1 146 ? 74.816 -16.435 57.147 1.00 15.02 ? 317 LEU A C   1 
ATOM   973  O O   . LEU A  1 146 ? 74.677 -15.224 57.451 1.00 16.90 ? 317 LEU A O   1 
ATOM   974  C CB  . LEU A  1 146 ? 72.734 -17.808 56.895 1.00 16.00 ? 317 LEU A CB  1 
ATOM   975  C CG  . LEU A  1 146 ? 72.038 -19.119 57.051 1.00 23.41 ? 317 LEU A CG  1 
ATOM   976  C CD1 . LEU A  1 146 ? 71.652 -19.470 58.421 1.00 29.55 ? 317 LEU A CD1 1 
ATOM   977  C CD2 . LEU A  1 146 ? 70.820 -19.323 56.154 1.00 22.63 ? 317 LEU A CD2 1 
ATOM   978  N N   . LYS A  1 147 ? 75.742 -16.880 56.300 1.00 16.55 ? 318 LYS A N   1 
ATOM   979  C CA  . LYS A  1 147 ? 76.688 -15.956 55.633 1.00 17.60 ? 318 LYS A CA  1 
ATOM   980  C C   . LYS A  1 147 ? 75.970 -14.808 54.907 1.00 16.36 ? 318 LYS A C   1 
ATOM   981  O O   . LYS A  1 147 ? 76.368 -13.622 55.033 1.00 19.33 ? 318 LYS A O   1 
ATOM   982  C CB  . LYS A  1 147 ? 77.653 -16.730 54.724 1.00 21.99 ? 318 LYS A CB  1 
ATOM   983  C CG  . LYS A  1 147 ? 78.637 -15.852 54.016 1.00 25.93 ? 318 LYS A CG  1 
ATOM   984  C CD  . LYS A  1 147 ? 79.786 -16.628 53.393 1.00 35.29 ? 318 LYS A CD  1 
ATOM   985  C CE  . LYS A  1 147 ? 80.869 -15.634 52.949 1.00 44.90 ? 318 LYS A CE  1 
ATOM   986  N NZ  . LYS A  1 147 ? 82.028 -16.318 52.339 1.00 52.93 ? 318 LYS A NZ  1 
ATOM   987  N N   . LYS A  1 148 ? 74.950 -15.186 54.124 1.00 15.50 ? 319 LYS A N   1 
ATOM   988  C CA  . LYS A  1 148 ? 73.969 -14.214 53.600 1.00 15.49 ? 319 LYS A CA  1 
ATOM   989  C C   . LYS A  1 148 ? 72.859 -14.211 54.607 1.00 14.42 ? 319 LYS A C   1 
ATOM   990  O O   . LYS A  1 148 ? 72.051 -15.141 54.653 1.00 13.71 ? 319 LYS A O   1 
ATOM   991  C CB  . LYS A  1 148 ? 73.500 -14.626 52.203 1.00 14.80 ? 319 LYS A CB  1 
ATOM   992  C CG  . LYS A  1 148 ? 74.539 -14.292 51.148 1.00 14.87 ? 319 LYS A CG  1 
ATOM   993  C CD  . LYS A  1 148 ? 74.115 -14.673 49.737 1.00 18.18 ? 319 LYS A CD  1 
ATOM   994  C CE  . LYS A  1 148 ? 75.019 -14.034 48.695 1.00 20.65 ? 319 LYS A CE  1 
ATOM   995  N NZ  . LYS A  1 148 ? 74.566 -14.379 47.312 1.00 22.08 ? 319 LYS A NZ  1 
ATOM   996  N N   . THR A  1 149 ? 72.796 -13.146 55.423 1.00 13.46 ? 320 THR A N   1 
ATOM   997  C CA  . THR A  1 149 ? 72.036 -13.253 56.702 1.00 12.96 ? 320 THR A CA  1 
ATOM   998  C C   . THR A  1 149 ? 70.525 -13.369 56.505 1.00 12.55 ? 320 THR A C   1 
ATOM   999  O O   . THR A  1 149 ? 69.820 -13.884 57.356 1.00 15.08 ? 320 THR A O   1 
ATOM   1000 C CB  . THR A  1 149 ? 72.306 -12.044 57.605 1.00 15.15 ? 320 THR A CB  1 
ATOM   1001 O OG1 . THR A  1 149 ? 72.094 -10.853 56.847 1.00 14.86 ? 320 THR A OG1 1 
ATOM   1002 C CG2 . THR A  1 149 ? 73.721 -12.068 58.163 1.00 15.40 ? 320 THR A CG2 1 
ATOM   1003 N N   . TRP A  1 150 ? 70.039 -12.903 55.326 1.00 12.32 ? 321 TRP A N   1 
ATOM   1004 C CA  . TRP A  1 150 ? 68.603 -12.926 54.996 1.00 12.87 ? 321 TRP A CA  1 
ATOM   1005 C C   . TRP A  1 150 ? 68.095 -14.290 54.549 1.00 11.81 ? 321 TRP A C   1 
ATOM   1006 O O   . TRP A  1 150 ? 66.877 -14.474 54.424 1.00 13.38 ? 321 TRP A O   1 
ATOM   1007 C CB  . TRP A  1 150 ? 68.297 -11.958 53.846 1.00 13.84 ? 321 TRP A CB  1 
ATOM   1008 C CG  . TRP A  1 150 ? 69.152 -12.159 52.628 1.00 14.37 ? 321 TRP A CG  1 
ATOM   1009 C CD1 . TRP A  1 150 ? 68.961 -13.081 51.615 1.00 15.72 ? 321 TRP A CD1 1 
ATOM   1010 C CD2 . TRP A  1 150 ? 70.372 -11.497 52.328 1.00 15.39 ? 321 TRP A CD2 1 
ATOM   1011 N NE1 . TRP A  1 150 ? 69.977 -13.006 50.731 1.00 16.32 ? 321 TRP A NE1 1 
ATOM   1012 C CE2 . TRP A  1 150 ? 70.849 -12.023 51.122 1.00 15.23 ? 321 TRP A CE2 1 
ATOM   1013 C CE3 . TRP A  1 150 ? 71.079 -10.467 52.937 1.00 15.87 ? 321 TRP A CE3 1 
ATOM   1014 C CZ2 . TRP A  1 150 ? 72.005 -11.569 50.512 1.00 16.70 ? 321 TRP A CZ2 1 
ATOM   1015 C CZ3 . TRP A  1 150 ? 72.276 -10.040 52.340 1.00 19.23 ? 321 TRP A CZ3 1 
ATOM   1016 C CH2 . TRP A  1 150 ? 72.713 -10.598 51.137 1.00 18.28 ? 321 TRP A CH2 1 
ATOM   1017 N N   . GLU A  1 151 ? 69.000 -15.259 54.374 1.00 11.88 ? 322 GLU A N   1 
ATOM   1018 C CA  . GLU A  1 151 ? 68.546 -16.537 53.757 1.00 12.42 ? 322 GLU A CA  1 
ATOM   1019 C C   . GLU A  1 151 ? 67.659 -17.405 54.645 1.00 13.38 ? 322 GLU A C   1 
ATOM   1020 O O   . GLU A  1 151 ? 67.041 -18.374 54.168 1.00 16.68 ? 322 GLU A O   1 
ATOM   1021 C CB  . GLU A  1 151 ? 69.757 -17.307 53.224 1.00 12.88 ? 322 GLU A CB  1 
ATOM   1022 C CG  . GLU A  1 151 ? 70.293 -16.713 51.935 1.00 14.23 ? 322 GLU A CG  1 
ATOM   1023 C CD  . GLU A  1 151 ? 71.506 -17.448 51.377 1.00 15.19 ? 322 GLU A CD  1 
ATOM   1024 O OE1 . GLU A  1 151 ? 72.098 -18.248 52.082 1.00 16.45 ? 322 GLU A OE1 1 
ATOM   1025 O OE2 . GLU A  1 151 ? 71.787 -17.260 50.172 1.00 17.95 ? 322 GLU A OE2 1 
ATOM   1026 N N   . ASP A  1 152 ? 67.597 -17.066 55.937 1.00 11.99 ? 323 ASP A N   1 
ATOM   1027 C CA  . ASP A  1 152 ? 66.724 -17.761 56.847 1.00 12.39 ? 323 ASP A CA  1 
ATOM   1028 C C   . ASP A  1 152 ? 65.465 -16.962 57.184 1.00 13.22 ? 323 ASP A C   1 
ATOM   1029 O O   . ASP A  1 152 ? 64.750 -17.307 58.137 1.00 16.95 ? 323 ASP A O   1 
ATOM   1030 C CB  . ASP A  1 152 ? 67.463 -18.178 58.154 1.00 13.03 ? 323 ASP A CB  1 
ATOM   1031 C CG  . ASP A  1 152 ? 67.985 -17.022 58.917 1.00 15.02 ? 323 ASP A CG  1 
ATOM   1032 O OD1 . ASP A  1 152 ? 67.768 -15.857 58.508 1.00 14.31 ? 323 ASP A OD1 1 
ATOM   1033 O OD2 . ASP A  1 152 ? 68.679 -17.252 59.944 1.00 16.42 ? 323 ASP A OD2 1 
ATOM   1034 N N   . ILE A  1 153 ? 65.158 -15.940 56.388 1.00 13.27 ? 324 ILE A N   1 
ATOM   1035 C CA  . ILE A  1 153 ? 63.884 -15.222 56.564 1.00 13.15 ? 324 ILE A CA  1 
ATOM   1036 C C   . ILE A  1 153 ? 62.824 -16.011 55.806 1.00 13.98 ? 324 ILE A C   1 
ATOM   1037 O O   . ILE A  1 153 ? 62.916 -16.170 54.569 1.00 15.43 ? 324 ILE A O   1 
ATOM   1038 C CB  . ILE A  1 153 ? 64.012 -13.759 56.080 1.00 13.03 ? 324 ILE A CB  1 
ATOM   1039 C CG1 . ILE A  1 153 ? 65.017 -12.990 56.939 1.00 13.69 ? 324 ILE A CG1 1 
ATOM   1040 C CG2 . ILE A  1 153 ? 62.650 -13.076 56.097 1.00 14.01 ? 324 ILE A CG2 1 
ATOM   1041 C CD1 . ILE A  1 153 ? 65.313 -11.608 56.418 1.00 13.95 ? 324 ILE A CD1 1 
ATOM   1042 N N   . GLU A  1 154 ? 61.815 -16.440 56.543 1.00 14.23 ? 325 GLU A N   1 
ATOM   1043 C CA  A GLU A  1 154 ? 60.773 -17.341 56.012 0.70 16.71 ? 325 GLU A CA  1 
ATOM   1044 C CA  B GLU A  1 154 ? 60.843 -17.362 55.988 0.30 15.26 ? 325 GLU A CA  1 
ATOM   1045 C C   . GLU A  1 154 ? 59.870 -16.680 54.979 1.00 15.99 ? 325 GLU A C   1 
ATOM   1046 O O   . GLU A  1 154 ? 59.490 -17.292 53.994 1.00 19.90 ? 325 GLU A O   1 
ATOM   1047 C CB  A GLU A  1 154 ? 59.869 -17.874 57.123 0.70 18.96 ? 325 GLU A CB  1 
ATOM   1048 C CB  B GLU A  1 154 ? 60.129 -18.104 57.127 0.30 14.98 ? 325 GLU A CB  1 
ATOM   1049 C CG  A GLU A  1 154 ? 58.712 -18.735 56.567 0.70 25.36 ? 325 GLU A CG  1 
ATOM   1050 C CG  B GLU A  1 154 ? 61.079 -18.968 57.996 0.30 15.39 ? 325 GLU A CG  1 
ATOM   1051 C CD  A GLU A  1 154 ? 58.028 -19.594 57.598 0.70 36.97 ? 325 GLU A CD  1 
ATOM   1052 C CD  B GLU A  1 154 ? 60.336 -20.007 58.835 0.30 19.89 ? 325 GLU A CD  1 
ATOM   1053 O OE1 A GLU A  1 154 ? 57.433 -19.035 58.546 0.70 44.34 ? 325 GLU A OE1 1 
ATOM   1054 O OE1 B GLU A  1 154 ? 59.833 -20.990 58.272 0.30 24.15 ? 325 GLU A OE1 1 
ATOM   1055 O OE2 A GLU A  1 154 ? 58.052 -20.832 57.419 0.70 51.33 ? 325 GLU A OE2 1 
ATOM   1056 O OE2 B GLU A  1 154 ? 60.265 -19.853 60.058 0.30 20.50 ? 325 GLU A OE2 1 
ATOM   1057 N N   . ASP A  1 155 ? 59.488 -15.447 55.224 1.00 16.12 ? 326 ASP A N   1 
ATOM   1058 C CA  . ASP A  1 155 ? 58.557 -14.727 54.313 1.00 17.85 ? 326 ASP A CA  1 
ATOM   1059 C C   . ASP A  1 155 ? 59.373 -14.252 53.123 1.00 17.72 ? 326 ASP A C   1 
ATOM   1060 O O   . ASP A  1 155 ? 60.304 -13.458 53.280 1.00 18.01 ? 326 ASP A O   1 
ATOM   1061 C CB  . ASP A  1 155 ? 57.890 -13.571 55.080 1.00 21.07 ? 326 ASP A CB  1 
ATOM   1062 C CG  . ASP A  1 155 ? 56.912 -12.784 54.250 1.00 25.65 ? 326 ASP A CG  1 
ATOM   1063 O OD1 . ASP A  1 155 ? 57.323 -12.252 53.240 1.00 27.74 ? 326 ASP A OD1 1 
ATOM   1064 O OD2 . ASP A  1 155 ? 55.736 -12.652 54.646 1.00 33.67 ? 326 ASP A OD2 1 
ATOM   1065 N N   . ILE A  1 156 ? 59.084 -14.804 51.931 1.00 19.10 ? 327 ILE A N   1 
ATOM   1066 C CA  . ILE A  1 156 ? 59.901 -14.527 50.750 1.00 20.84 ? 327 ILE A CA  1 
ATOM   1067 C C   . ILE A  1 156 ? 59.906 -13.022 50.413 1.00 18.09 ? 327 ILE A C   1 
ATOM   1068 O O   . ILE A  1 156 ? 60.923 -12.521 49.976 1.00 18.79 ? 327 ILE A O   1 
ATOM   1069 C CB  . ILE A  1 156 ? 59.502 -15.413 49.552 1.00 23.77 ? 327 ILE A CB  1 
ATOM   1070 C CG1 . ILE A  1 156 ? 60.521 -15.291 48.389 1.00 27.76 ? 327 ILE A CG1 1 
ATOM   1071 C CG2 . ILE A  1 156 ? 58.117 -15.038 49.021 1.00 28.98 ? 327 ILE A CG2 1 
ATOM   1072 C CD1 . ILE A  1 156 ? 61.957 -15.623 48.756 1.00 28.10 ? 327 ILE A CD1 1 
ATOM   1073 N N   . SER A  1 157 ? 58.800 -12.295 50.613 1.00 18.38 ? 328 SER A N   1 
ATOM   1074 C CA  A SER A  1 157 ? 58.783 -10.843 50.319 0.70 19.12 ? 328 SER A CA  1 
ATOM   1075 C CA  B SER A  1 157 ? 58.801 -10.854 50.314 0.30 18.47 ? 328 SER A CA  1 
ATOM   1076 C C   . SER A  1 157 ? 59.771 -10.094 51.231 1.00 17.25 ? 328 SER A C   1 
ATOM   1077 O O   . SER A  1 157 ? 60.508 -9.208  50.790 1.00 17.35 ? 328 SER A O   1 
ATOM   1078 C CB  A SER A  1 157 ? 57.374 -10.216 50.398 0.70 24.86 ? 328 SER A CB  1 
ATOM   1079 C CB  B SER A  1 157 ? 57.394 -10.288 50.400 0.30 19.49 ? 328 SER A CB  1 
ATOM   1080 O OG  A SER A  1 157 ? 56.855 -10.176 51.716 0.70 25.16 ? 328 SER A OG  1 
ATOM   1081 O OG  B SER A  1 157 ? 56.573 -10.976 49.472 0.30 21.23 ? 328 SER A OG  1 
ATOM   1082 N N   . CYS A  1 158 ? 59.795 -10.502 52.483 1.00 16.03 ? 329 CYS A N   1 
ATOM   1083 C CA  . CYS A  1 158 ? 60.707 -9.936  53.460 1.00 14.70 ? 329 CYS A CA  1 
ATOM   1084 C C   . CYS A  1 158 ? 62.154 -10.300 53.099 1.00 14.10 ? 329 CYS A C   1 
ATOM   1085 O O   . CYS A  1 158 ? 63.018 -9.442  53.122 1.00 16.75 ? 329 CYS A O   1 
ATOM   1086 C CB  . CYS A  1 158 ? 60.357 -10.430 54.831 1.00 15.49 ? 329 CYS A CB  1 
ATOM   1087 S SG  . CYS A  1 158 ? 58.736 -9.828  55.420 1.00 22.03 ? 329 CYS A SG  1 
ATOM   1088 N N   . ARG A  1 159 ? 62.394 -11.555 52.785 1.00 13.34 ? 330 ARG A N   1 
ATOM   1089 C CA  . ARG A  1 159 ? 63.703 -12.057 52.429 1.00 14.16 ? 330 ARG A CA  1 
ATOM   1090 C C   . ARG A  1 159 ? 64.293 -11.295 51.245 1.00 14.75 ? 330 ARG A C   1 
ATOM   1091 O O   . ARG A  1 159 ? 65.456 -10.827 51.264 1.00 14.68 ? 330 ARG A O   1 
ATOM   1092 C CB  . ARG A  1 159 ? 63.639 -13.566 52.122 1.00 15.58 ? 330 ARG A CB  1 
ATOM   1093 C CG  . ARG A  1 159 ? 64.932 -14.215 51.696 1.00 16.10 ? 330 ARG A CG  1 
ATOM   1094 C CD  . ARG A  1 159 ? 64.783 -15.761 51.651 1.00 19.64 ? 330 ARG A CD  1 
ATOM   1095 N NE  . ARG A  1 159 ? 65.819 -16.333 50.788 1.00 21.89 ? 330 ARG A NE  1 
ATOM   1096 C CZ  . ARG A  1 159 ? 65.926 -17.626 50.466 1.00 24.62 ? 330 ARG A CZ  1 
ATOM   1097 N NH1 . ARG A  1 159 ? 66.882 -17.996 49.610 1.00 23.30 ? 330 ARG A NH1 1 
ATOM   1098 N NH2 . ARG A  1 159 ? 65.057 -18.529 50.934 1.00 22.88 ? 330 ARG A NH2 1 
ATOM   1099 N N   . ASP A  1 160 ? 63.464 -11.170 50.197 1.00 15.25 ? 331 ASP A N   1 
ATOM   1100 C CA  . ASP A  1 160 ? 63.882 -10.451 49.006 1.00 14.40 ? 331 ASP A CA  1 
ATOM   1101 C C   . ASP A  1 160 ? 64.168 -8.981  49.273 1.00 11.89 ? 331 ASP A C   1 
ATOM   1102 O O   . ASP A  1 160 ? 65.151 -8.417  48.746 1.00 14.36 ? 331 ASP A O   1 
ATOM   1103 C CB  . ASP A  1 160 ? 62.845 -10.601 47.918 1.00 17.13 ? 331 ASP A CB  1 
ATOM   1104 C CG  . ASP A  1 160 ? 62.859 -11.989 47.264 1.00 19.23 ? 331 ASP A CG  1 
ATOM   1105 O OD1 . ASP A  1 160 ? 63.823 -12.778 47.390 1.00 23.99 ? 331 ASP A OD1 1 
ATOM   1106 O OD2 . ASP A  1 160 ? 61.930 -12.220 46.496 1.00 26.29 ? 331 ASP A OD2 1 
ATOM   1107 N N   . PHE A  1 161 ? 63.315 -8.353  50.079 1.00 12.97 ? 332 PHE A N   1 
ATOM   1108 C CA  . PHE A  1 161 ? 63.519 -6.978  50.426 1.00 12.88 ? 332 PHE A CA  1 
ATOM   1109 C C   . PHE A  1 161 ? 64.865 -6.740  51.152 1.00 11.53 ? 332 PHE A C   1 
ATOM   1110 O O   . PHE A  1 161 ? 65.627 -5.812  50.831 1.00 12.08 ? 332 PHE A O   1 
ATOM   1111 C CB  . PHE A  1 161 ? 62.378 -6.403  51.235 1.00 12.72 ? 332 PHE A CB  1 
ATOM   1112 C CG  . PHE A  1 161 ? 62.636 -5.005  51.673 1.00 13.33 ? 332 PHE A CG  1 
ATOM   1113 C CD1 . PHE A  1 161 ? 62.423 -3.935  50.820 1.00 14.90 ? 332 PHE A CD1 1 
ATOM   1114 C CD2 . PHE A  1 161 ? 63.231 -4.735  52.894 1.00 16.46 ? 332 PHE A CD2 1 
ATOM   1115 C CE1 . PHE A  1 161 ? 62.721 -2.665  51.191 1.00 17.45 ? 332 PHE A CE1 1 
ATOM   1116 C CE2 . PHE A  1 161 ? 63.557 -3.435  53.247 1.00 15.21 ? 332 PHE A CE2 1 
ATOM   1117 C CZ  . PHE A  1 161 ? 63.294 -2.412  52.420 1.00 16.65 ? 332 PHE A CZ  1 
ATOM   1118 N N   . ILE A  1 162 ? 65.138 -7.608  52.145 1.00 11.81 ? 333 ILE A N   1 
ATOM   1119 C CA  . ILE A  1 162 ? 66.352 -7.436  52.932 1.00 11.57 ? 333 ILE A CA  1 
ATOM   1120 C C   . ILE A  1 162 ? 67.558 -7.637  52.031 1.00 10.51 ? 333 ILE A C   1 
ATOM   1121 O O   . ILE A  1 162 ? 68.523 -6.899  52.131 1.00 11.89 ? 333 ILE A O   1 
ATOM   1122 C CB  . ILE A  1 162 ? 66.384 -8.400  54.133 1.00 12.93 ? 333 ILE A CB  1 
ATOM   1123 C CG1 . ILE A  1 162 ? 65.272 -8.081  55.098 1.00 13.52 ? 333 ILE A CG1 1 
ATOM   1124 C CG2 . ILE A  1 162 ? 67.725 -8.412  54.786 1.00 12.69 ? 333 ILE A CG2 1 
ATOM   1125 C CD1 . ILE A  1 162 ? 65.312 -6.724  55.747 1.00 13.40 ? 333 ILE A CD1 1 
ATOM   1126 N N   . GLU A  1 163 ? 67.533 -8.679  51.160 1.00 10.83 ? 334 GLU A N   1 
ATOM   1127 C CA  . GLU A  1 163 ? 68.676 -8.869  50.292 1.00 12.66 ? 334 GLU A CA  1 
ATOM   1128 C C   . GLU A  1 163 ? 68.943 -7.590  49.464 1.00 12.32 ? 334 GLU A C   1 
ATOM   1129 O O   . GLU A  1 163 ? 70.099 -7.133  49.299 1.00 13.34 ? 334 GLU A O   1 
ATOM   1130 C CB  . GLU A  1 163 ? 68.471 -10.095 49.343 1.00 13.34 ? 334 GLU A CB  1 
ATOM   1131 C CG  . GLU A  1 163 ? 69.560 -10.203 48.306 1.00 14.66 ? 334 GLU A CG  1 
ATOM   1132 C CD  . GLU A  1 163 ? 69.472 -11.436 47.446 1.00 20.65 ? 334 GLU A CD  1 
ATOM   1133 O OE1 . GLU A  1 163 ? 68.426 -12.014 47.353 1.00 26.89 ? 334 GLU A OE1 1 
ATOM   1134 O OE2 . GLU A  1 163 ? 70.486 -11.754 46.812 1.00 28.35 ? 334 GLU A OE2 1 
ATOM   1135 N N   . GLU A  1 164 ? 67.860 -7.040  48.897 1.00 12.26 ? 335 GLU A N   1 
ATOM   1136 C CA  . GLU A  1 164 ? 67.998 -5.821  48.073 1.00 13.97 ? 335 GLU A CA  1 
ATOM   1137 C C   . GLU A  1 164 ? 68.572 -4.657  48.870 1.00 12.46 ? 335 GLU A C   1 
ATOM   1138 O O   . GLU A  1 164 ? 69.535 -3.979  48.465 1.00 13.31 ? 335 GLU A O   1 
ATOM   1139 C CB  . GLU A  1 164 ? 66.662 -5.383  47.442 1.00 16.83 ? 335 GLU A CB  1 
ATOM   1140 C CG  . GLU A  1 164 ? 66.705 -4.100  46.612 1.00 25.51 ? 335 GLU A CG  1 
ATOM   1141 C CD  . GLU A  1 164 ? 65.275 -3.783  46.212 1.00 37.96 ? 335 GLU A CD  1 
ATOM   1142 O OE1 . GLU A  1 164 ? 64.862 -4.407  45.246 1.00 42.29 ? 335 GLU A OE1 1 
ATOM   1143 O OE2 . GLU A  1 164 ? 64.540 -3.024  46.940 1.00 48.10 ? 335 GLU A OE2 1 
ATOM   1144 N N   . TYR A  1 165 ? 68.006 -4.490  50.051 1.00 11.79 ? 336 TYR A N   1 
ATOM   1145 C CA  . TYR A  1 165 ? 68.392 -3.367  50.934 1.00 11.53 ? 336 TYR A CA  1 
ATOM   1146 C C   . TYR A  1 165 ? 69.861 -3.487  51.362 1.00 11.74 ? 336 TYR A C   1 
ATOM   1147 O O   . TYR A  1 165 ? 70.642 -2.511  51.284 1.00 12.72 ? 336 TYR A O   1 
ATOM   1148 C CB  . TYR A  1 165 ? 67.457 -3.335  52.139 1.00 12.25 ? 336 TYR A CB  1 
ATOM   1149 C CG  . TYR A  1 165 ? 67.781 -2.246  53.135 1.00 12.29 ? 336 TYR A CG  1 
ATOM   1150 C CD1 . TYR A  1 165 ? 68.682 -2.506  54.159 1.00 12.27 ? 336 TYR A CD1 1 
ATOM   1151 C CD2 . TYR A  1 165 ? 67.225 -1.005  53.083 1.00 11.36 ? 336 TYR A CD2 1 
ATOM   1152 C CE1 . TYR A  1 165 ? 69.008 -1.519  55.099 1.00 11.87 ? 336 TYR A CE1 1 
ATOM   1153 C CE2 . TYR A  1 165 ? 67.519 -0.005  54.003 1.00 12.35 ? 336 TYR A CE2 1 
ATOM   1154 C CZ  . TYR A  1 165 ? 68.415 -0.277  55.015 1.00 11.68 ? 336 TYR A CZ  1 
ATOM   1155 O OH  . TYR A  1 165 ? 68.697 0.729   55.935 1.00 13.11 ? 336 TYR A OH  1 
ATOM   1156 N N   . VAL A  1 166 ? 70.227 -4.670  51.868 1.00 11.44 ? 337 VAL A N   1 
ATOM   1157 C CA  . VAL A  1 166 ? 71.617 -4.825  52.366 1.00 13.15 ? 337 VAL A CA  1 
ATOM   1158 C C   . VAL A  1 166 ? 72.611 -4.687  51.225 1.00 14.13 ? 337 VAL A C   1 
ATOM   1159 O O   . VAL A  1 166 ? 73.713 -4.089  51.390 1.00 16.75 ? 337 VAL A O   1 
ATOM   1160 C CB  . VAL A  1 166 ? 71.763 -6.157  53.121 1.00 15.05 ? 337 VAL A CB  1 
ATOM   1161 C CG1 . VAL A  1 166 ? 73.213 -6.438  53.494 1.00 16.54 ? 337 VAL A CG1 1 
ATOM   1162 C CG2 . VAL A  1 166 ? 70.888 -6.127  54.374 1.00 15.21 ? 337 VAL A CG2 1 
ATOM   1163 N N   . THR A  1 167 ? 72.250 -5.218  50.049 1.00 14.64 ? 338 THR A N   1 
ATOM   1164 C CA  . THR A  1 167 ? 73.174 -5.202  48.916 1.00 16.20 ? 338 THR A CA  1 
ATOM   1165 C C   . THR A  1 167 ? 73.381 -3.768  48.388 1.00 14.34 ? 338 THR A C   1 
ATOM   1166 O O   . THR A  1 167 ? 74.481 -3.390  47.946 1.00 19.53 ? 338 THR A O   1 
ATOM   1167 C CB  . THR A  1 167 ? 72.683 -6.182  47.806 1.00 20.92 ? 338 THR A CB  1 
ATOM   1168 O OG1 . THR A  1 167 ? 72.638 -7.505  48.387 1.00 20.19 ? 338 THR A OG1 1 
ATOM   1169 C CG2 . THR A  1 167 ? 73.612 -6.164  46.599 1.00 24.21 ? 338 THR A CG2 1 
ATOM   1170 N N   . ALA A  1 168 ? 72.328 -2.987  48.428 1.00 16.04 ? 339 ALA A N   1 
ATOM   1171 C CA  . ALA A  1 168 ? 72.362 -1.608  47.950 1.00 14.84 ? 339 ALA A CA  1 
ATOM   1172 C C   . ALA A  1 168 ? 73.012 -0.626  48.935 1.00 14.33 ? 339 ALA A C   1 
ATOM   1173 O O   . ALA A  1 168 ? 73.484 0.445   48.541 1.00 15.63 ? 339 ALA A O   1 
ATOM   1174 C CB  . ALA A  1 168 ? 70.942 -1.168  47.646 1.00 16.85 ? 339 ALA A CB  1 
ATOM   1175 N N   . TYR A  1 169 ? 72.975 -0.976  50.217 1.00 14.39 ? 340 TYR A N   1 
ATOM   1176 C CA  . TYR A  1 169 ? 73.491 -0.084  51.270 1.00 13.51 ? 340 TYR A CA  1 
ATOM   1177 C C   . TYR A  1 169 ? 74.928 0.341   50.904 1.00 15.24 ? 340 TYR A C   1 
ATOM   1178 O O   . TYR A  1 169 ? 75.713 -0.514  50.495 1.00 16.55 ? 340 TYR A O   1 
ATOM   1179 C CB  . TYR A  1 169 ? 73.458 -0.843  52.599 1.00 15.24 ? 340 TYR A CB  1 
ATOM   1180 C CG  . TYR A  1 169 ? 73.832 0.019   53.765 1.00 14.54 ? 340 TYR A CG  1 
ATOM   1181 C CD1 . TYR A  1 169 ? 72.932 0.883   54.301 1.00 16.17 ? 340 TYR A CD1 1 
ATOM   1182 C CD2 . TYR A  1 169 ? 75.135 0.056   54.258 1.00 14.06 ? 340 TYR A CD2 1 
ATOM   1183 C CE1 . TYR A  1 169 ? 73.265 1.757   55.327 1.00 18.55 ? 340 TYR A CE1 1 
ATOM   1184 C CE2 . TYR A  1 169 ? 75.459 0.881   55.307 1.00 16.68 ? 340 TYR A CE2 1 
ATOM   1185 C CZ  . TYR A  1 169 ? 74.552 1.753   55.813 1.00 16.99 ? 340 TYR A CZ  1 
ATOM   1186 O OH  . TYR A  1 169 ? 74.918 2.593   56.836 1.00 22.87 ? 340 TYR A OH  1 
ATOM   1187 N N   . PRO A  1 170 ? 75.276 1.633   51.023 1.00 15.83 ? 341 PRO A N   1 
ATOM   1188 C CA  . PRO A  1 170 ? 74.536 2.706   51.716 1.00 13.38 ? 341 PRO A CA  1 
ATOM   1189 C C   . PRO A  1 170 ? 73.684 3.612   50.805 1.00 12.69 ? 341 PRO A C   1 
ATOM   1190 O O   . PRO A  1 170 ? 73.307 4.692   51.210 1.00 16.41 ? 341 PRO A O   1 
ATOM   1191 C CB  . PRO A  1 170 ? 75.668 3.508   52.326 1.00 16.21 ? 341 PRO A CB  1 
ATOM   1192 C CG  . PRO A  1 170 ? 76.729 3.438   51.257 1.00 17.70 ? 341 PRO A CG  1 
ATOM   1193 C CD  . PRO A  1 170 ? 76.667 2.030   50.716 1.00 17.21 ? 341 PRO A CD  1 
ATOM   1194 N N   . ASN A  1 171 ? 73.404 3.153   49.575 1.00 14.03 ? 342 ASN A N   1 
ATOM   1195 C CA  . ASN A  1 171 ? 72.555 3.924   48.656 1.00 15.47 ? 342 ASN A CA  1 
ATOM   1196 C C   . ASN A  1 171 ? 71.091 3.694   49.056 1.00 14.84 ? 342 ASN A C   1 
ATOM   1197 O O   . ASN A  1 171 ? 70.558 2.623   48.847 1.00 19.39 ? 342 ASN A O   1 
ATOM   1198 C CB  . ASN A  1 171 ? 72.787 3.479   47.222 1.00 17.57 ? 342 ASN A CB  1 
ATOM   1199 C CG  . ASN A  1 171 ? 72.105 4.356   46.184 1.00 24.40 ? 342 ASN A CG  1 
ATOM   1200 O OD1 . ASN A  1 171 ? 71.232 5.114   46.463 1.00 28.67 ? 342 ASN A OD1 1 
ATOM   1201 N ND2 . ASN A  1 171 ? 72.550 4.216   44.940 1.00 38.49 ? 342 ASN A ND2 1 
ATOM   1202 N N   . ARG A  1 172 ? 70.549 4.676   49.767 1.00 13.58 ? 343 ARG A N   1 
ATOM   1203 C CA  . ARG A  1 172 ? 69.210 4.634   50.335 1.00 12.51 ? 343 ARG A CA  1 
ATOM   1204 C C   . ARG A  1 172 ? 68.345 5.829   49.921 1.00 14.59 ? 343 ARG A C   1 
ATOM   1205 O O   . ARG A  1 172 ? 68.220 6.805   50.626 1.00 14.25 ? 343 ARG A O   1 
ATOM   1206 C CB  . ARG A  1 172 ? 69.235 4.539   51.875 1.00 12.21 ? 343 ARG A CB  1 
ATOM   1207 C CG  . ARG A  1 172 ? 69.913 3.283   52.395 1.00 12.58 ? 343 ARG A CG  1 
ATOM   1208 C CD  . ARG A  1 172 ? 69.680 3.069   53.877 1.00 12.11 ? 343 ARG A CD  1 
ATOM   1209 N NE  . ARG A  1 172 ? 70.218 4.176   54.672 1.00 12.56 ? 343 ARG A NE  1 
ATOM   1210 C CZ  . ARG A  1 172 ? 69.875 4.408   55.925 1.00 12.57 ? 343 ARG A CZ  1 
ATOM   1211 N NH1 . ARG A  1 172 ? 69.066 3.591   56.546 1.00 14.16 ? 343 ARG A NH1 1 
ATOM   1212 N NH2 . ARG A  1 172 ? 70.340 5.494   56.538 1.00 15.33 ? 343 ARG A NH2 1 
ATOM   1213 N N   . PRO A  1 173 ? 67.734 5.736   48.778 1.00 17.63 ? 344 PRO A N   1 
ATOM   1214 C CA  . PRO A  1 173 ? 66.799 6.801   48.407 1.00 15.43 ? 344 PRO A CA  1 
ATOM   1215 C C   . PRO A  1 173 ? 65.641 6.876   49.396 1.00 13.63 ? 344 PRO A C   1 
ATOM   1216 O O   . PRO A  1 173 ? 65.073 5.842   49.743 1.00 16.09 ? 344 PRO A O   1 
ATOM   1217 C CB  . PRO A  1 173 ? 66.294 6.342   47.018 1.00 19.61 ? 344 PRO A CB  1 
ATOM   1218 C CG  . PRO A  1 173 ? 67.303 5.364   46.509 1.00 22.40 ? 344 PRO A CG  1 
ATOM   1219 C CD  . PRO A  1 173 ? 67.894 4.714   47.738 1.00 17.59 ? 344 PRO A CD  1 
ATOM   1220 N N   . MET A  1 174 ? 65.325 8.062   49.860 1.00 15.26 ? 345 MET A N   1 
ATOM   1221 C CA  . MET A  1 174 ? 64.256 8.277   50.819 1.00 14.84 ? 345 MET A CA  1 
ATOM   1222 C C   . MET A  1 174 ? 63.462 9.516   50.394 1.00 16.85 ? 345 MET A C   1 
ATOM   1223 O O   . MET A  1 174 ? 63.983 10.443  49.747 1.00 22.51 ? 345 MET A O   1 
ATOM   1224 C CB  . MET A  1 174 ? 64.768 8.469   52.272 1.00 14.94 ? 345 MET A CB  1 
ATOM   1225 C CG  . MET A  1 174 ? 65.540 7.274   52.804 1.00 13.31 ? 345 MET A CG  1 
ATOM   1226 S SD  . MET A  1 174 ? 65.881 7.498   54.539 1.00 15.39 ? 345 MET A SD  1 
ATOM   1227 C CE  . MET A  1 174 ? 67.261 6.381   54.699 1.00 14.24 ? 345 MET A CE  1 
ATOM   1228 N N   . VAL A  1 175 ? 62.211 9.558   50.836 1.00 15.96 ? 346 VAL A N   1 
ATOM   1229 C CA  A VAL A  1 175 ? 61.459 10.786  50.605 0.30 15.59 ? 346 VAL A CA  1 
ATOM   1230 C CA  B VAL A  1 175 ? 61.361 10.742  50.643 0.70 16.49 ? 346 VAL A CA  1 
ATOM   1231 C C   . VAL A  1 175 ? 61.440 11.680  51.832 1.00 15.58 ? 346 VAL A C   1 
ATOM   1232 O O   . VAL A  1 175 ? 61.381 11.220  52.992 1.00 16.03 ? 346 VAL A O   1 
ATOM   1233 C CB  A VAL A  1 175 ? 60.081 10.564  49.978 0.30 15.42 ? 346 VAL A CB  1 
ATOM   1234 C CB  B VAL A  1 175 ? 59.891 10.383  50.330 0.70 19.72 ? 346 VAL A CB  1 
ATOM   1235 C CG1 A VAL A  1 175 ? 60.253 10.122  48.545 0.30 16.34 ? 346 VAL A CG1 1 
ATOM   1236 C CG1 B VAL A  1 175 ? 59.246 9.556   51.412 0.70 17.83 ? 346 VAL A CG1 1 
ATOM   1237 C CG2 A VAL A  1 175 ? 59.281 9.530   50.740 0.30 15.68 ? 346 VAL A CG2 1 
ATOM   1238 C CG2 B VAL A  1 175 ? 59.060 11.632  50.132 0.70 20.04 ? 346 VAL A CG2 1 
ATOM   1239 N N   . LEU A  1 176 ? 61.578 12.977  51.547 1.00 17.36 ? 347 LEU A N   1 
ATOM   1240 C CA  . LEU A  1 176 ? 61.492 13.990  52.545 1.00 16.84 ? 347 LEU A CA  1 
ATOM   1241 C C   . LEU A  1 176 ? 60.023 14.287  52.778 1.00 15.29 ? 347 LEU A C   1 
ATOM   1242 O O   . LEU A  1 176 ? 59.346 14.837  51.900 1.00 19.60 ? 347 LEU A O   1 
ATOM   1243 C CB  . LEU A  1 176 ? 62.213 15.256  52.107 1.00 20.60 ? 347 LEU A CB  1 
ATOM   1244 C CG  . LEU A  1 176 ? 62.562 16.272  53.225 1.00 28.38 ? 347 LEU A CG  1 
ATOM   1245 C CD1 . LEU A  1 176 ? 61.418 16.971  53.944 1.00 31.43 ? 347 LEU A CD1 1 
ATOM   1246 C CD2 . LEU A  1 176 ? 63.431 15.616  54.276 1.00 31.84 ? 347 LEU A CD2 1 
ATOM   1247 N N   . LEU A  1 177 ? 59.575 13.971  53.972 1.00 15.38 ? 348 LEU A N   1 
ATOM   1248 C CA  . LEU A  1 177 ? 58.199 14.234  54.407 1.00 15.06 ? 348 LEU A CA  1 
ATOM   1249 C C   . LEU A  1 177 ? 58.184 15.144  55.601 1.00 17.63 ? 348 LEU A C   1 
ATOM   1250 O O   . LEU A  1 177 ? 59.102 15.101  56.405 1.00 17.67 ? 348 LEU A O   1 
ATOM   1251 C CB  . LEU A  1 177 ? 57.535 12.909  54.758 1.00 15.08 ? 348 LEU A CB  1 
ATOM   1252 C CG  . LEU A  1 177 ? 57.374 11.936  53.608 1.00 15.62 ? 348 LEU A CG  1 
ATOM   1253 C CD1 . LEU A  1 177 ? 57.022 10.536  54.110 1.00 15.91 ? 348 LEU A CD1 1 
ATOM   1254 C CD2 . LEU A  1 177 ? 56.307 12.445  52.620 1.00 17.04 ? 348 LEU A CD2 1 
ATOM   1255 N N   . LYS A  1 178 ? 57.118 15.941  55.714 1.00 17.17 ? 349 LYS A N   1 
ATOM   1256 C CA  . LYS A  1 178 ? 56.925 16.879  56.796 1.00 18.15 ? 349 LYS A CA  1 
ATOM   1257 C C   . LYS A  1 178 ? 55.644 16.526  57.572 1.00 16.39 ? 349 LYS A C   1 
ATOM   1258 O O   . LYS A  1 178 ? 54.676 16.062  56.978 1.00 17.15 ? 349 LYS A O   1 
ATOM   1259 C CB  . LYS A  1 178 ? 56.849 18.342  56.214 1.00 18.37 ? 349 LYS A CB  1 
ATOM   1260 C CG  . LYS A  1 178 ? 58.142 18.829  55.564 1.00 25.81 ? 349 LYS A CG  1 
ATOM   1261 C CD  . LYS A  1 178 ? 58.191 20.310  55.209 1.00 35.37 ? 349 LYS A CD  1 
ATOM   1262 N N   . SER A  1 179 ? 55.663 16.723  58.907 1.00 17.61 ? 350 SER A N   1 
ATOM   1263 C CA  A SER A  1 179 ? 54.496 16.609  59.737 0.70 17.64 ? 350 SER A CA  1 
ATOM   1264 C CA  B SER A  1 179 ? 54.466 16.537  59.699 0.30 17.68 ? 350 SER A CA  1 
ATOM   1265 C C   . SER A  1 179 ? 53.334 17.394  59.117 1.00 17.12 ? 350 SER A C   1 
ATOM   1266 O O   . SER A  1 179 ? 53.513 18.569  58.742 1.00 18.82 ? 350 SER A O   1 
ATOM   1267 C CB  A SER A  1 179 ? 54.823 17.119  61.151 0.70 27.41 ? 350 SER A CB  1 
ATOM   1268 C CB  B SER A  1 179 ? 54.695 16.794  61.202 0.30 19.57 ? 350 SER A CB  1 
ATOM   1269 O OG  A SER A  1 179 ? 53.696 17.016  61.982 0.70 37.31 ? 350 SER A OG  1 
ATOM   1270 O OG  B SER A  1 179 ? 55.055 18.131  61.455 0.30 20.17 ? 350 SER A OG  1 
ATOM   1271 N N   . GLY A  1 180 ? 52.167 16.762  59.005 1.00 17.39 ? 351 GLY A N   1 
ATOM   1272 C CA  . GLY A  1 180 ? 50.960 17.359  58.428 1.00 17.35 ? 351 GLY A CA  1 
ATOM   1273 C C   . GLY A  1 180 ? 50.747 17.091  56.931 1.00 17.65 ? 351 GLY A C   1 
ATOM   1274 O O   . GLY A  1 180 ? 49.660 17.325  56.427 1.00 18.61 ? 351 GLY A O   1 
ATOM   1275 N N   . GLN A  1 181 ? 51.791 16.626  56.247 1.00 15.89 ? 352 GLN A N   1 
ATOM   1276 C CA  . GLN A  1 181 ? 51.710 16.303  54.828 1.00 13.34 ? 352 GLN A CA  1 
ATOM   1277 C C   . GLN A  1 181 ? 50.752 15.158  54.594 1.00 13.34 ? 352 GLN A C   1 
ATOM   1278 O O   . GLN A  1 181 ? 50.721 14.178  55.360 1.00 15.42 ? 352 GLN A O   1 
ATOM   1279 C CB  . GLN A  1 181 ? 53.081 15.945  54.277 1.00 14.44 ? 352 GLN A CB  1 
ATOM   1280 C CG  . GLN A  1 181 ? 53.164 15.841  52.801 1.00 15.55 ? 352 GLN A CG  1 
ATOM   1281 C CD  . GLN A  1 181 ? 54.610 15.764  52.300 1.00 16.37 ? 352 GLN A CD  1 
ATOM   1282 O OE1 . GLN A  1 181 ? 55.638 16.006  53.060 1.00 18.53 ? 352 GLN A OE1 1 
ATOM   1283 N NE2 . GLN A  1 181 ? 54.739 15.487  51.001 1.00 18.02 ? 352 GLN A NE2 1 
ATOM   1284 N N   . LEU A  1 182 ? 49.993 15.271  53.505 1.00 13.71 ? 353 LEU A N   1 
ATOM   1285 C CA  . LEU A  1 182 ? 49.043 14.248  53.084 1.00 15.13 ? 353 LEU A CA  1 
ATOM   1286 C C   . LEU A  1 182 ? 49.604 13.472  51.909 1.00 14.18 ? 353 LEU A C   1 
ATOM   1287 O O   . LEU A  1 182 ? 50.030 14.063  50.898 1.00 15.19 ? 353 LEU A O   1 
ATOM   1288 C CB  . LEU A  1 182 ? 47.703 14.892  52.700 1.00 17.65 ? 353 LEU A CB  1 
ATOM   1289 C CG  . LEU A  1 182 ? 47.033 15.689  53.823 1.00 18.48 ? 353 LEU A CG  1 
ATOM   1290 C CD1 . LEU A  1 182 ? 45.827 16.472  53.280 1.00 19.97 ? 353 LEU A CD1 1 
ATOM   1291 C CD2 . LEU A  1 182 ? 46.556 14.771  54.954 1.00 18.25 ? 353 LEU A CD2 1 
ATOM   1292 N N   . ILE A  1 183 ? 49.601 12.143  52.032 1.00 13.15 ? 354 ILE A N   1 
ATOM   1293 C CA  . ILE A  1 183 ? 50.048 11.264  50.988 1.00 13.13 ? 354 ILE A CA  1 
ATOM   1294 C C   . ILE A  1 183 ? 49.166 10.017  50.951 1.00 12.97 ? 354 ILE A C   1 
ATOM   1295 O O   . ILE A  1 183 ? 48.469 9.739   51.935 1.00 15.29 ? 354 ILE A O   1 
ATOM   1296 C CB  . ILE A  1 183 ? 51.515 10.836  51.174 1.00 14.17 ? 354 ILE A CB  1 
ATOM   1297 C CG1 . ILE A  1 183 ? 51.754 9.968   52.418 1.00 13.86 ? 354 ILE A CG1 1 
ATOM   1298 C CG2 . ILE A  1 183 ? 52.454 12.046  51.121 1.00 16.15 ? 354 ILE A CG2 1 
ATOM   1299 C CD1 . ILE A  1 183 ? 53.147 9.359   52.471 1.00 15.03 ? 354 ILE A CD1 1 
ATOM   1300 N N   . LYS A  1 184 ? 49.268 9.236   49.870 1.00 13.45 ? 355 LYS A N   1 
ATOM   1301 C CA  . LYS A  1 184 ? 48.720 7.887   49.861 1.00 14.06 ? 355 LYS A CA  1 
ATOM   1302 C C   . LYS A  1 184 ? 49.798 6.912   50.370 1.00 13.37 ? 355 LYS A C   1 
ATOM   1303 O O   . LYS A  1 184 ? 50.983 7.006   50.007 1.00 13.16 ? 355 LYS A O   1 
ATOM   1304 C CB  . LYS A  1 184 ? 48.290 7.485   48.472 1.00 16.08 ? 355 LYS A CB  1 
ATOM   1305 C CG  A LYS A  1 184 ? 47.138 8.329   47.897 0.70 21.54 ? 355 LYS A CG  1 
ATOM   1306 C CG  B LYS A  1 184 ? 47.152 8.303   47.884 0.30 16.82 ? 355 LYS A CG  1 
ATOM   1307 C CD  A LYS A  1 184 ? 46.492 7.656   46.687 0.70 25.87 ? 355 LYS A CD  1 
ATOM   1308 C CD  B LYS A  1 184 ? 45.828 7.877   48.476 0.30 14.93 ? 355 LYS A CD  1 
ATOM   1309 C CE  A LYS A  1 184 ? 45.494 8.558   45.936 0.70 33.39 ? 355 LYS A CE  1 
ATOM   1310 C CE  B LYS A  1 184 ? 44.675 8.657   47.881 0.30 16.33 ? 355 LYS A CE  1 
ATOM   1311 N NZ  A LYS A  1 184 ? 44.556 9.212   46.870 0.70 35.78 ? 355 LYS A NZ  1 
ATOM   1312 N NZ  B LYS A  1 184 ? 44.498 8.311   46.448 0.30 17.03 ? 355 LYS A NZ  1 
ATOM   1313 N N   . THR A  1 185 ? 49.383 5.980   51.209 1.00 13.12 ? 356 THR A N   1 
ATOM   1314 C CA  . THR A  1 185 ? 50.247 4.931   51.729 1.00 13.16 ? 356 THR A CA  1 
ATOM   1315 C C   . THR A  1 185 ? 49.565 3.556   51.450 1.00 13.41 ? 356 THR A C   1 
ATOM   1316 O O   . THR A  1 185 ? 48.355 3.381   51.667 1.00 15.28 ? 356 THR A O   1 
ATOM   1317 C CB  . THR A  1 185 ? 50.514 5.123   53.217 1.00 13.76 ? 356 THR A CB  1 
ATOM   1318 O OG1 . THR A  1 185 ? 51.147 6.384   53.428 1.00 15.09 ? 356 THR A OG1 1 
ATOM   1319 C CG2 . THR A  1 185 ? 51.422 4.009   53.777 1.00 17.34 ? 356 THR A CG2 1 
ATOM   1320 N N   . GLU A  1 186 ? 50.325 2.634   50.925 1.00 14.21 ? 357 GLU A N   1 
ATOM   1321 C CA  . GLU A  1 186 ? 49.834 1.304   50.652 1.00 13.13 ? 357 GLU A CA  1 
ATOM   1322 C C   . GLU A  1 186 ? 49.727 0.466   51.911 1.00 15.16 ? 357 GLU A C   1 
ATOM   1323 O O   . GLU A  1 186 ? 50.594 0.524   52.783 1.00 16.34 ? 357 GLU A O   1 
ATOM   1324 C CB  . GLU A  1 186 ? 50.740 0.627   49.644 1.00 13.61 ? 357 GLU A CB  1 
ATOM   1325 C CG  . GLU A  1 186 ? 50.228 -0.698  49.072 1.00 16.44 ? 357 GLU A CG  1 
ATOM   1326 C CD  . GLU A  1 186 ? 50.571 -1.926  49.897 1.00 16.89 ? 357 GLU A CD  1 
ATOM   1327 O OE1 . GLU A  1 186 ? 51.327 -1.822  50.897 1.00 15.44 ? 357 GLU A OE1 1 
ATOM   1328 O OE2 . GLU A  1 186 ? 50.130 -3.050  49.479 1.00 17.45 ? 357 GLU A OE2 1 
ATOM   1329 N N   . TRP A  1 187 ? 48.671 -0.379  51.943 1.00 16.54 ? 358 TRP A N   1 
ATOM   1330 C CA  . TRP A  1 187 ? 48.525 -1.402  52.968 1.00 19.75 ? 358 TRP A CA  1 
ATOM   1331 C C   . TRP A  1 187 ? 47.555 -2.481  52.451 1.00 24.02 ? 358 TRP A C   1 
ATOM   1332 O O   . TRP A  1 187 ? 46.448 -2.145  51.944 1.00 23.98 ? 358 TRP A O   1 
ATOM   1333 C CB  . TRP A  1 187 ? 48.064 -0.760  54.291 1.00 22.28 ? 358 TRP A CB  1 
ATOM   1334 C CG  . TRP A  1 187 ? 47.921 -1.737  55.454 1.00 25.63 ? 358 TRP A CG  1 
ATOM   1335 C CD1 . TRP A  1 187 ? 48.886 -2.113  56.341 1.00 26.70 ? 358 TRP A CD1 1 
ATOM   1336 C CD2 . TRP A  1 187 ? 46.724 -2.380  55.872 1.00 28.81 ? 358 TRP A CD2 1 
ATOM   1337 N NE1 . TRP A  1 187 ? 48.377 -2.979  57.246 1.00 27.46 ? 358 TRP A NE1 1 
ATOM   1338 C CE2 . TRP A  1 187 ? 47.041 -3.147  56.998 1.00 26.62 ? 358 TRP A CE2 1 
ATOM   1339 C CE3 . TRP A  1 187 ? 45.397 -2.378  55.398 1.00 31.23 ? 358 TRP A CE3 1 
ATOM   1340 C CZ2 . TRP A  1 187 ? 46.095 -3.941  57.651 1.00 29.22 ? 358 TRP A CZ2 1 
ATOM   1341 C CZ3 . TRP A  1 187 ? 44.454 -3.141  56.075 1.00 33.10 ? 358 TRP A CZ3 1 
ATOM   1342 C CH2 . TRP A  1 187 ? 44.808 -3.915  57.184 1.00 27.35 ? 358 TRP A CH2 1 
ATOM   1343 N N   . GLU A  1 188 ? 47.984 -3.746  52.495 1.00 26.18 ? 359 GLU A N   1 
ATOM   1344 C CA  . GLU A  1 188 ? 47.173 -4.890  51.949 1.00 29.54 ? 359 GLU A CA  1 
ATOM   1345 C C   . GLU A  1 188 ? 46.693 -4.696  50.531 1.00 26.94 ? 359 GLU A C   1 
ATOM   1346 O O   . GLU A  1 188 ? 45.548 -5.047  50.228 1.00 36.27 ? 359 GLU A O   1 
ATOM   1347 C CB  . GLU A  1 188 ? 45.899 -5.166  52.772 1.00 38.38 ? 359 GLU A CB  1 
ATOM   1348 C CG  . GLU A  1 188 ? 46.074 -5.703  54.146 1.00 41.94 ? 359 GLU A CG  1 
ATOM   1349 C CD  . GLU A  1 188 ? 44.752 -6.309  54.722 1.00 41.00 ? 359 GLU A CD  1 
ATOM   1350 O OE1 . GLU A  1 188 ? 43.575 -6.067  54.223 1.00 37.11 ? 359 GLU A OE1 1 
ATOM   1351 O OE2 . GLU A  1 188 ? 44.905 -7.048  55.703 1.00 43.46 ? 359 GLU A OE2 1 
ATOM   1352 N N   . GLY A  1 189 ? 47.480 -4.115  49.646 1.00 20.87 ? 360 GLY A N   1 
ATOM   1353 C CA  . GLY A  1 189 ? 47.007 -3.965  48.250 1.00 21.40 ? 360 GLY A CA  1 
ATOM   1354 C C   . GLY A  1 189 ? 46.190 -2.756  47.905 1.00 21.50 ? 360 GLY A C   1 
ATOM   1355 O O   . GLY A  1 189 ? 45.861 -2.552  46.729 1.00 31.46 ? 360 GLY A O   1 
ATOM   1356 N N   . THR A  1 190 ? 45.826 -1.970  48.904 1.00 22.97 ? 361 THR A N   1 
ATOM   1357 C CA  . THR A  1 190 ? 45.073 -0.750  48.692 1.00 23.02 ? 361 THR A CA  1 
ATOM   1358 C C   . THR A  1 190 ? 45.947 0.435   49.012 1.00 21.53 ? 361 THR A C   1 
ATOM   1359 O O   . THR A  1 190 ? 46.779 0.370   49.928 1.00 20.02 ? 361 THR A O   1 
ATOM   1360 C CB  . THR A  1 190 ? 43.783 -0.747  49.579 1.00 25.83 ? 361 THR A CB  1 
ATOM   1361 O OG1 . THR A  1 190 ? 42.890 -1.758  49.139 1.00 29.30 ? 361 THR A OG1 1 
ATOM   1362 C CG2 . THR A  1 190 ? 43.052 0.593   49.541 1.00 28.58 ? 361 THR A CG2 1 
ATOM   1363 N N   . TRP A  1 191 ? 45.750 1.521   48.258 1.00 18.50 ? 362 TRP A N   1 
ATOM   1364 C CA  . TRP A  1 191 ? 46.411 2.803   48.538 1.00 17.60 ? 362 TRP A CA  1 
ATOM   1365 C C   . TRP A  1 191 ? 45.471 3.689   49.275 1.00 17.54 ? 362 TRP A C   1 
ATOM   1366 O O   . TRP A  1 191 ? 44.381 4.033   48.754 1.00 20.47 ? 362 TRP A O   1 
ATOM   1367 C CB  . TRP A  1 191 ? 46.905 3.441   47.240 1.00 17.57 ? 362 TRP A CB  1 
ATOM   1368 C CG  . TRP A  1 191 ? 48.000 2.650   46.640 1.00 16.02 ? 362 TRP A CG  1 
ATOM   1369 C CD1 . TRP A  1 191 ? 47.886 1.531   45.860 1.00 17.69 ? 362 TRP A CD1 1 
ATOM   1370 C CD2 . TRP A  1 191 ? 49.398 2.812   46.890 1.00 15.17 ? 362 TRP A CD2 1 
ATOM   1371 N NE1 . TRP A  1 191 ? 49.114 1.041   45.565 1.00 17.80 ? 362 TRP A NE1 1 
ATOM   1372 C CE2 . TRP A  1 191 ? 50.061 1.815   46.177 1.00 15.56 ? 362 TRP A CE2 1 
ATOM   1373 C CE3 . TRP A  1 191 ? 50.148 3.751   47.611 1.00 14.33 ? 362 TRP A CE3 1 
ATOM   1374 C CZ2 . TRP A  1 191 ? 51.434 1.711   46.160 1.00 16.93 ? 362 TRP A CZ2 1 
ATOM   1375 C CZ3 . TRP A  1 191 ? 51.511 3.641   47.573 1.00 14.74 ? 362 TRP A CZ3 1 
ATOM   1376 C CH2 . TRP A  1 191 ? 52.127 2.638   46.877 1.00 17.23 ? 362 TRP A CH2 1 
ATOM   1377 N N   . TRP A  1 192 ? 45.838 4.028   50.496 1.00 15.47 ? 363 TRP A N   1 
ATOM   1378 C CA  . TRP A  1 192 ? 44.970 4.718   51.453 1.00 16.72 ? 363 TRP A CA  1 
ATOM   1379 C C   . TRP A  1 192 ? 45.346 6.160   51.642 1.00 16.15 ? 363 TRP A C   1 
ATOM   1380 O O   . TRP A  1 192 ? 46.540 6.495   51.737 1.00 15.74 ? 363 TRP A O   1 
ATOM   1381 C CB  . TRP A  1 192 ? 45.065 4.042   52.828 1.00 17.23 ? 363 TRP A CB  1 
ATOM   1382 C CG  . TRP A  1 192 ? 44.762 2.557   52.829 1.00 19.89 ? 363 TRP A CG  1 
ATOM   1383 C CD1 . TRP A  1 192 ? 45.625 1.554   52.542 1.00 21.14 ? 363 TRP A CD1 1 
ATOM   1384 C CD2 . TRP A  1 192 ? 43.495 1.950   53.061 1.00 18.65 ? 363 TRP A CD2 1 
ATOM   1385 N NE1 . TRP A  1 192 ? 44.986 0.323   52.620 1.00 19.63 ? 363 TRP A NE1 1 
ATOM   1386 C CE2 . TRP A  1 192 ? 43.668 0.547   52.939 1.00 20.38 ? 363 TRP A CE2 1 
ATOM   1387 C CE3 . TRP A  1 192 ? 42.238 2.451   53.426 1.00 20.58 ? 363 TRP A CE3 1 
ATOM   1388 C CZ2 . TRP A  1 192 ? 42.646 -0.344  53.136 1.00 21.42 ? 363 TRP A CZ2 1 
ATOM   1389 C CZ3 . TRP A  1 192 ? 41.207 1.554   53.596 1.00 20.45 ? 363 TRP A CZ3 1 
ATOM   1390 C CH2 . TRP A  1 192 ? 41.405 0.170   53.437 1.00 22.34 ? 363 TRP A CH2 1 
ATOM   1391 N N   . LYS A  1 193 ? 44.345 7.033   51.769 1.00 16.73 ? 364 LYS A N   1 
ATOM   1392 C CA  . LYS A  1 193 ? 44.575 8.390   52.217 1.00 15.43 ? 364 LYS A CA  1 
ATOM   1393 C C   . LYS A  1 193 ? 45.231 8.357   53.607 1.00 15.03 ? 364 LYS A C   1 
ATOM   1394 O O   . LYS A  1 193 ? 44.791 7.682   54.493 1.00 17.58 ? 364 LYS A O   1 
ATOM   1395 C CB  . LYS A  1 193 ? 43.264 9.179   52.242 1.00 17.80 ? 364 LYS A CB  1 
ATOM   1396 C CG  . LYS A  1 193 ? 42.724 9.456   50.848 1.00 20.92 ? 364 LYS A CG  1 
ATOM   1397 C CD  . LYS A  1 193 ? 41.465 10.328  50.865 1.00 27.27 ? 364 LYS A CD  1 
ATOM   1398 C CE  . LYS A  1 193 ? 40.914 10.586  49.442 1.00 39.31 ? 364 LYS A CE  1 
ATOM   1399 N N   . SER A  1 194 ? 46.305 9.122   53.770 1.00 15.01 ? 365 SER A N   1 
ATOM   1400 C CA  . SER A  1 194 ? 47.083 9.105   54.987 1.00 13.94 ? 365 SER A CA  1 
ATOM   1401 C C   . SER A  1 194 ? 47.752 10.449  55.253 1.00 14.29 ? 365 SER A C   1 
ATOM   1402 O O   . SER A  1 194 ? 47.773 11.375  54.397 1.00 14.66 ? 365 SER A O   1 
ATOM   1403 C CB  . SER A  1 194 ? 48.100 7.989   54.936 1.00 15.25 ? 365 SER A CB  1 
ATOM   1404 O OG  . SER A  1 194 ? 49.185 8.255   54.098 1.00 15.70 ? 365 SER A OG  1 
ATOM   1405 N N   . ARG A  1 195 ? 48.225 10.614  56.482 1.00 14.01 ? 366 ARG A N   1 
ATOM   1406 C CA  . ARG A  1 195 ? 48.826 11.838  56.931 1.00 14.44 ? 366 ARG A CA  1 
ATOM   1407 C C   . ARG A  1 195 ? 50.131 11.531  57.675 1.00 15.53 ? 366 ARG A C   1 
ATOM   1408 O O   . ARG A  1 195 ? 50.209 10.569  58.452 1.00 16.25 ? 366 ARG A O   1 
ATOM   1409 C CB  . ARG A  1 195 ? 47.871 12.618  57.840 1.00 17.75 ? 366 ARG A CB  1 
ATOM   1410 C CG  . ARG A  1 195 ? 48.352 14.007  58.213 1.00 17.87 ? 366 ARG A CG  1 
ATOM   1411 C CD  . ARG A  1 195 ? 47.277 14.795  58.962 1.00 18.97 ? 366 ARG A CD  1 
ATOM   1412 N NE  . ARG A  1 195 ? 47.128 14.281  60.308 1.00 21.79 ? 366 ARG A NE  1 
ATOM   1413 C CZ  . ARG A  1 195 ? 46.131 14.555  61.123 1.00 28.34 ? 366 ARG A CZ  1 
ATOM   1414 N NH1 . ARG A  1 195 ? 45.143 15.358  60.748 1.00 37.08 ? 366 ARG A NH1 1 
ATOM   1415 N NH2 . ARG A  1 195 ? 46.132 14.022  62.350 1.00 29.40 ? 366 ARG A NH2 1 
ATOM   1416 N N   . VAL A  1 196 ? 51.152 12.377  57.444 1.00 15.06 ? 367 VAL A N   1 
ATOM   1417 C CA  . VAL A  1 196 ? 52.400 12.254  58.143 1.00 13.68 ? 367 VAL A CA  1 
ATOM   1418 C C   . VAL A  1 196 ? 52.273 12.901  59.532 1.00 13.61 ? 367 VAL A C   1 
ATOM   1419 O O   . VAL A  1 196 ? 52.057 14.114  59.648 1.00 17.02 ? 367 VAL A O   1 
ATOM   1420 C CB  . VAL A  1 196 ? 53.542 12.938  57.360 1.00 14.22 ? 367 VAL A CB  1 
ATOM   1421 C CG1 . VAL A  1 196 ? 54.832 12.911  58.163 1.00 15.35 ? 367 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A  1 196 ? 53.690 12.320  56.001 1.00 14.74 ? 367 VAL A CG2 1 
ATOM   1423 N N   . GLU A  1 197 ? 52.405 12.078  60.584 1.00 16.15 ? 368 GLU A N   1 
ATOM   1424 C CA  . GLU A  1 197 ? 52.232 12.582  61.940 1.00 17.80 ? 368 GLU A CA  1 
ATOM   1425 C C   . GLU A  1 197 ? 53.539 13.035  62.551 1.00 16.95 ? 368 GLU A C   1 
ATOM   1426 O O   . GLU A  1 197 ? 53.545 13.919  63.387 1.00 21.67 ? 368 GLU A O   1 
ATOM   1427 C CB  . GLU A  1 197 ? 51.583 11.527  62.842 1.00 18.54 ? 368 GLU A CB  1 
ATOM   1428 C CG  . GLU A  1 197 ? 50.254 11.032  62.379 1.00 20.66 ? 368 GLU A CG  1 
ATOM   1429 C CD  . GLU A  1 197 ? 49.249 12.155  62.277 1.00 22.67 ? 368 GLU A CD  1 
ATOM   1430 O OE1 . GLU A  1 197 ? 48.536 12.401  63.286 1.00 25.92 ? 368 GLU A OE1 1 
ATOM   1431 O OE2 . GLU A  1 197 ? 49.233 12.829  61.206 1.00 23.19 ? 368 GLU A OE2 1 
ATOM   1432 N N   . GLU A  1 198 ? 54.634 12.398  62.159 1.00 17.93 ? 369 GLU A N   1 
ATOM   1433 C CA  . GLU A  1 198 ? 55.926 12.532  62.867 1.00 19.05 ? 369 GLU A CA  1 
ATOM   1434 C C   . GLU A  1 198 ? 57.018 11.936  62.013 1.00 16.59 ? 369 GLU A C   1 
ATOM   1435 O O   . GLU A  1 198 ? 56.794 10.911  61.356 1.00 17.67 ? 369 GLU A O   1 
ATOM   1436 C CB  . GLU A  1 198 ? 55.858 11.742  64.221 1.00 21.60 ? 369 GLU A CB  1 
ATOM   1437 C CG  . GLU A  1 198 ? 56.980 12.038  65.188 1.00 25.30 ? 369 GLU A CG  1 
ATOM   1438 C CD  . GLU A  1 198 ? 56.878 11.204  66.466 1.00 25.36 ? 369 GLU A CD  1 
ATOM   1439 O OE1 . GLU A  1 198 ? 55.812 10.568  66.748 1.00 23.99 ? 369 GLU A OE1 1 
ATOM   1440 O OE2 . GLU A  1 198 ? 57.868 11.185  67.184 1.00 31.86 ? 369 GLU A OE2 1 
ATOM   1441 N N   . VAL A  1 199 ? 58.205 12.522  62.048 1.00 16.80 ? 370 VAL A N   1 
ATOM   1442 C CA  . VAL A  1 199 ? 59.391 11.957  61.420 1.00 16.37 ? 370 VAL A CA  1 
ATOM   1443 C C   . VAL A  1 199 ? 60.390 11.643  62.539 1.00 15.76 ? 370 VAL A C   1 
ATOM   1444 O O   . VAL A  1 199 ? 60.617 12.452  63.432 1.00 19.05 ? 370 VAL A O   1 
ATOM   1445 C CB  . VAL A  1 199 ? 59.978 12.919  60.403 1.00 20.08 ? 370 VAL A CB  1 
ATOM   1446 C CG1 . VAL A  1 199 ? 61.276 12.397  59.833 1.00 22.55 ? 370 VAL A CG1 1 
ATOM   1447 C CG2 . VAL A  1 199 ? 58.961 13.157  59.287 1.00 23.92 ? 370 VAL A CG2 1 
ATOM   1448 N N   . ASP A  1 200 ? 60.973 10.463  62.473 1.00 15.91 ? 371 ASP A N   1 
ATOM   1449 C CA  . ASP A  1 200 ? 61.997 10.041  63.425 1.00 15.25 ? 371 ASP A CA  1 
ATOM   1450 C C   . ASP A  1 200 ? 63.110 9.326   62.663 1.00 14.54 ? 371 ASP A C   1 
ATOM   1451 O O   . ASP A  1 200 ? 62.973 8.162   62.317 1.00 14.12 ? 371 ASP A O   1 
ATOM   1452 C CB  . ASP A  1 200 ? 61.395 9.118   64.490 1.00 17.12 ? 371 ASP A CB  1 
ATOM   1453 C CG  . ASP A  1 200 ? 62.364 8.756   65.576 1.00 22.69 ? 371 ASP A CG  1 
ATOM   1454 O OD1 . ASP A  1 200 ? 63.359 9.432   65.733 1.00 24.48 ? 371 ASP A OD1 1 
ATOM   1455 O OD2 . ASP A  1 200 ? 62.120 7.769   66.276 1.00 21.73 ? 371 ASP A OD2 1 
ATOM   1456 N N   . GLY A  1 201 ? 64.189 10.024  62.342 1.00 16.76 ? 372 GLY A N   1 
ATOM   1457 C CA  . GLY A  1 201 ? 65.292 9.480   61.550 1.00 16.74 ? 372 GLY A CA  1 
ATOM   1458 C C   . GLY A  1 201 ? 64.779 8.949   60.202 1.00 13.52 ? 372 GLY A C   1 
ATOM   1459 O O   . GLY A  1 201 ? 64.206 9.697   59.439 1.00 16.41 ? 372 GLY A O   1 
ATOM   1460 N N   . SER A  1 202 ? 64.990 7.662   59.960 1.00 11.87 ? 373 SER A N   1 
ATOM   1461 C CA  . SER A  1 202 ? 64.635 6.999   58.707 1.00 12.16 ? 373 SER A CA  1 
ATOM   1462 C C   . SER A  1 202 ? 63.215 6.459   58.693 1.00 12.05 ? 373 SER A C   1 
ATOM   1463 O O   . SER A  1 202 ? 62.854 5.746   57.756 1.00 13.19 ? 373 SER A O   1 
ATOM   1464 C CB  . SER A  1 202 ? 65.607 5.907   58.395 1.00 12.40 ? 373 SER A CB  1 
ATOM   1465 O OG  . SER A  1 202 ? 66.918 6.452   58.236 1.00 14.04 ? 373 SER A OG  1 
ATOM   1466 N N   . LEU A  1 203 ? 62.451 6.717   59.768 1.00 11.96 ? 374 LEU A N   1 
ATOM   1467 C CA  . LEU A  1 203 ? 61.061 6.331   59.914 1.00 12.43 ? 374 LEU A CA  1 
ATOM   1468 C C   . LEU A  1 203 ? 60.111 7.496   59.882 1.00 13.35 ? 374 LEU A C   1 
ATOM   1469 O O   . LEU A  1 203 ? 60.451 8.596   60.334 1.00 14.09 ? 374 LEU A O   1 
ATOM   1470 C CB  . LEU A  1 203 ? 60.818 5.456   61.151 1.00 12.47 ? 374 LEU A CB  1 
ATOM   1471 C CG  . LEU A  1 203 ? 61.569 4.125   61.284 1.00 13.09 ? 374 LEU A CG  1 
ATOM   1472 C CD1 . LEU A  1 203 ? 61.230 3.474   62.595 1.00 13.94 ? 374 LEU A CD1 1 
ATOM   1473 C CD2 . LEU A  1 203 ? 61.299 3.215   60.099 1.00 15.18 ? 374 LEU A CD2 1 
ATOM   1474 N N   . VAL A  1 204 ? 58.910 7.251   59.358 1.00 12.91 ? 375 VAL A N   1 
ATOM   1475 C CA  . VAL A  1 204 ? 57.817 8.219   59.433 1.00 12.96 ? 375 VAL A CA  1 
ATOM   1476 C C   . VAL A  1 204 ? 56.604 7.530   60.044 1.00 12.19 ? 375 VAL A C   1 
ATOM   1477 O O   . VAL A  1 204 ? 56.308 6.391   59.683 1.00 13.94 ? 375 VAL A O   1 
ATOM   1478 C CB  . VAL A  1 204 ? 57.486 8.808   58.030 1.00 13.79 ? 375 VAL A CB  1 
ATOM   1479 C CG1 . VAL A  1 204 ? 57.197 7.772   56.983 1.00 14.09 ? 375 VAL A CG1 1 
ATOM   1480 C CG2 . VAL A  1 204 ? 56.400 9.814   58.134 1.00 19.20 ? 375 VAL A CG2 1 
ATOM   1481 N N   . ARG A  1 205 ? 55.916 8.231   60.951 1.00 14.03 ? 376 ARG A N   1 
ATOM   1482 C CA  . ARG A  1 205 ? 54.679 7.737   61.540 1.00 14.30 ? 376 ARG A CA  1 
ATOM   1483 C C   . ARG A  1 205 ? 53.522 8.223   60.653 1.00 15.34 ? 376 ARG A C   1 
ATOM   1484 O O   . ARG A  1 205 ? 53.245 9.412   60.582 1.00 15.50 ? 376 ARG A O   1 
ATOM   1485 C CB  . ARG A  1 205 ? 54.535 8.184   63.005 1.00 16.04 ? 376 ARG A CB  1 
ATOM   1486 C CG  . ARG A  1 205 ? 53.278 7.593   63.644 1.00 18.64 ? 376 ARG A CG  1 
ATOM   1487 C CD  . ARG A  1 205 ? 53.303 7.648   65.159 1.00 21.66 ? 376 ARG A CD  1 
ATOM   1488 N NE  . ARG A  1 205 ? 53.472 9.001   65.667 1.00 21.10 ? 376 ARG A NE  1 
ATOM   1489 C CZ  . ARG A  1 205 ? 52.471 9.875   65.925 1.00 20.69 ? 376 ARG A CZ  1 
ATOM   1490 N NH1 . ARG A  1 205 ? 52.769 11.081  66.380 1.00 26.87 ? 376 ARG A NH1 1 
ATOM   1491 N NH2 . ARG A  1 205 ? 51.190 9.563   65.722 1.00 23.80 ? 376 ARG A NH2 1 
ATOM   1492 N N   . ILE A  1 206 ? 52.869 7.254   60.012 1.00 13.61 ? 377 ILE A N   1 
ATOM   1493 C CA  . ILE A  1 206 ? 51.804 7.504   59.078 1.00 13.29 ? 377 ILE A CA  1 
ATOM   1494 C C   . ILE A  1 206 ? 50.450 7.191   59.748 1.00 14.01 ? 377 ILE A C   1 
ATOM   1495 O O   . ILE A  1 206 ? 50.259 6.101   60.323 1.00 15.40 ? 377 ILE A O   1 
ATOM   1496 C CB  . ILE A  1 206 ? 51.929 6.639   57.849 1.00 13.89 ? 377 ILE A CB  1 
ATOM   1497 C CG1 . ILE A  1 206 ? 53.225 6.972   57.061 1.00 14.77 ? 377 ILE A CG1 1 
ATOM   1498 C CG2 . ILE A  1 206 ? 50.701 6.769   56.954 1.00 15.08 ? 377 ILE A CG2 1 
ATOM   1499 C CD1 . ILE A  1 206 ? 53.301 8.373   56.498 1.00 16.95 ? 377 ILE A CD1 1 
ATOM   1500 N N   . LEU A  1 207 ? 49.562 8.186   59.742 1.00 15.53 ? 378 LEU A N   1 
ATOM   1501 C CA  . LEU A  1 207 ? 48.169 7.986   60.166 1.00 17.29 ? 378 LEU A CA  1 
ATOM   1502 C C   . LEU A  1 207 ? 47.321 7.619   58.940 1.00 16.48 ? 378 LEU A C   1 
ATOM   1503 O O   . LEU A  1 207 ? 47.205 8.423   58.003 1.00 16.79 ? 378 LEU A O   1 
ATOM   1504 C CB  . LEU A  1 207 ? 47.633 9.245   60.846 1.00 17.22 ? 378 LEU A CB  1 
ATOM   1505 C CG  . LEU A  1 207 ? 46.092 9.191   61.099 1.00 20.45 ? 378 LEU A CG  1 
ATOM   1506 C CD1 . LEU A  1 207 ? 45.688 8.085   62.065 1.00 23.35 ? 378 LEU A CD1 1 
ATOM   1507 C CD2 . LEU A  1 207 ? 45.632 10.538  61.554 1.00 22.82 ? 378 LEU A CD2 1 
ATOM   1508 N N   . PHE A  1 208 ? 46.711 6.454   58.964 1.00 17.67 ? 379 PHE A N   1 
ATOM   1509 C CA  . PHE A  1 208 ? 45.732 6.028   57.950 1.00 16.95 ? 379 PHE A CA  1 
ATOM   1510 C C   . PHE A  1 208 ? 44.408 6.662   58.330 1.00 19.77 ? 379 PHE A C   1 
ATOM   1511 O O   . PHE A  1 208 ? 43.875 6.424   59.408 1.00 21.66 ? 379 PHE A O   1 
ATOM   1512 C CB  . PHE A  1 208 ? 45.656 4.481   57.886 1.00 17.52 ? 379 PHE A CB  1 
ATOM   1513 C CG  . PHE A  1 208 ? 46.875 3.828   57.287 1.00 16.84 ? 379 PHE A CG  1 
ATOM   1514 C CD1 . PHE A  1 208 ? 48.002 3.568   58.070 1.00 22.56 ? 379 PHE A CD1 1 
ATOM   1515 C CD2 . PHE A  1 208 ? 46.920 3.480   55.986 1.00 18.52 ? 379 PHE A CD2 1 
ATOM   1516 C CE1 . PHE A  1 208 ? 49.136 2.969   57.524 1.00 20.79 ? 379 PHE A CE1 1 
ATOM   1517 C CE2 . PHE A  1 208 ? 48.035 2.888   55.406 1.00 17.83 ? 379 PHE A CE2 1 
ATOM   1518 C CZ  . PHE A  1 208 ? 49.156 2.634   56.178 1.00 21.65 ? 379 PHE A CZ  1 
ATOM   1519 N N   . LEU A  1 209 ? 43.921 7.521   57.449 1.00 16.68 ? 380 LEU A N   1 
ATOM   1520 C CA  . LEU A  1 209 ? 42.789 8.381   57.766 1.00 18.20 ? 380 LEU A CA  1 
ATOM   1521 C C   . LEU A  1 209 ? 41.452 7.670   57.815 1.00 18.69 ? 380 LEU A C   1 
ATOM   1522 O O   . LEU A  1 209 ? 40.600 8.121   58.581 1.00 22.00 ? 380 LEU A O   1 
ATOM   1523 C CB  . LEU A  1 209 ? 42.763 9.562   56.782 1.00 17.21 ? 380 LEU A CB  1 
ATOM   1524 C CG  . LEU A  1 209 ? 43.951 10.554  56.998 1.00 18.10 ? 380 LEU A CG  1 
ATOM   1525 C CD1 . LEU A  1 209 ? 44.078 11.546  55.858 1.00 20.21 ? 380 LEU A CD1 1 
ATOM   1526 C CD2 . LEU A  1 209 ? 43.811 11.295  58.323 1.00 20.29 ? 380 LEU A CD2 1 
ATOM   1527 N N   . ASP A  1 210 ? 41.271 6.578   57.037 1.00 20.32 ? 381 ASP A N   1 
ATOM   1528 C CA  . ASP A  1 210 ? 39.946 5.897   56.987 1.00 22.57 ? 381 ASP A CA  1 
ATOM   1529 C C   . ASP A  1 210 ? 39.754 5.155   58.312 1.00 26.24 ? 381 ASP A C   1 
ATOM   1530 O O   . ASP A  1 210 ? 38.718 5.258   58.970 1.00 26.05 ? 381 ASP A O   1 
ATOM   1531 C CB  . ASP A  1 210 ? 39.770 4.990   55.740 1.00 27.31 ? 381 ASP A CB  1 
ATOM   1532 C CG  . ASP A  1 210 ? 39.696 5.809   54.412 1.00 28.70 ? 381 ASP A CG  1 
ATOM   1533 O OD1 . ASP A  1 210 ? 38.709 6.562   54.249 1.00 26.32 ? 381 ASP A OD1 1 
ATOM   1534 O OD2 . ASP A  1 210 ? 40.622 5.684   53.534 1.00 33.07 ? 381 ASP A OD2 1 
ATOM   1535 N N   . ASP A  1 211 ? 40.768 4.392   58.691 1.00 28.20 ? 382 ASP A N   1 
ATOM   1536 C CA  . ASP A  1 211 ? 40.694 3.566   59.921 1.00 28.63 ? 382 ASP A CA  1 
ATOM   1537 C C   . ASP A  1 211 ? 41.299 4.208   61.216 1.00 28.22 ? 382 ASP A C   1 
ATOM   1538 O O   . ASP A  1 211 ? 41.095 3.695   62.297 1.00 41.33 ? 382 ASP A O   1 
ATOM   1539 C CB  . ASP A  1 211 ? 41.235 2.142   59.659 1.00 35.78 ? 382 ASP A CB  1 
ATOM   1540 C CG  A ASP A  1 211 ? 40.437 1.384   58.556 0.60 32.42 ? 382 ASP A CG  1 
ATOM   1541 O OD1 A ASP A  1 211 ? 39.149 1.461   58.503 0.60 53.38 ? 382 ASP A OD1 1 
ATOM   1542 O OD2 A ASP A  1 211 ? 41.110 0.648   57.797 0.60 30.23 ? 382 ASP A OD2 1 
ATOM   1543 N N   . LYS A  1 212 ? 42.057 5.323   61.092 1.00 34.84 ? 383 LYS A N   1 
ATOM   1544 C CA  . LYS A  1 212 ? 42.710 6.073   62.246 1.00 28.75 ? 383 LYS A CA  1 
ATOM   1545 C C   . LYS A  1 212 ? 43.852 5.364   63.021 1.00 33.16 ? 383 LYS A C   1 
ATOM   1546 O O   . LYS A  1 212 ? 44.153 5.681   64.188 1.00 47.41 ? 383 LYS A O   1 
ATOM   1547 C CB  . LYS A  1 212 ? 41.710 6.582   63.248 1.00 36.94 ? 383 LYS A CB  1 
ATOM   1548 C CG  . LYS A  1 212 ? 40.568 7.351   62.665 1.00 33.20 ? 383 LYS A CG  1 
ATOM   1549 C CD  . LYS A  1 212 ? 40.992 8.644   61.951 1.00 28.60 ? 383 LYS A CD  1 
ATOM   1550 C CE  . LYS A  1 212 ? 39.741 9.323   61.422 1.00 29.95 ? 383 LYS A CE  1 
ATOM   1551 N NZ  . LYS A  1 212 ? 40.059 10.310  60.365 1.00 27.19 ? 383 LYS A NZ  1 
ATOM   1552 N N   . ARG A  1 213 ? 44.495 4.440   62.338 1.00 24.11 ? 384 ARG A N   1 
ATOM   1553 C CA  . ARG A  1 213 ? 45.617 3.636   62.862 1.00 27.29 ? 384 ARG A CA  1 
ATOM   1554 C C   . ARG A  1 213 ? 46.926 4.228   62.360 1.00 23.36 ? 384 ARG A C   1 
ATOM   1555 O O   . ARG A  1 213 ? 46.998 4.693   61.232 1.00 21.25 ? 384 ARG A O   1 
ATOM   1556 C CB  . ARG A  1 213 ? 45.508 2.222   62.294 1.00 37.58 ? 384 ARG A CB  1 
ATOM   1557 N N   . CYS A  1 214 ? 47.932 4.240   63.227 1.00 23.47 ? 385 CYS A N   1 
ATOM   1558 C CA  . CYS A  1 214 ? 49.265 4.666   62.871 1.00 21.07 ? 385 CYS A CA  1 
ATOM   1559 C C   . CYS A  1 214 ? 50.171 3.475   62.583 1.00 18.03 ? 385 CYS A C   1 
ATOM   1560 O O   . CYS A  1 214 ? 50.048 2.402   63.198 1.00 22.73 ? 385 CYS A O   1 
ATOM   1561 C CB  . CYS A  1 214 ? 49.916 5.561   63.930 1.00 22.05 ? 385 CYS A CB  1 
ATOM   1562 S SG  . CYS A  1 214 ? 49.170 7.203   64.009 1.00 27.08 ? 385 CYS A SG  1 
ATOM   1563 N N   . GLU A  1 215 ? 51.143 3.724   61.716 1.00 14.96 ? 386 GLU A N   1 
ATOM   1564 C CA  . GLU A  1 215 ? 52.208 2.754   61.398 1.00 15.04 ? 386 GLU A CA  1 
ATOM   1565 C C   . GLU A  1 215 ? 53.502 3.527   61.191 1.00 15.01 ? 386 GLU A C   1 
ATOM   1566 O O   . GLU A  1 215 ? 53.527 4.517   60.482 1.00 15.25 ? 386 GLU A O   1 
ATOM   1567 C CB  . GLU A  1 215 ? 51.872 1.959   60.150 1.00 16.64 ? 386 GLU A CB  1 
ATOM   1568 C CG  . GLU A  1 215 ? 52.804 0.771   59.931 1.00 16.18 ? 386 GLU A CG  1 
ATOM   1569 C CD  . GLU A  1 215 ? 52.517 -0.060  58.719 1.00 15.71 ? 386 GLU A CD  1 
ATOM   1570 O OE1 . GLU A  1 215 ? 51.551 0.250   58.011 1.00 16.25 ? 386 GLU A OE1 1 
ATOM   1571 O OE2 . GLU A  1 215 ? 53.292 -1.022  58.469 1.00 14.73 ? 386 GLU A OE2 1 
ATOM   1572 N N   . TRP A  1 216 ? 54.604 3.035   61.758 1.00 14.52 ? 387 TRP A N   1 
ATOM   1573 C CA  . TRP A  1 216 ? 55.930 3.586   61.477 1.00 15.19 ? 387 TRP A CA  1 
ATOM   1574 C C   . TRP A  1 216 ? 56.489 2.867   60.254 1.00 12.89 ? 387 TRP A C   1 
ATOM   1575 O O   . TRP A  1 216 ? 56.576 1.628   60.230 1.00 14.07 ? 387 TRP A O   1 
ATOM   1576 C CB  . TRP A  1 216 ? 56.834 3.360   62.677 1.00 15.66 ? 387 TRP A CB  1 
ATOM   1577 C CG  . TRP A  1 216 ? 56.617 4.266   63.807 1.00 16.63 ? 387 TRP A CG  1 
ATOM   1578 C CD1 . TRP A  1 216 ? 55.924 3.978   64.962 1.00 18.26 ? 387 TRP A CD1 1 
ATOM   1579 C CD2 . TRP A  1 216 ? 57.087 5.598   63.943 1.00 14.03 ? 387 TRP A CD2 1 
ATOM   1580 N NE1 . TRP A  1 216 ? 55.962 5.061   65.814 1.00 19.64 ? 387 TRP A NE1 1 
ATOM   1581 C CE2 . TRP A  1 216 ? 56.679 6.065   65.217 1.00 17.10 ? 387 TRP A CE2 1 
ATOM   1582 C CE3 . TRP A  1 216 ? 57.854 6.439   63.134 1.00 16.92 ? 387 TRP A CE3 1 
ATOM   1583 C CZ2 . TRP A  1 216 ? 57.020 7.330   65.679 1.00 17.80 ? 387 TRP A CZ2 1 
ATOM   1584 C CZ3 . TRP A  1 216 ? 58.167 7.705   63.581 1.00 18.35 ? 387 TRP A CZ3 1 
ATOM   1585 C CH2 . TRP A  1 216 ? 57.771 8.132   64.861 1.00 17.78 ? 387 TRP A CH2 1 
ATOM   1586 N N   . ILE A  1 217 ? 56.786 3.640   59.208 1.00 12.00 ? 388 ILE A N   1 
ATOM   1587 C CA  . ILE A  1 217 ? 57.245 3.088   57.933 1.00 11.65 ? 388 ILE A CA  1 
ATOM   1588 C C   . ILE A  1 217 ? 58.579 3.739   57.533 1.00 10.73 ? 388 ILE A C   1 
ATOM   1589 O O   . ILE A  1 217 ? 58.841 4.949   57.735 1.00 11.87 ? 388 ILE A O   1 
ATOM   1590 C CB  . ILE A  1 217 ? 56.204 3.366   56.861 1.00 12.54 ? 388 ILE A CB  1 
ATOM   1591 C CG1 . ILE A  1 217 ? 54.869 2.716   57.283 1.00 13.34 ? 388 ILE A CG1 1 
ATOM   1592 C CG2 . ILE A  1 217 ? 56.653 2.884   55.494 1.00 13.21 ? 388 ILE A CG2 1 
ATOM   1593 C CD1 . ILE A  1 217 ? 53.694 2.980   56.364 1.00 16.25 ? 388 ILE A CD1 1 
ATOM   1594 N N   . TYR A  1 218 ? 59.442 2.896   56.997 1.00 11.04 ? 389 TYR A N   1 
ATOM   1595 C CA  . TYR A  1 218 ? 60.729 3.320   56.477 1.00 10.72 ? 389 TYR A CA  1 
ATOM   1596 C C   . TYR A  1 218 ? 60.539 4.370   55.369 1.00 10.70 ? 389 TYR A C   1 
ATOM   1597 O O   . TYR A  1 218 ? 59.794 4.131   54.396 1.00 10.67 ? 389 TYR A O   1 
ATOM   1598 C CB  . TYR A  1 218 ? 61.469 2.074   55.996 1.00 12.28 ? 389 TYR A CB  1 
ATOM   1599 C CG  . TYR A  1 218 ? 62.769 2.348   55.256 1.00 10.51 ? 389 TYR A CG  1 
ATOM   1600 C CD1 . TYR A  1 218 ? 63.764 3.144   55.821 1.00 11.44 ? 389 TYR A CD1 1 
ATOM   1601 C CD2 . TYR A  1 218 ? 63.010 1.785   54.007 1.00 10.39 ? 389 TYR A CD2 1 
ATOM   1602 C CE1 . TYR A  1 218 ? 64.947 3.387   55.138 1.00 11.87 ? 389 TYR A CE1 1 
ATOM   1603 C CE2 . TYR A  1 218 ? 64.202 1.985   53.315 1.00 10.08 ? 389 TYR A CE2 1 
ATOM   1604 C CZ  . TYR A  1 218 ? 65.168 2.872   53.873 1.00 10.40 ? 389 TYR A CZ  1 
ATOM   1605 O OH  . TYR A  1 218 ? 66.332 3.123   53.212 1.00 12.56 ? 389 TYR A OH  1 
ATOM   1606 N N   . ARG A  1 219 ? 61.281 5.476   55.453 1.00 10.65 ? 390 ARG A N   1 
ATOM   1607 C CA  . ARG A  1 219 ? 61.147 6.554   54.485 1.00 11.66 ? 390 ARG A CA  1 
ATOM   1608 C C   . ARG A  1 219 ? 61.661 6.197   53.083 1.00 11.30 ? 390 ARG A C   1 
ATOM   1609 O O   . ARG A  1 219 ? 61.413 6.943   52.158 1.00 12.46 ? 390 ARG A O   1 
ATOM   1610 C CB  . ARG A  1 219 ? 61.808 7.859   54.968 1.00 13.04 ? 390 ARG A CB  1 
ATOM   1611 C CG  . ARG A  1 219 ? 61.041 8.426   56.136 1.00 13.92 ? 390 ARG A CG  1 
ATOM   1612 C CD  . ARG A  1 219 ? 61.458 9.840   56.490 1.00 15.73 ? 390 ARG A CD  1 
ATOM   1613 N NE  . ARG A  1 219 ? 62.876 9.981   56.783 1.00 16.19 ? 390 ARG A NE  1 
ATOM   1614 C CZ  . ARG A  1 219 ? 63.833 10.489  55.997 1.00 15.34 ? 390 ARG A CZ  1 
ATOM   1615 N NH1 . ARG A  1 219 ? 63.585 10.948  54.770 1.00 17.75 ? 390 ARG A NH1 1 
ATOM   1616 N NH2 . ARG A  1 219 ? 65.103 10.555  56.460 1.00 17.74 ? 390 ARG A NH2 1 
ATOM   1617 N N   . GLY A  1 220 ? 62.339 5.057   52.939 1.00 11.28 ? 391 GLY A N   1 
ATOM   1618 C CA  . GLY A  1 220 ? 62.701 4.547   51.653 1.00 10.50 ? 391 GLY A CA  1 
ATOM   1619 C C   . GLY A  1 220 ? 61.763 3.482   51.102 1.00 10.91 ? 391 GLY A C   1 
ATOM   1620 O O   . GLY A  1 220 ? 62.048 2.900   50.038 1.00 13.84 ? 391 GLY A O   1 
ATOM   1621 N N   . SER A  1 221 ? 60.640 3.235   51.788 1.00 10.59 ? 392 SER A N   1 
ATOM   1622 C CA  . SER A  1 221 ? 59.704 2.222   51.354 1.00 10.76 ? 392 SER A CA  1 
ATOM   1623 C C   . SER A  1 221 ? 58.823 2.722   50.221 1.00 11.66 ? 392 SER A C   1 
ATOM   1624 O O   . SER A  1 221 ? 58.204 3.774   50.335 1.00 12.02 ? 392 SER A O   1 
ATOM   1625 C CB  . SER A  1 221 ? 58.771 1.836   52.496 1.00 11.92 ? 392 SER A CB  1 
ATOM   1626 O OG  . SER A  1 221 ? 57.738 0.923   52.085 1.00 11.06 ? 392 SER A OG  1 
ATOM   1627 N N   . THR A  1 222 ? 58.650 1.864   49.218 1.00 11.25 ? 393 THR A N   1 
ATOM   1628 C CA  . THR A  1 222 ? 57.707 2.198   48.098 1.00 12.81 ? 393 THR A CA  1 
ATOM   1629 C C   . THR A  1 222 ? 56.260 2.005   48.523 1.00 12.44 ? 393 THR A C   1 
ATOM   1630 O O   . THR A  1 222 ? 55.361 2.229   47.721 1.00 15.42 ? 393 THR A O   1 
ATOM   1631 C CB  . THR A  1 222 ? 57.997 1.364   46.879 1.00 15.46 ? 393 THR A CB  1 
ATOM   1632 O OG1 . THR A  1 222 ? 57.949 -0.035  47.209 1.00 16.15 ? 393 THR A OG1 1 
ATOM   1633 C CG2 . THR A  1 222 ? 59.373 1.678   46.357 1.00 16.57 ? 393 THR A CG2 1 
ATOM   1634 N N   . ARG A  1 223 ? 55.984 1.660   49.791 1.00 11.50 ? 394 ARG A N   1 
ATOM   1635 C CA  . ARG A  1 223 ? 54.604 1.820   50.293 1.00 11.42 ? 394 ARG A CA  1 
ATOM   1636 C C   . ARG A  1 223 ? 54.171 3.280   50.439 1.00 11.11 ? 394 ARG A C   1 
ATOM   1637 O O   . ARG A  1 223 ? 52.960 3.569   50.531 1.00 13.65 ? 394 ARG A O   1 
ATOM   1638 C CB  . ARG A  1 223 ? 54.372 1.081   51.635 1.00 11.37 ? 394 ARG A CB  1 
ATOM   1639 C CG  . ARG A  1 223 ? 54.502 -0.407  51.512 1.00 12.57 ? 394 ARG A CG  1 
ATOM   1640 C CD  . ARG A  1 223 ? 54.427 -1.118  52.837 1.00 11.49 ? 394 ARG A CD  1 
ATOM   1641 N NE  . ARG A  1 223 ? 53.175 -0.789  53.504 1.00 11.86 ? 394 ARG A NE  1 
ATOM   1642 C CZ  . ARG A  1 223 ? 52.990 -0.615  54.794 1.00 13.76 ? 394 ARG A CZ  1 
ATOM   1643 N NH1 . ARG A  1 223 ? 53.948 -0.918  55.662 1.00 14.24 ? 394 ARG A NH1 1 
ATOM   1644 N NH2 . ARG A  1 223 ? 51.800 -0.264  55.232 1.00 14.87 ? 394 ARG A NH2 1 
ATOM   1645 N N   . LEU A  1 224 ? 55.154 4.192   50.496 1.00 11.16 ? 395 LEU A N   1 
ATOM   1646 C CA  . LEU A  1 224 ? 54.866 5.611   50.549 1.00 11.26 ? 395 LEU A CA  1 
ATOM   1647 C C   . LEU A  1 224 ? 54.733 6.123   49.105 1.00 11.67 ? 395 LEU A C   1 
ATOM   1648 O O   . LEU A  1 224 ? 55.647 5.940   48.313 1.00 12.57 ? 395 LEU A O   1 
ATOM   1649 C CB  . LEU A  1 224 ? 55.989 6.343   51.264 1.00 11.90 ? 395 LEU A CB  1 
ATOM   1650 C CG  . LEU A  1 224 ? 56.283 5.858   52.678 1.00 11.82 ? 395 LEU A CG  1 
ATOM   1651 C CD1 . LEU A  1 224 ? 57.583 6.482   53.193 1.00 13.48 ? 395 LEU A CD1 1 
ATOM   1652 C CD2 . LEU A  1 224 ? 55.169 6.193   53.640 1.00 14.00 ? 395 LEU A CD2 1 
ATOM   1653 N N   . GLU A  1 225 ? 53.578 6.706   48.752 1.00 12.72 ? 396 GLU A N   1 
ATOM   1654 C CA  . GLU A  1 225 ? 53.365 7.091   47.328 1.00 13.33 ? 396 GLU A CA  1 
ATOM   1655 C C   . GLU A  1 225 ? 54.536 7.840   46.683 1.00 13.95 ? 396 GLU A C   1 
ATOM   1656 O O   . GLU A  1 225 ? 54.890 7.526   45.563 1.00 15.75 ? 396 GLU A O   1 
ATOM   1657 C CB  . GLU A  1 225 ? 52.065 7.830   47.176 1.00 16.75 ? 396 GLU A CB  1 
ATOM   1658 C CG  . GLU A  1 225 ? 51.765 8.160   45.699 1.00 20.19 ? 396 GLU A CG  1 
ATOM   1659 C CD  . GLU A  1 225 ? 52.452 9.361   45.228 1.00 26.67 ? 396 GLU A CD  1 
ATOM   1660 O OE1 . GLU A  1 225 ? 52.748 10.213  46.066 1.00 28.11 ? 396 GLU A OE1 1 
ATOM   1661 O OE2 . GLU A  1 225 ? 52.660 9.515   43.999 1.00 31.56 ? 396 GLU A OE2 1 
ATOM   1662 N N   . PRO A  1 226 ? 55.123 8.844   47.362 1.00 14.08 ? 397 PRO A N   1 
ATOM   1663 C CA  . PRO A  1 226 ? 56.184 9.557   46.666 1.00 14.96 ? 397 PRO A CA  1 
ATOM   1664 C C   . PRO A  1 226 ? 57.396 8.673   46.287 1.00 16.28 ? 397 PRO A C   1 
ATOM   1665 O O   . PRO A  1 226 ? 58.016 8.885   45.246 1.00 18.45 ? 397 PRO A O   1 
ATOM   1666 C CB  . PRO A  1 226 ? 56.586 10.666  47.669 1.00 17.46 ? 397 PRO A CB  1 
ATOM   1667 C CG  . PRO A  1 226 ? 55.369 10.826  48.541 1.00 19.53 ? 397 PRO A CG  1 
ATOM   1668 C CD  . PRO A  1 226 ? 54.723 9.511   48.611 1.00 15.98 ? 397 PRO A CD  1 
ATOM   1669 N N   . MET A  1 227 ? 57.727 7.702   47.130 1.00 14.80 ? 398 MET A N   1 
ATOM   1670 C CA  A MET A  1 227 ? 58.780 6.720   46.826 0.70 16.07 ? 398 MET A CA  1 
ATOM   1671 C CA  B MET A  1 227 ? 58.795 6.768   46.817 0.30 16.23 ? 398 MET A CA  1 
ATOM   1672 C C   . MET A  1 227 ? 58.351 5.789   45.706 1.00 15.69 ? 398 MET A C   1 
ATOM   1673 O O   . MET A  1 227 ? 59.109 5.478   44.807 1.00 18.58 ? 398 MET A O   1 
ATOM   1674 C CB  A MET A  1 227 ? 59.092 5.879   48.055 0.70 18.76 ? 398 MET A CB  1 
ATOM   1675 C CB  B MET A  1 227 ? 59.218 6.045   48.083 0.30 14.02 ? 398 MET A CB  1 
ATOM   1676 C CG  A MET A  1 227 ? 60.103 6.473   48.949 0.70 21.90 ? 398 MET A CG  1 
ATOM   1677 C CG  B MET A  1 227 ? 60.465 5.186   47.907 0.30 13.84 ? 398 MET A CG  1 
ATOM   1678 S SD  A MET A  1 227 ? 61.740 6.772   48.277 0.70 19.41 ? 398 MET A SD  1 
ATOM   1679 S SD  B MET A  1 227 ? 61.912 5.977   47.123 0.30 19.35 ? 398 MET A SD  1 
ATOM   1680 C CE  A MET A  1 227 ? 62.110 5.418   47.113 0.70 23.78 ? 398 MET A CE  1 
ATOM   1681 C CE  B MET A  1 227 ? 61.884 7.558   47.969 0.30 21.22 ? 398 MET A CE  1 
ATOM   1682 N N   . PHE A  1 228 ? 57.117 5.328   45.764 1.00 14.93 ? 399 PHE A N   1 
ATOM   1683 C CA  . PHE A  1 228 ? 56.567 4.464   44.691 1.00 16.03 ? 399 PHE A CA  1 
ATOM   1684 C C   . PHE A  1 228 ? 56.631 5.148   43.339 1.00 19.01 ? 399 PHE A C   1 
ATOM   1685 O O   . PHE A  1 228 ? 57.060 4.554   42.347 1.00 21.19 ? 399 PHE A O   1 
ATOM   1686 C CB  . PHE A  1 228 ? 55.116 4.091   44.991 1.00 16.56 ? 399 PHE A CB  1 
ATOM   1687 C CG  . PHE A  1 228 ? 54.544 3.121   44.021 1.00 17.01 ? 399 PHE A CG  1 
ATOM   1688 C CD1 . PHE A  1 228 ? 54.647 1.760   44.235 1.00 18.83 ? 399 PHE A CD1 1 
ATOM   1689 C CD2 . PHE A  1 228 ? 53.861 3.583   42.871 1.00 21.91 ? 399 PHE A CD2 1 
ATOM   1690 C CE1 . PHE A  1 228 ? 54.135 0.841   43.319 1.00 22.40 ? 399 PHE A CE1 1 
ATOM   1691 C CE2 . PHE A  1 228 ? 53.322 2.674   41.982 1.00 23.97 ? 399 PHE A CE2 1 
ATOM   1692 C CZ  . PHE A  1 228 ? 53.441 1.302   42.217 1.00 25.01 ? 399 PHE A CZ  1 
ATOM   1693 N N   . SER A  1 229 ? 56.209 6.389   43.322 1.00 17.13 ? 400 SER A N   1 
ATOM   1694 C CA  A SER A  1 229 ? 56.152 7.187   42.110 0.70 19.74 ? 400 SER A CA  1 
ATOM   1695 C CA  B SER A  1 229 ? 56.149 7.134   42.072 0.30 18.65 ? 400 SER A CA  1 
ATOM   1696 C C   . SER A  1 229 ? 57.522 7.382   41.514 1.00 20.93 ? 400 SER A C   1 
ATOM   1697 O O   . SER A  1 229 ? 57.732 7.256   40.289 1.00 23.29 ? 400 SER A O   1 
ATOM   1698 C CB  A SER A  1 229 ? 55.490 8.557   42.400 0.70 22.41 ? 400 SER A CB  1 
ATOM   1699 C CB  B SER A  1 229 ? 55.380 8.440   42.234 0.30 20.46 ? 400 SER A CB  1 
ATOM   1700 O OG  A SER A  1 229 ? 55.309 9.299   41.232 0.70 24.40 ? 400 SER A OG  1 
ATOM   1701 O OG  B SER A  1 229 ? 54.051 8.136   42.560 0.30 20.72 ? 400 SER A OG  1 
ATOM   1702 N N   . MET A  1 230 ? 58.471 7.718   42.375 1.00 20.99 ? 401 MET A N   1 
ATOM   1703 C CA  . MET A  1 230 ? 59.814 7.909   41.899 1.00 21.91 ? 401 MET A CA  1 
ATOM   1704 C C   . MET A  1 230 ? 60.356 6.593   41.302 1.00 22.04 ? 401 MET A C   1 
ATOM   1705 O O   . MET A  1 230 ? 61.003 6.639   40.235 1.00 25.93 ? 401 MET A O   1 
ATOM   1706 C CB  A MET A  1 230 ? 60.703 8.399   43.061 0.60 22.93 ? 401 MET A CB  1 
ATOM   1707 C CB  B MET A  1 230 ? 60.756 8.398   43.013 0.40 22.16 ? 401 MET A CB  1 
ATOM   1708 C CG  A MET A  1 230 ? 62.127 8.749   42.695 0.60 30.73 ? 401 MET A CG  1 
ATOM   1709 C CG  B MET A  1 230 ? 62.178 8.674   42.533 0.40 25.55 ? 401 MET A CG  1 
ATOM   1710 S SD  A MET A  1 230 ? 63.162 9.190   44.109 0.60 42.87 ? 401 MET A SD  1 
ATOM   1711 S SD  B MET A  1 230 ? 63.303 7.268   42.538 0.40 25.24 ? 401 MET A SD  1 
ATOM   1712 C CE  A MET A  1 230 ? 62.404 10.647  44.826 0.60 47.61 ? 401 MET A CE  1 
ATOM   1713 C CE  B MET A  1 230 ? 63.556 7.110   44.299 0.40 25.42 ? 401 MET A CE  1 
ATOM   1714 N N   . LYS A  1 231 ? 60.196 5.458   42.022 1.00 22.60 ? 402 LYS A N   1 
ATOM   1715 C CA  . LYS A  1 231 ? 60.777 4.197   41.554 1.00 25.50 ? 402 LYS A CA  1 
ATOM   1716 C C   . LYS A  1 231 ? 60.129 3.726   40.263 1.00 25.55 ? 402 LYS A C   1 
ATOM   1717 O O   . LYS A  1 231 ? 60.808 3.127   39.415 1.00 30.73 ? 402 LYS A O   1 
ATOM   1718 C CB  . LYS A  1 231 ? 60.722 3.081   42.644 1.00 30.22 ? 402 LYS A CB  1 
ATOM   1719 C CG  . LYS A  1 231 ? 61.671 3.300   43.783 1.00 32.66 ? 402 LYS A CG  1 
ATOM   1720 C CD  . LYS A  1 231 ? 63.059 2.785   43.456 1.00 38.15 ? 402 LYS A CD  1 
ATOM   1721 N N   . THR A  1 232 ? 58.835 4.015   40.110 1.00 23.45 ? 403 THR A N   1 
ATOM   1722 C CA  A THR A  1 232 ? 58.098 3.578   38.928 0.70 22.23 ? 403 THR A CA  1 
ATOM   1723 C CA  B THR A  1 232 ? 58.055 3.610   38.919 0.30 23.46 ? 403 THR A CA  1 
ATOM   1724 C C   . THR A  1 232 ? 58.500 4.381   37.693 1.00 28.01 ? 403 THR A C   1 
ATOM   1725 O O   . THR A  1 232 ? 58.502 3.823   36.590 1.00 36.49 ? 403 THR A O   1 
ATOM   1726 C CB  A THR A  1 232 ? 56.564 3.662   39.180 0.70 25.67 ? 403 THR A CB  1 
ATOM   1727 C CB  B THR A  1 232 ? 56.515 3.835   39.094 0.30 21.96 ? 403 THR A CB  1 
ATOM   1728 O OG1 A THR A  1 232 ? 56.252 4.890   39.835 0.70 33.41 ? 403 THR A OG1 1 
ATOM   1729 O OG1 B THR A  1 232 ? 56.015 3.050   40.180 0.30 22.36 ? 403 THR A OG1 1 
ATOM   1730 C CG2 A THR A  1 232 ? 56.071 2.512   40.051 0.70 26.92 ? 403 THR A CG2 1 
ATOM   1731 C CG2 B THR A  1 232 ? 55.704 3.462   37.781 0.30 21.66 ? 403 THR A CG2 1 
ATOM   1732 N N   . SER A  1 233 ? 58.850 5.671   37.861 1.00 21.81 ? 404 SER A N   1 
ATOM   1733 C CA  . SER A  1 233 ? 59.322 6.496   36.712 1.00 26.24 ? 404 SER A CA  1 
ATOM   1734 C C   A SER A  1 233 ? 60.688 6.044   36.258 0.50 27.79 ? 404 SER A C   1 
ATOM   1735 C C   B SER A  1 233 ? 60.787 6.135   36.409 0.50 32.77 ? 404 SER A C   1 
ATOM   1736 O O   A SER A  1 233 ? 61.460 5.533   37.056 0.50 29.80 ? 404 SER A O   1 
ATOM   1737 O O   B SER A  1 233 ? 61.179 5.955   35.245 0.50 44.73 ? 404 SER A O   1 
ATOM   1738 C CB  . SER A  1 233 ? 59.256 8.027   37.022 1.00 28.52 ? 404 SER A CB  1 
ATOM   1739 O OG  . SER A  1 233 ? 57.911 8.429   37.076 1.00 31.44 ? 404 SER A OG  1 
ATOM   1740 N N   A SER A  1 234 ? 60.948 6.167   34.954 0.50 26.94 ? 405 SER A N   1 
ATOM   1741 N N   B SER A  1 234 ? 61.595 6.064   37.475 0.50 33.93 ? 405 SER A N   1 
ATOM   1742 C CA  B SER A  1 234 ? 63.011 5.658   37.397 0.50 30.65 ? 405 SER A CA  1 
ATOM   1743 C C   B SER A  1 234 ? 63.212 4.348   36.621 0.50 28.47 ? 405 SER A C   1 
ATOM   1744 O O   B SER A  1 234 ? 64.106 4.256   35.776 0.50 38.00 ? 405 SER A O   1 
ATOM   1745 C CB  B SER A  1 234 ? 63.599 5.518   38.817 0.50 27.16 ? 405 SER A CB  1 
ATOM   1746 N N   B ALA A  1 235 ? 62.421 3.325   36.929 0.50 28.78 ? 406 ALA A N   1 
ATOM   1747 C CA  B ALA A  1 235 ? 62.433 2.088   36.152 0.50 32.13 ? 406 ALA A CA  1 
ATOM   1748 N N   A SER B  2 8   ? 48.811 -6.341  61.306 0.50 23.61 ? 10  SER B N   1 
ATOM   1749 N N   B SER B  2 8   ? 48.598 -3.400  62.474 0.50 27.16 ? 10  SER B N   1 
ATOM   1750 C CA  A SER B  2 8   ? 49.000 -4.860  61.477 0.50 29.29 ? 10  SER B CA  1 
ATOM   1751 C CA  B SER B  2 8   ? 49.205 -4.594  61.864 0.50 29.13 ? 10  SER B CA  1 
ATOM   1752 C C   A SER B  2 8   ? 50.068 -4.335  60.519 0.50 26.46 ? 10  SER B C   1 
ATOM   1753 C C   B SER B  2 8   ? 50.179 -4.131  60.796 0.50 27.82 ? 10  SER B C   1 
ATOM   1754 O O   A SER B  2 8   ? 49.796 -3.479  59.657 0.50 20.16 ? 10  SER B O   1 
ATOM   1755 O O   B SER B  2 8   ? 49.944 -3.095  60.148 0.50 27.32 ? 10  SER B O   1 
ATOM   1756 C CB  A SER B  2 8   ? 49.402 -4.514  62.923 0.50 27.43 ? 10  SER B CB  1 
ATOM   1757 C CB  B SER B  2 8   ? 48.124 -5.474  61.237 0.50 31.53 ? 10  SER B CB  1 
ATOM   1758 N N   . THR B  2 9   ? 51.287 -4.856  60.632 1.00 25.24 ? 11  THR B N   1 
ATOM   1759 C CA  . THR B  2 9   ? 52.362 -4.374  59.747 1.00 19.96 ? 11  THR B CA  1 
ATOM   1760 C C   . THR B  2 9   ? 52.024 -4.612  58.283 1.00 17.28 ? 11  THR B C   1 
ATOM   1761 O O   . THR B  2 9   ? 51.509 -5.661  57.920 1.00 20.67 ? 11  THR B O   1 
ATOM   1762 C CB  . THR B  2 9   ? 53.731 -4.981  60.045 1.00 19.97 ? 11  THR B CB  1 
ATOM   1763 O OG1 . THR B  2 9   ? 54.721 -4.350  59.231 1.00 16.16 ? 11  THR B OG1 1 
ATOM   1764 C CG2 . THR B  2 9   ? 53.783 -6.491  59.765 1.00 22.52 ? 11  THR B CG2 1 
ATOM   1765 N N   . GLY B  2 10  ? 52.315 -3.623  57.443 1.00 16.52 ? 12  GLY B N   1 
ATOM   1766 C CA  . GLY B  2 10  ? 52.285 -3.821  56.011 1.00 16.48 ? 12  GLY B CA  1 
ATOM   1767 C C   . GLY B  2 10  ? 53.605 -4.153  55.356 1.00 15.29 ? 12  GLY B C   1 
ATOM   1768 O O   . GLY B  2 10  ? 53.711 -4.214  54.155 1.00 15.90 ? 12  GLY B O   1 
ATOM   1769 N N   . GLY B  2 11  ? 54.642 -4.365  56.185 1.00 14.11 ? 13  GLY B N   1 
ATOM   1770 C CA  . GLY B  2 11  ? 55.960 -4.699  55.668 1.00 14.61 ? 13  GLY B CA  1 
ATOM   1771 C C   . GLY B  2 11  ? 56.623 -3.568  54.913 1.00 12.24 ? 13  GLY B C   1 
ATOM   1772 O O   . GLY B  2 11  ? 56.279 -2.395  55.051 1.00 13.20 ? 13  GLY B O   1 
HETATM 1773 O OH  . ALY B  2 12  ? 58.800 0.192   56.883 1.00 13.85 ? 14  ALY B OH  1 
HETATM 1774 C CH  . ALY B  2 12  ? 58.447 -0.895  57.374 1.00 11.50 ? 14  ALY B CH  1 
HETATM 1775 C CH3 . ALY B  2 12  ? 57.075 -1.098  57.969 1.00 12.68 ? 14  ALY B CH3 1 
HETATM 1776 N NZ  . ALY B  2 12  ? 59.211 -1.989  57.402 1.00 13.54 ? 14  ALY B NZ  1 
HETATM 1777 C CE  . ALY B  2 12  ? 60.591 -1.847  56.948 1.00 14.65 ? 14  ALY B CE  1 
HETATM 1778 C CD  . ALY B  2 12  ? 60.782 -1.999  55.515 1.00 14.30 ? 14  ALY B CD  1 
HETATM 1779 C CG  . ALY B  2 12  ? 60.450 -3.462  55.057 1.00 13.83 ? 14  ALY B CG  1 
HETATM 1780 C CB  . ALY B  2 12  ? 59.988 -3.461  53.594 1.00 12.46 ? 14  ALY B CB  1 
HETATM 1781 C CA  . ALY B  2 12  ? 58.540 -2.962  53.522 1.00 12.83 ? 14  ALY B CA  1 
HETATM 1782 N N   . ALY B  2 12  ? 57.618 -3.938  54.124 1.00 12.10 ? 14  ALY B N   1 
HETATM 1783 C C   . ALY B  2 12  ? 58.214 -2.564  52.121 1.00 12.45 ? 14  ALY B C   1 
HETATM 1784 O O   . ALY B  2 12  ? 58.711 -1.550  51.635 1.00 14.32 ? 14  ALY B O   1 
ATOM   1785 N N   . ALA B  2 13  ? 57.417 -3.392  51.447 1.00 14.40 ? 15  ALA B N   1 
ATOM   1786 C CA  . ALA B  2 13  ? 57.068 -3.142  50.024 1.00 17.11 ? 15  ALA B CA  1 
ATOM   1787 C C   . ALA B  2 13  ? 55.613 -3.449  49.830 1.00 16.88 ? 15  ALA B C   1 
ATOM   1788 O O   . ALA B  2 13  ? 55.047 -4.188  50.609 1.00 18.79 ? 15  ALA B O   1 
ATOM   1789 C CB  . ALA B  2 13  ? 57.884 -4.031  49.125 1.00 20.31 ? 15  ALA B CB  1 
ATOM   1790 N N   . PRO B  2 14  ? 55.006 -2.869  48.781 1.00 15.98 ? 16  PRO B N   1 
ATOM   1791 C CA  . PRO B  2 14  ? 53.595 -3.155  48.573 1.00 17.48 ? 16  PRO B CA  1 
ATOM   1792 C C   . PRO B  2 14  ? 53.335 -4.617  48.372 1.00 18.63 ? 16  PRO B C   1 
ATOM   1793 O O   . PRO B  2 14  ? 54.190 -5.339  47.799 1.00 22.36 ? 16  PRO B O   1 
ATOM   1794 C CB  . PRO B  2 14  ? 53.237 -2.354  47.295 1.00 18.03 ? 16  PRO B CB  1 
ATOM   1795 C CG  . PRO B  2 14  ? 54.242 -1.262  47.276 1.00 18.95 ? 16  PRO B CG  1 
ATOM   1796 C CD  . PRO B  2 14  ? 55.507 -1.836  47.871 1.00 18.11 ? 16  PRO B CD  1 
ATOM   1797 N N   . ARG B  2 15  ? 52.154 -5.035  48.796 1.00 21.43 ? 17  ARG B N   1 
ATOM   1798 C CA  . ARG B  2 15  ? 51.643 -6.385  48.520 1.00 23.76 ? 17  ARG B CA  1 
ATOM   1799 C C   . ARG B  2 15  ? 51.618 -6.677  46.990 1.00 29.76 ? 17  ARG B C   1 
ATOM   1800 O O   . ARG B  2 15  ? 51.198 -5.823  46.191 1.00 33.40 ? 17  ARG B O   1 
ATOM   1801 C CB  . ARG B  2 15  ? 50.247 -6.463  49.119 1.00 32.32 ? 17  ARG B CB  1 
ATOM   1802 N N   . LYS B  2 16  ? 52.099 -7.850  46.587 1.00 38.48 ? 18  LYS B N   1 
ATOM   1803 C CA  . LYS B  2 16  ? 52.289 -8.177  45.141 1.00 45.64 ? 18  LYS B CA  1 
ATOM   1804 C C   . LYS B  2 16  ? 50.979 -8.306  44.361 1.00 49.82 ? 18  LYS B C   1 
ATOM   1805 O O   . LYS B  2 16  ? 50.035 -8.909  44.842 1.00 56.18 ? 18  LYS B O   1 
ATOM   1806 C CB  . LYS B  2 16  ? 53.090 -9.480  44.977 1.00 57.59 ? 18  LYS B CB  1 
HETATM 1807 X UNK . UNX C  3 .   ? 68.429 -8.409  79.259 1.00 49.53 ? 501 UNX A UNK 1 
HETATM 1808 X UNK . UNX D  3 .   ? 71.787 -23.157 60.067 1.00 45.18 ? 502 UNX A UNK 1 
HETATM 1809 X UNK . UNX E  3 .   ? 77.261 -1.280  58.765 1.00 31.90 ? 503 UNX A UNK 1 
HETATM 1810 X UNK . UNX F  3 .   ? 77.017 -8.337  59.422 1.00 44.76 ? 504 UNX A UNK 1 
HETATM 1811 X UNK . UNX G  3 .   ? 62.219 -8.810  56.815 1.00 22.05 ? 505 UNX A UNK 1 
HETATM 1812 X UNK . UNX H  3 .   ? 75.532 -19.901 55.407 1.00 37.55 ? 506 UNX A UNK 1 
HETATM 1813 X UNK . UNX I  3 .   ? 72.736 -9.767  46.537 1.00 89.44 ? 507 UNX A UNK 1 
HETATM 1814 X UNK . UNX J  3 .   ? 71.648 -14.173 46.839 1.00 27.74 ? 508 UNX A UNK 1 
HETATM 1815 X UNK . UNX K  3 .   ? 79.712 -23.040 64.796 1.00 34.24 ? 509 UNX A UNK 1 
HETATM 1816 X UNK . UNX L  3 .   ? 68.614 1.044   49.723 1.00 21.53 ? 510 UNX A UNK 1 
HETATM 1817 X UNK . UNX M  3 .   ? 67.181 -0.338  47.997 1.00 42.42 ? 511 UNX A UNK 1 
HETATM 1818 X UNK . UNX N  3 .   ? 65.071 -0.752  50.010 1.00 31.60 ? 512 UNX A UNK 1 
HETATM 1819 X UNK . UNX O  3 .   ? 62.602 0.390   49.172 1.00 30.65 ? 513 UNX A UNK 1 
HETATM 1820 X UNK . UNX P  3 .   ? 41.565 6.162   51.353 1.00 18.75 ? 514 UNX A UNK 1 
HETATM 1821 X UNK . UNX Q  3 .   ? 66.301 -24.653 64.433 1.00 17.07 ? 515 UNX A UNK 1 
HETATM 1822 X UNK . UNX R  3 .   ? 55.118 -8.056  55.814 1.00 35.02 ? 516 UNX A UNK 1 
HETATM 1823 X UNK . UNX S  3 .   ? 73.595 -13.913 81.178 1.00 42.89 ? 517 UNX A UNK 1 
HETATM 1824 X UNK . UNX T  3 .   ? 50.454 10.482  47.481 1.00 29.61 ? 518 UNX A UNK 1 
HETATM 1825 X UNK . UNX U  3 .   ? 68.070 6.750   72.582 1.00 25.70 ? 519 UNX A UNK 1 
HETATM 1826 X UNK . UNX V  3 .   ? 69.331 5.126   74.157 1.00 30.58 ? 520 UNX A UNK 1 
HETATM 1827 X UNK . UNX W  3 .   ? 44.855 17.107  58.067 1.00 43.14 ? 521 UNX A UNK 1 
HETATM 1828 X UNK . UNX X  3 .   ? 62.499 -15.285 78.226 1.00 26.81 ? 522 UNX A UNK 1 
HETATM 1829 X UNK . UNX Y  3 .   ? 64.459 -18.694 60.435 1.00 20.58 ? 523 UNX A UNK 1 
HETATM 1830 X UNK . UNX Z  3 .   ? 43.306 0.742   56.174 1.00 38.26 ? 524 UNX A UNK 1 
HETATM 1831 X UNK . UNX AA 3 .   ? 83.935 -30.795 73.189 1.00 39.02 ? 525 UNX A UNK 1 
HETATM 1832 X UNK . UNX BA 3 .   ? 68.043 -7.976  44.993 1.00 41.72 ? 526 UNX A UNK 1 
HETATM 1833 X UNK . UNX CA 3 .   ? 69.989 0.029   51.526 1.00 21.58 ? 527 UNX A UNK 1 
HETATM 1834 X UNK . UNX DA 3 .   ? 45.551 -0.053  57.909 1.00 49.13 ? 528 UNX A UNK 1 
HETATM 1835 X UNK . UNX EA 3 .   ? 61.042 7.644   32.776 1.00 25.05 ? 529 UNX A UNK 1 
HETATM 1836 X UNK . UNX FA 3 .   ? 69.682 -14.197 81.622 1.00 51.98 ? 530 UNX A UNK 1 
HETATM 1837 X UNK . UNX GA 3 .   ? 72.751 -31.157 79.866 1.00 34.28 ? 531 UNX A UNK 1 
HETATM 1838 X UNK . UNX HA 3 .   ? 58.117 1.283   65.174 1.00 29.09 ? 532 UNX A UNK 1 
HETATM 1839 X UNK . UNX IA 3 .   ? 74.849 -7.292  78.085 1.00 36.48 ? 533 UNX A UNK 1 
HETATM 1840 X UNK . UNX JA 3 .   ? 56.384 13.098  44.779 1.00 47.14 ? 534 UNX A UNK 1 
HETATM 1841 X UNK . UNX KA 3 .   ? 76.231 -3.130  51.175 1.00 36.97 ? 535 UNX A UNK 1 
HETATM 1842 X UNK . UNX LA 3 .   ? 61.425 -14.179 44.987 1.00 41.45 ? 536 UNX A UNK 1 
HETATM 1843 X UNK . UNX MA 3 .   ? 64.352 12.857  63.053 1.00 28.68 ? 537 UNX A UNK 1 
HETATM 1844 X UNK . UNX NA 3 .   ? 71.587 8.237   52.594 1.00 32.13 ? 538 UNX A UNK 1 
HETATM 1845 X UNK . UNX OA 3 .   ? 75.295 -8.096  50.270 1.00 48.72 ? 539 UNX A UNK 1 
HETATM 1846 X UNK . UNX PA 3 .   ? 40.092 12.338  58.060 1.00 43.07 ? 540 UNX A UNK 1 
HETATM 1847 O O   . HOH QA 4 .   ? 45.199 -0.887  44.992 1.00 46.78 ? 601 HOH A O   1 
HETATM 1848 O O   . HOH QA 4 .   ? 57.846 1.526   35.847 1.00 40.99 ? 602 HOH A O   1 
HETATM 1849 O O   . HOH QA 4 .   ? 53.631 12.482  45.445 1.00 46.38 ? 603 HOH A O   1 
HETATM 1850 O O   . HOH QA 4 .   ? 70.891 -21.293 83.438 1.00 32.49 ? 604 HOH A O   1 
HETATM 1851 O O   . HOH QA 4 .   ? 43.089 -4.012  50.290 1.00 49.20 ? 605 HOH A O   1 
HETATM 1852 O O   . HOH QA 4 .   ? 75.158 -37.248 65.065 1.00 45.80 ? 606 HOH A O   1 
HETATM 1853 O O   . HOH QA 4 .   ? 64.644 3.435   48.996 1.00 18.28 ? 607 HOH A O   1 
HETATM 1854 O O   . HOH QA 4 .   ? 49.754 -5.459  53.229 0.50 19.56 ? 608 HOH A O   1 
HETATM 1855 O O   . HOH QA 4 .   ? 47.308 -7.206  56.605 1.00 32.87 ? 609 HOH A O   1 
HETATM 1856 O O   . HOH QA 4 .   ? 48.732 11.156  65.556 1.00 38.76 ? 610 HOH A O   1 
HETATM 1857 O O   . HOH QA 4 .   ? 70.519 -15.325 48.993 1.00 23.62 ? 611 HOH A O   1 
HETATM 1858 O O   . HOH QA 4 .   ? 83.817 -25.832 66.918 1.00 41.60 ? 612 HOH A O   1 
HETATM 1859 O O   . HOH QA 4 .   ? 80.971 -18.073 75.952 1.00 45.20 ? 613 HOH A O   1 
HETATM 1860 O O   . HOH QA 4 .   ? 56.736 -0.479  61.770 1.00 16.63 ? 614 HOH A O   1 
HETATM 1861 O O   . HOH QA 4 .   ? 77.786 -35.674 60.366 1.00 37.14 ? 615 HOH A O   1 
HETATM 1862 O O   . HOH QA 4 .   ? 80.470 -14.654 73.078 1.00 38.17 ? 616 HOH A O   1 
HETATM 1863 O O   . HOH QA 4 .   ? 76.900 -9.167  63.276 1.00 38.43 ? 617 HOH A O   1 
HETATM 1864 O O   . HOH QA 4 .   ? 66.460 -13.219 48.612 1.00 23.83 ? 618 HOH A O   1 
HETATM 1865 O O   . HOH QA 4 .   ? 66.435 2.290   50.715 1.00 18.03 ? 619 HOH A O   1 
HETATM 1866 O O   . HOH QA 4 .   ? 62.903 1.151   72.211 1.00 38.07 ? 620 HOH A O   1 
HETATM 1867 O O   . HOH QA 4 .   ? 55.097 -14.082 63.902 1.00 38.67 ? 621 HOH A O   1 
HETATM 1868 O O   . HOH QA 4 .   ? 39.301 3.409   64.218 1.00 27.22 ? 622 HOH A O   1 
HETATM 1869 O O   . HOH QA 4 .   ? 62.460 8.511   39.065 1.00 42.91 ? 623 HOH A O   1 
HETATM 1870 O O   . HOH QA 4 .   ? 66.901 -1.438  78.134 1.00 42.90 ? 624 HOH A O   1 
HETATM 1871 O O   . HOH QA 4 .   ? 77.318 -12.129 53.060 1.00 40.60 ? 625 HOH A O   1 
HETATM 1872 O O   . HOH QA 4 .   ? 55.307 20.418  59.376 1.00 33.79 ? 626 HOH A O   1 
HETATM 1873 O O   . HOH QA 4 .   ? 61.673 -14.370 65.275 1.00 14.82 ? 627 HOH A O   1 
HETATM 1874 O O   . HOH QA 4 .   ? 51.494 -3.912  52.524 1.00 25.18 ? 628 HOH A O   1 
HETATM 1875 O O   . HOH QA 4 .   ? 55.759 -13.130 50.794 1.00 42.30 ? 629 HOH A O   1 
HETATM 1876 O O   . HOH QA 4 .   ? 73.730 -24.996 63.289 1.00 24.25 ? 630 HOH A O   1 
HETATM 1877 O O   . HOH QA 4 .   ? 69.215 13.650  67.260 1.00 30.70 ? 631 HOH A O   1 
HETATM 1878 O O   . HOH QA 4 .   ? 74.386 -17.997 53.425 1.00 16.45 ? 632 HOH A O   1 
HETATM 1879 O O   . HOH QA 4 .   ? 62.299 -26.036 80.548 1.00 38.35 ? 633 HOH A O   1 
HETATM 1880 O O   . HOH QA 4 .   ? 67.240 13.206  63.022 1.00 33.33 ? 634 HOH A O   1 
HETATM 1881 O O   . HOH QA 4 .   ? 67.271 9.065   57.835 1.00 21.53 ? 635 HOH A O   1 
HETATM 1882 O O   . HOH QA 4 .   ? 77.720 -0.444  64.777 1.00 38.83 ? 636 HOH A O   1 
HETATM 1883 O O   . HOH QA 4 .   ? 69.129 8.522   52.465 1.00 30.49 ? 637 HOH A O   1 
HETATM 1884 O O   . HOH QA 4 .   ? 53.066 -5.699  63.999 1.00 36.95 ? 638 HOH A O   1 
HETATM 1885 O O   . HOH QA 4 .   ? 41.839 -8.003  53.590 1.00 45.74 ? 639 HOH A O   1 
HETATM 1886 O O   . HOH QA 4 .   ? 42.955 5.670   54.848 1.00 21.70 ? 640 HOH A O   1 
HETATM 1887 O O   . HOH QA 4 .   ? 65.888 10.311  65.771 1.00 32.69 ? 641 HOH A O   1 
HETATM 1888 O O   . HOH QA 4 .   ? 84.084 -27.768 69.285 1.00 46.91 ? 642 HOH A O   1 
HETATM 1889 O O   . HOH QA 4 .   ? 54.753 -1.970  60.513 1.00 17.40 ? 643 HOH A O   1 
HETATM 1890 O O   . HOH QA 4 .   ? 74.563 -12.002 64.724 1.00 26.30 ? 644 HOH A O   1 
HETATM 1891 O O   . HOH QA 4 .   ? 71.980 -20.932 51.957 1.00 17.65 ? 645 HOH A O   1 
HETATM 1892 O O   . HOH QA 4 .   ? 60.673 -2.453  68.933 1.00 21.03 ? 646 HOH A O   1 
HETATM 1893 O O   . HOH QA 4 .   ? 64.320 -2.013  77.198 1.00 36.99 ? 647 HOH A O   1 
HETATM 1894 O O   . HOH QA 4 .   ? 41.739 4.077   49.265 1.00 32.94 ? 648 HOH A O   1 
HETATM 1895 O O   . HOH QA 4 .   ? 62.183 -18.950 79.032 1.00 27.58 ? 649 HOH A O   1 
HETATM 1896 O O   . HOH QA 4 .   ? 53.152 -9.492  61.907 1.00 34.14 ? 650 HOH A O   1 
HETATM 1897 O O   . HOH QA 4 .   ? 74.933 -15.947 76.191 1.00 24.28 ? 651 HOH A O   1 
HETATM 1898 O O   . HOH QA 4 .   ? 58.953 -14.578 61.534 1.00 24.31 ? 652 HOH A O   1 
HETATM 1899 O O   . HOH QA 4 .   ? 60.316 -19.227 52.304 1.00 42.60 ? 653 HOH A O   1 
HETATM 1900 O O   . HOH QA 4 .   ? 70.472 1.079   75.980 1.00 31.86 ? 654 HOH A O   1 
HETATM 1901 O O   . HOH QA 4 .   ? 78.359 -21.776 82.445 1.00 30.62 ? 655 HOH A O   1 
HETATM 1902 O O   . HOH QA 4 .   ? 82.219 -21.984 66.215 1.00 50.91 ? 656 HOH A O   1 
HETATM 1903 O O   . HOH QA 4 .   ? 59.630 -7.372  48.997 1.00 24.82 ? 657 HOH A O   1 
HETATM 1904 O O   . HOH QA 4 .   ? 76.672 -31.876 74.470 1.00 21.41 ? 658 HOH A O   1 
HETATM 1905 O O   . HOH QA 4 .   ? 60.450 16.776  58.078 1.00 35.42 ? 659 HOH A O   1 
HETATM 1906 O O   . HOH QA 4 .   ? 61.824 -24.225 69.036 1.00 26.08 ? 660 HOH A O   1 
HETATM 1907 O O   . HOH QA 4 .   ? 74.259 -21.415 61.185 1.00 34.57 ? 661 HOH A O   1 
HETATM 1908 O O   . HOH QA 4 .   ? 77.664 -18.219 61.527 1.00 29.83 ? 662 HOH A O   1 
HETATM 1909 O O   . HOH QA 4 .   ? 50.494 8.692   42.545 1.00 39.08 ? 663 HOH A O   1 
HETATM 1910 O O   . HOH QA 4 .   ? 77.626 -0.515  48.536 1.00 39.73 ? 664 HOH A O   1 
HETATM 1911 O O   . HOH QA 4 .   ? 70.184 -4.144  45.809 1.00 28.22 ? 665 HOH A O   1 
HETATM 1912 O O   . HOH QA 4 .   ? 42.400 -3.971  52.906 1.00 34.32 ? 666 HOH A O   1 
HETATM 1913 O O   . HOH QA 4 .   ? 59.082 -27.727 80.456 1.00 47.42 ? 667 HOH A O   1 
HETATM 1914 O O   . HOH QA 4 .   ? 49.101 19.030  54.348 1.00 19.88 ? 668 HOH A O   1 
HETATM 1915 O O   . HOH QA 4 .   ? 47.371 18.270  57.624 1.00 33.62 ? 669 HOH A O   1 
HETATM 1916 O O   . HOH QA 4 .   ? 74.174 -18.431 49.464 1.00 15.37 ? 670 HOH A O   1 
HETATM 1917 O O   . HOH QA 4 .   ? 49.941 -3.371  46.751 1.00 23.18 ? 671 HOH A O   1 
HETATM 1918 O O   . HOH QA 4 .   ? 56.891 -19.576 75.763 1.00 40.65 ? 672 HOH A O   1 
HETATM 1919 O O   . HOH QA 4 .   ? 73.488 -20.736 82.793 1.00 29.47 ? 673 HOH A O   1 
HETATM 1920 O O   . HOH QA 4 .   ? 66.868 -22.988 81.641 1.00 26.28 ? 674 HOH A O   1 
HETATM 1921 O O   . HOH QA 4 .   ? 59.692 -14.165 57.919 1.00 17.48 ? 675 HOH A O   1 
HETATM 1922 O O   . HOH QA 4 .   ? 72.394 5.760   53.589 1.00 19.23 ? 676 HOH A O   1 
HETATM 1923 O O   . HOH QA 4 .   ? 62.920 -18.250 52.749 1.00 32.00 ? 677 HOH A O   1 
HETATM 1924 O O   . HOH QA 4 .   ? 64.634 12.426  59.532 1.00 19.06 ? 678 HOH A O   1 
HETATM 1925 O O   . HOH QA 4 .   ? 67.900 -15.415 49.215 1.00 22.65 ? 679 HOH A O   1 
HETATM 1926 O O   . HOH QA 4 .   ? 65.133 12.731  50.801 1.00 37.10 ? 680 HOH A O   1 
HETATM 1927 O O   . HOH QA 4 .   ? 51.480 15.729  63.756 1.00 39.65 ? 681 HOH A O   1 
HETATM 1928 O O   . HOH QA 4 .   ? 48.043 14.157  48.968 1.00 35.15 ? 682 HOH A O   1 
HETATM 1929 O O   . HOH QA 4 .   ? 37.878 7.488   51.772 1.00 40.63 ? 683 HOH A O   1 
HETATM 1930 O O   . HOH QA 4 .   ? 37.377 5.237   61.397 1.00 25.24 ? 684 HOH A O   1 
HETATM 1931 O O   . HOH QA 4 .   ? 67.559 -16.477 62.383 1.00 17.53 ? 685 HOH A O   1 
HETATM 1932 O O   . HOH QA 4 .   ? 75.672 -31.960 77.328 1.00 33.43 ? 686 HOH A O   1 
HETATM 1933 O O   . HOH QA 4 .   ? 65.670 12.127  53.342 1.00 37.12 ? 687 HOH A O   1 
HETATM 1934 O O   . HOH QA 4 .   ? 80.628 -30.249 63.772 1.00 43.56 ? 688 HOH A O   1 
HETATM 1935 O O   . HOH QA 4 .   ? 70.904 -15.665 59.354 1.00 15.26 ? 689 HOH A O   1 
HETATM 1936 O O   . HOH QA 4 .   ? 60.400 5.686   65.546 1.00 24.13 ? 690 HOH A O   1 
HETATM 1937 O O   . HOH QA 4 .   ? 58.715 11.506  44.554 1.00 39.65 ? 691 HOH A O   1 
HETATM 1938 O O   . HOH QA 4 .   ? 60.993 -5.648  58.278 1.00 19.07 ? 692 HOH A O   1 
HETATM 1939 O O   . HOH QA 4 .   ? 80.767 -26.912 78.838 1.00 29.82 ? 693 HOH A O   1 
HETATM 1940 O O   . HOH QA 4 .   ? 81.468 -33.647 66.549 1.00 38.73 ? 694 HOH A O   1 
HETATM 1941 O O   . HOH QA 4 .   ? 66.202 -9.358  46.310 1.00 29.89 ? 695 HOH A O   1 
HETATM 1942 O O   . HOH QA 4 .   ? 74.907 -37.322 61.818 1.00 41.73 ? 696 HOH A O   1 
HETATM 1943 O O   . HOH QA 4 .   ? 61.433 -15.125 62.667 1.00 16.77 ? 697 HOH A O   1 
HETATM 1944 O O   . HOH QA 4 .   ? 62.166 -20.640 62.238 1.00 30.74 ? 698 HOH A O   1 
HETATM 1945 O O   . HOH QA 4 .   ? 61.362 0.028   70.055 1.00 23.29 ? 699 HOH A O   1 
HETATM 1946 O O   . HOH QA 4 .   ? 81.998 -34.805 68.871 1.00 39.94 ? 700 HOH A O   1 
HETATM 1947 O O   . HOH QA 4 .   ? 63.136 3.483   70.255 1.00 35.54 ? 701 HOH A O   1 
HETATM 1948 O O   . HOH QA 4 .   ? 77.758 6.435   66.485 1.00 33.25 ? 702 HOH A O   1 
HETATM 1949 O O   . HOH QA 4 .   ? 42.043 11.975  61.545 1.00 38.06 ? 703 HOH A O   1 
HETATM 1950 O O   . HOH QA 4 .   ? 64.781 -9.437  77.394 1.00 45.60 ? 704 HOH A O   1 
HETATM 1951 O O   . HOH QA 4 .   ? 75.098 2.933   44.744 1.00 44.53 ? 705 HOH A O   1 
HETATM 1952 O O   . HOH QA 4 .   ? 59.604 -13.209 73.500 1.00 23.06 ? 706 HOH A O   1 
HETATM 1953 O O   . HOH QA 4 .   ? 50.900 13.107  67.165 1.00 41.39 ? 707 HOH A O   1 
HETATM 1954 O O   . HOH QA 4 .   ? 64.845 -16.186 62.668 1.00 17.11 ? 708 HOH A O   1 
HETATM 1955 O O   . HOH QA 4 .   ? 76.918 -13.696 58.408 1.00 30.20 ? 709 HOH A O   1 
HETATM 1956 O O   . HOH QA 4 .   ? 45.759 11.863  52.402 1.00 18.31 ? 710 HOH A O   1 
HETATM 1957 O O   . HOH QA 4 .   ? 58.261 15.056  63.409 1.00 28.89 ? 711 HOH A O   1 
HETATM 1958 O O   . HOH QA 4 .   ? 74.636 0.578   45.908 1.00 32.51 ? 712 HOH A O   1 
HETATM 1959 O O   . HOH QA 4 .   ? 57.286 -1.218  44.671 1.00 33.69 ? 713 HOH A O   1 
HETATM 1960 O O   . HOH QA 4 .   ? 75.015 -11.196 61.700 1.00 21.43 ? 714 HOH A O   1 
HETATM 1961 O O   . HOH QA 4 .   ? 76.963 -25.997 62.326 1.00 29.05 ? 715 HOH A O   1 
HETATM 1962 O O   . HOH QA 4 .   ? 74.962 -11.105 54.821 1.00 28.44 ? 716 HOH A O   1 
HETATM 1963 O O   . HOH QA 4 .   ? 67.060 1.583   76.724 1.00 43.94 ? 717 HOH A O   1 
HETATM 1964 O O   . HOH QA 4 .   ? 73.743 3.033   59.448 1.00 24.69 ? 718 HOH A O   1 
HETATM 1965 O O   . HOH QA 4 .   ? 49.727 15.684  61.370 1.00 30.79 ? 719 HOH A O   1 
HETATM 1966 O O   . HOH QA 4 .   ? 71.163 8.040   55.409 1.00 38.55 ? 720 HOH A O   1 
HETATM 1967 O O   . HOH QA 4 .   ? 61.651 -15.653 59.349 1.00 16.81 ? 721 HOH A O   1 
HETATM 1968 O O   . HOH QA 4 .   ? 49.563 14.474  65.058 1.00 44.95 ? 722 HOH A O   1 
HETATM 1969 O O   . HOH QA 4 .   ? 64.309 -9.375  58.801 1.00 17.25 ? 723 HOH A O   1 
HETATM 1970 O O   . HOH QA 4 .   ? 85.671 -25.222 69.823 1.00 43.90 ? 724 HOH A O   1 
HETATM 1971 O O   . HOH QA 4 .   ? 61.296 13.176  56.210 1.00 18.74 ? 725 HOH A O   1 
HETATM 1972 O O   . HOH QA 4 .   ? 58.630 -24.176 70.529 1.00 39.07 ? 726 HOH A O   1 
HETATM 1973 O O   . HOH QA 4 .   ? 83.502 -18.697 68.742 1.00 40.17 ? 727 HOH A O   1 
HETATM 1974 O O   . HOH QA 4 .   ? 60.714 3.145   66.288 1.00 20.19 ? 728 HOH A O   1 
HETATM 1975 O O   . HOH QA 4 .   ? 71.637 7.394   49.924 1.00 21.90 ? 729 HOH A O   1 
HETATM 1976 O O   . HOH QA 4 .   ? 61.758 13.731  48.719 1.00 28.55 ? 730 HOH A O   1 
HETATM 1977 O O   . HOH QA 4 .   ? 54.384 0.634   63.428 1.00 21.45 ? 731 HOH A O   1 
HETATM 1978 O O   . HOH QA 4 .   ? 71.131 3.264   72.674 1.00 48.74 ? 732 HOH A O   1 
HETATM 1979 O O   . HOH QA 4 .   ? 58.273 17.575  59.956 1.00 32.07 ? 733 HOH A O   1 
HETATM 1980 O O   . HOH QA 4 .   ? 44.006 1.404   45.890 1.00 29.12 ? 734 HOH A O   1 
HETATM 1981 O O   . HOH QA 4 .   ? 50.109 -1.574  44.648 1.00 26.58 ? 735 HOH A O   1 
HETATM 1982 O O   . HOH QA 4 .   ? 75.467 -33.810 72.964 1.00 30.39 ? 736 HOH A O   1 
HETATM 1983 O O   . HOH QA 4 .   ? 42.529 3.393   56.535 1.00 27.26 ? 737 HOH A O   1 
HETATM 1984 O O   . HOH QA 4 .   ? 37.477 7.943   58.958 1.00 32.28 ? 738 HOH A O   1 
HETATM 1985 O O   . HOH QA 4 .   ? 69.689 8.385   61.324 1.00 26.03 ? 739 HOH A O   1 
HETATM 1986 O O   . HOH QA 4 .   ? 76.266 -17.788 80.665 1.00 23.53 ? 740 HOH A O   1 
HETATM 1987 O O   A HOH QA 4 .   ? 60.622 -17.753 60.769 0.70 21.45 ? 741 HOH A O   1 
HETATM 1988 O O   . HOH QA 4 .   ? 66.950 -21.829 59.226 1.00 26.22 ? 742 HOH A O   1 
HETATM 1989 O O   . HOH QA 4 .   ? 54.796 5.884   68.430 1.00 54.67 ? 743 HOH A O   1 
HETATM 1990 O O   . HOH QA 4 .   ? 36.270 5.714   55.740 1.00 36.33 ? 744 HOH A O   1 
HETATM 1991 O O   . HOH QA 4 .   ? 59.929 -20.419 78.371 1.00 29.80 ? 745 HOH A O   1 
HETATM 1992 O O   . HOH QA 4 .   ? 47.563 3.313   66.042 1.00 41.22 ? 746 HOH A O   1 
HETATM 1993 O O   . HOH QA 4 .   ? 71.067 -9.887  78.524 1.00 40.17 ? 747 HOH A O   1 
HETATM 1994 O O   . HOH QA 4 .   ? 67.352 10.249  49.386 1.00 30.40 ? 748 HOH A O   1 
HETATM 1995 O O   . HOH QA 4 .   ? 76.704 10.497  64.633 1.00 29.67 ? 749 HOH A O   1 
HETATM 1996 O O   . HOH QA 4 .   ? 62.617 -22.438 65.982 1.00 43.07 ? 750 HOH A O   1 
HETATM 1997 O O   . HOH QA 4 .   ? 56.855 -16.850 51.787 1.00 34.67 ? 751 HOH A O   1 
HETATM 1998 O O   . HOH QA 4 .   ? 69.788 2.092   45.934 1.00 35.48 ? 752 HOH A O   1 
HETATM 1999 O O   . HOH QA 4 .   ? 49.999 -0.502  62.230 1.00 44.75 ? 753 HOH A O   1 
HETATM 2000 O O   . HOH QA 4 .   ? 80.718 -18.065 50.168 1.00 40.84 ? 754 HOH A O   1 
HETATM 2001 O O   . HOH QA 4 .   ? 35.769 5.906   58.353 1.00 35.39 ? 755 HOH A O   1 
HETATM 2002 O O   . HOH QA 4 .   ? 71.219 7.014   59.084 1.00 26.28 ? 756 HOH A O   1 
HETATM 2003 O O   . HOH QA 4 .   ? 74.003 11.472  62.635 1.00 26.58 ? 757 HOH A O   1 
HETATM 2004 O O   . HOH QA 4 .   ? 60.584 -25.854 83.002 1.00 48.65 ? 758 HOH A O   1 
HETATM 2005 O O   . HOH QA 4 .   ? 60.532 -21.572 64.646 1.00 49.38 ? 759 HOH A O   1 
HETATM 2006 O O   . HOH QA 4 .   ? 76.278 -20.463 59.181 1.00 47.81 ? 760 HOH A O   1 
HETATM 2007 O O   . HOH QA 4 .   ? 79.250 -32.920 75.839 1.00 33.27 ? 761 HOH A O   1 
HETATM 2008 O O   . HOH QA 4 .   ? 56.226 -18.247 54.246 1.00 54.00 ? 762 HOH A O   1 
HETATM 2009 O O   . HOH QA 4 .   ? 60.609 -2.302  47.292 1.00 37.99 ? 763 HOH A O   1 
HETATM 2010 O O   . HOH QA 4 .   ? 58.688 0.962   69.784 1.00 44.42 ? 764 HOH A O   1 
HETATM 2011 O O   . HOH QA 4 .   ? 63.881 13.810  57.219 1.00 20.11 ? 765 HOH A O   1 
HETATM 2012 O O   . HOH QA 4 .   ? 64.140 -21.394 59.267 1.00 39.06 ? 766 HOH A O   1 
HETATM 2013 O O   . HOH QA 4 .   ? 77.649 -16.242 47.566 1.00 27.33 ? 767 HOH A O   1 
HETATM 2014 O O   . HOH QA 4 .   ? 46.445 11.731  49.694 1.00 35.52 ? 768 HOH A O   1 
HETATM 2015 O O   . HOH QA 4 .   ? 70.054 9.158   48.543 1.00 39.95 ? 769 HOH A O   1 
HETATM 2016 O O   . HOH QA 4 .   ? 74.213 10.242  60.245 1.00 43.40 ? 770 HOH A O   1 
HETATM 2017 O O   . HOH QA 4 .   ? 57.353 -15.354 58.664 1.00 35.73 ? 771 HOH A O   1 
HETATM 2018 O O   . HOH QA 4 .   ? 72.496 -3.039  44.735 1.00 39.41 ? 772 HOH A O   1 
HETATM 2019 O O   . HOH QA 4 .   ? 48.245 17.731  61.130 1.00 39.26 ? 773 HOH A O   1 
HETATM 2020 O O   . HOH QA 4 .   ? 66.122 14.096  55.579 1.00 37.40 ? 774 HOH A O   1 
HETATM 2021 O O   . HOH QA 4 .   ? 57.649 -7.911  47.377 1.00 34.98 ? 775 HOH A O   1 
HETATM 2022 O O   . HOH QA 4 .   ? 76.949 -19.514 82.914 1.00 45.77 ? 776 HOH A O   1 
HETATM 2023 O O   . HOH QA 4 .   ? 62.470 -26.324 67.055 1.00 30.95 ? 777 HOH A O   1 
HETATM 2024 O O   . HOH QA 4 .   ? 61.425 -5.867  47.630 1.00 42.65 ? 778 HOH A O   1 
HETATM 2025 O O   . HOH QA 4 .   ? 63.618 -24.779 65.236 1.00 31.49 ? 779 HOH A O   1 
HETATM 2026 O O   . HOH QA 4 .   ? 68.924 9.559   55.491 1.00 36.69 ? 780 HOH A O   1 
HETATM 2027 O O   . HOH QA 4 .   ? 79.767 -15.771 75.386 1.00 45.19 ? 781 HOH A O   1 
HETATM 2028 O O   . HOH QA 4 .   ? 61.154 -6.670  55.548 1.00 21.97 ? 782 HOH A O   1 
HETATM 2029 O O   . HOH QA 4 .   ? 71.989 -37.927 60.814 1.00 45.85 ? 783 HOH A O   1 
HETATM 2030 O O   . HOH QA 4 .   ? 55.957 -13.238 58.938 1.00 45.38 ? 784 HOH A O   1 
HETATM 2031 O O   . HOH QA 4 .   ? 76.256 -18.187 51.350 1.00 18.48 ? 785 HOH A O   1 
HETATM 2032 O O   . HOH QA 4 .   ? 69.952 15.544  65.472 1.00 43.53 ? 786 HOH A O   1 
HETATM 2033 O O   . HOH QA 4 .   ? 44.379 3.800   44.505 1.00 45.10 ? 787 HOH A O   1 
HETATM 2034 O O   . HOH QA 4 .   ? 68.429 10.208  59.778 1.00 28.70 ? 788 HOH A O   1 
HETATM 2035 O O   . HOH QA 4 .   ? 67.984 10.784  52.269 1.00 41.90 ? 789 HOH A O   1 
HETATM 2036 O O   . HOH QA 4 .   ? 69.977 -21.920 85.764 1.00 44.90 ? 790 HOH A O   1 
HETATM 2037 O O   . HOH QA 4 .   ? 67.350 12.578  60.156 1.00 29.27 ? 791 HOH A O   1 
HETATM 2038 O O   . HOH QA 4 .   ? 58.463 -27.509 83.060 1.00 50.72 ? 792 HOH A O   1 
HETATM 2039 O O   . HOH QA 4 .   ? 78.327 -13.630 50.980 1.00 34.99 ? 793 HOH A O   1 
HETATM 2040 O O   . HOH QA 4 .   ? 78.010 -16.329 50.274 1.00 24.59 ? 794 HOH A O   1 
HETATM 2041 O O   . HOH QA 4 .   ? 77.387 -15.577 77.111 1.00 40.90 ? 795 HOH A O   1 
HETATM 2042 O O   . HOH QA 4 .   ? 78.175 -12.025 48.834 1.00 48.19 ? 796 HOH A O   1 
HETATM 2043 O O   . HOH QA 4 .   ? 68.288 15.489  63.417 1.00 49.14 ? 797 HOH A O   1 
HETATM 2044 O O   . HOH QA 4 .   ? 78.743 -20.530 61.108 1.00 41.48 ? 798 HOH A O   1 
HETATM 2045 O O   . HOH QA 4 .   ? 76.896 -7.210  53.698 1.00 38.81 ? 799 HOH A O   1 
HETATM 2046 O O   . HOH QA 4 .   ? 63.010 16.109  58.617 1.00 31.94 ? 800 HOH A O   1 
HETATM 2047 O O   . HOH QA 4 .   ? 75.769 -9.682  52.689 1.00 40.69 ? 801 HOH A O   1 
HETATM 2048 O O   . HOH QA 4 .   ? 74.933 -18.953 84.442 1.00 40.22 ? 802 HOH A O   1 
HETATM 2049 O O   . HOH QA 4 .   ? 80.225 -20.480 51.078 1.00 41.12 ? 803 HOH A O   1 
HETATM 2050 O O   . HOH QA 4 .   ? 78.437 -20.516 54.959 1.00 33.59 ? 804 HOH A O   1 
HETATM 2051 O O   . HOH QA 4 .   ? 80.294 -18.677 78.480 1.00 41.88 ? 805 HOH A O   1 
HETATM 2052 O O   . HOH QA 4 .   ? 65.298 2.009   46.621 1.00 37.93 ? 806 HOH A O   1 
HETATM 2053 O O   . HOH QA 4 .   ? 60.743 12.301  42.950 1.00 44.82 ? 807 HOH A O   1 
HETATM 2054 O O   . HOH QA 4 .   ? 76.887 -11.550 59.939 1.00 43.78 ? 808 HOH A O   1 
HETATM 2055 O O   . HOH QA 4 .   ? 43.432 13.326  52.786 1.00 29.33 ? 809 HOH A O   1 
HETATM 2056 O O   . HOH QA 4 .   ? 77.831 -20.256 52.263 1.00 27.64 ? 810 HOH A O   1 
HETATM 2057 O O   . HOH QA 4 .   ? 42.754 14.972  54.828 1.00 35.68 ? 811 HOH A O   1 
HETATM 2058 O O   . HOH RA 4 .   ? 55.025 -6.177  52.206 1.00 39.78 ? 101 HOH B O   1 
HETATM 2059 O O   . HOH RA 4 .   ? 55.700 -4.758  45.685 1.00 39.15 ? 102 HOH B O   1 
HETATM 2060 O O   . HOH RA 4 .   ? 60.091 -0.693  49.432 1.00 16.27 ? 103 HOH B O   1 
HETATM 2061 O O   . HOH RA 4 .   ? 55.451 -7.488  49.040 1.00 42.85 ? 104 HOH B O   1 
HETATM 2062 O O   . HOH RA 4 .   ? 49.086 -0.522  59.366 1.00 37.56 ? 105 HOH B O   1 
HETATM 2063 O O   . HOH RA 4 .   ? 58.714 -6.639  54.149 1.00 20.00 ? 106 HOH B O   1 
HETATM 2064 O O   . HOH RA 4 .   ? 53.500 -9.552  48.509 1.00 45.21 ? 107 HOH B O   1 
HETATM 2065 O O   . HOH RA 4 .   ? 51.744 -7.126  62.422 1.00 35.36 ? 108 HOH B O   1 
HETATM 2066 O O   . HOH RA 4 .   ? 58.014 -6.465  51.501 1.00 26.02 ? 109 HOH B O   1 
HETATM 2067 O O   . HOH RA 4 .   ? 52.827 -1.571  62.652 1.00 32.60 ? 110 HOH B O   1 
HETATM 2068 O O   . HOH RA 4 .   ? 52.373 -2.364  43.458 1.00 39.02 ? 111 HOH B O   1 
HETATM 2069 O O   . HOH RA 4 .   ? 55.309 -2.740  43.998 1.00 31.86 ? 112 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A  18  ? 0.8811 0.5950 0.7803 -0.0438 0.0720  -0.0108 189 GLY A N   
2    C CA  . GLY A  18  ? 0.8855 0.3626 0.4902 0.0181  0.0478  -0.0394 189 GLY A CA  
3    C C   . GLY A  18  ? 0.5551 0.3806 0.3323 0.0313  -0.0201 -0.1127 189 GLY A C   
4    O O   . GLY A  18  ? 0.6233 0.4038 0.4610 0.1584  -0.0549 -0.0511 189 GLY A O   
5    N N   . GLY A  19  ? 0.5721 0.3393 0.3908 0.0686  -0.0848 -0.0292 190 GLY A N   
6    C CA  . GLY A  19  ? 0.4976 0.3077 0.3144 0.0591  -0.0667 -0.0708 190 GLY A CA  
7    C C   . GLY A  19  ? 0.5114 0.2865 0.2497 0.0643  -0.0945 -0.0287 190 GLY A C   
8    O O   . GLY A  19  ? 0.3998 0.2997 0.1906 0.0813  -0.0779 0.0058  190 GLY A O   
9    N N   . GLU A  20  ? 0.4000 0.2897 0.2319 0.1411  -0.0930 -0.0378 191 GLU A N   
10   C CA  . GLU A  20  ? 0.3476 0.2424 0.2149 0.1127  -0.0737 -0.0045 191 GLU A CA  
11   C C   . GLU A  20  ? 0.3137 0.2740 0.1539 0.1056  -0.0614 0.0054  191 GLU A C   
12   O O   . GLU A  20  ? 0.3190 0.3207 0.2766 0.1263  -0.0615 -0.0361 191 GLU A O   
13   C CB  . GLU A  20  ? 0.3896 0.3620 0.2109 0.0136  -0.1246 0.0327  191 GLU A CB  
14   C CG  . GLU A  20  ? 0.3975 0.3640 0.2365 0.0080  -0.1067 0.0469  191 GLU A CG  
15   C CD  . GLU A  20  ? 0.5079 0.4009 0.3581 0.0130  -0.1124 -0.0501 191 GLU A CD  
16   O OE1 . GLU A  20  ? 0.5901 0.3017 0.3632 0.0610  -0.0660 -0.0445 191 GLU A OE1 
17   O OE2 . GLU A  20  ? 0.6137 0.5230 0.5033 -0.0939 -0.1197 -0.1168 191 GLU A OE2 
18   N N   . LEU A  21  ? 0.3177 0.2598 0.1943 0.0669  -0.0350 0.0175  192 LEU A N   
19   C CA  . LEU A  21  ? 0.3126 0.2369 0.2344 0.0868  -0.0286 0.0102  192 LEU A CA  
20   C C   . LEU A  21  ? 0.3084 0.2411 0.2341 0.0417  -0.0605 -0.0108 192 LEU A C   
21   O O   . LEU A  21  ? 0.3346 0.2883 0.1941 0.0586  -0.0557 0.0125  192 LEU A O   
22   C CB  . LEU A  21  ? 0.3334 0.2446 0.2459 0.0873  -0.0403 0.0196  192 LEU A CB  
23   C CG  . LEU A  21  ? 0.3845 0.3314 0.2417 0.0994  -0.0237 -0.0014 192 LEU A CG  
24   C CD1 . LEU A  21  ? 0.3960 0.3919 0.3007 0.0244  -0.0628 0.0674  192 LEU A CD1 
25   C CD2 . LEU A  21  ? 0.3703 0.4973 0.3378 0.0826  0.0627  -0.0291 192 LEU A CD2 
26   N N   . SER A  22  ? 0.2392 0.2724 0.2245 0.0778  -0.0513 0.0245  193 SER A N   
27   C CA  A SER A  22  ? 0.2709 0.2616 0.2074 0.0679  -0.0454 0.0263  193 SER A CA  
28   C CA  B SER A  22  ? 0.2604 0.2560 0.2293 0.0601  -0.0258 0.0256  193 SER A CA  
29   C C   . SER A  22  ? 0.2985 0.2671 0.1852 0.0777  -0.0465 0.0433  193 SER A C   
30   O O   . SER A  22  ? 0.2405 0.2641 0.2453 0.0748  -0.0497 0.0077  193 SER A O   
31   C CB  A SER A  22  ? 0.2756 0.3599 0.1865 0.0395  -0.0741 -0.0158 193 SER A CB  
32   C CB  B SER A  22  ? 0.2717 0.2313 0.2140 0.0485  -0.0247 0.0420  193 SER A CB  
33   O OG  A SER A  22  ? 0.2792 0.4513 0.2562 0.0687  -0.0420 0.0267  193 SER A OG  
34   O OG  B SER A  22  ? 0.2370 0.2409 0.2377 0.0427  -0.0130 0.0689  193 SER A OG  
35   N N   . LYS A  23  ? 0.2949 0.2486 0.2396 0.0431  -0.0002 0.0449  194 LYS A N   
36   C CA  . LYS A  23  ? 0.3691 0.2721 0.2009 -0.0012 -0.0308 0.0497  194 LYS A CA  
37   C C   . LYS A  23  ? 0.3761 0.2650 0.2073 0.0357  0.0172  0.0056  194 LYS A C   
38   O O   . LYS A  23  ? 0.4545 0.3171 0.2221 0.0797  -0.0147 -0.0315 194 LYS A O   
39   C CB  . LYS A  23  ? 0.3695 0.2780 0.3483 0.0100  -0.0689 0.0056  194 LYS A CB  
40   C CG  . LYS A  23  ? 0.4494 0.4373 0.4199 0.1163  -0.0147 0.0629  194 LYS A CG  
41   N N   . ASP A  24  ? 0.2797 0.2722 0.2221 0.0346  -0.0213 0.0175  195 ASP A N   
42   C CA  . ASP A  24  ? 0.3402 0.3475 0.2482 0.0190  -0.0320 0.0595  195 ASP A CA  
43   C C   . ASP A  24  ? 0.2428 0.3354 0.2303 0.0331  -0.0345 0.1047  195 ASP A C   
44   O O   . ASP A  24  ? 0.2647 0.3401 0.2364 0.0418  -0.0216 0.0628  195 ASP A O   
45   C CB  . ASP A  24  ? 0.3572 0.4050 0.1859 0.0023  0.0107  0.0228  195 ASP A CB  
46   C CG  . ASP A  24  ? 0.3965 0.4102 0.2286 0.0166  0.0501  0.0707  195 ASP A CG  
47   O OD1 . ASP A  24  ? 0.3530 0.4772 0.2342 0.0104  0.0031  -0.0175 195 ASP A OD1 
48   O OD2 . ASP A  24  ? 0.3935 0.5753 0.2869 -0.0237 -0.0416 0.0362  195 ASP A OD2 
49   N N   . GLY A  25  ? 0.2416 0.3554 0.2803 0.0317  0.0200  0.0233  196 GLY A N   
50   C CA  . GLY A  25  ? 0.2545 0.3561 0.3499 0.0173  -0.0328 0.0600  196 GLY A CA  
51   C C   . GLY A  25  ? 0.2426 0.3219 0.3600 0.0071  -0.0392 0.0556  196 GLY A C   
52   O O   . GLY A  25  ? 0.3730 0.4532 0.3363 0.0197  -0.1456 0.0626  196 GLY A O   
53   N N   . ASP A  26  ? 0.2639 0.3012 0.3325 -0.0068 -0.0833 0.0529  197 ASP A N   
54   C CA  . ASP A  26  ? 0.3407 0.3314 0.3415 0.0346  -0.0867 0.0463  197 ASP A CA  
55   C C   . ASP A  26  ? 0.3289 0.2648 0.3489 0.0551  -0.0734 -0.0134 197 ASP A C   
56   O O   . ASP A  26  ? 0.4218 0.3151 0.2725 0.0284  -0.0551 0.0129  197 ASP A O   
57   C CB  . ASP A  26  ? 0.4153 0.3258 0.3899 0.0199  0.0430  0.0301  197 ASP A CB  
58   C CG  . ASP A  26  ? 0.4920 0.3255 0.4323 0.0768  0.0266  0.0461  197 ASP A CG  
59   O OD1 . ASP A  26  ? 0.3294 0.3636 0.5898 0.0022  -0.1133 0.1647  197 ASP A OD1 
60   O OD2 . ASP A  26  ? 0.5521 0.3494 0.7946 0.1624  0.2159  0.1112  197 ASP A OD2 
61   N N   . LEU A  27  ? 0.2637 0.2316 0.1847 0.0338  -0.0724 0.0593  198 LEU A N   
62   C CA  . LEU A  27  ? 0.2827 0.2486 0.2216 0.0539  -0.0326 0.0290  198 LEU A CA  
63   C C   . LEU A  27  ? 0.2764 0.2375 0.2062 0.0200  0.0007  0.0469  198 LEU A C   
64   O O   . LEU A  27  ? 0.3132 0.2694 0.1971 0.0577  -0.0331 0.0502  198 LEU A O   
65   C CB  . LEU A  27  ? 0.2065 0.2111 0.2515 0.0315  -0.0346 0.0487  198 LEU A CB  
66   C CG  . LEU A  27  ? 0.2484 0.2553 0.2078 0.0398  -0.0432 0.0550  198 LEU A CG  
67   C CD1 . LEU A  27  ? 0.2603 0.2369 0.2130 0.0455  -0.0432 0.0521  198 LEU A CD1 
68   C CD2 . LEU A  27  ? 0.3619 0.2877 0.2853 0.1230  -0.0753 0.0172  198 LEU A CD2 
69   N N   . ILE A  28  ? 0.2709 0.2360 0.1906 0.0376  -0.0209 0.0471  199 ILE A N   
70   C CA  . ILE A  28  ? 0.2484 0.2352 0.2058 0.0072  -0.0561 0.0441  199 ILE A CA  
71   C C   . ILE A  28  ? 0.2492 0.2224 0.1635 0.0424  -0.0398 0.0343  199 ILE A C   
72   O O   . ILE A  28  ? 0.2984 0.2339 0.1635 0.0730  -0.0521 0.0209  199 ILE A O   
73   C CB  . ILE A  28  ? 0.2920 0.3261 0.2343 0.0129  -0.1024 0.0226  199 ILE A CB  
74   C CG1 . ILE A  28  ? 0.4014 0.3427 0.2468 -0.0041 -0.0578 0.0640  199 ILE A CG1 
75   C CG2 . ILE A  28  ? 0.3762 0.4041 0.2549 0.0096  -0.0790 0.0747  199 ILE A CG2 
76   C CD1 . ILE A  28  ? 0.5694 0.4008 0.5341 -0.0777 -0.1294 0.0170  199 ILE A CD1 
77   N N   . VAL A  29  ? 0.2206 0.2042 0.1791 0.0543  -0.0356 0.0119  200 VAL A N   
78   C CA  . VAL A  29  ? 0.2577 0.2298 0.1833 0.0143  -0.0370 -0.0175 200 VAL A CA  
79   C C   . VAL A  29  ? 0.2259 0.1996 0.1687 0.0495  -0.0334 0.0061  200 VAL A C   
80   O O   . VAL A  29  ? 0.2422 0.2428 0.2120 0.0237  -0.0647 0.0468  200 VAL A O   
81   C CB  . VAL A  29  ? 0.2641 0.2373 0.2189 0.0374  -0.0037 -0.0301 200 VAL A CB  
82   C CG1 . VAL A  29  ? 0.3000 0.1862 0.2404 0.0531  -0.0169 0.0196  200 VAL A CG1 
83   C CG2 . VAL A  29  ? 0.2595 0.2247 0.1980 0.0456  -0.0169 -0.0003 200 VAL A CG2 
84   N N   . SER A  30  ? 0.2192 0.1897 0.1340 0.0573  -0.0626 0.0309  201 SER A N   
85   C CA  . SER A  30  ? 0.2578 0.2044 0.1416 0.0373  -0.0370 0.0174  201 SER A CA  
86   C C   . SER A  30  ? 0.2688 0.2119 0.1765 0.0450  -0.0102 0.0366  201 SER A C   
87   O O   . SER A  30  ? 0.3318 0.2205 0.1785 0.0735  -0.0644 -0.0113 201 SER A O   
88   C CB  . SER A  30  ? 0.2630 0.1941 0.1695 0.0391  -0.0405 0.0619  201 SER A CB  
89   O OG  . SER A  30  ? 0.2796 0.2600 0.1685 0.0065  -0.0977 0.0407  201 SER A OG  
90   N N   . MET A  31  ? 0.2719 0.1765 0.1522 0.0214  -0.0221 0.0166  202 MET A N   
91   C CA  . MET A  31  ? 0.2717 0.1882 0.2571 0.0387  -0.0363 0.0246  202 MET A CA  
92   C C   . MET A  31  ? 0.2608 0.1868 0.1939 0.0310  0.0150  0.0355  202 MET A C   
93   O O   . MET A  31  ? 0.3353 0.1961 0.1675 0.0572  -0.0628 0.0270  202 MET A O   
94   C CB  . MET A  31  ? 0.2718 0.2061 0.2618 0.0481  -0.0398 0.0622  202 MET A CB  
95   C CG  . MET A  31  ? 0.2440 0.2371 0.2366 0.0344  -0.0017 0.0351  202 MET A CG  
96   S SD  . MET A  31  ? 0.3639 0.2871 0.2675 0.0938  0.0339  0.1012  202 MET A SD  
97   C CE  . MET A  31  ? 0.4858 0.2737 0.3266 0.0857  0.1129  0.0944  202 MET A CE  
98   N N   . ARG A  32  ? 0.2549 0.1964 0.1876 0.0367  -0.0765 0.0012  203 ARG A N   
99   C CA  . ARG A  32  ? 0.2509 0.2243 0.1891 0.0494  -0.0639 0.0020  203 ARG A CA  
100  C C   . ARG A  32  ? 0.2626 0.1993 0.1962 0.0387  -0.0480 0.0174  203 ARG A C   
101  O O   . ARG A  32  ? 0.3103 0.2057 0.1682 0.0492  -0.0469 0.0249  203 ARG A O   
102  C CB  . ARG A  32  ? 0.3079 0.2293 0.1854 0.0634  -0.0880 0.0054  203 ARG A CB  
103  C CG  . ARG A  32  ? 0.3655 0.2579 0.1939 0.0471  -0.0692 0.0418  203 ARG A CG  
104  C CD  . ARG A  32  ? 0.3389 0.3462 0.2050 0.0903  -0.0093 0.0428  203 ARG A CD  
105  N NE  . ARG A  32  ? 0.3623 0.3862 0.1935 0.1014  -0.0227 0.0131  203 ARG A NE  
106  C CZ  . ARG A  32  ? 0.4188 0.3987 0.1760 0.0176  0.0429  -0.0280 203 ARG A CZ  
107  N NH1 . ARG A  32  ? 0.3968 0.3933 0.3120 0.0433  0.0064  0.0556  203 ARG A NH1 
108  N NH2 . ARG A  32  ? 0.4883 0.5008 0.4034 0.0654  0.0270  0.0316  203 ARG A NH2 
109  N N   . ILE A  33  ? 0.2445 0.2298 0.1242 0.0602  -0.0211 0.0437  204 ILE A N   
110  C CA  . ILE A  33  ? 0.2644 0.2120 0.1263 0.0560  -0.0267 0.0445  204 ILE A CA  
111  C C   . ILE A  33  ? 0.2473 0.1974 0.1549 0.0417  -0.0252 0.0517  204 ILE A C   
112  O O   . ILE A  33  ? 0.2934 0.2785 0.1431 0.0549  -0.0234 0.0467  204 ILE A O   
113  C CB  A ILE A  33  ? 0.2338 0.2393 0.1387 0.0615  -0.0120 0.0200  204 ILE A CB  
114  C CB  B ILE A  33  ? 0.2771 0.2466 0.1688 0.0673  -0.0210 0.0066  204 ILE A CB  
115  C CG1 A ILE A  33  ? 0.2419 0.2247 0.1460 0.0433  -0.0025 0.0249  204 ILE A CG1 
116  C CG1 B ILE A  33  ? 0.3103 0.2404 0.1857 0.0495  0.0134  -0.0041 204 ILE A CG1 
117  C CG2 A ILE A  33  ? 0.2737 0.2480 0.1912 0.0441  -0.0170 0.0364  204 ILE A CG2 
118  C CG2 B ILE A  33  ? 0.2928 0.2672 0.2057 0.0575  -0.0214 0.0395  204 ILE A CG2 
119  C CD1 A ILE A  33  ? 0.2402 0.2205 0.1179 0.0334  -0.0365 0.0487  204 ILE A CD1 
120  C CD1 B ILE A  33  ? 0.3607 0.2217 0.1853 0.0685  -0.0267 -0.0215 204 ILE A CD1 
121  N N   . LEU A  34  ? 0.2820 0.2435 0.1290 0.0303  -0.0267 0.0410  205 LEU A N   
122  C CA  . LEU A  34  ? 0.2633 0.1785 0.1706 0.0294  -0.0086 0.0041  205 LEU A CA  
123  C C   . LEU A  34  ? 0.2230 0.1747 0.1677 0.0415  -0.0490 0.0229  205 LEU A C   
124  O O   . LEU A  34  ? 0.2677 0.2318 0.1509 0.0503  -0.0260 0.0238  205 LEU A O   
125  C CB  . LEU A  34  ? 0.3058 0.2197 0.1986 0.0640  -0.0177 0.0551  205 LEU A CB  
126  C CG  . LEU A  34  ? 0.3625 0.1858 0.2910 0.1019  -0.0267 0.0516  205 LEU A CG  
127  C CD1 . LEU A  34  ? 0.3987 0.3513 0.2879 0.0973  -0.0442 -0.0428 205 LEU A CD1 
128  C CD2 . LEU A  34  ? 0.3346 0.2025 0.2744 0.1125  0.0305  0.0573  205 LEU A CD2 
129  N N   . GLY A  35  ? 0.2210 0.1944 0.1518 0.0428  -0.0352 0.0192  206 GLY A N   
130  C CA  . GLY A  35  ? 0.2597 0.1848 0.1466 0.0463  -0.0194 0.0126  206 GLY A CA  
131  C C   . GLY A  35  ? 0.2713 0.1832 0.1414 0.0699  -0.0116 0.0246  206 GLY A C   
132  O O   . GLY A  35  ? 0.2493 0.2319 0.1422 0.0576  -0.0273 0.0173  206 GLY A O   
133  N N   . LYS A  36  ? 0.2166 0.2020 0.1412 0.0267  -0.0380 0.0278  207 LYS A N   
134  C CA  . LYS A  36  ? 0.2022 0.2180 0.1651 0.0325  -0.0196 0.0269  207 LYS A CA  
135  C C   . LYS A  36  ? 0.2290 0.2262 0.1486 0.0177  -0.0187 0.0427  207 LYS A C   
136  O O   . LYS A  36  ? 0.2786 0.2297 0.2481 0.0219  -0.0155 0.0142  207 LYS A O   
137  C CB  . LYS A  36  ? 0.1935 0.2291 0.1689 0.0422  -0.0082 0.0265  207 LYS A CB  
138  C CG  . LYS A  36  ? 0.1978 0.1914 0.1862 0.0117  -0.0300 0.0204  207 LYS A CG  
139  C CD  . LYS A  36  ? 0.2186 0.2268 0.1900 -0.0040 -0.0270 0.0291  207 LYS A CD  
140  C CE  . LYS A  36  ? 0.2004 0.2658 0.1956 0.0139  -0.0138 0.0290  207 LYS A CE  
141  N NZ  . LYS A  36  ? 0.2172 0.2394 0.1998 -0.0091 -0.0070 0.0285  207 LYS A NZ  
142  N N   . LYS A  37  ? 0.2537 0.2228 0.2217 0.0198  0.0152  0.0238  208 LYS A N   
143  C CA  . LYS A  37  ? 0.2706 0.2544 0.2613 0.0009  0.0046  0.0264  208 LYS A CA  
144  C C   . LYS A  37  ? 0.3316 0.2552 0.2242 -0.0222 0.0088  0.0087  208 LYS A C   
145  O O   . LYS A  37  ? 0.2717 0.3231 0.2401 -0.0247 0.0038  0.0459  208 LYS A O   
146  C CB  . LYS A  37  ? 0.2811 0.3007 0.2557 -0.0181 0.0241  0.0571  208 LYS A CB  
147  C CG  . LYS A  37  ? 0.3035 0.2982 0.2764 0.0393  0.0422  0.1018  208 LYS A CG  
148  C CD  . LYS A  37  ? 0.3101 0.3457 0.3096 0.0487  0.0592  0.1095  208 LYS A CD  
149  C CE  . LYS A  37  ? 0.3683 0.4174 0.2967 0.0828  0.0218  0.0598  208 LYS A CE  
150  N NZ  . LYS A  37  ? 0.3786 0.4568 0.3342 0.0471  0.0277  0.0524  208 LYS A NZ  
151  N N   . ARG A  38  ? 0.3305 0.2728 0.3163 -0.0370 0.0182  0.0422  209 ARG A N   
152  C CA  . ARG A  38  ? 0.3059 0.3789 0.3576 -0.0958 0.0322  0.0345  209 ARG A CA  
153  C C   . ARG A  38  ? 0.2924 0.3579 0.2764 -0.0925 -0.0208 -0.0181 209 ARG A C   
154  O O   . ARG A  38  ? 0.4156 0.4970 0.2443 -0.1071 -0.0630 -0.0985 209 ARG A O   
155  C CB  . ARG A  38  ? 0.5163 0.3150 0.5181 -0.0881 -0.0784 0.0189  209 ARG A CB  
156  C CG  . ARG A  38  ? 0.4747 0.4206 0.5538 -0.0890 0.0795  -0.0847 209 ARG A CG  
157  N N   . THR A  39  ? 0.2660 0.3323 0.3091 -0.0613 0.0402  0.0004  210 THR A N   
158  C CA  . THR A  39  ? 0.3568 0.3849 0.3053 -0.0090 0.0006  0.0100  210 THR A CA  
159  C C   . THR A  39  ? 0.3083 0.3266 0.2562 0.0144  0.0073  -0.0251 210 THR A C   
160  O O   . THR A  39  ? 0.2586 0.4062 0.3351 0.0386  0.0334  0.0270  210 THR A O   
161  C CB  . THR A  39  ? 0.3188 0.4245 0.3450 -0.0021 0.0598  0.0113  210 THR A CB  
162  O OG1 . THR A  39  ? 0.3181 0.4767 0.3067 0.0540  0.0440  0.0655  210 THR A OG1 
163  C CG2 . THR A  39  ? 0.4250 0.4544 0.3677 -0.0255 0.0774  0.0427  210 THR A CG2 
164  N N   . LYS A  40  ? 0.2976 0.3033 0.2251 -0.0170 0.0035  0.0018  211 LYS A N   
165  C CA  . LYS A  40  ? 0.2462 0.2979 0.2181 0.0194  0.0142  0.0191  211 LYS A CA  
166  C C   . LYS A  40  ? 0.2728 0.2733 0.1874 0.0418  -0.0227 0.0439  211 LYS A C   
167  O O   . LYS A  40  ? 0.2736 0.3536 0.1976 0.0258  -0.0069 0.0256  211 LYS A O   
168  C CB  . LYS A  40  ? 0.2931 0.3605 0.2485 -0.0400 -0.0519 0.0601  211 LYS A CB  
169  C CG  . LYS A  40  ? 0.3575 0.4685 0.3127 -0.0805 -0.0057 -0.0309 211 LYS A CG  
170  C CD  . LYS A  40  ? 0.3761 0.5425 0.3713 -0.0600 -0.0613 -0.0978 211 LYS A CD  
171  C CE  . LYS A  40  ? 0.5614 0.6615 0.5315 -0.1840 -0.1903 -0.1404 211 LYS A CE  
172  N NZ  . LYS A  40  ? 0.6609 0.6721 0.6237 -0.1736 -0.2128 -0.0920 211 LYS A NZ  
173  N N   . THR A  41  ? 0.2250 0.2355 0.2143 0.0149  0.0055  0.0381  212 THR A N   
174  C CA  . THR A  41  ? 0.1998 0.1988 0.2591 0.0361  0.0000  0.0388  212 THR A CA  
175  C C   . THR A  41  ? 0.2101 0.2305 0.2250 0.0364  0.0065  0.0566  212 THR A C   
176  O O   . THR A  41  ? 0.2284 0.2282 0.1832 0.0267  -0.0039 0.0292  212 THR A O   
177  C CB  . THR A  41  ? 0.2397 0.3058 0.2614 0.0584  0.0162  0.0263  212 THR A CB  
178  O OG1 . THR A  41  ? 0.2494 0.3467 0.2790 0.0317  0.0491  0.0556  212 THR A OG1 
179  C CG2 . THR A  41  ? 0.2755 0.3876 0.2706 0.0456  -0.0205 0.0723  212 THR A CG2 
180  N N   . TRP A  42  ? 0.2066 0.2120 0.1837 0.0778  -0.0108 0.0484  213 TRP A N   
181  C CA  . TRP A  42  ? 0.1861 0.2462 0.1732 0.0595  -0.0304 0.0044  213 TRP A CA  
182  C C   . TRP A  42  ? 0.2679 0.2085 0.1790 0.0470  -0.0158 0.0093  213 TRP A C   
183  O O   . TRP A  42  ? 0.2808 0.2391 0.1591 0.0893  -0.0017 0.0481  213 TRP A O   
184  C CB  . TRP A  42  ? 0.2296 0.2011 0.1519 0.0603  -0.0136 0.0154  213 TRP A CB  
185  C CG  . TRP A  42  ? 0.1879 0.1724 0.1458 0.0215  -0.0138 0.0440  213 TRP A CG  
186  C CD1 . TRP A  42  ? 0.2019 0.1833 0.1770 0.0574  -0.0020 0.0592  213 TRP A CD1 
187  C CD2 . TRP A  42  ? 0.2075 0.1690 0.1495 0.0378  -0.0194 0.0430  213 TRP A CD2 
188  N NE1 . TRP A  42  ? 0.1981 0.1948 0.1639 0.0313  -0.0237 0.0104  213 TRP A NE1 
189  C CE2 . TRP A  42  ? 0.2226 0.1683 0.1453 0.0426  -0.0243 0.0143  213 TRP A CE2 
190  C CE3 . TRP A  42  ? 0.2326 0.1776 0.1966 0.0552  -0.0477 0.0204  213 TRP A CE3 
191  C CZ2 . TRP A  42  ? 0.2151 0.1599 0.2129 0.0380  -0.0059 0.0065  213 TRP A CZ2 
192  C CZ3 . TRP A  42  ? 0.1933 0.1776 0.2063 0.0317  -0.0474 0.0454  213 TRP A CZ3 
193  C CH2 . TRP A  42  ? 0.2236 0.1793 0.1838 0.0664  0.0159  -0.0005 213 TRP A CH2 
194  N N   . HIS A  43  ? 0.2785 0.2277 0.1631 0.0532  0.0004  0.0336  214 HIS A N   
195  C CA  . HIS A  43  ? 0.2556 0.2697 0.1597 0.0607  -0.0109 0.0158  214 HIS A CA  
196  C C   . HIS A  43  ? 0.2734 0.2726 0.1391 0.0663  -0.0125 0.0373  214 HIS A C   
197  O O   . HIS A  43  ? 0.2859 0.2807 0.1689 0.0876  -0.0135 0.0292  214 HIS A O   
198  C CB  . HIS A  43  ? 0.2781 0.2855 0.1455 0.0447  -0.0166 0.0295  214 HIS A CB  
199  C CG  . HIS A  43  ? 0.2369 0.2865 0.2305 0.0515  0.0206  0.0521  214 HIS A CG  
200  N ND1 . HIS A  43  ? 0.2437 0.3694 0.2803 0.0856  0.0155  0.0388  214 HIS A ND1 
201  C CD2 . HIS A  43  ? 0.2479 0.3367 0.2323 0.0548  0.0105  0.0327  214 HIS A CD2 
202  C CE1 . HIS A  43  ? 0.2685 0.4212 0.2845 0.0998  -0.0240 -0.0051 214 HIS A CE1 
203  N NE2 . HIS A  43  ? 0.2913 0.3408 0.2667 0.0883  -0.0178 0.0514  214 HIS A NE2 
204  N N   . LYS A  44  ? 0.3546 0.2238 0.1508 0.0835  -0.0230 0.0170  215 LYS A N   
205  C CA  . LYS A  44  ? 0.3249 0.2543 0.1856 0.0616  -0.0138 0.0383  215 LYS A CA  
206  C C   . LYS A  44  ? 0.2920 0.2506 0.1296 0.0616  -0.0343 0.0064  215 LYS A C   
207  O O   . LYS A  44  ? 0.3263 0.2668 0.1541 0.0664  -0.0055 0.0511  215 LYS A O   
208  C CB  . LYS A  44  ? 0.4073 0.2659 0.2202 0.1061  -0.0799 0.0169  215 LYS A CB  
209  C CG  . LYS A  44  ? 0.5385 0.2455 0.3960 0.0533  -0.1046 -0.0132 215 LYS A CG  
210  C CD  . LYS A  44  ? 0.5876 0.3596 0.4375 0.0542  -0.1761 -0.0082 215 LYS A CD  
211  C CE  . LYS A  44  ? 0.5859 0.3907 0.4069 0.0519  -0.0581 0.0033  215 LYS A CE  
212  N NZ  . LYS A  44  ? 0.5252 0.4459 0.5028 0.0681  -0.0410 -0.0767 215 LYS A NZ  
213  N N   . GLY A  45  ? 0.3083 0.2448 0.1637 0.0882  -0.0109 0.0537  216 GLY A N   
214  C CA  . GLY A  45  ? 0.2982 0.2297 0.1618 0.0798  0.0000  0.0484  216 GLY A CA  
215  C C   . GLY A  45  ? 0.2932 0.2238 0.1169 0.0169  -0.0171 0.0197  216 GLY A C   
216  O O   . GLY A  45  ? 0.2930 0.2214 0.1418 0.0245  -0.0589 0.0495  216 GLY A O   
217  N N   . THR A  46  ? 0.2645 0.2133 0.1774 0.0249  -0.0173 0.0002  217 THR A N   
218  C CA  . THR A  46  ? 0.2729 0.2039 0.1763 0.0169  -0.0055 0.0214  217 THR A CA  
219  C C   . THR A  46  ? 0.2532 0.1949 0.1494 0.0392  -0.0374 0.0389  217 THR A C   
220  O O   . THR A  46  ? 0.2577 0.2200 0.1769 0.0241  -0.0486 0.0416  217 THR A O   
221  C CB  . THR A  46  ? 0.2869 0.2087 0.1556 0.0306  -0.0304 0.0033  217 THR A CB  
222  O OG1 . THR A  46  ? 0.4465 0.2700 0.1716 0.0925  -0.0281 -0.0116 217 THR A OG1 
223  C CG2 . THR A  46  ? 0.2896 0.3090 0.1968 0.0101  -0.0548 0.0389  217 THR A CG2 
224  N N   . LEU A  47  ? 0.2621 0.1832 0.1322 0.0190  -0.0325 0.0256  218 LEU A N   
225  C CA  . LEU A  47  ? 0.2554 0.2328 0.1200 0.0465  -0.0584 0.0066  218 LEU A CA  
226  C C   . LEU A  47  ? 0.2256 0.2101 0.1810 0.0182  -0.0662 0.0223  218 LEU A C   
227  O O   . LEU A  47  ? 0.2576 0.2258 0.1704 0.0465  -0.0880 -0.0094 218 LEU A O   
228  C CB  . LEU A  47  ? 0.2287 0.2198 0.1784 0.0402  -0.0574 0.0093  218 LEU A CB  
229  C CG  . LEU A  47  ? 0.2802 0.1974 0.1849 0.0464  -0.0626 0.0161  218 LEU A CG  
230  C CD1 . LEU A  47  ? 0.2462 0.2529 0.1767 0.0537  -0.0425 0.0027  218 LEU A CD1 
231  C CD2 . LEU A  47  ? 0.2637 0.2327 0.1963 0.0667  -0.0299 -0.0271 218 LEU A CD2 
232  N N   . ILE A  48  ? 0.2586 0.1733 0.1463 0.0311  -0.0535 0.0292  219 ILE A N   
233  C CA  . ILE A  48  ? 0.2663 0.1822 0.1689 0.0328  -0.0592 0.0360  219 ILE A CA  
234  C C   . ILE A  48  ? 0.2698 0.2015 0.1503 0.0399  -0.0443 0.0313  219 ILE A C   
235  O O   . ILE A  48  ? 0.3334 0.2001 0.1763 0.0464  -0.0637 0.0308  219 ILE A O   
236  C CB  . ILE A  48  ? 0.2685 0.1837 0.1836 0.0252  -0.0456 0.0303  219 ILE A CB  
237  C CG1 . ILE A  48  ? 0.2986 0.2500 0.1977 0.0311  -0.0670 0.0026  219 ILE A CG1 
238  C CG2 . ILE A  48  ? 0.2663 0.2273 0.1895 0.0534  -0.0494 0.0338  219 ILE A CG2 
239  C CD1 . ILE A  48  ? 0.3241 0.2886 0.2518 0.0224  -0.0564 0.0097  219 ILE A CD1 
240  N N   . ALA A  49  ? 0.2771 0.2156 0.1489 0.0341  -0.0468 0.0313  220 ALA A N   
241  C CA  . ALA A  49  ? 0.2419 0.2012 0.1857 0.0274  -0.0516 0.0286  220 ALA A CA  
242  C C   . ALA A  49  ? 0.2242 0.2205 0.1835 0.0142  -0.0546 0.0150  220 ALA A C   
243  O O   . ALA A  49  ? 0.2730 0.2344 0.1698 0.0576  -0.0634 0.0125  220 ALA A O   
244  C CB  . ALA A  49  ? 0.2677 0.1967 0.1909 0.0255  -0.0382 0.0132  220 ALA A CB  
245  N N   . ILE A  50  ? 0.2276 0.2570 0.1345 0.0581  -0.0622 0.0107  221 ILE A N   
246  C CA  . ILE A  50  ? 0.2065 0.2197 0.1469 0.0674  -0.0614 0.0131  221 ILE A CA  
247  C C   . ILE A  50  ? 0.2608 0.2168 0.1806 0.0691  -0.0809 -0.0091 221 ILE A C   
248  O O   . ILE A  50  ? 0.3077 0.2614 0.1824 0.0892  -0.0814 0.0244  221 ILE A O   
249  C CB  . ILE A  50  ? 0.2186 0.2397 0.1732 0.0607  -0.0307 0.0172  221 ILE A CB  
250  C CG1 . ILE A  50  ? 0.2717 0.2359 0.1647 0.0400  -0.0529 0.0154  221 ILE A CG1 
251  C CG2 . ILE A  50  ? 0.2696 0.2702 0.1736 0.0157  -0.0317 0.0246  221 ILE A CG2 
252  C CD1 . ILE A  50  ? 0.3126 0.2778 0.1707 -0.0025 -0.0354 0.0223  221 ILE A CD1 
253  N N   . GLN A  51  ? 0.3055 0.2106 0.1768 0.0758  -0.0919 0.0118  222 GLN A N   
254  C CA  . GLN A  51  ? 0.3609 0.2458 0.1710 0.0530  -0.0470 -0.0126 222 GLN A CA  
255  C C   . GLN A  51  ? 0.3021 0.2336 0.1695 0.0573  -0.0459 -0.0308 222 GLN A C   
256  O O   . GLN A  51  ? 0.3355 0.2649 0.1849 0.0622  -0.0596 0.0065  222 GLN A O   
257  C CB  . GLN A  51  ? 0.4686 0.2842 0.2196 -0.0344 -0.0523 -0.0021 222 GLN A CB  
258  C CG  . GLN A  51  ? 0.4464 0.3137 0.2800 -0.0432 -0.0424 -0.0307 222 GLN A CG  
259  C CD  . GLN A  51  ? 0.5329 0.3501 0.4731 -0.0977 -0.0136 -0.0310 222 GLN A CD  
260  O OE1 . GLN A  51  ? 0.5554 0.5340 0.5435 -0.0626 0.0185  -0.0166 222 GLN A OE1 
261  N NE2 . GLN A  51  ? 0.8144 0.3632 0.4283 0.0243  -0.0078 -0.0304 222 GLN A NE2 
262  N N   . THR A  52  ? 0.3154 0.2789 0.1899 0.1145  -0.0750 -0.0157 223 THR A N   
263  C CA  . THR A  52  ? 0.2967 0.2933 0.1837 0.0472  -0.0772 -0.0225 223 THR A CA  
264  C C   . THR A  52  ? 0.3295 0.2590 0.2534 0.0409  -0.0725 -0.0133 223 THR A C   
265  O O   . THR A  52  ? 0.4272 0.2884 0.1873 0.0609  -0.0359 0.0144  223 THR A O   
266  C CB  . THR A  52  ? 0.3167 0.3904 0.2746 0.0659  -0.0519 -0.0950 223 THR A CB  
267  O OG1 . THR A  52  ? 0.2941 0.4201 0.3628 0.0811  -0.0731 -0.1304 223 THR A OG1 
268  C CG2 . THR A  52  ? 0.4165 0.4423 0.2649 0.0839  -0.0529 -0.0377 223 THR A CG2 
269  N N   . VAL A  53  ? 0.3088 0.2647 0.1885 0.0161  -0.0669 -0.0518 224 VAL A N   
270  C CA  . VAL A  53  ? 0.3704 0.2666 0.1790 -0.0283 -0.1018 0.0000  224 VAL A CA  
271  C C   . VAL A  53  ? 0.3385 0.2311 0.1924 -0.0194 -0.0589 0.0025  224 VAL A C   
272  O O   . VAL A  53  ? 0.4340 0.2287 0.1826 0.0197  -0.1012 -0.0278 224 VAL A O   
273  C CB  . VAL A  53  ? 0.3302 0.3639 0.2365 -0.0209 -0.1169 0.0440  224 VAL A CB  
274  C CG1 . VAL A  53  ? 0.4125 0.3578 0.2557 -0.0795 -0.0611 0.0399  224 VAL A CG1 
275  C CG2 . VAL A  53  ? 0.4418 0.4637 0.2405 -0.0820 -0.0926 -0.0049 224 VAL A CG2 
276  N N   . GLY A  54  ? 0.4505 0.2844 0.1923 0.0438  -0.0622 -0.0131 225 GLY A N   
277  C CA  . GLY A  54  ? 0.3738 0.2700 0.1777 -0.0262 -0.0176 -0.0382 225 GLY A CA  
278  C C   . GLY A  54  ? 0.3542 0.2439 0.1871 0.0049  0.0038  -0.0420 225 GLY A C   
279  O O   . GLY A  54  ? 0.3765 0.3679 0.3262 0.0304  -0.0091 0.0192  225 GLY A O   
280  N N   . PRO A  55  ? 0.3715 0.2300 0.2360 0.0264  -0.0392 -0.0593 226 PRO A N   
281  C CA  . PRO A  55  ? 0.4029 0.2996 0.2340 -0.0150 -0.0265 -0.0669 226 PRO A CA  
282  C C   . PRO A  55  ? 0.4623 0.2963 0.2583 -0.1027 0.0466  -0.0734 226 PRO A C   
283  O O   . PRO A  55  ? 0.5068 0.3201 0.2164 -0.1228 0.0420  -0.0577 226 PRO A O   
284  C CB  . PRO A  55  ? 0.4545 0.3414 0.1637 -0.0470 -0.0504 -0.0706 226 PRO A CB  
285  C CG  . PRO A  55  ? 0.3904 0.3169 0.2233 -0.0051 -0.1228 -0.1106 226 PRO A CG  
286  C CD  . PRO A  55  ? 0.3930 0.3353 0.2218 -0.0257 -0.0962 -0.0968 226 PRO A CD  
287  N N   . GLY A  56  ? 0.3452 0.2574 0.2311 -0.0252 -0.0040 -0.0525 227 GLY A N   
288  C CA  . GLY A  56  ? 0.3106 0.2569 0.1769 -0.0444 -0.0459 -0.0075 227 GLY A CA  
289  C C   . GLY A  56  ? 0.3210 0.2495 0.1692 -0.0169 -0.0614 0.0073  227 GLY A C   
290  O O   . GLY A  56  ? 0.5234 0.2411 0.1953 -0.0569 -0.0474 -0.0411 227 GLY A O   
291  N N   . LYS A  57  ? 0.3102 0.2234 0.1990 -0.0232 -0.0141 0.0023  228 LYS A N   
292  C CA  . LYS A  57  ? 0.2349 0.2342 0.1880 0.0192  -0.0563 -0.0007 228 LYS A CA  
293  C C   . LYS A  57  ? 0.2386 0.2063 0.1782 0.0141  -0.0529 -0.0339 228 LYS A C   
294  O O   . LYS A  57  ? 0.2350 0.2452 0.2371 0.0458  -0.0567 0.0090  228 LYS A O   
295  C CB  . LYS A  57  ? 0.2720 0.2910 0.2354 0.0335  -0.1022 -0.0617 228 LYS A CB  
296  C CG  . LYS A  57  ? 0.2769 0.3074 0.3260 0.0618  -0.1322 -0.0630 228 LYS A CG  
297  C CD  . LYS A  57  ? 0.3326 0.3998 0.3286 -0.0128 -0.0534 -0.1110 228 LYS A CD  
298  C CE  . LYS A  57  ? 0.3539 0.4598 0.4589 -0.0115 0.0395  -0.0390 228 LYS A CE  
299  N NZ  . LYS A  57  ? 0.3022 0.7256 0.4262 -0.0372 -0.0093 0.0232  228 LYS A NZ  
300  N N   . LYS A  58  ? 0.2714 0.2320 0.2016 0.0384  -0.0591 0.0163  229 LYS A N   
301  C CA  . LYS A  58  ? 0.2786 0.2443 0.1568 0.0823  -0.0827 -0.0284 229 LYS A CA  
302  C C   . LYS A  58  ? 0.2403 0.2403 0.1287 0.0938  -0.0495 0.0099  229 LYS A C   
303  O O   . LYS A  58  ? 0.2779 0.2466 0.1938 0.1192  -0.0852 0.0000  229 LYS A O   
304  C CB  . LYS A  58  ? 0.3295 0.3257 0.2176 0.0257  -0.0422 -0.0593 229 LYS A CB  
305  C CG  . LYS A  58  ? 0.4745 0.4224 0.2528 0.0278  -0.0872 -0.1019 229 LYS A CG  
306  C CD  . LYS A  58  ? 0.4072 0.4801 0.3055 0.0255  -0.0635 -0.0636 229 LYS A CD  
307  C CE  . LYS A  58  ? 0.4373 0.6231 0.4074 -0.0053 -0.0717 -0.2275 229 LYS A CE  
308  N NZ  . LYS A  58  ? 0.4710 0.6576 0.2403 -0.1253 0.0425  -0.0996 229 LYS A NZ  
309  N N   . TYR A  59  ? 0.2159 0.2416 0.1532 0.0854  -0.0585 -0.0023 230 TYR A N   
310  C CA  . TYR A  59  ? 0.2368 0.2084 0.1496 0.0575  -0.0647 0.0215  230 TYR A CA  
311  C C   . TYR A  59  ? 0.2444 0.2169 0.1496 0.0525  -0.0535 0.0065  230 TYR A C   
312  O O   . TYR A  59  ? 0.2345 0.2863 0.1452 0.0708  -0.0251 0.0310  230 TYR A O   
313  C CB  . TYR A  59  ? 0.2381 0.1948 0.1573 0.0676  -0.0515 0.0036  230 TYR A CB  
314  C CG  . TYR A  59  ? 0.2366 0.1879 0.1629 0.0468  -0.0490 0.0181  230 TYR A CG  
315  C CD1 . TYR A  59  ? 0.2270 0.2233 0.2067 0.0529  -0.0466 0.0181  230 TYR A CD1 
316  C CD2 . TYR A  59  ? 0.2502 0.2029 0.1672 0.0783  -0.0490 0.0190  230 TYR A CD2 
317  C CE1 . TYR A  59  ? 0.2794 0.1897 0.1588 0.0129  -0.0307 0.0264  230 TYR A CE1 
318  C CE2 . TYR A  59  ? 0.2653 0.1847 0.1685 0.0520  -0.0402 0.0195  230 TYR A CE2 
319  C CZ  . TYR A  59  ? 0.2736 0.2270 0.1624 0.0373  -0.0439 0.0132  230 TYR A CZ  
320  O OH  . TYR A  59  ? 0.2704 0.2440 0.1997 0.0421  -0.0220 -0.0046 230 TYR A OH  
321  N N   . LYS A  60  ? 0.2304 0.2300 0.1545 0.0429  -0.0384 0.0209  231 LYS A N   
322  C CA  . LYS A  60  ? 0.2351 0.2318 0.1719 0.0099  -0.0488 0.0146  231 LYS A CA  
323  C C   . LYS A  60  ? 0.2316 0.2399 0.2175 0.0065  -0.0143 -0.0010 231 LYS A C   
324  O O   . LYS A  60  ? 0.2751 0.2624 0.1783 0.0410  -0.0492 0.0149  231 LYS A O   
325  C CB  . LYS A  60  ? 0.2901 0.2244 0.1406 0.0393  -0.0527 -0.0117 231 LYS A CB  
326  C CG  . LYS A  60  ? 0.3102 0.2564 0.2159 0.0233  -0.0199 -0.0028 231 LYS A CG  
327  C CD  . LYS A  60  ? 0.4657 0.2977 0.3157 0.0478  0.0079  0.0487  231 LYS A CD  
328  C CE  . LYS A  60  ? 0.5266 0.3844 0.4762 0.0070  -0.0474 -0.0479 231 LYS A CE  
329  N NZ  . LYS A  60  ? 0.6708 0.3238 0.6802 -0.0595 -0.0529 -0.0287 231 LYS A NZ  
330  N N   . VAL A  61  ? 0.2466 0.2307 0.1451 0.0353  -0.0312 0.0026  232 VAL A N   
331  C CA  . VAL A  61  ? 0.2453 0.2105 0.1442 0.0394  -0.0298 0.0113  232 VAL A CA  
332  C C   . VAL A  61  ? 0.2341 0.2754 0.1543 0.0193  -0.0320 0.0095  232 VAL A C   
333  O O   . VAL A  61  ? 0.2673 0.2743 0.1598 -0.0122 -0.0360 0.0285  232 VAL A O   
334  C CB  . VAL A  61  ? 0.2876 0.2030 0.1709 0.0372  -0.0224 0.0262  232 VAL A CB  
335  C CG1 . VAL A  61  ? 0.2581 0.2353 0.1794 0.0462  0.0045  0.0269  232 VAL A CG1 
336  C CG2 . VAL A  61  ? 0.2790 0.2600 0.1624 0.0437  -0.0307 0.0379  232 VAL A CG2 
337  N N   . LYS A  62  ? 0.2654 0.2390 0.1455 0.0384  -0.0370 0.0367  233 LYS A N   
338  C CA  . LYS A  62  ? 0.2488 0.2130 0.1980 0.0125  -0.0188 0.0327  233 LYS A CA  
339  C C   . LYS A  62  ? 0.2564 0.2451 0.1768 0.0435  0.0177  0.0347  233 LYS A C   
340  O O   . LYS A  62  ? 0.2969 0.2489 0.1572 0.0402  -0.0103 0.0336  233 LYS A O   
341  C CB  . LYS A  62  ? 0.2363 0.2204 0.2164 0.0321  -0.0126 0.0367  233 LYS A CB  
342  C CG  . LYS A  62  ? 0.3368 0.3318 0.2669 0.0351  0.0802  0.0500  233 LYS A CG  
343  N N   . PHE A  63  ? 0.2576 0.2535 0.1608 0.0421  -0.0065 0.0077  234 PHE A N   
344  C CA  . PHE A  63  ? 0.3098 0.2772 0.1904 0.0709  -0.0008 0.0170  234 PHE A CA  
345  C C   . PHE A  63  ? 0.3497 0.3066 0.1772 -0.0035 0.0031  0.0250  234 PHE A C   
346  O O   . PHE A  63  ? 0.3010 0.3207 0.2032 0.0331  0.0492  0.0323  234 PHE A O   
347  C CB  . PHE A  63  ? 0.2787 0.3167 0.2113 -0.0046 -0.0010 0.0515  234 PHE A CB  
348  C CG  . PHE A  63  ? 0.2775 0.2548 0.2128 0.0697  -0.0091 0.0719  234 PHE A CG  
349  C CD1 . PHE A  63  ? 0.2520 0.2625 0.2088 0.0392  -0.0088 0.0544  234 PHE A CD1 
350  C CD2 . PHE A  63  ? 0.3373 0.2677 0.2185 0.0149  0.0220  0.0605  234 PHE A CD2 
351  C CE1 . PHE A  63  ? 0.3584 0.2771 0.1912 0.0591  -0.0277 0.0463  234 PHE A CE1 
352  C CE2 . PHE A  63  ? 0.3068 0.2716 0.1994 0.0288  -0.0142 -0.0002 234 PHE A CE2 
353  C CZ  . PHE A  63  ? 0.2940 0.2660 0.1975 0.0529  -0.0410 0.0610  234 PHE A CZ  
354  N N   . ASP A  64  ? 0.3091 0.2989 0.1511 0.0493  0.0093  0.0598  235 ASP A N   
355  C CA  . ASP A  64  ? 0.3922 0.3281 0.1652 0.0584  0.0340  0.0468  235 ASP A CA  
356  C C   . ASP A  64  ? 0.4178 0.3724 0.2543 0.0161  0.0385  0.0115  235 ASP A C   
357  O O   . ASP A  64  ? 0.4853 0.4965 0.2633 0.0605  0.0960  0.0584  235 ASP A O   
358  C CB  . ASP A  64  ? 0.4041 0.3124 0.1666 0.0898  -0.0251 0.0531  235 ASP A CB  
359  C CG  . ASP A  64  ? 0.4335 0.3014 0.1413 0.0716  -0.0347 0.0291  235 ASP A CG  
360  O OD1 . ASP A  64  ? 0.3927 0.3568 0.2240 0.0736  -0.0228 0.0293  235 ASP A OD1 
361  O OD2 . ASP A  64  ? 0.5805 0.2978 0.3464 0.0756  -0.0148 -0.0381 235 ASP A OD2 
362  N N   . ASN A  65  ? 0.3902 0.3644 0.3542 0.0665  0.0357  0.0242  236 ASN A N   
363  C CA  . ASN A  65  ? 0.3595 0.5203 0.4112 -0.0367 -0.0349 -0.0010 236 ASN A CA  
364  C C   . ASN A  65  ? 0.4130 0.4892 0.3994 0.0088  -0.0326 0.0339  236 ASN A C   
365  O O   . ASN A  65  ? 0.5253 0.7146 0.3302 0.0462  0.0627  0.0589  236 ASN A O   
366  C CB  . ASN A  65  ? 0.4381 0.5264 0.4915 0.0188  0.0855  0.0944  236 ASN A CB  
367  N N   . LYS A  66  ? 0.4215 0.5320 0.3528 -0.1172 0.0272  0.0329  237 LYS A N   
368  C CA  . LYS A  66  ? 0.4578 0.4908 0.3324 -0.0137 0.0711  -0.0279 237 LYS A CA  
369  C C   . LYS A  66  ? 0.3584 0.4225 0.3466 -0.0384 0.0848  0.0289  237 LYS A C   
370  O O   . LYS A  66  ? 0.3745 0.4922 0.3343 -0.0516 0.0730  0.0706  237 LYS A O   
371  C CB  . LYS A  66  ? 0.4587 0.6298 0.4088 -0.0171 0.0488  -0.0409 237 LYS A CB  
372  N N   . GLY A  67  ? 0.3345 0.4125 0.2503 -0.0481 0.0599  -0.0190 238 GLY A N   
373  C CA  . GLY A  67  ? 0.3241 0.4338 0.2978 -0.0750 0.0739  -0.0614 238 GLY A CA  
374  C C   . GLY A  67  ? 0.3100 0.3065 0.2733 -0.0554 0.0244  0.0454  238 GLY A C   
375  O O   . GLY A  67  ? 0.3716 0.3317 0.2272 -0.0384 -0.0472 0.0428  238 GLY A O   
376  N N   . LYS A  68  ? 0.3374 0.3955 0.3535 -0.0480 0.0001  -0.0489 239 LYS A N   
377  C CA  . LYS A  68  ? 0.3342 0.3838 0.2342 -0.0765 0.0103  -0.0309 239 LYS A CA  
378  C C   . LYS A  68  ? 0.3452 0.4714 0.2341 -0.0868 0.0027  -0.0378 239 LYS A C   
379  O O   . LYS A  68  ? 0.3714 0.5495 0.3015 -0.1157 0.0029  -0.1232 239 LYS A O   
380  C CB  . LYS A  68  ? 0.3810 0.4115 0.2991 -0.0415 0.0747  0.0427  239 LYS A CB  
381  C CG  . LYS A  68  ? 0.5873 0.4804 0.3238 0.0132  -0.0241 -0.0822 239 LYS A CG  
382  C CD  . LYS A  68  ? 0.5220 0.3857 0.6949 -0.0448 0.0165  -0.0699 239 LYS A CD  
383  N N   . SER A  69  ? 0.2679 0.3446 0.2047 0.0212  -0.0309 -0.0092 240 SER A N   
384  C CA  . SER A  69  ? 0.2625 0.3254 0.2007 -0.0012 0.0083  -0.0171 240 SER A CA  
385  C C   . SER A  69  ? 0.2445 0.2616 0.2294 -0.0014 -0.0175 -0.0204 240 SER A C   
386  O O   . SER A  69  ? 0.2602 0.3475 0.1755 0.0157  -0.0271 -0.0381 240 SER A O   
387  C CB  . SER A  69  ? 0.2485 0.3480 0.2351 0.0565  -0.0270 -0.0128 240 SER A CB  
388  O OG  . SER A  69  ? 0.2709 0.4517 0.2545 0.0688  -0.0339 -0.0365 240 SER A OG  
389  N N   . LEU A  70  ? 0.2705 0.2656 0.2233 0.0138  -0.0609 -0.0211 241 LEU A N   
390  C CA  . LEU A  70  ? 0.2998 0.2183 0.1579 -0.0016 -0.0354 0.0064  241 LEU A CA  
391  C C   . LEU A  70  ? 0.2622 0.2275 0.1675 0.0042  -0.0186 0.0108  241 LEU A C   
392  O O   . LEU A  70  ? 0.3197 0.2840 0.1871 -0.0162 -0.0586 0.0144  241 LEU A O   
393  C CB  . LEU A  70  ? 0.3167 0.2386 0.1962 -0.0154 -0.0638 -0.0214 241 LEU A CB  
394  C CG  . LEU A  70  ? 0.3608 0.2667 0.2463 0.0340  -0.0513 -0.0294 241 LEU A CG  
395  C CD1 . LEU A  70  ? 0.3815 0.3159 0.2983 0.0115  -0.0848 0.0052  241 LEU A CD1 
396  C CD2 . LEU A  70  ? 0.3678 0.3179 0.2740 -0.0046 -0.0621 -0.0868 241 LEU A CD2 
397  N N   . LEU A  71  ? 0.2512 0.2032 0.1686 0.0219  -0.0385 0.0235  242 LEU A N   
398  C CA  . LEU A  71  ? 0.2707 0.1809 0.1693 0.0404  -0.0454 0.0120  242 LEU A CA  
399  C C   . LEU A  71  ? 0.2462 0.2024 0.1424 0.0531  -0.0640 0.0165  242 LEU A C   
400  O O   . LEU A  71  ? 0.2350 0.2828 0.1611 0.0861  -0.0427 0.0147  242 LEU A O   
401  C CB  . LEU A  71  ? 0.2590 0.1873 0.1618 0.0481  -0.0462 0.0161  242 LEU A CB  
402  C CG  . LEU A  71  ? 0.2445 0.1960 0.1985 0.0482  -0.0361 0.0211  242 LEU A CG  
403  C CD1 . LEU A  71  ? 0.2519 0.2000 0.1863 0.0494  0.0278  0.0164  242 LEU A CD1 
404  C CD2 . LEU A  71  ? 0.2048 0.2378 0.2592 0.0304  -0.0407 0.0333  242 LEU A CD2 
405  N N   . SER A  72  ? 0.2299 0.2082 0.1347 0.0301  -0.0763 0.0151  243 SER A N   
406  C CA  . SER A  72  ? 0.2322 0.2071 0.1544 0.0367  -0.0688 0.0387  243 SER A CA  
407  C C   . SER A  72  ? 0.2368 0.2013 0.1356 0.0363  -0.0296 0.0390  243 SER A C   
408  O O   . SER A  72  ? 0.2391 0.2194 0.1318 0.0597  -0.0496 0.0352  243 SER A O   
409  C CB  A SER A  72  ? 0.2941 0.2874 0.1506 0.0213  -0.0832 0.0032  243 SER A CB  
410  C CB  B SER A  72  ? 0.2451 0.2541 0.1514 0.0383  -0.0646 0.0239  243 SER A CB  
411  O OG  A SER A  72  ? 0.4190 0.2900 0.2206 -0.0332 -0.1009 0.0005  243 SER A OG  
412  O OG  B SER A  72  ? 0.2560 0.2605 0.1530 0.0490  -0.0717 0.0187  243 SER A OG  
413  N N   . GLY A  73  ? 0.2317 0.1948 0.1391 0.0719  -0.0396 0.0311  244 GLY A N   
414  C CA  . GLY A  73  ? 0.2325 0.2011 0.1881 0.0545  -0.0076 0.0114  244 GLY A CA  
415  C C   . GLY A  73  ? 0.2125 0.2008 0.1644 0.0414  -0.0420 0.0124  244 GLY A C   
416  O O   . GLY A  73  ? 0.2292 0.1865 0.2050 0.0377  -0.0764 0.0136  244 GLY A O   
417  N N   . ASN A  74  ? 0.2062 0.1743 0.1702 0.0529  -0.0478 0.0105  245 ASN A N   
418  C CA  . ASN A  74  ? 0.2148 0.1783 0.1270 0.0585  -0.0066 0.0291  245 ASN A CA  
419  C C   . ASN A  74  ? 0.2056 0.1719 0.1342 0.0538  -0.0320 -0.0260 245 ASN A C   
420  O O   . ASN A  74  ? 0.2199 0.1949 0.1462 0.0790  -0.0231 0.0206  245 ASN A O   
421  C CB  . ASN A  74  ? 0.2190 0.2064 0.1273 0.0380  -0.0170 0.0314  245 ASN A CB  
422  C CG  . ASN A  74  ? 0.3009 0.1894 0.1819 0.0531  -0.0579 0.0036  245 ASN A CG  
423  O OD1 . ASN A  74  ? 0.3244 0.1801 0.1668 0.0515  -0.0738 0.0018  245 ASN A OD1 
424  N ND2 . ASN A  74  ? 0.2752 0.2219 0.1513 0.0556  -0.0278 0.0554  245 ASN A ND2 
425  N N   . HIS A  75  ? 0.2345 0.2213 0.1615 0.0278  -0.0492 0.0208  246 HIS A N   
426  C CA  . HIS A  75  ? 0.2455 0.1792 0.1542 0.0653  -0.0506 0.0674  246 HIS A CA  
427  C C   . HIS A  75  ? 0.2471 0.1933 0.1454 0.0680  -0.0278 0.0748  246 HIS A C   
428  O O   . HIS A  75  ? 0.2200 0.2047 0.1632 0.0423  -0.0349 0.0170  246 HIS A O   
429  C CB  . HIS A  75  ? 0.2186 0.2020 0.1675 0.0656  -0.0139 0.0284  246 HIS A CB  
430  C CG  . HIS A  75  ? 0.2147 0.2119 0.1808 0.0223  -0.0398 0.0131  246 HIS A CG  
431  N ND1 . HIS A  75  ? 0.3072 0.2481 0.2092 0.0273  -0.1016 0.0094  246 HIS A ND1 
432  C CD2 . HIS A  75  ? 0.2197 0.1964 0.1642 0.0296  -0.0534 -0.0232 246 HIS A CD2 
433  C CE1 . HIS A  75  ? 0.3097 0.2915 0.1989 -0.0275 -0.1114 0.0244  246 HIS A CE1 
434  N NE2 . HIS A  75  ? 0.2222 0.2623 0.1651 0.0350  -0.0682 -0.0144 246 HIS A NE2 
435  N N   . ILE A  76  ? 0.2551 0.1686 0.1222 0.0552  -0.0109 -0.0141 247 ILE A N   
436  C CA  . ILE A  76  ? 0.2131 0.1842 0.1232 0.0451  -0.0283 0.0048  247 ILE A CA  
437  C C   . ILE A  76  ? 0.1900 0.1848 0.1499 0.0554  -0.0376 0.0154  247 ILE A C   
438  O O   . ILE A  76  ? 0.2103 0.1967 0.1581 0.0199  -0.0445 0.0219  247 ILE A O   
439  C CB  . ILE A  76  ? 0.2021 0.2078 0.1621 0.0441  -0.0399 0.0176  247 ILE A CB  
440  C CG1 . ILE A  76  ? 0.2251 0.1924 0.1856 0.0649  -0.0272 0.0191  247 ILE A CG1 
441  C CG2 . ILE A  76  ? 0.2060 0.2165 0.1617 0.0468  -0.0110 0.0243  247 ILE A CG2 
442  C CD1 . ILE A  76  ? 0.2602 0.1916 0.1740 0.0710  -0.0564 0.0106  247 ILE A CD1 
443  N N   . ALA A  77  ? 0.2325 0.1853 0.1186 0.0411  -0.0265 0.0327  248 ALA A N   
444  C CA  . ALA A  77  ? 0.2544 0.1856 0.1458 0.0489  -0.0359 0.0041  248 ALA A CA  
445  C C   . ALA A  77  ? 0.2507 0.2160 0.1574 0.0225  -0.0448 -0.0160 248 ALA A C   
446  O O   . ALA A  77  ? 0.2472 0.2432 0.1707 0.0485  -0.0542 0.0001  248 ALA A O   
447  C CB  . ALA A  77  ? 0.2393 0.1993 0.1746 0.0443  -0.0286 0.0415  248 ALA A CB  
448  N N   . TYR A  78  ? 0.2711 0.2321 0.1328 0.0219  -0.0462 0.0152  249 TYR A N   
449  C CA  . TYR A  78  ? 0.2491 0.2583 0.1773 0.0450  -0.0870 0.0283  249 TYR A CA  
450  C C   . TYR A  78  ? 0.3213 0.2705 0.1934 0.0554  -0.0751 0.0131  249 TYR A C   
451  O O   . TYR A  78  ? 0.3460 0.2631 0.1836 0.0617  -0.0882 -0.0149 249 TYR A O   
452  C CB  . TYR A  78  ? 0.2803 0.3090 0.1851 -0.0056 -0.1421 0.0209  249 TYR A CB  
453  C CG  . TYR A  78  ? 0.2710 0.3499 0.2338 -0.0265 -0.0797 0.0171  249 TYR A CG  
454  C CD1 . TYR A  78  ? 0.2565 0.2958 0.3074 -0.0278 -0.1018 -0.0297 249 TYR A CD1 
455  C CD2 . TYR A  78  ? 0.3128 0.3471 0.2369 -0.0120 -0.1030 0.0492  249 TYR A CD2 
456  C CE1 . TYR A  78  ? 0.2633 0.4091 0.3694 0.0163  -0.0514 0.0194  249 TYR A CE1 
457  C CE2 . TYR A  78  ? 0.3202 0.3773 0.2857 -0.0591 -0.0503 -0.0486 249 TYR A CE2 
458  C CZ  . TYR A  78  ? 0.3518 0.3388 0.3420 -0.0610 -0.0457 -0.0251 249 TYR A CZ  
459  O OH  . TYR A  78  ? 0.4110 0.5020 0.3447 -0.0744 -0.0344 -0.0942 249 TYR A OH  
460  N N   . ASP A  79  ? 0.3006 0.2651 0.1742 0.0562  -0.0613 -0.0009 250 ASP A N   
461  C CA  . ASP A  79  ? 0.4044 0.2799 0.1896 0.0530  -0.0427 -0.0175 250 ASP A CA  
462  C C   . ASP A  79  ? 0.4581 0.3608 0.2150 -0.0268 -0.1317 0.0277  250 ASP A C   
463  O O   . ASP A  79  ? 0.7003 0.3025 0.2222 0.0606  -0.1935 -0.0127 250 ASP A O   
464  C CB  . ASP A  79  ? 0.4904 0.3437 0.2009 0.0435  -0.0646 0.0135  250 ASP A CB  
465  C CG  . ASP A  79  ? 0.5352 0.3766 0.2975 0.1147  -0.0153 0.0231  250 ASP A CG  
466  O OD1 . ASP A  79  ? 0.5708 0.4334 0.2650 0.1907  -0.0315 -0.0323 250 ASP A OD1 
467  O OD2 . ASP A  79  ? 0.6976 0.3758 0.2730 0.1717  -0.0495 -0.0073 250 ASP A OD2 
468  N N   . TYR A  80  ? 0.4195 0.2596 0.2175 0.0143  -0.0961 0.0041  251 TYR A N   
469  C CA  . TYR A  80  ? 0.3453 0.2574 0.2787 0.0352  -0.0877 -0.0046 251 TYR A CA  
470  C C   . TYR A  80  ? 0.3953 0.2857 0.2387 0.0216  -0.1121 -0.0109 251 TYR A C   
471  O O   . TYR A  80  ? 0.3468 0.2627 0.2557 0.0279  -0.1170 -0.0366 251 TYR A O   
472  C CB  . TYR A  80  ? 0.3769 0.2876 0.3360 0.0166  -0.1559 -0.0530 251 TYR A CB  
473  C CG  . TYR A  80  ? 0.2988 0.3333 0.3460 0.0625  -0.1295 0.0470  251 TYR A CG  
474  C CD1 . TYR A  80  ? 0.3963 0.3205 0.3431 0.0232  -0.0769 0.0334  251 TYR A CD1 
475  C CD2 . TYR A  80  ? 0.4500 0.2919 0.3581 0.0724  -0.2301 -0.0489 251 TYR A CD2 
476  C CE1 . TYR A  80  ? 0.3861 0.3963 0.3821 0.0454  -0.1306 -0.0604 251 TYR A CE1 
477  C CE2 . TYR A  80  ? 0.4771 0.5118 0.3464 -0.0112 -0.1550 -0.0596 251 TYR A CE2 
478  C CZ  . TYR A  80  ? 0.4026 0.3352 0.3589 -0.0409 -0.1694 -0.0722 251 TYR A CZ  
479  O OH  . TYR A  80  ? 0.4327 0.5219 0.3842 0.0179  -0.1628 -0.0698 251 TYR A OH  
480  N N   . HIS A  81  ? 0.3917 0.2974 0.2564 0.0278  -0.1848 -0.0119 252 HIS A N   
481  C CA  . HIS A  81  ? 0.3752 0.2212 0.2764 0.0282  -0.1137 -0.0274 252 HIS A CA  
482  C C   . HIS A  81  ? 0.4347 0.2615 0.3497 -0.0719 -0.0784 -0.1149 252 HIS A C   
483  O O   . HIS A  81  ? 0.4480 0.4625 0.5205 -0.0377 -0.2002 0.0742  252 HIS A O   
484  C CB  . HIS A  81  ? 0.3652 0.2471 0.2209 0.0456  -0.1418 -0.0311 252 HIS A CB  
485  C CG  . HIS A  81  ? 0.4287 0.2091 0.2707 0.0154  -0.0930 0.0113  252 HIS A CG  
486  N ND1 . HIS A  81  ? 0.3074 0.3467 0.3480 0.0613  -0.0876 0.0284  252 HIS A ND1 
487  C CD2 . HIS A  81  ? 0.4642 0.3174 0.2809 0.0488  -0.0750 -0.0272 252 HIS A CD2 
488  C CE1 . HIS A  81  ? 0.4905 0.3374 0.2878 0.0475  -0.0665 -0.0190 252 HIS A CE1 
489  N NE2 . HIS A  81  ? 0.4497 0.3519 0.2215 0.0577  -0.0696 0.0207  252 HIS A NE2 
490  N N   . PRO A  82  ? 0.4933 0.4058 0.3393 -0.0338 -0.0208 -0.0941 253 PRO A N   
491  C CA  . PRO A  82  ? 0.5204 0.4970 0.5355 -0.0493 0.0203  -0.0250 253 PRO A CA  
492  C C   . PRO A  82  ? 0.4923 0.4770 0.5326 -0.0805 0.0075  0.0455  253 PRO A C   
493  O O   . PRO A  82  ? 0.5436 0.3656 0.4173 -0.1231 -0.1469 -0.0027 253 PRO A O   
494  C CB  . PRO A  82  ? 0.5853 0.6644 0.5527 -0.0685 0.0325  -0.1602 253 PRO A CB  
495  C CG  . PRO A  82  ? 0.5807 0.7995 0.5173 -0.0371 0.0999  -0.0278 253 PRO A CG  
496  C CD  . PRO A  82  ? 0.5261 0.5971 0.3871 -0.0541 -0.0321 -0.0577 253 PRO A CD  
497  N N   . PRO A  83  ? 0.4692 0.6117 0.5787 0.1122  -0.1432 0.1782  254 PRO A N   
498  C CA  . PRO A  83  ? 0.4961 0.6742 0.4804 0.0110  -0.1658 0.0628  254 PRO A CA  
499  C C   . PRO A  83  ? 0.4240 0.6145 0.4485 0.0518  -0.0672 0.0695  254 PRO A C   
500  O O   . PRO A  83  ? 0.3535 0.6224 0.4921 0.0096  -0.1142 0.0384  254 PRO A O   
501  C CB  . PRO A  83  ? 0.5081 0.6666 0.6698 0.0205  -0.1050 0.1154  254 PRO A CB  
502  C CG  . PRO A  83  ? 0.6186 0.6695 0.7771 0.1209  -0.1444 0.1083  254 PRO A CG  
503  C CD  . PRO A  83  ? 0.5963 0.6169 0.7754 0.2015  -0.1115 0.0673  254 PRO A CD  
504  N N   . ALA A  84  ? 0.6025 0.4669 0.4234 -0.0781 -0.1741 -0.0231 255 ALA A N   
505  C CA  . ALA A  84  ? 0.5858 0.5985 0.4213 0.0486  -0.2640 -0.1474 255 ALA A CA  
506  C C   . ALA A  84  ? 0.5469 0.6224 0.5928 0.0634  -0.1305 -0.0830 255 ALA A C   
507  O O   . ALA A  84  ? 0.6487 0.5302 0.8379 0.1881  -0.3430 -0.1948 255 ALA A O   
508  C CB  . ALA A  84  ? 0.5423 0.5401 0.7564 -0.0825 -0.2061 -0.2228 255 ALA A CB  
509  N N   . ASP A  85  ? 0.5284 0.6152 0.3687 0.0922  -0.2220 -0.0199 256 ASP A N   
510  C CA  . ASP A  85  ? 0.4523 0.6506 0.4478 -0.0496 -0.1467 0.0035  256 ASP A CA  
511  C C   . ASP A  85  ? 0.3755 0.6423 0.3974 -0.0504 -0.1736 0.0588  256 ASP A C   
512  O O   . ASP A  85  ? 0.6881 0.9417 0.4222 0.0377  -0.1324 -0.0110 256 ASP A O   
513  C CB  . ASP A  85  ? 0.3727 0.7919 0.7981 -0.2558 -0.0375 -0.1985 256 ASP A CB  
514  N N   . LYS A  86  ? 0.3693 0.5854 0.4753 -0.0613 -0.2238 -0.0280 257 LYS A N   
515  C CA  . LYS A  86  ? 0.4706 0.5729 0.5260 0.0140  -0.1306 -0.0016 257 LYS A CA  
516  C C   . LYS A  86  ? 0.3146 0.5977 0.5577 0.1881  -0.1075 -0.0494 257 LYS A C   
517  O O   . LYS A  86  ? 0.4050 0.6439 0.7827 0.2171  -0.2758 -0.1446 257 LYS A O   
518  C CB  . LYS A  86  ? 0.4546 0.6520 0.6210 0.1155  -0.1342 0.1142  257 LYS A CB  
519  N N   . LEU A  87  ? 0.3284 0.4711 0.3243 0.1384  -0.1423 -0.1026 258 LEU A N   
520  C CA  . LEU A  87  ? 0.3382 0.3316 0.2758 0.0313  -0.1137 -0.0341 258 LEU A CA  
521  C C   . LEU A  87  ? 0.2821 0.3333 0.2714 -0.0008 -0.1036 -0.0486 258 LEU A C   
522  O O   . LEU A  87  ? 0.4613 0.3238 0.4076 -0.0012 -0.1980 -0.0679 258 LEU A O   
523  C CB  . LEU A  87  ? 0.3566 0.3489 0.2239 0.0592  -0.0865 -0.0272 258 LEU A CB  
524  C CG  . LEU A  87  ? 0.3661 0.3433 0.2909 0.0958  -0.0715 0.0002  258 LEU A CG  
525  C CD1 . LEU A  87  ? 0.3693 0.3922 0.3669 0.0717  -0.0359 0.0188  258 LEU A CD1 
526  C CD2 . LEU A  87  ? 0.3969 0.3481 0.3688 0.0437  -0.0750 -0.0190 258 LEU A CD2 
527  N N   . TYR A  88  ? 0.2644 0.2477 0.2791 0.0114  -0.1016 -0.0518 259 TYR A N   
528  C CA  . TYR A  88  ? 0.2288 0.2304 0.2911 -0.0272 -0.0623 -0.0372 259 TYR A CA  
529  C C   . TYR A  88  ? 0.2106 0.2092 0.2137 0.0267  -0.0446 0.0158  259 TYR A C   
530  O O   . TYR A  88  ? 0.2259 0.2253 0.2373 0.0229  -0.0317 -0.0090 259 TYR A O   
531  C CB  . TYR A  88  ? 0.2425 0.2909 0.3454 0.0136  -0.0558 -0.0260 259 TYR A CB  
532  C CG  . TYR A  88  ? 0.2954 0.4046 0.4502 0.0114  -0.1361 0.0433  259 TYR A CG  
533  C CD1 . TYR A  88  ? 0.2779 0.4442 0.5454 0.0137  -0.1276 0.0427  259 TYR A CD1 
534  C CD2 . TYR A  88  ? 0.3771 0.4712 0.5552 0.1305  -0.1221 0.0871  259 TYR A CD2 
535  C CE1 . TYR A  88  ? 0.2001 0.5172 0.5374 0.0684  0.0122  0.0869  259 TYR A CE1 
536  C CE2 . TYR A  88  ? 0.3084 0.5194 0.7122 0.0842  -0.0885 0.0187  259 TYR A CE2 
537  C CZ  . TYR A  88  ? 0.3167 0.4891 0.5217 0.0725  -0.1712 0.0289  259 TYR A CZ  
538  O OH  . TYR A  88  ? 0.2629 0.7649 0.6284 0.1065  -0.1055 0.1094  259 TYR A OH  
539  N N   . VAL A  89  ? 0.1837 0.1653 0.2137 0.0206  -0.0460 -0.0104 260 VAL A N   
540  C CA  . VAL A  89  ? 0.1878 0.1924 0.1939 0.0010  -0.0502 -0.0007 260 VAL A CA  
541  C C   . VAL A  89  ? 0.1876 0.2277 0.1635 -0.0060 0.0049  -0.0235 260 VAL A C   
542  O O   . VAL A  89  ? 0.1926 0.2492 0.2762 -0.0110 0.0263  -0.0914 260 VAL A O   
543  C CB  . VAL A  89  ? 0.1718 0.2215 0.2075 0.0276  0.0111  0.0033  260 VAL A CB  
544  C CG1 . VAL A  89  ? 0.2038 0.2510 0.1991 0.0043  -0.0179 0.0473  260 VAL A CG1 
545  C CG2 . VAL A  89  ? 0.2228 0.2057 0.2320 0.0013  -0.0396 -0.0048 260 VAL A CG2 
546  N N   . GLY A  90  ? 0.1438 0.1761 0.1816 0.0239  -0.0397 -0.0006 261 GLY A N   
547  C CA  . GLY A  90  ? 0.1373 0.1761 0.1596 0.0239  -0.0273 0.0000  261 GLY A CA  
548  C C   . GLY A  90  ? 0.1569 0.1768 0.1761 0.0261  -0.0438 0.0042  261 GLY A C   
549  O O   . GLY A  90  ? 0.2164 0.1690 0.1953 0.0251  -0.0420 -0.0209 261 GLY A O   
550  N N   . SER A  91  ? 0.1622 0.1468 0.1770 0.0227  -0.0363 -0.0068 262 SER A N   
551  C CA  . SER A  91  ? 0.1838 0.1708 0.1877 0.0231  -0.0679 0.0085  262 SER A CA  
552  C C   . SER A  91  ? 0.1841 0.1660 0.1531 0.0423  -0.0441 -0.0344 262 SER A C   
553  O O   . SER A  91  ? 0.1842 0.1801 0.1459 0.0490  -0.0390 -0.0007 262 SER A O   
554  C CB  . SER A  91  ? 0.2027 0.1892 0.1532 0.0161  -0.0706 0.0311  262 SER A CB  
555  O OG  . SER A  91  ? 0.1961 0.2214 0.2820 0.0151  -0.0896 -0.0051 262 SER A OG  
556  N N   . ARG A  92  ? 0.1843 0.1763 0.1767 0.0575  -0.0487 -0.0050 263 ARG A N   
557  C CA  . ARG A  92  ? 0.2010 0.1819 0.1458 0.0599  -0.0288 -0.0024 263 ARG A CA  
558  C C   . ARG A  92  ? 0.1717 0.1805 0.1408 0.0393  -0.0431 0.0074  263 ARG A C   
559  O O   . ARG A  92  ? 0.2035 0.2210 0.1644 0.0690  -0.0759 -0.0099 263 ARG A O   
560  C CB  . ARG A  92  ? 0.1831 0.1866 0.1603 0.0514  -0.0379 -0.0047 263 ARG A CB  
561  C CG  . ARG A  92  ? 0.2309 0.1678 0.1589 0.0263  -0.0176 0.0032  263 ARG A CG  
562  C CD  . ARG A  92  ? 0.1771 0.1949 0.1822 0.0177  -0.0249 0.0051  263 ARG A CD  
563  N NE  . ARG A  92  ? 0.2105 0.1722 0.1277 0.0145  -0.0093 -0.0103 263 ARG A NE  
564  C CZ  . ARG A  92  ? 0.1917 0.1937 0.1370 0.0166  -0.0259 0.0175  263 ARG A CZ  
565  N NH1 . ARG A  92  ? 0.1806 0.1926 0.1535 0.0179  -0.0243 0.0107  263 ARG A NH1 
566  N NH2 . ARG A  92  ? 0.1947 0.1825 0.1520 0.0284  -0.0275 -0.0029 263 ARG A NH2 
567  N N   . VAL A  93  ? 0.1636 0.1820 0.1233 0.0420  -0.0548 0.0314  264 VAL A N   
568  C CA  . VAL A  93  ? 0.2141 0.1840 0.1420 0.0569  -0.0475 0.0184  264 VAL A CA  
569  C C   . VAL A  93  ? 0.2188 0.1767 0.1436 0.0660  -0.0354 0.0067  264 VAL A C   
570  O O   . VAL A  93  ? 0.2401 0.1719 0.1390 0.0359  -0.0440 0.0197  264 VAL A O   
571  C CB  . VAL A  93  ? 0.2483 0.1865 0.1372 0.0429  -0.0646 0.0106  264 VAL A CB  
572  C CG1 . VAL A  93  ? 0.2567 0.1649 0.1944 0.0240  -0.0889 -0.0221 264 VAL A CG1 
573  C CG2 . VAL A  93  ? 0.1991 0.1671 0.2029 0.0385  -0.0550 0.0021  264 VAL A CG2 
574  N N   . VAL A  94  ? 0.2420 0.1881 0.1363 0.0275  -0.0582 0.0103  265 VAL A N   
575  C CA  . VAL A  94  ? 0.2326 0.1835 0.1628 0.0433  -0.0402 0.0032  265 VAL A CA  
576  C C   . VAL A  94  ? 0.2114 0.1734 0.1502 0.0303  -0.0436 0.0159  265 VAL A C   
577  O O   . VAL A  94  ? 0.2453 0.1816 0.1779 0.0354  -0.0708 0.0008  265 VAL A O   
578  C CB  . VAL A  94  ? 0.2098 0.2073 0.1911 0.0367  -0.0377 0.0230  265 VAL A CB  
579  C CG1 . VAL A  94  ? 0.2376 0.2047 0.1658 0.0499  -0.0155 0.0390  265 VAL A CG1 
580  C CG2 . VAL A  94  ? 0.2699 0.1954 0.2142 0.0561  -0.0226 0.0423  265 VAL A CG2 
581  N N   . ALA A  95  ? 0.2201 0.1646 0.1419 0.0408  -0.0410 -0.0009 266 ALA A N   
582  C CA  . ALA A  95  ? 0.2245 0.1769 0.1170 0.0530  -0.0436 0.0016  266 ALA A CA  
583  C C   . ALA A  95  ? 0.2279 0.1679 0.1415 0.0342  -0.0357 0.0150  266 ALA A C   
584  O O   . ALA A  95  ? 0.2344 0.1988 0.1545 0.0224  -0.0274 -0.0025 266 ALA A O   
585  C CB  . ALA A  95  ? 0.2915 0.1839 0.1600 0.0302  -0.0245 0.0099  266 ALA A CB  
586  N N   . LYS A  96  ? 0.2869 0.2157 0.1707 0.0410  -0.0267 -0.0281 267 LYS A N   
587  C CA  . LYS A  96  ? 0.2995 0.2175 0.2035 0.0488  -0.0166 -0.0150 267 LYS A CA  
588  C C   . LYS A  96  ? 0.2483 0.2803 0.1993 0.0475  -0.0168 -0.0397 267 LYS A C   
589  O O   . LYS A  96  ? 0.3579 0.2865 0.2417 0.0846  -0.0526 0.0030  267 LYS A O   
590  C CB  . LYS A  96  ? 0.3494 0.2567 0.2426 0.0474  0.0020  -0.0601 267 LYS A CB  
591  C CG  . LYS A  96  ? 0.3967 0.2986 0.2360 -0.0017 -0.0259 -0.0284 267 LYS A CG  
592  C CD  . LYS A  96  ? 0.5697 0.4071 0.2465 -0.0824 -0.0349 -0.0969 267 LYS A CD  
593  C CE  . LYS A  96  ? 0.6108 0.5294 0.2044 -0.1018 -0.0179 -0.0287 267 LYS A CE  
594  N NZ  . LYS A  96  ? 0.7078 0.5817 0.2043 -0.1031 0.0117  -0.0470 267 LYS A NZ  
595  N N   . TYR A  97  ? 0.2983 0.2222 0.1930 0.0286  -0.0386 0.0496  268 TYR A N   
596  C CA  . TYR A  97  ? 0.3078 0.2283 0.2413 0.0579  -0.0583 0.0342  268 TYR A CA  
597  C C   . TYR A  97  ? 0.4174 0.2741 0.3154 0.0711  -0.0065 -0.0406 268 TYR A C   
598  O O   . TYR A  97  ? 0.3692 0.3455 0.3359 0.1024  0.0428  -0.0517 268 TYR A O   
599  C CB  . TYR A  97  ? 0.3052 0.2392 0.2204 0.0515  -0.0204 0.0267  268 TYR A CB  
600  C CG  . TYR A  97  ? 0.2721 0.3020 0.2171 0.0516  0.0005  -0.0122 268 TYR A CG  
601  C CD1 . TYR A  97  ? 0.2952 0.3857 0.3233 0.1001  0.0091  0.0067  268 TYR A CD1 
602  C CD2 . TYR A  97  ? 0.2649 0.2073 0.2071 0.0621  -0.0041 0.0299  268 TYR A CD2 
603  C CE1 . TYR A  97  ? 0.2630 0.4375 0.3059 0.0990  0.0272  0.0337  268 TYR A CE1 
604  C CE2 . TYR A  97  ? 0.2538 0.2866 0.1980 0.0681  0.0027  0.0874  268 TYR A CE2 
605  C CZ  . TYR A  97  ? 0.2619 0.3004 0.2750 0.0957  -0.0159 0.0609  268 TYR A CZ  
606  O OH  . TYR A  97  ? 0.2604 0.3115 0.2581 0.0683  0.0013  0.0822  268 TYR A OH  
607  N N   . LYS A  98  ? 0.4573 0.2744 0.3776 0.0933  0.0239  0.0255  269 LYS A N   
608  C CA  . LYS A  98  ? 0.4248 0.4161 0.3257 0.1287  -0.0050 -0.0047 269 LYS A CA  
609  C C   . LYS A  98  ? 0.4012 0.4108 0.3613 0.1916  0.0555  0.0688  269 LYS A C   
610  O O   . LYS A  98  ? 1.0325 0.4302 0.2489 0.2344  0.0590  0.0554  269 LYS A O   
611  C CB  . LYS A  98  ? 0.5211 0.4553 0.4380 0.1241  -0.0510 -0.0754 269 LYS A CB  
612  C CG  . LYS A  98  ? 0.5359 0.3737 0.4918 0.1036  -0.0568 -0.0039 269 LYS A CG  
613  C CD  . LYS A  98  ? 0.5959 0.4873 0.4146 0.0307  -0.0865 -0.0184 269 LYS A CD  
614  C CE  . LYS A  98  ? 0.4674 0.4798 0.4575 -0.0051 0.0379  -0.0681 269 LYS A CE  
615  N NZ  . LYS A  98  ? 0.5405 0.4559 0.2897 0.0041  -0.0132 0.0236  269 LYS A NZ  
616  N N   . ASP A  99  ? 0.3402 0.4874 0.5485 0.1989  0.0349  -0.0032 270 ASP A N   
617  C CA  . ASP A  99  ? 0.4294 0.5600 0.6508 0.1780  -0.0775 0.0045  270 ASP A CA  
618  C C   . ASP A  99  ? 0.5746 0.8188 0.6178 0.0529  0.0500  0.0038  270 ASP A C   
619  O O   . ASP A  99  ? 0.5729 0.8172 0.6399 0.1475  0.0836  0.0201  270 ASP A O   
620  C CB  . ASP A  99  ? 0.3000 0.5761 0.7880 0.1374  -0.1483 0.0052  270 ASP A CB  
621  N N   . VAL A  103 ? 0.3687 0.8030 0.5083 -0.0452 0.2725  -0.2366 274 VAL A N   
622  C CA  . VAL A  103 ? 0.3771 0.4112 0.3990 0.1113  0.1349  -0.0782 274 VAL A CA  
623  C C   . VAL A  103 ? 0.4089 0.3806 0.4004 0.0581  0.0648  -0.0470 274 VAL A C   
624  O O   . VAL A  103 ? 0.6261 0.4043 0.4078 0.0004  0.2137  -0.0622 274 VAL A O   
625  C CB  . VAL A  103 ? 0.4763 0.4824 0.3834 0.0233  0.1112  -0.0637 274 VAL A CB  
626  C CG1 . VAL A  103 ? 0.6742 0.5820 0.4528 0.0158  0.0485  0.0548  274 VAL A CG1 
627  C CG2 . VAL A  103 ? 0.4640 0.3668 0.3963 -0.0537 0.0871  -0.1621 274 VAL A CG2 
628  N N   . TRP A  104 ? 0.3454 0.2767 0.3600 0.0641  0.0431  0.0224  275 TRP A N   
629  C CA  . TRP A  104 ? 0.3065 0.2979 0.3254 0.0515  0.0592  -0.0264 275 TRP A CA  
630  C C   . TRP A  104 ? 0.2692 0.2289 0.2151 0.0638  -0.0115 0.0236  275 TRP A C   
631  O O   . TRP A  104 ? 0.2561 0.2533 0.2923 0.0789  0.0537  0.0603  275 TRP A O   
632  C CB  . TRP A  104 ? 0.3021 0.2987 0.3930 -0.0167 0.0355  -0.0008 275 TRP A CB  
633  C CG  . TRP A  104 ? 0.2871 0.3561 0.5540 0.0442  0.0085  0.0171  275 TRP A CG  
634  C CD1 . TRP A  104 ? 0.3906 0.4343 0.4996 -0.0470 -0.0071 0.0272  275 TRP A CD1 
635  C CD2 . TRP A  104 ? 0.3104 0.4310 0.4952 0.1143  -0.0307 -0.0585 275 TRP A CD2 
636  N NE1 . TRP A  104 ? 0.3634 0.4871 0.6494 -0.0667 0.0162  0.0921  275 TRP A NE1 
637  C CE2 . TRP A  104 ? 0.4912 0.3998 0.6687 -0.0469 0.0588  -0.0304 275 TRP A CE2 
638  N N   . LEU A  105 ? 0.2626 0.2304 0.1429 0.0622  -0.0144 0.0367  276 LEU A N   
639  C CA  . LEU A  105 ? 0.2452 0.1765 0.1576 0.0522  -0.0153 0.0042  276 LEU A CA  
640  C C   . LEU A  105 ? 0.2650 0.1843 0.1444 0.0359  -0.0210 0.0237  276 LEU A C   
641  O O   . LEU A  105 ? 0.2148 0.1933 0.1659 0.0502  -0.0194 0.0397  276 LEU A O   
642  C CB  . LEU A  105 ? 0.3049 0.2546 0.1360 0.0721  -0.0359 0.0204  276 LEU A CB  
643  C CG  . LEU A  105 ? 0.2948 0.2655 0.1444 0.0618  -0.0485 0.0039  276 LEU A CG  
644  C CD1 . LEU A  105 ? 0.3172 0.3108 0.1836 0.0856  -0.0595 0.0077  276 LEU A CD1 
645  C CD2 . LEU A  105 ? 0.3506 0.3023 0.1959 0.0250  -0.0496 -0.0016 276 LEU A CD2 
646  N N   . TYR A  106 ? 0.2345 0.1766 0.1458 0.0135  -0.0159 -0.0007 277 TYR A N   
647  C CA  . TYR A  106 ? 0.2338 0.1652 0.1515 0.0524  -0.0241 -0.0209 277 TYR A CA  
648  C C   . TYR A  106 ? 0.2249 0.1819 0.1472 0.0347  -0.0424 0.0201  277 TYR A C   
649  O O   . TYR A  106 ? 0.2392 0.1945 0.1308 0.0253  -0.0348 0.0144  277 TYR A O   
650  C CB  . TYR A  106 ? 0.2111 0.1831 0.1792 0.0501  0.0037  0.0201  277 TYR A CB  
651  C CG  . TYR A  106 ? 0.2741 0.2223 0.2558 0.0067  -0.0622 0.0690  277 TYR A CG  
652  C CD1 . TYR A  106 ? 0.2623 0.3026 0.2230 0.0014  -0.0261 0.0904  277 TYR A CD1 
653  C CD2 . TYR A  106 ? 0.2679 0.2564 0.2482 -0.0005 -0.0432 0.0423  277 TYR A CD2 
654  C CE1 . TYR A  106 ? 0.2634 0.3661 0.2771 -0.0364 -0.0327 0.0823  277 TYR A CE1 
655  C CE2 . TYR A  106 ? 0.2716 0.3101 0.2408 0.0018  -0.0716 0.0465  277 TYR A CE2 
656  C CZ  . TYR A  106 ? 0.2280 0.3323 0.2342 0.0082  -0.0081 -0.0116 277 TYR A CZ  
657  O OH  . TYR A  106 ? 0.3677 0.3108 0.3137 -0.0275 -0.1027 -0.0008 277 TYR A OH  
658  N N   . ALA A  107 ? 0.1843 0.1801 0.1279 0.0304  -0.0423 0.0243  278 ALA A N   
659  C CA  . ALA A  107 ? 0.2129 0.1543 0.1518 0.0098  -0.0122 0.0248  278 ALA A CA  
660  C C   . ALA A  107 ? 0.1827 0.1523 0.1375 0.0255  -0.0251 0.0137  278 ALA A C   
661  O O   . ALA A  107 ? 0.1849 0.1840 0.1475 0.0389  -0.0259 0.0088  278 ALA A O   
662  C CB  . ALA A  107 ? 0.2188 0.1695 0.1415 0.0333  -0.0305 0.0157  278 ALA A CB  
663  N N   . GLY A  108 ? 0.1750 0.1471 0.1471 0.0186  -0.0387 0.0237  279 GLY A N   
664  C CA  . GLY A  108 ? 0.1911 0.1660 0.1122 0.0148  -0.0315 0.0094  279 GLY A CA  
665  C C   . GLY A  108 ? 0.1782 0.1508 0.1166 0.0191  -0.0395 -0.0050 279 GLY A C   
666  O O   . GLY A  108 ? 0.1667 0.1639 0.1553 0.0295  -0.0268 0.0035  279 GLY A O   
667  N N   . ILE A  109 ? 0.1794 0.1468 0.1321 0.0185  -0.0425 0.0043  280 ILE A N   
668  C CA  . ILE A  109 ? 0.1492 0.1406 0.1171 0.0306  -0.0496 -0.0030 280 ILE A CA  
669  C C   . ILE A  109 ? 0.1579 0.1550 0.1558 0.0187  -0.0387 -0.0268 280 ILE A C   
670  O O   . ILE A  109 ? 0.1680 0.1427 0.1724 0.0202  -0.0439 -0.0047 280 ILE A O   
671  C CB  . ILE A  109 ? 0.1820 0.1945 0.1170 -0.0169 -0.0341 -0.0384 280 ILE A CB  
672  C CG1 . ILE A  109 ? 0.1962 0.1862 0.1625 -0.0140 -0.0117 -0.0201 280 ILE A CG1 
673  C CG2 . ILE A  109 ? 0.2163 0.1957 0.1638 -0.0227 -0.0171 -0.0262 280 ILE A CG2 
674  C CD1 . ILE A  109 ? 0.2016 0.2028 0.2059 0.0130  -0.0413 -0.0009 280 ILE A CD1 
675  N N   . VAL A  110 ? 0.1536 0.1394 0.1438 0.0139  -0.0419 0.0002  281 VAL A N   
676  C CA  . VAL A  110 ? 0.1738 0.1454 0.1507 0.0096  -0.0392 -0.0175 281 VAL A CA  
677  C C   . VAL A  110 ? 0.1259 0.1444 0.1548 0.0143  -0.0266 -0.0134 281 VAL A C   
678  O O   . VAL A  110 ? 0.1650 0.1569 0.1546 0.0385  -0.0115 0.0066  281 VAL A O   
679  C CB  . VAL A  110 ? 0.1742 0.1757 0.1758 0.0120  -0.0505 0.0071  281 VAL A CB  
680  C CG1 . VAL A  110 ? 0.1927 0.1841 0.1552 0.0062  -0.0639 0.0013  281 VAL A CG1 
681  C CG2 . VAL A  110 ? 0.1642 0.1887 0.1753 0.0008  -0.0501 -0.0009 281 VAL A CG2 
682  N N   . ALA A  111 ? 0.1594 0.1541 0.1195 0.0307  -0.0285 -0.0119 282 ALA A N   
683  C CA  . ALA A  111 ? 0.1323 0.1453 0.1210 0.0062  -0.0166 -0.0034 282 ALA A CA  
684  C C   . ALA A  111 ? 0.1552 0.1329 0.1421 0.0073  -0.0421 0.0030  282 ALA A C   
685  O O   . ALA A  111 ? 0.1575 0.1540 0.1792 -0.0248 -0.0233 0.0129  282 ALA A O   
686  C CB  . ALA A  111 ? 0.1406 0.1879 0.1484 0.0070  -0.0417 -0.0217 282 ALA A CB  
687  N N   . GLU A  112 ? 0.1730 0.1536 0.1445 0.0175  -0.0731 0.0160  283 GLU A N   
688  C CA  . GLU A  112 ? 0.1579 0.1622 0.1694 0.0068  -0.0246 0.0136  283 GLU A CA  
689  C C   . GLU A  112 ? 0.1699 0.1609 0.1931 0.0130  -0.0528 -0.0180 283 GLU A C   
690  O O   . GLU A  112 ? 0.1753 0.2166 0.1494 0.0122  -0.0697 -0.0307 283 GLU A O   
691  C CB  . GLU A  112 ? 0.1707 0.1608 0.2036 0.0082  -0.0407 -0.0360 283 GLU A CB  
692  C CG  . GLU A  112 ? 0.2110 0.1784 0.1921 0.0137  -0.0473 -0.0186 283 GLU A CG  
693  C CD  . GLU A  112 ? 0.1976 0.1822 0.1678 0.0262  -0.0291 -0.0280 283 GLU A CD  
694  O OE1 . GLU A  112 ? 0.2131 0.2079 0.1515 0.0212  -0.0813 -0.0415 283 GLU A OE1 
695  O OE2 . GLU A  112 ? 0.1662 0.1810 0.1822 -0.0021 -0.0440 -0.0471 283 GLU A OE2 
696  N N   . THR A  113 ? 0.1771 0.2015 0.1733 0.0028  -0.0511 -0.0334 284 THR A N   
697  C CA  . THR A  113 ? 0.2041 0.1870 0.2099 0.0103  -0.0916 -0.0349 284 THR A CA  
698  C C   . THR A  113 ? 0.1387 0.1977 0.2020 0.0024  -0.0599 -0.0430 284 THR A C   
699  O O   . THR A  113 ? 0.2047 0.1972 0.1939 -0.0060 -0.0675 -0.0336 284 THR A O   
700  C CB  . THR A  113 ? 0.2194 0.3131 0.2357 0.0397  -0.1050 -0.0716 284 THR A CB  
701  O OG1 . THR A  113 ? 0.1413 0.3832 0.2876 0.0399  -0.0145 -0.0721 284 THR A OG1 
702  C CG2 . THR A  113 ? 0.2829 0.3572 0.3366 0.1023  -0.1406 -0.1202 284 THR A CG2 
703  N N   . PRO A  114 ? 0.1972 0.2217 0.2145 -0.0016 -0.0953 -0.0499 285 PRO A N   
704  C CA  . PRO A  114 ? 0.1788 0.2329 0.2006 0.0180  -0.0784 -0.0409 285 PRO A CA  
705  C C   . PRO A  114 ? 0.2066 0.2450 0.1910 0.0011  -0.0565 -0.0633 285 PRO A C   
706  O O   . PRO A  114 ? 0.2023 0.2538 0.2228 -0.0230 -0.0418 -0.0754 285 PRO A O   
707  C CB  . PRO A  114 ? 0.1948 0.2628 0.2037 0.0369  -0.0903 -0.0371 285 PRO A CB  
708  C CG  . PRO A  114 ? 0.2525 0.2869 0.2081 0.0409  -0.0836 -0.0322 285 PRO A CG  
709  C CD  . PRO A  114 ? 0.2882 0.2453 0.2157 0.0002  -0.1181 -0.0503 285 PRO A CD  
710  N N   . ASN A  115 ? 0.1621 0.2568 0.2138 -0.0056 -0.0632 -0.0829 286 ASN A N   
711  C CA  . ASN A  115 ? 0.1771 0.2633 0.2215 -0.0156 -0.0442 -0.0713 286 ASN A CA  
712  C C   . ASN A  115 ? 0.2222 0.2442 0.1808 -0.0319 -0.0454 -0.0785 286 ASN A C   
713  O O   . ASN A  115 ? 0.2155 0.2461 0.2191 -0.0047 -0.0499 -0.0857 286 ASN A O   
714  C CB  . ASN A  115 ? 0.2197 0.2271 0.2453 -0.0447 -0.0201 -0.0285 286 ASN A CB  
715  C CG  . ASN A  115 ? 0.2200 0.2001 0.2399 0.0035  -0.0260 -0.0371 286 ASN A CG  
716  O OD1 . ASN A  115 ? 0.2177 0.2289 0.2577 0.0225  -0.0349 -0.0384 286 ASN A OD1 
717  N ND2 . ASN A  115 ? 0.2135 0.2748 0.2518 0.0032  -0.0186 -0.0791 286 ASN A ND2 
718  N N   . VAL A  116 ? 0.2126 0.2869 0.2838 -0.0585 -0.0152 -0.1030 287 VAL A N   
719  C CA  . VAL A  116 ? 0.3287 0.2668 0.3179 -0.0200 -0.0369 -0.1027 287 VAL A CA  
720  C C   . VAL A  116 ? 0.3317 0.2567 0.2654 -0.0147 -0.0036 -0.0928 287 VAL A C   
721  O O   . VAL A  116 ? 0.2799 0.2434 0.2522 -0.0729 -0.0493 -0.0546 287 VAL A O   
722  C CB  . VAL A  116 ? 0.3231 0.2564 0.3417 -0.0206 -0.0562 -0.0749 287 VAL A CB  
723  C CG1 . VAL A  116 ? 0.3481 0.2824 0.2959 -0.0011 -0.0195 -0.0477 287 VAL A CG1 
724  C CG2 . VAL A  116 ? 0.2899 0.2741 0.4160 -0.0873 -0.0667 -0.0639 287 VAL A CG2 
725  N N   . LYS A  117 ? 0.2771 0.2446 0.2468 0.0105  -0.0262 -0.0512 288 LYS A N   
726  C CA  . LYS A  117 ? 0.2990 0.2540 0.3176 0.0080  -0.0364 -0.0297 288 LYS A CA  
727  C C   . LYS A  117 ? 0.2597 0.2545 0.2520 0.0206  -0.0611 -0.0137 288 LYS A C   
728  O O   . LYS A  117 ? 0.2566 0.2380 0.4580 0.0118  -0.1017 -0.0195 288 LYS A O   
729  C CB  . LYS A  117 ? 0.2606 0.2843 0.2923 0.0061  -0.0079 -0.0057 288 LYS A CB  
730  C CG  . LYS A  117 ? 0.4581 0.2876 0.3759 0.0133  0.0301  0.0264  288 LYS A CG  
731  C CD  . LYS A  117 ? 0.3364 0.4779 0.3423 0.0317  -0.0222 0.0660  288 LYS A CD  
732  N N   . ASN A  118 ? 0.2318 0.2339 0.2334 0.0213  -0.0451 -0.0590 289 ASN A N   
733  C CA  . ASN A  118 ? 0.1988 0.2189 0.2444 0.0526  -0.0547 -0.0410 289 ASN A CA  
734  C C   . ASN A  118 ? 0.2220 0.1952 0.2405 0.0167  -0.0882 -0.0413 289 ASN A C   
735  O O   . ASN A  118 ? 0.2319 0.2500 0.2071 0.0049  -0.0604 -0.0823 289 ASN A O   
736  C CB  . ASN A  118 ? 0.2239 0.2290 0.2181 0.0319  -0.0726 -0.0603 289 ASN A CB  
737  C CG  . ASN A  118 ? 0.2092 0.1703 0.1695 0.0004  -0.0704 -0.0501 289 ASN A CG  
738  O OD1 . ASN A  118 ? 0.1940 0.2341 0.1926 0.0140  -0.0925 -0.0706 289 ASN A OD1 
739  N ND2 . ASN A  118 ? 0.1802 0.2063 0.1675 -0.0103 -0.0678 -0.0680 289 ASN A ND2 
740  N N   . LYS A  119 ? 0.2604 0.1907 0.2528 0.0247  -0.0866 -0.0615 290 LYS A N   
741  C CA  . LYS A  119 ? 0.2818 0.2872 0.2407 0.0439  -0.1085 -0.1196 290 LYS A CA  
742  C C   . LYS A  119 ? 0.2513 0.2496 0.2062 0.0127  -0.0314 -0.0774 290 LYS A C   
743  O O   . LYS A  119 ? 0.2453 0.2851 0.2038 0.0171  -0.0552 -0.0884 290 LYS A O   
744  C CB  . LYS A  119 ? 0.3205 0.3370 0.2640 0.0946  -0.0853 -0.1526 290 LYS A CB  
745  C CG  . LYS A  119 ? 0.3899 0.4256 0.3796 0.1795  -0.1153 -0.1203 290 LYS A CG  
746  C CD  . LYS A  119 ? 0.5493 0.6680 0.4022 0.0804  0.0586  -0.1983 290 LYS A CD  
747  N N   . LEU A  120 ? 0.2247 0.2302 0.1820 0.0128  -0.0844 -0.0814 291 LEU A N   
748  C CA  . LEU A  120 ? 0.2122 0.2454 0.1536 0.0252  -0.0732 -0.0841 291 LEU A CA  
749  C C   . LEU A  120 ? 0.1901 0.2373 0.2078 0.0448  -0.1038 -0.0469 291 LEU A C   
750  O O   . LEU A  120 ? 0.2652 0.2632 0.1716 0.0198  -0.1040 -0.0479 291 LEU A O   
751  C CB  . LEU A  120 ? 0.2586 0.2641 0.1391 -0.0412 -0.0798 -0.0430 291 LEU A CB  
752  C CG  . LEU A  120 ? 0.2648 0.2445 0.2139 -0.0471 -0.0973 -0.0824 291 LEU A CG  
753  C CD1 . LEU A  120 ? 0.2756 0.2173 0.2007 -0.0112 -0.1084 -0.0682 291 LEU A CD1 
754  C CD2 . LEU A  120 ? 0.2623 0.3027 0.2476 -0.0542 -0.0868 -0.0489 291 LEU A CD2 
755  N N   . ARG A  121 ? 0.1724 0.2254 0.1888 0.0096  -0.0843 -0.0229 292 ARG A N   
756  C CA  . ARG A  121 ? 0.2206 0.1915 0.1405 0.0094  -0.0611 -0.0328 292 ARG A CA  
757  C C   . ARG A  121 ? 0.1800 0.1950 0.1692 0.0193  -0.0560 -0.0443 292 ARG A C   
758  O O   . ARG A  121 ? 0.2174 0.1957 0.1771 -0.0128 -0.0548 -0.0555 292 ARG A O   
759  C CB  . ARG A  121 ? 0.2208 0.2119 0.1518 0.0144  -0.0599 -0.0413 292 ARG A CB  
760  C CG  . ARG A  121 ? 0.2396 0.2648 0.1526 0.0039  -0.0472 -0.0484 292 ARG A CG  
761  C CD  . ARG A  121 ? 0.2705 0.3017 0.1684 0.0393  0.0113  -0.0480 292 ARG A CD  
762  N NE  . ARG A  121 ? 0.2474 0.2219 0.2235 0.0057  0.0055  -0.0659 292 ARG A NE  
763  C CZ  . ARG A  121 ? 0.2835 0.2705 0.2515 0.0407  -0.0130 -0.1064 292 ARG A CZ  
764  N NH1 . ARG A  121 ? 0.2502 0.2857 0.3297 0.0452  -0.0294 -0.1588 292 ARG A NH1 
765  N NH2 . ARG A  121 ? 0.3507 0.2563 0.2582 0.0837  -0.1389 -0.0890 292 ARG A NH2 
766  N N   . PHE A  122 ? 0.2143 0.2054 0.1297 -0.0005 -0.0678 -0.0274 293 PHE A N   
767  C CA  . PHE A  122 ? 0.1836 0.1739 0.1338 0.0266  -0.0518 -0.0186 293 PHE A CA  
768  C C   . PHE A  122 ? 0.1647 0.1632 0.1570 0.0257  -0.0337 0.0033  293 PHE A C   
769  O O   . PHE A  122 ? 0.1866 0.1882 0.1495 0.0280  -0.0411 -0.0034 293 PHE A O   
770  C CB  . PHE A  122 ? 0.2207 0.1940 0.1414 0.0467  -0.0565 0.0061  293 PHE A CB  
771  C CG  . PHE A  122 ? 0.2277 0.2173 0.2121 0.0385  -0.0761 -0.0205 293 PHE A CG  
772  C CD1 . PHE A  122 ? 0.1981 0.2387 0.2539 0.0338  -0.0603 -0.0108 293 PHE A CD1 
773  C CD2 . PHE A  122 ? 0.2625 0.3653 0.2586 -0.0247 -0.1360 -0.0295 293 PHE A CD2 
774  C CE1 . PHE A  122 ? 0.2291 0.3304 0.3670 0.0829  -0.0689 -0.0200 293 PHE A CE1 
775  C CE2 . PHE A  122 ? 0.2829 0.3696 0.3638 0.0093  -0.1731 0.0634  293 PHE A CE2 
776  C CZ  . PHE A  122 ? 0.2938 0.3602 0.3900 0.0053  -0.1683 0.0430  293 PHE A CZ  
777  N N   . LEU A  123 ? 0.1797 0.1678 0.1653 -0.0008 -0.0525 0.0075  294 LEU A N   
778  C CA  . LEU A  123 ? 0.1494 0.1455 0.1781 -0.0034 -0.0273 -0.0162 294 LEU A CA  
779  C C   . LEU A  123 ? 0.1648 0.1485 0.1143 -0.0004 -0.0473 -0.0112 294 LEU A C   
780  O O   . LEU A  123 ? 0.1856 0.1721 0.1366 0.0172  -0.0404 -0.0227 294 LEU A O   
781  C CB  . LEU A  123 ? 0.1684 0.1424 0.1445 -0.0115 -0.0422 -0.0323 294 LEU A CB  
782  C CG  . LEU A  123 ? 0.1634 0.1725 0.1646 -0.0254 -0.0416 -0.0062 294 LEU A CG  
783  C CD1 . LEU A  123 ? 0.1865 0.1457 0.1990 0.0037  -0.0424 -0.0118 294 LEU A CD1 
784  C CD2 . LEU A  123 ? 0.1776 0.1774 0.1710 -0.0115 -0.0453 0.0044  294 LEU A CD2 
785  N N   . ILE A  124 ? 0.1598 0.1359 0.1268 0.0114  -0.0418 -0.0159 295 ILE A N   
786  C CA  . ILE A  124 ? 0.1742 0.1330 0.1512 -0.0033 -0.0271 -0.0044 295 ILE A CA  
787  C C   . ILE A  124 ? 0.1614 0.1529 0.1416 0.0116  -0.0133 -0.0046 295 ILE A C   
788  O O   . ILE A  124 ? 0.1860 0.1606 0.1296 0.0243  -0.0096 -0.0262 295 ILE A O   
789  C CB  . ILE A  124 ? 0.1901 0.1870 0.1246 0.0169  -0.0314 -0.0057 295 ILE A CB  
790  C CG1 . ILE A  124 ? 0.2143 0.1835 0.1470 0.0019  -0.0538 -0.0172 295 ILE A CG1 
791  C CG2 . ILE A  124 ? 0.2056 0.1840 0.1212 0.0094  -0.0184 0.0207  295 ILE A CG2 
792  C CD1 . ILE A  124 ? 0.2088 0.1841 0.1715 0.0122  -0.0813 -0.0147 295 ILE A CD1 
793  N N   . PHE A  125 ? 0.1381 0.1296 0.1427 0.0245  -0.0379 -0.0031 296 PHE A N   
794  C CA  . PHE A  125 ? 0.1380 0.1293 0.1559 0.0068  -0.0259 -0.0073 296 PHE A CA  
795  C C   . PHE A  125 ? 0.1542 0.1410 0.1123 0.0242  -0.0352 0.0210  296 PHE A C   
796  O O   . PHE A  125 ? 0.1873 0.1393 0.1357 0.0387  -0.0404 0.0139  296 PHE A O   
797  C CB  . PHE A  125 ? 0.1337 0.1175 0.1443 0.0192  -0.0194 -0.0156 296 PHE A CB  
798  C CG  . PHE A  125 ? 0.1511 0.1408 0.1289 -0.0018 -0.0503 -0.0107 296 PHE A CG  
799  C CD1 . PHE A  125 ? 0.1719 0.1637 0.1104 0.0187  -0.0509 -0.0139 296 PHE A CD1 
800  C CD2 . PHE A  125 ? 0.1541 0.1479 0.1442 0.0200  -0.0248 -0.0013 296 PHE A CD2 
801  C CE1 . PHE A  125 ? 0.1450 0.1688 0.1629 0.0159  -0.0400 0.0014  296 PHE A CE1 
802  C CE2 . PHE A  125 ? 0.1589 0.1685 0.1265 -0.0013 -0.0255 0.0140  296 PHE A CE2 
803  C CZ  . PHE A  125 ? 0.1445 0.1416 0.1486 -0.0068 -0.0586 0.0212  296 PHE A CZ  
804  N N   . PHE A  126 ? 0.1582 0.1565 0.1244 0.0206  -0.0358 0.0170  297 PHE A N   
805  C CA  . PHE A  126 ? 0.1758 0.1466 0.1467 0.0228  -0.0212 0.0126  297 PHE A CA  
806  C C   . PHE A  126 ? 0.1356 0.1423 0.1471 0.0212  -0.0208 0.0175  297 PHE A C   
807  O O   . PHE A  126 ? 0.1584 0.1789 0.1220 0.0010  -0.0098 0.0198  297 PHE A O   
808  C CB  . PHE A  126 ? 0.1842 0.1679 0.1476 0.0379  -0.0274 0.0273  297 PHE A CB  
809  C CG  . PHE A  126 ? 0.2091 0.1784 0.1539 0.0451  -0.0500 0.0165  297 PHE A CG  
810  C CD1 . PHE A  126 ? 0.2453 0.1850 0.1326 0.0278  -0.0515 0.0199  297 PHE A CD1 
811  C CD2 . PHE A  126 ? 0.2552 0.1613 0.1434 0.0283  -0.0428 0.0245  297 PHE A CD2 
812  C CE1 . PHE A  126 ? 0.1646 0.1495 0.1802 0.0282  -0.0462 0.0000  297 PHE A CE1 
813  C CE2 . PHE A  126 ? 0.2384 0.1743 0.1442 0.0213  -0.0364 0.0183  297 PHE A CE2 
814  C CZ  . PHE A  126 ? 0.2680 0.1865 0.1523 0.0535  -0.0491 -0.0023 297 PHE A CZ  
815  N N   . ASP A  127 ? 0.1841 0.1355 0.1272 0.0210  -0.0304 0.0111  298 ASP A N   
816  C CA  . ASP A  127 ? 0.1706 0.1554 0.1521 0.0188  0.0120  -0.0077 298 ASP A CA  
817  C C   . ASP A  127 ? 0.1886 0.1586 0.2124 0.0232  -0.0172 -0.0008 298 ASP A C   
818  O O   . ASP A  127 ? 0.2064 0.2327 0.2143 0.0305  -0.0452 -0.0076 298 ASP A O   
819  C CB  . ASP A  127 ? 0.1927 0.1612 0.1681 0.0276  -0.0320 -0.0002 298 ASP A CB  
820  C CG  . ASP A  127 ? 0.1863 0.1754 0.1799 0.0164  -0.0257 -0.0158 298 ASP A CG  
821  O OD1 . ASP A  127 ? 0.1957 0.1714 0.2194 0.0175  -0.0171 -0.0239 298 ASP A OD1 
822  O OD2 . ASP A  127 ? 0.2261 0.1807 0.1725 0.0236  -0.0241 0.0112  298 ASP A OD2 
823  N N   . ASP A  128 ? 0.1795 0.1450 0.1763 0.0024  -0.0390 -0.0232 299 ASP A N   
824  C CA  . ASP A  128 ? 0.2040 0.1842 0.2477 0.0143  -0.0613 -0.0111 299 ASP A CA  
825  C C   . ASP A  128 ? 0.1691 0.2226 0.2058 0.0285  -0.0413 0.0070  299 ASP A C   
826  O O   . ASP A  128 ? 0.1921 0.2208 0.3483 0.0388  -0.1029 0.0084  299 ASP A O   
827  C CB  . ASP A  128 ? 0.1907 0.2312 0.3226 -0.0017 -0.0128 0.0292  299 ASP A CB  
828  C CG  . ASP A  128 ? 0.2119 0.2574 0.2594 0.0318  0.0327  0.0399  299 ASP A CG  
829  O OD1 . ASP A  128 ? 0.2541 0.1795 0.2218 0.0290  0.0174  0.0134  299 ASP A OD1 
830  O OD2 . ASP A  128 ? 0.2335 0.3103 0.2585 0.0521  0.0405  0.0287  299 ASP A OD2 
831  N N   . GLY A  129 ? 0.2111 0.1745 0.1799 0.0305  -0.0481 -0.0030 300 GLY A N   
832  C CA  . GLY A  129 ? 0.2643 0.1735 0.1711 0.0388  -0.0856 -0.0124 300 GLY A CA  
833  C C   . GLY A  129 ? 0.1849 0.1701 0.1618 0.0252  -0.0347 -0.0007 300 GLY A C   
834  O O   . GLY A  129 ? 0.2119 0.1822 0.1469 0.0277  -0.0345 0.0190  300 GLY A O   
835  N N   . TYR A  130 ? 0.1804 0.1758 0.1582 0.0050  -0.0355 0.0044  301 TYR A N   
836  C CA  . TYR A  130 ? 0.1695 0.1553 0.1639 0.0216  -0.0453 0.0101  301 TYR A CA  
837  C C   . TYR A  130 ? 0.1743 0.1547 0.1304 0.0279  -0.0309 0.0313  301 TYR A C   
838  O O   . TYR A  130 ? 0.1739 0.1653 0.2102 0.0292  -0.0322 0.0019  301 TYR A O   
839  C CB  . TYR A  130 ? 0.1920 0.1985 0.1668 0.0334  -0.0379 0.0214  301 TYR A CB  
840  C CG  . TYR A  130 ? 0.2106 0.1946 0.1687 0.0175  -0.0098 0.0317  301 TYR A CG  
841  C CD1 . TYR A  130 ? 0.2859 0.2264 0.1489 0.0693  0.0007  0.0022  301 TYR A CD1 
842  C CD2 . TYR A  130 ? 0.2766 0.2134 0.1512 0.0509  -0.0218 0.0285  301 TYR A CD2 
843  C CE1 . TYR A  130 ? 0.3990 0.2271 0.2447 0.1329  0.0347  -0.0302 301 TYR A CE1 
844  C CE2 . TYR A  130 ? 0.3654 0.2668 0.1768 0.0374  -0.0510 -0.0350 301 TYR A CE2 
845  C CZ  . TYR A  130 ? 0.4255 0.2829 0.2239 0.0937  0.0161  0.0132  301 TYR A CZ  
846  O OH  . TYR A  130 ? 0.7512 0.3055 0.2175 0.1265  -0.0176 0.0057  301 TYR A OH  
847  N N   . ALA A  131 ? 0.1645 0.1662 0.1699 0.0248  -0.0388 0.0023  302 ALA A N   
848  C CA  . ALA A  131 ? 0.1621 0.1838 0.1518 0.0217  -0.0289 0.0026  302 ALA A CA  
849  C C   . ALA A  131 ? 0.1847 0.1697 0.1605 0.0088  -0.0151 0.0046  302 ALA A C   
850  O O   . ALA A  131 ? 0.1904 0.2101 0.1393 0.0268  -0.0232 -0.0013 302 ALA A O   
851  C CB  . ALA A  131 ? 0.1826 0.2203 0.1579 0.0010  -0.0239 0.0108  302 ALA A CB  
852  N N   . SER A  132 ? 0.1654 0.1429 0.1611 0.0389  -0.0173 -0.0036 303 SER A N   
853  C CA  A SER A  132 ? 0.1730 0.1400 0.1658 0.0450  -0.0235 -0.0048 303 SER A CA  
854  C CA  B SER A  132 ? 0.1764 0.1583 0.1613 0.0297  -0.0111 -0.0080 303 SER A CA  
855  C C   . SER A  132 ? 0.1822 0.1452 0.0920 0.0251  -0.0139 -0.0153 303 SER A C   
856  O O   . SER A  132 ? 0.1721 0.1908 0.1611 0.0286  -0.0201 -0.0590 303 SER A O   
857  C CB  A SER A  132 ? 0.2030 0.2331 0.1757 0.0352  -0.0219 0.0146  303 SER A CB  
858  C CB  B SER A  132 ? 0.2058 0.2102 0.1912 0.0290  0.0019  0.0237  303 SER A CB  
859  O OG  A SER A  132 ? 0.2195 0.2311 0.1487 0.0449  -0.0287 -0.0021 303 SER A OG  
860  O OG  B SER A  132 ? 0.2235 0.2461 0.1772 0.0528  0.0249  0.0221  303 SER A OG  
861  N N   . TYR A  133 ? 0.1968 0.1356 0.1621 0.0204  -0.0424 -0.0279 304 TYR A N   
862  C CA  . TYR A  133 ? 0.1823 0.1697 0.1633 -0.0008 -0.0207 0.0023  304 TYR A CA  
863  C C   . TYR A  133 ? 0.2010 0.1623 0.1676 0.0121  -0.0184 -0.0057 304 TYR A C   
864  O O   . TYR A  133 ? 0.2391 0.2327 0.1388 0.0300  -0.0119 0.0224  304 TYR A O   
865  C CB  . TYR A  133 ? 0.2141 0.1774 0.1312 -0.0027 -0.0485 -0.0298 304 TYR A CB  
866  C CG  . TYR A  133 ? 0.1651 0.1541 0.1405 -0.0051 -0.0385 -0.0309 304 TYR A CG  
867  C CD1 . TYR A  133 ? 0.1485 0.1914 0.1287 0.0197  -0.0727 -0.0191 304 TYR A CD1 
868  C CD2 . TYR A  133 ? 0.1746 0.1968 0.1913 0.0087  -0.0454 -0.0123 304 TYR A CD2 
869  C CE1 . TYR A  133 ? 0.1980 0.1681 0.1663 0.0209  -0.0453 -0.0164 304 TYR A CE1 
870  C CE2 . TYR A  133 ? 0.1702 0.1723 0.1776 0.0136  -0.0306 -0.0304 304 TYR A CE2 
871  C CZ  . TYR A  133 ? 0.1792 0.1316 0.1476 0.0116  -0.0323 -0.0337 304 TYR A CZ  
872  O OH  . TYR A  133 ? 0.1957 0.1661 0.1439 -0.0010 -0.0538 -0.0018 304 TYR A OH  
873  N N   . VAL A  134 ? 0.2290 0.2052 0.1108 0.0394  -0.0499 -0.0126 305 VAL A N   
874  C CA  . VAL A  134 ? 0.2522 0.2182 0.1183 0.0261  -0.0208 0.0126  305 VAL A CA  
875  C C   . VAL A  134 ? 0.2618 0.1950 0.1883 0.0363  -0.0162 -0.0443 305 VAL A C   
876  O O   . VAL A  134 ? 0.2579 0.2071 0.1492 -0.0060 -0.0948 -0.0040 305 VAL A O   
877  C CB  . VAL A  134 ? 0.2322 0.2248 0.1306 -0.0095 -0.0321 0.0174  305 VAL A CB  
878  C CG1 . VAL A  134 ? 0.2363 0.2038 0.2006 -0.0075 -0.0436 -0.0118 305 VAL A CG1 
879  C CG2 . VAL A  134 ? 0.2225 0.1969 0.1429 -0.0181 -0.0655 -0.0074 305 VAL A CG2 
880  N N   . THR A  135 ? 0.3004 0.2141 0.1880 0.0282  -0.0358 -0.0105 306 THR A N   
881  C CA  . THR A  135 ? 0.3230 0.2276 0.1755 0.0236  -0.0589 -0.0007 306 THR A CA  
882  C C   . THR A  135 ? 0.3033 0.2396 0.1542 0.0137  -0.0839 -0.0141 306 THR A C   
883  O O   . THR A  135 ? 0.3363 0.2273 0.1476 0.0274  -0.0955 -0.0247 306 THR A O   
884  C CB  . THR A  135 ? 0.3691 0.2886 0.2059 -0.0139 -0.0465 -0.0655 306 THR A CB  
885  O OG1 . THR A  135 ? 0.4038 0.3323 0.1727 0.0101  -0.0405 -0.0493 306 THR A OG1 
886  C CG2 . THR A  135 ? 0.4033 0.2477 0.1810 -0.0263 -0.0140 -0.0347 306 THR A CG2 
887  N N   . GLN A  136 ? 0.3333 0.3362 0.1898 -0.0307 -0.0963 -0.0269 307 GLN A N   
888  C CA  . GLN A  136 ? 0.3483 0.3881 0.2733 -0.0014 0.0006  -0.0608 307 GLN A CA  
889  C C   . GLN A  136 ? 0.3238 0.3610 0.2195 0.0013  -0.0798 -0.0776 307 GLN A C   
890  O O   . GLN A  136 ? 0.4945 0.4656 0.2101 0.1741  -0.1296 -0.0396 307 GLN A O   
891  C CB  . GLN A  136 ? 0.4064 0.5422 0.4225 -0.1137 0.0249  -0.0261 307 GLN A CB  
892  C CG  . GLN A  136 ? 0.4128 0.4507 0.5059 -0.1237 0.0245  -0.0359 307 GLN A CG  
893  C CD  . GLN A  136 ? 0.5389 0.3461 0.5801 -0.1040 -0.1691 0.0992  307 GLN A CD  
894  O OE1 . GLN A  136 ? 0.5890 0.8707 0.5664 0.0287  -0.2500 -0.2360 307 GLN A OE1 
895  N NE2 . GLN A  136 ? 0.3721 0.2887 0.2577 -0.0389 -0.1098 -0.0151 307 GLN A NE2 
896  N N   . SER A  137 ? 0.3685 0.2736 0.1748 0.0470  -0.0939 -0.0542 308 SER A N   
897  C CA  . SER A  137 ? 0.4269 0.2521 0.1931 0.0429  -0.1098 -0.0391 308 SER A CA  
898  C C   . SER A  137 ? 0.4049 0.3165 0.1475 0.0067  -0.0562 -0.0342 308 SER A C   
899  O O   . SER A  137 ? 0.4729 0.3132 0.1221 0.0366  -0.0672 -0.0342 308 SER A O   
900  C CB  . SER A  137 ? 0.4583 0.3413 0.1961 0.0472  -0.0384 -0.0629 308 SER A CB  
901  O OG  . SER A  137 ? 0.4537 0.3924 0.1942 0.0442  -0.0528 -0.0910 308 SER A OG  
902  N N   . GLU A  138 ? 0.3570 0.2159 0.1631 0.0300  -0.0624 -0.0225 309 GLU A N   
903  C CA  . GLU A  138 ? 0.2889 0.2439 0.1717 0.0483  0.0017  -0.0022 309 GLU A CA  
904  C C   . GLU A  138 ? 0.2635 0.2095 0.1995 0.0158  -0.0438 -0.0158 309 GLU A C   
905  O O   . GLU A  138 ? 0.2677 0.2274 0.2199 0.0281  -0.0565 -0.0613 309 GLU A O   
906  C CB  . GLU A  138 ? 0.3699 0.1865 0.1606 0.0462  -0.0401 -0.0149 309 GLU A CB  
907  C CG  . GLU A  138 ? 0.3641 0.2398 0.1688 0.0572  -0.0147 -0.0243 309 GLU A CG  
908  C CD  . GLU A  138 ? 0.3723 0.2230 0.1992 0.0528  -0.0100 -0.0088 309 GLU A CD  
909  O OE1 . GLU A  138 ? 0.4051 0.2565 0.1573 0.0333  -0.0296 -0.0313 309 GLU A OE1 
910  O OE2 . GLU A  138 ? 0.3836 0.3476 0.3243 0.0641  0.0400  -0.0420 309 GLU A OE2 
911  N N   . LEU A  139 ? 0.2894 0.2081 0.1542 0.0573  -0.0706 -0.0143 310 LEU A N   
912  C CA  . LEU A  139 ? 0.3345 0.2006 0.1698 0.0326  -0.0578 -0.0199 310 LEU A CA  
913  C C   . LEU A  139 ? 0.3308 0.2214 0.2035 0.0315  -0.1015 -0.0412 310 LEU A C   
914  O O   . LEU A  139 ? 0.3175 0.2230 0.2392 0.0136  -0.1179 -0.0481 310 LEU A O   
915  C CB  . LEU A  139 ? 0.3960 0.3070 0.1828 0.0085  0.0280  -0.0135 310 LEU A CB  
916  C CG  . LEU A  139 ? 0.3599 0.2398 0.2595 -0.0305 -0.0666 -0.0199 310 LEU A CG  
917  C CD1 . LEU A  139 ? 0.3547 0.2833 0.2673 0.0703  -0.0857 0.0353  310 LEU A CD1 
918  C CD2 . LEU A  139 ? 0.4363 0.3888 0.2676 -0.0182 -0.0724 -0.0947 310 LEU A CD2 
919  N N   . TYR A  140 ? 0.2686 0.2187 0.1803 0.0377  -0.0774 -0.0332 311 TYR A N   
920  C CA  . TYR A  140 ? 0.2653 0.2116 0.2061 0.0429  -0.0490 -0.0353 311 TYR A CA  
921  C C   . TYR A  140 ? 0.2306 0.1949 0.1781 0.0286  -0.0538 -0.0056 311 TYR A C   
922  O O   . TYR A  140 ? 0.2347 0.2670 0.1772 0.0664  -0.0728 -0.0022 311 TYR A O   
923  C CB  . TYR A  140 ? 0.2231 0.2515 0.1925 0.0530  -0.0440 -0.0159 311 TYR A CB  
924  C CG  . TYR A  140 ? 0.2873 0.2420 0.1757 0.0633  -0.0628 -0.0279 311 TYR A CG  
925  C CD1 . TYR A  140 ? 0.2840 0.2435 0.2021 0.0535  -0.0300 -0.0085 311 TYR A CD1 
926  C CD2 . TYR A  140 ? 0.3239 0.3244 0.2128 0.1005  -0.1019 -0.0009 311 TYR A CD2 
927  C CE1 . TYR A  140 ? 0.3693 0.3279 0.2465 0.1040  0.0171  0.0104  311 TYR A CE1 
928  C CE2 . TYR A  140 ? 0.3683 0.3604 0.2700 0.0328  -0.0358 -0.0335 311 TYR A CE2 
929  C CZ  . TYR A  140 ? 0.4127 0.3441 0.2355 0.0705  -0.0316 -0.0883 311 TYR A CZ  
930  O OH  . TYR A  140 ? 0.5122 0.5334 0.2433 0.0368  -0.0044 -0.1612 311 TYR A OH  
931  N N   . PRO A  141 ? 0.2224 0.2148 0.1914 0.0116  -0.0664 -0.0040 312 PRO A N   
932  C CA  . PRO A  141 ? 0.2265 0.2318 0.2016 0.0307  -0.0431 0.0130  312 PRO A CA  
933  C C   . PRO A  141 ? 0.2584 0.2149 0.1799 0.0595  -0.0566 0.0121  312 PRO A C   
934  O O   . PRO A  141 ? 0.2411 0.2330 0.1843 0.0260  -0.0479 0.0377  312 PRO A O   
935  C CB  . PRO A  141 ? 0.2566 0.2733 0.2647 -0.0043 -0.0566 -0.0004 312 PRO A CB  
936  C CG  . PRO A  141 ? 0.3175 0.3970 0.2801 -0.0708 -0.0246 -0.1022 312 PRO A CG  
937  C CD  . PRO A  141 ? 0.2601 0.3479 0.2269 -0.0140 -0.0917 -0.0615 312 PRO A CD  
938  N N   . ILE A  142 ? 0.2246 0.1593 0.1872 0.0645  -0.0559 0.0112  313 ILE A N   
939  C CA  . ILE A  142 ? 0.2212 0.1702 0.1771 0.0368  -0.0534 0.0333  313 ILE A CA  
940  C C   . ILE A  142 ? 0.2186 0.2154 0.1733 0.0365  -0.0458 0.0299  313 ILE A C   
941  O O   . ILE A  142 ? 0.2257 0.2027 0.1775 0.0531  -0.0244 0.0289  313 ILE A O   
942  C CB  . ILE A  142 ? 0.2465 0.2044 0.1567 0.0542  -0.0546 0.0320  313 ILE A CB  
943  C CG1 . ILE A  142 ? 0.2342 0.2006 0.1578 0.0422  -0.0544 0.0283  313 ILE A CG1 
944  C CG2 . ILE A  142 ? 0.2754 0.2083 0.1483 0.0602  -0.0366 0.0331  313 ILE A CG2 
945  C CD1 . ILE A  142 ? 0.2535 0.2279 0.1852 0.0639  -0.0670 0.0223  313 ILE A CD1 
946  N N   . CYS A  143 ? 0.2077 0.1961 0.1765 -0.0040 -0.0319 0.0189  314 CYS A N   
947  C CA  . CYS A  143 ? 0.2361 0.2105 0.1972 0.0493  -0.0227 0.0041  314 CYS A CA  
948  C C   . CYS A  143 ? 0.2133 0.1989 0.1555 0.0464  -0.0548 0.0517  314 CYS A C   
949  O O   . CYS A  143 ? 0.2209 0.2173 0.2146 0.0345  -0.0550 0.0106  314 CYS A O   
950  C CB  . CYS A  143 ? 0.2123 0.2352 0.1751 0.0381  -0.0816 0.0133  314 CYS A CB  
951  S SG  . CYS A  143 ? 0.2765 0.2332 0.1669 0.0615  -0.0688 0.0244  314 CYS A SG  
952  N N   . ARG A  144 ? 0.2218 0.2215 0.1935 0.0554  -0.0446 0.0039  315 ARG A N   
953  C CA  . ARG A  144 ? 0.2318 0.2120 0.1915 0.0648  -0.0485 -0.0006 315 ARG A CA  
954  C C   . ARG A  144 ? 0.2248 0.2146 0.1721 0.0667  -0.0274 0.0016  315 ARG A C   
955  O O   . ARG A  144 ? 0.2182 0.2237 0.1831 0.0571  -0.0441 0.0210  315 ARG A O   
956  C CB  . ARG A  144 ? 0.2237 0.2112 0.1908 0.0441  -0.0408 0.0282  315 ARG A CB  
957  C CG  . ARG A  144 ? 0.2350 0.2155 0.1875 0.0471  -0.0492 0.0149  315 ARG A CG  
958  C CD  . ARG A  144 ? 0.2448 0.2860 0.2166 0.0259  -0.0857 0.0103  315 ARG A CD  
959  N NE  . ARG A  144 ? 0.2757 0.3822 0.2527 0.1066  -0.0926 0.0123  315 ARG A NE  
960  C CZ  . ARG A  144 ? 0.2814 0.3683 0.2585 0.0591  -0.0871 0.0424  315 ARG A CZ  
961  N NH1 . ARG A  144 ? 0.3103 0.3550 0.2422 0.0382  -0.0927 0.0300  315 ARG A NH1 
962  N NH2 . ARG A  144 ? 0.3141 0.4416 0.2592 0.0717  -0.0882 0.0879  315 ARG A NH2 
963  N N   . PRO A  145 ? 0.2264 0.2290 0.1663 0.0821  -0.0264 0.0257  316 PRO A N   
964  C CA  . PRO A  145 ? 0.2220 0.2401 0.1693 0.0558  -0.0381 0.0204  316 PRO A CA  
965  C C   . PRO A  145 ? 0.2262 0.2411 0.1625 0.0494  -0.0341 0.0191  316 PRO A C   
966  O O   . PRO A  145 ? 0.2452 0.2564 0.1830 0.0753  -0.0185 0.0243  316 PRO A O   
967  C CB  . PRO A  145 ? 0.3352 0.2311 0.1866 0.0861  -0.0449 0.0457  316 PRO A CB  
968  C CG  . PRO A  145 ? 0.4972 0.2751 0.3036 0.0103  -0.1375 0.0715  316 PRO A CG  
969  C CD  . PRO A  145 ? 0.3139 0.2251 0.2083 0.0810  -0.0670 0.0036  316 PRO A CD  
970  N N   . LEU A  146 ? 0.1806 0.2197 0.1921 0.0691  -0.0323 0.0145  317 LEU A N   
971  C CA  . LEU A  146 ? 0.2133 0.2156 0.2086 0.0511  -0.0217 0.0074  317 LEU A CA  
972  C C   . LEU A  146 ? 0.2032 0.2103 0.1570 0.0360  -0.0578 -0.0186 317 LEU A C   
973  O O   . LEU A  146 ? 0.2581 0.2085 0.1755 0.0424  -0.0348 -0.0233 317 LEU A O   
974  C CB  . LEU A  146 ? 0.2241 0.2232 0.1603 0.0583  -0.0296 -0.0095 317 LEU A CB  
975  C CG  . LEU A  146 ? 0.3233 0.2787 0.2874 -0.0138 -0.0829 0.0011  317 LEU A CG  
976  C CD1 . LEU A  146 ? 0.4413 0.4285 0.2528 -0.1121 -0.0965 -0.0380 317 LEU A CD1 
977  C CD2 . LEU A  146 ? 0.3274 0.2816 0.2507 -0.0320 -0.0863 0.0482  317 LEU A CD2 
978  N N   . LYS A  147 ? 0.2176 0.2225 0.1887 0.0509  -0.0280 -0.0100 318 LYS A N   
979  C CA  . LYS A  147 ? 0.2241 0.2585 0.1860 0.0255  -0.0530 -0.0002 318 LYS A CA  
980  C C   . LYS A  147 ? 0.2099 0.2417 0.1699 -0.0024 -0.0358 0.0027  318 LYS A C   
981  O O   . LYS A  147 ? 0.2166 0.2646 0.2532 -0.0371 -0.0465 -0.0045 318 LYS A O   
982  C CB  . LYS A  147 ? 0.2565 0.3426 0.2364 0.0103  -0.0093 -0.0467 318 LYS A CB  
983  C CG  . LYS A  147 ? 0.2964 0.3517 0.3368 0.0002  -0.0034 -0.0136 318 LYS A CG  
984  C CD  . LYS A  147 ? 0.3101 0.5425 0.4881 -0.0054 0.0668  -0.0744 318 LYS A CD  
985  C CE  . LYS A  147 ? 0.4329 0.7114 0.5614 -0.0692 0.1158  0.1130  318 LYS A CE  
986  N NZ  . LYS A  147 ? 0.5428 0.8530 0.6150 0.0764  0.0248  0.0571  318 LYS A NZ  
987  N N   . LYS A  148 ? 0.2054 0.1970 0.1862 0.0170  -0.0249 -0.0739 319 LYS A N   
988  C CA  . LYS A  148 ? 0.2312 0.1627 0.1944 -0.0100 -0.0193 -0.0374 319 LYS A CA  
989  C C   . LYS A  148 ? 0.2045 0.1658 0.1776 -0.0036 -0.0321 -0.0382 319 LYS A C   
990  O O   . LYS A  148 ? 0.1918 0.1771 0.1520 0.0007  -0.0339 -0.0142 319 LYS A O   
991  C CB  . LYS A  148 ? 0.1868 0.1837 0.1917 -0.0200 -0.0174 -0.0267 319 LYS A CB  
992  C CG  . LYS A  148 ? 0.2020 0.1552 0.2076 -0.0264 -0.0164 -0.0125 319 LYS A CG  
993  C CD  . LYS A  148 ? 0.2503 0.2248 0.2157 -0.0393 -0.0243 -0.0435 319 LYS A CD  
994  C CE  . LYS A  148 ? 0.3171 0.2101 0.2573 -0.0392 0.0083  -0.0423 319 LYS A CE  
995  N NZ  . LYS A  148 ? 0.3678 0.2295 0.2417 -0.0235 0.0279  -0.0279 319 LYS A NZ  
996  N N   . THR A  149 ? 0.2072 0.1484 0.1557 -0.0031 -0.0076 -0.0131 320 THR A N   
997  C CA  . THR A  149 ? 0.1852 0.1618 0.1452 0.0077  -0.0026 -0.0186 320 THR A CA  
998  C C   . THR A  149 ? 0.1929 0.1418 0.1420 0.0216  -0.0123 0.0045  320 THR A C   
999  O O   . THR A  149 ? 0.2167 0.2026 0.1537 0.0018  0.0016  -0.0177 320 THR A O   
1000 C CB  . THR A  149 ? 0.2136 0.1911 0.1710 -0.0006 -0.0319 -0.0305 320 THR A CB  
1001 O OG1 . THR A  149 ? 0.2089 0.1751 0.1806 0.0092  -0.0430 -0.0312 320 THR A OG1 
1002 C CG2 . THR A  149 ? 0.2205 0.1675 0.1970 0.0006  -0.0312 -0.0061 320 THR A CG2 
1003 N N   . TRP A  150 ? 0.1741 0.1615 0.1323 0.0141  -0.0156 0.0012  321 TRP A N   
1004 C CA  . TRP A  150 ? 0.1803 0.1445 0.1641 0.0096  -0.0149 -0.0200 321 TRP A CA  
1005 C C   . TRP A  150 ? 0.1577 0.1385 0.1523 0.0062  -0.0287 -0.0038 321 TRP A C   
1006 O O   . TRP A  150 ? 0.1540 0.1755 0.1787 0.0100  -0.0088 0.0068  321 TRP A O   
1007 C CB  . TRP A  150 ? 0.1936 0.1620 0.1699 0.0052  -0.0263 -0.0010 321 TRP A CB  
1008 C CG  . TRP A  150 ? 0.1884 0.1707 0.1867 0.0260  -0.0147 0.0252  321 TRP A CG  
1009 C CD1 . TRP A  150 ? 0.2355 0.1923 0.1692 0.0023  -0.0031 0.0379  321 TRP A CD1 
1010 C CD2 . TRP A  150 ? 0.1991 0.1786 0.2069 0.0128  -0.0252 0.0115  321 TRP A CD2 
1011 N NE1 . TRP A  150 ? 0.2169 0.2196 0.1833 -0.0076 -0.0073 0.0237  321 TRP A NE1 
1012 C CE2 . TRP A  150 ? 0.1885 0.1887 0.2012 0.0159  -0.0099 0.0341  321 TRP A CE2 
1013 C CE3 . TRP A  150 ? 0.1860 0.1893 0.2277 0.0164  -0.0396 0.0056  321 TRP A CE3 
1014 C CZ2 . TRP A  150 ? 0.2229 0.2297 0.1815 -0.0020 0.0198  -0.0061 321 TRP A CZ2 
1015 C CZ3 . TRP A  150 ? 0.2299 0.2310 0.2696 -0.0198 -0.0124 0.0147  321 TRP A CZ3 
1016 C CH2 . TRP A  150 ? 0.1928 0.2097 0.2918 -0.0280 0.0019  0.0206  321 TRP A CH2 
1017 N N   . GLU A  151 ? 0.1508 0.1542 0.1463 0.0039  -0.0083 -0.0161 322 GLU A N   
1018 C CA  . GLU A  151 ? 0.1662 0.1713 0.1341 -0.0010 -0.0333 -0.0191 322 GLU A CA  
1019 C C   . GLU A  151 ? 0.1955 0.1604 0.1525 -0.0090 -0.0179 -0.0284 322 GLU A C   
1020 O O   . GLU A  151 ? 0.2564 0.1941 0.1830 -0.0640 0.0043  -0.0384 322 GLU A O   
1021 C CB  . GLU A  151 ? 0.1752 0.1624 0.1518 0.0000  -0.0308 -0.0397 322 GLU A CB  
1022 C CG  . GLU A  151 ? 0.1543 0.2125 0.1736 0.0028  -0.0232 -0.0218 322 GLU A CG  
1023 C CD  . GLU A  151 ? 0.1791 0.1871 0.2109 0.0091  -0.0322 -0.0650 322 GLU A CD  
1024 O OE1 . GLU A  151 ? 0.2325 0.1688 0.2237 0.0102  -0.0294 -0.0460 322 GLU A OE1 
1025 O OE2 . GLU A  151 ? 0.2266 0.2329 0.2225 -0.0249 -0.0008 -0.0861 322 GLU A OE2 
1026 N N   . ASP A  152 ? 0.1645 0.1588 0.1320 -0.0050 -0.0278 0.0003  323 ASP A N   
1027 C CA  . ASP A  152 ? 0.1747 0.1725 0.1232 0.0176  -0.0328 0.0239  323 ASP A CA  
1028 C C   . ASP A  152 ? 0.1676 0.1748 0.1597 0.0204  -0.0294 0.0438  323 ASP A C   
1029 O O   . ASP A  152 ? 0.2122 0.2465 0.1854 0.0309  0.0052  0.0742  323 ASP A O   
1030 C CB  . ASP A  152 ? 0.1849 0.1705 0.1396 0.0185  -0.0439 0.0377  323 ASP A CB  
1031 C CG  . ASP A  152 ? 0.2041 0.1800 0.1865 0.0268  -0.0436 0.0019  323 ASP A CG  
1032 O OD1 . ASP A  152 ? 0.1882 0.1945 0.1610 0.0419  -0.0420 0.0017  323 ASP A OD1 
1033 O OD2 . ASP A  152 ? 0.2406 0.1906 0.1925 0.0490  -0.0485 0.0241  323 ASP A OD2 
1034 N N   . ILE A  153 ? 0.1907 0.1719 0.1416 0.0231  -0.0354 0.0354  324 ILE A N   
1035 C CA  . ILE A  153 ? 0.1858 0.1845 0.1292 0.0109  -0.0263 -0.0018 324 ILE A CA  
1036 C C   . ILE A  153 ? 0.1564 0.1937 0.1808 0.0115  -0.0295 0.0054  324 ILE A C   
1037 O O   . ILE A  153 ? 0.2073 0.2157 0.1632 -0.0062 -0.0246 0.0117  324 ILE A O   
1038 C CB  . ILE A  153 ? 0.1612 0.1918 0.1419 0.0078  -0.0407 0.0216  324 ILE A CB  
1039 C CG1 . ILE A  153 ? 0.1826 0.1888 0.1487 0.0072  -0.0287 -0.0050 324 ILE A CG1 
1040 C CG2 . ILE A  153 ? 0.1763 0.1822 0.1738 0.0164  -0.0351 0.0410  324 ILE A CG2 
1041 C CD1 . ILE A  153 ? 0.1566 0.1819 0.1914 -0.0049 -0.0438 -0.0084 324 ILE A CD1 
1042 N N   . GLU A  154 ? 0.1968 0.1922 0.1515 -0.0047 -0.0293 0.0054  325 GLU A N   
1043 C CA  A GLU A  154 ? 0.2252 0.1969 0.2126 -0.0279 -0.0375 0.0066  325 GLU A CA  
1044 C CA  B GLU A  154 ? 0.1982 0.1887 0.1928 -0.0176 -0.0150 0.0021  325 GLU A CA  
1045 C C   . GLU A  154 ? 0.1529 0.2306 0.2241 -0.0298 -0.0342 -0.0099 325 GLU A C   
1046 O O   . GLU A  154 ? 0.2519 0.2887 0.2156 -0.0603 -0.0781 -0.0069 325 GLU A O   
1047 C CB  A GLU A  154 ? 0.2772 0.1734 0.2697 -0.0535 -0.0062 0.0247  325 GLU A CB  
1048 C CB  B GLU A  154 ? 0.1986 0.1693 0.2011 -0.0227 -0.0136 -0.0010 325 GLU A CB  
1049 C CG  A GLU A  154 ? 0.2840 0.3371 0.3424 -0.0761 -0.0599 0.0025  325 GLU A CG  
1050 C CG  B GLU A  154 ? 0.2063 0.1944 0.1840 -0.0185 -0.0135 -0.0053 325 GLU A CG  
1051 C CD  A GLU A  154 ? 0.5136 0.4285 0.4624 -0.1027 0.0463  0.0697  325 GLU A CD  
1052 C CD  B GLU A  154 ? 0.3069 0.2181 0.2306 -0.0344 0.0225  0.0159  325 GLU A CD  
1053 O OE1 A GLU A  154 ? 0.6223 0.5348 0.5275 -0.1856 0.1126  -0.0265 325 GLU A OE1 
1054 O OE1 B GLU A  154 ? 0.3387 0.2477 0.3309 -0.0748 0.0167  -0.0045 325 GLU A OE1 
1055 O OE2 A GLU A  154 ? 0.7488 0.4327 0.7686 -0.1724 0.0479  0.0435  325 GLU A OE2 
1056 O OE2 B GLU A  154 ? 0.3781 0.2005 0.2002 -0.0719 -0.0338 0.0967  325 GLU A OE2 
1057 N N   . ASP A  155 ? 0.2186 0.1994 0.1942 -0.0381 -0.0594 0.0363  326 ASP A N   
1058 C CA  . ASP A  155 ? 0.1656 0.2823 0.2303 -0.0522 -0.0518 0.0778  326 ASP A CA  
1059 C C   . ASP A  155 ? 0.2311 0.2324 0.2099 -0.0390 -0.0161 0.0275  326 ASP A C   
1060 O O   . ASP A  155 ? 0.1978 0.2560 0.2305 -0.0232 -0.0607 0.0613  326 ASP A O   
1061 C CB  . ASP A  155 ? 0.2003 0.3054 0.2947 -0.0261 0.0181  0.0819  326 ASP A CB  
1062 C CG  . ASP A  155 ? 0.2148 0.3737 0.3859 -0.0261 -0.0111 0.1240  326 ASP A CG  
1063 O OD1 . ASP A  155 ? 0.1803 0.4579 0.4156 0.0455  0.0173  0.1606  326 ASP A OD1 
1064 O OD2 . ASP A  155 ? 0.2359 0.5165 0.5269 0.0580  0.0151  0.2090  326 ASP A OD2 
1065 N N   . ILE A  156 ? 0.2404 0.2550 0.2301 -0.0840 -0.0689 0.0302  327 ILE A N   
1066 C CA  . ILE A  156 ? 0.3019 0.2560 0.2337 -0.0623 -0.0622 0.0536  327 ILE A CA  
1067 C C   . ILE A  156 ? 0.2447 0.2445 0.1978 -0.0637 -0.0476 0.0178  327 ILE A C   
1068 O O   . ILE A  156 ? 0.2349 0.2886 0.1903 -0.0710 -0.0824 0.0867  327 ILE A O   
1069 C CB  . ILE A  156 ? 0.2789 0.3028 0.3215 -0.0963 -0.0676 0.0000  327 ILE A CB  
1070 C CG1 . ILE A  156 ? 0.2600 0.4337 0.3608 -0.0791 -0.0575 -0.0300 327 ILE A CG1 
1071 C CG2 . ILE A  156 ? 0.3133 0.4169 0.3709 -0.0782 -0.1150 0.0042  327 ILE A CG2 
1072 C CD1 . ILE A  156 ? 0.2553 0.4658 0.3464 -0.0605 -0.0013 -0.0238 327 ILE A CD1 
1073 N N   . SER A  157 ? 0.2296 0.2699 0.1987 -0.0508 -0.0905 0.0560  328 SER A N   
1074 C CA  A SER A  157 ? 0.2068 0.2573 0.2622 -0.0411 -0.1074 0.0514  328 SER A CA  
1075 C CA  B SER A  157 ? 0.2039 0.2605 0.2371 -0.0497 -0.0893 0.0522  328 SER A CA  
1076 C C   . SER A  157 ? 0.1935 0.2568 0.2051 -0.0526 -0.0629 0.0481  328 SER A C   
1077 O O   . SER A  157 ? 0.1866 0.2574 0.2149 -0.0459 -0.0900 0.0568  328 SER A O   
1078 C CB  A SER A  157 ? 0.2025 0.3982 0.3436 -0.0291 -0.1046 0.0743  328 SER A CB  
1079 C CB  B SER A  157 ? 0.1881 0.2966 0.2557 -0.0651 -0.1082 0.0603  328 SER A CB  
1080 O OG  A SER A  157 ? 0.2701 0.3262 0.3594 -0.0245 -0.0756 0.0248  328 SER A OG  
1081 O OG  B SER A  157 ? 0.1397 0.3214 0.3455 -0.0775 -0.1506 0.0718  328 SER A OG  
1082 N N   . CYS A  158 ? 0.1801 0.2109 0.2181 -0.0258 -0.0467 0.0397  329 CYS A N   
1083 C CA  . CYS A  158 ? 0.1836 0.2018 0.1732 -0.0210 -0.0300 0.0291  329 CYS A CA  
1084 C C   . CYS A  158 ? 0.1818 0.2001 0.1535 -0.0089 -0.0422 0.0238  329 CYS A C   
1085 O O   . CYS A  158 ? 0.2126 0.2387 0.1852 -0.0390 -0.0602 0.0338  329 CYS A O   
1086 C CB  . CYS A  158 ? 0.1963 0.2186 0.1735 -0.0591 -0.0111 0.0026  329 CYS A CB  
1087 S SG  . CYS A  158 ? 0.2449 0.2884 0.3034 0.0242  -0.0096 0.0279  329 CYS A SG  
1088 N N   . ARG A  159 ? 0.1554 0.2101 0.1413 -0.0324 -0.0410 0.0217  330 ARG A N   
1089 C CA  . ARG A  159 ? 0.1578 0.2110 0.1689 -0.0221 -0.0365 0.0097  330 ARG A CA  
1090 C C   . ARG A  159 ? 0.1696 0.1979 0.1929 -0.0206 -0.0372 0.0319  330 ARG A C   
1091 O O   . ARG A  159 ? 0.1791 0.2268 0.1517 -0.0318 -0.0480 0.0223  330 ARG A O   
1092 C CB  . ARG A  159 ? 0.2024 0.2080 0.1815 -0.0062 -0.0466 0.0214  330 ARG A CB  
1093 C CG  . ARG A  159 ? 0.2170 0.2488 0.1459 -0.0023 -0.0334 0.0148  330 ARG A CG  
1094 C CD  . ARG A  159 ? 0.2506 0.2567 0.2388 0.0192  -0.1033 -0.0470 330 ARG A CD  
1095 N NE  . ARG A  159 ? 0.3188 0.2561 0.2566 -0.0400 -0.0495 -0.0299 330 ARG A NE  
1096 C CZ  . ARG A  159 ? 0.3458 0.2792 0.3104 0.0511  0.0394  -0.0449 330 ARG A CZ  
1097 N NH1 . ARG A  159 ? 0.2885 0.2832 0.3132 0.0477  0.0342  -0.0052 330 ARG A NH1 
1098 N NH2 . ARG A  159 ? 0.3713 0.2415 0.2563 0.0350  -0.0012 -0.0323 330 ARG A NH2 
1099 N N   . ASP A  160 ? 0.2109 0.2000 0.1683 -0.0526 -0.0450 0.0245  331 ASP A N   
1100 C CA  . ASP A  160 ? 0.1798 0.2099 0.1571 -0.0520 -0.0349 0.0085  331 ASP A CA  
1101 C C   . ASP A  160 ? 0.1612 0.1893 0.1011 -0.0144 -0.0354 0.0068  331 ASP A C   
1102 O O   . ASP A  160 ? 0.1777 0.2341 0.1337 -0.0307 -0.0244 -0.0044 331 ASP A O   
1103 C CB  . ASP A  160 ? 0.2603 0.2377 0.1528 -0.0611 -0.0777 0.0111  331 ASP A CB  
1104 C CG  . ASP A  160 ? 0.2911 0.2530 0.1865 -0.0422 -0.0780 -0.0008 331 ASP A CG  
1105 O OD1 . ASP A  160 ? 0.4450 0.2177 0.2489 -0.0196 -0.1067 -0.0349 331 ASP A OD1 
1106 O OD2 . ASP A  160 ? 0.4055 0.3763 0.2168 -0.1532 -0.1366 0.0138  331 ASP A OD2 
1107 N N   . PHE A  161 ? 0.1520 0.1924 0.1482 -0.0106 -0.0482 -0.0018 332 PHE A N   
1108 C CA  . PHE A  161 ? 0.1581 0.1727 0.1586 0.0157  -0.0327 0.0159  332 PHE A CA  
1109 C C   . PHE A  161 ? 0.1417 0.1579 0.1382 0.0054  -0.0158 0.0098  332 PHE A C   
1110 O O   . PHE A  161 ? 0.1469 0.1823 0.1297 -0.0031 -0.0116 -0.0008 332 PHE A O   
1111 C CB  . PHE A  161 ? 0.1208 0.2073 0.1551 0.0082  -0.0327 0.0320  332 PHE A CB  
1112 C CG  . PHE A  161 ? 0.1444 0.1862 0.1758 0.0259  -0.0132 0.0259  332 PHE A CG  
1113 C CD1 . PHE A  161 ? 0.1618 0.2203 0.1839 -0.0061 -0.0135 0.0568  332 PHE A CD1 
1114 C CD2 . PHE A  161 ? 0.1636 0.2710 0.1905 0.0443  -0.0236 -0.0105 332 PHE A CD2 
1115 C CE1 . PHE A  161 ? 0.2393 0.2187 0.2048 0.0072  0.0125  0.0471  332 PHE A CE1 
1116 C CE2 . PHE A  161 ? 0.1214 0.2421 0.2141 0.0646  0.0084  0.0262  332 PHE A CE2 
1117 C CZ  . PHE A  161 ? 0.1942 0.1907 0.2477 0.0218  0.0102  0.0174  332 PHE A CZ  
1118 N N   . ILE A  162 ? 0.1473 0.1647 0.1366 -0.0125 -0.0275 0.0094  333 ILE A N   
1119 C CA  . ILE A  162 ? 0.1322 0.1740 0.1332 -0.0046 -0.0156 -0.0047 333 ILE A CA  
1120 C C   . ILE A  162 ? 0.1383 0.1397 0.1213 0.0001  -0.0164 0.0047  333 ILE A C   
1121 O O   . ILE A  162 ? 0.1537 0.1591 0.1390 -0.0113 -0.0329 0.0030  333 ILE A O   
1122 C CB  . ILE A  162 ? 0.1869 0.1522 0.1522 0.0128  -0.0228 -0.0001 333 ILE A CB  
1123 C CG1 . ILE A  162 ? 0.1589 0.1835 0.1709 -0.0149 -0.0304 0.0002  333 ILE A CG1 
1124 C CG2 . ILE A  162 ? 0.1676 0.1779 0.1365 -0.0145 0.0050  -0.0022 333 ILE A CG2 
1125 C CD1 . ILE A  162 ? 0.1604 0.1884 0.1603 0.0049  0.0130  -0.0122 333 ILE A CD1 
1126 N N   . GLU A  163 ? 0.1452 0.1467 0.1195 -0.0021 -0.0325 -0.0010 334 GLU A N   
1127 C CA  . GLU A  163 ? 0.1914 0.1565 0.1331 0.0072  -0.0100 -0.0031 334 GLU A CA  
1128 C C   . GLU A  163 ? 0.1801 0.1589 0.1291 -0.0056 0.0097  -0.0094 334 GLU A C   
1129 O O   . GLU A  163 ? 0.1741 0.1696 0.1629 0.0031  0.0093  -0.0020 334 GLU A O   
1130 C CB  . GLU A  163 ? 0.2231 0.1599 0.1237 0.0044  -0.0112 -0.0033 334 GLU A CB  
1131 C CG  . GLU A  163 ? 0.2549 0.1758 0.1262 -0.0049 0.0096  -0.0188 334 GLU A CG  
1132 C CD  . GLU A  163 ? 0.3597 0.2138 0.2109 -0.0059 0.0186  -0.0678 334 GLU A CD  
1133 O OE1 . GLU A  163 ? 0.4913 0.2529 0.2773 -0.1321 0.0652  -0.1000 334 GLU A OE1 
1134 O OE2 . GLU A  163 ? 0.5193 0.2275 0.3304 0.0664  0.1333  -0.0931 334 GLU A OE2 
1135 N N   . GLU A  164 ? 0.1694 0.1575 0.1389 -0.0184 -0.0255 -0.0272 335 GLU A N   
1136 C CA  . GLU A  164 ? 0.2036 0.1766 0.1506 -0.0164 0.0068  -0.0091 335 GLU A CA  
1137 C C   . GLU A  164 ? 0.1503 0.1647 0.1584 -0.0158 0.0017  0.0131  335 GLU A C   
1138 O O   . GLU A  164 ? 0.1754 0.1752 0.1549 -0.0476 0.0109  -0.0177 335 GLU A O   
1139 C CB  . GLU A  164 ? 0.2635 0.2145 0.1613 -0.0069 -0.0521 0.0078  335 GLU A CB  
1140 C CG  . GLU A  164 ? 0.3534 0.3339 0.2818 -0.0349 -0.0779 0.1180  335 GLU A CG  
1141 C CD  . GLU A  164 ? 0.4075 0.5244 0.5103 0.0613  -0.1772 -0.0386 335 GLU A CD  
1142 O OE1 . GLU A  164 ? 0.6375 0.4685 0.5006 0.0310  -0.2342 -0.0001 335 GLU A OE1 
1143 O OE2 . GLU A  164 ? 0.7782 0.5921 0.4570 0.3209  -0.2732 -0.0346 335 GLU A OE2 
1144 N N   . TYR A  165 ? 0.1625 0.1542 0.1310 -0.0211 -0.0171 0.0063  336 TYR A N   
1145 C CA  . TYR A  165 ? 0.1528 0.1302 0.1551 0.0133  -0.0162 -0.0023 336 TYR A CA  
1146 C C   . TYR A  165 ? 0.1486 0.1527 0.1445 0.0011  -0.0038 -0.0001 336 TYR A C   
1147 O O   . TYR A  165 ? 0.1617 0.1739 0.1477 -0.0145 -0.0004 -0.0024 336 TYR A O   
1148 C CB  . TYR A  165 ? 0.1423 0.1861 0.1368 -0.0001 -0.0340 -0.0019 336 TYR A CB  
1149 C CG  . TYR A  165 ? 0.1646 0.1605 0.1415 -0.0058 -0.0223 0.0026  336 TYR A CG  
1150 C CD1 . TYR A  165 ? 0.1736 0.1368 0.1556 0.0124  -0.0391 -0.0059 336 TYR A CD1 
1151 C CD2 . TYR A  165 ? 0.1477 0.1684 0.1155 -0.0081 -0.0111 0.0196  336 TYR A CD2 
1152 C CE1 . TYR A  165 ? 0.1703 0.1470 0.1335 0.0037  -0.0457 -0.0023 336 TYR A CE1 
1153 C CE2 . TYR A  165 ? 0.1621 0.1593 0.1476 0.0184  -0.0193 -0.0024 336 TYR A CE2 
1154 C CZ  . TYR A  165 ? 0.1526 0.1406 0.1504 -0.0027 -0.0206 -0.0039 336 TYR A CZ  
1155 O OH  . TYR A  165 ? 0.1902 0.1633 0.1444 0.0108  -0.0168 -0.0170 336 TYR A OH  
1156 N N   . VAL A  166 ? 0.1571 0.1400 0.1375 -0.0150 -0.0290 -0.0107 337 VAL A N   
1157 C CA  . VAL A  166 ? 0.1517 0.1773 0.1706 -0.0197 -0.0285 -0.0242 337 VAL A CA  
1158 C C   . VAL A  166 ? 0.1673 0.1863 0.1831 0.0076  -0.0153 -0.0010 337 VAL A C   
1159 O O   . VAL A  166 ? 0.1785 0.2098 0.2482 -0.0106 -0.0059 -0.0106 337 VAL A O   
1160 C CB  . VAL A  166 ? 0.1621 0.1880 0.2215 -0.0091 -0.0607 0.0088  337 VAL A CB  
1161 C CG1 . VAL A  166 ? 0.1707 0.2116 0.2460 -0.0118 -0.0740 -0.0005 337 VAL A CG1 
1162 C CG2 . VAL A  166 ? 0.2034 0.1767 0.1976 0.0272  -0.0777 0.0107  337 VAL A CG2 
1163 N N   . THR A  167 ? 0.1661 0.1882 0.2019 -0.0293 0.0080  -0.0314 338 THR A N   
1164 C CA  . THR A  167 ? 0.1745 0.2155 0.2253 -0.0014 0.0233  -0.0347 338 THR A CA  
1165 C C   . THR A  167 ? 0.1488 0.2198 0.1760 -0.0094 -0.0010 -0.0357 338 THR A C   
1166 O O   . THR A  167 ? 0.1640 0.2644 0.3134 -0.0229 0.0485  -0.0309 338 THR A O   
1167 C CB  . THR A  167 ? 0.3273 0.2256 0.2420 -0.0143 0.0477  -0.0682 338 THR A CB  
1168 O OG1 . THR A  167 ? 0.2606 0.2157 0.2907 -0.0026 0.0326  -0.0657 338 THR A OG1 
1169 C CG2 . THR A  167 ? 0.2718 0.3264 0.3217 -0.0050 0.0581  -0.1041 338 THR A CG2 
1170 N N   . ALA A  168 ? 0.1717 0.2144 0.2231 -0.0032 0.0196  -0.0248 339 ALA A N   
1171 C CA  . ALA A  168 ? 0.1947 0.2003 0.1686 0.0019  0.0281  -0.0310 339 ALA A CA  
1172 C C   . ALA A  168 ? 0.1605 0.1804 0.2034 -0.0217 -0.0036 0.0121  339 ALA A C   
1173 O O   . ALA A  168 ? 0.2025 0.1772 0.2140 -0.0498 0.0034  -0.0052 339 ALA A O   
1174 C CB  . ALA A  168 ? 0.2241 0.2232 0.1929 -0.0043 -0.0437 0.0074  339 ALA A CB  
1175 N N   . TYR A  169 ? 0.1814 0.1756 0.1897 -0.0411 -0.0175 -0.0050 340 TYR A N   
1176 C CA  . TYR A  169 ? 0.1338 0.1789 0.2003 -0.0216 0.0075  -0.0268 340 TYR A CA  
1177 C C   . TYR A  169 ? 0.1441 0.1973 0.2374 -0.0272 0.0202  -0.0213 340 TYR A C   
1178 O O   . TYR A  169 ? 0.1185 0.2200 0.2903 -0.0057 -0.0019 -0.0148 340 TYR A O   
1179 C CB  . TYR A  169 ? 0.1501 0.2254 0.2033 0.0012  0.0043  -0.0158 340 TYR A CB  
1180 C CG  . TYR A  169 ? 0.1520 0.2195 0.1809 -0.0061 -0.0254 -0.0004 340 TYR A CG  
1181 C CD1 . TYR A  169 ? 0.1757 0.2485 0.1902 0.0301  -0.0609 -0.0162 340 TYR A CD1 
1182 C CD2 . TYR A  169 ? 0.1475 0.1634 0.2231 -0.0062 -0.0133 -0.0080 340 TYR A CD2 
1183 C CE1 . TYR A  169 ? 0.2810 0.2066 0.2172 0.0377  -0.0598 -0.0149 340 TYR A CE1 
1184 C CE2 . TYR A  169 ? 0.1916 0.2545 0.1874 -0.0611 -0.0272 -0.0009 340 TYR A CE2 
1185 C CZ  . TYR A  169 ? 0.2631 0.1664 0.2159 -0.0437 -0.0458 0.0048  340 TYR A CZ  
1186 O OH  . TYR A  169 ? 0.3840 0.2541 0.2308 -0.1432 -0.0742 0.0026  340 TYR A OH  
1187 N N   . PRO A  170 ? 0.1399 0.2048 0.2568 -0.0334 0.0000  -0.0347 341 PRO A N   
1188 C CA  . PRO A  170 ? 0.1657 0.1723 0.1701 -0.0392 -0.0225 -0.0127 341 PRO A CA  
1189 C C   . PRO A  170 ? 0.1213 0.1575 0.2031 -0.0358 -0.0008 -0.0100 341 PRO A C   
1190 O O   . PRO A  170 ? 0.1821 0.1925 0.2488 0.0109  -0.0124 -0.0332 341 PRO A O   
1191 C CB  . PRO A  170 ? 0.1901 0.1950 0.2305 -0.0490 -0.0607 -0.0131 341 PRO A CB  
1192 C CG  . PRO A  170 ? 0.1958 0.2268 0.2498 -0.0301 -0.0500 0.0268  341 PRO A CG  
1193 C CD  . PRO A  170 ? 0.1506 0.2532 0.2501 -0.0475 0.0095  -0.0247 341 PRO A CD  
1194 N N   . ASN A  171 ? 0.1479 0.1972 0.1878 0.0017  -0.0016 -0.0292 342 ASN A N   
1195 C CA  . ASN A  171 ? 0.1398 0.2393 0.2085 -0.0131 0.0031  0.0242  342 ASN A CA  
1196 C C   . ASN A  171 ? 0.1412 0.2224 0.2003 -0.0094 0.0153  -0.0089 342 ASN A C   
1197 O O   . ASN A  171 ? 0.1683 0.2770 0.2913 -0.0375 0.0510  -0.0631 342 ASN A O   
1198 C CB  . ASN A  171 ? 0.1728 0.2828 0.2117 0.0184  0.0324  0.0178  342 ASN A CB  
1199 C CG  . ASN A  171 ? 0.3226 0.3416 0.2627 0.0749  0.0181  0.0475  342 ASN A CG  
1200 O OD1 . ASN A  171 ? 0.3309 0.4758 0.2825 0.1110  0.0543  0.0444  342 ASN A OD1 
1201 N ND2 . ASN A  171 ? 0.5997 0.5869 0.2759 -0.0283 0.0742  0.0104  342 ASN A ND2 
1202 N N   . ARG A  172 ? 0.1139 0.2143 0.1878 -0.0036 0.0006  0.0017  343 ARG A N   
1203 C CA  . ARG A  172 ? 0.1264 0.1838 0.1650 -0.0001 0.0132  -0.0187 343 ARG A CA  
1204 C C   . ARG A  172 ? 0.1432 0.1992 0.2120 0.0088  0.0153  0.0137  343 ARG A C   
1205 O O   . ARG A  172 ? 0.1494 0.1972 0.1946 0.0291  -0.0137 0.0130  343 ARG A O   
1206 C CB  . ARG A  172 ? 0.1323 0.1758 0.1557 -0.0265 -0.0060 -0.0180 343 ARG A CB  
1207 C CG  . ARG A  172 ? 0.1345 0.1723 0.1712 -0.0294 0.0035  -0.0169 343 ARG A CG  
1208 C CD  . ARG A  172 ? 0.1307 0.1685 0.1606 0.0055  -0.0210 -0.0293 343 ARG A CD  
1209 N NE  . ARG A  172 ? 0.1099 0.1884 0.1788 -0.0119 -0.0084 -0.0332 343 ARG A NE  
1210 C CZ  . ARG A  172 ? 0.1339 0.1616 0.1821 0.0280  -0.0311 -0.0362 343 ARG A CZ  
1211 N NH1 . ARG A  172 ? 0.2099 0.1668 0.1611 0.0061  -0.0537 0.0027  343 ARG A NH1 
1212 N NH2 . ARG A  172 ? 0.1744 0.2052 0.2028 -0.0259 -0.0596 -0.0431 343 ARG A NH2 
1213 N N   . PRO A  173 ? 0.1715 0.2795 0.2187 0.0479  0.0151  0.0332  344 PRO A N   
1214 C CA  . PRO A  173 ? 0.1621 0.2468 0.1772 0.0240  0.0119  0.0313  344 PRO A CA  
1215 C C   . PRO A  173 ? 0.1111 0.2209 0.1857 0.0220  -0.0134 -0.0081 344 PRO A C   
1216 O O   . PRO A  173 ? 0.1792 0.2492 0.1828 -0.0030 -0.0314 0.0362  344 PRO A O   
1217 C CB  . PRO A  173 ? 0.2637 0.3318 0.1494 0.0331  -0.0368 0.0614  344 PRO A CB  
1218 C CG  . PRO A  173 ? 0.2740 0.3662 0.2107 0.0275  0.0039  0.0790  344 PRO A CG  
1219 C CD  . PRO A  173 ? 0.1739 0.2912 0.2032 0.0558  0.0171  0.0310  344 PRO A CD  
1220 N N   . MET A  174 ? 0.1729 0.2016 0.2052 0.0093  -0.0234 0.0268  345 MET A N   
1221 C CA  . MET A  174 ? 0.1582 0.2035 0.2021 0.0143  -0.0276 0.0127  345 MET A CA  
1222 C C   . MET A  174 ? 0.2063 0.2268 0.2070 0.0312  -0.0221 0.0486  345 MET A C   
1223 O O   . MET A  174 ? 0.2537 0.2337 0.3676 0.0136  -0.0343 0.1108  345 MET A O   
1224 C CB  . MET A  174 ? 0.1742 0.1901 0.2030 -0.0030 -0.0264 0.0376  345 MET A CB  
1225 C CG  . MET A  174 ? 0.1336 0.1791 0.1930 0.0067  -0.0262 -0.0087 345 MET A CG  
1226 S SD  . MET A  174 ? 0.1573 0.2278 0.1996 0.0218  -0.0318 -0.0100 345 MET A SD  
1227 C CE  . MET A  174 ? 0.1522 0.1818 0.2071 -0.0001 -0.0275 -0.0006 345 MET A CE  
1228 N N   . VAL A  175 ? 0.2049 0.1951 0.2064 0.0196  -0.0310 0.0234  346 VAL A N   
1229 C CA  A VAL A  175 ? 0.1849 0.1981 0.2091 0.0155  -0.0248 0.0297  346 VAL A CA  
1230 C CA  B VAL A  175 ? 0.2001 0.2124 0.2137 0.0363  -0.0200 0.0141  346 VAL A CA  
1231 C C   . VAL A  175 ? 0.1782 0.1965 0.2171 0.0069  -0.0304 0.0235  346 VAL A C   
1232 O O   . VAL A  175 ? 0.2077 0.1944 0.2069 0.0148  -0.0477 0.0135  346 VAL A O   
1233 C CB  A VAL A  175 ? 0.1657 0.1914 0.2287 0.0011  -0.0037 0.0306  346 VAL A CB  
1234 C CB  B VAL A  175 ? 0.2184 0.2314 0.2995 0.0510  -0.0736 -0.0285 346 VAL A CB  
1235 C CG1 A VAL A  175 ? 0.2083 0.1958 0.2166 -0.0039 -0.0092 0.0460  346 VAL A CG1 
1236 C CG1 B VAL A  175 ? 0.1840 0.2309 0.2624 0.0504  -0.1082 -0.0207 346 VAL A CG1 
1237 C CG2 A VAL A  175 ? 0.1775 0.2083 0.2100 0.0093  -0.0137 0.0669  346 VAL A CG2 
1238 C CG2 B VAL A  175 ? 0.2315 0.2270 0.3029 0.0474  -0.0712 -0.0036 346 VAL A CG2 
1239 N N   . LEU A  176 ? 0.1903 0.1976 0.2717 -0.0182 -0.0101 0.0212  347 LEU A N   
1240 C CA  . LEU A  176 ? 0.1581 0.2196 0.2619 -0.0106 -0.0223 0.0161  347 LEU A CA  
1241 C C   . LEU A  176 ? 0.1790 0.1830 0.2188 0.0063  -0.0013 0.0113  347 LEU A C   
1242 O O   . LEU A  176 ? 0.2403 0.2259 0.2784 0.0526  -0.0327 0.0449  347 LEU A O   
1243 C CB  . LEU A  176 ? 0.1706 0.2508 0.3613 0.0126  0.0485  0.0781  347 LEU A CB  
1244 C CG  . LEU A  176 ? 0.3295 0.3098 0.4387 -0.0584 -0.0452 0.0478  347 LEU A CG  
1245 C CD1 . LEU A  176 ? 0.4022 0.3539 0.4382 -0.0389 -0.0025 0.0898  347 LEU A CD1 
1246 C CD2 . LEU A  176 ? 0.4475 0.4113 0.3508 -0.0936 -0.1196 0.0166  347 LEU A CD2 
1247 N N   . LEU A  177 ? 0.1691 0.1835 0.2316 0.0031  0.0150  0.0169  348 LEU A N   
1248 C CA  . LEU A  177 ? 0.1596 0.2035 0.2091 0.0182  -0.0035 0.0213  348 LEU A CA  
1249 C C   . LEU A  177 ? 0.2006 0.1824 0.2866 0.0117  -0.0347 -0.0112 348 LEU A C   
1250 O O   . LEU A  177 ? 0.2254 0.2042 0.2417 0.0515  -0.0336 0.0011  348 LEU A O   
1251 C CB  . LEU A  177 ? 0.1670 0.2114 0.1945 0.0143  0.0015  0.0156  348 LEU A CB  
1252 C CG  . LEU A  177 ? 0.1743 0.1935 0.2256 -0.0050 0.0096  -0.0033 348 LEU A CG  
1253 C CD1 . LEU A  177 ? 0.1826 0.1910 0.2306 -0.0103 0.0191  -0.0121 348 LEU A CD1 
1254 C CD2 . LEU A  177 ? 0.1912 0.2328 0.2234 0.0079  -0.0053 -0.0176 348 LEU A CD2 
1255 N N   . LYS A  178 ? 0.1992 0.2059 0.2471 0.0255  -0.0545 -0.0040 349 LYS A N   
1256 C CA  . LYS A  178 ? 0.1980 0.2192 0.2720 0.0297  -0.0160 -0.0105 349 LYS A CA  
1257 C C   . LYS A  178 ? 0.2289 0.1809 0.2129 0.0139  -0.0192 0.0063  349 LYS A C   
1258 O O   . LYS A  178 ? 0.1752 0.2435 0.2328 0.0084  0.0108  -0.0105 349 LYS A O   
1259 C CB  . LYS A  178 ? 0.2365 0.2263 0.2350 0.0235  -0.0176 0.0046  349 LYS A CB  
1260 C CG  . LYS A  178 ? 0.3516 0.3068 0.3222 0.0315  0.0866  0.0519  349 LYS A CG  
1261 C CD  . LYS A  178 ? 0.5396 0.2901 0.5140 0.0170  -0.0798 0.0428  349 LYS A CD  
1262 N N   . SER A  179 ? 0.2297 0.2262 0.2130 0.0173  -0.0330 -0.0078 350 SER A N   
1263 C CA  A SER A  179 ? 0.2708 0.2059 0.1935 0.0103  -0.0287 -0.0162 350 SER A CA  
1264 C CA  B SER A  179 ? 0.2626 0.2124 0.1968 0.0060  -0.0197 -0.0078 350 SER A CA  
1265 C C   . SER A  179 ? 0.2582 0.2260 0.1662 0.0087  -0.0119 -0.0119 350 SER A C   
1266 O O   . SER A  179 ? 0.2540 0.2255 0.2356 0.0296  -0.0090 -0.0110 350 SER A O   
1267 C CB  A SER A  179 ? 0.4322 0.3615 0.2476 0.0020  -0.0431 -0.1154 350 SER A CB  
1268 C CB  B SER A  179 ? 0.2823 0.2725 0.1886 -0.0007 0.0378  -0.0375 350 SER A CB  
1269 O OG  A SER A  179 ? 0.4468 0.5615 0.4094 0.0078  -0.0203 -0.0227 350 SER A OG  
1270 O OG  B SER A  179 ? 0.2778 0.2711 0.2175 0.0090  -0.0411 -0.0276 350 SER A OG  
1271 N N   . GLY A  180 ? 0.2474 0.2044 0.2088 0.0167  0.0131  0.0195  351 GLY A N   
1272 C CA  . GLY A  180 ? 0.2376 0.2093 0.2121 0.0275  0.0205  -0.0118 351 GLY A CA  
1273 C C   . GLY A  180 ? 0.2315 0.2216 0.2173 0.0262  0.0009  -0.0002 351 GLY A C   
1274 O O   . GLY A  180 ? 0.2198 0.2551 0.2320 0.0524  0.0184  0.0226  351 GLY A O   
1275 N N   . GLN A  181 ? 0.2079 0.2239 0.1718 0.0058  -0.0062 0.0084  352 GLN A N   
1276 C CA  . GLN A  181 ? 0.1592 0.1791 0.1684 0.0259  0.0039  0.0283  352 GLN A CA  
1277 C C   . GLN A  181 ? 0.1723 0.1461 0.1884 0.0361  0.0086  0.0299  352 GLN A C   
1278 O O   . GLN A  181 ? 0.1951 0.1966 0.1939 0.0098  -0.0140 0.0641  352 GLN A O   
1279 C CB  . GLN A  181 ? 0.1542 0.2085 0.1856 0.0153  0.0025  0.0190  352 GLN A CB  
1280 C CG  . GLN A  181 ? 0.1909 0.2087 0.1911 0.0220  0.0028  0.0129  352 GLN A CG  
1281 C CD  . GLN A  181 ? 0.1790 0.2369 0.2061 0.0081  0.0164  0.0311  352 GLN A CD  
1282 O OE1 . GLN A  181 ? 0.2102 0.2785 0.2154 0.0070  -0.0113 0.0595  352 GLN A OE1 
1283 N NE2 . GLN A  181 ? 0.2117 0.2742 0.1988 -0.0049 -0.0113 0.0464  352 GLN A NE2 
1284 N N   . LEU A  182 ? 0.1640 0.1774 0.1792 0.0131  0.0038  0.0534  353 LEU A N   
1285 C CA  . LEU A  182 ? 0.1760 0.1962 0.2024 0.0029  -0.0054 0.0459  353 LEU A CA  
1286 C C   . LEU A  182 ? 0.1781 0.1807 0.1798 -0.0012 -0.0269 0.0518  353 LEU A C   
1287 O O   . LEU A  182 ? 0.1871 0.2043 0.1856 0.0333  -0.0041 0.0667  353 LEU A O   
1288 C CB  . LEU A  182 ? 0.1996 0.2220 0.2491 0.0381  0.0045  0.0624  353 LEU A CB  
1289 C CG  . LEU A  182 ? 0.2168 0.2072 0.2780 0.0434  0.0000  0.0401  353 LEU A CG  
1290 C CD1 . LEU A  182 ? 0.2369 0.2481 0.2738 0.0526  0.0175  0.0983  353 LEU A CD1 
1291 C CD2 . LEU A  182 ? 0.2281 0.2165 0.2486 0.0607  0.0020  0.0333  353 LEU A CD2 
1292 N N   . ILE A  183 ? 0.1557 0.1697 0.1741 0.0160  -0.0307 0.0300  354 ILE A N   
1293 C CA  . ILE A  183 ? 0.1544 0.1715 0.1729 0.0145  -0.0361 0.0409  354 ILE A CA  
1294 C C   . ILE A  183 ? 0.1594 0.1603 0.1731 0.0195  -0.0321 0.0433  354 ILE A C   
1295 O O   . ILE A  183 ? 0.1826 0.2080 0.1901 -0.0126 -0.0068 0.0320  354 ILE A O   
1296 C CB  . ILE A  183 ? 0.1432 0.2080 0.1869 0.0082  -0.0214 0.0411  354 ILE A CB  
1297 C CG1 . ILE A  183 ? 0.1466 0.1941 0.1857 0.0054  -0.0098 0.0384  354 ILE A CG1 
1298 C CG2 . ILE A  183 ? 0.1647 0.2111 0.2376 0.0072  -0.0028 0.0653  354 ILE A CG2 
1299 C CD1 . ILE A  183 ? 0.1467 0.2196 0.2046 0.0050  -0.0298 0.0526  354 ILE A CD1 
1300 N N   . LYS A  184 ? 0.1445 0.1911 0.1755 0.0150  -0.0258 0.0438  355 LYS A N   
1301 C CA  . LYS A  184 ? 0.1552 0.1714 0.2074 0.0285  -0.0042 0.0030  355 LYS A CA  
1302 C C   . LYS A  184 ? 0.1413 0.1937 0.1730 -0.0020 -0.0144 0.0498  355 LYS A C   
1303 O O   . LYS A  184 ? 0.1338 0.1889 0.1770 0.0164  -0.0205 0.0496  355 LYS A O   
1304 C CB  . LYS A  184 ? 0.1607 0.2215 0.2286 0.0073  -0.0329 -0.0013 355 LYS A CB  
1305 C CG  A LYS A  184 ? 0.2274 0.2818 0.3090 0.0704  -0.0613 0.0000  355 LYS A CG  
1306 C CG  B LYS A  184 ? 0.1815 0.2220 0.2355 0.0293  -0.0219 0.0081  355 LYS A CG  
1307 C CD  A LYS A  184 ? 0.2861 0.3664 0.3304 0.0381  -0.0621 -0.0373 355 LYS A CD  
1308 C CD  B LYS A  184 ? 0.1698 0.1686 0.2285 0.0532  -0.0223 0.0253  355 LYS A CD  
1309 C CE  A LYS A  184 ? 0.3053 0.4247 0.5386 0.0891  -0.0286 0.0444  355 LYS A CE  
1310 C CE  B LYS A  184 ? 0.1644 0.2385 0.2175 0.0492  -0.0398 0.0408  355 LYS A CE  
1311 N NZ  A LYS A  184 ? 0.3399 0.4391 0.5803 0.0946  -0.0114 0.0130  355 LYS A NZ  
1312 N NZ  B LYS A  184 ? 0.1941 0.2208 0.2321 0.0831  -0.0109 -0.0073 355 LYS A NZ  
1313 N N   . THR A  185 ? 0.1378 0.1835 0.1773 0.0075  -0.0025 0.0425  356 THR A N   
1314 C CA  . THR A  185 ? 0.1454 0.1813 0.1730 0.0201  0.0077  0.0285  356 THR A CA  
1315 C C   . THR A  185 ? 0.1361 0.1888 0.1845 0.0096  -0.0085 0.0462  356 THR A C   
1316 O O   . THR A  185 ? 0.1179 0.2118 0.2507 0.0228  -0.0144 0.0525  356 THR A O   
1317 C CB  . THR A  185 ? 0.1547 0.1984 0.1695 0.0343  0.0067  0.0341  356 THR A CB  
1318 O OG1 . THR A  185 ? 0.1544 0.2236 0.1951 0.0325  -0.0042 0.0367  356 THR A OG1 
1319 C CG2 . THR A  185 ? 0.1739 0.2233 0.2616 0.0376  -0.0160 0.0601  356 THR A CG2 
1320 N N   . GLU A  186 ? 0.1574 0.2028 0.1796 0.0150  -0.0312 0.0162  357 GLU A N   
1321 C CA  . GLU A  186 ? 0.1381 0.1727 0.1880 0.0197  -0.0336 0.0464  357 GLU A CA  
1322 C C   . GLU A  186 ? 0.1441 0.2298 0.2018 -0.0151 -0.0207 0.0642  357 GLU A C   
1323 O O   . GLU A  186 ? 0.1572 0.2462 0.2172 0.0301  -0.0381 0.0652  357 GLU A O   
1324 C CB  . GLU A  186 ? 0.1608 0.1778 0.1785 0.0026  -0.0379 0.0363  357 GLU A CB  
1325 C CG  . GLU A  186 ? 0.1988 0.1936 0.2320 -0.0175 -0.0553 0.0201  357 GLU A CG  
1326 C CD  . GLU A  186 ? 0.2406 0.1934 0.2077 -0.0280 -0.0645 0.0222  357 GLU A CD  
1327 O OE1 . GLU A  186 ? 0.1711 0.1882 0.2273 0.0092  -0.0586 0.0397  357 GLU A OE1 
1328 O OE2 . GLU A  186 ? 0.2064 0.1736 0.2828 0.0008  -0.0685 0.0207  357 GLU A OE2 
1329 N N   . TRP A  187 ? 0.1259 0.2122 0.2902 0.0086  -0.0301 0.1080  358 TRP A N   
1330 C CA  . TRP A  187 ? 0.1806 0.2803 0.2893 0.0423  -0.0033 0.1364  358 TRP A CA  
1331 C C   . TRP A  187 ? 0.2665 0.2572 0.3886 -0.0029 0.0638  0.0879  358 TRP A C   
1332 O O   . TRP A  187 ? 0.1939 0.2116 0.5056 -0.0213 0.0586  0.0540  358 TRP A O   
1333 C CB  . TRP A  187 ? 0.2161 0.2982 0.3322 0.0753  -0.0023 0.1157  358 TRP A CB  
1334 C CG  . TRP A  187 ? 0.2633 0.3515 0.3590 0.0580  0.0390  0.1428  358 TRP A CG  
1335 C CD1 . TRP A  187 ? 0.2811 0.3941 0.3389 0.1022  0.0926  0.2112  358 TRP A CD1 
1336 C CD2 . TRP A  187 ? 0.3475 0.3292 0.4176 -0.0093 0.0632  0.1579  358 TRP A CD2 
1337 N NE1 . TRP A  187 ? 0.2873 0.3711 0.3849 0.0663  0.1016  0.2005  358 TRP A NE1 
1338 C CE2 . TRP A  187 ? 0.3321 0.3097 0.3695 -0.0884 0.0792  0.1282  358 TRP A CE2 
1339 C CE3 . TRP A  187 ? 0.3767 0.3975 0.4123 -0.1181 0.0657  0.0379  358 TRP A CE3 
1340 C CZ2 . TRP A  187 ? 0.3111 0.4042 0.3948 -0.1405 0.0985  0.0783  358 TRP A CZ2 
1341 C CZ3 . TRP A  187 ? 0.4292 0.4468 0.3813 -0.1190 0.0646  0.0764  358 TRP A CZ3 
1342 C CH2 . TRP A  187 ? 0.3353 0.3331 0.3706 -0.1819 0.1078  0.0614  358 TRP A CH2 
1343 N N   . GLU A  188 ? 0.3116 0.3164 0.3667 0.1030  0.0739  0.0741  359 GLU A N   
1344 C CA  . GLU A  188 ? 0.4024 0.2967 0.4231 0.0305  0.1737  0.0251  359 GLU A CA  
1345 C C   . GLU A  188 ? 0.2173 0.2586 0.5476 -0.0064 0.0085  0.1033  359 GLU A C   
1346 O O   . GLU A  188 ? 0.2411 0.2584 0.8785 -0.0836 0.0237  0.0953  359 GLU A O   
1347 C CB  . GLU A  188 ? 0.4514 0.3853 0.6214 -0.0358 0.2342  0.0629  359 GLU A CB  
1348 C CG  . GLU A  188 ? 0.5620 0.4300 0.6012 0.0500  0.1728  0.0569  359 GLU A CG  
1349 C CD  . GLU A  188 ? 0.4783 0.5108 0.5684 0.0697  0.0733  0.1877  359 GLU A CD  
1350 O OE1 . GLU A  188 ? 0.3804 0.4371 0.5923 -0.0543 0.0683  -0.0124 359 GLU A OE1 
1351 O OE2 . GLU A  188 ? 0.7311 0.4762 0.4438 -0.0391 0.0894  0.1289  359 GLU A OE2 
1352 N N   . GLY A  189 ? 0.2216 0.2226 0.3487 -0.0059 -0.0575 0.0533  360 GLY A N   
1353 C CA  . GLY A  189 ? 0.2179 0.2108 0.3841 -0.0067 -0.1177 0.0184  360 GLY A CA  
1354 C C   . GLY A  189 ? 0.2354 0.1950 0.3863 -0.0095 -0.0396 0.0638  360 GLY A C   
1355 O O   . GLY A  189 ? 0.3318 0.4014 0.4619 -0.0417 -0.1518 -0.0207 360 GLY A O   
1356 N N   . THR A  190 ? 0.1733 0.2269 0.4723 0.0063  -0.0783 0.0346  361 THR A N   
1357 C CA  . THR A  190 ? 0.1800 0.2095 0.4848 -0.0055 -0.0788 0.0492  361 THR A CA  
1358 C C   . THR A  190 ? 0.2098 0.2482 0.3600 -0.0461 -0.0764 0.0817  361 THR A C   
1359 O O   . THR A  190 ? 0.1501 0.2187 0.3918 -0.0450 -0.0759 0.1134  361 THR A O   
1360 C CB  . THR A  190 ? 0.2241 0.3053 0.4521 -0.0542 -0.0443 0.0332  361 THR A CB  
1361 O OG1 . THR A  190 ? 0.2423 0.2888 0.5823 -0.0518 -0.0969 0.0743  361 THR A OG1 
1362 C CG2 . THR A  190 ? 0.2340 0.2946 0.5572 -0.0837 -0.0476 0.0239  361 THR A CG2 
1363 N N   . TRP A  191 ? 0.1473 0.2266 0.3288 -0.0148 -0.0833 0.0470  362 TRP A N   
1364 C CA  . TRP A  191 ? 0.1534 0.2159 0.2992 -0.0043 -0.0368 0.0266  362 TRP A CA  
1365 C C   . TRP A  191 ? 0.1674 0.2347 0.2641 0.0274  -0.0474 0.0547  362 TRP A C   
1366 O O   . TRP A  191 ? 0.1812 0.2746 0.3217 0.0352  -0.0961 0.0502  362 TRP A O   
1367 C CB  . TRP A  191 ? 0.1686 0.2466 0.2521 0.0056  -0.0724 0.0464  362 TRP A CB  
1368 C CG  . TRP A  191 ? 0.1803 0.1765 0.2519 -0.0328 -0.0615 0.0456  362 TRP A CG  
1369 C CD1 . TRP A  191 ? 0.2210 0.2290 0.2218 0.0010  -0.0599 0.0134  362 TRP A CD1 
1370 C CD2 . TRP A  191 ? 0.1727 0.1962 0.2074 -0.0280 -0.0529 0.0335  362 TRP A CD2 
1371 N NE1 . TRP A  191 ? 0.2216 0.2062 0.2486 0.0006  -0.0696 -0.0047 362 TRP A NE1 
1372 C CE2 . TRP A  191 ? 0.1893 0.2170 0.1848 -0.0145 -0.0610 0.0433  362 TRP A CE2 
1373 C CE3 . TRP A  191 ? 0.1513 0.2165 0.1767 -0.0093 -0.0422 0.0221  362 TRP A CE3 
1374 C CZ2 . TRP A  191 ? 0.2110 0.2242 0.2081 0.0383  -0.0558 0.0531  362 TRP A CZ2 
1375 C CZ3 . TRP A  191 ? 0.1509 0.2278 0.1813 -0.0244 -0.0522 0.0545  362 TRP A CZ3 
1376 C CH2 . TRP A  191 ? 0.1896 0.2504 0.2143 0.0162  -0.0591 0.0543  362 TRP A CH2 
1377 N N   . TRP A  192 ? 0.1121 0.2074 0.2682 -0.0054 -0.0499 0.0372  363 TRP A N   
1378 C CA  . TRP A  192 ? 0.1335 0.2185 0.2829 -0.0045 -0.0184 0.0509  363 TRP A CA  
1379 C C   . TRP A  192 ? 0.1241 0.2010 0.2885 0.0157  -0.0074 0.0464  363 TRP A C   
1380 O O   . TRP A  192 ? 0.1143 0.2276 0.2559 0.0199  -0.0164 0.0510  363 TRP A O   
1381 C CB  . TRP A  192 ? 0.1177 0.2632 0.2738 -0.0050 0.0098  0.0458  363 TRP A CB  
1382 C CG  . TRP A  192 ? 0.1379 0.2628 0.3549 -0.0219 0.0034  0.0863  363 TRP A CG  
1383 C CD1 . TRP A  192 ? 0.2047 0.2158 0.3828 -0.0015 0.0432  0.1317  363 TRP A CD1 
1384 C CD2 . TRP A  192 ? 0.1220 0.1991 0.3873 0.0063  -0.0062 0.1027  363 TRP A CD2 
1385 N NE1 . TRP A  192 ? 0.1390 0.2032 0.4034 0.0360  0.0099  0.0882  363 TRP A NE1 
1386 C CE2 . TRP A  192 ? 0.1109 0.2139 0.4492 0.0422  -0.0315 0.1039  363 TRP A CE2 
1387 C CE3 . TRP A  192 ? 0.1501 0.2690 0.3628 0.0070  0.0377  0.0984  363 TRP A CE3 
1388 C CZ2 . TRP A  192 ? 0.1916 0.2249 0.3974 0.0108  0.0018  0.1153  363 TRP A CZ2 
1389 C CZ3 . TRP A  192 ? 0.1224 0.2665 0.3881 0.0104  -0.0023 0.1197  363 TRP A CZ3 
1390 C CH2 . TRP A  192 ? 0.1974 0.2682 0.3829 0.0017  0.0459  0.0526  363 TRP A CH2 
1391 N N   . LYS A  193 ? 0.1301 0.1895 0.3159 0.0153  -0.0384 0.0475  364 LYS A N   
1392 C CA  . LYS A  193 ? 0.1297 0.2010 0.2556 0.0251  0.0229  0.0375  364 LYS A CA  
1393 C C   . LYS A  193 ? 0.1465 0.1886 0.2358 0.0160  0.0296  0.0472  364 LYS A C   
1394 O O   . LYS A  193 ? 0.1272 0.2617 0.2788 0.0228  0.0396  0.0867  364 LYS A O   
1395 C CB  . LYS A  193 ? 0.1235 0.2216 0.3310 0.0234  -0.0169 0.0297  364 LYS A CB  
1396 C CG  . LYS A  193 ? 0.2017 0.2647 0.3282 0.0521  -0.0481 0.0412  364 LYS A CG  
1397 C CD  . LYS A  193 ? 0.2432 0.3226 0.4703 0.1086  -0.0944 0.0652  364 LYS A CD  
1398 C CE  . LYS A  193 ? 0.5238 0.4910 0.4787 0.0555  -0.1665 0.0427  364 LYS A CE  
1399 N N   . SER A  194 ? 0.1544 0.2180 0.1977 0.0007  0.0001  0.0673  365 SER A N   
1400 C CA  . SER A  194 ? 0.1663 0.1897 0.1736 0.0203  0.0265  0.0379  365 SER A CA  
1401 C C   . SER A  194 ? 0.1402 0.2162 0.1864 -0.0013 0.0248  0.0285  365 SER A C   
1402 O O   . SER A  194 ? 0.1316 0.2257 0.1995 0.0150  0.0096  0.0493  365 SER A O   
1403 C CB  . SER A  194 ? 0.1710 0.1927 0.2155 0.0206  0.0133  0.0455  365 SER A CB  
1404 O OG  . SER A  194 ? 0.1441 0.2256 0.2267 0.0229  0.0130  0.0435  365 SER A OG  
1405 N N   . ARG A  195 ? 0.1711 0.2030 0.1580 0.0231  0.0227  0.0436  366 ARG A N   
1406 C CA  . ARG A  195 ? 0.1686 0.2014 0.1785 0.0388  0.0212  0.0356  366 ARG A CA  
1407 C C   . ARG A  195 ? 0.1615 0.2320 0.1964 0.0327  0.0242  0.0515  366 ARG A C   
1408 O O   . ARG A  195 ? 0.1768 0.2489 0.1916 0.0435  0.0189  0.0557  366 ARG A O   
1409 C CB  . ARG A  195 ? 0.1941 0.2392 0.2410 0.0585  0.0257  0.0021  366 ARG A CB  
1410 C CG  . ARG A  195 ? 0.2088 0.2395 0.2303 0.0396  0.0544  0.0183  366 ARG A CG  
1411 C CD  . ARG A  195 ? 0.1778 0.2875 0.2554 0.0581  0.0390  0.0311  366 ARG A CD  
1412 N NE  . ARG A  195 ? 0.2549 0.2913 0.2815 0.1038  0.0854  0.0574  366 ARG A NE  
1413 C CZ  . ARG A  195 ? 0.2962 0.3888 0.3918 0.1119  0.1632  0.0935  366 ARG A CZ  
1414 N NH1 . ARG A  195 ? 0.3173 0.5416 0.5499 0.1569  0.1136  0.1551  366 ARG A NH1 
1415 N NH2 . ARG A  195 ? 0.3418 0.4062 0.3690 0.1217  0.1058  0.0687  366 ARG A NH2 
1416 N N   . VAL A  196 ? 0.1733 0.2162 0.1825 0.0253  0.0224  0.0253  367 VAL A N   
1417 C CA  . VAL A  196 ? 0.1584 0.1936 0.1679 0.0162  0.0204  0.0051  367 VAL A CA  
1418 C C   . VAL A  196 ? 0.1560 0.1893 0.1715 0.0421  -0.0005 0.0110  367 VAL A C   
1419 O O   . VAL A  196 ? 0.2523 0.2031 0.1912 0.0567  0.0094  0.0006  367 VAL A O   
1420 C CB  . VAL A  196 ? 0.1430 0.2033 0.1939 0.0161  0.0099  0.0048  367 VAL A CB  
1421 C CG1 . VAL A  196 ? 0.1423 0.2392 0.2016 0.0167  0.0067  0.0068  367 VAL A CG1 
1422 C CG2 . VAL A  196 ? 0.1459 0.2193 0.1945 0.0149  0.0068  0.0033  367 VAL A CG2 
1423 N N   . GLU A  197 ? 0.2520 0.1970 0.1644 0.0828  -0.0230 0.0062  368 GLU A N   
1424 C CA  . GLU A  197 ? 0.2575 0.2315 0.1873 0.0667  0.0018  -0.0082 368 GLU A CA  
1425 C C   . GLU A  197 ? 0.2346 0.2387 0.1704 0.0671  0.0249  -0.0301 368 GLU A C   
1426 O O   . GLU A  197 ? 0.3224 0.2638 0.2371 0.0706  -0.0337 -0.0777 368 GLU A O   
1427 C CB  . GLU A  197 ? 0.2938 0.2138 0.1965 0.0712  0.0035  0.0072  368 GLU A CB  
1428 C CG  . GLU A  197 ? 0.2760 0.3096 0.1991 0.0597  0.0325  0.0427  368 GLU A CG  
1429 C CD  . GLU A  197 ? 0.2734 0.3060 0.2817 0.0559  0.0413  0.0632  368 GLU A CD  
1430 O OE1 . GLU A  197 ? 0.3466 0.3433 0.2948 0.0845  0.0725  0.0073  368 GLU A OE1 
1431 O OE2 . GLU A  197 ? 0.2848 0.3492 0.2469 0.1061  0.0344  0.0570  368 GLU A OE2 
1432 N N   . GLU A  198 ? 0.2482 0.2772 0.1559 0.0967  0.0162  -0.0338 369 GLU A N   
1433 C CA  . GLU A  198 ? 0.2736 0.2640 0.1860 0.0661  -0.0026 -0.0326 369 GLU A CA  
1434 C C   . GLU A  198 ? 0.2364 0.2096 0.1841 0.0451  -0.0029 0.0113  369 GLU A C   
1435 O O   . GLU A  198 ? 0.2399 0.2286 0.2026 0.0576  -0.0204 -0.0241 369 GLU A O   
1436 C CB  . GLU A  198 ? 0.2752 0.3463 0.1990 0.0732  0.0183  0.0056  369 GLU A CB  
1437 C CG  . GLU A  198 ? 0.3234 0.3662 0.2717 0.0330  0.0109  -0.0274 369 GLU A CG  
1438 C CD  . GLU A  198 ? 0.3985 0.2933 0.2717 0.0819  -0.0533 -0.0363 369 GLU A CD  
1439 O OE1 . GLU A  198 ? 0.4082 0.3509 0.1524 0.0991  -0.0685 -0.0291 369 GLU A OE1 
1440 O OE2 . GLU A  198 ? 0.5086 0.4635 0.2382 0.0776  -0.1094 -0.0064 369 GLU A OE2 
1441 N N   . VAL A  199 ? 0.2264 0.1911 0.2205 0.0490  -0.0064 -0.0356 370 VAL A N   
1442 C CA  . VAL A  199 ? 0.1878 0.2147 0.2193 0.0326  -0.0179 -0.0161 370 VAL A CA  
1443 C C   . VAL A  199 ? 0.2357 0.1886 0.1742 0.0332  -0.0271 -0.0458 370 VAL A C   
1444 O O   . VAL A  199 ? 0.2821 0.2152 0.2262 0.0654  -0.0716 -0.0887 370 VAL A O   
1445 C CB  . VAL A  199 ? 0.2667 0.2538 0.2422 0.0301  -0.0226 0.0213  370 VAL A CB  
1446 C CG1 . VAL A  199 ? 0.3207 0.3022 0.2336 0.0415  0.0217  0.0047  370 VAL A CG1 
1447 C CG2 . VAL A  199 ? 0.2655 0.3976 0.2456 0.0601  -0.0114 0.0123  370 VAL A CG2 
1448 N N   . ASP A  200 ? 0.2251 0.1887 0.1906 0.0287  -0.0639 -0.0596 371 ASP A N   
1449 C CA  . ASP A  200 ? 0.1815 0.1948 0.2029 0.0310  -0.0532 -0.0587 371 ASP A CA  
1450 C C   . ASP A  200 ? 0.2020 0.1800 0.1702 0.0156  -0.0296 -0.0465 371 ASP A C   
1451 O O   . ASP A  200 ? 0.2084 0.1737 0.1544 0.0320  -0.0453 -0.0418 371 ASP A O   
1452 C CB  . ASP A  200 ? 0.1831 0.2574 0.2100 0.0294  -0.0260 -0.0668 371 ASP A CB  
1453 C CG  . ASP A  200 ? 0.2973 0.2836 0.2812 0.0229  -0.0910 -0.0105 371 ASP A CG  
1454 O OD1 . ASP A  200 ? 0.3188 0.3895 0.2219 -0.0291 -0.0939 0.0128  371 ASP A OD1 
1455 O OD2 . ASP A  200 ? 0.2700 0.3064 0.2491 0.0249  -0.0697 -0.0030 371 ASP A OD2 
1456 N N   . GLY A  201 ? 0.2534 0.1861 0.1972 -0.0140 -0.0484 -0.0140 372 GLY A N   
1457 C CA  . GLY A  201 ? 0.2454 0.2063 0.1843 -0.0022 -0.0730 -0.0191 372 GLY A CA  
1458 C C   . GLY A  201 ? 0.1924 0.1577 0.1633 0.0000  -0.0321 -0.0169 372 GLY A C   
1459 O O   . GLY A  201 ? 0.2525 0.1650 0.2059 0.0159  -0.0538 -0.0019 372 GLY A O   
1460 N N   . SER A  202 ? 0.1497 0.1606 0.1407 0.0213  -0.0449 -0.0093 373 SER A N   
1461 C CA  . SER A  202 ? 0.1495 0.1786 0.1336 0.0274  -0.0628 0.0000  373 SER A CA  
1462 C C   . SER A  202 ? 0.1696 0.1293 0.1590 0.0146  -0.0270 0.0042  373 SER A C   
1463 O O   . SER A  202 ? 0.1630 0.1840 0.1542 0.0187  -0.0427 -0.0147 373 SER A O   
1464 C CB  . SER A  202 ? 0.1198 0.1936 0.1574 0.0144  -0.0612 -0.0162 373 SER A CB  
1465 O OG  . SER A  202 ? 0.1485 0.2006 0.1843 -0.0124 -0.0290 0.0131  373 SER A OG  
1466 N N   . LEU A  203 ? 0.1483 0.1674 0.1386 0.0087  -0.0465 -0.0138 374 LEU A N   
1467 C CA  . LEU A  203 ? 0.1566 0.1783 0.1374 0.0146  -0.0229 -0.0086 374 LEU A CA  
1468 C C   . LEU A  203 ? 0.1853 0.1570 0.1646 0.0163  -0.0375 -0.0145 374 LEU A C   
1469 O O   . LEU A  203 ? 0.1849 0.1561 0.1942 0.0215  -0.0562 -0.0168 374 LEU A O   
1470 C CB  . LEU A  203 ? 0.1606 0.1753 0.1376 0.0000  -0.0139 -0.0119 374 LEU A CB  
1471 C CG  . LEU A  203 ? 0.1689 0.1749 0.1533 0.0090  -0.0354 -0.0018 374 LEU A CG  
1472 C CD1 . LEU A  203 ? 0.1959 0.1723 0.1613 0.0262  -0.0384 -0.0034 374 LEU A CD1 
1473 C CD2 . LEU A  203 ? 0.2050 0.1752 0.1965 0.0149  -0.0514 -0.0164 374 LEU A CD2 
1474 N N   . VAL A  204 ? 0.1865 0.1705 0.1334 0.0475  -0.0366 -0.0172 375 VAL A N   
1475 C CA  . VAL A  204 ? 0.1690 0.1680 0.1551 0.0389  -0.0279 -0.0053 375 VAL A CA  
1476 C C   . VAL A  204 ? 0.1719 0.1716 0.1194 0.0522  -0.0270 0.0136  375 VAL A C   
1477 O O   . VAL A  204 ? 0.1712 0.1889 0.1692 0.0424  -0.0053 -0.0163 375 VAL A O   
1478 C CB  . VAL A  204 ? 0.1738 0.1966 0.1534 0.0199  -0.0368 -0.0029 375 VAL A CB  
1479 C CG1 . VAL A  204 ? 0.1835 0.1901 0.1618 0.0363  -0.0082 -0.0098 375 VAL A CG1 
1480 C CG2 . VAL A  204 ? 0.2662 0.2077 0.2553 0.0728  -0.0541 0.0224  375 VAL A CG2 
1481 N N   . ARG A  205 ? 0.1791 0.1887 0.1650 0.0610  -0.0014 0.0083  376 ARG A N   
1482 C CA  . ARG A  205 ? 0.1745 0.2217 0.1469 0.0479  -0.0177 -0.0087 376 ARG A CA  
1483 C C   . ARG A  205 ? 0.1877 0.2249 0.1700 0.0516  -0.0127 0.0268  376 ARG A C   
1484 O O   . ARG A  205 ? 0.1943 0.2235 0.1708 0.0584  0.0104  0.0157  376 ARG A O   
1485 C CB  . ARG A  205 ? 0.2169 0.2373 0.1551 0.0519  -0.0255 -0.0262 376 ARG A CB  
1486 C CG  . ARG A  205 ? 0.2793 0.2721 0.1565 0.0285  0.0055  0.0030  376 ARG A CG  
1487 C CD  . ARG A  205 ? 0.3783 0.2923 0.1521 0.0513  -0.0087 0.0190  376 ARG A CD  
1488 N NE  . ARG A  205 ? 0.3070 0.3221 0.1726 0.0695  0.0210  0.0058  376 ARG A NE  
1489 C CZ  . ARG A  205 ? 0.3251 0.2878 0.1732 0.0633  0.0391  0.0617  376 ARG A CZ  
1490 N NH1 . ARG A  205 ? 0.4585 0.3219 0.2404 0.0553  0.0018  -0.0027 376 ARG A NH1 
1491 N NH2 . ARG A  205 ? 0.3089 0.3594 0.2357 0.0896  0.0692  -0.0169 376 ARG A NH2 
1492 N N   . ILE A  206 ? 0.1608 0.1944 0.1616 0.0489  0.0086  0.0381  377 ILE A N   
1493 C CA  . ILE A  206 ? 0.1469 0.1884 0.1693 0.0537  0.0144  0.0361  377 ILE A CA  
1494 C C   . ILE A  206 ? 0.1733 0.1913 0.1676 0.0267  0.0340  0.0365  377 ILE A C   
1495 O O   . ILE A  206 ? 0.1852 0.2012 0.1985 0.0509  0.0230  0.0565  377 ILE A O   
1496 C CB  . ILE A  206 ? 0.1621 0.1772 0.1884 0.0426  0.0033  0.0213  377 ILE A CB  
1497 C CG1 . ILE A  206 ? 0.1855 0.2002 0.1752 0.0194  0.0064  0.0198  377 ILE A CG1 
1498 C CG2 . ILE A  206 ? 0.1514 0.2311 0.1904 0.0350  0.0103  0.0622  377 ILE A CG2 
1499 C CD1 . ILE A  206 ? 0.2191 0.2091 0.2159 0.0456  0.0284  0.0339  377 ILE A CD1 
1500 N N   . LEU A  207 ? 0.1657 0.2056 0.2186 0.0351  0.0392  0.0499  378 LEU A N   
1501 C CA  . LEU A  207 ? 0.1710 0.2694 0.2166 0.0565  0.0557  0.0510  378 LEU A CA  
1502 C C   . LEU A  207 ? 0.1603 0.2387 0.2268 0.0377  0.0620  0.0385  378 LEU A C   
1503 O O   . LEU A  207 ? 0.1624 0.2497 0.2258 0.0276  0.0478  0.0535  378 LEU A O   
1504 C CB  . LEU A  207 ? 0.1936 0.2531 0.2075 0.0642  0.0720  0.0635  378 LEU A CB  
1505 C CG  . LEU A  207 ? 0.2015 0.3491 0.2264 0.0598  0.0749  0.0321  378 LEU A CG  
1506 C CD1 . LEU A  207 ? 0.2152 0.3355 0.3365 0.0363  0.0785  0.0450  378 LEU A CD1 
1507 C CD2 . LEU A  207 ? 0.2789 0.3664 0.2217 0.0959  0.0690  0.0391  378 LEU A CD2 
1508 N N   . PHE A  208 ? 0.2025 0.2441 0.2248 0.0400  0.0599  0.0849  379 PHE A N   
1509 C CA  . PHE A  208 ? 0.1736 0.2242 0.2462 0.0384  0.0544  0.0790  379 PHE A CA  
1510 C C   . PHE A  208 ? 0.1867 0.2904 0.2742 0.0723  0.0420  0.0878  379 PHE A C   
1511 O O   . PHE A  208 ? 0.1983 0.3121 0.3123 0.0793  0.0728  0.0757  379 PHE A O   
1512 C CB  . PHE A  208 ? 0.1755 0.2287 0.2612 0.0337  0.0413  0.0476  379 PHE A CB  
1513 C CG  . PHE A  208 ? 0.1595 0.2232 0.2572 0.0502  0.0213  0.0682  379 PHE A CG  
1514 C CD1 . PHE A  208 ? 0.2028 0.3908 0.2634 0.0920  0.0147  0.1161  379 PHE A CD1 
1515 C CD2 . PHE A  208 ? 0.1963 0.2592 0.2481 0.0272  0.0314  0.0776  379 PHE A CD2 
1516 C CE1 . PHE A  208 ? 0.2253 0.3150 0.2495 0.1125  -0.0184 0.0808  379 PHE A CE1 
1517 C CE2 . PHE A  208 ? 0.1665 0.2560 0.2546 0.0214  0.0161  0.0885  379 PHE A CE2 
1518 C CZ  . PHE A  208 ? 0.2024 0.3702 0.2498 0.0833  0.0175  0.0960  379 PHE A CZ  
1519 N N   . LEU A  209 ? 0.1444 0.2720 0.2171 0.0269  0.0560  0.0806  380 LEU A N   
1520 C CA  . LEU A  209 ? 0.1403 0.2595 0.2914 0.0330  0.0122  0.0753  380 LEU A CA  
1521 C C   . LEU A  209 ? 0.1790 0.2723 0.2587 -0.0079 0.0595  0.0010  380 LEU A C   
1522 O O   . LEU A  209 ? 0.1956 0.2495 0.3905 0.0314  0.1140  0.0243  380 LEU A O   
1523 C CB  . LEU A  209 ? 0.1665 0.2161 0.2711 0.0060  -0.0035 0.0472  380 LEU A CB  
1524 C CG  . LEU A  209 ? 0.1848 0.2447 0.2582 -0.0149 -0.0056 0.0461  380 LEU A CG  
1525 C CD1 . LEU A  209 ? 0.2138 0.2418 0.3121 -0.0178 -0.0157 0.0735  380 LEU A CD1 
1526 C CD2 . LEU A  209 ? 0.2626 0.2498 0.2582 -0.0204 -0.0183 0.0387  380 LEU A CD2 
1527 N N   . ASP A  210 ? 0.1658 0.2745 0.3318 -0.0272 0.0865  0.0091  381 ASP A N   
1528 C CA  . ASP A  210 ? 0.2170 0.3165 0.3239 -0.0945 0.0561  -0.0093 381 ASP A CA  
1529 C C   . ASP A  210 ? 0.2714 0.2753 0.4500 0.0743  0.1314  0.0878  381 ASP A C   
1530 O O   . ASP A  210 ? 0.2455 0.3077 0.4365 0.0211  0.1152  0.0442  381 ASP A O   
1531 C CB  . ASP A  210 ? 0.3125 0.3007 0.4245 -0.0010 0.0893  -0.0775 381 ASP A CB  
1532 C CG  . ASP A  210 ? 0.3292 0.1887 0.5723 0.0186  -0.0806 -0.0474 381 ASP A CG  
1533 O OD1 . ASP A  210 ? 0.3340 0.2654 0.4004 0.0526  -0.0690 -0.0224 381 ASP A OD1 
1534 O OD2 . ASP A  210 ? 0.3687 0.4423 0.4454 0.0458  -0.2052 -0.1816 381 ASP A OD2 
1535 N N   . ASP A  211 ? 0.1875 0.3592 0.5244 -0.0138 0.0918  0.1855  382 ASP A N   
1536 C CA  . ASP A  211 ? 0.2930 0.3398 0.4550 0.0116  0.1723  0.1281  382 ASP A CA  
1537 C C   . ASP A  211 ? 0.2843 0.3875 0.4003 0.0928  0.1527  0.0301  382 ASP A C   
1538 O O   . ASP A  211 ? 0.2820 0.5920 0.6960 0.0830  0.2336  0.3297  382 ASP A O   
1539 C CB  . ASP A  211 ? 0.3486 0.3303 0.6804 0.0152  0.0628  0.0915  382 ASP A CB  
1540 C CG  A ASP A  211 ? 0.5360 0.2546 0.4411 0.0473  0.0566  0.1665  382 ASP A CG  
1541 O OD1 A ASP A  211 ? 0.6442 0.2770 1.1068 -0.0264 -0.6808 -0.0061 382 ASP A OD1 
1542 O OD2 A ASP A  211 ? 0.2998 0.5817 0.2669 -0.1001 -0.0504 -0.0111 382 ASP A OD2 
1543 N N   . LYS A  212 ? 0.3359 0.3977 0.5902 0.0802  0.1131  0.1143  383 LYS A N   
1544 C CA  . LYS A  212 ? 0.2940 0.4142 0.3840 0.1613  0.1383  0.1809  383 LYS A CA  
1545 C C   . LYS A  212 ? 0.2647 0.5645 0.4305 0.1511  0.0701  0.1261  383 LYS A C   
1546 O O   . LYS A  212 ? 0.6662 0.7075 0.4276 0.1491  0.1077  0.1207  383 LYS A O   
1547 C CB  . LYS A  212 ? 0.3088 0.6884 0.4064 0.1376  0.1751  0.1544  383 LYS A CB  
1548 C CG  . LYS A  212 ? 0.2352 0.4907 0.5356 0.0363  0.0758  0.0370  383 LYS A CG  
1549 C CD  . LYS A  212 ? 0.2887 0.4330 0.3649 0.1197  0.0967  0.0282  383 LYS A CD  
1550 C CE  . LYS A  212 ? 0.2950 0.4809 0.3620 0.0481  -0.0007 0.0523  383 LYS A CE  
1551 N NZ  . LYS A  212 ? 0.3121 0.3352 0.3856 0.0263  0.0268  0.0057  383 LYS A NZ  
1552 N N   . ARG A  213 ? 0.2278 0.3788 0.3095 0.0394  0.0758  0.1303  384 ARG A N   
1553 C CA  . ARG A  213 ? 0.2147 0.4434 0.3786 0.0406  0.1065  0.2009  384 ARG A CA  
1554 C C   . ARG A  213 ? 0.2455 0.3608 0.2810 0.0262  0.1352  0.0856  384 ARG A C   
1555 O O   . ARG A  213 ? 0.2421 0.2674 0.2977 0.0545  0.1049  0.1148  384 ARG A O   
1556 C CB  . ARG A  213 ? 0.3127 0.3767 0.7384 -0.0418 0.1266  0.1840  384 ARG A CB  
1557 N N   . CYS A  214 ? 0.2686 0.3338 0.2892 0.0815  0.0963  0.0895  385 CYS A N   
1558 C CA  . CYS A  214 ? 0.2567 0.2795 0.2640 0.0888  0.0827  0.0579  385 CYS A CA  
1559 C C   . CYS A  214 ? 0.2463 0.2396 0.1989 0.0679  0.0912  0.0805  385 CYS A C   
1560 O O   . CYS A  214 ? 0.2754 0.2742 0.3138 0.1054  0.1131  0.1435  385 CYS A O   
1561 C CB  . CYS A  214 ? 0.2649 0.3164 0.2563 0.0846  0.0775  0.0369  385 CYS A CB  
1562 S SG  . CYS A  214 ? 0.3481 0.3783 0.3022 0.1381  0.0771  0.0435  385 CYS A SG  
1563 N N   . GLU A  215 ? 0.1926 0.2211 0.1547 0.0526  0.0384  0.0617  386 GLU A N   
1564 C CA  . GLU A  215 ? 0.1931 0.2028 0.1755 0.0419  0.0236  0.0446  386 GLU A CA  
1565 C C   . GLU A  215 ? 0.1917 0.1982 0.1803 0.0375  0.0332  0.0587  386 GLU A C   
1566 O O   . GLU A  215 ? 0.1776 0.2070 0.1945 0.0455  0.0178  0.0726  386 GLU A O   
1567 C CB  . GLU A  215 ? 0.2178 0.2103 0.2040 0.0278  0.0270  0.0180  386 GLU A CB  
1568 C CG  . GLU A  215 ? 0.2151 0.1950 0.2045 0.0215  0.0107  0.0419  386 GLU A CG  
1569 C CD  . GLU A  215 ? 0.2060 0.1854 0.2055 0.0371  0.0042  0.0527  386 GLU A CD  
1570 O OE1 . GLU A  215 ? 0.1618 0.2386 0.2168 0.0493  0.0193  0.0526  386 GLU A OE1 
1571 O OE2 . GLU A  215 ? 0.1682 0.1956 0.1958 0.0349  -0.0008 0.0363  386 GLU A OE2 
1572 N N   . TRP A  216 ? 0.2091 0.2058 0.1367 0.0423  0.0258  0.0378  387 TRP A N   
1573 C CA  . TRP A  216 ? 0.2167 0.1965 0.1638 0.0377  0.0035  0.0383  387 TRP A CA  
1574 C C   . TRP A  216 ? 0.1719 0.1767 0.1410 0.0398  -0.0120 0.0568  387 TRP A C   
1575 O O   . TRP A  216 ? 0.1909 0.1834 0.1601 0.0521  0.0158  0.0317  387 TRP A O   
1576 C CB  . TRP A  216 ? 0.2299 0.2001 0.1647 0.0632  -0.0092 0.0181  387 TRP A CB  
1577 C CG  . TRP A  216 ? 0.2489 0.2076 0.1753 0.0278  0.0111  0.0068  387 TRP A CG  
1578 C CD1 . TRP A  216 ? 0.2993 0.2321 0.1622 0.0809  0.0157  0.0161  387 TRP A CD1 
1579 C CD2 . TRP A  216 ? 0.1848 0.2018 0.1463 0.0563  -0.0046 -0.0068 387 TRP A CD2 
1580 N NE1 . TRP A  216 ? 0.3047 0.2491 0.1921 0.0665  -0.0197 -0.0067 387 TRP A NE1 
1581 C CE2 . TRP A  216 ? 0.2388 0.2371 0.1738 0.0634  0.0176  -0.0300 387 TRP A CE2 
1582 C CE3 . TRP A  216 ? 0.2308 0.2446 0.1673 0.0526  0.0041  0.0222  387 TRP A CE3 
1583 C CZ2 . TRP A  216 ? 0.2695 0.2547 0.1521 0.0686  -0.0254 -0.0376 387 TRP A CZ2 
1584 C CZ3 . TRP A  216 ? 0.1998 0.2991 0.1981 0.0509  -0.0665 -0.0223 387 TRP A CZ3 
1585 C CH2 . TRP A  216 ? 0.2300 0.2241 0.2215 0.0582  -0.0361 -0.0402 387 TRP A CH2 
1586 N N   . ILE A  217 ? 0.1603 0.1528 0.1425 0.0289  0.0077  0.0386  388 ILE A N   
1587 C CA  . ILE A  217 ? 0.1387 0.1635 0.1403 0.0235  -0.0127 0.0252  388 ILE A CA  
1588 C C   . ILE A  217 ? 0.1451 0.1483 0.1143 0.0183  -0.0167 0.0175  388 ILE A C   
1589 O O   . ILE A  217 ? 0.1466 0.1516 0.1525 0.0200  -0.0183 -0.0050 388 ILE A O   
1590 C CB  . ILE A  217 ? 0.1436 0.1741 0.1585 0.0197  -0.0283 0.0198  388 ILE A CB  
1591 C CG1 . ILE A  217 ? 0.1526 0.2091 0.1450 0.0219  -0.0005 0.0215  388 ILE A CG1 
1592 C CG2 . ILE A  217 ? 0.1414 0.2038 0.1567 -0.0060 -0.0211 0.0176  388 ILE A CG2 
1593 C CD1 . ILE A  217 ? 0.1559 0.2352 0.2263 0.0036  -0.0314 0.0544  388 ILE A CD1 
1594 N N   . TYR A  218 ? 0.1387 0.1495 0.1309 0.0160  -0.0257 0.0057  389 TYR A N   
1595 C CA  . TYR A  218 ? 0.1456 0.1527 0.1090 0.0067  -0.0211 -0.0007 389 TYR A CA  
1596 C C   . TYR A  218 ? 0.1346 0.1596 0.1120 0.0021  -0.0091 0.0063  389 TYR A C   
1597 O O   . TYR A  218 ? 0.1126 0.1575 0.1353 0.0027  -0.0151 -0.0027 389 TYR A O   
1598 C CB  . TYR A  218 ? 0.1423 0.1707 0.1534 0.0175  -0.0192 -0.0004 389 TYR A CB  
1599 C CG  . TYR A  218 ? 0.1164 0.1444 0.1383 0.0116  -0.0336 -0.0048 389 TYR A CG  
1600 C CD1 . TYR A  218 ? 0.1172 0.1591 0.1582 0.0024  -0.0260 -0.0102 389 TYR A CD1 
1601 C CD2 . TYR A  218 ? 0.1234 0.1334 0.1378 -0.0087 -0.0181 -0.0087 389 TYR A CD2 
1602 C CE1 . TYR A  218 ? 0.1188 0.1697 0.1626 0.0061  -0.0228 -0.0069 389 TYR A CE1 
1603 C CE2 . TYR A  218 ? 0.1099 0.1318 0.1410 0.0132  -0.0228 -0.0061 389 TYR A CE2 
1604 C CZ  . TYR A  218 ? 0.1045 0.1403 0.1501 0.0067  -0.0198 0.0108  389 TYR A CZ  
1605 O OH  . TYR A  218 ? 0.1202 0.1773 0.1797 -0.0018 0.0015  0.0112  389 TYR A OH  
1606 N N   . ARG A  219 ? 0.1301 0.1441 0.1304 0.0116  -0.0167 0.0063  390 ARG A N   
1607 C CA  . ARG A  219 ? 0.1382 0.1443 0.1605 0.0194  -0.0031 0.0150  390 ARG A CA  
1608 C C   . ARG A  219 ? 0.1256 0.1556 0.1481 -0.0062 -0.0049 0.0311  390 ARG A C   
1609 O O   . ARG A  219 ? 0.1638 0.1624 0.1469 0.0233  -0.0352 0.0239  390 ARG A O   
1610 C CB  . ARG A  219 ? 0.1689 0.1563 0.1700 0.0172  -0.0349 0.0135  390 ARG A CB  
1611 C CG  . ARG A  219 ? 0.1644 0.1904 0.1741 0.0282  -0.0427 0.0074  390 ARG A CG  
1612 C CD  . ARG A  219 ? 0.2094 0.1913 0.1967 0.0313  -0.0338 -0.0174 390 ARG A CD  
1613 N NE  . ARG A  219 ? 0.2192 0.1770 0.2189 0.0070  -0.0497 0.0020  390 ARG A NE  
1614 C CZ  . ARG A  219 ? 0.2013 0.1456 0.2358 -0.0396 -0.0503 -0.0254 390 ARG A CZ  
1615 N NH1 . ARG A  219 ? 0.2028 0.2191 0.2524 0.0421  -0.0506 -0.0094 390 ARG A NH1 
1616 N NH2 . ARG A  219 ? 0.1937 0.2196 0.2605 -0.0134 -0.0496 -0.0229 390 ARG A NH2 
1617 N N   . GLY A  220 ? 0.1405 0.1706 0.1173 0.0095  -0.0095 0.0159  391 GLY A N   
1618 C CA  . GLY A  220 ? 0.1275 0.1528 0.1183 0.0127  -0.0009 0.0225  391 GLY A CA  
1619 C C   . GLY A  220 ? 0.1333 0.1407 0.1403 0.0237  -0.0047 0.0238  391 GLY A C   
1620 O O   . GLY A  220 ? 0.1771 0.2162 0.1324 -0.0033 -0.0108 -0.0063 391 GLY A O   
1621 N N   . SER A  221 ? 0.1210 0.1550 0.1264 0.0046  -0.0212 0.0167  392 SER A N   
1622 C CA  . SER A  221 ? 0.1395 0.1504 0.1189 -0.0022 -0.0158 0.0160  392 SER A CA  
1623 C C   . SER A  221 ? 0.1568 0.1676 0.1183 -0.0064 -0.0188 0.0163  392 SER A C   
1624 O O   . SER A  221 ? 0.1291 0.1852 0.1423 -0.0051 -0.0093 0.0085  392 SER A O   
1625 C CB  . SER A  221 ? 0.1367 0.1816 0.1344 -0.0251 -0.0201 0.0311  392 SER A CB  
1626 O OG  . SER A  221 ? 0.1110 0.1812 0.1280 -0.0098 -0.0214 0.0273  392 SER A OG  
1627 N N   . THR A  222 ? 0.1265 0.1635 0.1374 0.0140  -0.0301 0.0011  393 THR A N   
1628 C CA  . THR A  222 ? 0.1382 0.1982 0.1501 0.0083  -0.0358 0.0237  393 THR A CA  
1629 C C   . THR A  222 ? 0.1401 0.1946 0.1378 -0.0015 -0.0375 0.0335  393 THR A C   
1630 O O   . THR A  222 ? 0.1641 0.2822 0.1395 0.0126  -0.0575 0.0373  393 THR A O   
1631 C CB  . THR A  222 ? 0.1775 0.2508 0.1591 0.0219  -0.0192 0.0050  393 THR A CB  
1632 O OG1 . THR A  222 ? 0.2010 0.2315 0.1810 0.0011  -0.0319 -0.0237 393 THR A OG1 
1633 C CG2 . THR A  222 ? 0.1836 0.2687 0.1771 0.0145  -0.0153 0.0057  393 THR A CG2 
1634 N N   . ARG A  223 ? 0.1298 0.1722 0.1347 -0.0011 -0.0136 0.0217  394 ARG A N   
1635 C CA  . ARG A  223 ? 0.1341 0.1694 0.1303 -0.0243 -0.0137 0.0053  394 ARG A CA  
1636 C C   . ARG A  223 ? 0.1280 0.1654 0.1287 0.0026  -0.0365 0.0235  394 ARG A C   
1637 O O   . ARG A  223 ? 0.1296 0.2020 0.1869 0.0030  -0.0427 0.0168  394 ARG A O   
1638 C CB  . ARG A  223 ? 0.1161 0.1827 0.1331 -0.0024 -0.0079 0.0210  394 ARG A CB  
1639 C CG  . ARG A  223 ? 0.1383 0.1839 0.1554 0.0074  -0.0184 0.0216  394 ARG A CG  
1640 C CD  . ARG A  223 ? 0.1202 0.1647 0.1513 0.0170  -0.0023 0.0193  394 ARG A CD  
1641 N NE  . ARG A  223 ? 0.1111 0.1774 0.1620 0.0124  -0.0053 0.0381  394 ARG A NE  
1642 C CZ  . ARG A  223 ? 0.1551 0.2064 0.1611 0.0225  0.0101  0.0650  394 ARG A CZ  
1643 N NH1 . ARG A  223 ? 0.1575 0.1961 0.1872 0.0239  -0.0214 0.0210  394 ARG A NH1 
1644 N NH2 . ARG A  223 ? 0.1381 0.2434 0.1833 0.0412  -0.0103 0.0881  394 ARG A NH2 
1645 N N   . LEU A  224 ? 0.1145 0.1677 0.1417 0.0127  -0.0252 0.0225  395 LEU A N   
1646 C CA  . LEU A  224 ? 0.1281 0.1614 0.1381 -0.0024 -0.0054 0.0338  395 LEU A CA  
1647 C C   . LEU A  224 ? 0.1344 0.1758 0.1331 0.0195  -0.0073 0.0248  395 LEU A C   
1648 O O   . LEU A  224 ? 0.1350 0.2098 0.1328 0.0096  -0.0100 0.0226  395 LEU A O   
1649 C CB  . LEU A  224 ? 0.1500 0.1639 0.1381 0.0013  -0.0097 0.0228  395 LEU A CB  
1650 C CG  . LEU A  224 ? 0.1503 0.1661 0.1324 0.0096  -0.0067 0.0239  395 LEU A CG  
1651 C CD1 . LEU A  224 ? 0.1653 0.1790 0.1676 0.0110  -0.0304 0.0288  395 LEU A CD1 
1652 C CD2 . LEU A  224 ? 0.1569 0.2317 0.1432 0.0464  -0.0073 0.0393  395 LEU A CD2 
1653 N N   . GLU A  225 ? 0.1354 0.2043 0.1435 0.0153  -0.0239 0.0487  396 GLU A N   
1654 C CA  . GLU A  225 ? 0.1599 0.2037 0.1426 0.0306  -0.0112 0.0428  396 GLU A CA  
1655 C C   . GLU A  225 ? 0.1721 0.1948 0.1631 0.0165  -0.0339 0.0572  396 GLU A C   
1656 O O   . GLU A  225 ? 0.1873 0.2555 0.1555 0.0293  -0.0300 0.0343  396 GLU A O   
1657 C CB  . GLU A  225 ? 0.1512 0.3011 0.1839 0.0411  -0.0371 0.0653  396 GLU A CB  
1658 C CG  . GLU A  225 ? 0.2169 0.3565 0.1936 0.1102  -0.0568 0.0603  396 GLU A CG  
1659 C CD  . GLU A  225 ? 0.3144 0.4180 0.2807 0.0908  -0.0277 0.0899  396 GLU A CD  
1660 O OE1 . GLU A  225 ? 0.3072 0.4743 0.2866 0.0790  -0.0948 0.0699  396 GLU A OE1 
1661 O OE2 . GLU A  225 ? 0.4792 0.4540 0.2659 0.1221  0.0183  0.0700  396 GLU A OE2 
1662 N N   . PRO A  226 ? 0.1608 0.2013 0.1729 0.0093  -0.0331 0.0499  397 PRO A N   
1663 C CA  . PRO A  226 ? 0.1608 0.2351 0.1724 0.0052  -0.0325 0.0588  397 PRO A CA  
1664 C C   . PRO A  226 ? 0.1713 0.2125 0.2345 0.0045  -0.0152 0.0807  397 PRO A C   
1665 O O   . PRO A  226 ? 0.1577 0.3056 0.2374 0.0047  -0.0154 0.0836  397 PRO A O   
1666 C CB  . PRO A  226 ? 0.2089 0.2076 0.2467 -0.0433 -0.0116 0.0485  397 PRO A CB  
1667 C CG  . PRO A  226 ? 0.2635 0.2449 0.2335 -0.0229 0.0000  0.0278  397 PRO A CG  
1668 C CD  . PRO A  226 ? 0.1818 0.2327 0.1924 -0.0053 -0.0632 -0.0007 397 PRO A CD  
1669 N N   . MET A  227 ? 0.1654 0.2261 0.1706 -0.0058 -0.0240 0.0650  398 MET A N   
1670 C CA  A MET A  227 ? 0.1484 0.2586 0.2036 -0.0025 -0.0090 0.0832  398 MET A CA  
1671 C CA  B MET A  227 ? 0.1634 0.2524 0.2008 0.0067  -0.0109 0.0742  398 MET A CA  
1672 C C   . MET A  227 ? 0.1583 0.2553 0.1825 0.0363  -0.0079 0.0778  398 MET A C   
1673 O O   . MET A  227 ? 0.1700 0.3290 0.2066 0.0520  -0.0027 0.0703  398 MET A O   
1674 C CB  A MET A  227 ? 0.2247 0.3060 0.1819 -0.0552 -0.0120 0.0983  398 MET A CB  
1675 C CB  B MET A  227 ? 0.1350 0.2119 0.1856 0.0079  -0.0221 0.0401  398 MET A CB  
1676 C CG  A MET A  227 ? 0.2760 0.3388 0.2171 -0.0923 -0.0068 0.0651  398 MET A CG  
1677 C CG  B MET A  227 ? 0.1583 0.1752 0.1922 0.0195  -0.0186 0.0333  398 MET A CG  
1678 S SD  A MET A  227 ? 0.2314 0.3355 0.1706 -0.0514 -0.0331 0.0491  398 MET A SD  
1679 S SD  B MET A  227 ? 0.1335 0.2279 0.3738 -0.0085 -0.0135 0.0266  398 MET A SD  
1680 C CE  A MET A  227 ? 0.2622 0.2809 0.3604 -0.0660 0.0085  0.0137  398 MET A CE  
1681 C CE  B MET A  227 ? 0.2563 0.2465 0.3031 -0.0095 -0.0301 0.0150  398 MET A CE  
1682 N N   . PHE A  228 ? 0.1641 0.2624 0.1407 0.0083  -0.0235 0.0341  399 PHE A N   
1683 C CA  . PHE A  228 ? 0.2089 0.2553 0.1446 0.0331  -0.0005 0.0221  399 PHE A CA  
1684 C C   . PHE A  228 ? 0.2862 0.2521 0.1838 0.0377  -0.0206 0.0592  399 PHE A C   
1685 O O   . PHE A  228 ? 0.2752 0.3314 0.1983 0.0619  -0.0097 0.0332  399 PHE A O   
1686 C CB  . PHE A  228 ? 0.2060 0.2803 0.1426 -0.0018 -0.0574 0.0205  399 PHE A CB  
1687 C CG  . PHE A  228 ? 0.1921 0.2693 0.1847 0.0208  -0.0571 -0.0093 399 PHE A CG  
1688 C CD1 . PHE A  228 ? 0.2208 0.2724 0.2222 0.0159  -0.0514 -0.0040 399 PHE A CD1 
1689 C CD2 . PHE A  228 ? 0.3063 0.3225 0.2035 0.0521  -0.0916 0.0009  399 PHE A CD2 
1690 C CE1 . PHE A  228 ? 0.2913 0.2927 0.2668 0.0092  -0.0646 -0.0277 399 PHE A CE1 
1691 C CE2 . PHE A  228 ? 0.3395 0.3837 0.1875 0.0172  -0.1065 -0.0125 399 PHE A CE2 
1692 C CZ  . PHE A  228 ? 0.3687 0.3663 0.2150 0.0069  -0.0951 -0.0736 399 PHE A CZ  
1693 N N   . SER A  229 ? 0.2605 0.2443 0.1459 0.0432  -0.0095 0.0519  400 SER A N   
1694 C CA  A SER A  229 ? 0.2731 0.3578 0.1190 0.0588  -0.0025 0.0713  400 SER A CA  
1695 C CA  B SER A  229 ? 0.2683 0.2893 0.1508 0.0481  -0.0085 0.0679  400 SER A CA  
1696 C C   . SER A  229 ? 0.2583 0.3379 0.1990 0.0462  -0.0139 0.0807  400 SER A C   
1697 O O   . SER A  229 ? 0.2894 0.3879 0.2073 0.0476  0.0185  0.0314  400 SER A O   
1698 C CB  A SER A  229 ? 0.3046 0.3587 0.1880 0.0639  0.0533  0.0946  400 SER A CB  
1699 C CB  B SER A  229 ? 0.2763 0.2885 0.2123 0.0458  0.0008  0.0464  400 SER A CB  
1700 O OG  A SER A  229 ? 0.2681 0.4636 0.1953 -0.0025 -0.0272 0.1161  400 SER A OG  
1701 O OG  B SER A  229 ? 0.2878 0.2556 0.2438 0.0313  0.0105  0.0537  400 SER A OG  
1702 N N   . MET A  230 ? 0.2701 0.3567 0.1707 0.0091  -0.0091 0.0958  401 MET A N   
1703 C CA  . MET A  230 ? 0.2716 0.3060 0.2549 0.0373  0.0129  0.0604  401 MET A CA  
1704 C C   . MET A  230 ? 0.2667 0.3081 0.2622 0.0411  0.0364  0.0628  401 MET A C   
1705 O O   . MET A  230 ? 0.2877 0.4023 0.2952 0.0758  0.0597  0.0625  401 MET A O   
1706 C CB  A MET A  230 ? 0.2888 0.3546 0.2278 0.0153  0.0330  0.0189  401 MET A CB  
1707 C CB  B MET A  230 ? 0.2653 0.3289 0.2476 0.0178  0.0276  0.0282  401 MET A CB  
1708 C CG  A MET A  230 ? 0.3359 0.4021 0.4293 -0.0207 0.0697  0.0890  401 MET A CG  
1709 C CG  B MET A  230 ? 0.2770 0.3335 0.3601 0.0148  0.0436  0.0371  401 MET A CG  
1710 S SD  A MET A  230 ? 0.3102 0.6816 0.6371 -0.0741 -0.0240 -0.0169 401 MET A SD  
1711 S SD  B MET A  230 ? 0.2208 0.3957 0.3423 0.0245  -0.0364 0.0159  401 MET A SD  
1712 C CE  A MET A  230 ? 0.6291 0.5846 0.5952 -0.1006 0.1234  0.0988  401 MET A CE  
1713 C CE  B MET A  230 ? 0.2121 0.3934 0.3601 0.0548  -0.0522 0.1590  401 MET A CE  
1714 N N   . LYS A  231 ? 0.2718 0.3312 0.2556 0.0653  0.0338  0.0755  402 LYS A N   
1715 C CA  . LYS A  231 ? 0.3096 0.3268 0.3321 0.0440  0.0590  0.0516  402 LYS A CA  
1716 C C   . LYS A  231 ? 0.3006 0.4020 0.2682 0.0928  0.1087  0.0269  402 LYS A C   
1717 O O   . LYS A  231 ? 0.3870 0.4814 0.2990 0.1611  0.1058  -0.0178 402 LYS A O   
1718 C CB  . LYS A  231 ? 0.3710 0.3782 0.3988 0.0359  0.0181  0.1040  402 LYS A CB  
1719 C CG  . LYS A  231 ? 0.3292 0.4795 0.4319 0.0144  0.0581  -0.0111 402 LYS A CG  
1720 C CD  . LYS A  231 ? 0.3738 0.4287 0.6468 0.0925  0.0779  -0.0033 402 LYS A CD  
1721 N N   . THR A  232 ? 0.3197 0.3119 0.2591 0.0504  0.0037  0.0133  403 THR A N   
1722 C CA  A THR A  232 ? 0.2860 0.2980 0.2606 0.0833  -0.0157 0.0195  403 THR A CA  
1723 C CA  B THR A  232 ? 0.3072 0.3150 0.2689 0.0463  -0.0043 0.0140  403 THR A CA  
1724 C C   . THR A  232 ? 0.4233 0.3105 0.3304 0.0170  0.0541  0.0267  403 THR A C   
1725 O O   . THR A  232 ? 0.6462 0.4630 0.2769 -0.0635 0.0421  0.0635  403 THR A O   
1726 C CB  A THR A  232 ? 0.2813 0.3626 0.3312 0.0074  -0.0458 -0.0164 403 THR A CB  
1727 C CB  B THR A  232 ? 0.2923 0.2960 0.2458 0.0208  -0.0597 -0.0111 403 THR A CB  
1728 O OG1 A THR A  232 ? 0.5407 0.4356 0.2928 0.0030  0.0444  -0.0764 403 THR A OG1 
1729 O OG1 B THR A  232 ? 0.3848 0.2098 0.2550 -0.0071 -0.0170 -0.0592 403 THR A OG1 
1730 C CG2 A THR A  232 ? 0.4214 0.3127 0.2884 -0.0504 -0.0318 -0.0905 403 THR A CG2 
1731 C CG2 B THR A  232 ? 0.3351 0.2616 0.2260 0.0450  -0.0509 -0.0473 403 THR A CG2 
1732 N N   . SER A  233 ? 0.2976 0.3184 0.2124 0.0463  0.0485  0.0273  404 SER A N   
1733 C CA  . SER A  233 ? 0.3552 0.3869 0.2549 -0.0040 0.0220  0.0719  404 SER A CA  
1734 C C   A SER A  233 ? 0.3763 0.4096 0.2698 0.0074  0.0188  -0.0152 404 SER A C   
1735 C C   B SER A  233 ? 0.3833 0.4694 0.3921 0.0255  0.0501  -0.0128 404 SER A C   
1736 O O   A SER A  233 ? 0.3224 0.5339 0.2759 0.1038  0.1278  0.0691  404 SER A O   
1737 O O   B SER A  233 ? 0.6609 0.5930 0.4456 0.0016  0.1652  -0.0290 404 SER A O   
1738 C CB  . SER A  233 ? 0.2922 0.4117 0.3796 0.0324  0.0031  0.0890  404 SER A CB  
1739 O OG  . SER A  233 ? 0.2766 0.3693 0.5483 -0.0004 -0.0196 0.1136  404 SER A OG  
1740 N N   A SER A  234 ? 0.4497 0.3203 0.2535 -0.0536 -0.0428 0.0210  405 SER A N   
1741 N N   B SER A  234 ? 0.3392 0.5141 0.4357 0.0365  0.0388  0.0145  405 SER A N   
1742 C CA  B SER A  234 ? 0.3335 0.4315 0.3993 0.0310  -0.0132 -0.0529 405 SER A CA  
1743 C C   B SER A  234 ? 0.2341 0.4542 0.3931 0.0501  0.0883  -0.0531 405 SER A C   
1744 O O   B SER A  234 ? 0.3712 0.5838 0.4887 0.1669  0.1900  -0.0584 405 SER A O   
1745 C CB  B SER A  234 ? 0.2261 0.3973 0.4082 -0.0151 -0.0294 -0.0571 405 SER A CB  
1746 N N   B ALA A  235 ? 0.3393 0.3490 0.4050 0.1141  0.1306  0.0058  406 ALA A N   
1747 C CA  B ALA A  235 ? 0.3759 0.4241 0.4208 0.2750  -0.0108 -0.0592 406 ALA A CA  
1748 N N   A SER B  8   ? 0.2250 0.3326 0.3393 0.0103  0.0604  0.0472  10  SER B N   
1749 N N   B SER B  8   ? 0.2650 0.4187 0.3482 -0.0624 0.0424  -0.0300 10  SER B N   
1750 C CA  A SER B  8   ? 0.3442 0.3483 0.4204 -0.0172 0.0943  0.0602  10  SER B CA  
1751 C CA  B SER B  8   ? 0.3517 0.3843 0.3705 -0.0462 0.0593  0.0190  10  SER B CA  
1752 C C   A SER B  8   ? 0.3096 0.3503 0.3454 0.0372  0.0817  0.0625  10  SER B C   
1753 C C   B SER B  8   ? 0.2733 0.3460 0.4376 0.0155  0.0669  0.0783  10  SER B C   
1754 O O   A SER B  8   ? 0.1348 0.3152 0.3156 0.0366  0.1024  0.0258  10  SER B O   
1755 O O   B SER B  8   ? 0.2561 0.3309 0.4508 -0.0688 0.0321  0.0948  10  SER B O   
1756 C CB  A SER B  8   ? 0.3483 0.3099 0.3837 -0.0654 0.2001  -0.0051 10  SER B CB  
1757 C CB  B SER B  8   ? 0.4288 0.3691 0.4000 -0.0857 0.0461  -0.0300 10  SER B CB  
1758 N N   . THR B  9   ? 0.3036 0.3109 0.3445 0.0268  0.1181  0.1340  11  THR B N   
1759 C CA  . THR B  9   ? 0.2076 0.2531 0.2977 0.0026  0.0650  0.0521  11  THR B CA  
1760 C C   . THR B  9   ? 0.1381 0.2066 0.3119 0.0191  0.0484  0.0655  11  THR B C   
1761 O O   . THR B  9   ? 0.1973 0.2496 0.3384 -0.0222 0.0229  0.0540  11  THR B O   
1762 C CB  . THR B  9   ? 0.2518 0.2495 0.2575 0.0104  0.0214  0.1059  11  THR B CB  
1763 O OG1 . THR B  9   ? 0.1803 0.2180 0.2156 0.0218  0.0066  0.0518  11  THR B OG1 
1764 C CG2 . THR B  9   ? 0.2972 0.2565 0.3018 0.0547  0.0732  0.1007  11  THR B CG2 
1765 N N   . GLY B  10  ? 0.1469 0.2043 0.2762 -0.0062 0.0404  0.0510  12  GLY B N   
1766 C CA  . GLY B  10  ? 0.1502 0.2025 0.2734 0.0149  -0.0231 0.0531  12  GLY B CA  
1767 C C   . GLY B  10  ? 0.1640 0.2110 0.2060 0.0073  -0.0318 0.0169  12  GLY B C   
1768 O O   . GLY B  10  ? 0.1905 0.2102 0.2031 -0.0333 -0.0617 0.0265  12  GLY B O   
1769 N N   . GLY B  11  ? 0.1498 0.1741 0.2120 -0.0173 -0.0312 0.0450  13  GLY B N   
1770 C CA  . GLY B  11  ? 0.1744 0.1896 0.1909 0.0117  -0.0263 0.0239  13  GLY B CA  
1771 C C   . GLY B  11  ? 0.1220 0.1819 0.1609 0.0127  -0.0142 -0.0034 13  GLY B C   
1772 O O   . GLY B  11  ? 0.1174 0.1907 0.1934 0.0144  -0.0198 0.0072  13  GLY B O   
1773 O OH  . ALY B  12  ? 0.1510 0.1607 0.2143 -0.0100 0.0102  0.0101  14  ALY B OH  
1774 C CH  . ALY B  12  ? 0.1455 0.1603 0.1308 -0.0042 -0.0077 -0.0098 14  ALY B CH  
1775 C CH3 . ALY B  12  ? 0.1385 0.1688 0.1742 0.0279  0.0082  -0.0069 14  ALY B CH3 
1776 N NZ  . ALY B  12  ? 0.1509 0.1793 0.1841 0.0114  -0.0115 -0.0021 14  ALY B NZ  
1777 C CE  . ALY B  12  ? 0.1759 0.1748 0.2059 0.0037  0.0203  -0.0068 14  ALY B CE  
1778 C CD  . ALY B  12  ? 0.1454 0.2065 0.1913 -0.0257 0.0020  -0.0118 14  ALY B CD  
1779 C CG  . ALY B  12  ? 0.1577 0.2009 0.1666 0.0108  -0.0015 -0.0079 14  ALY B CG  
1780 C CB  . ALY B  12  ? 0.1292 0.1823 0.1617 0.0151  -0.0100 0.0018  14  ALY B CB  
1781 C CA  . ALY B  12  ? 0.1291 0.1705 0.1879 0.0105  -0.0119 0.0037  14  ALY B CA  
1782 N N   . ALY B  12  ? 0.1421 0.1748 0.1427 0.0169  -0.0095 0.0001  14  ALY B N   
1783 C C   . ALY B  12  ? 0.1265 0.1696 0.1769 -0.0019 -0.0064 -0.0051 14  ALY B C   
1784 O O   . ALY B  12  ? 0.1587 0.1721 0.2133 -0.0137 -0.0187 0.0049  14  ALY B O   
1785 N N   . ALA B  13  ? 0.1760 0.1716 0.1994 -0.0296 -0.0394 0.0208  15  ALA B N   
1786 C CA  . ALA B  13  ? 0.2121 0.2334 0.2045 -0.0047 -0.0470 0.0193  15  ALA B CA  
1787 C C   . ALA B  13  ? 0.1882 0.2235 0.2297 0.0247  -0.0260 0.0213  15  ALA B C   
1788 O O   . ALA B  13  ? 0.2078 0.2932 0.2128 -0.0478 -0.0633 0.0307  15  ALA B O   
1789 C CB  . ALA B  13  ? 0.2498 0.3252 0.1965 0.0144  -0.0612 -0.0358 15  ALA B CB  
1790 N N   . PRO B  14  ? 0.1741 0.2057 0.2271 -0.0043 -0.0468 0.0100  16  PRO B N   
1791 C CA  . PRO B  14  ? 0.1917 0.2376 0.2346 -0.0177 -0.0705 0.0119  16  PRO B CA  
1792 C C   . PRO B  14  ? 0.2391 0.2246 0.2440 0.0026  -0.0752 0.0193  16  PRO B C   
1793 O O   . PRO B  14  ? 0.2494 0.2622 0.3378 0.0293  -0.0847 -0.0673 16  PRO B O   
1794 C CB  . PRO B  14  ? 0.2117 0.2562 0.2169 0.0162  -0.0616 0.0092  16  PRO B CB  
1795 C CG  . PRO B  14  ? 0.2709 0.2254 0.2235 0.0009  -0.0958 0.0161  16  PRO B CG  
1796 C CD  . PRO B  14  ? 0.2353 0.2427 0.2101 -0.0195 -0.0591 0.0235  16  PRO B CD  
1797 N N   . ARG B  15  ? 0.2593 0.2430 0.3118 -0.0118 -0.0615 0.0207  17  ARG B N   
1798 C CA  . ARG B  15  ? 0.2771 0.2143 0.4113 -0.0261 -0.0310 0.0358  17  ARG B CA  
1799 C C   . ARG B  15  ? 0.3760 0.2900 0.4646 -0.0209 -0.1485 -0.0579 17  ARG B C   
1800 O O   . ARG B  15  ? 0.4412 0.3335 0.4941 0.0182  -0.2229 -0.0614 17  ARG B O   
1801 C CB  . ARG B  15  ? 0.2678 0.3027 0.6573 -0.1145 0.0025  0.0591  17  ARG B CB  
1802 N N   . LYS B  16  ? 0.5230 0.2921 0.6466 0.0195  -0.1083 -0.0743 18  LYS B N   
1803 C CA  . LYS B  16  ? 0.5798 0.4962 0.6581 0.1172  -0.0936 -0.0934 18  LYS B CA  
1804 C C   . LYS B  16  ? 0.5059 0.4035 0.9832 -0.1381 -0.0799 -0.2413 18  LYS B C   
1805 O O   . LYS B  16  ? 0.6119 0.5543 0.9682 -0.2612 -0.2384 -0.0266 18  LYS B O   
1806 C CB  . LYS B  16  ? 0.8934 0.4440 0.8506 0.1587  -0.0440 -0.2038 18  LYS B CB  
1807 X UNK . UNX C  .   ? 0.4198 1.1178 0.3440 0.0733  -0.0617 0.3865  501 UNX A UNK 
1808 X UNK . UNX D  .   ? 0.7167 0.3096 0.6903 0.1702  0.2675  0.0998  502 UNX A UNK 
1809 X UNK . UNX E  .   ? 0.2475 0.2755 0.6889 -0.0698 -0.1223 0.1930  503 UNX A UNK 
1810 X UNK . UNX F  .   ? 0.4361 0.3748 0.8897 -0.0622 0.3625  -0.1178 504 UNX A UNK 
1811 X UNK . UNX G  .   ? 0.2953 0.2218 0.3205 0.0179  0.1501  0.0465  505 UNX A UNK 
1812 X UNK . UNX H  .   ? 0.5265 0.2506 0.6494 0.2089  0.4104  0.1173  506 UNX A UNK 
1813 X UNK . UNX I  .   ? 1.2347 0.7743 1.3894 -0.6686 1.2150  -0.8821 507 UNX A UNK 
1814 X UNK . UNX J  .   ? 0.4159 0.3426 0.2955 0.1006  -0.0073 0.0311  508 UNX A UNK 
1815 X UNK . UNX K  .   ? 0.3566 0.5406 0.4038 0.0068  -0.0179 0.2108  509 UNX A UNK 
1816 X UNK . UNX L  .   ? 0.3437 0.2673 0.2070 0.0518  0.0413  -0.0337 510 UNX A UNK 
1817 X UNK . UNX M  .   ? 0.1492 0.6065 0.8560 0.0522  0.0238  -0.1440 511 UNX A UNK 
1818 X UNK . UNX N  .   ? 0.3227 0.4907 0.3873 -0.1255 -0.0410 0.1683  512 UNX A UNK 
1819 X UNK . UNX O  .   ? 0.2258 0.1910 0.7477 0.0180  0.1390  -0.0470 513 UNX A UNK 
1820 X UNK . UNX P  .   ? 0.0458 0.2195 0.4471 -0.0364 -0.0111 0.0695  514 UNX A UNK 
1821 X UNK . UNX Q  .   ? 0.2863 0.1969 0.1654 0.0507  -0.1441 -0.0107 515 UNX A UNK 
1822 X UNK . UNX R  .   ? 0.6341 0.3284 0.3678 -0.1097 -0.2258 0.1166  516 UNX A UNK 
1823 X UNK . UNX S  .   ? 0.7753 0.3011 0.5529 0.1623  -0.1959 -0.0114 517 UNX A UNK 
1824 X UNK . UNX T  .   ? 0.4268 0.3608 0.3372 0.1888  0.0881  0.2665  518 UNX A UNK 
1825 X UNK . UNX U  .   ? 0.2958 0.4724 0.2080 -0.0949 0.0395  -0.1287 519 UNX A UNK 
1826 X UNK . UNX V  .   ? 0.4330 0.3649 0.3638 -0.1245 0.0695  -0.1956 520 UNX A UNK 
1827 X UNK . UNX W  .   ? 0.3397 0.8503 0.4489 0.3476  0.1041  0.1043  521 UNX A UNK 
1828 X UNK . UNX X  .   ? 0.4674 0.3245 0.2267 0.1680  -0.0094 -0.0401 522 UNX A UNK 
1829 X UNK . UNX Y  .   ? 0.2699 0.3118 0.2002 0.0931  0.0192  0.1105  523 UNX A UNK 
1830 X UNK . UNX Z  .   ? 0.5132 0.4637 0.4766 0.1167  0.2021  0.1317  524 UNX A UNK 
1831 X UNK . UNX AA .   ? 0.2952 0.9243 0.2631 0.1842  -0.0755 -0.1162 525 UNX A UNK 
1832 X UNK . UNX BA .   ? 0.7972 0.4172 0.3706 -0.2122 0.2511  -0.1279 526 UNX A UNK 
1833 X UNK . UNX CA .   ? 0.1541 0.1679 0.4980 -0.0046 0.1206  -0.0451 527 UNX A UNK 
1834 X UNK . UNX DA .   ? 0.7768 0.3958 0.6939 -0.1229 -0.4510 -0.0676 528 UNX A UNK 
1835 X UNK . UNX EA .   ? 0.3198 0.3978 0.2339 0.0101  -0.0706 0.0600  529 UNX A UNK 
1836 X UNK . UNX FA .   ? 0.9876 0.7535 0.2336 -0.3182 -0.0717 0.0396  530 UNX A UNK 
1837 X UNK . UNX GA .   ? 0.5611 0.4452 0.2959 0.0640  0.0410  0.0890  531 UNX A UNK 
1838 X UNK . UNX HA .   ? 0.5283 0.3950 0.1817 0.3096  -0.0389 -0.0244 532 UNX A UNK 
1839 X UNK . UNX IA .   ? 0.6904 0.3395 0.3559 0.1656  -0.3464 -0.1400 533 UNX A UNK 
1840 X UNK . UNX JA .   ? 0.6952 0.6567 0.4388 0.3612  0.0159  0.1951  534 UNX A UNK 
1841 X UNK . UNX KA .   ? 0.2635 0.3234 0.8176 0.0132  0.0285  -0.0995 535 UNX A UNK 
1842 X UNK . UNX LA .   ? 0.8220 0.4735 0.2793 -0.2612 -0.1520 -0.0553 536 UNX A UNK 
1843 X UNK . UNX MA .   ? 0.2482 0.2516 0.5897 -0.0154 -0.0822 -0.1282 537 UNX A UNK 
1844 X UNK . UNX NA .   ? 0.3613 0.3634 0.4960 0.0186  -0.0506 0.0614  538 UNX A UNK 
1845 X UNK . UNX OA .   ? 0.4911 0.4915 0.8685 -0.1043 0.3346  -0.0598 539 UNX A UNK 
1846 X UNK . UNX PA .   ? 0.3073 0.5687 0.7604 0.1898  0.0922  0.1777  540 UNX A UNK 
1847 O O   . HOH QA .   ? 0.6034 0.6031 0.5709 -0.2700 -0.1391 -0.0283 601 HOH A O   
1848 O O   . HOH QA .   ? 0.6804 0.4535 0.4236 0.0828  -0.0017 0.0115  602 HOH A O   
1849 O O   . HOH QA .   ? 0.4655 0.8380 0.4585 -0.2018 -0.1624 0.3662  603 HOH A O   
1850 O O   . HOH QA .   ? 0.3829 0.4475 0.4039 0.0699  -0.0744 -0.0691 604 HOH A O   
1851 O O   . HOH QA .   ? 0.3999 0.4615 1.0077 -0.1124 -0.1185 0.3478  605 HOH A O   
1852 O O   . HOH QA .   ? 0.7302 0.3771 0.6329 -0.0061 -0.1092 0.0269  606 HOH A O   
1853 O O   . HOH QA .   ? 0.2311 0.2559 0.2074 0.0074  0.0176  0.0159  607 HOH A O   
1854 O O   . HOH QA .   ? 0.2086 0.2681 0.2663 -0.0227 -0.0502 0.0219  608 HOH A O   
1855 O O   . HOH QA .   ? 0.3737 0.4906 0.3844 -0.1331 -0.0411 0.0257  609 HOH A O   
1856 O O   . HOH QA .   ? 0.7250 0.4753 0.2724 0.2426  0.1517  0.0623  610 HOH A O   
1857 O O   . HOH QA .   ? 0.4195 0.2617 0.2160 -0.0321 -0.0088 -0.0191 611 HOH A O   
1858 O O   . HOH QA .   ? 0.3586 0.8051 0.4170 0.1567  0.0466  -0.0567 612 HOH A O   
1859 O O   . HOH QA .   ? 0.5572 0.4994 0.6606 0.0386  -0.2615 -0.1548 613 HOH A O   
1860 O O   . HOH QA .   ? 0.2065 0.2295 0.1959 0.0465  -0.0048 0.0617  614 HOH A O   
1861 O O   . HOH QA .   ? 0.4937 0.4001 0.5174 0.0698  0.0420  0.0207  615 HOH A O   
1862 O O   . HOH QA .   ? 0.3250 0.4130 0.7120 0.0069  -0.0602 -0.0248 616 HOH A O   
1863 O O   . HOH QA .   ? 0.5302 0.4598 0.4701 0.2425  -0.1193 0.0896  617 HOH A O   
1864 O O   . HOH QA .   ? 0.3444 0.2976 0.2632 0.0363  -0.0366 -0.0108 618 HOH A O   
1865 O O   . HOH QA .   ? 0.1828 0.3144 0.1879 -0.0474 -0.0070 -0.0104 619 HOH A O   
1866 O O   . HOH QA .   ? 0.5305 0.4784 0.4375 0.2408  0.1179  0.1088  620 HOH A O   
1867 O O   . HOH QA .   ? 0.4628 0.6438 0.3627 -0.0814 0.0396  0.0183  621 HOH A O   
1868 O O   . HOH QA .   ? 0.3215 0.2750 0.4374 0.0065  0.1158  -0.0262 622 HOH A O   
1869 O O   . HOH QA .   ? 0.5093 0.8450 0.2761 -0.2166 0.0427  0.0986  623 HOH A O   
1870 O O   . HOH QA .   ? 0.6848 0.5223 0.4228 -0.0686 -0.0416 0.0598  624 HOH A O   
1871 O O   . HOH QA .   ? 0.5695 0.5152 0.4579 -0.2176 -0.0161 0.0171  625 HOH A O   
1872 O O   . HOH QA .   ? 0.5018 0.3290 0.4531 -0.0884 -0.1254 -0.0385 626 HOH A O   
1873 O O   . HOH QA .   ? 0.2133 0.1917 0.1579 0.0217  -0.0439 0.0243  627 HOH A O   
1874 O O   . HOH QA .   ? 0.3173 0.2793 0.3599 -0.1385 -0.1909 0.1485  628 HOH A O   
1875 O O   . HOH QA .   ? 0.4606 0.5452 0.6012 -0.1089 -0.0614 0.0461  629 HOH A O   
1876 O O   . HOH QA .   ? 0.3927 0.3088 0.2198 0.1391  -0.0312 0.0135  630 HOH A O   
1877 O O   . HOH QA .   ? 0.4132 0.3359 0.4171 0.0932  0.0321  -0.0230 631 HOH A O   
1878 O O   . HOH QA .   ? 0.1769 0.2261 0.2218 0.0173  -0.0048 -0.0690 632 HOH A O   
1879 O O   . HOH QA .   ? 0.4371 0.5475 0.4723 -0.0540 -0.0142 -0.0804 633 HOH A O   
1880 O O   . HOH QA .   ? 0.2931 0.3103 0.6629 0.0053  -0.1129 0.0628  634 HOH A O   
1881 O O   . HOH QA .   ? 0.2552 0.2129 0.3497 0.0087  -0.0776 0.0387  635 HOH A O   
1882 O O   . HOH QA .   ? 0.4416 0.5333 0.5003 0.0650  -0.2171 -0.0582 636 HOH A O   
1883 O O   . HOH QA .   ? 0.3996 0.4184 0.3404 -0.1073 0.0390  -0.0747 637 HOH A O   
1884 O O   . HOH QA .   ? 0.3055 0.4586 0.6398 0.1158  -0.0446 0.0790  638 HOH A O   
1885 O O   . HOH QA .   ? 0.6230 0.5088 0.6057 -0.0577 0.0764  0.1124  639 HOH A O   
1886 O O   . HOH QA .   ? 0.1477 0.2979 0.3786 -0.0200 0.0205  0.0351  640 HOH A O   
1887 O O   . HOH QA .   ? 0.3375 0.5301 0.3742 -0.0138 -0.0362 -0.1287 641 HOH A O   
1888 O O   . HOH QA .   ? 0.5367 0.5887 0.6569 0.1682  0.2563  0.0360  642 HOH A O   
1889 O O   . HOH QA .   ? 0.2251 0.2450 0.1909 0.0385  -0.0074 0.0823  643 HOH A O   
1890 O O   . HOH QA .   ? 0.2388 0.4107 0.3496 0.0705  -0.0218 0.0677  644 HOH A O   
1891 O O   . HOH QA .   ? 0.2111 0.2065 0.2531 -0.0162 0.0074  -0.0489 645 HOH A O   
1892 O O   . HOH QA .   ? 0.3329 0.2799 0.1861 0.0591  0.0510  0.0506  646 HOH A O   
1893 O O   . HOH QA .   ? 0.6855 0.4375 0.2823 -0.0970 0.1317  -0.0481 647 HOH A O   
1894 O O   . HOH QA .   ? 0.1877 0.6394 0.4241 0.0119  -0.0300 -0.0123 648 HOH A O   
1895 O O   . HOH QA .   ? 0.4395 0.4114 0.1968 0.1389  -0.0280 0.0145  649 HOH A O   
1896 O O   . HOH QA .   ? 0.3677 0.4024 0.5271 -0.0658 0.0159  0.0595  650 HOH A O   
1897 O O   . HOH QA .   ? 0.3369 0.2614 0.3241 0.0596  -0.0407 0.0804  651 HOH A O   
1898 O O   . HOH QA .   ? 0.2082 0.4203 0.2951 0.0412  -0.0240 0.0118  652 HOH A O   
1899 O O   . HOH QA .   ? 0.6969 0.3760 0.5455 -0.0622 -0.1938 -0.1613 653 HOH A O   
1900 O O   . HOH QA .   ? 0.5417 0.3815 0.2873 0.0157  -0.1100 0.0197  654 HOH A O   
1901 O O   . HOH QA .   ? 0.5069 0.3286 0.3278 -0.0120 -0.0717 -0.0078 655 HOH A O   
1902 O O   . HOH QA .   ? 0.8638 0.6064 0.4638 0.2382  -0.0023 0.1045  656 HOH A O   
1903 O O   . HOH QA .   ? 0.3334 0.3111 0.2981 -0.0380 -0.1004 0.0692  657 HOH A O   
1904 O O   . HOH QA .   ? 0.3642 0.2186 0.2307 0.0925  -0.0681 0.0426  658 HOH A O   
1905 O O   . HOH QA .   ? 0.4149 0.3904 0.5404 0.0285  -0.1238 -0.1176 659 HOH A O   
1906 O O   . HOH QA .   ? 0.3184 0.2525 0.4198 0.0217  -0.1148 0.0276  660 HOH A O   
1907 O O   . HOH QA .   ? 0.4641 0.4573 0.3918 0.2329  -0.1714 -0.1185 661 HOH A O   
1908 O O   . HOH QA .   ? 0.2898 0.5453 0.2981 0.0906  -0.0090 0.0946  662 HOH A O   
1909 O O   . HOH QA .   ? 0.4974 0.6777 0.3097 0.0303  -0.0596 0.0910  663 HOH A O   
1910 O O   . HOH QA .   ? 0.4347 0.5532 0.5214 -0.0652 0.1721  -0.1448 664 HOH A O   
1911 O O   . HOH QA .   ? 0.4850 0.3910 0.1960 -0.1294 0.0111  -0.0578 665 HOH A O   
1912 O O   . HOH QA .   ? 0.2905 0.4080 0.6056 -0.0376 0.0086  0.0263  666 HOH A O   
1913 O O   . HOH QA .   ? 0.5676 0.7467 0.4874 -0.0518 0.0169  0.2353  667 HOH A O   
1914 O O   . HOH QA .   ? 0.2290 0.2466 0.2796 0.0465  0.0492  0.0556  668 HOH A O   
1915 O O   . HOH QA .   ? 0.3684 0.4523 0.4565 0.1264  0.1847  0.1587  669 HOH A O   
1916 O O   . HOH QA .   ? 0.1982 0.1802 0.2056 -0.0086 0.0042  -0.0498 670 HOH A O   
1917 O O   . HOH QA .   ? 0.2745 0.2491 0.3569 0.0017  -0.1545 -0.0033 671 HOH A O   
1918 O O   . HOH QA .   ? 0.4074 0.7105 0.4263 0.0063  0.0416  0.0063  672 HOH A O   
1919 O O   . HOH QA .   ? 0.5360 0.2630 0.3208 0.1497  0.0476  0.0799  673 HOH A O   
1920 O O   . HOH QA .   ? 0.4467 0.3824 0.1693 0.0399  -0.0255 0.0249  674 HOH A O   
1921 O O   . HOH QA .   ? 0.2230 0.2117 0.2291 0.0312  -0.0361 0.0095  675 HOH A O   
1922 O O   . HOH QA .   ? 0.1544 0.2716 0.3043 -0.0663 -0.0015 -0.0454 676 HOH A O   
1923 O O   . HOH QA .   ? 0.4945 0.3194 0.4019 -0.0679 0.1596  -0.0888 677 HOH A O   
1924 O O   . HOH QA .   ? 0.2378 0.1839 0.3024 0.0200  -0.0905 -0.0256 678 HOH A O   
1925 O O   . HOH QA .   ? 0.3126 0.3252 0.2224 -0.0335 -0.0731 -0.0274 679 HOH A O   
1926 O O   . HOH QA .   ? 0.3443 0.4256 0.6397 -0.0809 0.0050  -0.0467 680 HOH A O   
1927 O O   . HOH QA .   ? 0.6092 0.4022 0.4948 0.1856  0.0674  -0.0607 681 HOH A O   
1928 O O   . HOH QA .   ? 0.4162 0.4575 0.4614 -0.0514 -0.1605 0.0522  682 HOH A O   
1929 O O   . HOH QA .   ? 0.5174 0.5380 0.4883 0.0702  0.0327  0.1033  683 HOH A O   
1930 O O   . HOH QA .   ? 0.2997 0.3091 0.3500 0.0453  0.0853  0.0451  684 HOH A O   
1931 O O   . HOH QA .   ? 0.2655 0.2120 0.1885 0.0538  -0.0639 0.0531  685 HOH A O   
1932 O O   . HOH QA .   ? 0.4069 0.3760 0.4871 0.1170  -0.1707 -0.0392 686 HOH A O   
1933 O O   . HOH QA .   ? 0.5097 0.3519 0.5485 -0.1379 0.2341  -0.0451 687 HOH A O   
1934 O O   . HOH QA .   ? 0.4633 0.5591 0.6324 -0.0641 -0.0228 0.0218  688 HOH A O   
1935 O O   . HOH QA .   ? 0.2001 0.2005 0.1789 0.0310  -0.0433 -0.0385 689 HOH A O   
1936 O O   . HOH QA .   ? 0.3754 0.2171 0.3243 0.0398  -0.1148 -0.0087 690 HOH A O   
1937 O O   . HOH QA .   ? 0.5717 0.3730 0.5615 0.0907  0.1829  0.1681  691 HOH A O   
1938 O O   . HOH QA .   ? 0.2388 0.2523 0.2334 0.0357  -0.0535 0.0030  692 HOH A O   
1939 O O   . HOH QA .   ? 0.3669 0.4523 0.3137 0.1000  -0.0977 -0.0186 693 HOH A O   
1940 O O   . HOH QA .   ? 0.3741 0.8328 0.2646 0.1826  -0.0512 -0.1423 694 HOH A O   
1941 O O   . HOH QA .   ? 0.4963 0.3915 0.2478 -0.0600 -0.0118 0.0062  695 HOH A O   
1942 O O   . HOH QA .   ? 0.8292 0.3174 0.4388 0.0616  -0.0034 -0.0287 696 HOH A O   
1943 O O   . HOH QA .   ? 0.2499 0.2164 0.1706 -0.0065 -0.0415 0.0276  697 HOH A O   
1944 O O   . HOH QA .   ? 0.4021 0.2823 0.4835 -0.0072 -0.0929 -0.0341 698 HOH A O   
1945 O O   . HOH QA .   ? 0.3676 0.2607 0.2565 0.0255  0.0308  -0.0126 699 HOH A O   
1946 O O   . HOH QA .   ? 0.3844 0.7415 0.3914 0.2051  -0.0225 -0.1609 700 HOH A O   
1947 O O   . HOH QA .   ? 0.3899 0.3679 0.5924 -0.1030 0.1354  -0.1162 701 HOH A O   
1948 O O   . HOH QA .   ? 0.2789 0.6332 0.3509 0.0116  -0.0315 -0.1602 702 HOH A O   
1949 O O   . HOH QA .   ? 0.2657 0.5865 0.5937 0.0442  0.0718  -0.0769 703 HOH A O   
1950 O O   . HOH QA .   ? 0.8638 0.5515 0.3170 0.0878  -0.0327 -0.1225 704 HOH A O   
1951 O O   . HOH QA .   ? 0.4648 0.6736 0.5535 0.0355  0.0709  0.0782  705 HOH A O   
1952 O O   . HOH QA .   ? 0.3150 0.2572 0.3040 0.0410  0.0566  0.0910  706 HOH A O   
1953 O O   . HOH QA .   ? 0.7068 0.5263 0.3395 0.3076  0.1305  0.0485  707 HOH A O   
1954 O O   . HOH QA .   ? 0.2205 0.2536 0.1758 -0.0134 -0.0291 0.0423  708 HOH A O   
1955 O O   . HOH QA .   ? 0.2677 0.4447 0.4348 0.0433  -0.1478 -0.1842 709 HOH A O   
1956 O O   . HOH QA .   ? 0.1773 0.2268 0.2915 0.0144  -0.0267 0.0693  710 HOH A O   
1957 O O   . HOH QA .   ? 0.3503 0.2616 0.4857 0.0411  -0.0319 -0.1319 711 HOH A O   
1958 O O   . HOH QA .   ? 0.4527 0.4035 0.3790 -0.0510 0.1278  -0.0122 712 HOH A O   
1959 O O   . HOH QA .   ? 0.5657 0.4416 0.2727 -0.0922 0.0531  -0.1268 713 HOH A O   
1960 O O   . HOH QA .   ? 0.2193 0.1962 0.3984 0.0655  -0.0265 0.0434  714 HOH A O   
1961 O O   . HOH QA .   ? 0.5193 0.2730 0.3112 -0.0154 -0.0213 0.0134  715 HOH A O   
1962 O O   . HOH QA .   ? 0.4853 0.3483 0.2470 -0.1400 -0.0373 0.0127  716 HOH A O   
1963 O O   . HOH QA .   ? 0.8407 0.5654 0.2634 -0.0738 0.1037  0.0410  717 HOH A O   
1964 O O   . HOH QA .   ? 0.2531 0.3086 0.3764 -0.0202 -0.1261 0.0423  718 HOH A O   
1965 O O   . HOH QA .   ? 0.4039 0.4192 0.3465 0.0827  0.0968  -0.0171 719 HOH A O   
1966 O O   . HOH QA .   ? 0.5262 0.2627 0.6758 -0.0412 0.2401  0.0061  720 HOH A O   
1967 O O   . HOH QA .   ? 0.2333 0.2129 0.1924 0.0158  -0.0136 0.0077  721 HOH A O   
1968 O O   . HOH QA .   ? 0.5070 0.8031 0.3976 0.0287  0.1307  -0.2347 722 HOH A O   
1969 O O   . HOH QA .   ? 0.2044 0.2472 0.2037 0.0054  -0.0011 -0.0199 723 HOH A O   
1970 O O   . HOH QA .   ? 0.4461 0.4165 0.8052 0.1734  0.0807  0.1354  724 HOH A O   
1971 O O   . HOH QA .   ? 0.2066 0.2007 0.3044 0.0263  -0.0334 -0.0002 725 HOH A O   
1972 O O   . HOH QA .   ? 0.4534 0.2825 0.7486 0.0041  -0.1041 0.1373  726 HOH A O   
1973 O O   . HOH QA .   ? 0.3736 0.6679 0.4847 0.0238  0.0776  0.1053  727 HOH A O   
1974 O O   . HOH QA .   ? 0.2719 0.2324 0.2628 0.0638  -0.0062 -0.0154 728 HOH A O   
1975 O O   . HOH QA .   ? 0.2069 0.2504 0.3746 -0.0074 0.0040  -0.0043 729 HOH A O   
1976 O O   . HOH QA .   ? 0.3378 0.4074 0.3395 0.0492  0.0752  0.1188  730 HOH A O   
1977 O O   . HOH QA .   ? 0.2847 0.2861 0.2441 0.0794  0.0367  0.1193  731 HOH A O   
1978 O O   . HOH QA .   ? 0.6789 0.8547 0.3183 -0.4638 0.1930  -0.2366 732 HOH A O   
1979 O O   . HOH QA .   ? 0.3323 0.4886 0.3975 0.0624  -0.1363 -0.1896 733 HOH A O   
1980 O O   . HOH QA .   ? 0.3154 0.3103 0.4805 -0.0904 -0.2341 0.0567  734 HOH A O   
1981 O O   . HOH QA .   ? 0.4255 0.2784 0.3059 -0.0013 -0.0641 -0.0136 735 HOH A O   
1982 O O   . HOH QA .   ? 0.3850 0.3507 0.4190 0.0454  0.0115  -0.0173 736 HOH A O   
1983 O O   . HOH QA .   ? 0.2130 0.3754 0.4472 -0.0506 0.0420  -0.0263 737 HOH A O   
1984 O O   . HOH QA .   ? 0.3647 0.4578 0.4041 -0.0155 0.1718  0.0374  738 HOH A O   
1985 O O   . HOH QA .   ? 0.3304 0.2750 0.3835 0.0238  -0.0739 -0.0650 739 HOH A O   
1986 O O   . HOH QA .   ? 0.3258 0.2830 0.2849 0.0090  -0.0727 -0.0532 740 HOH A O   
1987 O O   A HOH QA .   ? 0.3207 0.2554 0.2387 -0.0802 -0.1163 0.1190  741 HOH A O   
1988 O O   . HOH QA .   ? 0.4181 0.3699 0.2081 -0.0825 -0.0728 -0.0318 742 HOH A O   
1989 O O   . HOH QA .   ? 0.7882 1.0001 0.2888 -0.0655 0.1864  0.0148  743 HOH A O   
1990 O O   . HOH QA .   ? 0.2500 0.7395 0.3906 0.0708  -0.1135 -0.2251 744 HOH A O   
1991 O O   . HOH QA .   ? 0.3335 0.3827 0.4161 0.0531  -0.0189 0.0894  745 HOH A O   
1992 O O   . HOH QA .   ? 0.4328 0.6991 0.4341 0.1007  0.1190  0.2438  746 HOH A O   
1993 O O   . HOH QA .   ? 0.6445 0.5533 0.3282 0.0662  -0.1641 -0.0195 747 HOH A O   
1994 O O   . HOH QA .   ? 0.2814 0.3225 0.5511 -0.0320 0.0593  0.0312  748 HOH A O   
1995 O O   . HOH QA .   ? 0.2658 0.3906 0.4709 -0.0985 0.0334  -0.2061 749 HOH A O   
1996 O O   . HOH QA .   ? 0.7920 0.4575 0.3867 -0.0438 -0.0606 0.0534  750 HOH A O   
1997 O O   . HOH QA .   ? 0.3962 0.4965 0.4246 -0.2760 -0.1156 0.0623  751 HOH A O   
1998 O O   . HOH QA .   ? 0.4426 0.4711 0.4344 0.0562  -0.0338 -0.0745 752 HOH A O   
1999 O O   . HOH QA .   ? 0.7187 0.3547 0.6266 0.1170  0.1296  0.1743  753 HOH A O   
2000 O O   . HOH QA .   ? 0.5713 0.4734 0.5069 -0.2150 -0.0826 -0.0249 754 HOH A O   
2001 O O   . HOH QA .   ? 0.4762 0.5078 0.3607 0.0918  -0.1767 -0.0988 755 HOH A O   
2002 O O   . HOH QA .   ? 0.3506 0.3755 0.2724 -0.1168 -0.0661 -0.0863 756 HOH A O   
2003 O O   . HOH QA .   ? 0.3679 0.3026 0.3390 0.0481  0.0375  -0.0161 757 HOH A O   
2004 O O   . HOH QA .   ? 0.3416 0.8705 0.6362 -0.0895 -0.0099 0.1188  758 HOH A O   
2005 O O   . HOH QA .   ? 0.7587 0.6365 0.4808 0.1458  0.2250  0.2150  759 HOH A O   
2006 O O   . HOH QA .   ? 0.4593 0.7660 0.5911 0.1689  -0.1042 0.0917  760 HOH A O   
2007 O O   . HOH QA .   ? 0.6105 0.3653 0.2880 0.0728  -0.1587 0.1184  761 HOH A O   
2008 O O   . HOH QA .   ? 0.5521 0.7364 0.7632 -0.2790 -0.0349 -0.1794 762 HOH A O   
2009 O O   . HOH QA .   ? 0.4170 0.7100 0.3164 0.0293  0.1133  -0.1694 763 HOH A O   
2010 O O   . HOH QA .   ? 0.5261 0.5373 0.6241 0.1824  0.0152  0.0543  764 HOH A O   
2011 O O   . HOH QA .   ? 0.2311 0.2506 0.2822 -0.0007 -0.0224 0.0163  765 HOH A O   
2012 O O   . HOH QA .   ? 0.6198 0.2791 0.5851 0.1352  -0.2162 -0.0920 766 HOH A O   
2013 O O   . HOH QA .   ? 0.2419 0.3221 0.4744 -0.0839 -0.0207 -0.0260 767 HOH A O   
2014 O O   . HOH QA .   ? 0.4720 0.6214 0.2561 0.2448  -0.0805 0.0161  768 HOH A O   
2015 O O   . HOH QA .   ? 0.3762 0.4560 0.6857 -0.0194 0.1726  0.0295  769 HOH A O   
2016 O O   . HOH QA .   ? 0.6999 0.5383 0.4104 0.2222  0.0167  0.0251  770 HOH A O   
2017 O O   . HOH QA .   ? 0.3623 0.5072 0.4880 -0.0337 0.0692  0.0652  771 HOH A O   
2018 O O   . HOH QA .   ? 0.6584 0.5508 0.2881 -0.2009 0.1719  -0.0705 772 HOH A O   
2019 O O   . HOH QA .   ? 0.6560 0.4406 0.3950 0.0853  0.0368  0.0316  773 HOH A O   
2020 O O   . HOH QA .   ? 0.3002 0.4704 0.6502 -0.0019 0.0108  0.0570  774 HOH A O   
2021 O O   . HOH QA .   ? 0.3492 0.6236 0.3561 0.0144  -0.0774 -0.0639 775 HOH A O   
2022 O O   . HOH QA .   ? 0.9286 0.4445 0.3659 0.0736  -0.0828 -0.0542 776 HOH A O   
2023 O O   . HOH QA .   ? 0.4489 0.4542 0.2727 -0.0709 -0.0103 -0.0289 777 HOH A O   
2024 O O   . HOH QA .   ? 0.6122 0.6453 0.3630 -0.3291 -0.2499 0.2256  778 HOH A O   
2025 O O   . HOH QA .   ? 0.5344 0.3816 0.2803 -0.0226 -0.1350 0.0066  779 HOH A O   
2026 O O   . HOH QA .   ? 0.5280 0.4076 0.4584 -0.0434 0.0921  0.0909  780 HOH A O   
2027 O O   . HOH QA .   ? 0.4639 0.5751 0.6781 0.1626  -0.0836 0.1708  781 HOH A O   
2028 O O   . HOH QA .   ? 0.3059 0.2472 0.2816 -0.0214 -0.0492 0.0786  782 HOH A O   
2029 O O   . HOH QA .   ? 0.7093 0.5995 0.4332 0.0464  -0.1235 0.0560  783 HOH A O   
2030 O O   . HOH QA .   ? 0.6407 0.3811 0.7024 0.0215  -0.1333 -0.1426 784 HOH A O   
2031 O O   . HOH QA .   ? 0.2018 0.2710 0.2293 -0.0028 -0.0186 -0.0617 785 HOH A O   
2032 O O   . HOH QA .   ? 0.6206 0.5102 0.5231 0.1444  0.0392  -0.0115 786 HOH A O   
2033 O O   . HOH QA .   ? 0.5653 0.5838 0.5642 -0.0841 -0.2268 0.2033  787 HOH A O   
2034 O O   . HOH QA .   ? 0.4344 0.2510 0.4052 -0.0087 -0.1312 -0.0183 788 HOH A O   
2035 O O   . HOH QA .   ? 0.3071 0.3766 0.9079 -0.0424 0.0223  -0.1085 789 HOH A O   
2036 O O   . HOH QA .   ? 0.5992 0.7487 0.3579 0.1478  0.0601  -0.0413 790 HOH A O   
2037 O O   . HOH QA .   ? 0.2482 0.3066 0.5573 -0.0299 -0.1185 -0.0151 791 HOH A O   
2038 O O   . HOH QA .   ? 0.6565 0.8639 0.4066 0.0682  0.0101  -0.2728 792 HOH A O   
2039 O O   . HOH QA .   ? 0.4849 0.3269 0.5175 -0.1554 0.0079  -0.0943 793 HOH A O   
2040 O O   . HOH QA .   ? 0.2287 0.3529 0.3525 -0.0562 -0.0169 -0.0303 794 HOH A O   
2041 O O   . HOH QA .   ? 0.5702 0.3248 0.6588 0.0061  -0.3431 0.0580  795 HOH A O   
2042 O O   . HOH QA .   ? 0.5559 0.5288 0.7463 -0.1409 0.0968  0.0649  796 HOH A O   
2043 O O   . HOH QA .   ? 0.5639 0.4397 0.8633 -0.1014 0.0240  -0.0201 797 HOH A O   
2044 O O   . HOH QA .   ? 0.4033 0.5524 0.6202 0.1161  -0.0077 0.1292  798 HOH A O   
2045 O O   . HOH QA .   ? 0.3474 0.5882 0.5387 0.0295  0.0867  -0.0715 799 HOH A O   
2046 O O   . HOH QA .   ? 0.4158 0.3067 0.4908 -0.0002 -0.1323 -0.0244 800 HOH A O   
2047 O O   . HOH QA .   ? 0.3764 0.7692 0.4004 -0.2212 -0.0564 0.1843  801 HOH A O   
2048 O O   . HOH QA .   ? 0.8223 0.3354 0.3702 0.1466  -0.1574 -0.0145 802 HOH A O   
2049 O O   . HOH QA .   ? 0.3037 0.6600 0.5985 0.0707  0.0523  0.1992  803 HOH A O   
2050 O O   . HOH QA .   ? 0.4220 0.5024 0.3517 0.1037  -0.0478 -0.1035 804 HOH A O   
2051 O O   . HOH QA .   ? 0.4854 0.6387 0.4671 0.1469  -0.1997 -0.0931 805 HOH A O   
2052 O O   . HOH QA .   ? 0.5532 0.4471 0.4406 -0.0860 0.2053  -0.0610 806 HOH A O   
2053 O O   . HOH QA .   ? 0.3801 0.4550 0.8677 0.1160  -0.1339 -0.1855 807 HOH A O   
2054 O O   . HOH QA .   ? 0.3199 0.6584 0.6850 -0.0332 0.0073  -0.3768 808 HOH A O   
2055 O O   . HOH QA .   ? 0.1966 0.3773 0.5403 0.0895  -0.0768 0.0309  809 HOH A O   
2056 O O   . HOH QA .   ? 0.3040 0.3059 0.4401 0.0134  -0.1279 -0.0153 810 HOH A O   
2057 O O   . HOH QA .   ? 0.2213 0.5069 0.6274 0.0785  0.1389  0.1925  811 HOH A O   
2058 O O   . HOH RA .   ? 0.6662 0.3688 0.4765 0.0347  -0.0667 0.1447  101 HOH B O   
2059 O O   . HOH RA .   ? 0.6403 0.4039 0.4430 0.0856  0.0539  -0.0327 102 HOH B O   
2060 O O   . HOH RA .   ? 0.2058 0.1976 0.2147 0.0212  -0.0012 0.0342  103 HOH B O   
2061 O O   . HOH RA .   ? 0.4736 0.4512 0.7032 0.1561  -0.0024 0.2249  104 HOH B O   
2062 O O   . HOH RA .   ? 0.3383 0.5367 0.5519 -0.0524 0.0807  0.1204  105 HOH B O   
2063 O O   . HOH RA .   ? 0.2837 0.1875 0.2884 0.0435  0.0407  0.0215  106 HOH B O   
2064 O O   . HOH RA .   ? 0.6404 0.4441 0.6332 0.1691  0.0659  0.0636  107 HOH B O   
2065 O O   . HOH RA .   ? 0.3930 0.5795 0.3709 0.0880  0.0833  0.2197  108 HOH B O   
2066 O O   . HOH RA .   ? 0.4114 0.2237 0.3533 -0.0371 -0.0994 -0.0284 109 HOH B O   
2067 O O   . HOH RA .   ? 0.4259 0.4412 0.3714 0.0120  0.0316  0.1676  110 HOH B O   
2068 O O   . HOH RA .   ? 0.6599 0.4120 0.4107 -0.0050 0.0218  0.0550  111 HOH B O   
2069 O O   . HOH RA .   ? 0.5610 0.3751 0.2743 0.0582  -0.0521 0.0227  112 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   172 ?   ?   ?   A . n 
A 1 2   HIS 2   173 ?   ?   ?   A . n 
A 1 3   HIS 3   174 ?   ?   ?   A . n 
A 1 4   HIS 4   175 ?   ?   ?   A . n 
A 1 5   HIS 5   176 ?   ?   ?   A . n 
A 1 6   HIS 6   177 ?   ?   ?   A . n 
A 1 7   HIS 7   178 ?   ?   ?   A . n 
A 1 8   SER 8   179 ?   ?   ?   A . n 
A 1 9   SER 9   180 ?   ?   ?   A . n 
A 1 10  GLY 10  181 ?   ?   ?   A . n 
A 1 11  ARG 11  182 ?   ?   ?   A . n 
A 1 12  GLU 12  183 ?   ?   ?   A . n 
A 1 13  ASN 13  184 ?   ?   ?   A . n 
A 1 14  LEU 14  185 ?   ?   ?   A . n 
A 1 15  TYR 15  186 ?   ?   ?   A . n 
A 1 16  PHE 16  187 ?   ?   ?   A . n 
A 1 17  GLN 17  188 ?   ?   ?   A . n 
A 1 18  GLY 18  189 189 GLY GLY A . n 
A 1 19  GLY 19  190 190 GLY GLY A . n 
A 1 20  GLU 20  191 191 GLU GLU A . n 
A 1 21  LEU 21  192 192 LEU LEU A . n 
A 1 22  SER 22  193 193 SER SER A . n 
A 1 23  LYS 23  194 194 LYS LYS A . n 
A 1 24  ASP 24  195 195 ASP ASP A . n 
A 1 25  GLY 25  196 196 GLY GLY A . n 
A 1 26  ASP 26  197 197 ASP ASP A . n 
A 1 27  LEU 27  198 198 LEU LEU A . n 
A 1 28  ILE 28  199 199 ILE ILE A . n 
A 1 29  VAL 29  200 200 VAL VAL A . n 
A 1 30  SER 30  201 201 SER SER A . n 
A 1 31  MET 31  202 202 MET MET A . n 
A 1 32  ARG 32  203 203 ARG ARG A . n 
A 1 33  ILE 33  204 204 ILE ILE A . n 
A 1 34  LEU 34  205 205 LEU LEU A . n 
A 1 35  GLY 35  206 206 GLY GLY A . n 
A 1 36  LYS 36  207 207 LYS LYS A . n 
A 1 37  LYS 37  208 208 LYS LYS A . n 
A 1 38  ARG 38  209 209 ARG ARG A . n 
A 1 39  THR 39  210 210 THR THR A . n 
A 1 40  LYS 40  211 211 LYS LYS A . n 
A 1 41  THR 41  212 212 THR THR A . n 
A 1 42  TRP 42  213 213 TRP TRP A . n 
A 1 43  HIS 43  214 214 HIS HIS A . n 
A 1 44  LYS 44  215 215 LYS LYS A . n 
A 1 45  GLY 45  216 216 GLY GLY A . n 
A 1 46  THR 46  217 217 THR THR A . n 
A 1 47  LEU 47  218 218 LEU LEU A . n 
A 1 48  ILE 48  219 219 ILE ILE A . n 
A 1 49  ALA 49  220 220 ALA ALA A . n 
A 1 50  ILE 50  221 221 ILE ILE A . n 
A 1 51  GLN 51  222 222 GLN GLN A . n 
A 1 52  THR 52  223 223 THR THR A . n 
A 1 53  VAL 53  224 224 VAL VAL A . n 
A 1 54  GLY 54  225 225 GLY GLY A . n 
A 1 55  PRO 55  226 226 PRO PRO A . n 
A 1 56  GLY 56  227 227 GLY GLY A . n 
A 1 57  LYS 57  228 228 LYS LYS A . n 
A 1 58  LYS 58  229 229 LYS LYS A . n 
A 1 59  TYR 59  230 230 TYR TYR A . n 
A 1 60  LYS 60  231 231 LYS LYS A . n 
A 1 61  VAL 61  232 232 VAL VAL A . n 
A 1 62  LYS 62  233 233 LYS LYS A . n 
A 1 63  PHE 63  234 234 PHE PHE A . n 
A 1 64  ASP 64  235 235 ASP ASP A . n 
A 1 65  ASN 65  236 236 ASN ASN A . n 
A 1 66  LYS 66  237 237 LYS LYS A . n 
A 1 67  GLY 67  238 238 GLY GLY A . n 
A 1 68  LYS 68  239 239 LYS LYS A . n 
A 1 69  SER 69  240 240 SER SER A . n 
A 1 70  LEU 70  241 241 LEU LEU A . n 
A 1 71  LEU 71  242 242 LEU LEU A . n 
A 1 72  SER 72  243 243 SER SER A . n 
A 1 73  GLY 73  244 244 GLY GLY A . n 
A 1 74  ASN 74  245 245 ASN ASN A . n 
A 1 75  HIS 75  246 246 HIS HIS A . n 
A 1 76  ILE 76  247 247 ILE ILE A . n 
A 1 77  ALA 77  248 248 ALA ALA A . n 
A 1 78  TYR 78  249 249 TYR TYR A . n 
A 1 79  ASP 79  250 250 ASP ASP A . n 
A 1 80  TYR 80  251 251 TYR TYR A . n 
A 1 81  HIS 81  252 252 HIS HIS A . n 
A 1 82  PRO 82  253 253 PRO PRO A . n 
A 1 83  PRO 83  254 254 PRO PRO A . n 
A 1 84  ALA 84  255 255 ALA ALA A . n 
A 1 85  ASP 85  256 256 ASP ASP A . n 
A 1 86  LYS 86  257 257 LYS LYS A . n 
A 1 87  LEU 87  258 258 LEU LEU A . n 
A 1 88  TYR 88  259 259 TYR TYR A . n 
A 1 89  VAL 89  260 260 VAL VAL A . n 
A 1 90  GLY 90  261 261 GLY GLY A . n 
A 1 91  SER 91  262 262 SER SER A . n 
A 1 92  ARG 92  263 263 ARG ARG A . n 
A 1 93  VAL 93  264 264 VAL VAL A . n 
A 1 94  VAL 94  265 265 VAL VAL A . n 
A 1 95  ALA 95  266 266 ALA ALA A . n 
A 1 96  LYS 96  267 267 LYS LYS A . n 
A 1 97  TYR 97  268 268 TYR TYR A . n 
A 1 98  LYS 98  269 269 LYS LYS A . n 
A 1 99  ASP 99  270 270 ASP ASP A . n 
A 1 100 GLY 100 271 ?   ?   ?   A . n 
A 1 101 ASN 101 272 ?   ?   ?   A . n 
A 1 102 GLN 102 273 ?   ?   ?   A . n 
A 1 103 VAL 103 274 274 VAL VAL A . n 
A 1 104 TRP 104 275 275 TRP TRP A . n 
A 1 105 LEU 105 276 276 LEU LEU A . n 
A 1 106 TYR 106 277 277 TYR TYR A . n 
A 1 107 ALA 107 278 278 ALA ALA A . n 
A 1 108 GLY 108 279 279 GLY GLY A . n 
A 1 109 ILE 109 280 280 ILE ILE A . n 
A 1 110 VAL 110 281 281 VAL VAL A . n 
A 1 111 ALA 111 282 282 ALA ALA A . n 
A 1 112 GLU 112 283 283 GLU GLU A . n 
A 1 113 THR 113 284 284 THR THR A . n 
A 1 114 PRO 114 285 285 PRO PRO A . n 
A 1 115 ASN 115 286 286 ASN ASN A . n 
A 1 116 VAL 116 287 287 VAL VAL A . n 
A 1 117 LYS 117 288 288 LYS LYS A . n 
A 1 118 ASN 118 289 289 ASN ASN A . n 
A 1 119 LYS 119 290 290 LYS LYS A . n 
A 1 120 LEU 120 291 291 LEU LEU A . n 
A 1 121 ARG 121 292 292 ARG ARG A . n 
A 1 122 PHE 122 293 293 PHE PHE A . n 
A 1 123 LEU 123 294 294 LEU LEU A . n 
A 1 124 ILE 124 295 295 ILE ILE A . n 
A 1 125 PHE 125 296 296 PHE PHE A . n 
A 1 126 PHE 126 297 297 PHE PHE A . n 
A 1 127 ASP 127 298 298 ASP ASP A . n 
A 1 128 ASP 128 299 299 ASP ASP A . n 
A 1 129 GLY 129 300 300 GLY GLY A . n 
A 1 130 TYR 130 301 301 TYR TYR A . n 
A 1 131 ALA 131 302 302 ALA ALA A . n 
A 1 132 SER 132 303 303 SER SER A . n 
A 1 133 TYR 133 304 304 TYR TYR A . n 
A 1 134 VAL 134 305 305 VAL VAL A . n 
A 1 135 THR 135 306 306 THR THR A . n 
A 1 136 GLN 136 307 307 GLN GLN A . n 
A 1 137 SER 137 308 308 SER SER A . n 
A 1 138 GLU 138 309 309 GLU GLU A . n 
A 1 139 LEU 139 310 310 LEU LEU A . n 
A 1 140 TYR 140 311 311 TYR TYR A . n 
A 1 141 PRO 141 312 312 PRO PRO A . n 
A 1 142 ILE 142 313 313 ILE ILE A . n 
A 1 143 CYS 143 314 314 CYS CYS A . n 
A 1 144 ARG 144 315 315 ARG ARG A . n 
A 1 145 PRO 145 316 316 PRO PRO A . n 
A 1 146 LEU 146 317 317 LEU LEU A . n 
A 1 147 LYS 147 318 318 LYS LYS A . n 
A 1 148 LYS 148 319 319 LYS LYS A . n 
A 1 149 THR 149 320 320 THR THR A . n 
A 1 150 TRP 150 321 321 TRP TRP A . n 
A 1 151 GLU 151 322 322 GLU GLU A . n 
A 1 152 ASP 152 323 323 ASP ASP A . n 
A 1 153 ILE 153 324 324 ILE ILE A . n 
A 1 154 GLU 154 325 325 GLU GLU A . n 
A 1 155 ASP 155 326 326 ASP ASP A . n 
A 1 156 ILE 156 327 327 ILE ILE A . n 
A 1 157 SER 157 328 328 SER SER A . n 
A 1 158 CYS 158 329 329 CYS CYS A . n 
A 1 159 ARG 159 330 330 ARG ARG A . n 
A 1 160 ASP 160 331 331 ASP ASP A . n 
A 1 161 PHE 161 332 332 PHE PHE A . n 
A 1 162 ILE 162 333 333 ILE ILE A . n 
A 1 163 GLU 163 334 334 GLU GLU A . n 
A 1 164 GLU 164 335 335 GLU GLU A . n 
A 1 165 TYR 165 336 336 TYR TYR A . n 
A 1 166 VAL 166 337 337 VAL VAL A . n 
A 1 167 THR 167 338 338 THR THR A . n 
A 1 168 ALA 168 339 339 ALA ALA A . n 
A 1 169 TYR 169 340 340 TYR TYR A . n 
A 1 170 PRO 170 341 341 PRO PRO A . n 
A 1 171 ASN 171 342 342 ASN ASN A . n 
A 1 172 ARG 172 343 343 ARG ARG A . n 
A 1 173 PRO 173 344 344 PRO PRO A . n 
A 1 174 MET 174 345 345 MET MET A . n 
A 1 175 VAL 175 346 346 VAL VAL A . n 
A 1 176 LEU 176 347 347 LEU LEU A . n 
A 1 177 LEU 177 348 348 LEU LEU A . n 
A 1 178 LYS 178 349 349 LYS LYS A . n 
A 1 179 SER 179 350 350 SER SER A . n 
A 1 180 GLY 180 351 351 GLY GLY A . n 
A 1 181 GLN 181 352 352 GLN GLN A . n 
A 1 182 LEU 182 353 353 LEU LEU A . n 
A 1 183 ILE 183 354 354 ILE ILE A . n 
A 1 184 LYS 184 355 355 LYS LYS A . n 
A 1 185 THR 185 356 356 THR THR A . n 
A 1 186 GLU 186 357 357 GLU GLU A . n 
A 1 187 TRP 187 358 358 TRP TRP A . n 
A 1 188 GLU 188 359 359 GLU GLU A . n 
A 1 189 GLY 189 360 360 GLY GLY A . n 
A 1 190 THR 190 361 361 THR THR A . n 
A 1 191 TRP 191 362 362 TRP TRP A . n 
A 1 192 TRP 192 363 363 TRP TRP A . n 
A 1 193 LYS 193 364 364 LYS LYS A . n 
A 1 194 SER 194 365 365 SER SER A . n 
A 1 195 ARG 195 366 366 ARG ARG A . n 
A 1 196 VAL 196 367 367 VAL VAL A . n 
A 1 197 GLU 197 368 368 GLU GLU A . n 
A 1 198 GLU 198 369 369 GLU GLU A . n 
A 1 199 VAL 199 370 370 VAL VAL A . n 
A 1 200 ASP 200 371 371 ASP ASP A . n 
A 1 201 GLY 201 372 372 GLY GLY A . n 
A 1 202 SER 202 373 373 SER SER A . n 
A 1 203 LEU 203 374 374 LEU LEU A . n 
A 1 204 VAL 204 375 375 VAL VAL A . n 
A 1 205 ARG 205 376 376 ARG ARG A . n 
A 1 206 ILE 206 377 377 ILE ILE A . n 
A 1 207 LEU 207 378 378 LEU LEU A . n 
A 1 208 PHE 208 379 379 PHE PHE A . n 
A 1 209 LEU 209 380 380 LEU LEU A . n 
A 1 210 ASP 210 381 381 ASP ASP A . n 
A 1 211 ASP 211 382 382 ASP ASP A . n 
A 1 212 LYS 212 383 383 LYS LYS A . n 
A 1 213 ARG 213 384 384 ARG ARG A . n 
A 1 214 CYS 214 385 385 CYS CYS A . n 
A 1 215 GLU 215 386 386 GLU GLU A . n 
A 1 216 TRP 216 387 387 TRP TRP A . n 
A 1 217 ILE 217 388 388 ILE ILE A . n 
A 1 218 TYR 218 389 389 TYR TYR A . n 
A 1 219 ARG 219 390 390 ARG ARG A . n 
A 1 220 GLY 220 391 391 GLY GLY A . n 
A 1 221 SER 221 392 392 SER SER A . n 
A 1 222 THR 222 393 393 THR THR A . n 
A 1 223 ARG 223 394 394 ARG ARG A . n 
A 1 224 LEU 224 395 395 LEU LEU A . n 
A 1 225 GLU 225 396 396 GLU GLU A . n 
A 1 226 PRO 226 397 397 PRO PRO A . n 
A 1 227 MET 227 398 398 MET MET A . n 
A 1 228 PHE 228 399 399 PHE PHE A . n 
A 1 229 SER 229 400 400 SER SER A . n 
A 1 230 MET 230 401 401 MET MET A . n 
A 1 231 LYS 231 402 402 LYS LYS A . n 
A 1 232 THR 232 403 403 THR THR A . n 
A 1 233 SER 233 404 404 SER SER A . n 
A 1 234 SER 234 405 405 SER SER A . n 
A 1 235 ALA 235 406 406 ALA ALA A . n 
A 1 236 SER 236 407 ?   ?   ?   A . n 
A 1 237 ALA 237 408 ?   ?   ?   A . n 
A 1 238 LEU 238 409 ?   ?   ?   A . n 
A 1 239 GLU 239 410 ?   ?   ?   A . n 
B 2 1   ACE 1   3   ?   ?   ?   B . n 
B 2 2   LYS 2   4   ?   ?   ?   B . n 
B 2 3   GLN 3   5   ?   ?   ?   B . n 
B 2 4   THR 4   6   ?   ?   ?   B . n 
B 2 5   ALA 5   7   ?   ?   ?   B . n 
B 2 6   ARG 6   8   ?   ?   ?   B . n 
B 2 7   LYS 7   9   ?   ?   ?   B . n 
B 2 8   SER 8   10  10  SER SER B . n 
B 2 9   THR 9   11  11  THR THR B . n 
B 2 10  GLY 10  12  12  GLY GLY B . n 
B 2 11  GLY 11  13  13  GLY GLY B . n 
B 2 12  ALY 12  14  14  ALY ALY B . n 
B 2 13  ALA 13  15  15  ALA ALA B . n 
B 2 14  PRO 14  16  16  PRO PRO B . n 
B 2 15  ARG 15  17  17  ARG ARG B . n 
B 2 16  LYS 16  18  18  LYS LYS B . n 
B 2 17  GLN 17  19  ?   ?   ?   B . n 
B 2 18  NH2 18  20  ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C  3 UNX 1   501 2   UNX UNX A . 
D  3 UNX 1   502 3   UNX UNX A . 
E  3 UNX 1   503 4   UNX UNX A . 
F  3 UNX 1   504 5   UNX UNX A . 
G  3 UNX 1   505 6   UNX UNX A . 
H  3 UNX 1   506 7   UNX UNX A . 
I  3 UNX 1   507 8   UNX UNX A . 
J  3 UNX 1   508 9   UNX UNX A . 
K  3 UNX 1   509 10  UNX UNX A . 
L  3 UNX 1   510 67  UNX UNX A . 
M  3 UNX 1   511 68  UNX UNX A . 
N  3 UNX 1   512 69  UNX UNX A . 
O  3 UNX 1   513 70  UNX UNX A . 
P  3 UNX 1   514 71  UNX UNX A . 
Q  3 UNX 1   515 72  UNX UNX A . 
R  3 UNX 1   516 73  UNX UNX A . 
S  3 UNX 1   517 74  UNX UNX A . 
T  3 UNX 1   518 75  UNX UNX A . 
U  3 UNX 1   519 76  UNX UNX A . 
V  3 UNX 1   520 77  UNX UNX A . 
W  3 UNX 1   521 78  UNX UNX A . 
X  3 UNX 1   522 79  UNX UNX A . 
Y  3 UNX 1   523 80  UNX UNX A . 
Z  3 UNX 1   524 81  UNX UNX A . 
AA 3 UNX 1   525 82  UNX UNX A . 
BA 3 UNX 1   526 83  UNX UNX A . 
CA 3 UNX 1   527 84  UNX UNX A . 
DA 3 UNX 1   528 85  UNX UNX A . 
EA 3 UNX 1   529 86  UNX UNX A . 
FA 3 UNX 1   530 87  UNX UNX A . 
GA 3 UNX 1   531 88  UNX UNX A . 
HA 3 UNX 1   532 89  UNX UNX A . 
IA 3 UNX 1   533 90  UNX UNX A . 
JA 3 UNX 1   534 91  UNX UNX A . 
KA 3 UNX 1   535 92  UNX UNX A . 
LA 3 UNX 1   536 93  UNX UNX A . 
MA 3 UNX 1   537 94  UNX UNX A . 
NA 3 UNX 1   538 95  UNX UNX A . 
OA 3 UNX 1   539 96  UNX UNX A . 
PA 3 UNX 1   540 97  UNX UNX A . 
QA 4 HOH 1   601 205 HOH HOH A . 
QA 4 HOH 2   602 136 HOH HOH A . 
QA 4 HOH 3   603 188 HOH HOH A . 
QA 4 HOH 4   604 250 HOH HOH A . 
QA 4 HOH 5   605 135 HOH HOH A . 
QA 4 HOH 6   606 317 HOH HOH A . 
QA 4 HOH 7   607 28  HOH HOH A . 
QA 4 HOH 8   608 337 HOH HOH A . 
QA 4 HOH 9   609 242 HOH HOH A . 
QA 4 HOH 10  610 118 HOH HOH A . 
QA 4 HOH 11  611 50  HOH HOH A . 
QA 4 HOH 12  612 330 HOH HOH A . 
QA 4 HOH 13  613 332 HOH HOH A . 
QA 4 HOH 14  614 2   HOH HOH A . 
QA 4 HOH 15  615 137 HOH HOH A . 
QA 4 HOH 16  616 95  HOH HOH A . 
QA 4 HOH 17  617 143 HOH HOH A . 
QA 4 HOH 18  618 48  HOH HOH A . 
QA 4 HOH 19  619 13  HOH HOH A . 
QA 4 HOH 20  620 203 HOH HOH A . 
QA 4 HOH 21  621 211 HOH HOH A . 
QA 4 HOH 22  622 56  HOH HOH A . 
QA 4 HOH 23  623 261 HOH HOH A . 
QA 4 HOH 24  624 151 HOH HOH A . 
QA 4 HOH 25  625 147 HOH HOH A . 
QA 4 HOH 26  626 222 HOH HOH A . 
QA 4 HOH 27  627 9   HOH HOH A . 
QA 4 HOH 28  628 25  HOH HOH A . 
QA 4 HOH 29  629 146 HOH HOH A . 
QA 4 HOH 30  630 20  HOH HOH A . 
QA 4 HOH 31  631 127 HOH HOH A . 
QA 4 HOH 32  632 8   HOH HOH A . 
QA 4 HOH 33  633 154 HOH HOH A . 
QA 4 HOH 34  634 93  HOH HOH A . 
QA 4 HOH 35  635 46  HOH HOH A . 
QA 4 HOH 36  636 266 HOH HOH A . 
QA 4 HOH 37  637 59  HOH HOH A . 
QA 4 HOH 38  638 132 HOH HOH A . 
QA 4 HOH 39  639 270 HOH HOH A . 
QA 4 HOH 40  640 32  HOH HOH A . 
QA 4 HOH 41  641 73  HOH HOH A . 
QA 4 HOH 42  642 267 HOH HOH A . 
QA 4 HOH 43  643 3   HOH HOH A . 
QA 4 HOH 44  644 68  HOH HOH A . 
QA 4 HOH 45  645 5   HOH HOH A . 
QA 4 HOH 46  646 38  HOH HOH A . 
QA 4 HOH 47  647 131 HOH HOH A . 
QA 4 HOH 48  648 216 HOH HOH A . 
QA 4 HOH 49  649 84  HOH HOH A . 
QA 4 HOH 50  650 210 HOH HOH A . 
QA 4 HOH 51  651 34  HOH HOH A . 
QA 4 HOH 52  652 62  HOH HOH A . 
QA 4 HOH 53  653 322 HOH HOH A . 
QA 4 HOH 54  654 209 HOH HOH A . 
QA 4 HOH 55  655 87  HOH HOH A . 
QA 4 HOH 56  656 254 HOH HOH A . 
QA 4 HOH 57  657 74  HOH HOH A . 
QA 4 HOH 58  658 30  HOH HOH A . 
QA 4 HOH 59  659 165 HOH HOH A . 
QA 4 HOH 60  660 41  HOH HOH A . 
QA 4 HOH 61  661 128 HOH HOH A . 
QA 4 HOH 62  662 82  HOH HOH A . 
QA 4 HOH 63  663 182 HOH HOH A . 
QA 4 HOH 64  664 228 HOH HOH A . 
QA 4 HOH 65  665 79  HOH HOH A . 
QA 4 HOH 66  666 183 HOH HOH A . 
QA 4 HOH 67  667 268 HOH HOH A . 
QA 4 HOH 68  668 24  HOH HOH A . 
QA 4 HOH 69  669 149 HOH HOH A . 
QA 4 HOH 70  670 4   HOH HOH A . 
QA 4 HOH 71  671 29  HOH HOH A . 
QA 4 HOH 72  672 208 HOH HOH A . 
QA 4 HOH 73  673 102 HOH HOH A . 
QA 4 HOH 74  674 98  HOH HOH A . 
QA 4 HOH 75  675 11  HOH HOH A . 
QA 4 HOH 76  676 7   HOH HOH A . 
QA 4 HOH 77  677 110 HOH HOH A . 
QA 4 HOH 78  678 15  HOH HOH A . 
QA 4 HOH 79  679 35  HOH HOH A . 
QA 4 HOH 80  680 112 HOH HOH A . 
QA 4 HOH 81  681 158 HOH HOH A . 
QA 4 HOH 82  682 103 HOH HOH A . 
QA 4 HOH 83  683 185 HOH HOH A . 
QA 4 HOH 84  684 43  HOH HOH A . 
QA 4 HOH 85  685 12  HOH HOH A . 
QA 4 HOH 86  686 140 HOH HOH A . 
QA 4 HOH 87  687 108 HOH HOH A . 
QA 4 HOH 88  688 245 HOH HOH A . 
QA 4 HOH 89  689 1   HOH HOH A . 
QA 4 HOH 90  690 54  HOH HOH A . 
QA 4 HOH 91  691 156 HOH HOH A . 
QA 4 HOH 92  692 16  HOH HOH A . 
QA 4 HOH 93  693 104 HOH HOH A . 
QA 4 HOH 94  694 336 HOH HOH A . 
QA 4 HOH 95  695 69  HOH HOH A . 
QA 4 HOH 96  696 226 HOH HOH A . 
QA 4 HOH 97  697 19  HOH HOH A . 
QA 4 HOH 98  698 105 HOH HOH A . 
QA 4 HOH 99  699 88  HOH HOH A . 
QA 4 HOH 100 700 125 HOH HOH A . 
QA 4 HOH 101 701 91  HOH HOH A . 
QA 4 HOH 102 702 201 HOH HOH A . 
QA 4 HOH 103 703 324 HOH HOH A . 
QA 4 HOH 104 704 293 HOH HOH A . 
QA 4 HOH 105 705 224 HOH HOH A . 
QA 4 HOH 106 706 44  HOH HOH A . 
QA 4 HOH 107 707 258 HOH HOH A . 
QA 4 HOH 108 708 17  HOH HOH A . 
QA 4 HOH 109 709 97  HOH HOH A . 
QA 4 HOH 110 710 31  HOH HOH A . 
QA 4 HOH 111 711 67  HOH HOH A . 
QA 4 HOH 112 712 111 HOH HOH A . 
QA 4 HOH 113 713 96  HOH HOH A . 
QA 4 HOH 114 714 26  HOH HOH A . 
QA 4 HOH 115 715 78  HOH HOH A . 
QA 4 HOH 116 716 55  HOH HOH A . 
QA 4 HOH 117 717 257 HOH HOH A . 
QA 4 HOH 118 718 72  HOH HOH A . 
QA 4 HOH 119 719 194 HOH HOH A . 
QA 4 HOH 120 720 246 HOH HOH A . 
QA 4 HOH 121 721 10  HOH HOH A . 
QA 4 HOH 122 722 229 HOH HOH A . 
QA 4 HOH 123 723 37  HOH HOH A . 
QA 4 HOH 124 724 141 HOH HOH A . 
QA 4 HOH 125 725 23  HOH HOH A . 
QA 4 HOH 126 726 89  HOH HOH A . 
QA 4 HOH 127 727 214 HOH HOH A . 
QA 4 HOH 128 728 14  HOH HOH A . 
QA 4 HOH 129 729 47  HOH HOH A . 
QA 4 HOH 130 730 45  HOH HOH A . 
QA 4 HOH 131 731 33  HOH HOH A . 
QA 4 HOH 132 732 193 HOH HOH A . 
QA 4 HOH 133 733 123 HOH HOH A . 
QA 4 HOH 134 734 134 HOH HOH A . 
QA 4 HOH 135 735 57  HOH HOH A . 
QA 4 HOH 136 736 198 HOH HOH A . 
QA 4 HOH 137 737 106 HOH HOH A . 
QA 4 HOH 138 738 167 HOH HOH A . 
QA 4 HOH 139 739 107 HOH HOH A . 
QA 4 HOH 140 740 52  HOH HOH A . 
QA 4 HOH 141 741 64  HOH HOH A . 
QA 4 HOH 142 742 232 HOH HOH A . 
QA 4 HOH 143 743 318 HOH HOH A . 
QA 4 HOH 144 744 238 HOH HOH A . 
QA 4 HOH 145 745 316 HOH HOH A . 
QA 4 HOH 146 746 187 HOH HOH A . 
QA 4 HOH 147 747 237 HOH HOH A . 
QA 4 HOH 148 748 86  HOH HOH A . 
QA 4 HOH 149 749 234 HOH HOH A . 
QA 4 HOH 150 750 253 HOH HOH A . 
QA 4 HOH 151 751 119 HOH HOH A . 
QA 4 HOH 152 752 178 HOH HOH A . 
QA 4 HOH 153 753 191 HOH HOH A . 
QA 4 HOH 154 754 150 HOH HOH A . 
QA 4 HOH 155 755 175 HOH HOH A . 
QA 4 HOH 156 756 42  HOH HOH A . 
QA 4 HOH 157 757 76  HOH HOH A . 
QA 4 HOH 158 758 320 HOH HOH A . 
QA 4 HOH 159 759 264 HOH HOH A . 
QA 4 HOH 160 760 334 HOH HOH A . 
QA 4 HOH 161 761 122 HOH HOH A . 
QA 4 HOH 162 762 174 HOH HOH A . 
QA 4 HOH 163 763 161 HOH HOH A . 
QA 4 HOH 164 764 326 HOH HOH A . 
QA 4 HOH 165 765 27  HOH HOH A . 
QA 4 HOH 166 766 217 HOH HOH A . 
QA 4 HOH 167 767 66  HOH HOH A . 
QA 4 HOH 168 768 139 HOH HOH A . 
QA 4 HOH 169 769 159 HOH HOH A . 
QA 4 HOH 170 770 144 HOH HOH A . 
QA 4 HOH 171 771 200 HOH HOH A . 
QA 4 HOH 172 772 171 HOH HOH A . 
QA 4 HOH 173 773 251 HOH HOH A . 
QA 4 HOH 174 774 177 HOH HOH A . 
QA 4 HOH 175 775 63  HOH HOH A . 
QA 4 HOH 176 776 168 HOH HOH A . 
QA 4 HOH 177 777 219 HOH HOH A . 
QA 4 HOH 178 778 180 HOH HOH A . 
QA 4 HOH 179 779 328 HOH HOH A . 
QA 4 HOH 180 780 90  HOH HOH A . 
QA 4 HOH 181 781 259 HOH HOH A . 
QA 4 HOH 182 782 71  HOH HOH A . 
QA 4 HOH 183 783 173 HOH HOH A . 
QA 4 HOH 184 784 311 HOH HOH A . 
QA 4 HOH 185 785 21  HOH HOH A . 
QA 4 HOH 186 786 113 HOH HOH A . 
QA 4 HOH 187 787 329 HOH HOH A . 
QA 4 HOH 188 788 61  HOH HOH A . 
QA 4 HOH 189 789 196 HOH HOH A . 
QA 4 HOH 190 790 327 HOH HOH A . 
QA 4 HOH 191 791 126 HOH HOH A . 
QA 4 HOH 192 792 335 HOH HOH A . 
QA 4 HOH 193 793 170 HOH HOH A . 
QA 4 HOH 194 794 51  HOH HOH A . 
QA 4 HOH 195 795 181 HOH HOH A . 
QA 4 HOH 196 796 294 HOH HOH A . 
QA 4 HOH 197 797 321 HOH HOH A . 
QA 4 HOH 198 798 272 HOH HOH A . 
QA 4 HOH 199 799 153 HOH HOH A . 
QA 4 HOH 200 800 129 HOH HOH A . 
QA 4 HOH 201 801 155 HOH HOH A . 
QA 4 HOH 202 802 255 HOH HOH A . 
QA 4 HOH 203 803 207 HOH HOH A . 
QA 4 HOH 204 804 115 HOH HOH A . 
QA 4 HOH 205 805 303 HOH HOH A . 
QA 4 HOH 206 806 308 HOH HOH A . 
QA 4 HOH 207 807 275 HOH HOH A . 
QA 4 HOH 208 808 94  HOH HOH A . 
QA 4 HOH 209 809 99  HOH HOH A . 
QA 4 HOH 210 810 116 HOH HOH A . 
QA 4 HOH 211 811 77  HOH HOH A . 
RA 4 HOH 1   101 81  HOH HOH B . 
RA 4 HOH 2   102 221 HOH HOH B . 
RA 4 HOH 3   103 6   HOH HOH B . 
RA 4 HOH 4   104 231 HOH HOH B . 
RA 4 HOH 5   105 70  HOH HOH B . 
RA 4 HOH 6   106 36  HOH HOH B . 
RA 4 HOH 7   107 215 HOH HOH B . 
RA 4 HOH 8   108 263 HOH HOH B . 
RA 4 HOH 9   109 80  HOH HOH B . 
RA 4 HOH 10  110 204 HOH HOH B . 
RA 4 HOH 11  111 145 HOH HOH B . 
RA 4 HOH 12  112 101 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    ALY 
_pdbx_struct_mod_residue.label_seq_id     12 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     ALY 
_pdbx_struct_mod_residue.auth_seq_id      14 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1070  ? 
1 MORE         -5    ? 
1 'SSA (A^2)'  11640 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-12-06 
2 'Structure model' 1 1 2018-01-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0158 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.27   2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .        5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              292 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              292 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              292 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.15 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.15 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 201 ? ? 100.30 -11.21 
2 1 ASP A 250 ? ? -94.57 57.05  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       811 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.19 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 194 ? CD  ? A LYS 23  CD  
2  1 Y 1 A LYS 194 ? CE  ? A LYS 23  CE  
3  1 Y 1 A LYS 194 ? NZ  ? A LYS 23  NZ  
4  1 Y 1 A ARG 209 ? CD  ? A ARG 38  CD  
5  1 Y 1 A ARG 209 ? NE  ? A ARG 38  NE  
6  1 Y 1 A ARG 209 ? CZ  ? A ARG 38  CZ  
7  1 Y 1 A ARG 209 ? NH1 ? A ARG 38  NH1 
8  1 Y 1 A ARG 209 ? NH2 ? A ARG 38  NH2 
9  1 Y 1 A LYS 233 ? CD  ? A LYS 62  CD  
10 1 Y 1 A LYS 233 ? CE  ? A LYS 62  CE  
11 1 Y 1 A LYS 233 ? NZ  ? A LYS 62  NZ  
12 1 Y 1 A ASN 236 ? CG  ? A ASN 65  CG  
13 1 Y 1 A ASN 236 ? OD1 ? A ASN 65  OD1 
14 1 Y 1 A ASN 236 ? ND2 ? A ASN 65  ND2 
15 1 Y 1 A LYS 237 ? CG  ? A LYS 66  CG  
16 1 Y 1 A LYS 237 ? CD  ? A LYS 66  CD  
17 1 Y 1 A LYS 237 ? CE  ? A LYS 66  CE  
18 1 Y 1 A LYS 237 ? NZ  ? A LYS 66  NZ  
19 1 Y 1 A LYS 239 ? CE  ? A LYS 68  CE  
20 1 Y 1 A LYS 239 ? NZ  ? A LYS 68  NZ  
21 1 Y 1 A ASP 256 ? CG  ? A ASP 85  CG  
22 1 Y 1 A ASP 256 ? OD1 ? A ASP 85  OD1 
23 1 Y 1 A ASP 256 ? OD2 ? A ASP 85  OD2 
24 1 Y 1 A LYS 257 ? CG  ? A LYS 86  CG  
25 1 Y 1 A LYS 257 ? CD  ? A LYS 86  CD  
26 1 Y 1 A LYS 257 ? CE  ? A LYS 86  CE  
27 1 Y 1 A LYS 257 ? NZ  ? A LYS 86  NZ  
28 1 Y 1 A ASP 270 ? CG  ? A ASP 99  CG  
29 1 Y 1 A ASP 270 ? OD1 ? A ASP 99  OD1 
30 1 Y 1 A ASP 270 ? OD2 ? A ASP 99  OD2 
31 1 Y 1 A TRP 275 ? CE3 ? A TRP 104 CE3 
32 1 Y 1 A TRP 275 ? CZ2 ? A TRP 104 CZ2 
33 1 Y 1 A TRP 275 ? CZ3 ? A TRP 104 CZ3 
34 1 Y 1 A TRP 275 ? CH2 ? A TRP 104 CH2 
35 1 Y 1 A LYS 288 ? CE  ? A LYS 117 CE  
36 1 Y 1 A LYS 288 ? NZ  ? A LYS 117 NZ  
37 1 Y 1 A LYS 290 ? CE  ? A LYS 119 CE  
38 1 Y 1 A LYS 290 ? NZ  ? A LYS 119 NZ  
39 1 Y 1 A LYS 349 ? CE  ? A LYS 178 CE  
40 1 Y 1 A LYS 349 ? NZ  ? A LYS 178 NZ  
41 1 Y 1 A LYS 364 ? NZ  ? A LYS 193 NZ  
42 1 Y 1 A ARG 384 ? CG  ? A ARG 213 CG  
43 1 Y 1 A ARG 384 ? CD  ? A ARG 213 CD  
44 1 Y 1 A ARG 384 ? NE  ? A ARG 213 NE  
45 1 Y 1 A ARG 384 ? CZ  ? A ARG 213 CZ  
46 1 Y 1 A ARG 384 ? NH1 ? A ARG 213 NH1 
47 1 Y 1 A ARG 384 ? NH2 ? A ARG 213 NH2 
48 1 Y 1 A LYS 402 ? CE  ? A LYS 231 CE  
49 1 Y 1 A LYS 402 ? NZ  ? A LYS 231 NZ  
50 1 Y 1 A SER 405 ? OG  ? A SER 234 OG  
51 1 Y 1 A ALA 406 ? C   ? A ALA 235 C   
52 1 Y 1 A ALA 406 ? O   ? A ALA 235 O   
53 1 Y 1 A ALA 406 ? CB  ? A ALA 235 CB  
54 1 Y 1 B SER 10  ? OG  ? B SER 8   OG  
55 1 Y 1 B ARG 17  ? CG  ? B ARG 15  CG  
56 1 Y 1 B ARG 17  ? CD  ? B ARG 15  CD  
57 1 Y 1 B ARG 17  ? NE  ? B ARG 15  NE  
58 1 Y 1 B ARG 17  ? CZ  ? B ARG 15  CZ  
59 1 Y 1 B ARG 17  ? NH1 ? B ARG 15  NH1 
60 1 Y 1 B ARG 17  ? NH2 ? B ARG 15  NH2 
61 1 Y 1 B LYS 18  ? CG  ? B LYS 16  CG  
62 1 Y 1 B LYS 18  ? CD  ? B LYS 16  CD  
63 1 Y 1 B LYS 18  ? CE  ? B LYS 16  CE  
64 1 Y 1 B LYS 18  ? NZ  ? B LYS 16  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 172 ? A MET 1   
2  1 Y 1 A HIS 173 ? A HIS 2   
3  1 Y 1 A HIS 174 ? A HIS 3   
4  1 Y 1 A HIS 175 ? A HIS 4   
5  1 Y 1 A HIS 176 ? A HIS 5   
6  1 Y 1 A HIS 177 ? A HIS 6   
7  1 Y 1 A HIS 178 ? A HIS 7   
8  1 Y 1 A SER 179 ? A SER 8   
9  1 Y 1 A SER 180 ? A SER 9   
10 1 Y 1 A GLY 181 ? A GLY 10  
11 1 Y 1 A ARG 182 ? A ARG 11  
12 1 Y 1 A GLU 183 ? A GLU 12  
13 1 Y 1 A ASN 184 ? A ASN 13  
14 1 Y 1 A LEU 185 ? A LEU 14  
15 1 Y 1 A TYR 186 ? A TYR 15  
16 1 Y 1 A PHE 187 ? A PHE 16  
17 1 Y 1 A GLN 188 ? A GLN 17  
18 1 Y 1 A GLY 271 ? A GLY 100 
19 1 Y 1 A ASN 272 ? A ASN 101 
20 1 Y 1 A GLN 273 ? A GLN 102 
21 1 Y 1 A SER 407 ? A SER 236 
22 1 Y 1 A ALA 408 ? A ALA 237 
23 1 Y 1 A LEU 409 ? A LEU 238 
24 1 Y 1 A GLU 410 ? A GLU 239 
25 1 Y 1 B ACE 3   ? B ACE 1   
26 1 Y 1 B LYS 4   ? B LYS 2   
27 1 Y 1 B GLN 5   ? B GLN 3   
28 1 Y 1 B THR 6   ? B THR 4   
29 1 Y 1 B ALA 7   ? B ALA 5   
30 1 Y 1 B ARG 8   ? B ARG 6   
31 1 Y 1 B LYS 9   ? B LYS 7   
32 1 Y 1 B GLN 19  ? B GLN 17  
33 1 Y 1 B NH2 20  ? B NH2 18  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'UNKNOWN ATOM OR ION' UNX 
4 water                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#