data_6BJV
# 
_entry.id   6BJV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BJV         
WWPDB D_1000230555 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BJV 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Foss, D.V.'    1 0000-0003-2937-4703 
'Schirle, N.'   2 ?                   
'Pezacki, J.P.' 3 ?                   
'Macrae, I.J.'  4 ?                   
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? NE ? ? primary 'Febs Open Bio' ?      ?    2211-5463 ? ? 9  ? 1042 1051 
'Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.' 2019 ? 
10.1002/2211-5463.12644 31021526 ? 
? ? ? ? ? ? ? US ? ? 1       Biochemistry    BICHAW 0353 0006-2960 ? ? 50 ? 7745 7755 
'Enhanced specificity of the viral suppressor of RNA silencing protein p19 toward sequestering of human microRNA-122' 2011 ? 
10.1021/bi2008273       21819044 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Foss, D.V.'      1 ? 
primary 'Schirle, N.T.'   2 ? 
primary 'MacRae, I.J.'    3 ? 
primary 'Pezacki, J.P.'   4 ? 
1       'Cheng, J.'       5 ? 
1       'Danielson, D.C.' 6 ? 
1       'Nasheri, N.'     7 ? 
1       'Singaravelu, R.' 8 ? 
1       'Pezacki, J.P.'   9 ? 
# 
_cell.angle_alpha                  109.440 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   111.110 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  96.780 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6BJV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     46.586 
_cell.length_a_esd                 ? 
_cell.length_b                     46.997 
_cell.length_b_esd                 ? 
_cell.length_c                     54.883 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6BJV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'RNA silencing suppressor p19'                                                   19358.373 2  ? ? ? ? 
2 polymer syn 
;RNA (5'-R(P*UP*CP*GP*AP*AP*GP*UP*AP*UP*UP*CP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3')
;
6666.964  1  ? ? ? ? 
3 polymer syn 
;RNA (5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*AP*UP*U)-3')
;
6690.004  1  ? ? ? ? 
4 water   nat water                                                                            18.015    65 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '19 kDa symptom severity modulator' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
A,B ? 
2 polyribonucleotide no no UCGAAGUAUUCCGCGUACGUU UCGAAGUAUUCCGCGUACGUU C   ? 
3 polyribonucleotide no no CGUACGCGGAAUACUUCGAUU CGUACGCGGAAUACUUCGAUU D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ARG n 
1 4   ALA n 
1 5   ILE n 
1 6   GLN n 
1 7   GLY n 
1 8   ASN n 
1 9   ASP n 
1 10  THR n 
1 11  ARG n 
1 12  GLU n 
1 13  GLN n 
1 14  ALA n 
1 15  ASN n 
1 16  GLY n 
1 17  GLU n 
1 18  ARG n 
1 19  TRP n 
1 20  ASP n 
1 21  GLY n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  GLY n 
1 26  ILE n 
1 27  THR n 
1 28  SER n 
1 29  PRO n 
1 30  PHE n 
1 31  LYS n 
1 32  LEU n 
1 33  PRO n 
1 34  ASP n 
1 35  GLU n 
1 36  SER n 
1 37  PRO n 
1 38  SER n 
1 39  TRP n 
1 40  THR n 
1 41  GLU n 
1 42  TRP n 
1 43  ARG n 
1 44  LEU n 
1 45  TYR n 
1 46  ASN n 
1 47  ASP n 
1 48  GLU n 
1 49  THR n 
1 50  ASN n 
1 51  SER n 
1 52  ASN n 
1 53  GLN n 
1 54  ASP n 
1 55  ASN n 
1 56  PRO n 
1 57  LEU n 
1 58  GLY n 
1 59  PHE n 
1 60  LYS n 
1 61  GLU n 
1 62  SER n 
1 63  TRP n 
1 64  GLY n 
1 65  PHE n 
1 66  GLY n 
1 67  LYS n 
1 68  VAL n 
1 69  VAL n 
1 70  PHE n 
1 71  LYS n 
1 72  ARG n 
1 73  TYR n 
1 74  LEU n 
1 75  ARG n 
1 76  TYR n 
1 77  ASP n 
1 78  ARG n 
1 79  THR n 
1 80  GLU n 
1 81  ALA n 
1 82  SER n 
1 83  LEU n 
1 84  HIS n 
1 85  ARG n 
1 86  VAL n 
1 87  LEU n 
1 88  GLY n 
1 89  SER n 
1 90  TRP n 
1 91  THR n 
1 92  GLY n 
1 93  ASP n 
1 94  SER n 
1 95  VAL n 
1 96  ASN n 
1 97  TYR n 
1 98  ALA n 
1 99  ALA n 
1 100 SER n 
1 101 ARG n 
1 102 PHE n 
1 103 LEU n 
1 104 GLY n 
1 105 ALA n 
1 106 ASN n 
1 107 GLN n 
1 108 VAL n 
1 109 GLY n 
1 110 CYS n 
1 111 THR n 
1 112 TYR n 
1 113 SER n 
1 114 ILE n 
1 115 ARG n 
1 116 PHE n 
1 117 ARG n 
1 118 GLY n 
1 119 VAL n 
1 120 SER n 
1 121 VAL n 
1 122 THR n 
1 123 ILE n 
1 124 SER n 
1 125 GLY n 
1 126 GLY n 
1 127 SER n 
1 128 ARG n 
1 129 THR n 
1 130 LEU n 
1 131 GLN n 
1 132 HIS n 
1 133 LEU n 
1 134 CYS n 
1 135 GLU n 
1 136 MET n 
1 137 ALA n 
1 138 ILE n 
1 139 ARG n 
1 140 SER n 
1 141 LYS n 
1 142 GLN n 
1 143 GLU n 
1 144 LEU n 
1 145 LEU n 
1 146 GLN n 
1 147 LEU n 
1 148 THR n 
1 149 PRO n 
1 150 VAL n 
1 151 GLU n 
1 152 VAL n 
1 153 GLU n 
1 154 SER n 
1 155 ASN n 
1 156 VAL n 
1 157 SER n 
1 158 ARG n 
1 159 GLY n 
1 160 CYS n 
1 161 PRO n 
1 162 GLU n 
1 163 GLY n 
1 164 ILE n 
1 165 GLU n 
1 166 THR n 
1 167 PHE n 
1 168 LYS n 
1 169 LYS n 
1 170 GLU n 
1 171 SER n 
1 172 GLU n 
2 1   U   n 
2 2   C   n 
2 3   G   n 
2 4   A   n 
2 5   A   n 
2 6   G   n 
2 7   U   n 
2 8   A   n 
2 9   U   n 
2 10  U   n 
2 11  C   n 
2 12  C   n 
2 13  G   n 
2 14  C   n 
2 15  G   n 
2 16  U   n 
2 17  A   n 
2 18  C   n 
2 19  G   n 
2 20  U   n 
2 21  U   n 
3 1   C   n 
3 2   G   n 
3 3   U   n 
3 4   A   n 
3 5   C   n 
3 6   G   n 
3 7   C   n 
3 8   G   n 
3 9   G   n 
3 10  A   n 
3 11  A   n 
3 12  U   n 
3 13  A   n 
3 14  C   n 
3 15  U   n 
3 16  U   n 
3 17  C   n 
3 18  G   n 
3 19  A   n 
3 20  U   n 
3 21  U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   172 
_entity_src_gen.gene_src_common_name               CIRV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ORF4 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Carnation Italian ringspot virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     39443 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 21 Lampyridae ? 7049 ? 
3 1 sample 1 21 Lampyridae ? 7049 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP P19_CIRV Q66104 ? 1 
;MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE
ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC
PEGIETFKKESE
;
1 
2 PDB 6BJV     6BJV   ? 2 ? 1 
3 PDB 6BJV     6BJV   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6BJV A 1 ? 172 ? Q66104 1 ? 172 ? 1 172 
2 1 6BJV B 1 ? 172 ? Q66104 1 ? 172 ? 1 172 
3 2 6BJV C 1 ? 21  ? 6BJV   1 ? 21  ? 1 21  
4 3 6BJV D 1 ? 21  ? 6BJV   1 ? 21  ? 1 21  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BJV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.45 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '3-12% PEG 1500, 100 mM Sodium Acetate pH 4.6, 10-40 mM MgCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           70 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-03-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6BJV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.198 
_reflns.d_resolution_low                 46.807 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18756 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.147 
_reflns.pdbx_Rpim_I_all                  0.092 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.25 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.84 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           10 
_reflns_shell.percent_possible_all        68.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.741 
_reflns_shell.pdbx_Rpim_I_all             0.478 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                239.750 
_refine.B_iso_mean                               78.1630 
_refine.B_iso_min                                14.740 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6BJV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.1980 
_refine.ls_d_res_low                             46.8070 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18756 
_refine.ls_number_reflns_R_free                  960 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.4700 
_refine.ls_percent_reflns_R_free                 5.1200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2620 
_refine.ls_R_factor_R_free                       0.2971 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2600 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.970 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1RPU 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 41.5200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.1980 
_refine_hist.d_res_low                        46.8070 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               3291 
_refine_hist.pdbx_number_residues_total       336 
_refine_hist.pdbx_B_iso_mean_solvent          52.58 
_refine_hist.pdbx_number_atoms_protein        2336 
_refine_hist.pdbx_number_atoms_nucleic_acid   890 
# 
_struct.entry_id                     6BJV 
_struct.title                        'CIRV p19 protein in complex with siRNA' 
_struct.pdbx_descriptor              'RNA silencing suppressor p19/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BJV 
_struct_keywords.text            
'Viral Suppressor, RNA silencing siRNA binding protein p19, altered affinity for microRNA, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 6   ? GLU A 17  ? GLN A 6   GLU A 17  1 ? 12 
HELX_P HELX_P2  AA2 SER A 38  ? ASN A 46  ? SER A 38  ASN A 46  1 ? 9  
HELX_P HELX_P3  AA3 THR A 79  ? GLY A 88  ? THR A 79  GLY A 88  1 ? 10 
HELX_P HELX_P4  AA4 THR A 91  ? SER A 100 ? THR A 91  SER A 100 1 ? 10 
HELX_P HELX_P5  AA5 THR A 129 ? LEU A 145 ? THR A 129 LEU A 145 1 ? 17 
HELX_P HELX_P6  AA6 GLY B 7   ? ARG B 18  ? GLY B 7   ARG B 18  1 ? 12 
HELX_P HELX_P7  AA7 SER B 38  ? LEU B 44  ? SER B 38  LEU B 44  1 ? 7  
HELX_P HELX_P8  AA8 THR B 79  ? GLY B 88  ? THR B 79  GLY B 88  1 ? 10 
HELX_P HELX_P9  AA9 THR B 91  ? ARG B 101 ? THR B 91  ARG B 101 1 ? 11 
HELX_P HELX_P10 AB1 THR B 129 ? LEU B 145 ? THR B 129 LEU B 145 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C U 1  N3 ? ? ? 1_555 D A 19 N1 ? ? C U 1  D A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C U 1  O4 ? ? ? 1_555 D A 19 N6 ? ? C U 1  D A 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C C 2  N3 ? ? ? 1_555 D G 18 N1 ? ? C C 2  D G 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C C 2  N4 ? ? ? 1_555 D G 18 O6 ? ? C C 2  D G 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C C 2  O2 ? ? ? 1_555 D G 18 N2 ? ? C C 2  D G 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C G 3  N1 ? ? ? 1_555 D C 17 N3 ? ? C G 3  D C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C G 3  N2 ? ? ? 1_555 D C 17 O2 ? ? C G 3  D C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C G 3  O6 ? ? ? 1_555 D C 17 N4 ? ? C G 3  D C 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C A 4  N1 ? ? ? 1_555 D U 16 N3 ? ? C A 4  D U 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C A 4  N6 ? ? ? 1_555 D U 16 O4 ? ? C A 4  D U 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C A 5  N1 ? ? ? 1_555 D U 15 N3 ? ? C A 5  D U 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C A 5  N6 ? ? ? 1_555 D U 15 O4 ? ? C A 5  D U 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C G 6  N1 ? ? ? 1_555 D C 14 N3 ? ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C G 6  N2 ? ? ? 1_555 D C 14 O2 ? ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C G 6  O6 ? ? ? 1_555 D C 14 N4 ? ? C G 6  D C 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C U 7  N3 ? ? ? 1_555 D A 13 N1 ? ? C U 7  D A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C U 7  O4 ? ? ? 1_555 D A 13 N6 ? ? C U 7  D A 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C A 8  N1 ? ? ? 1_555 D U 12 N3 ? ? C A 8  D U 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C A 8  N6 ? ? ? 1_555 D U 12 O4 ? ? C A 8  D U 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C U 9  N3 ? ? ? 1_555 D A 11 N1 ? ? C U 9  D A 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C U 9  O4 ? ? ? 1_555 D A 11 N6 ? ? C U 9  D A 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C U 10 N3 ? ? ? 1_555 D A 10 N1 ? ? C U 10 D A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C U 10 O4 ? ? ? 1_555 D A 10 N6 ? ? C U 10 D A 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C C 11 N3 ? ? ? 1_555 D G 9  N1 ? ? C C 11 D G 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C C 11 N4 ? ? ? 1_555 D G 9  O6 ? ? C C 11 D G 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C C 11 O2 ? ? ? 1_555 D G 9  N2 ? ? C C 11 D G 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C C 12 N3 ? ? ? 1_555 D G 8  N1 ? ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C C 12 N4 ? ? ? 1_555 D G 8  O6 ? ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C C 12 O2 ? ? ? 1_555 D G 8  N2 ? ? C C 12 D G 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C G 13 N1 ? ? ? 1_555 D C 7  N3 ? ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C G 13 N2 ? ? ? 1_555 D C 7  O2 ? ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C G 13 O6 ? ? ? 1_555 D C 7  N4 ? ? C G 13 D C 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C C 14 N3 ? ? ? 1_555 D G 6  N1 ? ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C C 14 N4 ? ? ? 1_555 D G 6  O6 ? ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C C 14 O2 ? ? ? 1_555 D G 6  N2 ? ? C C 14 D G 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C G 15 N1 ? ? ? 1_555 D C 5  N3 ? ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C G 15 N2 ? ? ? 1_555 D C 5  O2 ? ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C G 15 O6 ? ? ? 1_555 D C 5  N4 ? ? C G 15 D C 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C U 16 N3 ? ? ? 1_555 D A 4  N1 ? ? C U 16 D A 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C U 16 O4 ? ? ? 1_555 D A 4  N6 ? ? C U 16 D A 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C A 17 N1 ? ? ? 1_555 D U 3  N3 ? ? C A 17 D U 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C A 17 N6 ? ? ? 1_555 D U 3  O4 ? ? C A 17 D U 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C C 18 N3 ? ? ? 1_555 D G 2  N1 ? ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C C 18 N4 ? ? ? 1_555 D G 2  O6 ? ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C C 18 O2 ? ? ? 1_555 D G 2  N2 ? ? C C 18 D G 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C G 19 N1 ? ? ? 1_555 D C 1  N3 ? ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? C G 19 N2 ? ? ? 1_555 D C 1  O2 ? ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? C G 19 O6 ? ? ? 1_555 D C 1  N4 ? ? C G 19 D C 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 2  A . ? GLU 2  A ARG 3  A ? ARG 3  A 1 1.62  
2 ARG 3  A . ? ARG 3  A ALA 4  A ? ALA 4  A 1 8.10  
3 ALA 4  A . ? ALA 4  A ILE 5  A ? ILE 5  A 1 0.35  
4 GLY 21 A . ? GLY 21 A GLY 22 A ? GLY 22 A 1 3.41  
5 GLY 22 A . ? GLY 22 A SER 23 A ? SER 23 A 1 19.75 
6 SER 23 A . ? SER 23 A GLY 24 A ? GLY 24 A 1 -1.61 
7 ASP 54 A . ? ASP 54 A ASN 55 A ? ASN 55 A 1 0.19  
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 68  ? ARG A 75  ? VAL A 68  ARG A 75  
AA1 2 GLY A 58  ? PHE A 65  ? GLY A 58  PHE A 65  
AA1 3 GLY A 109 ? PHE A 116 ? GLY A 109 PHE A 116 
AA1 4 VAL A 119 ? GLY A 126 ? VAL A 119 GLY A 126 
AA1 5 VAL B 119 ? GLY B 126 ? VAL B 119 GLY B 126 
AA1 6 GLY B 109 ? PHE B 116 ? GLY B 109 PHE B 116 
AA1 7 PHE B 59  ? PHE B 65  ? PHE B 59  PHE B 65  
AA1 8 VAL B 68  ? LEU B 74  ? VAL B 68  LEU B 74  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 70  ? O PHE A 70  N TRP A 63  ? N TRP A 63  
AA1 2 3 N LYS A 60  ? N LYS A 60  O ARG A 115 ? O ARG A 115 
AA1 3 4 N TYR A 112 ? N TYR A 112 O ILE A 123 ? O ILE A 123 
AA1 4 5 N SER A 124 ? N SER A 124 O SER B 120 ? O SER B 120 
AA1 5 6 O ILE B 123 ? O ILE B 123 N TYR B 112 ? N TYR B 112 
AA1 6 7 O THR B 111 ? O THR B 111 N GLY B 64  ? N GLY B 64  
AA1 7 8 N TRP B 63  ? N TRP B 63  O PHE B 70  ? O PHE B 70  
# 
_atom_sites.entry_id                    6BJV 
_atom_sites.fract_transf_matrix[1][1]   0.021466 
_atom_sites.fract_transf_matrix[1][2]   0.002554 
_atom_sites.fract_transf_matrix[1][3]   0.010198 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021428 
_atom_sites.fract_transf_matrix[2][3]   0.009498 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021364 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N      . GLU A 1 2   ? -3.030  30.985 68.207 1.00 105.56 ? 2   GLU A N      1 
ATOM   2    C CA     . GLU A 1 2   ? -4.127  30.613 69.088 1.00 112.05 ? 2   GLU A CA     1 
ATOM   3    C C      . GLU A 1 2   ? -5.130  31.726 69.372 1.00 116.13 ? 2   GLU A C      1 
ATOM   4    O O      . GLU A 1 2   ? -6.284  31.623 68.989 1.00 121.40 ? 2   GLU A O      1 
ATOM   5    C CB     . GLU A 1 2   ? -3.594  30.046 70.396 1.00 108.21 ? 2   GLU A CB     1 
ATOM   6    C CG     . GLU A 1 2   ? -3.795  28.550 70.558 1.00 112.93 ? 2   GLU A CG     1 
ATOM   7    C CD     . GLU A 1 2   ? -2.701  27.926 71.379 1.00 110.84 ? 2   GLU A CD     1 
ATOM   8    O OE1    . GLU A 1 2   ? -1.631  28.543 71.486 1.00 104.99 ? 2   GLU A OE1    1 
ATOM   9    O OE2    . GLU A 1 2   ? -2.908  26.825 71.915 1.00 115.51 ? 2   GLU A OE2    1 
ATOM   10   N N      . ARG A 1 3   ? -4.715  32.783 70.052 1.00 109.08 ? 3   ARG A N      1 
ATOM   11   C CA     . ARG A 1 3   ? -3.360  32.964 70.514 1.00 102.64 ? 3   ARG A CA     1 
ATOM   12   C C      . ARG A 1 3   ? -3.360  33.216 71.987 1.00 104.88 ? 3   ARG A C      1 
ATOM   13   O O      . ARG A 1 3   ? -2.404  33.764 72.493 1.00 98.94  ? 3   ARG A O      1 
ATOM   14   C CB     . ARG A 1 3   ? -2.724  34.197 69.828 1.00 100.40 ? 3   ARG A CB     1 
ATOM   15   C CG     . ARG A 1 3   ? -1.196  34.227 69.828 1.00 93.71  ? 3   ARG A CG     1 
ATOM   16   C CD     . ARG A 1 3   ? -0.595  35.512 69.284 1.00 91.38  ? 3   ARG A CD     1 
ATOM   17   N NE     . ARG A 1 3   ? -0.396  35.531 67.837 1.00 88.89  ? 3   ARG A NE     1 
ATOM   18   C CZ     . ARG A 1 3   ? 0.768   35.757 67.230 1.00 82.17  ? 3   ARG A CZ     1 
ATOM   19   N NH1    . ARG A 1 3   ? 1.869   35.970 67.918 1.00 79.19  ? 3   ARG A NH1    1 
ATOM   20   N NH2    . ARG A 1 3   ? 0.836   35.790 65.916 1.00 81.45  ? 3   ARG A NH2    1 
ATOM   21   N N      . ALA A 1 4   ? -4.414  32.882 72.713 1.00 153.14 ? 4   ALA A N      1 
ATOM   22   C CA     . ALA A 1 4   ? -5.613  32.128 72.359 1.00 158.60 ? 4   ALA A CA     1 
ATOM   23   C C      . ALA A 1 4   ? -6.692  32.368 73.413 1.00 166.41 ? 4   ALA A C      1 
ATOM   24   O O      . ALA A 1 4   ? -6.387  32.784 74.530 1.00 165.73 ? 4   ALA A O      1 
ATOM   25   C CB     . ALA A 1 4   ? -5.301  30.645 72.237 1.00 156.15 ? 4   ALA A CB     1 
ATOM   26   N N      . ILE A 1 5   ? -7.949  32.110 73.063 1.00 131.83 ? 5   ILE A N      1 
ATOM   27   C CA     . ILE A 1 5   ? -8.308  31.612 71.741 1.00 132.64 ? 5   ILE A CA     1 
ATOM   28   C C      . ILE A 1 5   ? -8.438  32.768 70.752 1.00 136.34 ? 5   ILE A C      1 
ATOM   29   O O      . ILE A 1 5   ? -8.273  32.583 69.548 1.00 134.51 ? 5   ILE A O      1 
ATOM   30   C CB     . ILE A 1 5   ? -9.608  30.785 71.797 1.00 137.14 ? 5   ILE A CB     1 
ATOM   31   C CG1    . ILE A 1 5   ? -9.924  30.189 70.424 1.00 134.61 ? 5   ILE A CG1    1 
ATOM   32   C CG2    . ILE A 1 5   ? -10.765 31.640 72.292 1.00 145.11 ? 5   ILE A CG2    1 
ATOM   33   C CD1    . ILE A 1 5   ? -8.870  29.230 69.916 1.00 129.92 ? 5   ILE A CD1    1 
ATOM   34   N N      . GLN A 1 6   ? -8.740  33.959 71.264 1.00 120.09 ? 6   GLN A N      1 
ATOM   35   C CA     . GLN A 1 6   ? -8.830  35.154 70.430 1.00 123.14 ? 6   GLN A CA     1 
ATOM   36   C C      . GLN A 1 6   ? -7.419  35.613 70.084 1.00 114.62 ? 6   GLN A C      1 
ATOM   37   O O      . GLN A 1 6   ? -6.717  36.181 70.927 1.00 111.80 ? 6   GLN A O      1 
ATOM   38   C CB     . GLN A 1 6   ? -9.606  36.256 71.146 1.00 130.91 ? 6   GLN A CB     1 
ATOM   39   C CG     . GLN A 1 6   ? -11.055 35.912 71.465 1.00 138.15 ? 6   GLN A CG     1 
ATOM   40   C CD     . GLN A 1 6   ? -11.208 35.153 72.770 1.00 137.77 ? 6   GLN A CD     1 
ATOM   41   O OE1    . GLN A 1 6   ? -10.247 34.987 73.521 1.00 132.81 ? 6   GLN A OE1    1 
ATOM   42   N NE2    . GLN A 1 6   ? -12.422 34.691 73.047 1.00 142.27 ? 6   GLN A NE2    1 
ATOM   43   N N      . GLY A 1 7   ? -7.002  35.373 68.840 1.00 132.45 ? 7   GLY A N      1 
ATOM   44   C CA     . GLY A 1 7   ? -5.643  35.703 68.445 1.00 121.95 ? 7   GLY A CA     1 
ATOM   45   C C      . GLY A 1 7   ? -5.336  37.186 68.508 1.00 120.48 ? 7   GLY A C      1 
ATOM   46   O O      . GLY A 1 7   ? -4.204  37.577 68.805 1.00 112.10 ? 7   GLY A O      1 
ATOM   47   N N      . ASN A 1 8   ? -6.328  38.030 68.227 1.00 107.43 ? 8   ASN A N      1 
ATOM   48   C CA     . ASN A 1 8   ? -6.128  39.473 68.216 1.00 103.19 ? 8   ASN A CA     1 
ATOM   49   C C      . ASN A 1 8   ? -6.318  40.117 69.582 1.00 106.49 ? 8   ASN A C      1 
ATOM   50   O O      . ASN A 1 8   ? -5.924  41.274 69.760 1.00 102.44 ? 8   ASN A O      1 
ATOM   51   C CB     . ASN A 1 8   ? -7.085  40.130 67.215 1.00 102.83 ? 8   ASN A CB     1 
ATOM   52   C CG     . ASN A 1 8   ? -6.738  39.802 65.777 1.00 95.18  ? 8   ASN A CG     1 
ATOM   53   O OD1    . ASN A 1 8   ? -5.575  39.577 65.443 1.00 88.37  ? 8   ASN A OD1    1 
ATOM   54   N ND2    . ASN A 1 8   ? -7.748  39.779 64.915 1.00 95.19  ? 8   ASN A ND2    1 
ATOM   55   H H      . ASN A 1 8   ? -7.131  37.788 68.039 1.00 129.35 ? 8   ASN A H      1 
ATOM   56   H HA     . ASN A 1 8   ? -5.222  39.660 67.925 1.00 121.19 ? 8   ASN A HA     1 
ATOM   57   H HB2    . ASN A 1 8   ? -7.987  39.815 67.386 1.00 120.54 ? 8   ASN A HB2    1 
ATOM   58   H HB3    . ASN A 1 8   ? -7.044  41.093 67.323 1.00 120.54 ? 8   ASN A HB3    1 
ATOM   59   H HD21   . ASN A 1 8   ? -7.602  39.598 64.087 1.00 121.09 ? 8   ASN A HD21   1 
ATOM   60   H HD22   . ASN A 1 8   ? -8.547  39.944 65.184 1.00 121.09 ? 8   ASN A HD22   1 
ATOM   61   N N      . ASP A 1 9   ? -6.908  39.407 70.546 1.00 79.82  ? 9   ASP A N      1 
ATOM   62   C CA     . ASP A 1 9   ? -7.148  40.010 71.853 1.00 80.92  ? 9   ASP A CA     1 
ATOM   63   C C      . ASP A 1 9   ? -5.859  40.152 72.654 1.00 69.26  ? 9   ASP A C      1 
ATOM   64   O O      . ASP A 1 9   ? -5.742  41.070 73.473 1.00 67.82  ? 9   ASP A O      1 
ATOM   65   C CB     . ASP A 1 9   ? -8.178  39.191 72.631 1.00 88.18  ? 9   ASP A CB     1 
ATOM   66   C CG     . ASP A 1 9   ? -9.583  39.326 72.063 1.00 97.17  ? 9   ASP A CG     1 
ATOM   67   O OD1    . ASP A 1 9   ? -9.785  40.158 71.153 1.00 95.68  ? 9   ASP A OD1    1 
ATOM   68   O OD2    . ASP A 1 9   ? -10.488 38.607 72.537 1.00 99.66  ? 9   ASP A OD2    1 
ATOM   69   H H      . ASP A 1 9   ? -7.172  38.593 70.470 1.00 94.43  ? 9   ASP A H      1 
ATOM   70   H HA     . ASP A 1 9   ? -7.513  40.899 71.723 1.00 92.51  ? 9   ASP A HA     1 
ATOM   71   H HB2    . ASP A 1 9   ? -7.929  38.255 72.598 1.00 99.82  ? 9   ASP A HB2    1 
ATOM   72   H HB3    . ASP A 1 9   ? -8.196  39.498 73.552 1.00 99.82  ? 9   ASP A HB3    1 
ATOM   73   N N      . THR A 1 10  ? -4.884  39.266 72.438 1.00 78.64  ? 10  THR A N      1 
ATOM   74   C CA     . THR A 1 10  ? -3.589  39.438 73.089 1.00 68.36  ? 10  THR A CA     1 
ATOM   75   C C      . THR A 1 10  ? -2.850  40.642 72.518 1.00 62.55  ? 10  THR A C      1 
ATOM   76   O O      . THR A 1 10  ? -2.172  41.370 73.253 1.00 58.21  ? 10  THR A O      1 
ATOM   77   C CB     . THR A 1 10  ? -2.748  38.167 72.945 1.00 62.10  ? 10  THR A CB     1 
ATOM   78   O OG1    . THR A 1 10  ? -1.509  38.324 73.648 1.00 55.05  ? 10  THR A OG1    1 
ATOM   79   C CG2    . THR A 1 10  ? -2.461  37.859 71.484 1.00 59.58  ? 10  THR A CG2    1 
ATOM   80   H H      . THR A 1 10  ? -4.946  38.573 71.932 1.00 86.22  ? 10  THR A H      1 
ATOM   81   H HA     . THR A 1 10  ? -3.731  39.596 74.036 1.00 77.27  ? 10  THR A HA     1 
ATOM   82   H HB     . THR A 1 10  ? -3.236  37.418 73.322 1.00 72.75  ? 10  THR A HB     1 
ATOM   83   H HG1    . THR A 1 10  ? -1.045  37.628 73.571 1.00 68.83  ? 10  THR A HG1    1 
ATOM   84   H HG21   . THR A 1 10  ? -1.928  37.051 71.415 1.00 68.55  ? 10  THR A HG21   1 
ATOM   85   H HG22   . THR A 1 10  ? -3.293  37.730 71.003 1.00 68.55  ? 10  THR A HG22   1 
ATOM   86   H HG23   . THR A 1 10  ? -1.973  38.594 71.081 1.00 68.55  ? 10  THR A HG23   1 
ATOM   87   N N      . ARG A 1 11  ? -2.968  40.866 71.208 1.00 61.72  ? 11  ARG A N      1 
ATOM   88   C CA     . ARG A 1 11  ? -2.460  42.099 70.616 1.00 56.83  ? 11  ARG A CA     1 
ATOM   89   C C      . ARG A 1 11  ? -3.145  43.309 71.231 1.00 59.28  ? 11  ARG A C      1 
ATOM   90   O O      . ARG A 1 11  ? -2.509  44.341 71.477 1.00 54.72  ? 11  ARG A O      1 
ATOM   91   C CB     . ARG A 1 11  ? -2.675  42.069 69.102 1.00 57.15  ? 11  ARG A CB     1 
ATOM   92   C CG     . ARG A 1 11  ? -2.538  43.416 68.394 1.00 52.65  ? 11  ARG A CG     1 
ATOM   93   C CD     . ARG A 1 11  ? -2.802  43.261 66.906 1.00 50.09  ? 11  ARG A CD     1 
ATOM   94   N NE     . ARG A 1 11  ? -2.711  44.527 66.188 1.00 44.81  ? 11  ARG A NE     1 
ATOM   95   C CZ     . ARG A 1 11  ? -1.574  45.077 65.774 1.00 41.16  ? 11  ARG A CZ     1 
ATOM   96   N NH1    . ARG A 1 11  ? -0.414  44.478 66.010 1.00 38.18  ? 11  ARG A NH1    1 
ATOM   97   N NH2    . ARG A 1 11  ? -1.598  46.233 65.125 1.00 42.17  ? 11  ARG A NH2    1 
ATOM   98   H H      . ARG A 1 11  ? -3.334  40.326 70.648 1.00 68.83  ? 11  ARG A H      1 
ATOM   99   H HA     . ARG A 1 11  ? -1.508  42.168 70.788 1.00 65.17  ? 11  ARG A HA     1 
ATOM   100  H HB2    . ARG A 1 11  ? -2.023  41.467 68.711 1.00 63.90  ? 11  ARG A HB2    1 
ATOM   101  H HB3    . ARG A 1 11  ? -3.569  41.738 68.925 1.00 63.90  ? 11  ARG A HB3    1 
ATOM   102  H HG2    . ARG A 1 11  ? -3.185  44.040 68.758 1.00 61.49  ? 11  ARG A HG2    1 
ATOM   103  H HG3    . ARG A 1 11  ? -1.636  43.753 68.513 1.00 61.49  ? 11  ARG A HG3    1 
ATOM   104  H HD2    . ARG A 1 11  ? -2.145  42.654 66.529 1.00 60.14  ? 11  ARG A HD2    1 
ATOM   105  H HD3    . ARG A 1 11  ? -3.695  42.906 66.778 1.00 60.14  ? 11  ARG A HD3    1 
ATOM   106  H HE     . ARG A 1 11  ? -3.443  44.947 66.022 1.00 57.44  ? 11  ARG A HE     1 
ATOM   107  H HH11   . ARG A 1 11  ? -0.395  43.728 66.430 1.00 51.93  ? 11  ARG A HH11   1 
ATOM   108  H HH12   . ARG A 1 11  ? 0.318   44.839 65.741 1.00 51.93  ? 11  ARG A HH12   1 
ATOM   109  H HH21   . ARG A 1 11  ? -2.349  46.624 64.972 1.00 55.81  ? 11  ARG A HH21   1 
ATOM   110  H HH22   . ARG A 1 11  ? -0.864  46.591 64.858 1.00 55.81  ? 11  ARG A HH22   1 
ATOM   111  N N      . GLU A 1 12  ? -4.447  43.195 71.486 1.00 69.27  ? 12  GLU A N      1 
ATOM   112  C CA     . GLU A 1 12  ? -5.201  44.297 72.067 1.00 71.49  ? 12  GLU A CA     1 
ATOM   113  C C      . GLU A 1 12  ? -4.702  44.627 73.469 1.00 69.75  ? 12  GLU A C      1 
ATOM   114  O O      . GLU A 1 12  ? -4.645  45.800 73.856 1.00 68.38  ? 12  GLU A O      1 
ATOM   115  C CB     . GLU A 1 12  ? -6.685  43.933 72.086 1.00 80.97  ? 12  GLU A CB     1 
ATOM   116  C CG     . GLU A 1 12  ? -7.613  45.111 72.201 1.00 81.24  ? 12  GLU A CG     1 
ATOM   117  C CD     . GLU A 1 12  ? -9.075  44.711 72.133 1.00 89.02  ? 12  GLU A CD     1 
ATOM   118  O OE1    . GLU A 1 12  ? -9.377  43.512 72.324 1.00 95.64  ? 12  GLU A OE1    1 
ATOM   119  O OE2    . GLU A 1 12  ? -9.925  45.594 71.887 1.00 87.93  ? 12  GLU A OE2    1 
ATOM   120  H H      . GLU A 1 12  ? -4.914  42.489 71.331 1.00 81.39  ? 12  GLU A H      1 
ATOM   121  H HA     . GLU A 1 12  ? -5.090  45.086 71.513 1.00 84.91  ? 12  GLU A HA     1 
ATOM   122  H HB2    . GLU A 1 12  ? -6.901  43.467 71.263 1.00 92.36  ? 12  GLU A HB2    1 
ATOM   123  H HB3    . GLU A 1 12  ? -6.852  43.351 72.844 1.00 92.36  ? 12  GLU A HB3    1 
ATOM   124  H HG2    . GLU A 1 12  ? -7.462  45.552 73.051 1.00 98.76  ? 12  GLU A HG2    1 
ATOM   125  H HG3    . GLU A 1 12  ? -7.436  45.726 71.472 1.00 98.76  ? 12  GLU A HG3    1 
ATOM   126  N N      . GLN A 1 13  ? -4.326  43.605 74.241 1.00 63.64  ? 13  GLN A N      1 
ATOM   127  C CA     . GLN A 1 13  ? -3.813  43.843 75.586 1.00 61.37  ? 13  GLN A CA     1 
ATOM   128  C C      . GLN A 1 13  ? -2.401  44.416 75.546 1.00 54.20  ? 13  GLN A C      1 
ATOM   129  O O      . GLN A 1 13  ? -2.053  45.278 76.361 1.00 53.82  ? 13  GLN A O      1 
ATOM   130  C CB     . GLN A 1 13  ? -3.844  42.543 76.392 1.00 64.70  ? 13  GLN A CB     1 
ATOM   131  C CG     . GLN A 1 13  ? -5.249  42.046 76.710 1.00 75.19  ? 13  GLN A CG     1 
ATOM   132  C CD     . GLN A 1 13  ? -5.254  40.674 77.362 1.00 76.65  ? 13  GLN A CD     1 
ATOM   133  O OE1    . GLN A 1 13  ? -4.281  39.925 77.267 1.00 72.09  ? 13  GLN A OE1    1 
ATOM   134  N NE2    . GLN A 1 13  ? -6.353  40.340 78.029 1.00 82.30  ? 13  GLN A NE2    1 
ATOM   135  H H      . GLN A 1 13  ? -4.358  42.777 74.011 1.00 74.91  ? 13  GLN A H      1 
ATOM   136  H HA     . GLN A 1 13  ? -4.385  44.486 76.033 1.00 71.83  ? 13  GLN A HA     1 
ATOM   137  H HB2    . GLN A 1 13  ? -3.393  41.850 75.885 1.00 76.84  ? 13  GLN A HB2    1 
ATOM   138  H HB3    . GLN A 1 13  ? -3.383  42.687 77.233 1.00 76.84  ? 13  GLN A HB3    1 
ATOM   139  H HG2    . GLN A 1 13  ? -5.674  42.669 77.321 1.00 85.24  ? 13  GLN A HG2    1 
ATOM   140  H HG3    . GLN A 1 13  ? -5.758  41.989 75.887 1.00 85.24  ? 13  GLN A HG3    1 
ATOM   141  H HE21   . GLN A 1 13  ? -7.012  40.890 78.074 1.00 96.52  ? 13  GLN A HE21   1 
ATOM   142  H HE22   . GLN A 1 13  ? -6.405  39.573 78.415 1.00 96.52  ? 13  GLN A HE22   1 
ATOM   143  N N      . ALA A 1 14  ? -1.574  43.954 74.604 1.00 49.03  ? 14  ALA A N      1 
ATOM   144  C CA     . ALA A 1 14  ? -0.201  44.440 74.526 1.00 43.23  ? 14  ALA A CA     1 
ATOM   145  C C      . ALA A 1 14  ? -0.162  45.937 74.245 1.00 43.39  ? 14  ALA A C      1 
ATOM   146  O O      . ALA A 1 14  ? 0.703   46.652 74.764 1.00 43.59  ? 14  ALA A O      1 
ATOM   147  C CB     . ALA A 1 14  ? 0.567   43.672 73.451 1.00 39.01  ? 14  ALA A CB     1 
ATOM   148  H H      . ALA A 1 14  ? -1.783  43.370 74.009 1.00 56.26  ? 14  ALA A H      1 
ATOM   149  H HA     . ALA A 1 14  ? 0.238   44.284 75.377 1.00 52.95  ? 14  ALA A HA     1 
ATOM   150  H HB1    . ALA A 1 14  ? 1.476   44.006 73.413 1.00 49.46  ? 14  ALA A HB1    1 
ATOM   151  H HB2    . ALA A 1 14  ? 0.570   42.729 73.680 1.00 49.46  ? 14  ALA A HB2    1 
ATOM   152  H HB3    . ALA A 1 14  ? 0.129   43.804 72.596 1.00 49.46  ? 14  ALA A HB3    1 
ATOM   153  N N      . ASN A 1 15  ? -1.090  46.429 73.423 1.00 58.24  ? 15  ASN A N      1 
ATOM   154  C CA     . ASN A 1 15  ? -1.143  47.858 73.141 1.00 59.50  ? 15  ASN A CA     1 
ATOM   155  C C      . ASN A 1 15  ? -1.614  48.643 74.357 1.00 63.55  ? 15  ASN A C      1 
ATOM   156  O O      . ASN A 1 15  ? -1.157  49.769 74.582 1.00 64.49  ? 15  ASN A O      1 
ATOM   157  C CB     . ASN A 1 15  ? -2.060  48.122 71.946 1.00 61.23  ? 15  ASN A CB     1 
ATOM   158  C CG     . ASN A 1 15  ? -1.871  49.508 71.359 1.00 63.06  ? 15  ASN A CG     1 
ATOM   159  O OD1    . ASN A 1 15  ? -1.666  50.481 72.084 1.00 65.60  ? 15  ASN A OD1    1 
ATOM   160  N ND2    . ASN A 1 15  ? -1.935  49.602 70.036 1.00 62.43  ? 15  ASN A ND2    1 
ATOM   161  H H      . ASN A 1 15  ? -1.691  45.962 73.022 1.00 65.54  ? 15  ASN A H      1 
ATOM   162  H HA     . ASN A 1 15  ? -0.253  48.168 72.910 1.00 70.30  ? 15  ASN A HA     1 
ATOM   163  H HB2    . ASN A 1 15  ? -1.868  47.473 71.251 1.00 75.40  ? 15  ASN A HB2    1 
ATOM   164  H HB3    . ASN A 1 15  ? -2.983  48.040 72.232 1.00 75.40  ? 15  ASN A HB3    1 
ATOM   165  H HD21   . ASN A 1 15  ? -1.834  50.366 69.653 1.00 82.85  ? 15  ASN A HD21   1 
ATOM   166  H HD22   . ASN A 1 15  ? -2.076  48.899 69.561 1.00 82.85  ? 15  ASN A HD22   1 
ATOM   167  N N      . GLY A 1 16  ? -2.520  48.067 75.150 1.00 51.92  ? 16  GLY A N      1 
ATOM   168  C CA     . GLY A 1 16  ? -2.946  48.705 76.382 1.00 56.15  ? 16  GLY A CA     1 
ATOM   169  C C      . GLY A 1 16  ? -1.902  48.672 77.476 1.00 56.72  ? 16  GLY A C      1 
ATOM   170  O O      . GLY A 1 16  ? -1.994  49.452 78.429 1.00 60.41  ? 16  GLY A O      1 
ATOM   171  H H      . GLY A 1 16  ? -2.899  47.311 74.993 1.00 60.91  ? 16  GLY A H      1 
ATOM   172  H HA2    . GLY A 1 16  ? -3.167  49.632 76.201 1.00 65.23  ? 16  GLY A HA2    1 
ATOM   173  H HA3    . GLY A 1 16  ? -3.744  48.262 76.711 1.00 65.23  ? 16  GLY A HA3    1 
ATOM   174  N N      . GLU A 1 17  ? -0.907  47.790 77.358 1.00 55.72  ? 17  GLU A N      1 
ATOM   175  C CA     . GLU A 1 17  ? 0.140   47.720 78.371 1.00 60.44  ? 17  GLU A CA     1 
ATOM   176  C C      . GLU A 1 17  ? 0.913   49.029 78.464 1.00 61.41  ? 17  GLU A C      1 
ATOM   177  O O      . GLU A 1 17  ? 1.480   49.342 79.517 1.00 60.78  ? 17  GLU A O      1 
ATOM   178  C CB     . GLU A 1 17  ? 1.084   46.557 78.065 1.00 56.77  ? 17  GLU A CB     1 
ATOM   179  C CG     . GLU A 1 17  ? 2.164   46.334 79.120 1.00 58.68  ? 17  GLU A CG     1 
ATOM   180  C CD     . GLU A 1 17  ? 3.400   47.189 78.901 1.00 59.17  ? 17  GLU A CD     1 
ATOM   181  O OE1    . GLU A 1 17  ? 3.657   47.591 77.746 1.00 56.27  ? 17  GLU A OE1    1 
ATOM   182  O OE2    . GLU A 1 17  ? 4.117   47.456 79.889 1.00 62.87  ? 17  GLU A OE2    1 
ATOM   183  H H      . GLU A 1 17  ? -0.818  47.231 76.711 1.00 62.37  ? 17  GLU A H      1 
ATOM   184  H HA     . GLU A 1 17  ? -0.269  47.553 79.234 1.00 81.61  ? 17  GLU A HA     1 
ATOM   185  H HB2    . GLU A 1 17  ? 0.562   45.742 78.000 1.00 78.23  ? 17  GLU A HB2    1 
ATOM   186  H HB3    . GLU A 1 17  ? 1.528   46.730 77.220 1.00 78.23  ? 17  GLU A HB3    1 
ATOM   187  H HG2    . GLU A 1 17  ? 1.801   46.553 79.993 1.00 79.99  ? 17  GLU A HG2    1 
ATOM   188  H HG3    . GLU A 1 17  ? 2.437   45.404 79.099 1.00 79.99  ? 17  GLU A HG3    1 
ATOM   189  N N      . ARG A 1 18  ? 0.946   49.804 77.379 1.00 53.67  ? 18  ARG A N      1 
ATOM   190  C CA     . ARG A 1 18  ? 1.638   51.088 77.403 1.00 56.04  ? 18  ARG A CA     1 
ATOM   191  C C      . ARG A 1 18  ? 1.049   52.012 78.462 1.00 61.09  ? 18  ARG A C      1 
ATOM   192  O O      . ARG A 1 18  ? 1.779   52.763 79.119 1.00 64.85  ? 18  ARG A O      1 
ATOM   193  C CB     . ARG A 1 18  ? 1.560   51.737 76.022 1.00 53.95  ? 18  ARG A CB     1 
ATOM   194  C CG     . ARG A 1 18  ? 2.252   53.084 75.910 1.00 56.97  ? 18  ARG A CG     1 
ATOM   195  C CD     . ARG A 1 18  ? 2.192   53.597 74.482 1.00 55.06  ? 18  ARG A CD     1 
ATOM   196  N NE     . ARG A 1 18  ? 2.859   54.886 74.322 1.00 58.49  ? 18  ARG A NE     1 
ATOM   197  C CZ     . ARG A 1 18  ? 2.951   55.544 73.171 1.00 58.26  ? 18  ARG A CZ     1 
ATOM   198  N NH1    . ARG A 1 18  ? 2.418   55.038 72.066 1.00 54.70  ? 18  ARG A NH1    1 
ATOM   199  N NH2    . ARG A 1 18  ? 3.577   56.711 73.122 1.00 62.22  ? 18  ARG A NH2    1 
ATOM   200  H H      . ARG A 1 18  ? 0.580   49.610 76.626 1.00 78.86  ? 18  ARG A H      1 
ATOM   201  H HA     . ARG A 1 18  ? 2.573   50.942 77.616 1.00 65.29  ? 18  ARG A HA     1 
ATOM   202  H HB2    . ARG A 1 18  ? 1.973   51.141 75.377 1.00 63.69  ? 18  ARG A HB2    1 
ATOM   203  H HB3    . ARG A 1 18  ? 0.627   51.868 75.794 1.00 63.69  ? 18  ARG A HB3    1 
ATOM   204  H HG2    . ARG A 1 18  ? 1.807   53.726 76.485 1.00 67.09  ? 18  ARG A HG2    1 
ATOM   205  H HG3    . ARG A 1 18  ? 3.184   52.991 76.163 1.00 67.09  ? 18  ARG A HG3    1 
ATOM   206  H HD2    . ARG A 1 18  ? 2.628   52.958 73.897 1.00 65.92  ? 18  ARG A HD2    1 
ATOM   207  H HD3    . ARG A 1 18  ? 1.263   53.705 74.223 1.00 65.92  ? 18  ARG A HD3    1 
ATOM   208  H HE     . ARG A 1 18  ? 3.216   55.242 75.019 1.00 70.23  ? 18  ARG A HE     1 
ATOM   209  H HH11   . ARG A 1 18  ? 2.011   54.281 72.093 1.00 67.50  ? 18  ARG A HH11   1 
ATOM   210  H HH12   . ARG A 1 18  ? 2.479   55.467 71.323 1.00 67.50  ? 18  ARG A HH12   1 
ATOM   211  H HH21   . ARG A 1 18  ? 3.924   57.043 73.836 1.00 76.13  ? 18  ARG A HH21   1 
ATOM   212  H HH22   . ARG A 1 18  ? 3.636   57.137 72.377 1.00 76.13  ? 18  ARG A HH22   1 
ATOM   213  N N      . TRP A 1 19  ? -0.269  51.962 78.648 1.00 59.62  ? 19  TRP A N      1 
ATOM   214  C CA     . TRP A 1 19  ? -0.968  52.872 79.546 1.00 63.82  ? 19  TRP A CA     1 
ATOM   215  C C      . TRP A 1 19  ? -1.185  52.279 80.932 1.00 76.40  ? 19  TRP A C      1 
ATOM   216  O O      . TRP A 1 19  ? -0.922  52.945 81.937 1.00 80.38  ? 19  TRP A O      1 
ATOM   217  C CB     . TRP A 1 19  ? -2.310  53.269 78.925 1.00 62.99  ? 19  TRP A CB     1 
ATOM   218  C CG     . TRP A 1 19  ? -2.201  53.564 77.466 1.00 61.18  ? 19  TRP A CG     1 
ATOM   219  C CD1    . TRP A 1 19  ? -2.809  52.893 76.447 1.00 55.95  ? 19  TRP A CD1    1 
ATOM   220  C CD2    . TRP A 1 19  ? -1.416  54.596 76.855 1.00 57.55  ? 19  TRP A CD2    1 
ATOM   221  N NE1    . TRP A 1 19  ? -2.460  53.448 75.240 1.00 52.31  ? 19  TRP A NE1    1 
ATOM   222  C CE2    . TRP A 1 19  ? -1.604  54.495 75.464 1.00 52.86  ? 19  TRP A CE2    1 
ATOM   223  C CE3    . TRP A 1 19  ? -0.575  55.597 77.351 1.00 57.63  ? 19  TRP A CE3    1 
ATOM   224  C CZ2    . TRP A 1 19  ? -0.986  55.359 74.562 1.00 44.82  ? 19  TRP A CZ2    1 
ATOM   225  C CZ3    . TRP A 1 19  ? 0.040   56.452 76.454 1.00 55.76  ? 19  TRP A CZ3    1 
ATOM   226  C CH2    . TRP A 1 19  ? -0.170  56.328 75.075 1.00 50.59  ? 19  TRP A CH2    1 
ATOM   227  H H      . TRP A 1 19  ? -0.787  51.398 78.258 1.00 72.70  ? 19  TRP A H      1 
ATOM   228  H HA     . TRP A 1 19  ? -0.438  53.678 79.648 1.00 80.50  ? 19  TRP A HA     1 
ATOM   229  H HB2    . TRP A 1 19  ? -2.940  52.539 79.037 1.00 77.56  ? 19  TRP A HB2    1 
ATOM   230  H HB3    . TRP A 1 19  ? -2.642  54.065 79.368 1.00 77.56  ? 19  TRP A HB3    1 
ATOM   231  H HD1    . TRP A 1 19  ? -3.381  52.168 76.554 1.00 65.21  ? 19  TRP A HD1    1 
ATOM   232  H HE1    . TRP A 1 19  ? -2.733  53.182 74.469 1.00 60.85  ? 19  TRP A HE1    1 
ATOM   233  H HE3    . TRP A 1 19  ? -0.432  55.686 78.266 1.00 75.36  ? 19  TRP A HE3    1 
ATOM   234  H HZ2    . TRP A 1 19  ? -1.122  55.278 73.645 1.00 54.67  ? 19  TRP A HZ2    1 
ATOM   235  H HZ3    . TRP A 1 19  ? 0.600   57.123 76.772 1.00 69.79  ? 19  TRP A HZ3    1 
ATOM   236  H HH2    . TRP A 1 19  ? 0.257   56.917 74.496 1.00 81.20  ? 19  TRP A HH2    1 
ATOM   237  N N      . ASP A 1 20  ? -1.658  51.040 81.010 1.00 76.29  ? 20  ASP A N      1 
ATOM   238  C CA     . ASP A 1 20  ? -1.888  50.407 82.297 1.00 83.28  ? 20  ASP A CA     1 
ATOM   239  C C      . ASP A 1 20  ? -0.573  49.855 82.846 1.00 86.93  ? 20  ASP A C      1 
ATOM   240  O O      . ASP A 1 20  ? 0.495   50.000 82.245 1.00 82.49  ? 20  ASP A O      1 
ATOM   241  C CB     . ASP A 1 20  ? -2.958  49.326 82.165 1.00 82.69  ? 20  ASP A CB     1 
ATOM   242  C CG     . ASP A 1 20  ? -2.608  48.277 81.130 1.00 79.73  ? 20  ASP A CG     1 
ATOM   243  O OD1    . ASP A 1 20  ? -1.441  47.845 81.089 1.00 78.81  ? 20  ASP A OD1    1 
ATOM   244  O OD2    . ASP A 1 20  ? -3.502  47.891 80.348 1.00 75.08  ? 20  ASP A OD2    1 
ATOM   245  H H      . ASP A 1 20  ? -1.853  50.547 80.332 1.00 92.59  ? 20  ASP A H      1 
ATOM   246  H HA     . ASP A 1 20  ? -2.214  51.074 82.921 1.00 107.24 ? 20  ASP A HA     1 
ATOM   247  H HB2    . ASP A 1 20  ? -3.064  48.880 83.020 1.00 106.76 ? 20  ASP A HB2    1 
ATOM   248  H HB3    . ASP A 1 20  ? -3.795  49.740 81.901 1.00 106.76 ? 20  ASP A HB3    1 
ATOM   249  N N      . GLY A 1 21  ? -0.650  49.216 84.008 1.00 150.65 ? 21  GLY A N      1 
ATOM   250  C CA     . GLY A 1 21  ? 0.533   48.739 84.702 1.00 151.29 ? 21  GLY A CA     1 
ATOM   251  C C      . GLY A 1 21  ? 1.419   47.809 83.894 1.00 142.36 ? 21  GLY A C      1 
ATOM   252  O O      . GLY A 1 21  ? 2.592   48.116 83.672 1.00 139.72 ? 21  GLY A O      1 
ATOM   253  H H      . GLY A 1 21  ? -1.387  49.045 84.417 1.00 192.84 ? 21  GLY A H      1 
ATOM   254  H HA2    . GLY A 1 21  ? 1.068   49.502 84.971 1.00 193.21 ? 21  GLY A HA2    1 
ATOM   255  H HA3    . GLY A 1 21  ? 0.258   48.267 85.504 1.00 193.21 ? 21  GLY A HA3    1 
ATOM   256  N N      . GLY A 1 22  ? 0.880   46.676 83.450 1.00 105.17 ? 22  GLY A N      1 
ATOM   257  C CA     . GLY A 1 22  ? -0.517  46.332 83.641 1.00 108.78 ? 22  GLY A CA     1 
ATOM   258  C C      . GLY A 1 22  ? -0.719  44.836 83.712 1.00 107.44 ? 22  GLY A C      1 
ATOM   259  O O      . GLY A 1 22  ? 0.076   44.076 83.156 1.00 102.94 ? 22  GLY A O      1 
ATOM   260  H H      . GLY A 1 22  ? 1.322   46.075 83.022 1.00 133.95 ? 22  GLY A H      1 
ATOM   261  H HA2    . GLY A 1 22  ? -0.839  46.727 84.466 1.00 136.89 ? 22  GLY A HA2    1 
ATOM   262  H HA3    . GLY A 1 22  ? -1.042  46.681 82.904 1.00 136.89 ? 22  GLY A HA3    1 
ATOM   263  N N      . SER A 1 23  ? -1.788  44.383 84.361 1.00 102.92 ? 23  SER A N      1 
ATOM   264  C CA     . SER A 1 23  ? -2.982  45.171 84.656 1.00 107.29 ? 23  SER A CA     1 
ATOM   265  C C      . SER A 1 23  ? -4.105  44.258 85.133 1.00 114.60 ? 23  SER A C      1 
ATOM   266  O O      . SER A 1 23  ? -4.739  44.571 86.140 1.00 123.25 ? 23  SER A O      1 
ATOM   267  C CB     . SER A 1 23  ? -3.470  45.972 83.444 1.00 101.15 ? 23  SER A CB     1 
ATOM   268  O OG     . SER A 1 23  ? -4.870  46.171 83.501 1.00 105.22 ? 23  SER A OG     1 
ATOM   269  H H      . SER A 1 23  ? -1.846  43.578 84.655 1.00 124.33 ? 23  SER A H      1 
ATOM   270  H HA     . SER A 1 23  ? -2.780  45.797 85.369 1.00 129.90 ? 23  SER A HA     1 
ATOM   271  H HB2    . SER A 1 23  ? -3.029  46.835 83.438 1.00 124.72 ? 23  SER A HB2    1 
ATOM   272  H HB3    . SER A 1 23  ? -3.254  45.483 82.634 1.00 124.72 ? 23  SER A HB3    1 
ATOM   273  H HG     . SER A 1 23  ? -5.125  46.611 82.832 1.00 129.51 ? 23  SER A HG     1 
ATOM   274  N N      . GLY A 1 24  ? -4.388  43.135 84.458 1.00 98.57  ? 24  GLY A N      1 
ATOM   275  C CA     . GLY A 1 24  ? -3.743  42.663 83.239 1.00 89.59  ? 24  GLY A CA     1 
ATOM   276  C C      . GLY A 1 24  ? -2.925  41.392 83.436 1.00 89.60  ? 24  GLY A C      1 
ATOM   277  O O      . GLY A 1 24  ? -3.460  40.290 83.313 1.00 90.93  ? 24  GLY A O      1 
ATOM   278  H H      . GLY A 1 24  ? -5.003  42.593 84.718 1.00 129.25 ? 24  GLY A H      1 
ATOM   279  H HA2    . GLY A 1 24  ? -4.420  42.487 82.567 1.00 118.54 ? 24  GLY A HA2    1 
ATOM   280  H HA3    . GLY A 1 24  ? -3.152  43.354 82.902 1.00 118.54 ? 24  GLY A HA3    1 
ATOM   281  N N      . GLY A 1 25  ? -1.633  41.543 83.721 1.00 84.06  ? 25  GLY A N      1 
ATOM   282  C CA     . GLY A 1 25  ? -0.716  40.434 83.846 1.00 84.25  ? 25  GLY A CA     1 
ATOM   283  C C      . GLY A 1 25  ? 0.103   40.192 82.601 1.00 76.15  ? 25  GLY A C      1 
ATOM   284  O O      . GLY A 1 25  ? 1.010   39.351 82.626 1.00 75.92  ? 25  GLY A O      1 
ATOM   285  H H      . GLY A 1 25  ? -1.261  42.307 83.850 1.00 96.51  ? 25  GLY A H      1 
ATOM   286  H HA2    . GLY A 1 25  ? -0.108  40.603 84.582 1.00 95.52  ? 25  GLY A HA2    1 
ATOM   287  H HA3    . GLY A 1 25  ? -1.216  39.627 84.043 1.00 95.52  ? 25  GLY A HA3    1 
ATOM   288  N N      . ILE A 1 26  ? -0.179  40.921 81.524 1.00 89.22  ? 26  ILE A N      1 
ATOM   289  C CA     . ILE A 1 26  ? 0.521   40.721 80.262 1.00 82.72  ? 26  ILE A CA     1 
ATOM   290  C C      . ILE A 1 26  ? 1.982   41.111 80.442 1.00 80.73  ? 26  ILE A C      1 
ATOM   291  O O      . ILE A 1 26  ? 2.299   42.252 80.798 1.00 80.37  ? 26  ILE A O      1 
ATOM   292  C CB     . ILE A 1 26  ? -0.145  41.520 79.132 1.00 77.93  ? 26  ILE A CB     1 
ATOM   293  C CG1    . ILE A 1 26  ? 0.537   41.218 77.799 1.00 72.00  ? 26  ILE A CG1    1 
ATOM   294  C CG2    . ILE A 1 26  ? -0.128  43.025 79.421 1.00 77.78  ? 26  ILE A CG2    1 
ATOM   295  C CD1    . ILE A 1 26  ? -0.276  41.638 76.596 1.00 67.68  ? 26  ILE A CD1    1 
ATOM   296  H H      . ILE A 1 26  ? -0.775  41.541 81.500 1.00 100.60 ? 26  ILE A H      1 
ATOM   297  H HA     . ILE A 1 26  ? 0.487   39.781 80.026 1.00 94.81  ? 26  ILE A HA     1 
ATOM   298  H HB     . ILE A 1 26  ? -1.070  41.236 79.067 1.00 91.57  ? 26  ILE A HB     1 
ATOM   299  H HG12   . ILE A 1 26  ? 1.384   41.690 77.766 1.00 85.55  ? 26  ILE A HG12   1 
ATOM   300  H HG13   . ILE A 1 26  ? 0.690   40.262 77.735 1.00 85.55  ? 26  ILE A HG13   1 
ATOM   301  H HG21   . ILE A 1 26  ? -0.556  43.492 78.686 1.00 93.53  ? 26  ILE A HG21   1 
ATOM   302  H HG22   . ILE A 1 26  ? -0.610  43.193 80.246 1.00 93.53  ? 26  ILE A HG22   1 
ATOM   303  H HG23   . ILE A 1 26  ? 0.792   43.319 79.509 1.00 93.53  ? 26  ILE A HG23   1 
ATOM   304  H HD11   . ILE A 1 26  ? 0.216   41.417 75.790 1.00 81.16  ? 26  ILE A HD11   1 
ATOM   305  H HD12   . ILE A 1 26  ? -1.123  41.166 76.607 1.00 81.16  ? 26  ILE A HD12   1 
ATOM   306  H HD13   . ILE A 1 26  ? -0.429  42.595 76.637 1.00 81.16  ? 26  ILE A HD13   1 
ATOM   307  N N      . THR A 1 27  ? 2.876   40.157 80.207 1.00 60.76  ? 27  THR A N      1 
ATOM   308  C CA     . THR A 1 27  ? 4.301   40.410 80.360 1.00 59.34  ? 27  THR A CA     1 
ATOM   309  C C      . THR A 1 27  ? 4.776   41.368 79.276 1.00 57.48  ? 27  THR A C      1 
ATOM   310  O O      . THR A 1 27  ? 4.451   41.198 78.097 1.00 49.35  ? 27  THR A O      1 
ATOM   311  C CB     . THR A 1 27  ? 5.085   39.102 80.283 1.00 60.18  ? 27  THR A CB     1 
ATOM   312  O OG1    . THR A 1 27  ? 5.003   38.575 78.953 1.00 55.92  ? 27  THR A OG1    1 
ATOM   313  C CG2    . THR A 1 27  ? 4.534   38.077 81.274 1.00 66.58  ? 27  THR A CG2    1 
ATOM   314  H H      . THR A 1 27  ? 2.684   39.356 79.959 1.00 104.35 ? 27  THR A H      1 
ATOM   315  H HA     . THR A 1 27  ? 4.466   40.817 81.225 1.00 68.67  ? 27  THR A HA     1 
ATOM   316  H HB     . THR A 1 27  ? 6.014   39.272 80.504 1.00 67.77  ? 27  THR A HB     1 
ATOM   317  H HG1    . THR A 1 27  ? 4.201   38.428 78.751 1.00 62.60  ? 27  THR A HG1    1 
ATOM   318  H HG21   . THR A 1 27  ? 5.042   37.252 81.214 1.00 73.43  ? 27  THR A HG21   1 
ATOM   319  H HG22   . THR A 1 27  ? 4.600   38.422 82.178 1.00 73.43  ? 27  THR A HG22   1 
ATOM   320  H HG23   . THR A 1 27  ? 3.604   37.890 81.075 1.00 73.43  ? 27  THR A HG23   1 
ATOM   321  N N      . SER A 1 28  ? 5.544   42.377 79.677 1.00 53.99  ? 28  SER A N      1 
ATOM   322  C CA     . SER A 1 28  ? 6.094   43.334 78.735 1.00 49.80  ? 28  SER A CA     1 
ATOM   323  C C      . SER A 1 28  ? 7.601   43.138 78.592 1.00 49.51  ? 28  SER A C      1 
ATOM   324  O O      . SER A 1 28  ? 8.261   42.668 79.524 1.00 53.14  ? 28  SER A O      1 
ATOM   325  C CB     . SER A 1 28  ? 5.819   44.775 79.183 1.00 51.36  ? 28  SER A CB     1 
ATOM   326  O OG     . SER A 1 28  ? 6.436   45.703 78.309 1.00 48.30  ? 28  SER A OG     1 
ATOM   327  H H      . SER A 1 28  ? 5.760   42.527 80.496 1.00 64.60  ? 28  SER A H      1 
ATOM   328  H HA     . SER A 1 28  ? 5.685   43.201 77.866 1.00 60.54  ? 28  SER A HA     1 
ATOM   329  H HB2    . SER A 1 28  ? 4.861   44.928 79.181 1.00 63.81  ? 28  SER A HB2    1 
ATOM   330  H HB3    . SER A 1 28  ? 6.173   44.900 80.077 1.00 63.81  ? 28  SER A HB3    1 
ATOM   331  H HG     . SER A 1 28  ? 6.278   46.487 78.564 1.00 60.63  ? 28  SER A HG     1 
ATOM   332  N N      . PRO A 1 29  ? 8.176   43.476 77.433 1.00 39.65  ? 29  PRO A N      1 
ATOM   333  C CA     . PRO A 1 29  ? 9.639   43.436 77.299 1.00 43.17  ? 29  PRO A CA     1 
ATOM   334  C C      . PRO A 1 29  ? 10.348  44.639 77.897 1.00 48.27  ? 29  PRO A C      1 
ATOM   335  O O      . PRO A 1 29  ? 11.570  44.580 78.089 1.00 50.95  ? 29  PRO A O      1 
ATOM   336  C CB     . PRO A 1 29  ? 9.846   43.381 75.780 1.00 42.09  ? 29  PRO A CB     1 
ATOM   337  C CG     . PRO A 1 29  ? 8.655   44.078 75.219 1.00 39.14  ? 29  PRO A CG     1 
ATOM   338  C CD     . PRO A 1 29  ? 7.512   43.772 76.151 1.00 37.96  ? 29  PRO A CD     1 
ATOM   339  H HA     . PRO A 1 29  ? 9.991   42.626 77.699 1.00 51.47  ? 29  PRO A HA     1 
ATOM   340  H HB2    . PRO A 1 29  ? 10.663  43.847 75.543 1.00 48.15  ? 29  PRO A HB2    1 
ATOM   341  H HB3    . PRO A 1 29  ? 9.877   42.458 75.486 1.00 48.15  ? 29  PRO A HB3    1 
ATOM   342  H HG2    . PRO A 1 29  ? 8.823   45.033 75.189 1.00 43.78  ? 29  PRO A HG2    1 
ATOM   343  H HG3    . PRO A 1 29  ? 8.470   43.738 74.330 1.00 43.78  ? 29  PRO A HG3    1 
ATOM   344  H HD2    . PRO A 1 29  ? 6.933   44.546 76.242 1.00 46.18  ? 29  PRO A HD2    1 
ATOM   345  H HD3    . PRO A 1 29  ? 7.020   42.996 75.839 1.00 46.18  ? 29  PRO A HD3    1 
ATOM   346  N N      . PHE A 1 30  ? 9.629   45.717 78.200 1.00 47.04  ? 30  PHE A N      1 
ATOM   347  C CA     . PHE A 1 30  ? 10.233  46.926 78.738 1.00 49.98  ? 30  PHE A CA     1 
ATOM   348  C C      . PHE A 1 30  ? 10.281  46.874 80.260 1.00 50.18  ? 30  PHE A C      1 
ATOM   349  O O      . PHE A 1 30  ? 9.416   46.282 80.909 1.00 48.49  ? 30  PHE A O      1 
ATOM   350  C CB     . PHE A 1 30  ? 9.452   48.164 78.295 1.00 51.33  ? 30  PHE A CB     1 
ATOM   351  C CG     . PHE A 1 30  ? 9.503   48.420 76.817 1.00 52.66  ? 30  PHE A CG     1 
ATOM   352  C CD1    . PHE A 1 30  ? 10.657  48.902 76.224 1.00 54.95  ? 30  PHE A CD1    1 
ATOM   353  C CD2    . PHE A 1 30  ? 8.392   48.193 76.022 1.00 50.58  ? 30  PHE A CD2    1 
ATOM   354  C CE1    . PHE A 1 30  ? 10.706  49.144 74.864 1.00 54.80  ? 30  PHE A CE1    1 
ATOM   355  C CE2    . PHE A 1 30  ? 8.436   48.432 74.662 1.00 49.98  ? 30  PHE A CE2    1 
ATOM   356  C CZ     . PHE A 1 30  ? 9.594   48.910 74.083 1.00 52.21  ? 30  PHE A CZ     1 
ATOM   357  H H      . PHE A 1 30  ? 8.777   45.770 78.100 1.00 54.85  ? 30  PHE A H      1 
ATOM   358  H HA     . PHE A 1 30  ? 11.141  47.005 78.407 1.00 56.80  ? 30  PHE A HA     1 
ATOM   359  H HB2    . PHE A 1 30  ? 8.521   48.051 78.544 1.00 56.95  ? 30  PHE A HB2    1 
ATOM   360  H HB3    . PHE A 1 30  ? 9.819   48.942 78.743 1.00 56.95  ? 30  PHE A HB3    1 
ATOM   361  H HD1    . PHE A 1 30  ? 11.409  49.061 76.747 1.00 56.12  ? 30  PHE A HD1    1 
ATOM   362  H HD2    . PHE A 1 30  ? 7.609   47.871 76.407 1.00 56.40  ? 30  PHE A HD2    1 
ATOM   363  H HE1    . PHE A 1 30  ? 11.488  49.466 74.477 1.00 53.43  ? 30  PHE A HE1    1 
ATOM   364  H HE2    . PHE A 1 30  ? 7.684   48.274 74.137 1.00 53.74  ? 30  PHE A HE2    1 
ATOM   365  H HZ     . PHE A 1 30  ? 9.625   49.072 73.168 1.00 51.76  ? 30  PHE A HZ     1 
ATOM   366  N N      . LYS A 1 31  ? 11.306  47.513 80.824 1.00 66.64  ? 31  LYS A N      1 
ATOM   367  C CA     . LYS A 1 31  ? 11.463  47.619 82.268 1.00 65.99  ? 31  LYS A CA     1 
ATOM   368  C C      . LYS A 1 31  ? 11.153  49.012 82.798 1.00 67.21  ? 31  LYS A C      1 
ATOM   369  O O      . LYS A 1 31  ? 11.188  49.217 84.016 1.00 67.20  ? 31  LYS A O      1 
ATOM   370  C CB     . LYS A 1 31  ? 12.887  47.225 82.678 1.00 66.23  ? 31  LYS A CB     1 
ATOM   371  C CG     . LYS A 1 31  ? 13.289  45.818 82.261 1.00 65.04  ? 31  LYS A CG     1 
ATOM   372  C CD     . LYS A 1 31  ? 14.637  45.418 82.848 1.00 65.10  ? 31  LYS A CD     1 
ATOM   373  C CE     . LYS A 1 31  ? 14.522  45.015 84.312 1.00 65.78  ? 31  LYS A CE     1 
ATOM   374  N NZ     . LYS A 1 31  ? 13.770  43.739 84.489 1.00 64.74  ? 31  LYS A NZ     1 
ATOM   375  H H      . LYS A 1 31  ? 11.934  47.899 80.381 1.00 71.66  ? 31  LYS A H      1 
ATOM   376  H HA     . LYS A 1 31  ? 10.851  46.998 82.694 1.00 73.08  ? 31  LYS A HA     1 
ATOM   377  H HB2    . LYS A 1 31  ? 13.511  47.844 82.268 1.00 76.44  ? 31  LYS A HB2    1 
ATOM   378  H HB3    . LYS A 1 31  ? 12.959  47.278 83.644 1.00 76.44  ? 31  LYS A HB3    1 
ATOM   379  H HG2    . LYS A 1 31  ? 12.622  45.189 82.576 1.00 77.82  ? 31  LYS A HG2    1 
ATOM   380  H HG3    . LYS A 1 31  ? 13.356  45.779 81.294 1.00 77.82  ? 31  LYS A HG3    1 
ATOM   381  H HD2    . LYS A 1 31  ? 14.989  44.662 82.352 1.00 83.08  ? 31  LYS A HD2    1 
ATOM   382  H HD3    . LYS A 1 31  ? 15.247  46.170 82.788 1.00 83.08  ? 31  LYS A HD3    1 
ATOM   383  H HE2    . LYS A 1 31  ? 15.412  44.895 84.679 1.00 89.60  ? 31  LYS A HE2    1 
ATOM   384  H HE3    . LYS A 1 31  ? 14.053  45.712 84.797 1.00 89.60  ? 31  LYS A HE3    1 
ATOM   385  H HZ1    . LYS A 1 31  ? 13.721  43.533 85.354 1.00 90.97  ? 31  LYS A HZ1    1 
ATOM   386  H HZ2    . LYS A 1 31  ? 12.945  43.824 84.165 1.00 90.97  ? 31  LYS A HZ2    1 
ATOM   387  H HZ3    . LYS A 1 31  ? 14.183  43.080 84.058 1.00 90.97  ? 31  LYS A HZ3    1 
ATOM   388  N N      . LEU A 1 32  ? 10.859  49.974 81.924 1.00 58.42  ? 32  LEU A N      1 
ATOM   389  C CA     . LEU A 1 32  ? 10.534  51.324 82.348 1.00 61.46  ? 32  LEU A CA     1 
ATOM   390  C C      . LEU A 1 32  ? 9.101   51.667 81.959 1.00 61.38  ? 32  LEU A C      1 
ATOM   391  O O      . LEU A 1 32  ? 8.629   51.230 80.903 1.00 60.99  ? 32  LEU A O      1 
ATOM   392  C CB     . LEU A 1 32  ? 11.487  52.349 81.719 1.00 64.28  ? 32  LEU A CB     1 
ATOM   393  C CG     . LEU A 1 32  ? 12.970  52.213 82.069 1.00 65.45  ? 32  LEU A CG     1 
ATOM   394  C CD1    . LEU A 1 32  ? 13.784  53.259 81.322 1.00 66.45  ? 32  LEU A CD1    1 
ATOM   395  C CD2    . LEU A 1 32  ? 13.194  52.335 83.568 1.00 67.12  ? 32  LEU A CD2    1 
ATOM   396  H H      . LEU A 1 32  ? 10.843  49.864 81.071 1.00 64.70  ? 32  LEU A H      1 
ATOM   397  H HA     . LEU A 1 32  ? 10.613  51.385 83.313 1.00 70.51  ? 32  LEU A HA     1 
ATOM   398  H HB2    . LEU A 1 32  ? 11.413  52.279 80.754 1.00 74.91  ? 32  LEU A HB2    1 
ATOM   399  H HB3    . LEU A 1 32  ? 11.207  53.235 81.998 1.00 74.91  ? 32  LEU A HB3    1 
ATOM   400  H HG     . LEU A 1 32  ? 13.281  51.338 81.791 1.00 81.67  ? 32  LEU A HG     1 
ATOM   401  H HD11   . LEU A 1 32  ? 14.720  53.157 81.556 1.00 82.24  ? 32  LEU A HD11   1 
ATOM   402  H HD12   . LEU A 1 32  ? 13.666  53.128 80.368 1.00 82.24  ? 32  LEU A HD12   1 
ATOM   403  H HD13   . LEU A 1 32  ? 13.473  54.142 81.576 1.00 82.24  ? 32  LEU A HD13   1 
ATOM   404  H HD21   . LEU A 1 32  ? 14.142  52.244 83.753 1.00 88.91  ? 32  LEU A HD21   1 
ATOM   405  H HD22   . LEU A 1 32  ? 12.880  53.203 83.864 1.00 88.91  ? 32  LEU A HD22   1 
ATOM   406  H HD23   . LEU A 1 32  ? 12.699  51.632 84.018 1.00 88.91  ? 32  LEU A HD23   1 
ATOM   407  N N      . PRO A 1 33  ? 8.383   52.438 82.774 1.00 56.95  ? 33  PRO A N      1 
ATOM   408  C CA     . PRO A 1 33  ? 7.016   52.821 82.404 1.00 56.40  ? 33  PRO A CA     1 
ATOM   409  C C      . PRO A 1 33  ? 7.013   53.795 81.236 1.00 58.03  ? 33  PRO A C      1 
ATOM   410  O O      . PRO A 1 33  ? 8.046   54.309 80.803 1.00 59.47  ? 33  PRO A O      1 
ATOM   411  C CB     . PRO A 1 33  ? 6.458   53.477 83.675 1.00 57.34  ? 33  PRO A CB     1 
ATOM   412  C CG     . PRO A 1 33  ? 7.434   53.157 84.757 1.00 58.06  ? 33  PRO A CG     1 
ATOM   413  C CD     . PRO A 1 33  ? 8.753   52.984 84.089 1.00 58.29  ? 33  PRO A CD     1 
ATOM   414  H HA     . PRO A 1 33  ? 6.488   52.039 82.181 1.00 67.46  ? 33  PRO A HA     1 
ATOM   415  H HB2    . PRO A 1 33  ? 6.395   54.436 83.545 1.00 69.53  ? 33  PRO A HB2    1 
ATOM   416  H HB3    . PRO A 1 33  ? 5.587   53.102 83.879 1.00 69.53  ? 33  PRO A HB3    1 
ATOM   417  H HG2    . PRO A 1 33  ? 7.467   53.891 85.391 1.00 71.82  ? 33  PRO A HG2    1 
ATOM   418  H HG3    . PRO A 1 33  ? 7.168   52.336 85.201 1.00 71.82  ? 33  PRO A HG3    1 
ATOM   419  H HD2    . PRO A 1 33  ? 9.198   53.840 83.989 1.00 70.79  ? 33  PRO A HD2    1 
ATOM   420  H HD3    . PRO A 1 33  ? 9.301   52.351 84.578 1.00 70.79  ? 33  PRO A HD3    1 
ATOM   421  N N      . ASP A 1 34  ? 5.811   54.051 80.727 1.00 52.29  ? 34  ASP A N      1 
ATOM   422  C CA     . ASP A 1 34  ? 5.634   54.991 79.632 1.00 53.59  ? 34  ASP A CA     1 
ATOM   423  C C      . ASP A 1 34  ? 5.684   56.422 80.153 1.00 55.48  ? 34  ASP A C      1 
ATOM   424  O O      . ASP A 1 34  ? 5.196   56.718 81.248 1.00 55.80  ? 34  ASP A O      1 
ATOM   425  C CB     . ASP A 1 34  ? 4.305   54.732 78.922 1.00 52.01  ? 34  ASP A CB     1 
ATOM   426  C CG     . ASP A 1 34  ? 4.074   55.671 77.758 1.00 52.90  ? 34  ASP A CG     1 
ATOM   427  O OD1    . ASP A 1 34  ? 4.739   55.502 76.715 1.00 53.23  ? 34  ASP A OD1    1 
ATOM   428  O OD2    . ASP A 1 34  ? 3.221   56.574 77.880 1.00 53.31  ? 34  ASP A OD2    1 
ATOM   429  H H      . ASP A 1 34  ? 5.081   53.689 81.001 1.00 63.02  ? 34  ASP A H      1 
ATOM   430  H HA     . ASP A 1 34  ? 6.351   54.875 78.989 1.00 63.38  ? 34  ASP A HA     1 
ATOM   431  H HB2    . ASP A 1 34  ? 4.300   53.824 78.582 1.00 63.69  ? 34  ASP A HB2    1 
ATOM   432  H HB3    . ASP A 1 34  ? 3.579   54.853 79.555 1.00 63.69  ? 34  ASP A HB3    1 
ATOM   433  N N      . GLU A 1 35  ? 6.286   57.312 79.360 1.00 51.06  ? 35  GLU A N      1 
ATOM   434  C CA     . GLU A 1 35  ? 6.437   58.715 79.728 1.00 52.65  ? 35  GLU A CA     1 
ATOM   435  C C      . GLU A 1 35  ? 5.916   59.629 78.623 1.00 53.22  ? 35  GLU A C      1 
ATOM   436  O O      . GLU A 1 35  ? 6.450   60.720 78.412 1.00 53.93  ? 35  GLU A O      1 
ATOM   437  C CB     . GLU A 1 35  ? 7.899   59.040 80.043 1.00 53.40  ? 35  GLU A CB     1 
ATOM   438  C CG     . GLU A 1 35  ? 8.493   58.213 81.177 1.00 53.40  ? 35  GLU A CG     1 
ATOM   439  C CD     . GLU A 1 35  ? 9.997   58.387 81.310 1.00 54.64  ? 35  GLU A CD     1 
ATOM   440  O OE1    . GLU A 1 35  ? 10.638  58.840 80.338 1.00 54.84  ? 35  GLU A OE1    1 
ATOM   441  O OE2    . GLU A 1 35  ? 10.540  58.069 82.390 1.00 55.38  ? 35  GLU A OE2    1 
ATOM   442  H H      . GLU A 1 35  ? 6.620   57.120 78.591 1.00 64.05  ? 35  GLU A H      1 
ATOM   443  H HA     . GLU A 1 35  ? 5.915   58.888 80.527 1.00 66.17  ? 35  GLU A HA     1 
ATOM   444  H HB2    . GLU A 1 35  ? 8.431   58.878 79.249 1.00 65.00  ? 35  GLU A HB2    1 
ATOM   445  H HB3    . GLU A 1 35  ? 7.962   59.975 80.295 1.00 65.00  ? 35  GLU A HB3    1 
ATOM   446  H HG2    . GLU A 1 35  ? 8.085   58.485 82.013 1.00 64.96  ? 35  GLU A HG2    1 
ATOM   447  H HG3    . GLU A 1 35  ? 8.314   57.275 81.010 1.00 64.96  ? 35  GLU A HG3    1 
ATOM   448  N N      . SER A 1 36  ? 4.878   59.199 77.914 1.00 62.24  ? 36  SER A N      1 
ATOM   449  C CA     . SER A 1 36  ? 4.339   60.005 76.827 1.00 62.48  ? 36  SER A CA     1 
ATOM   450  C C      . SER A 1 36  ? 3.847   61.341 77.375 1.00 62.03  ? 36  SER A C      1 
ATOM   451  O O      . SER A 1 36  ? 3.073   61.360 78.342 1.00 61.91  ? 36  SER A O      1 
ATOM   452  C CB     . SER A 1 36  ? 3.192   59.278 76.126 1.00 61.95  ? 36  SER A CB     1 
ATOM   453  O OG     . SER A 1 36  ? 3.607   58.016 75.641 1.00 61.43  ? 36  SER A OG     1 
ATOM   454  H H      . SER A 1 36  ? 4.471   58.452 78.040 1.00 69.45  ? 36  SER A H      1 
ATOM   455  H HA     . SER A 1 36  ? 5.037   60.177 76.175 1.00 72.36  ? 36  SER A HA     1 
ATOM   456  H HB2    . SER A 1 36  ? 2.468   59.150 76.759 1.00 75.70  ? 36  SER A HB2    1 
ATOM   457  H HB3    . SER A 1 36  ? 2.887   59.818 75.380 1.00 75.70  ? 36  SER A HB3    1 
ATOM   458  H HG     . SER A 1 36  ? 3.874   57.537 76.277 1.00 73.72  ? 36  SER A HG     1 
ATOM   459  N N      . PRO A 1 37  ? 4.260   62.467 76.798 1.00 56.36  ? 37  PRO A N      1 
ATOM   460  C CA     . PRO A 1 37  ? 3.772   63.757 77.291 1.00 56.25  ? 37  PRO A CA     1 
ATOM   461  C C      . PRO A 1 37  ? 2.324   63.990 76.894 1.00 54.54  ? 37  PRO A C      1 
ATOM   462  O O      . PRO A 1 37  ? 1.843   63.487 75.876 1.00 53.13  ? 37  PRO A O      1 
ATOM   463  C CB     . PRO A 1 37  ? 4.704   64.767 76.615 1.00 56.43  ? 37  PRO A CB     1 
ATOM   464  C CG     . PRO A 1 37  ? 5.064   64.106 75.329 1.00 55.60  ? 37  PRO A CG     1 
ATOM   465  C CD     . PRO A 1 37  ? 5.159   62.631 75.641 1.00 55.88  ? 37  PRO A CD     1 
ATOM   466  H HA     . PRO A 1 37  ? 3.865   63.817 78.255 1.00 68.98  ? 37  PRO A HA     1 
ATOM   467  H HB2    . PRO A 1 37  ? 4.231   65.600 76.457 1.00 70.77  ? 37  PRO A HB2    1 
ATOM   468  H HB3    . PRO A 1 37  ? 5.490   64.912 77.164 1.00 70.77  ? 37  PRO A HB3    1 
ATOM   469  H HG2    . PRO A 1 37  ? 4.370   64.272 74.673 1.00 69.16  ? 37  PRO A HG2    1 
ATOM   470  H HG3    . PRO A 1 37  ? 5.918   64.445 75.018 1.00 69.16  ? 37  PRO A HG3    1 
ATOM   471  H HD2    . PRO A 1 37  ? 4.843   62.106 74.890 1.00 66.24  ? 37  PRO A HD2    1 
ATOM   472  H HD3    . PRO A 1 37  ? 6.068   62.395 75.883 1.00 66.24  ? 37  PRO A HD3    1 
ATOM   473  N N      . SER A 1 38  ? 1.626   64.764 77.717 1.00 52.75  ? 38  SER A N      1 
ATOM   474  C CA     . SER A 1 38  ? 0.258   65.136 77.402 1.00 53.17  ? 38  SER A CA     1 
ATOM   475  C C      . SER A 1 38  ? 0.233   66.059 76.186 1.00 54.18  ? 38  SER A C      1 
ATOM   476  O O      . SER A 1 38  ? 1.268   66.507 75.684 1.00 54.91  ? 38  SER A O      1 
ATOM   477  C CB     . SER A 1 38  ? -0.400  65.816 78.602 1.00 55.37  ? 38  SER A CB     1 
ATOM   478  O OG     . SER A 1 38  ? 0.389   66.898 79.067 1.00 62.18  ? 38  SER A OG     1 
ATOM   479  H H      . SER A 1 38  ? 1.921   65.084 78.459 1.00 63.76  ? 38  SER A H      1 
ATOM   480  H HA     . SER A 1 38  ? -0.250  64.338 77.189 1.00 65.88  ? 38  SER A HA     1 
ATOM   481  H HB2    . SER A 1 38  ? -1.270  66.152 78.337 1.00 68.53  ? 38  SER A HB2    1 
ATOM   482  H HB3    . SER A 1 38  ? -0.499  65.168 79.317 1.00 68.53  ? 38  SER A HB3    1 
ATOM   483  H HG     . SER A 1 38  ? 0.017   67.263 79.725 1.00 118.24 ? 38  SER A HG     1 
ATOM   484  N N      . TRP A 1 39  ? -0.979  66.340 75.708 1.00 54.68  ? 39  TRP A N      1 
ATOM   485  C CA     . TRP A 1 39  ? -1.131  67.247 74.576 1.00 56.16  ? 39  TRP A CA     1 
ATOM   486  C C      . TRP A 1 39  ? -0.582  68.628 74.910 1.00 58.98  ? 39  TRP A C      1 
ATOM   487  O O      . TRP A 1 39  ? 0.241   69.179 74.169 1.00 60.13  ? 39  TRP A O      1 
ATOM   488  C CB     . TRP A 1 39  ? -2.604  67.334 74.176 1.00 56.77  ? 39  TRP A CB     1 
ATOM   489  C CG     . TRP A 1 39  ? -2.839  68.051 72.882 1.00 58.39  ? 39  TRP A CG     1 
ATOM   490  C CD1    . TRP A 1 39  ? -1.902  68.390 71.950 1.00 59.07  ? 39  TRP A CD1    1 
ATOM   491  C CD2    . TRP A 1 39  ? -4.095  68.520 72.377 1.00 60.07  ? 39  TRP A CD2    1 
ATOM   492  N NE1    . TRP A 1 39  ? -2.496  69.037 70.896 1.00 61.14  ? 39  TRP A NE1    1 
ATOM   493  C CE2    . TRP A 1 39  ? -3.842  69.132 71.134 1.00 61.73  ? 39  TRP A CE2    1 
ATOM   494  C CE3    . TRP A 1 39  ? -5.408  68.481 72.855 1.00 60.73  ? 39  TRP A CE3    1 
ATOM   495  C CZ2    . TRP A 1 39  ? -4.853  69.699 70.362 1.00 63.99  ? 39  TRP A CZ2    1 
ATOM   496  C CZ3    . TRP A 1 39  ? -6.410  69.047 72.087 1.00 62.88  ? 39  TRP A CZ3    1 
ATOM   497  C CH2    . TRP A 1 39  ? -6.127  69.647 70.855 1.00 64.46  ? 39  TRP A CH2    1 
ATOM   498  H H      . TRP A 1 39  ? -1.716  66.024 76.016 1.00 69.01  ? 39  TRP A H      1 
ATOM   499  H HA     . TRP A 1 39  ? -0.633  66.898 73.820 1.00 68.36  ? 39  TRP A HA     1 
ATOM   500  H HB2    . TRP A 1 39  ? -2.957  66.435 74.084 1.00 67.48  ? 39  TRP A HB2    1 
ATOM   501  H HB3    . TRP A 1 39  ? -3.089  67.808 74.869 1.00 67.48  ? 39  TRP A HB3    1 
ATOM   502  H HD1    . TRP A 1 39  ? -0.993  68.206 72.017 1.00 67.61  ? 39  TRP A HD1    1 
ATOM   503  H HE1    . TRP A 1 39  ? -2.090  69.337 70.200 1.00 68.26  ? 39  TRP A HE1    1 
ATOM   504  H HE3    . TRP A 1 39  ? -5.604  68.084 73.673 1.00 68.28  ? 39  TRP A HE3    1 
ATOM   505  H HZ2    . TRP A 1 39  ? -4.668  70.099 69.543 1.00 69.38  ? 39  TRP A HZ2    1 
ATOM   506  H HZ3    . TRP A 1 39  ? -7.288  69.027 72.395 1.00 69.32  ? 39  TRP A HZ3    1 
ATOM   507  H HH2    . TRP A 1 39  ? -6.821  70.019 70.361 1.00 69.82  ? 39  TRP A HH2    1 
ATOM   508  N N      . THR A 1 40  ? -1.027  69.204 76.029 1.00 66.29  ? 40  THR A N      1 
ATOM   509  C CA     . THR A 1 40  ? -0.561  70.531 76.420 1.00 71.37  ? 40  THR A CA     1 
ATOM   510  C C      . THR A 1 40  ? 0.945   70.536 76.650 1.00 73.87  ? 40  THR A C      1 
ATOM   511  O O      . THR A 1 40  ? 1.666   71.382 76.108 1.00 76.24  ? 40  THR A O      1 
ATOM   512  C CB     . THR A 1 40  ? -1.294  70.993 77.681 1.00 74.90  ? 40  THR A CB     1 
ATOM   513  O OG1    . THR A 1 40  ? -1.086  70.041 78.732 1.00 74.18  ? 40  THR A OG1    1 
ATOM   514  C CG2    . THR A 1 40  ? -2.785  71.135 77.415 1.00 74.64  ? 40  THR A CG2    1 
ATOM   515  H H      . THR A 1 40  ? -1.592  68.849 76.572 1.00 83.52  ? 40  THR A H      1 
ATOM   516  H HA     . THR A 1 40  ? -0.760  71.159 75.709 1.00 88.42  ? 40  THR A HA     1 
ATOM   517  H HB     . THR A 1 40  ? -0.949  71.856 77.955 1.00 89.01  ? 40  THR A HB     1 
ATOM   518  H HG1    . THR A 1 40  ? -1.487  70.290 79.428 1.00 87.38  ? 40  THR A HG1    1 
ATOM   519  H HG21   . THR A 1 40  ? -3.239  71.428 78.220 1.00 88.29  ? 40  THR A HG21   1 
ATOM   520  H HG22   . THR A 1 40  ? -2.936  71.788 76.713 1.00 88.29  ? 40  THR A HG22   1 
ATOM   521  H HG23   . THR A 1 40  ? -3.155  70.283 77.137 1.00 88.29  ? 40  THR A HG23   1 
ATOM   522  N N      . GLU A 1 41  ? 1.439   69.592 77.456 1.00 74.87  ? 41  GLU A N      1 
ATOM   523  C CA     . GLU A 1 41  ? 2.868   69.532 77.744 1.00 76.93  ? 41  GLU A CA     1 
ATOM   524  C C      . GLU A 1 41  ? 3.691   69.407 76.470 1.00 75.35  ? 41  GLU A C      1 
ATOM   525  O O      . GLU A 1 41  ? 4.847   69.844 76.432 1.00 78.49  ? 41  GLU A O      1 
ATOM   526  C CB     . GLU A 1 41  ? 3.160   68.360 78.681 1.00 75.83  ? 41  GLU A CB     1 
ATOM   527  C CG     . GLU A 1 41  ? 4.586   68.318 79.201 1.00 78.78  ? 41  GLU A CG     1 
ATOM   528  C CD     . GLU A 1 41  ? 4.859   67.092 80.049 1.00 77.14  ? 41  GLU A CD     1 
ATOM   529  O OE1    . GLU A 1 41  ? 4.029   66.158 80.033 1.00 72.41  ? 41  GLU A OE1    1 
ATOM   530  O OE2    . GLU A 1 41  ? 5.905   67.062 80.732 1.00 79.79  ? 41  GLU A OE2    1 
ATOM   531  H H      . GLU A 1 41  ? 0.971   68.982 77.842 1.00 90.47  ? 41  GLU A H      1 
ATOM   532  H HA     . GLU A 1 41  ? 3.134   70.349 78.194 1.00 91.44  ? 41  GLU A HA     1 
ATOM   533  H HB2    . GLU A 1 41  ? 2.568   68.419 79.448 1.00 91.98  ? 41  GLU A HB2    1 
ATOM   534  H HB3    . GLU A 1 41  ? 2.996   67.531 78.204 1.00 91.98  ? 41  GLU A HB3    1 
ATOM   535  H HG2    . GLU A 1 41  ? 5.198   68.306 78.449 1.00 95.70  ? 41  GLU A HG2    1 
ATOM   536  H HG3    . GLU A 1 41  ? 4.747   69.104 79.748 1.00 95.70  ? 41  GLU A HG3    1 
ATOM   537  N N      . TRP A 1 42  ? 3.121   68.811 75.422 1.00 60.52  ? 42  TRP A N      1 
ATOM   538  C CA     . TRP A 1 42  ? 3.813   68.723 74.143 1.00 60.54  ? 42  TRP A CA     1 
ATOM   539  C C      . TRP A 1 42  ? 3.656   70.001 73.332 1.00 63.58  ? 42  TRP A C      1 
ATOM   540  O O      . TRP A 1 42  ? 4.573   70.381 72.597 1.00 65.47  ? 42  TRP A O      1 
ATOM   541  C CB     . TRP A 1 42  ? 3.292   67.526 73.346 1.00 57.47  ? 42  TRP A CB     1 
ATOM   542  C CG     . TRP A 1 42  ? 3.784   67.482 71.936 1.00 57.98  ? 42  TRP A CG     1 
ATOM   543  C CD1    . TRP A 1 42  ? 4.917   66.873 71.479 1.00 57.47  ? 42  TRP A CD1    1 
ATOM   544  C CD2    . TRP A 1 42  ? 3.155   68.071 70.793 1.00 59.58  ? 42  TRP A CD2    1 
ATOM   545  N NE1    . TRP A 1 42  ? 5.032   67.047 70.121 1.00 58.76  ? 42  TRP A NE1    1 
ATOM   546  C CE2    . TRP A 1 42  ? 3.963   67.780 69.676 1.00 60.15  ? 42  TRP A CE2    1 
ATOM   547  C CE3    . TRP A 1 42  ? 1.987   68.816 70.606 1.00 60.91  ? 42  TRP A CE3    1 
ATOM   548  C CZ2    . TRP A 1 42  ? 3.640   68.208 68.391 1.00 62.23  ? 42  TRP A CZ2    1 
ATOM   549  C CZ3    . TRP A 1 42  ? 1.669   69.239 69.331 1.00 62.83  ? 42  TRP A CZ3    1 
ATOM   550  C CH2    . TRP A 1 42  ? 2.492   68.935 68.239 1.00 63.58  ? 42  TRP A CH2    1 
ATOM   551  H H      . TRP A 1 42  ? 2.339   68.452 75.428 1.00 72.23  ? 42  TRP A H      1 
ATOM   552  H HA     . TRP A 1 42  ? 4.759   68.587 74.305 1.00 72.14  ? 42  TRP A HA     1 
ATOM   553  H HB2    . TRP A 1 42  ? 3.579   66.710 73.786 1.00 68.47  ? 42  TRP A HB2    1 
ATOM   554  H HB3    . TRP A 1 42  ? 2.324   67.564 73.322 1.00 68.47  ? 42  TRP A HB3    1 
ATOM   555  H HD1    . TRP A 1 42  ? 5.523   66.408 72.010 1.00 69.92  ? 42  TRP A HD1    1 
ATOM   556  H HE1    . TRP A 1 42  ? 5.671   66.747 69.631 1.00 70.47  ? 42  TRP A HE1    1 
ATOM   557  H HE3    . TRP A 1 42  ? 1.436   69.022 71.326 1.00 67.71  ? 42  TRP A HE3    1 
ATOM   558  H HZ2    . TRP A 1 42  ? 4.184   68.008 67.664 1.00 70.49  ? 42  TRP A HZ2    1 
ATOM   559  H HZ3    . TRP A 1 42  ? 0.894   69.736 69.195 1.00 68.50  ? 42  TRP A HZ3    1 
ATOM   560  H HH2    . TRP A 1 42  ? 2.252   69.234 67.392 1.00 69.96  ? 42  TRP A HH2    1 
ATOM   561  N N      . ARG A 1 43  ? 2.508   70.671 73.454 1.00 67.29  ? 43  ARG A N      1 
ATOM   562  C CA     . ARG A 1 43  ? 2.321   71.951 72.782 1.00 68.97  ? 43  ARG A CA     1 
ATOM   563  C C      . ARG A 1 43  ? 3.285   73.000 73.321 1.00 74.17  ? 43  ARG A C      1 
ATOM   564  O O      . ARG A 1 43  ? 3.794   73.836 72.564 1.00 76.38  ? 43  ARG A O      1 
ATOM   565  C CB     . ARG A 1 43  ? 0.876   72.422 72.950 1.00 68.15  ? 43  ARG A CB     1 
ATOM   566  C CG     . ARG A 1 43  ? 0.591   73.776 72.325 1.00 71.71  ? 43  ARG A CG     1 
ATOM   567  C CD     . ARG A 1 43  ? -0.834  74.225 72.594 1.00 72.22  ? 43  ARG A CD     1 
ATOM   568  N NE     . ARG A 1 43  ? -1.095  74.404 74.020 1.00 72.39  ? 43  ARG A NE     1 
ATOM   569  C CZ     . ARG A 1 43  ? -0.801  75.503 74.711 1.00 75.50  ? 43  ARG A CZ     1 
ATOM   570  N NH1    . ARG A 1 43  ? -0.226  76.542 74.117 1.00 78.19  ? 43  ARG A NH1    1 
ATOM   571  N NH2    . ARG A 1 43  ? -1.081  75.564 76.006 1.00 77.18  ? 43  ARG A NH2    1 
ATOM   572  H H      . ARG A 1 43  ? 1.831   70.408 73.915 1.00 85.77  ? 43  ARG A H      1 
ATOM   573  H HA     . ARG A 1 43  ? 2.494   71.841 71.834 1.00 88.67  ? 43  ARG A HA     1 
ATOM   574  H HB2    . ARG A 1 43  ? 0.286   71.773 72.534 1.00 86.79  ? 43  ARG A HB2    1 
ATOM   575  H HB3    . ARG A 1 43  ? 0.677   72.485 73.898 1.00 86.79  ? 43  ARG A HB3    1 
ATOM   576  H HG2    . ARG A 1 43  ? 1.193   74.436 72.702 1.00 91.11  ? 43  ARG A HG2    1 
ATOM   577  H HG3    . ARG A 1 43  ? 0.715   73.718 71.364 1.00 91.11  ? 43  ARG A HG3    1 
ATOM   578  H HD2    . ARG A 1 43  ? -0.990  75.073 72.149 1.00 90.87  ? 43  ARG A HD2    1 
ATOM   579  H HD3    . ARG A 1 43  ? -1.448  73.554 72.256 1.00 90.87  ? 43  ARG A HD3    1 
ATOM   580  H HE     . ARG A 1 43  ? -1.465  73.753 74.444 1.00 90.55  ? 43  ARG A HE     1 
ATOM   581  H HH11   . ARG A 1 43  ? -0.042  76.510 73.278 1.00 97.30  ? 43  ARG A HH11   1 
ATOM   582  H HH12   . ARG A 1 43  ? -0.039  77.248 74.572 1.00 97.30  ? 43  ARG A HH12   1 
ATOM   583  H HH21   . ARG A 1 43  ? -1.452  74.895 76.398 1.00 92.60  ? 43  ARG A HH21   1 
ATOM   584  H HH22   . ARG A 1 43  ? -0.891  76.273 76.454 1.00 92.60  ? 43  ARG A HH22   1 
ATOM   585  N N      . LEU A 1 44  ? 3.541   72.977 74.628 1.00 71.39  ? 44  LEU A N      1 
ATOM   586  C CA     . LEU A 1 44  ? 4.364   73.996 75.266 1.00 75.37  ? 44  LEU A CA     1 
ATOM   587  C C      . LEU A 1 44  ? 5.855   73.697 75.190 1.00 76.45  ? 44  LEU A C      1 
ATOM   588  O O      . LEU A 1 44  ? 6.663   74.633 75.180 1.00 80.61  ? 44  LEU A O      1 
ATOM   589  C CB     . LEU A 1 44  ? 3.949   74.157 76.729 1.00 75.96  ? 44  LEU A CB     1 
ATOM   590  C CG     . LEU A 1 44  ? 2.496   74.596 76.929 1.00 75.73  ? 44  LEU A CG     1 
ATOM   591  C CD1    . LEU A 1 44  ? 2.114   74.535 78.392 1.00 76.24  ? 44  LEU A CD1    1 
ATOM   592  C CD2    . LEU A 1 44  ? 2.272   76.002 76.392 1.00 79.31  ? 44  LEU A CD2    1 
ATOM   593  H H      . LEU A 1 44  ? 3.246   72.376 75.169 1.00 81.15  ? 44  LEU A H      1 
ATOM   594  H HA     . LEU A 1 44  ? 4.211   74.843 74.820 1.00 86.32  ? 44  LEU A HA     1 
ATOM   595  H HB2    . LEU A 1 44  ? 4.064   73.306 77.180 1.00 87.13  ? 44  LEU A HB2    1 
ATOM   596  H HB3    . LEU A 1 44  ? 4.518   74.825 77.142 1.00 87.13  ? 44  LEU A HB3    1 
ATOM   597  H HG     . LEU A 1 44  ? 1.914   73.992 76.442 1.00 85.24  ? 44  LEU A HG     1 
ATOM   598  H HD11   . LEU A 1 44  ? 1.191   74.817 78.489 1.00 86.40  ? 44  LEU A HD11   1 
ATOM   599  H HD12   . LEU A 1 44  ? 2.216   73.623 78.707 1.00 86.40  ? 44  LEU A HD12   1 
ATOM   600  H HD13   . LEU A 1 44  ? 2.695   75.126 78.895 1.00 86.40  ? 44  LEU A HD13   1 
ATOM   601  H HD21   . LEU A 1 44  ? 1.344   76.249 76.533 1.00 88.11  ? 44  LEU A HD21   1 
ATOM   602  H HD22   . LEU A 1 44  ? 2.854   76.617 76.864 1.00 88.11  ? 44  LEU A HD22   1 
ATOM   603  H HD23   . LEU A 1 44  ? 2.477   76.013 75.444 1.00 88.11  ? 44  LEU A HD23   1 
ATOM   604  N N      . TYR A 1 45  ? 6.248   72.422 75.144 1.00 92.55  ? 45  TYR A N      1 
ATOM   605  C CA     . TYR A 1 45  ? 7.662   72.109 74.975 1.00 96.46  ? 45  TYR A CA     1 
ATOM   606  C C      . TYR A 1 45  ? 8.181   72.606 73.634 1.00 98.10  ? 45  TYR A C      1 
ATOM   607  O O      . TYR A 1 45  ? 9.381   72.860 73.488 1.00 101.95 ? 45  TYR A O      1 
ATOM   608  C CB     . TYR A 1 45  ? 7.895   70.607 75.104 1.00 93.34  ? 45  TYR A CB     1 
ATOM   609  C CG     . TYR A 1 45  ? 9.346   70.221 74.931 1.00 96.96  ? 45  TYR A CG     1 
ATOM   610  C CD1    . TYR A 1 45  ? 10.228  70.262 76.003 1.00 97.99  ? 45  TYR A CD1    1 
ATOM   611  C CD2    . TYR A 1 45  ? 9.838   69.828 73.694 1.00 96.33  ? 45  TYR A CD2    1 
ATOM   612  C CE1    . TYR A 1 45  ? 11.556  69.916 75.849 1.00 99.27  ? 45  TYR A CE1    1 
ATOM   613  C CE2    . TYR A 1 45  ? 11.164  69.481 73.530 1.00 98.69  ? 45  TYR A CE2    1 
ATOM   614  C CZ     . TYR A 1 45  ? 12.019  69.526 74.611 1.00 99.97  ? 45  TYR A CZ     1 
ATOM   615  O OH     . TYR A 1 45  ? 13.342  69.180 74.453 1.00 101.77 ? 45  TYR A OH     1 
ATOM   616  H H      . TYR A 1 45  ? 5.729   71.739 75.207 1.00 99.82  ? 45  TYR A H      1 
ATOM   617  H HA     . TYR A 1 45  ? 8.168   72.552 75.674 1.00 104.67 ? 45  TYR A HA     1 
ATOM   618  H HB2    . TYR A 1 45  ? 7.612   70.317 75.986 1.00 98.07  ? 45  TYR A HB2    1 
ATOM   619  H HB3    . TYR A 1 45  ? 7.380   70.147 74.423 1.00 98.07  ? 45  TYR A HB3    1 
ATOM   620  H HD1    . TYR A 1 45  ? 9.918   70.525 76.840 1.00 107.22 ? 45  TYR A HD1    1 
ATOM   621  H HD2    . TYR A 1 45  ? 9.264   69.796 72.963 1.00 103.24 ? 45  TYR A HD2    1 
ATOM   622  H HE1    . TYR A 1 45  ? 12.134  69.946 76.577 1.00 112.63 ? 45  TYR A HE1    1 
ATOM   623  H HE2    . TYR A 1 45  ? 11.479  69.217 72.696 1.00 108.99 ? 45  TYR A HE2    1 
ATOM   624  H HH     . TYR A 1 45  ? 13.489  68.964 73.655 1.00 119.82 ? 45  TYR A HH     1 
ATOM   625  N N      . ASN A 1 46  ? 7.296   72.750 72.645 1.00 104.93 ? 46  ASN A N      1 
ATOM   626  C CA     . ASN A 1 46  ? 7.665   73.280 71.339 1.00 106.73 ? 46  ASN A CA     1 
ATOM   627  C C      . ASN A 1 46  ? 7.615   74.803 71.294 1.00 110.04 ? 46  ASN A C      1 
ATOM   628  O O      . ASN A 1 46  ? 7.331   75.382 70.237 1.00 110.00 ? 46  ASN A O      1 
ATOM   629  C CB     . ASN A 1 46  ? 6.757   72.684 70.261 1.00 101.08 ? 46  ASN A CB     1 
ATOM   630  C CG     . ASN A 1 46  ? 7.304   72.886 68.861 1.00 102.35 ? 46  ASN A CG     1 
ATOM   631  O OD1    . ASN A 1 46  ? 6.920   73.823 68.160 1.00 102.53 ? 46  ASN A OD1    1 
ATOM   632  N ND2    . ASN A 1 46  ? 8.210   72.008 68.448 1.00 103.92 ? 46  ASN A ND2    1 
ATOM   633  H H      . ASN A 1 46  ? 6.464   72.543 72.711 1.00 110.66 ? 46  ASN A H      1 
ATOM   634  H HA     . ASN A 1 46  ? 8.575   73.009 71.140 1.00 117.21 ? 46  ASN A HA     1 
ATOM   635  H HB2    . ASN A 1 46  ? 6.669   71.730 70.414 1.00 110.08 ? 46  ASN A HB2    1 
ATOM   636  H HB3    . ASN A 1 46  ? 5.887   73.110 70.309 1.00 110.08 ? 46  ASN A HB3    1 
ATOM   637  H HD21   . ASN A 1 46  ? 8.551   72.079 67.662 1.00 111.31 ? 46  ASN A HD21   1 
ATOM   638  H HD22   . ASN A 1 46  ? 8.456   71.368 68.967 1.00 111.31 ? 46  ASN A HD22   1 
ATOM   639  N N      . ASP A 1 47  ? 7.884   75.471 72.420 1.00 85.40  ? 47  ASP A N      1 
ATOM   640  C CA     . ASP A 1 47  ? 7.857   76.926 72.484 1.00 90.36  ? 47  ASP A CA     1 
ATOM   641  C C      . ASP A 1 47  ? 9.089   77.542 73.133 1.00 95.06  ? 47  ASP A C      1 
ATOM   642  O O      . ASP A 1 47  ? 9.258   78.762 73.040 1.00 100.02 ? 47  ASP A O      1 
ATOM   643  C CB     . ASP A 1 47  ? 6.610   77.409 73.243 1.00 89.56  ? 47  ASP A CB     1 
ATOM   644  C CG     . ASP A 1 47  ? 5.322   77.140 72.485 1.00 86.59  ? 47  ASP A CG     1 
ATOM   645  O OD1    . ASP A 1 47  ? 5.387   76.872 71.268 1.00 86.28  ? 47  ASP A OD1    1 
ATOM   646  O OD2    . ASP A 1 47  ? 4.241   77.206 73.106 1.00 85.04  ? 47  ASP A OD2    1 
ATOM   647  H H      . ASP A 1 47  ? 8.087   75.095 73.167 1.00 114.35 ? 47  ASP A H      1 
ATOM   648  H HA     . ASP A 1 47  ? 7.801   77.271 71.579 1.00 115.91 ? 47  ASP A HA     1 
ATOM   649  H HB2    . ASP A 1 47  ? 6.559   76.948 74.094 1.00 103.47 ? 47  ASP A HB2    1 
ATOM   650  H HB3    . ASP A 1 47  ? 6.679   78.366 73.387 1.00 103.47 ? 47  ASP A HB3    1 
ATOM   651  N N      . GLU A 1 48  ? 9.947   76.754 73.782 1.00 141.18 ? 48  GLU A N      1 
ATOM   652  C CA     . GLU A 1 48  ? 11.183  77.286 74.343 1.00 142.97 ? 48  GLU A CA     1 
ATOM   653  C C      . GLU A 1 48  ? 12.135  77.650 73.212 1.00 146.39 ? 48  GLU A C      1 
ATOM   654  O O      . GLU A 1 48  ? 12.408  78.831 72.973 1.00 152.67 ? 48  GLU A O      1 
ATOM   655  C CB     . GLU A 1 48  ? 11.838  76.276 75.290 1.00 137.75 ? 48  GLU A CB     1 
ATOM   656  C CG     . GLU A 1 48  ? 11.053  75.987 76.565 1.00 133.20 ? 48  GLU A CG     1 
ATOM   657  C CD     . GLU A 1 48  ? 9.870   75.068 76.332 1.00 127.83 ? 48  GLU A CD     1 
ATOM   658  O OE1    . GLU A 1 48  ? 9.514   74.843 75.157 1.00 128.80 ? 48  GLU A OE1    1 
ATOM   659  O OE2    . GLU A 1 48  ? 9.298   74.567 77.324 1.00 122.18 ? 48  GLU A OE2    1 
ATOM   660  H H      . GLU A 1 48  ? 9.834   75.911 73.910 1.00 176.34 ? 48  GLU A H      1 
ATOM   661  H HA     . GLU A 1 48  ? 10.986  78.092 74.847 1.00 179.23 ? 48  GLU A HA     1 
ATOM   662  N N      . THR A 1 49  ? 12.642  76.639 72.513 1.00 139.33 ? 49  THR A N      1 
ATOM   663  C CA     . THR A 1 49  ? 13.442  76.830 71.309 1.00 141.46 ? 49  THR A CA     1 
ATOM   664  C C      . THR A 1 49  ? 12.608  76.396 70.107 1.00 142.26 ? 49  THR A C      1 
ATOM   665  O O      . THR A 1 49  ? 12.849  75.358 69.488 1.00 138.96 ? 49  THR A O      1 
ATOM   666  C CB     . THR A 1 49  ? 14.761  76.046 71.402 1.00 137.44 ? 49  THR A CB     1 
ATOM   667  O OG1    . THR A 1 49  ? 15.497  76.197 70.182 1.00 140.51 ? 49  THR A OG1    1 
ATOM   668  C CG2    . THR A 1 49  ? 14.496  74.568 71.655 1.00 131.05 ? 49  THR A CG2    1 
ATOM   669  H H      . THR A 1 49  ? 12.533  75.812 72.723 1.00 168.37 ? 49  THR A H      1 
ATOM   670  H HA     . THR A 1 49  ? 13.653  77.772 71.210 1.00 166.64 ? 49  THR A HA     1 
ATOM   671  N N      . ASN A 1 50  ? 11.601  77.215 69.795 1.00 111.23 ? 50  ASN A N      1 
ATOM   672  C CA     . ASN A 1 50  ? 10.643  76.951 68.728 1.00 112.54 ? 50  ASN A CA     1 
ATOM   673  C C      . ASN A 1 50  ? 11.292  76.251 67.541 1.00 113.23 ? 50  ASN A C      1 
ATOM   674  O O      . ASN A 1 50  ? 12.169  76.817 66.882 1.00 117.44 ? 50  ASN A O      1 
ATOM   675  C CB     . ASN A 1 50  ? 9.993   78.260 68.274 1.00 118.53 ? 50  ASN A CB     1 
ATOM   676  C CG     . ASN A 1 50  ? 9.319   79.005 69.410 1.00 118.46 ? 50  ASN A CG     1 
ATOM   677  O OD1    . ASN A 1 50  ? 9.956   79.777 70.127 1.00 120.04 ? 50  ASN A OD1    1 
ATOM   678  N ND2    . ASN A 1 50  ? 8.019   78.785 69.572 1.00 116.82 ? 50  ASN A ND2    1 
ATOM   679  N N      . SER A 1 51  ? 10.873  75.023 67.266 1.00 141.09 ? 51  SER A N      1 
ATOM   680  C CA     . SER A 1 51  ? 11.456  74.218 66.196 1.00 141.22 ? 51  SER A CA     1 
ATOM   681  C C      . SER A 1 51  ? 10.531  73.029 65.949 1.00 137.61 ? 51  SER A C      1 
ATOM   682  O O      . SER A 1 51  ? 9.387   73.005 66.418 1.00 135.62 ? 51  SER A O      1 
ATOM   683  C CB     . SER A 1 51  ? 12.878  73.780 66.549 1.00 139.16 ? 51  SER A CB     1 
ATOM   684  O OG     . SER A 1 51  ? 13.405  72.906 65.565 1.00 139.17 ? 51  SER A OG     1 
ATOM   685  N N      . ASN A 1 52  ? 11.030  72.041 65.206 1.00 146.89 ? 52  ASN A N      1 
ATOM   686  C CA     . ASN A 1 52  ? 10.279  70.825 64.919 1.00 143.45 ? 52  ASN A CA     1 
ATOM   687  C C      . ASN A 1 52  ? 11.045  69.541 65.201 1.00 139.18 ? 52  ASN A C      1 
ATOM   688  O O      . ASN A 1 52  ? 10.404  68.512 65.445 1.00 135.03 ? 52  ASN A O      1 
ATOM   689  C CB     . ASN A 1 52  ? 9.814   70.810 63.454 1.00 147.71 ? 52  ASN A CB     1 
ATOM   690  C CG     . ASN A 1 52  ? 10.961  70.981 62.474 1.00 152.17 ? 52  ASN A CG     1 
ATOM   691  O OD1    . ASN A 1 52  ? 12.126  70.780 62.818 1.00 151.51 ? 52  ASN A OD1    1 
ATOM   692  N ND2    . ASN A 1 52  ? 10.634  71.352 61.241 1.00 156.88 ? 52  ASN A ND2    1 
ATOM   693  N N      . GLN A 1 53  ? 12.381  69.560 65.179 1.00 116.19 ? 53  GLN A N      1 
ATOM   694  C CA     . GLN A 1 53  ? 13.166  68.370 65.477 1.00 113.45 ? 53  GLN A CA     1 
ATOM   695  C C      . GLN A 1 53  ? 14.360  68.667 66.376 1.00 112.69 ? 53  GLN A C      1 
ATOM   696  O O      . GLN A 1 53  ? 15.245  67.810 66.504 1.00 110.54 ? 53  GLN A O      1 
ATOM   697  C CB     . GLN A 1 53  ? 13.652  67.705 64.180 1.00 116.18 ? 53  GLN A CB     1 
ATOM   698  C CG     . GLN A 1 53  ? 12.552  67.040 63.365 1.00 116.05 ? 53  GLN A CG     1 
ATOM   699  C CD     . GLN A 1 53  ? 11.993  65.797 64.035 1.00 109.97 ? 53  GLN A CD     1 
ATOM   700  O OE1    . GLN A 1 53  ? 12.257  65.535 65.208 1.00 105.87 ? 53  GLN A OE1    1 
ATOM   701  N NE2    . GLN A 1 53  ? 11.218  65.020 63.285 1.00 109.48 ? 53  GLN A NE2    1 
ATOM   702  H H      . GLN A 1 53  ? 12.854  70.255 64.993 1.00 136.54 ? 53  GLN A H      1 
ATOM   703  H HA     . GLN A 1 53  ? 12.600  67.733 65.941 1.00 136.92 ? 53  GLN A HA     1 
ATOM   704  H HB2    . GLN A 1 53  ? 14.065  68.381 63.620 1.00 141.09 ? 53  GLN A HB2    1 
ATOM   705  H HB3    . GLN A 1 53  ? 14.305  67.024 64.405 1.00 141.09 ? 53  GLN A HB3    1 
ATOM   706  H HG2    . GLN A 1 53  ? 11.824  67.669 63.244 1.00 140.75 ? 53  GLN A HG2    1 
ATOM   707  H HG3    . GLN A 1 53  ? 12.912  66.779 62.503 1.00 140.75 ? 53  GLN A HG3    1 
ATOM   708  H HE21   . GLN A 1 53  ? 11.059  65.233 62.467 1.00 132.43 ? 53  GLN A HE21   1 
ATOM   709  H HE22   . GLN A 1 53  ? 10.877  64.304 63.617 1.00 132.43 ? 53  GLN A HE22   1 
ATOM   710  N N      . ASP A 1 54  ? 14.423  69.843 66.991 1.00 116.51 ? 54  ASP A N      1 
ATOM   711  C CA     . ASP A 1 54  ? 15.515  70.161 67.901 1.00 115.77 ? 54  ASP A CA     1 
ATOM   712  C C      . ASP A 1 54  ? 15.132  71.321 68.826 1.00 117.54 ? 54  ASP A C      1 
ATOM   713  O O      . ASP A 1 54  ? 14.864  72.413 68.333 1.00 122.08 ? 54  ASP A O      1 
ATOM   714  C CB     . ASP A 1 54  ? 16.781  70.518 67.119 1.00 118.78 ? 54  ASP A CB     1 
ATOM   715  C CG     . ASP A 1 54  ? 17.969  70.785 68.022 1.00 116.85 ? 54  ASP A CG     1 
ATOM   716  O OD1    . ASP A 1 54  ? 18.074  70.123 69.073 1.00 111.94 ? 54  ASP A OD1    1 
ATOM   717  O OD2    . ASP A 1 54  ? 18.797  71.659 67.681 1.00 120.49 ? 54  ASP A OD2    1 
ATOM   718  H H      . ASP A 1 54  ? 13.846  70.474 66.898 1.00 145.42 ? 54  ASP A H      1 
ATOM   719  H HA     . ASP A 1 54  ? 15.708  69.385 68.452 1.00 144.92 ? 54  ASP A HA     1 
ATOM   720  H HB2    . ASP A 1 54  ? 17.009  69.780 66.532 1.00 145.66 ? 54  ASP A HB2    1 
ATOM   721  H HB3    . ASP A 1 54  ? 16.615  71.319 66.597 1.00 145.66 ? 54  ASP A HB3    1 
ATOM   722  N N      . ASN A 1 55  ? 15.097  71.130 70.149 1.00 130.70 ? 55  ASN A N      1 
ATOM   723  C CA     . ASN A 1 55  ? 15.405  69.871 70.827 1.00 126.03 ? 55  ASN A CA     1 
ATOM   724  C C      . ASN A 1 55  ? 14.151  69.008 70.979 1.00 121.80 ? 55  ASN A C      1 
ATOM   725  O O      . ASN A 1 55  ? 13.048  69.543 71.068 1.00 123.76 ? 55  ASN A O      1 
ATOM   726  C CB     . ASN A 1 55  ? 16.017  70.145 72.200 1.00 125.15 ? 55  ASN A CB     1 
ATOM   727  C CG     . ASN A 1 55  ? 17.384  70.788 72.105 1.00 128.30 ? 55  ASN A CG     1 
ATOM   728  O OD1    . ASN A 1 55  ? 18.379  70.117 71.840 1.00 127.68 ? 55  ASN A OD1    1 
ATOM   729  N ND2    . ASN A 1 55  ? 17.440  72.097 72.314 1.00 131.75 ? 55  ASN A ND2    1 
ATOM   730  H H      . ASN A 1 55  ? 14.886  71.754 70.701 1.00 156.15 ? 55  ASN A H      1 
ATOM   731  H HA     . ASN A 1 55  ? 16.052  69.375 70.301 1.00 152.83 ? 55  ASN A HA     1 
ATOM   732  H HB2    . ASN A 1 55  ? 15.435  70.746 72.691 1.00 154.54 ? 55  ASN A HB2    1 
ATOM   733  H HB3    . ASN A 1 55  ? 16.111  69.307 72.678 1.00 154.54 ? 55  ASN A HB3    1 
ATOM   734  H HD21   . ASN A 1 55  ? 18.194  72.508 72.271 1.00 161.57 ? 55  ASN A HD21   1 
ATOM   735  H HD22   . ASN A 1 55  ? 16.721  72.535 72.492 1.00 161.57 ? 55  ASN A HD22   1 
ATOM   736  N N      . PRO A 1 56  ? 14.310  67.673 71.011 1.00 92.57  ? 56  PRO A N      1 
ATOM   737  C CA     . PRO A 1 56  ? 13.148  66.804 71.236 1.00 86.98  ? 56  PRO A CA     1 
ATOM   738  C C      . PRO A 1 56  ? 12.985  66.412 72.696 1.00 81.98  ? 56  PRO A C      1 
ATOM   739  O O      . PRO A 1 56  ? 13.974  66.271 73.423 1.00 80.76  ? 56  PRO A O      1 
ATOM   740  C CB     . PRO A 1 56  ? 13.457  65.587 70.358 1.00 85.88  ? 56  PRO A CB     1 
ATOM   741  C CG     . PRO A 1 56  ? 14.977  65.560 70.249 1.00 87.45  ? 56  PRO A CG     1 
ATOM   742  C CD     . PRO A 1 56  ? 15.523  66.877 70.766 1.00 91.02  ? 56  PRO A CD     1 
ATOM   743  H HA     . PRO A 1 56  ? 12.336  67.233 70.922 1.00 103.60 ? 56  PRO A HA     1 
ATOM   744  H HB2    . PRO A 1 56  ? 13.128  64.781 70.788 1.00 102.28 ? 56  PRO A HB2    1 
ATOM   745  H HB3    . PRO A 1 56  ? 13.051  65.701 69.485 1.00 102.28 ? 56  PRO A HB3    1 
ATOM   746  H HG2    . PRO A 1 56  ? 15.320  64.826 70.782 1.00 104.85 ? 56  PRO A HG2    1 
ATOM   747  H HG3    . PRO A 1 56  ? 15.225  65.439 69.319 1.00 104.85 ? 56  PRO A HG3    1 
ATOM   748  H HD2    . PRO A 1 56  ? 16.011  66.740 71.593 1.00 111.32 ? 56  PRO A HD2    1 
ATOM   749  H HD3    . PRO A 1 56  ? 16.076  67.302 70.092 1.00 111.32 ? 56  PRO A HD3    1 
ATOM   750  N N      . LEU A 1 57  ? 11.738  66.224 73.136 1.00 73.21  ? 57  LEU A N      1 
ATOM   751  C CA     . LEU A 1 57  ? 11.484  65.881 74.530 1.00 69.48  ? 57  LEU A CA     1 
ATOM   752  C C      . LEU A 1 57  ? 11.839  64.434 74.845 1.00 65.53  ? 57  LEU A C      1 
ATOM   753  O O      . LEU A 1 57  ? 12.095  64.112 76.011 1.00 62.89  ? 57  LEU A O      1 
ATOM   754  C CB     . LEU A 1 57  ? 10.015  66.140 74.872 1.00 73.02  ? 57  LEU A CB     1 
ATOM   755  C CG     . LEU A 1 57  ? 9.589   65.857 76.316 1.00 69.53  ? 57  LEU A CG     1 
ATOM   756  C CD1    . LEU A 1 57  ? 10.360  66.724 77.301 1.00 70.69  ? 57  LEU A CD1    1 
ATOM   757  C CD2    . LEU A 1 57  ? 8.093   66.070 76.476 1.00 68.97  ? 57  LEU A CD2    1 
ATOM   758  H H      . LEU A 1 57  ? 11.031  66.289 72.650 1.00 86.78  ? 57  LEU A H      1 
ATOM   759  H HA     . LEU A 1 57  ? 12.027  66.450 75.097 1.00 82.77  ? 57  LEU A HA     1 
ATOM   760  H HB2    . LEU A 1 57  ? 9.823   67.074 74.694 1.00 98.78  ? 57  LEU A HB2    1 
ATOM   761  H HB3    . LEU A 1 57  ? 9.467   65.585 74.296 1.00 98.78  ? 57  LEU A HB3    1 
ATOM   762  H HG     . LEU A 1 57  ? 9.781   64.929 76.523 1.00 94.95  ? 57  LEU A HG     1 
ATOM   763  H HD11   . LEU A 1 57  ? 10.065  66.517 78.201 1.00 95.67  ? 57  LEU A HD11   1 
ATOM   764  H HD12   . LEU A 1 57  ? 11.308  66.536 77.212 1.00 95.67  ? 57  LEU A HD12   1 
ATOM   765  H HD13   . LEU A 1 57  ? 10.188  67.657 77.102 1.00 95.67  ? 57  LEU A HD13   1 
ATOM   766  H HD21   . LEU A 1 57  ? 7.845   65.886 77.395 1.00 94.38  ? 57  LEU A HD21   1 
ATOM   767  H HD22   . LEU A 1 57  ? 7.881   66.990 76.253 1.00 94.38  ? 57  LEU A HD22   1 
ATOM   768  H HD23   . LEU A 1 57  ? 7.623   65.468 75.878 1.00 94.38  ? 57  LEU A HD23   1 
ATOM   769  N N      . GLY A 1 58  ? 11.856  63.561 73.847 1.00 51.13  ? 58  GLY A N      1 
ATOM   770  C CA     . GLY A 1 58  ? 12.184  62.171 74.087 1.00 49.61  ? 58  GLY A CA     1 
ATOM   771  C C      . GLY A 1 58  ? 12.229  61.399 72.790 1.00 48.63  ? 58  GLY A C      1 
ATOM   772  O O      . GLY A 1 58  ? 12.414  61.973 71.715 1.00 49.36  ? 58  GLY A O      1 
ATOM   773  H H      . GLY A 1 58  ? 11.682  63.751 73.026 1.00 72.86  ? 58  GLY A H      1 
ATOM   774  H HA2    . GLY A 1 58  ? 13.050  62.108 74.518 1.00 69.14  ? 58  GLY A HA2    1 
ATOM   775  H HA3    . GLY A 1 58  ? 11.516  61.771 74.665 1.00 69.14  ? 58  GLY A HA3    1 
ATOM   776  N N      . PHE A 1 59  ? 12.059  60.083 72.903 1.00 55.99  ? 59  PHE A N      1 
ATOM   777  C CA     . PHE A 1 59  ? 12.051  59.203 71.744 1.00 56.18  ? 59  PHE A CA     1 
ATOM   778  C C      . PHE A 1 59  ? 10.989  58.131 71.934 1.00 55.28  ? 59  PHE A C      1 
ATOM   779  O O      . PHE A 1 59  ? 10.511  57.887 73.045 1.00 53.91  ? 59  PHE A O      1 
ATOM   780  C CB     . PHE A 1 59  ? 13.425  58.557 71.511 1.00 56.33  ? 59  PHE A CB     1 
ATOM   781  C CG     . PHE A 1 59  ? 13.818  57.560 72.565 1.00 56.71  ? 59  PHE A CG     1 
ATOM   782  C CD1    . PHE A 1 59  ? 14.489  57.969 73.705 1.00 58.61  ? 59  PHE A CD1    1 
ATOM   783  C CD2    . PHE A 1 59  ? 13.530  56.215 72.409 1.00 55.75  ? 59  PHE A CD2    1 
ATOM   784  C CE1    . PHE A 1 59  ? 14.857  57.057 74.675 1.00 59.52  ? 59  PHE A CE1    1 
ATOM   785  C CE2    . PHE A 1 59  ? 13.896  55.297 73.375 1.00 55.98  ? 59  PHE A CE2    1 
ATOM   786  C CZ     . PHE A 1 59  ? 14.560  55.719 74.510 1.00 57.97  ? 59  PHE A CZ     1 
ATOM   787  H H      . PHE A 1 59  ? 11.946  59.673 73.650 1.00 67.07  ? 59  PHE A H      1 
ATOM   788  H HA     . PHE A 1 59  ? 11.823  59.719 70.955 1.00 67.66  ? 59  PHE A HA     1 
ATOM   789  H HB2    . PHE A 1 59  ? 13.411  58.095 70.658 1.00 67.19  ? 59  PHE A HB2    1 
ATOM   790  H HB3    . PHE A 1 59  ? 14.099  59.254 71.496 1.00 67.19  ? 59  PHE A HB3    1 
ATOM   791  H HD1    . PHE A 1 59  ? 14.690  58.869 73.821 1.00 72.18  ? 59  PHE A HD1    1 
ATOM   792  H HD2    . PHE A 1 59  ? 13.082  55.926 71.647 1.00 67.79  ? 59  PHE A HD2    1 
ATOM   793  H HE1    . PHE A 1 59  ? 15.304  57.343 75.438 1.00 73.14  ? 59  PHE A HE1    1 
ATOM   794  H HE2    . PHE A 1 59  ? 13.695  54.396 73.261 1.00 68.96  ? 59  PHE A HE2    1 
ATOM   795  H HZ     . PHE A 1 59  ? 14.807  55.103 75.161 1.00 71.37  ? 59  PHE A HZ     1 
ATOM   796  N N      . LYS A 1 60  ? 10.629  57.490 70.826 1.00 49.90  ? 60  LYS A N      1 
ATOM   797  C CA     . LYS A 1 60  ? 9.595   56.466 70.798 1.00 47.89  ? 60  LYS A CA     1 
ATOM   798  C C      . LYS A 1 60  ? 10.208  55.167 70.298 1.00 47.75  ? 60  LYS A C      1 
ATOM   799  O O      . LYS A 1 60  ? 10.938  55.168 69.302 1.00 50.09  ? 60  LYS A O      1 
ATOM   800  C CB     . LYS A 1 60  ? 8.432   56.893 69.897 1.00 46.70  ? 60  LYS A CB     1 
ATOM   801  C CG     . LYS A 1 60  ? 7.264   55.923 69.863 1.00 42.94  ? 60  LYS A CG     1 
ATOM   802  C CD     . LYS A 1 60  ? 6.081   56.525 69.118 1.00 42.43  ? 60  LYS A CD     1 
ATOM   803  C CE     . LYS A 1 60  ? 4.854   55.637 69.203 1.00 39.57  ? 60  LYS A CE     1 
ATOM   804  N NZ     . LYS A 1 60  ? 3.645   56.313 68.661 1.00 39.45  ? 60  LYS A NZ     1 
ATOM   805  H H      . LYS A 1 60  ? 10.981  57.639 70.056 1.00 59.51  ? 60  LYS A H      1 
ATOM   806  H HA     . LYS A 1 60  ? 9.255   56.322 71.695 1.00 57.59  ? 60  LYS A HA     1 
ATOM   807  H HB2    . LYS A 1 60  ? 8.095   57.747 70.211 1.00 57.30  ? 60  LYS A HB2    1 
ATOM   808  H HB3    . LYS A 1 60  ? 8.762   56.987 68.990 1.00 57.30  ? 60  LYS A HB3    1 
ATOM   809  H HG2    . LYS A 1 60  ? 7.533   55.111 69.406 1.00 56.68  ? 60  LYS A HG2    1 
ATOM   810  H HG3    . LYS A 1 60  ? 6.985   55.723 70.770 1.00 56.68  ? 60  LYS A HG3    1 
ATOM   811  H HD2    . LYS A 1 60  ? 5.861   57.385 69.510 1.00 58.35  ? 60  LYS A HD2    1 
ATOM   812  H HD3    . LYS A 1 60  ? 6.314   56.633 68.183 1.00 58.35  ? 60  LYS A HD3    1 
ATOM   813  H HE2    . LYS A 1 60  ? 5.007   54.830 68.686 1.00 58.39  ? 60  LYS A HE2    1 
ATOM   814  H HE3    . LYS A 1 60  ? 4.685   55.413 70.132 1.00 58.39  ? 60  LYS A HE3    1 
ATOM   815  H HZ1    . LYS A 1 60  ? 2.941   55.772 68.722 1.00 59.89  ? 60  LYS A HZ1    1 
ATOM   816  H HZ2    . LYS A 1 60  ? 3.480   57.056 69.122 1.00 59.89  ? 60  LYS A HZ2    1 
ATOM   817  H HZ3    . LYS A 1 60  ? 3.774   56.525 67.806 1.00 59.89  ? 60  LYS A HZ3    1 
ATOM   818  N N      . GLU A 1 61  ? 9.923   54.068 70.993 1.00 43.19  ? 61  GLU A N      1 
ATOM   819  C CA     . GLU A 1 61  ? 10.452  52.765 70.621 1.00 41.94  ? 61  GLU A CA     1 
ATOM   820  C C      . GLU A 1 61  ? 9.369   51.710 70.794 1.00 39.81  ? 61  GLU A C      1 
ATOM   821  O O      . GLU A 1 61  ? 8.439   51.875 71.587 1.00 38.38  ? 61  GLU A O      1 
ATOM   822  C CB     . GLU A 1 61  ? 11.692  52.392 71.450 1.00 42.44  ? 61  GLU A CB     1 
ATOM   823  C CG     . GLU A 1 61  ? 11.456  52.301 72.950 1.00 42.43  ? 61  GLU A CG     1 
ATOM   824  C CD     . GLU A 1 61  ? 12.680  51.804 73.701 1.00 43.61  ? 61  GLU A CD     1 
ATOM   825  O OE1    . GLU A 1 61  ? 13.692  51.477 73.043 1.00 43.81  ? 61  GLU A OE1    1 
ATOM   826  O OE2    . GLU A 1 61  ? 12.629  51.736 74.948 1.00 43.90  ? 61  GLU A OE2    1 
ATOM   827  H H      . GLU A 1 61  ? 9.420   54.053 71.690 1.00 50.91  ? 61  GLU A H      1 
ATOM   828  H HA     . GLU A 1 61  ? 10.709  52.782 69.686 1.00 49.03  ? 61  GLU A HA     1 
ATOM   829  H HB2    . GLU A 1 61  ? 12.015  51.527 71.151 1.00 48.19  ? 61  GLU A HB2    1 
ATOM   830  H HB3    . GLU A 1 61  ? 12.376  53.064 71.301 1.00 48.19  ? 61  GLU A HB3    1 
ATOM   831  H HG2    . GLU A 1 61  ? 11.232  53.182 73.289 1.00 51.42  ? 61  GLU A HG2    1 
ATOM   832  H HG3    . GLU A 1 61  ? 10.727  51.684 73.119 1.00 51.42  ? 61  GLU A HG3    1 
ATOM   833  N N      . SER A 1 62  ? 9.499   50.619 70.040 1.00 38.97  ? 62  SER A N      1 
ATOM   834  C CA     . SER A 1 62  ? 8.494   49.567 70.044 1.00 38.95  ? 62  SER A CA     1 
ATOM   835  C C      . SER A 1 62  ? 9.163   48.212 69.864 1.00 39.36  ? 62  SER A C      1 
ATOM   836  O O      . SER A 1 62  ? 10.214  48.098 69.230 1.00 40.06  ? 62  SER A O      1 
ATOM   837  C CB     . SER A 1 62  ? 7.454   49.789 68.939 1.00 39.34  ? 62  SER A CB     1 
ATOM   838  O OG     . SER A 1 62  ? 8.040   49.679 67.655 1.00 40.37  ? 62  SER A OG     1 
ATOM   839  H H      . SER A 1 62  ? 10.165  50.467 69.516 1.00 46.23  ? 62  SER A H      1 
ATOM   840  H HA     . SER A 1 62  ? 8.035   49.568 70.899 1.00 50.71  ? 62  SER A HA     1 
ATOM   841  H HB2    . SER A 1 62  ? 6.756   49.120 69.025 1.00 55.33  ? 62  SER A HB2    1 
ATOM   842  H HB3    . SER A 1 62  ? 7.075   50.677 69.037 1.00 55.33  ? 62  SER A HB3    1 
ATOM   843  H HG     . SER A 1 62  ? 7.458   49.803 67.062 1.00 56.60  ? 62  SER A HG     1 
ATOM   844  N N      . TRP A 1 63  ? 8.537   47.186 70.436 1.00 38.90  ? 63  TRP A N      1 
ATOM   845  C CA     . TRP A 1 63  ? 8.945   45.800 70.254 1.00 40.02  ? 63  TRP A CA     1 
ATOM   846  C C      . TRP A 1 63  ? 7.760   45.010 69.721 1.00 40.96  ? 63  TRP A C      1 
ATOM   847  O O      . TRP A 1 63  ? 6.681   45.021 70.324 1.00 41.03  ? 63  TRP A O      1 
ATOM   848  C CB     . TRP A 1 63  ? 9.436   45.180 71.565 1.00 40.77  ? 63  TRP A CB     1 
ATOM   849  C CG     . TRP A 1 63  ? 10.917  45.255 71.760 1.00 41.16  ? 63  TRP A CG     1 
ATOM   850  C CD1    . TRP A 1 63  ? 11.594  46.101 72.590 1.00 40.97  ? 63  TRP A CD1    1 
ATOM   851  C CD2    . TRP A 1 63  ? 11.909  44.448 71.114 1.00 42.20  ? 63  TRP A CD2    1 
ATOM   852  N NE1    . TRP A 1 63  ? 12.946  45.870 72.501 1.00 41.46  ? 63  TRP A NE1    1 
ATOM   853  C CE2    . TRP A 1 63  ? 13.165  44.859 71.602 1.00 42.02  ? 63  TRP A CE2    1 
ATOM   854  C CE3    . TRP A 1 63  ? 11.856  43.417 70.171 1.00 43.45  ? 63  TRP A CE3    1 
ATOM   855  C CZ2    . TRP A 1 63  ? 14.358  44.278 71.178 1.00 42.22  ? 63  TRP A CZ2    1 
ATOM   856  C CZ3    . TRP A 1 63  ? 13.042  42.841 69.751 1.00 44.13  ? 63  TRP A CZ3    1 
ATOM   857  C CH2    . TRP A 1 63  ? 14.275  43.273 70.254 1.00 43.19  ? 63  TRP A CH2    1 
ATOM   858  H H      . TRP A 1 63  ? 7.852   47.274 70.949 1.00 54.57  ? 63  TRP A H      1 
ATOM   859  H HA     . TRP A 1 63  ? 9.663   45.755 69.604 1.00 53.50  ? 63  TRP A HA     1 
ATOM   860  H HB2    . TRP A 1 63  ? 9.016   45.645 72.306 1.00 54.29  ? 63  TRP A HB2    1 
ATOM   861  H HB3    . TRP A 1 63  ? 9.183   44.243 71.581 1.00 54.29  ? 63  TRP A HB3    1 
ATOM   862  H HD1    . TRP A 1 63  ? 11.198  46.739 73.139 1.00 55.22  ? 63  TRP A HD1    1 
ATOM   863  H HE1    . TRP A 1 63  ? 13.555  46.290 72.939 1.00 55.08  ? 63  TRP A HE1    1 
ATOM   864  H HE3    . TRP A 1 63  ? 11.041  43.125 69.832 1.00 55.21  ? 63  TRP A HE3    1 
ATOM   865  H HZ2    . TRP A 1 63  ? 15.179  44.563 71.509 1.00 54.35  ? 63  TRP A HZ2    1 
ATOM   866  H HZ3    . TRP A 1 63  ? 13.019  42.155 69.124 1.00 55.73  ? 63  TRP A HZ3    1 
ATOM   867  H HH2    . TRP A 1 63  ? 15.056  42.867 69.953 1.00 55.10  ? 63  TRP A HH2    1 
ATOM   868  N N      . GLY A 1 64  ? 7.961   44.332 68.595 1.00 37.29  ? 64  GLY A N      1 
ATOM   869  C CA     . GLY A 1 64  ? 6.917   43.515 68.012 1.00 39.16  ? 64  GLY A CA     1 
ATOM   870  C C      . GLY A 1 64  ? 7.300   42.053 67.932 1.00 41.57  ? 64  GLY A C      1 
ATOM   871  O O      . GLY A 1 64  ? 8.325   41.707 67.340 1.00 41.33  ? 64  GLY A O      1 
ATOM   872  H H      . GLY A 1 64  ? 8.697   44.333 68.151 1.00 52.20  ? 64  GLY A H      1 
ATOM   873  H HA2    . GLY A 1 64  ? 6.111   43.592 68.546 1.00 53.85  ? 64  GLY A HA2    1 
ATOM   874  H HA3    . GLY A 1 64  ? 6.723   43.830 67.115 1.00 53.85  ? 64  GLY A HA3    1 
ATOM   875  N N      . PHE A 1 65  ? 6.491   41.188 68.538 1.00 41.52  ? 65  PHE A N      1 
ATOM   876  C CA     . PHE A 1 65  ? 6.640   39.739 68.422 1.00 43.97  ? 65  PHE A CA     1 
ATOM   877  C C      . PHE A 1 65  ? 5.404   39.239 67.686 1.00 46.97  ? 65  PHE A C      1 
ATOM   878  O O      . PHE A 1 65  ? 4.349   39.031 68.293 1.00 48.96  ? 65  PHE A O      1 
ATOM   879  C CB     . PHE A 1 65  ? 6.790   39.083 69.789 1.00 45.49  ? 65  PHE A CB     1 
ATOM   880  C CG     . PHE A 1 65  ? 7.766   39.777 70.689 1.00 44.18  ? 65  PHE A CG     1 
ATOM   881  C CD1    . PHE A 1 65  ? 9.130   39.624 70.508 1.00 44.25  ? 65  PHE A CD1    1 
ATOM   882  C CD2    . PHE A 1 65  ? 7.318   40.583 71.722 1.00 43.51  ? 65  PHE A CD2    1 
ATOM   883  C CE1    . PHE A 1 65  ? 10.026  40.265 71.340 1.00 43.67  ? 65  PHE A CE1    1 
ATOM   884  C CE2    . PHE A 1 65  ? 8.207   41.223 72.554 1.00 42.90  ? 65  PHE A CE2    1 
ATOM   885  C CZ     . PHE A 1 65  ? 9.561   41.065 72.364 1.00 42.98  ? 65  PHE A CZ     1 
ATOM   886  H H      . PHE A 1 65  ? 5.831   41.423 69.036 1.00 55.33  ? 65  PHE A H      1 
ATOM   887  H HA     . PHE A 1 65  ? 7.425   39.532 67.890 1.00 57.03  ? 65  PHE A HA     1 
ATOM   888  H HB2    . PHE A 1 65  ? 5.927   39.082 70.231 1.00 56.83  ? 65  PHE A HB2    1 
ATOM   889  H HB3    . PHE A 1 65  ? 7.097   38.171 69.666 1.00 56.83  ? 65  PHE A HB3    1 
ATOM   890  H HD1    . PHE A 1 65  ? 9.445   39.085 69.818 1.00 52.91  ? 65  PHE A HD1    1 
ATOM   891  H HD2    . PHE A 1 65  ? 6.404   40.694 71.855 1.00 54.24  ? 65  PHE A HD2    1 
ATOM   892  H HE1    . PHE A 1 65  ? 10.941  40.157 71.212 1.00 51.45  ? 65  PHE A HE1    1 
ATOM   893  H HE2    . PHE A 1 65  ? 7.893   41.762 73.243 1.00 52.81  ? 65  PHE A HE2    1 
ATOM   894  H HZ     . PHE A 1 65  ? 10.163  41.497 72.926 1.00 51.39  ? 65  PHE A HZ     1 
ATOM   895  N N      . GLY A 1 66  ? 5.536   39.048 66.377 1.00 45.62  ? 66  GLY A N      1 
ATOM   896  C CA     . GLY A 1 66  ? 4.354   38.850 65.563 1.00 47.36  ? 66  GLY A CA     1 
ATOM   897  C C      . GLY A 1 66  ? 3.502   40.102 65.587 1.00 45.62  ? 66  GLY A C      1 
ATOM   898  O O      . GLY A 1 66  ? 4.001   41.227 65.468 1.00 42.90  ? 66  GLY A O      1 
ATOM   899  H H      . GLY A 1 66  ? 6.281   39.030 65.949 1.00 56.59  ? 66  GLY A H      1 
ATOM   900  H HA2    . GLY A 1 66  ? 4.609   38.660 64.646 1.00 57.13  ? 66  GLY A HA2    1 
ATOM   901  H HA3    . GLY A 1 66  ? 3.834   38.107 65.907 1.00 57.13  ? 66  GLY A HA3    1 
ATOM   902  N N      . LYS A 1 67  ? 2.198   39.914 65.763 1.00 47.75  ? 67  LYS A N      1 
ATOM   903  C CA     . LYS A 1 67  ? 1.270   41.030 65.871 1.00 47.07  ? 67  LYS A CA     1 
ATOM   904  C C      . LYS A 1 67  ? 1.085   41.503 67.310 1.00 46.27  ? 67  LYS A C      1 
ATOM   905  O O      . LYS A 1 67  ? 0.142   42.251 67.587 1.00 46.80  ? 67  LYS A O      1 
ATOM   906  C CB     . LYS A 1 67  ? -0.085  40.651 65.266 1.00 50.61  ? 67  LYS A CB     1 
ATOM   907  C CG     . LYS A 1 67  ? -0.661  39.339 65.769 1.00 54.21  ? 67  LYS A CG     1 
ATOM   908  C CD     . LYS A 1 67  ? -2.107  39.175 65.334 1.00 58.09  ? 67  LYS A CD     1 
ATOM   909  C CE     . LYS A 1 67  ? -2.538  37.717 65.361 1.00 62.54  ? 67  LYS A CE     1 
ATOM   910  N NZ     . LYS A 1 67  ? -1.875  36.918 64.290 1.00 63.36  ? 67  LYS A NZ     1 
ATOM   911  H H      . LYS A 1 67  ? 1.824   39.142 65.823 1.00 58.34  ? 67  LYS A H      1 
ATOM   912  H HA     . LYS A 1 67  ? 1.622   41.776 65.360 1.00 57.80  ? 67  LYS A HA     1 
ATOM   913  H HB2    . LYS A 1 67  ? -0.723  41.350 65.474 1.00 60.72  ? 67  LYS A HB2    1 
ATOM   914  H HB3    . LYS A 1 67  ? 0.016   40.577 64.304 1.00 60.72  ? 67  LYS A HB3    1 
ATOM   915  H HG2    . LYS A 1 67  ? -0.147  38.601 65.404 1.00 65.00  ? 67  LYS A HG2    1 
ATOM   916  H HG3    . LYS A 1 67  ? -0.630  39.324 66.738 1.00 65.00  ? 67  LYS A HG3    1 
ATOM   917  H HD2    . LYS A 1 67  ? -2.680  39.673 65.937 1.00 68.19  ? 67  LYS A HD2    1 
ATOM   918  H HD3    . LYS A 1 67  ? -2.207  39.504 64.427 1.00 68.19  ? 67  LYS A HD3    1 
ATOM   919  H HE2    . LYS A 1 67  ? -2.300  37.330 66.218 1.00 72.82  ? 67  LYS A HE2    1 
ATOM   920  H HE3    . LYS A 1 67  ? -3.497  37.666 65.226 1.00 72.82  ? 67  LYS A HE3    1 
ATOM   921  H HZ1    . LYS A 1 67  ? -2.146  36.071 64.331 1.00 72.80  ? 67  LYS A HZ1    1 
ATOM   922  H HZ2    . LYS A 1 67  ? -2.082  37.250 63.491 1.00 72.80  ? 67  LYS A HZ2    1 
ATOM   923  H HZ3    . LYS A 1 67  ? -0.992  36.945 64.395 1.00 72.80  ? 67  LYS A HZ3    1 
ATOM   924  N N      . VAL A 1 68  ? 1.963   41.094 68.222 1.00 49.50  ? 68  VAL A N      1 
ATOM   925  C CA     . VAL A 1 68  ? 1.902   41.492 69.624 1.00 49.15  ? 68  VAL A CA     1 
ATOM   926  C C      . VAL A 1 68  ? 2.926   42.608 69.806 1.00 45.12  ? 68  VAL A C      1 
ATOM   927  O O      . VAL A 1 68  ? 4.121   42.352 69.981 1.00 44.78  ? 68  VAL A O      1 
ATOM   928  C CB     . VAL A 1 68  ? 2.175   40.310 70.559 1.00 51.93  ? 68  VAL A CB     1 
ATOM   929  C CG1    . VAL A 1 68  ? 1.937   40.709 72.007 1.00 52.71  ? 68  VAL A CG1    1 
ATOM   930  C CG2    . VAL A 1 68  ? 1.306   39.116 70.180 1.00 56.34  ? 68  VAL A CG2    1 
ATOM   931  H H      . VAL A 1 68  ? 2.622   40.570 68.046 1.00 58.11  ? 68  VAL A H      1 
ATOM   932  H HA     . VAL A 1 68  ? 1.021   41.846 69.823 1.00 58.73  ? 68  VAL A HA     1 
ATOM   933  H HB     . VAL A 1 68  ? 3.104   40.045 70.470 1.00 61.48  ? 68  VAL A HB     1 
ATOM   934  H HG11   . VAL A 1 68  ? 2.115   39.945 72.578 1.00 62.77  ? 68  VAL A HG11   1 
ATOM   935  H HG12   . VAL A 1 68  ? 2.533   41.440 72.235 1.00 62.77  ? 68  VAL A HG12   1 
ATOM   936  H HG13   . VAL A 1 68  ? 1.014   40.990 72.109 1.00 62.77  ? 68  VAL A HG13   1 
ATOM   937  H HG21   . VAL A 1 68  ? 1.497   38.382 70.785 1.00 65.38  ? 68  VAL A HG21   1 
ATOM   938  H HG22   . VAL A 1 68  ? 0.372   39.369 70.251 1.00 65.38  ? 68  VAL A HG22   1 
ATOM   939  H HG23   . VAL A 1 68  ? 1.510   38.854 69.268 1.00 65.38  ? 68  VAL A HG23   1 
ATOM   940  N N      . VAL A 1 69  ? 2.458   43.854 69.779 1.00 42.14  ? 69  VAL A N      1 
ATOM   941  C CA     . VAL A 1 69  ? 3.323   45.025 69.686 1.00 38.60  ? 69  VAL A CA     1 
ATOM   942  C C      . VAL A 1 69  ? 3.265   45.799 70.995 1.00 38.17  ? 69  VAL A C      1 
ATOM   943  O O      . VAL A 1 69  ? 2.177   46.083 71.510 1.00 39.89  ? 69  VAL A O      1 
ATOM   944  C CB     . VAL A 1 69  ? 2.917   45.920 68.502 1.00 37.39  ? 69  VAL A CB     1 
ATOM   945  C CG1    . VAL A 1 69  ? 3.824   47.141 68.410 1.00 35.10  ? 69  VAL A CG1    1 
ATOM   946  C CG2    . VAL A 1 69  ? 2.957   45.119 67.200 1.00 38.11  ? 69  VAL A CG2    1 
ATOM   947  H H      . VAL A 1 69  ? 1.621   44.050 69.815 1.00 56.85  ? 69  VAL A H      1 
ATOM   948  H HA     . VAL A 1 69  ? 4.238   44.735 69.546 1.00 51.23  ? 69  VAL A HA     1 
ATOM   949  H HB     . VAL A 1 69  ? 2.008   46.230 68.636 1.00 50.03  ? 69  VAL A HB     1 
ATOM   950  H HG11   . VAL A 1 69  ? 3.545   47.685 67.656 1.00 47.68  ? 69  VAL A HG11   1 
ATOM   951  H HG12   . VAL A 1 69  ? 3.751   47.651 69.232 1.00 47.68  ? 69  VAL A HG12   1 
ATOM   952  H HG13   . VAL A 1 69  ? 4.739   46.845 68.284 1.00 47.68  ? 69  VAL A HG13   1 
ATOM   953  H HG21   . VAL A 1 69  ? 2.698   45.698 66.466 1.00 49.83  ? 69  VAL A HG21   1 
ATOM   954  H HG22   . VAL A 1 69  ? 3.858   44.789 67.061 1.00 49.83  ? 69  VAL A HG22   1 
ATOM   955  H HG23   . VAL A 1 69  ? 2.338   44.375 67.269 1.00 49.83  ? 69  VAL A HG23   1 
ATOM   956  N N      . PHE A 1 70  ? 4.437   46.141 71.524 1.00 39.96  ? 70  PHE A N      1 
ATOM   957  C CA     . PHE A 1 70  ? 4.576   46.989 72.697 1.00 39.48  ? 70  PHE A CA     1 
ATOM   958  C C      . PHE A 1 70  ? 5.249   48.296 72.297 1.00 37.17  ? 70  PHE A C      1 
ATOM   959  O O      . PHE A 1 70  ? 6.029   48.341 71.341 1.00 36.25  ? 70  PHE A O      1 
ATOM   960  C CB     . PHE A 1 70  ? 5.402   46.300 73.786 1.00 40.90  ? 70  PHE A CB     1 
ATOM   961  C CG     . PHE A 1 70  ? 4.825   44.996 74.259 1.00 44.26  ? 70  PHE A CG     1 
ATOM   962  C CD1    . PHE A 1 70  ? 5.055   43.826 73.555 1.00 45.63  ? 70  PHE A CD1    1 
ATOM   963  C CD2    . PHE A 1 70  ? 4.065   44.938 75.415 1.00 46.92  ? 70  PHE A CD2    1 
ATOM   964  C CE1    . PHE A 1 70  ? 4.530   42.622 73.993 1.00 49.66  ? 70  PHE A CE1    1 
ATOM   965  C CE2    . PHE A 1 70  ? 3.538   43.740 75.857 1.00 51.54  ? 70  PHE A CE2    1 
ATOM   966  C CZ     . PHE A 1 70  ? 3.771   42.580 75.145 1.00 53.06  ? 70  PHE A CZ     1 
ATOM   967  H H      . PHE A 1 70  ? 5.192   45.882 71.205 1.00 51.54  ? 70  PHE A H      1 
ATOM   968  H HA     . PHE A 1 70  ? 3.698   47.192 73.057 1.00 52.00  ? 70  PHE A HA     1 
ATOM   969  H HB2    . PHE A 1 70  ? 6.289   46.122 73.439 1.00 52.14  ? 70  PHE A HB2    1 
ATOM   970  H HB3    . PHE A 1 70  ? 5.462   46.892 74.553 1.00 52.14  ? 70  PHE A HB3    1 
ATOM   971  H HD1    . PHE A 1 70  ? 5.565   43.849 72.778 1.00 54.16  ? 70  PHE A HD1    1 
ATOM   972  H HD2    . PHE A 1 70  ? 3.905   45.716 75.899 1.00 56.91  ? 70  PHE A HD2    1 
ATOM   973  H HE1    . PHE A 1 70  ? 4.688   41.843 73.511 1.00 57.31  ? 70  PHE A HE1    1 
ATOM   974  H HE2    . PHE A 1 70  ? 3.027   43.715 76.634 1.00 60.02  ? 70  PHE A HE2    1 
ATOM   975  H HZ     . PHE A 1 70  ? 3.417   41.773 75.441 1.00 60.28  ? 70  PHE A HZ     1 
ATOM   976  N N      . LYS A 1 71  ? 4.952   49.362 73.039 1.00 49.58  ? 71  LYS A N      1 
ATOM   977  C CA     . LYS A 1 71  ? 5.460   50.685 72.705 1.00 48.40  ? 71  LYS A CA     1 
ATOM   978  C C      . LYS A 1 71  ? 5.769   51.477 73.966 1.00 48.57  ? 71  LYS A C      1 
ATOM   979  O O      . LYS A 1 71  ? 5.041   51.398 74.959 1.00 49.40  ? 71  LYS A O      1 
ATOM   980  C CB     . LYS A 1 71  ? 4.456   51.453 71.838 1.00 48.04  ? 71  LYS A CB     1 
ATOM   981  C CG     . LYS A 1 71  ? 4.519   51.078 70.369 1.00 47.66  ? 71  LYS A CG     1 
ATOM   982  C CD     . LYS A 1 71  ? 3.330   51.604 69.590 1.00 47.45  ? 71  LYS A CD     1 
ATOM   983  C CE     . LYS A 1 71  ? 3.430   51.214 68.126 1.00 47.31  ? 71  LYS A CE     1 
ATOM   984  N NZ     . LYS A 1 71  ? 2.200   51.561 67.370 1.00 49.37  ? 71  LYS A NZ     1 
ATOM   985  H H      . LYS A 1 71  ? 4.458   49.342 73.743 1.00 64.56  ? 71  LYS A H      1 
ATOM   986  H HA     . LYS A 1 71  ? 6.283   50.590 72.200 1.00 62.68  ? 71  LYS A HA     1 
ATOM   987  H HB2    . LYS A 1 71  ? 3.559   51.265 72.155 1.00 64.36  ? 71  LYS A HB2    1 
ATOM   988  H HB3    . LYS A 1 71  ? 4.640   52.403 71.912 1.00 64.36  ? 71  LYS A HB3    1 
ATOM   989  H HG2    . LYS A 1 71  ? 5.325   51.453 69.980 1.00 63.31  ? 71  LYS A HG2    1 
ATOM   990  H HG3    . LYS A 1 71  ? 4.529   50.112 70.288 1.00 63.31  ? 71  LYS A HG3    1 
ATOM   991  H HD2    . LYS A 1 71  ? 2.514   51.226 69.954 1.00 65.22  ? 71  LYS A HD2    1 
ATOM   992  H HD3    . LYS A 1 71  ? 3.310   52.573 69.648 1.00 65.22  ? 71  LYS A HD3    1 
ATOM   993  H HE2    . LYS A 1 71  ? 4.176   51.683 67.722 1.00 65.04  ? 71  LYS A HE2    1 
ATOM   994  H HE3    . LYS A 1 71  ? 3.564   50.255 68.061 1.00 65.04  ? 71  LYS A HE3    1 
ATOM   995  H HZ1    . LYS A 1 71  ? 2.289   51.320 66.518 1.00 68.22  ? 71  LYS A HZ1    1 
ATOM   996  H HZ2    . LYS A 1 71  ? 1.499   51.138 67.719 1.00 68.22  ? 71  LYS A HZ2    1 
ATOM   997  H HZ3    . LYS A 1 71  ? 2.056   52.439 67.409 1.00 68.22  ? 71  LYS A HZ3    1 
ATOM   998  N N      . ARG A 1 72  ? 6.857   52.244 73.910 1.00 46.27  ? 72  ARG A N      1 
ATOM   999  C CA     . ARG A 1 72  ? 7.268   53.112 75.002 1.00 47.28  ? 72  ARG A CA     1 
ATOM   1000 C C      . ARG A 1 72  ? 7.713   54.455 74.445 1.00 48.78  ? 72  ARG A C      1 
ATOM   1001 O O      . ARG A 1 72  ? 8.267   54.537 73.346 1.00 49.06  ? 72  ARG A O      1 
ATOM   1002 C CB     . ARG A 1 72  ? 8.417   52.503 75.821 1.00 47.87  ? 72  ARG A CB     1 
ATOM   1003 C CG     . ARG A 1 72  ? 7.992   51.498 76.873 1.00 48.33  ? 72  ARG A CG     1 
ATOM   1004 C CD     . ARG A 1 72  ? 7.186   52.155 77.977 1.00 50.52  ? 72  ARG A CD     1 
ATOM   1005 N NE     . ARG A 1 72  ? 6.867   51.218 79.049 1.00 53.87  ? 72  ARG A NE     1 
ATOM   1006 C CZ     . ARG A 1 72  ? 5.966   50.247 78.947 1.00 54.75  ? 72  ARG A CZ     1 
ATOM   1007 N NH1    . ARG A 1 72  ? 5.296   50.072 77.814 1.00 52.74  ? 72  ARG A NH1    1 
ATOM   1008 N NH2    . ARG A 1 72  ? 5.740   49.444 79.977 1.00 57.98  ? 72  ARG A NH2    1 
ATOM   1009 H H      . ARG A 1 72  ? 7.385   52.276 73.231 1.00 58.87  ? 72  ARG A H      1 
ATOM   1010 H HA     . ARG A 1 72  ? 6.515   53.261 75.595 1.00 59.50  ? 72  ARG A HA     1 
ATOM   1011 H HB2    . ARG A 1 72  ? 9.024   52.052 75.213 1.00 58.36  ? 72  ARG A HB2    1 
ATOM   1012 H HB3    . ARG A 1 72  ? 8.886   53.221 76.275 1.00 58.36  ? 72  ARG A HB3    1 
ATOM   1013 H HG2    . ARG A 1 72  ? 7.441   50.816 76.459 1.00 60.24  ? 72  ARG A HG2    1 
ATOM   1014 H HG3    . ARG A 1 72  ? 8.781   51.098 77.270 1.00 60.24  ? 72  ARG A HG3    1 
ATOM   1015 H HD2    . ARG A 1 72  ? 7.700   52.885 78.356 1.00 64.35  ? 72  ARG A HD2    1 
ATOM   1016 H HD3    . ARG A 1 72  ? 6.353   52.488 77.609 1.00 64.35  ? 72  ARG A HD3    1 
ATOM   1017 H HE     . ARG A 1 72  ? 7.314   51.277 79.781 1.00 68.23  ? 72  ARG A HE     1 
ATOM   1018 H HH11   . ARG A 1 72  ? 5.441   50.592 77.144 1.00 69.67  ? 72  ARG A HH11   1 
ATOM   1019 H HH12   . ARG A 1 72  ? 4.715   49.441 77.751 1.00 69.67  ? 72  ARG A HH12   1 
ATOM   1020 H HH21   . ARG A 1 72  ? 6.175   49.554 80.711 1.00 72.67  ? 72  ARG A HH21   1 
ATOM   1021 H HH22   . ARG A 1 72  ? 5.160   48.813 79.911 1.00 72.67  ? 72  ARG A HH22   1 
ATOM   1022 N N      . TYR A 1 73  ? 7.463   55.508 75.221 1.00 48.38  ? 73  TYR A N      1 
ATOM   1023 C CA     . TYR A 1 73  ? 8.002   56.838 74.955 1.00 50.47  ? 73  TYR A CA     1 
ATOM   1024 C C      . TYR A 1 73  ? 8.726   57.291 76.214 1.00 51.92  ? 73  TYR A C      1 
ATOM   1025 O O      . TYR A 1 73  ? 8.091   57.522 77.248 1.00 52.51  ? 73  TYR A O      1 
ATOM   1026 C CB     . TYR A 1 73  ? 6.902   57.828 74.570 1.00 50.77  ? 73  TYR A CB     1 
ATOM   1027 C CG     . TYR A 1 73  ? 7.428   59.169 74.106 1.00 52.87  ? 73  TYR A CG     1 
ATOM   1028 C CD1    . TYR A 1 73  ? 7.953   60.084 75.011 1.00 54.36  ? 73  TYR A CD1    1 
ATOM   1029 C CD2    . TYR A 1 73  ? 7.398   59.522 72.764 1.00 53.47  ? 73  TYR A CD2    1 
ATOM   1030 C CE1    . TYR A 1 73  ? 8.436   61.309 74.591 1.00 55.94  ? 73  TYR A CE1    1 
ATOM   1031 C CE2    . TYR A 1 73  ? 7.877   60.745 72.335 1.00 54.89  ? 73  TYR A CE2    1 
ATOM   1032 C CZ     . TYR A 1 73  ? 8.394   61.635 73.253 1.00 56.07  ? 73  TYR A CZ     1 
ATOM   1033 O OH     . TYR A 1 73  ? 8.873   62.853 72.833 1.00 57.79  ? 73  TYR A OH     1 
ATOM   1034 H H      . TYR A 1 73  ? 6.970   55.475 75.925 1.00 62.04  ? 73  TYR A H      1 
ATOM   1035 H HA     . TYR A 1 73  ? 8.643   56.790 74.229 1.00 63.30  ? 73  TYR A HA     1 
ATOM   1036 H HB2    . TYR A 1 73  ? 6.378   57.448 73.848 1.00 64.70  ? 73  TYR A HB2    1 
ATOM   1037 H HB3    . TYR A 1 73  ? 6.335   57.982 75.343 1.00 64.70  ? 73  TYR A HB3    1 
ATOM   1038 H HD1    . TYR A 1 73  ? 7.983   59.867 75.915 1.00 67.64  ? 73  TYR A HD1    1 
ATOM   1039 H HD2    . TYR A 1 73  ? 7.049   58.924 72.142 1.00 63.83  ? 73  TYR A HD2    1 
ATOM   1040 H HE1    . TYR A 1 73  ? 8.785   61.911 75.208 1.00 68.34  ? 73  TYR A HE1    1 
ATOM   1041 H HE2    . TYR A 1 73  ? 7.851   60.967 71.432 1.00 62.79  ? 73  TYR A HE2    1 
ATOM   1042 H HH     . TYR A 1 73  ? 8.789   62.923 72.000 1.00 67.67  ? 73  TYR A HH     1 
ATOM   1043 N N      . LEU A 1 74  ? 10.046  57.411 76.131 1.00 50.13  ? 74  LEU A N      1 
ATOM   1044 C CA     . LEU A 1 74  ? 10.871  57.801 77.262 1.00 51.48  ? 74  LEU A CA     1 
ATOM   1045 C C      . LEU A 1 74  ? 11.449  59.190 77.031 1.00 53.34  ? 74  LEU A C      1 
ATOM   1046 O O      . LEU A 1 74  ? 11.701  59.596 75.893 1.00 53.32  ? 74  LEU A O      1 
ATOM   1047 C CB     . LEU A 1 74  ? 12.007  56.800 77.484 1.00 52.18  ? 74  LEU A CB     1 
ATOM   1048 C CG     . LEU A 1 74  ? 11.571  55.346 77.663 1.00 50.52  ? 74  LEU A CG     1 
ATOM   1049 C CD1    . LEU A 1 74  ? 12.774  54.426 77.628 1.00 51.09  ? 74  LEU A CD1    1 
ATOM   1050 C CD2    . LEU A 1 74  ? 10.798  55.163 78.960 1.00 50.71  ? 74  LEU A CD2    1 
ATOM   1051 H H      . LEU A 1 74  ? 10.495  57.268 75.412 1.00 64.78  ? 74  LEU A H      1 
ATOM   1052 H HA     . LEU A 1 74  ? 10.326  57.827 78.064 1.00 65.04  ? 74  LEU A HA     1 
ATOM   1053 H HB2    . LEU A 1 74  ? 12.601  56.834 76.718 1.00 63.26  ? 74  LEU A HB2    1 
ATOM   1054 H HB3    . LEU A 1 74  ? 12.494  57.058 78.282 1.00 63.26  ? 74  LEU A HB3    1 
ATOM   1055 H HG     . LEU A 1 74  ? 10.986  55.100 76.929 1.00 62.90  ? 74  LEU A HG     1 
ATOM   1056 H HD11   . LEU A 1 74  ? 12.474  53.510 77.743 1.00 60.13  ? 74  LEU A HD11   1 
ATOM   1057 H HD12   . LEU A 1 74  ? 13.221  54.523 76.772 1.00 60.13  ? 74  LEU A HD12   1 
ATOM   1058 H HD13   . LEU A 1 74  ? 13.378  54.669 78.347 1.00 60.13  ? 74  LEU A HD13   1 
ATOM   1059 H HD21   . LEU A 1 74  ? 10.537  54.232 79.043 1.00 66.52  ? 74  LEU A HD21   1 
ATOM   1060 H HD22   . LEU A 1 74  ? 11.367  55.414 79.704 1.00 66.52  ? 74  LEU A HD22   1 
ATOM   1061 H HD23   . LEU A 1 74  ? 10.010  55.728 78.940 1.00 66.52  ? 74  LEU A HD23   1 
ATOM   1062 N N      . ARG A 1 75  ? 11.656  59.916 78.126 1.00 54.14  ? 75  ARG A N      1 
ATOM   1063 C CA     . ARG A 1 75  ? 12.239  61.246 78.052 1.00 56.21  ? 75  ARG A CA     1 
ATOM   1064 C C      . ARG A 1 75  ? 13.756  61.138 77.983 1.00 58.62  ? 75  ARG A C      1 
ATOM   1065 O O      . ARG A 1 75  ? 14.365  60.304 78.658 1.00 59.91  ? 75  ARG A O      1 
ATOM   1066 C CB     . ARG A 1 75  ? 11.815  62.079 79.262 1.00 58.03  ? 75  ARG A CB     1 
ATOM   1067 C CG     . ARG A 1 75  ? 10.324  61.996 79.567 1.00 57.32  ? 75  ARG A CG     1 
ATOM   1068 C CD     . ARG A 1 75  ? 9.654   63.356 79.536 1.00 59.30  ? 75  ARG A CD     1 
ATOM   1069 N NE     . ARG A 1 75  ? 8.203   63.238 79.656 1.00 59.69  ? 75  ARG A NE     1 
ATOM   1070 C CZ     . ARG A 1 75  ? 7.381   64.248 79.923 1.00 63.35  ? 75  ARG A CZ     1 
ATOM   1071 N NH1    . ARG A 1 75  ? 7.856   65.473 80.111 1.00 68.66  ? 75  ARG A NH1    1 
ATOM   1072 N NH2    . ARG A 1 75  ? 6.076   64.030 80.009 1.00 64.74  ? 75  ARG A NH2    1 
ATOM   1073 H H      . ARG A 1 75  ? 11.465  59.658 78.924 1.00 61.73  ? 75  ARG A H      1 
ATOM   1074 H HA     . ARG A 1 75  ? 11.926  61.691 77.249 1.00 64.30  ? 75  ARG A HA     1 
ATOM   1075 H HB2    . ARG A 1 75  ? 12.297  61.765 80.043 1.00 68.16  ? 75  ARG A HB2    1 
ATOM   1076 H HB3    . ARG A 1 75  ? 12.033  63.009 79.094 1.00 68.16  ? 75  ARG A HB3    1 
ATOM   1077 H HG2    . ARG A 1 75  ? 9.895   61.433 78.904 1.00 69.33  ? 75  ARG A HG2    1 
ATOM   1078 H HG3    . ARG A 1 75  ? 10.202  61.620 80.453 1.00 69.33  ? 75  ARG A HG3    1 
ATOM   1079 H HD2    . ARG A 1 75  ? 9.978   63.891 80.278 1.00 73.31  ? 75  ARG A HD2    1 
ATOM   1080 H HD3    . ARG A 1 75  ? 9.855   63.793 78.693 1.00 73.31  ? 75  ARG A HD3    1 
ATOM   1081 H HE     . ARG A 1 75  ? 7.856   62.459 79.547 1.00 74.43  ? 75  ARG A HE     1 
ATOM   1082 H HH11   . ARG A 1 75  ? 8.702   65.619 80.056 1.00 91.66  ? 75  ARG A HH11   1 
ATOM   1083 H HH12   . ARG A 1 75  ? 7.318   66.121 80.284 1.00 91.66  ? 75  ARG A HH12   1 
ATOM   1084 H HH21   . ARG A 1 75  ? 5.764   63.238 79.889 1.00 83.07  ? 75  ARG A HH21   1 
ATOM   1085 H HH22   . ARG A 1 75  ? 5.542   64.681 80.183 1.00 83.07  ? 75  ARG A HH22   1 
ATOM   1086 N N      . TYR A 1 76  ? 14.364  61.983 77.156 1.00 56.81  ? 76  TYR A N      1 
ATOM   1087 C CA     . TYR A 1 76  ? 15.798  61.899 76.903 1.00 59.12  ? 76  TYR A CA     1 
ATOM   1088 C C      . TYR A 1 76  ? 16.330  63.292 76.610 1.00 61.12  ? 76  TYR A C      1 
ATOM   1089 O O      . TYR A 1 76  ? 15.911  63.920 75.634 1.00 59.98  ? 76  TYR A O      1 
ATOM   1090 C CB     . TYR A 1 76  ? 16.083  60.950 75.739 1.00 57.45  ? 76  TYR A CB     1 
ATOM   1091 C CG     . TYR A 1 76  ? 17.545  60.818 75.382 1.00 59.20  ? 76  TYR A CG     1 
ATOM   1092 C CD1    . TYR A 1 76  ? 18.475  60.395 76.323 1.00 62.01  ? 76  TYR A CD1    1 
ATOM   1093 C CD2    . TYR A 1 76  ? 17.992  61.098 74.099 1.00 58.45  ? 76  TYR A CD2    1 
ATOM   1094 C CE1    . TYR A 1 76  ? 19.810  60.269 75.998 1.00 63.98  ? 76  TYR A CE1    1 
ATOM   1095 C CE2    . TYR A 1 76  ? 19.323  60.972 73.764 1.00 59.96  ? 76  TYR A CE2    1 
ATOM   1096 C CZ     . TYR A 1 76  ? 20.228  60.554 74.716 1.00 62.75  ? 76  TYR A CZ     1 
ATOM   1097 O OH     . TYR A 1 76  ? 21.558  60.429 74.391 1.00 65.14  ? 76  TYR A OH     1 
ATOM   1098 H H      . TYR A 1 76  ? 13.968  62.615 76.728 1.00 79.25  ? 76  TYR A H      1 
ATOM   1099 H HA     . TYR A 1 76  ? 16.247  61.559 77.694 1.00 79.62  ? 76  TYR A HA     1 
ATOM   1100 H HB2    . TYR A 1 76  ? 15.756  60.067 75.971 1.00 75.95  ? 76  TYR A HB2    1 
ATOM   1101 H HB3    . TYR A 1 76  ? 15.617  61.275 74.952 1.00 75.95  ? 76  TYR A HB3    1 
ATOM   1102 H HD1    . TYR A 1 76  ? 18.194  60.201 77.188 1.00 72.98  ? 76  TYR A HD1    1 
ATOM   1103 H HD2    . TYR A 1 76  ? 17.383  61.379 73.454 1.00 72.89  ? 76  TYR A HD2    1 
ATOM   1104 H HE1    . TYR A 1 76  ? 20.423  59.987 76.638 1.00 71.29  ? 76  TYR A HE1    1 
ATOM   1105 H HE2    . TYR A 1 76  ? 19.609  61.166 72.901 1.00 71.58  ? 76  TYR A HE2    1 
ATOM   1106 H HH     . TYR A 1 76  ? 21.677  60.632 73.584 1.00 72.86  ? 76  TYR A HH     1 
ATOM   1107 N N      . ASP A 1 77  ? 17.253  63.764 77.449 1.00 79.87  ? 77  ASP A N      1 
ATOM   1108 C CA     . ASP A 1 77  ? 17.838  65.093 77.315 1.00 83.42  ? 77  ASP A CA     1 
ATOM   1109 C C      . ASP A 1 77  ? 19.304  65.041 76.893 1.00 86.98  ? 77  ASP A C      1 
ATOM   1110 O O      . ASP A 1 77  ? 20.011  66.047 76.996 1.00 89.98  ? 77  ASP A O      1 
ATOM   1111 C CB     . ASP A 1 77  ? 17.681  65.870 78.624 1.00 86.24  ? 77  ASP A CB     1 
ATOM   1112 C CG     . ASP A 1 77  ? 18.178  65.097 79.828 1.00 88.59  ? 77  ASP A CG     1 
ATOM   1113 O OD1    . ASP A 1 77  ? 19.278  64.510 79.750 1.00 90.70  ? 77  ASP A OD1    1 
ATOM   1114 O OD2    . ASP A 1 77  ? 17.465  65.070 80.853 1.00 88.88  ? 77  ASP A OD2    1 
ATOM   1115 H H      . ASP A 1 77  ? 17.561  63.321 78.118 1.00 96.77  ? 77  ASP A H      1 
ATOM   1116 H HA     . ASP A 1 77  ? 17.353  65.575 76.627 1.00 104.81 ? 77  ASP A HA     1 
ATOM   1117 H HB2    . ASP A 1 77  ? 18.190  66.694 78.565 1.00 110.06 ? 77  ASP A HB2    1 
ATOM   1118 H HB3    . ASP A 1 77  ? 16.742  66.070 78.762 1.00 110.06 ? 77  ASP A HB3    1 
ATOM   1119 N N      . ARG A 1 78  ? 19.774  63.883 76.426 1.00 77.99  ? 78  ARG A N      1 
ATOM   1120 C CA     . ARG A 1 78  ? 21.110  63.739 75.852 1.00 80.34  ? 78  ARG A CA     1 
ATOM   1121 C C      . ARG A 1 78  ? 22.215  63.962 76.881 1.00 85.49  ? 78  ARG A C      1 
ATOM   1122 O O      . ARG A 1 78  ? 23.333  64.335 76.523 1.00 88.66  ? 78  ARG A O      1 
ATOM   1123 C CB     . ARG A 1 78  ? 21.302  64.676 74.655 1.00 79.70  ? 78  ARG A CB     1 
ATOM   1124 C CG     . ARG A 1 78  ? 20.376  64.372 73.492 1.00 75.05  ? 78  ARG A CG     1 
ATOM   1125 C CD     . ARG A 1 78  ? 20.757  65.156 72.252 1.00 75.11  ? 78  ARG A CD     1 
ATOM   1126 N NE     . ARG A 1 78  ? 20.846  66.589 72.517 1.00 78.24  ? 78  ARG A NE     1 
ATOM   1127 C CZ     . ARG A 1 78  ? 19.800  67.405 72.603 1.00 78.75  ? 78  ARG A CZ     1 
ATOM   1128 N NH1    . ARG A 1 78  ? 18.568  66.936 72.448 1.00 76.35  ? 78  ARG A NH1    1 
ATOM   1129 N NH2    . ARG A 1 78  ? 19.985  68.693 72.848 1.00 82.02  ? 78  ARG A NH2    1 
ATOM   1130 H H      . ARG A 1 78  ? 19.325  63.150 76.432 1.00 90.21  ? 78  ARG A H      1 
ATOM   1131 H HA     . ARG A 1 78  ? 21.203  62.831 75.524 1.00 89.33  ? 78  ARG A HA     1 
ATOM   1132 H HB2    . ARG A 1 78  ? 21.132  65.588 74.940 1.00 92.26  ? 78  ARG A HB2    1 
ATOM   1133 H HB3    . ARG A 1 78  ? 22.215  64.596 74.337 1.00 92.26  ? 78  ARG A HB3    1 
ATOM   1134 H HG2    . ARG A 1 78  ? 20.428  63.427 73.281 1.00 88.90  ? 78  ARG A HG2    1 
ATOM   1135 H HG3    . ARG A 1 78  ? 19.468  64.612 73.735 1.00 88.90  ? 78  ARG A HG3    1 
ATOM   1136 H HD2    . ARG A 1 78  ? 21.622  64.853 71.936 1.00 92.14  ? 78  ARG A HD2    1 
ATOM   1137 H HD3    . ARG A 1 78  ? 20.083  65.017 71.568 1.00 92.14  ? 78  ARG A HD3    1 
ATOM   1138 H HE     . ARG A 1 78  ? 21.629  66.929 72.626 1.00 101.19 ? 78  ARG A HE     1 
ATOM   1139 H HH11   . ARG A 1 78  ? 18.443  66.101 72.289 1.00 106.82 ? 78  ARG A HH11   1 
ATOM   1140 H HH12   . ARG A 1 78  ? 17.895  67.469 72.505 1.00 106.82 ? 78  ARG A HH12   1 
ATOM   1141 H HH21   . ARG A 1 78  ? 20.781  69.001 72.950 1.00 118.08 ? 78  ARG A HH21   1 
ATOM   1142 H HH22   . ARG A 1 78  ? 19.309  69.222 72.904 1.00 118.08 ? 78  ARG A HH22   1 
ATOM   1143 N N      . THR A 1 79  ? 21.921  63.733 78.156 1.00 68.50  ? 79  THR A N      1 
ATOM   1144 C CA     . THR A 1 79  ? 22.943  63.723 79.191 1.00 73.66  ? 79  THR A CA     1 
ATOM   1145 C C      . THR A 1 79  ? 23.325  62.284 79.515 1.00 73.02  ? 79  THR A C      1 
ATOM   1146 O O      . THR A 1 79  ? 22.524  61.359 79.355 1.00 68.90  ? 79  THR A O      1 
ATOM   1147 C CB     . THR A 1 79  ? 22.463  64.431 80.461 1.00 77.08  ? 79  THR A CB     1 
ATOM   1148 O OG1    . THR A 1 79  ? 21.346  63.727 81.019 1.00 74.38  ? 79  THR A OG1    1 
ATOM   1149 C CG2    . THR A 1 79  ? 22.059  65.868 80.159 1.00 78.34  ? 79  THR A CG2    1 
ATOM   1150 H H      . THR A 1 79  ? 21.128  63.580 78.450 1.00 84.70  ? 79  THR A H      1 
ATOM   1151 H HA     . THR A 1 79  ? 23.733  64.182 78.866 1.00 84.45  ? 79  THR A HA     1 
ATOM   1152 H HB     . THR A 1 79  ? 23.185  64.449 81.108 1.00 82.83  ? 79  THR A HB     1 
ATOM   1153 H HG1    . THR A 1 79  ? 20.715  63.703 80.464 1.00 78.59  ? 79  THR A HG1    1 
ATOM   1154 H HG21   . THR A 1 79  ? 21.757  66.305 80.970 1.00 84.41  ? 79  THR A HG21   1 
ATOM   1155 H HG22   . THR A 1 79  ? 22.816  66.357 79.800 1.00 84.41  ? 79  THR A HG22   1 
ATOM   1156 H HG23   . THR A 1 79  ? 21.339  65.880 79.508 1.00 84.41  ? 79  THR A HG23   1 
ATOM   1157 N N      . GLU A 1 80  ? 24.570  62.101 79.963 1.00 118.95 ? 80  GLU A N      1 
ATOM   1158 C CA     . GLU A 1 80  ? 25.038  60.762 80.308 1.00 120.35 ? 80  GLU A CA     1 
ATOM   1159 C C      . GLU A 1 80  ? 24.121  60.107 81.332 1.00 120.23 ? 80  GLU A C      1 
ATOM   1160 O O      . GLU A 1 80  ? 23.822  58.911 81.234 1.00 118.93 ? 80  GLU A O      1 
ATOM   1161 C CB     . GLU A 1 80  ? 26.473  60.825 80.834 1.00 127.17 ? 80  GLU A CB     1 
ATOM   1162 C CG     . GLU A 1 80  ? 26.956  59.551 81.524 1.00 129.72 ? 80  GLU A CG     1 
ATOM   1163 C CD     . GLU A 1 80  ? 26.804  58.314 80.658 1.00 125.74 ? 80  GLU A CD     1 
ATOM   1164 O OE1    . GLU A 1 80  ? 26.643  58.461 79.429 1.00 122.00 ? 80  GLU A OE1    1 
ATOM   1165 O OE2    . GLU A 1 80  ? 26.846  57.192 81.207 1.00 126.92 ? 80  GLU A OE2    1 
ATOM   1166 H H      . GLU A 1 80  ? 25.151  62.725 80.073 1.00 132.25 ? 80  GLU A H      1 
ATOM   1167 H HA     . GLU A 1 80  ? 25.036  60.212 79.509 1.00 135.46 ? 80  GLU A HA     1 
ATOM   1168 H HB2    . GLU A 1 80  ? 27.068  61.000 80.088 1.00 143.53 ? 80  GLU A HB2    1 
ATOM   1169 H HB3    . GLU A 1 80  ? 26.535  61.549 81.477 1.00 143.53 ? 80  GLU A HB3    1 
ATOM   1170 H HG2    . GLU A 1 80  ? 27.895  59.648 81.744 1.00 145.55 ? 80  GLU A HG2    1 
ATOM   1171 H HG3    . GLU A 1 80  ? 26.438  59.415 82.333 1.00 145.55 ? 80  GLU A HG3    1 
ATOM   1172 N N      . ALA A 1 81  ? 23.663  60.876 82.323 1.00 103.55 ? 81  ALA A N      1 
ATOM   1173 C CA     . ALA A 1 81  ? 22.769  60.323 83.334 1.00 102.65 ? 81  ALA A CA     1 
ATOM   1174 C C      . ALA A 1 81  ? 21.464  59.844 82.711 1.00 95.49  ? 81  ALA A C      1 
ATOM   1175 O O      . ALA A 1 81  ? 20.917  58.811 83.114 1.00 94.76  ? 81  ALA A O      1 
ATOM   1176 C CB     . ALA A 1 81  ? 22.495  61.366 84.416 1.00 107.11 ? 81  ALA A CB     1 
ATOM   1177 H H      . ALA A 1 81  ? 23.853  61.707 82.429 1.00 127.24 ? 81  ALA A H      1 
ATOM   1178 H HA     . ALA A 1 81  ? 23.199  59.561 83.753 1.00 122.00 ? 81  ALA A HA     1 
ATOM   1179 H HB1    . ALA A 1 81  ? 21.900  60.983 85.080 1.00 125.64 ? 81  ALA A HB1    1 
ATOM   1180 H HB2    . ALA A 1 81  ? 23.335  61.618 84.831 1.00 125.64 ? 81  ALA A HB2    1 
ATOM   1181 H HB3    . ALA A 1 81  ? 22.080  62.142 84.008 1.00 125.64 ? 81  ALA A HB3    1 
ATOM   1182 N N      . SER A 1 82  ? 20.951  60.582 81.725 1.00 76.23  ? 82  SER A N      1 
ATOM   1183 C CA     . SER A 1 82  ? 19.699  60.211 81.080 1.00 71.60  ? 82  SER A CA     1 
ATOM   1184 C C      . SER A 1 82  ? 19.885  59.139 80.014 1.00 67.99  ? 82  SER A C      1 
ATOM   1185 O O      . SER A 1 82  ? 18.900  58.514 79.607 1.00 65.66  ? 82  SER A O      1 
ATOM   1186 C CB     . SER A 1 82  ? 19.044  61.448 80.460 1.00 70.23  ? 82  SER A CB     1 
ATOM   1187 O OG     . SER A 1 82  ? 17.707  61.181 80.076 1.00 68.82  ? 82  SER A OG     1 
ATOM   1188 H H      . SER A 1 82  ? 21.311  61.298 81.414 1.00 89.73  ? 82  SER A H      1 
ATOM   1189 H HA     . SER A 1 82  ? 19.094  59.860 81.752 1.00 82.65  ? 82  SER A HA     1 
ATOM   1190 H HB2    . SER A 1 82  ? 19.047  62.166 81.112 1.00 79.13  ? 82  SER A HB2    1 
ATOM   1191 H HB3    . SER A 1 82  ? 19.550  61.712 79.676 1.00 79.13  ? 82  SER A HB3    1 
ATOM   1192 H HG     . SER A 1 82  ? 17.689  60.561 79.510 1.00 74.56  ? 82  SER A HG     1 
ATOM   1193 N N      . LEU A 1 83  ? 21.118  58.915 79.553 1.00 77.62  ? 83  LEU A N      1 
ATOM   1194 C CA     . LEU A 1 83  ? 21.364  57.869 78.566 1.00 75.29  ? 83  LEU A CA     1 
ATOM   1195 C C      . LEU A 1 83  ? 21.422  56.492 79.215 1.00 75.83  ? 83  LEU A C      1 
ATOM   1196 O O      . LEU A 1 83  ? 20.838  55.534 78.697 1.00 73.27  ? 83  LEU A O      1 
ATOM   1197 C CB     . LEU A 1 83  ? 22.663  58.154 77.811 1.00 77.81  ? 83  LEU A CB     1 
ATOM   1198 C CG     . LEU A 1 83  ? 23.107  57.094 76.797 1.00 76.49  ? 83  LEU A CG     1 
ATOM   1199 C CD1    . LEU A 1 83  ? 22.036  56.859 75.741 1.00 71.39  ? 83  LEU A CD1    1 
ATOM   1200 C CD2    . LEU A 1 83  ? 24.418  57.500 76.144 1.00 79.66  ? 83  LEU A CD2    1 
ATOM   1201 H H      . LEU A 1 83  ? 21.819  59.350 79.794 1.00 92.41  ? 83  LEU A H      1 
ATOM   1202 H HA     . LEU A 1 83  ? 20.639  57.866 77.922 1.00 92.02  ? 83  LEU A HA     1 
ATOM   1203 H HB2    . LEU A 1 83  ? 22.558  58.988 77.328 1.00 97.48  ? 83  LEU A HB2    1 
ATOM   1204 H HB3    . LEU A 1 83  ? 23.378  58.247 78.461 1.00 97.48  ? 83  LEU A HB3    1 
ATOM   1205 H HG     . LEU A 1 83  ? 23.254  56.256 77.263 1.00 97.85  ? 83  LEU A HG     1 
ATOM   1206 H HD11   . LEU A 1 83  ? 22.350  56.185 75.118 1.00 92.94  ? 83  LEU A HD11   1 
ATOM   1207 H HD12   . LEU A 1 83  ? 21.225  56.555 76.177 1.00 92.94  ? 83  LEU A HD12   1 
ATOM   1208 H HD13   . LEU A 1 83  ? 21.868  57.691 75.272 1.00 92.94  ? 83  LEU A HD13   1 
ATOM   1209 H HD21   . LEU A 1 83  ? 24.678  56.816 75.507 1.00 102.82 ? 83  LEU A HD21   1 
ATOM   1210 H HD22   . LEU A 1 83  ? 24.294  58.347 75.688 1.00 102.82 ? 83  LEU A HD22   1 
ATOM   1211 H HD23   . LEU A 1 83  ? 25.097  57.590 76.830 1.00 102.82 ? 83  LEU A HD23   1 
ATOM   1212 N N      . HIS A 1 84  ? 22.124  56.374 80.344 1.00 98.61  ? 84  HIS A N      1 
ATOM   1213 C CA     . HIS A 1 84  ? 22.189  55.098 81.049 1.00 100.36 ? 84  HIS A CA     1 
ATOM   1214 C C      . HIS A 1 84  ? 20.798  54.598 81.414 1.00 98.51  ? 84  HIS A C      1 
ATOM   1215 O O      . HIS A 1 84  ? 20.530  53.392 81.361 1.00 97.79  ? 84  HIS A O      1 
ATOM   1216 C CB     . HIS A 1 84  ? 23.053  55.239 82.302 1.00 107.42 ? 84  HIS A CB     1 
ATOM   1217 C CG     . HIS A 1 84  ? 22.852  54.143 83.302 1.00 111.10 ? 84  HIS A CG     1 
ATOM   1218 N ND1    . HIS A 1 84  ? 21.881  54.196 84.278 1.00 112.20 ? 84  HIS A ND1    1 
ATOM   1219 C CD2    . HIS A 1 84  ? 23.498  52.967 83.477 1.00 114.10 ? 84  HIS A CD2    1 
ATOM   1220 C CE1    . HIS A 1 84  ? 21.937  53.099 85.012 1.00 115.36 ? 84  HIS A CE1    1 
ATOM   1221 N NE2    . HIS A 1 84  ? 22.911  52.338 84.548 1.00 116.56 ? 84  HIS A NE2    1 
ATOM   1222 H H      . HIS A 1 84  ? 22.566  57.010 80.717 1.00 117.18 ? 84  HIS A H      1 
ATOM   1223 H HA     . HIS A 1 84  ? 22.604  54.438 80.471 1.00 118.02 ? 84  HIS A HA     1 
ATOM   1224 H HB2    . HIS A 1 84  ? 23.987  55.234 82.040 1.00 126.08 ? 84  HIS A HB2    1 
ATOM   1225 H HB3    . HIS A 1 84  ? 22.838  56.080 82.736 1.00 126.08 ? 84  HIS A HB3    1 
ATOM   1226 H HD2    . HIS A 1 84  ? 24.209  52.646 82.970 1.00 134.93 ? 84  HIS A HD2    1 
ATOM   1227 H HE1    . HIS A 1 84  ? 21.385  52.898 85.733 1.00 134.64 ? 84  HIS A HE1    1 
ATOM   1228 H HE2    . HIS A 1 84  ? 23.139  51.571 84.863 1.00 136.36 ? 84  HIS A HE2    1 
ATOM   1229 N N      . ARG A 1 85  ? 19.899  55.508 81.790 1.00 81.78  ? 85  ARG A N      1 
ATOM   1230 C CA     . ARG A 1 85  ? 18.553  55.104 82.182 1.00 82.21  ? 85  ARG A CA     1 
ATOM   1231 C C      . ARG A 1 85  ? 17.775  54.564 80.988 1.00 78.75  ? 85  ARG A C      1 
ATOM   1232 O O      . ARG A 1 85  ? 17.254  53.443 81.025 1.00 78.30  ? 85  ARG A O      1 
ATOM   1233 C CB     . ARG A 1 85  ? 17.813  56.283 82.817 1.00 86.02  ? 85  ARG A CB     1 
ATOM   1234 C CG     . ARG A 1 85  ? 16.384  55.950 83.212 1.00 87.74  ? 85  ARG A CG     1 
ATOM   1235 C CD     . ARG A 1 85  ? 15.737  57.059 84.020 1.00 91.90  ? 85  ARG A CD     1 
ATOM   1236 N NE     . ARG A 1 85  ? 14.445  56.640 84.558 1.00 93.51  ? 85  ARG A NE     1 
ATOM   1237 C CZ     . ARG A 1 85  ? 14.285  55.938 85.678 1.00 95.70  ? 85  ARG A CZ     1 
ATOM   1238 N NH1    . ARG A 1 85  ? 15.336  55.568 86.398 1.00 97.51  ? 85  ARG A NH1    1 
ATOM   1239 N NH2    . ARG A 1 85  ? 13.068  55.602 86.081 1.00 95.68  ? 85  ARG A NH2    1 
ATOM   1240 H H      . ARG A 1 85  ? 20.043  56.356 81.826 1.00 96.94  ? 85  ARG A H      1 
ATOM   1241 H HA     . ARG A 1 85  ? 18.616  54.398 82.843 1.00 97.67  ? 85  ARG A HA     1 
ATOM   1242 H HB2    . ARG A 1 85  ? 18.287  56.558 83.617 1.00 99.37  ? 85  ARG A HB2    1 
ATOM   1243 H HB3    . ARG A 1 85  ? 17.784  57.015 82.181 1.00 99.37  ? 85  ARG A HB3    1 
ATOM   1244 H HG2    . ARG A 1 85  ? 15.855  55.815 82.410 1.00 96.04  ? 85  ARG A HG2    1 
ATOM   1245 H HG3    . ARG A 1 85  ? 16.383  55.144 83.751 1.00 96.04  ? 85  ARG A HG3    1 
ATOM   1246 H HD2    . ARG A 1 85  ? 16.315  57.293 84.763 1.00 97.31  ? 85  ARG A HD2    1 
ATOM   1247 H HD3    . ARG A 1 85  ? 15.594  57.830 83.450 1.00 97.31  ? 85  ARG A HD3    1 
ATOM   1248 H HE     . ARG A 1 85  ? 13.739  56.861 84.121 1.00 97.12  ? 85  ARG A HE     1 
ATOM   1249 H HH11   . ARG A 1 85  ? 16.129  55.781 86.142 1.00 105.74 ? 85  ARG A HH11   1 
ATOM   1250 H HH12   . ARG A 1 85  ? 15.225  55.115 87.120 1.00 105.74 ? 85  ARG A HH12   1 
ATOM   1251 H HH21   . ARG A 1 85  ? 12.382  55.839 85.619 1.00 98.76  ? 85  ARG A HH21   1 
ATOM   1252 H HH22   . ARG A 1 85  ? 12.964  55.150 86.805 1.00 98.76  ? 85  ARG A HH22   1 
ATOM   1253 N N      . VAL A 1 86  ? 17.678  55.355 79.917 1.00 74.10  ? 86  VAL A N      1 
ATOM   1254 C CA     . VAL A 1 86  ? 16.907  54.931 78.752 1.00 70.69  ? 86  VAL A CA     1 
ATOM   1255 C C      . VAL A 1 86  ? 17.471  53.642 78.174 1.00 67.54  ? 86  VAL A C      1 
ATOM   1256 O O      . VAL A 1 86  ? 16.722  52.802 77.661 1.00 66.55  ? 86  VAL A O      1 
ATOM   1257 C CB     . VAL A 1 86  ? 16.863  56.054 77.696 1.00 67.50  ? 86  VAL A CB     1 
ATOM   1258 C CG1    . VAL A 1 86  ? 16.180  57.291 78.265 1.00 71.06  ? 86  VAL A CG1    1 
ATOM   1259 C CG2    . VAL A 1 86  ? 18.263  56.388 77.202 1.00 67.01  ? 86  VAL A CG2    1 
ATOM   1260 H H      . VAL A 1 86  ? 18.044  56.130 79.841 1.00 87.39  ? 86  VAL A H      1 
ATOM   1261 H HA     . VAL A 1 86  ? 15.995  54.754 79.031 1.00 83.17  ? 86  VAL A HA     1 
ATOM   1262 H HB     . VAL A 1 86  ? 16.344  55.749 76.935 1.00 82.83  ? 86  VAL A HB     1 
ATOM   1263 H HG11   . VAL A 1 86  ? 16.164  57.983 77.585 1.00 81.35  ? 86  VAL A HG11   1 
ATOM   1264 H HG12   . VAL A 1 86  ? 15.275  57.060 78.524 1.00 81.35  ? 86  VAL A HG12   1 
ATOM   1265 H HG13   . VAL A 1 86  ? 16.678  57.598 79.038 1.00 81.35  ? 86  VAL A HG13   1 
ATOM   1266 H HG21   . VAL A 1 86  ? 18.204  57.096 76.541 1.00 87.87  ? 86  VAL A HG21   1 
ATOM   1267 H HG22   . VAL A 1 86  ? 18.801  56.683 77.954 1.00 87.87  ? 86  VAL A HG22   1 
ATOM   1268 H HG23   . VAL A 1 86  ? 18.656  55.595 76.805 1.00 87.87  ? 86  VAL A HG23   1 
ATOM   1269 N N      . LEU A 1 87  ? 18.792  53.459 78.241 1.00 69.97  ? 87  LEU A N      1 
ATOM   1270 C CA     . LEU A 1 87  ? 19.380  52.194 77.819 1.00 69.38  ? 87  LEU A CA     1 
ATOM   1271 C C      . LEU A 1 87  ? 18.885  51.030 78.665 1.00 71.62  ? 87  LEU A C      1 
ATOM   1272 O O      . LEU A 1 87  ? 18.920  49.884 78.205 1.00 70.18  ? 87  LEU A O      1 
ATOM   1273 C CB     . LEU A 1 87  ? 20.907  52.274 77.878 1.00 72.66  ? 87  LEU A CB     1 
ATOM   1274 C CG     . LEU A 1 87  ? 21.575  53.133 76.803 1.00 71.60  ? 87  LEU A CG     1 
ATOM   1275 C CD1    . LEU A 1 87  ? 23.058  53.296 77.100 1.00 76.22  ? 87  LEU A CD1    1 
ATOM   1276 C CD2    . LEU A 1 87  ? 21.373  52.533 75.418 1.00 68.42  ? 87  LEU A CD2    1 
ATOM   1277 H H      . LEU A 1 87  ? 19.357  54.042 78.523 1.00 87.53  ? 87  LEU A H      1 
ATOM   1278 H HA     . LEU A 1 87  ? 19.126  52.022 76.899 1.00 86.98  ? 87  LEU A HA     1 
ATOM   1279 H HB2    . LEU A 1 87  ? 21.160  52.640 78.740 1.00 89.66  ? 87  LEU A HB2    1 
ATOM   1280 H HB3    . LEU A 1 87  ? 21.263  51.375 77.793 1.00 89.66  ? 87  LEU A HB3    1 
ATOM   1281 H HG     . LEU A 1 87  ? 21.170  54.015 76.809 1.00 88.93  ? 87  LEU A HG     1 
ATOM   1282 H HD11   . LEU A 1 87  ? 23.460  53.843 76.407 1.00 93.59  ? 87  LEU A HD11   1 
ATOM   1283 H HD12   . LEU A 1 87  ? 23.162  53.726 77.963 1.00 93.59  ? 87  LEU A HD12   1 
ATOM   1284 H HD13   . LEU A 1 87  ? 23.475  52.420 77.114 1.00 93.59  ? 87  LEU A HD13   1 
ATOM   1285 H HD21   . LEU A 1 87  ? 21.807  53.100 74.762 1.00 86.14  ? 87  LEU A HD21   1 
ATOM   1286 H HD22   . LEU A 1 87  ? 21.764  51.645 75.399 1.00 86.14  ? 87  LEU A HD22   1 
ATOM   1287 H HD23   . LEU A 1 87  ? 20.422  52.480 75.233 1.00 86.14  ? 87  LEU A HD23   1 
ATOM   1288 N N      . GLY A 1 88  ? 18.429  51.297 79.887 1.00 77.45  ? 88  GLY A N      1 
ATOM   1289 C CA     . GLY A 1 88  ? 17.791  50.296 80.711 1.00 80.41  ? 88  GLY A CA     1 
ATOM   1290 C C      . GLY A 1 88  ? 16.329  50.072 80.407 1.00 80.24  ? 88  GLY A C      1 
ATOM   1291 O O      . GLY A 1 88  ? 15.657  49.341 81.139 1.00 82.59  ? 88  GLY A O      1 
ATOM   1292 H H      . GLY A 1 88  ? 18.483  52.069 80.262 1.00 97.72  ? 88  GLY A H      1 
ATOM   1293 H HA2    . GLY A 1 88  ? 18.254  49.451 80.596 1.00 98.62  ? 88  GLY A HA2    1 
ATOM   1294 H HA3    . GLY A 1 88  ? 17.868  50.557 81.642 1.00 98.62  ? 88  GLY A HA3    1 
ATOM   1295 N N      . SER A 1 89  ? 15.812  50.688 79.340 1.00 65.22  ? 89  SER A N      1 
ATOM   1296 C CA     . SER A 1 89  ? 14.415  50.495 78.970 1.00 65.18  ? 89  SER A CA     1 
ATOM   1297 C C      . SER A 1 89  ? 14.094  49.024 78.754 1.00 65.23  ? 89  SER A C      1 
ATOM   1298 O O      . SER A 1 89  ? 12.976  48.582 79.042 1.00 66.14  ? 89  SER A O      1 
ATOM   1299 C CB     . SER A 1 89  ? 14.096  51.291 77.707 1.00 62.14  ? 89  SER A CB     1 
ATOM   1300 O OG     . SER A 1 89  ? 12.723  51.188 77.372 1.00 62.76  ? 89  SER A OG     1 
ATOM   1301 H H      . SER A 1 89  ? 16.248  51.218 78.821 1.00 76.35  ? 89  SER A H      1 
ATOM   1302 H HA     . SER A 1 89  ? 13.849  50.825 79.686 1.00 72.11  ? 89  SER A HA     1 
ATOM   1303 H HB2    . SER A 1 89  ? 14.314  52.224 77.860 1.00 70.42  ? 89  SER A HB2    1 
ATOM   1304 H HB3    . SER A 1 89  ? 14.626  50.944 76.973 1.00 70.42  ? 89  SER A HB3    1 
ATOM   1305 H HG     . SER A 1 89  ? 12.564  51.631 76.676 1.00 69.21  ? 89  SER A HG     1 
ATOM   1306 N N      . TRP A 1 90  ? 15.052  48.257 78.240 1.00 66.28  ? 90  TRP A N      1 
ATOM   1307 C CA     . TRP A 1 90  ? 14.880  46.826 78.046 1.00 66.90  ? 90  TRP A CA     1 
ATOM   1308 C C      . TRP A 1 90  ? 16.256  46.196 77.906 1.00 64.99  ? 90  TRP A C      1 
ATOM   1309 O O      . TRP A 1 90  ? 17.153  46.784 77.299 1.00 61.52  ? 90  TRP A O      1 
ATOM   1310 C CB     . TRP A 1 90  ? 14.028  46.521 76.808 1.00 66.16  ? 90  TRP A CB     1 
ATOM   1311 C CG     . TRP A 1 90  ? 14.579  47.110 75.547 1.00 60.45  ? 90  TRP A CG     1 
ATOM   1312 C CD1    . TRP A 1 90  ? 14.203  48.283 74.960 1.00 56.45  ? 90  TRP A CD1    1 
ATOM   1313 C CD2    . TRP A 1 90  ? 15.607  46.556 74.716 1.00 56.04  ? 90  TRP A CD2    1 
ATOM   1314 N NE1    . TRP A 1 90  ? 14.932  48.493 73.815 1.00 49.32  ? 90  TRP A NE1    1 
ATOM   1315 C CE2    . TRP A 1 90  ? 15.802  47.449 73.643 1.00 49.22  ? 90  TRP A CE2    1 
ATOM   1316 C CE3    . TRP A 1 90  ? 16.381  45.393 74.775 1.00 57.27  ? 90  TRP A CE3    1 
ATOM   1317 C CZ2    . TRP A 1 90  ? 16.738  47.214 72.638 1.00 46.95  ? 90  TRP A CZ2    1 
ATOM   1318 C CZ3    . TRP A 1 90  ? 17.311  45.163 73.776 1.00 52.62  ? 90  TRP A CZ3    1 
ATOM   1319 C CH2    . TRP A 1 90  ? 17.481  46.069 72.723 1.00 49.78  ? 90  TRP A CH2    1 
ATOM   1320 H H      . TRP A 1 90  ? 15.822  48.550 77.994 1.00 80.59  ? 90  TRP A H      1 
ATOM   1321 H HA     . TRP A 1 90  ? 14.443  46.444 78.823 1.00 79.55  ? 90  TRP A HA     1 
ATOM   1322 H HB2    . TRP A 1 90  ? 13.979  45.560 76.691 1.00 77.76  ? 90  TRP A HB2    1 
ATOM   1323 H HB3    . TRP A 1 90  ? 13.139  46.883 76.942 1.00 77.76  ? 90  TRP A HB3    1 
ATOM   1324 H HD1    . TRP A 1 90  ? 13.548  48.856 75.287 1.00 69.81  ? 90  TRP A HD1    1 
ATOM   1325 H HE1    . TRP A 1 90  ? 14.857  49.172 73.292 1.00 65.17  ? 90  TRP A HE1    1 
ATOM   1326 H HE3    . TRP A 1 90  ? 16.274  44.787 75.472 1.00 71.75  ? 90  TRP A HE3    1 
ATOM   1327 H HZ2    . TRP A 1 90  ? 16.854  47.814 71.937 1.00 64.99  ? 90  TRP A HZ2    1 
ATOM   1328 H HZ3    . TRP A 1 90  ? 17.832  44.393 73.805 1.00 71.06  ? 90  TRP A HZ3    1 
ATOM   1329 H HH2    . TRP A 1 90  ? 18.113  45.888 72.065 1.00 68.23  ? 90  TRP A HH2    1 
ATOM   1330 N N      . THR A 1 91  ? 16.413  45.010 78.476 1.00 68.95  ? 91  THR A N      1 
ATOM   1331 C CA     . THR A 1 91  ? 17.640  44.239 78.369 1.00 68.78  ? 91  THR A CA     1 
ATOM   1332 C C      . THR A 1 91  ? 17.383  42.994 77.525 1.00 68.30  ? 91  THR A C      1 
ATOM   1333 O O      . THR A 1 91  ? 16.272  42.757 77.043 1.00 69.08  ? 91  THR A O      1 
ATOM   1334 C CB     . THR A 1 91  ? 18.175  43.876 79.759 1.00 73.48  ? 91  THR A CB     1 
ATOM   1335 O OG1    . THR A 1 91  ? 19.304  43.002 79.627 1.00 78.13  ? 91  THR A OG1    1 
ATOM   1336 C CG2    . THR A 1 91  ? 17.107  43.194 80.602 1.00 75.99  ? 91  THR A CG2    1 
ATOM   1337 H H      . THR A 1 91  ? 15.804  44.621 78.942 1.00 73.27  ? 91  THR A H      1 
ATOM   1338 H HA     . THR A 1 91  ? 18.312  44.774 77.919 1.00 76.88  ? 91  THR A HA     1 
ATOM   1339 H HB     . THR A 1 91  ? 18.451  44.685 80.216 1.00 86.67  ? 91  THR A HB     1 
ATOM   1340 H HG1    . THR A 1 91  ? 19.601  42.800 80.387 1.00 94.51  ? 91  THR A HG1    1 
ATOM   1341 H HG21   . THR A 1 91  ? 17.465  42.973 81.476 1.00 87.46  ? 91  THR A HG21   1 
ATOM   1342 H HG22   . THR A 1 91  ? 16.346  43.786 80.714 1.00 87.46  ? 91  THR A HG22   1 
ATOM   1343 H HG23   . THR A 1 91  ? 16.811  42.379 80.167 1.00 87.46  ? 91  THR A HG23   1 
ATOM   1344 N N      . GLY A 1 92  ? 18.437  42.200 77.333 1.00 74.91  ? 92  GLY A N      1 
ATOM   1345 C CA     . GLY A 1 92  ? 18.304  40.994 76.533 1.00 76.11  ? 92  GLY A CA     1 
ATOM   1346 C C      . GLY A 1 92  ? 17.365  39.979 77.156 1.00 81.17  ? 92  GLY A C      1 
ATOM   1347 O O      . GLY A 1 92  ? 16.616  39.297 76.452 1.00 83.12  ? 92  GLY A O      1 
ATOM   1348 H H      . GLY A 1 92  ? 19.224  42.337 77.651 1.00 94.11  ? 92  GLY A H      1 
ATOM   1349 H HA2    . GLY A 1 92  ? 17.964  41.226 75.654 1.00 96.06  ? 92  GLY A HA2    1 
ATOM   1350 H HA3    . GLY A 1 92  ? 19.175  40.580 76.425 1.00 96.06  ? 92  GLY A HA3    1 
ATOM   1351 N N      . ASP A 1 93  ? 17.390  39.865 78.485 1.00 93.60  ? 93  ASP A N      1 
ATOM   1352 C CA     . ASP A 1 93  ? 16.533  38.896 79.159 1.00 96.09  ? 93  ASP A CA     1 
ATOM   1353 C C      . ASP A 1 93  ? 15.077  39.344 79.147 1.00 96.36  ? 93  ASP A C      1 
ATOM   1354 O O      . ASP A 1 93  ? 14.169  38.519 78.993 1.00 97.43  ? 93  ASP A O      1 
ATOM   1355 C CB     . ASP A 1 93  ? 17.015  38.683 80.594 1.00 100.09 ? 93  ASP A CB     1 
ATOM   1356 C CG     . ASP A 1 93  ? 18.487  38.324 80.666 1.00 104.28 ? 93  ASP A CG     1 
ATOM   1357 O OD1    . ASP A 1 93  ? 19.055  37.929 79.626 1.00 103.31 ? 93  ASP A OD1    1 
ATOM   1358 O OD2    . ASP A 1 93  ? 19.073  38.434 81.764 1.00 108.69 ? 93  ASP A OD2    1 
ATOM   1359 H H      . ASP A 1 93  ? 17.887  40.331 79.010 1.00 113.47 ? 93  ASP A H      1 
ATOM   1360 H HA     . ASP A 1 93  ? 16.590  38.047 78.694 1.00 114.56 ? 93  ASP A HA     1 
ATOM   1361 H HB2    . ASP A 1 93  ? 16.880  39.500 81.098 1.00 118.44 ? 93  ASP A HB2    1 
ATOM   1362 H HB3    . ASP A 1 93  ? 16.509  37.958 80.993 1.00 118.44 ? 93  ASP A HB3    1 
ATOM   1363 N N      . SER A 1 94  ? 14.832  40.648 79.300 1.00 65.19  ? 94  SER A N      1 
ATOM   1364 C CA     . SER A 1 94  ? 13.461  41.143 79.344 1.00 63.53  ? 94  SER A CA     1 
ATOM   1365 C C      . SER A 1 94  ? 12.742  40.906 78.024 1.00 63.59  ? 94  SER A C      1 
ATOM   1366 O O      . SER A 1 94  ? 11.533  40.656 78.012 1.00 63.34  ? 94  SER A O      1 
ATOM   1367 C CB     . SER A 1 94  ? 13.453  42.633 79.691 1.00 61.71  ? 94  SER A CB     1 
ATOM   1368 O OG     . SER A 1 94  ? 14.062  43.398 78.665 1.00 60.24  ? 94  SER A OG     1 
ATOM   1369 H H      . SER A 1 94  ? 15.436  41.255 79.381 1.00 72.83  ? 94  SER A H      1 
ATOM   1370 H HA     . SER A 1 94  ? 12.976  40.671 80.038 1.00 67.62  ? 94  SER A HA     1 
ATOM   1371 H HB2    . SER A 1 94  ? 12.535  42.926 79.800 1.00 64.34  ? 94  SER A HB2    1 
ATOM   1372 H HB3    . SER A 1 94  ? 13.944  42.767 80.517 1.00 64.34  ? 94  SER A HB3    1 
ATOM   1373 H HG     . SER A 1 94  ? 13.647  43.292 77.943 1.00 61.92  ? 94  SER A HG     1 
ATOM   1374 N N      . VAL A 1 95  ? 13.464  40.977 76.907 1.00 58.31  ? 95  VAL A N      1 
ATOM   1375 C CA     . VAL A 1 95  ? 12.847  40.745 75.605 1.00 58.85  ? 95  VAL A CA     1 
ATOM   1376 C C      . VAL A 1 95  ? 12.673  39.252 75.349 1.00 61.81  ? 95  VAL A C      1 
ATOM   1377 O O      . VAL A 1 95  ? 11.624  38.815 74.865 1.00 62.84  ? 95  VAL A O      1 
ATOM   1378 C CB     . VAL A 1 95  ? 13.671  41.431 74.496 1.00 55.49  ? 95  VAL A CB     1 
ATOM   1379 C CG1    . VAL A 1 95  ? 15.127  40.999 74.533 1.00 54.99  ? 95  VAL A CG1    1 
ATOM   1380 C CG2    . VAL A 1 95  ? 13.071  41.157 73.121 1.00 54.20  ? 95  VAL A CG2    1 
ATOM   1381 H H      . VAL A 1 95  ? 14.304  41.157 76.877 1.00 64.85  ? 95  VAL A H      1 
ATOM   1382 H HA     . VAL A 1 95  ? 11.964  41.147 75.605 1.00 64.36  ? 95  VAL A HA     1 
ATOM   1383 H HB     . VAL A 1 95  ? 13.646  42.389 74.641 1.00 61.53  ? 95  VAL A HB     1 
ATOM   1384 H HG11   . VAL A 1 95  ? 15.608  41.451 73.822 1.00 66.98  ? 95  VAL A HG11   1 
ATOM   1385 H HG12   . VAL A 1 95  ? 15.505  41.238 75.394 1.00 66.98  ? 95  VAL A HG12   1 
ATOM   1386 H HG13   . VAL A 1 95  ? 15.175  40.038 74.406 1.00 66.98  ? 95  VAL A HG13   1 
ATOM   1387 H HG21   . VAL A 1 95  ? 13.610  41.601 72.448 1.00 57.66  ? 95  VAL A HG21   1 
ATOM   1388 H HG22   . VAL A 1 95  ? 13.066  40.200 72.963 1.00 57.66  ? 95  VAL A HG22   1 
ATOM   1389 H HG23   . VAL A 1 95  ? 12.164  41.502 73.098 1.00 57.66  ? 95  VAL A HG23   1 
ATOM   1390 N N      . ASN A 1 96  ? 13.686  38.445 75.671 1.00 68.82  ? 96  ASN A N      1 
ATOM   1391 C CA     . ASN A 1 96  ? 13.538  36.999 75.540 1.00 71.95  ? 96  ASN A CA     1 
ATOM   1392 C C      . ASN A 1 96  ? 12.441  36.481 76.461 1.00 73.54  ? 96  ASN A C      1 
ATOM   1393 O O      . ASN A 1 96  ? 11.610  35.661 76.053 1.00 75.29  ? 96  ASN A O      1 
ATOM   1394 C CB     . ASN A 1 96  ? 14.865  36.303 75.842 1.00 72.45  ? 96  ASN A CB     1 
ATOM   1395 C CG     . ASN A 1 96  ? 15.870  36.443 74.712 1.00 70.80  ? 96  ASN A CG     1 
ATOM   1396 O OD1    . ASN A 1 96  ? 15.497  36.559 73.543 1.00 69.17  ? 96  ASN A OD1    1 
ATOM   1397 N ND2    . ASN A 1 96  ? 17.154  36.426 75.056 1.00 70.81  ? 96  ASN A ND2    1 
ATOM   1398 H H      . ASN A 1 96  ? 14.453  38.705 75.960 1.00 70.73  ? 96  ASN A H      1 
ATOM   1399 H HA     . ASN A 1 96  ? 13.288  36.788 74.627 1.00 76.17  ? 96  ASN A HA     1 
ATOM   1400 H HB2    . ASN A 1 96  ? 15.254  36.694 76.640 1.00 77.82  ? 96  ASN A HB2    1 
ATOM   1401 H HB3    . ASN A 1 96  ? 14.701  35.357 75.982 1.00 77.82  ? 96  ASN A HB3    1 
ATOM   1402 H HD21   . ASN A 1 96  ? 17.762  36.502 74.452 1.00 81.07  ? 96  ASN A HD21   1 
ATOM   1403 H HD22   . ASN A 1 96  ? 17.377  36.339 75.882 1.00 81.07  ? 96  ASN A HD22   1 
ATOM   1404 N N      . TYR A 1 97  ? 12.423  36.954 77.708 1.00 77.96  ? 97  TYR A N      1 
ATOM   1405 C CA     . TYR A 1 97  ? 11.361  36.580 78.636 1.00 77.87  ? 97  TYR A CA     1 
ATOM   1406 C C      . TYR A 1 97  ? 9.991   36.902 78.051 1.00 76.48  ? 97  TYR A C      1 
ATOM   1407 O O      . TYR A 1 97  ? 9.098   36.047 78.017 1.00 77.57  ? 97  TYR A O      1 
ATOM   1408 C CB     . TYR A 1 97  ? 11.572  37.303 79.967 1.00 77.66  ? 97  TYR A CB     1 
ATOM   1409 C CG     . TYR A 1 97  ? 10.577  36.946 81.046 1.00 81.02  ? 97  TYR A CG     1 
ATOM   1410 C CD1    . TYR A 1 97  ? 10.757  35.821 81.839 1.00 87.62  ? 97  TYR A CD1    1 
ATOM   1411 C CD2    . TYR A 1 97  ? 9.467   37.746 81.286 1.00 79.54  ? 97  TYR A CD2    1 
ATOM   1412 C CE1    . TYR A 1 97  ? 9.854   35.495 82.832 1.00 91.66  ? 97  TYR A CE1    1 
ATOM   1413 C CE2    . TYR A 1 97  ? 8.558   37.429 82.276 1.00 83.51  ? 97  TYR A CE2    1 
ATOM   1414 C CZ     . TYR A 1 97  ? 8.759   36.305 83.048 1.00 89.37  ? 97  TYR A CZ     1 
ATOM   1415 O OH     . TYR A 1 97  ? 7.856   35.983 84.035 1.00 93.78  ? 97  TYR A OH     1 
ATOM   1416 H H      . TYR A 1 97  ? 13.010  37.489 78.037 1.00 83.48  ? 97  TYR A H      1 
ATOM   1417 H HA     . TYR A 1 97  ? 11.403  35.625 78.800 1.00 86.74  ? 97  TYR A HA     1 
ATOM   1418 H HB2    . TYR A 1 97  ? 12.456  37.085 80.301 1.00 88.91  ? 97  TYR A HB2    1 
ATOM   1419 H HB3    . TYR A 1 97  ? 11.508  38.258 79.814 1.00 88.91  ? 97  TYR A HB3    1 
ATOM   1420 H HD1    . TYR A 1 97  ? 11.496  35.275 81.696 1.00 104.28 ? 97  TYR A HD1    1 
ATOM   1421 H HD2    . TYR A 1 97  ? 9.331   38.506 80.767 1.00 96.70  ? 97  TYR A HD2    1 
ATOM   1422 H HE1    . TYR A 1 97  ? 9.986   34.737 83.354 1.00 108.06 ? 97  TYR A HE1    1 
ATOM   1423 H HE2    . TYR A 1 97  ? 7.818   37.972 82.424 1.00 100.30 ? 97  TYR A HE2    1 
ATOM   1424 H HH     . TYR A 1 97  ? 7.241   36.555 84.059 1.00 108.93 ? 97  TYR A HH     1 
ATOM   1425 N N      . ALA A 1 98  ? 9.808   38.137 77.578 1.00 59.62  ? 98  ALA A N      1 
ATOM   1426 C CA     . ALA A 1 98  ? 8.542   38.509 76.955 1.00 57.71  ? 98  ALA A CA     1 
ATOM   1427 C C      . ALA A 1 98  ? 8.326   37.748 75.653 1.00 58.78  ? 98  ALA A C      1 
ATOM   1428 O O      . ALA A 1 98  ? 7.195   37.370 75.327 1.00 57.98  ? 98  ALA A O      1 
ATOM   1429 C CB     . ALA A 1 98  ? 8.502   40.018 76.710 1.00 55.66  ? 98  ALA A CB     1 
ATOM   1430 H H      . ALA A 1 98  ? 10.392  38.767 77.606 1.00 70.31  ? 98  ALA A H      1 
ATOM   1431 H HA     . ALA A 1 98  ? 7.815   38.284 77.558 1.00 67.06  ? 98  ALA A HA     1 
ATOM   1432 H HB1    . ALA A 1 98  ? 7.656   40.248 76.296 1.00 63.11  ? 98  ALA A HB1    1 
ATOM   1433 H HB2    . ALA A 1 98  ? 8.592   40.478 77.559 1.00 63.11  ? 98  ALA A HB2    1 
ATOM   1434 H HB3    . ALA A 1 98  ? 9.235   40.261 76.122 1.00 63.11  ? 98  ALA A HB3    1 
ATOM   1435 N N      . ALA A 1 99  ? 9.400   37.511 74.897 1.00 56.96  ? 99  ALA A N      1 
ATOM   1436 C CA     . ALA A 1 99  ? 9.272   36.794 73.633 1.00 59.00  ? 99  ALA A CA     1 
ATOM   1437 C C      . ALA A 1 99  ? 8.765   35.375 73.855 1.00 60.79  ? 99  ALA A C      1 
ATOM   1438 O O      . ALA A 1 99  ? 7.915   34.885 73.102 1.00 60.97  ? 99  ALA A O      1 
ATOM   1439 C CB     . ALA A 1 99  ? 10.616  36.775 72.906 1.00 60.43  ? 99  ALA A CB     1 
ATOM   1440 H H      . ALA A 1 99  ? 10.203  37.752 75.093 1.00 71.16  ? 99  ALA A H      1 
ATOM   1441 H HA     . ALA A 1 99  ? 8.632   37.257 73.070 1.00 70.72  ? 99  ALA A HA     1 
ATOM   1442 H HB1    . ALA A 1 99  ? 10.514  36.295 72.069 1.00 69.62  ? 99  ALA A HB1    1 
ATOM   1443 H HB2    . ALA A 1 99  ? 10.894  37.688 72.734 1.00 69.62  ? 99  ALA A HB2    1 
ATOM   1444 H HB3    . ALA A 1 99  ? 11.271  36.329 73.466 1.00 69.62  ? 99  ALA A HB3    1 
ATOM   1445 N N      . SER A 1 100 ? 9.270   34.702 74.891 1.00 77.45  ? 100 SER A N      1 
ATOM   1446 C CA     . SER A 1 100 ? 8.845   33.341 75.197 1.00 79.63  ? 100 SER A CA     1 
ATOM   1447 C C      . SER A 1 100 ? 7.353   33.237 75.482 1.00 77.73  ? 100 SER A C      1 
ATOM   1448 O O      . SER A 1 100 ? 6.828   32.119 75.543 1.00 79.44  ? 100 SER A O      1 
ATOM   1449 C CB     . SER A 1 100 ? 9.631   32.815 76.401 1.00 80.79  ? 100 SER A CB     1 
ATOM   1450 O OG     . SER A 1 100 ? 11.027  32.872 76.166 1.00 82.05  ? 100 SER A OG     1 
ATOM   1451 H H      . SER A 1 100 ? 9.861   35.015 75.431 1.00 74.97  ? 100 SER A H      1 
ATOM   1452 H HA     . SER A 1 100 ? 9.045   32.771 74.438 1.00 81.68  ? 100 SER A HA     1 
ATOM   1453 H HB2    . SER A 1 100 ? 9.419   33.358 77.176 1.00 87.59  ? 100 SER A HB2    1 
ATOM   1454 H HB3    . SER A 1 100 ? 9.377   31.893 76.564 1.00 87.59  ? 100 SER A HB3    1 
ATOM   1455 H HG     . SER A 1 100 ? 11.262  33.666 76.024 1.00 88.01  ? 100 SER A HG     1 
ATOM   1456 N N      . ARG A 1 101 ? 6.662   34.362 75.653 1.00 66.54  ? 101 ARG A N      1 
ATOM   1457 C CA     . ARG A 1 101 ? 5.255   34.360 76.022 1.00 68.03  ? 101 ARG A CA     1 
ATOM   1458 C C      . ARG A 1 101 ? 4.318   34.413 74.823 1.00 66.28  ? 101 ARG A C      1 
ATOM   1459 O O      . ARG A 1 101 ? 3.125   34.127 74.976 1.00 68.72  ? 101 ARG A O      1 
ATOM   1460 C CB     . ARG A 1 101 ? 4.965   35.552 76.942 1.00 66.42  ? 101 ARG A CB     1 
ATOM   1461 C CG     . ARG A 1 101 ? 5.855   35.609 78.179 1.00 68.64  ? 101 ARG A CG     1 
ATOM   1462 C CD     . ARG A 1 101 ? 5.161   35.015 79.387 1.00 74.19  ? 101 ARG A CD     1 
ATOM   1463 N NE     . ARG A 1 101 ? 6.093   34.697 80.466 1.00 77.88  ? 101 ARG A NE     1 
ATOM   1464 C CZ     . ARG A 1 101 ? 5.744   34.506 81.735 1.00 83.87  ? 101 ARG A CZ     1 
ATOM   1465 N NH1    . ARG A 1 101 ? 4.478   34.620 82.111 1.00 85.66  ? 101 ARG A NH1    1 
ATOM   1466 N NH2    . ARG A 1 101 ? 6.667   34.210 82.639 1.00 87.57  ? 101 ARG A NH2    1 
ATOM   1467 H H      . ARG A 1 101 ? 6.994   35.150 75.559 1.00 75.01  ? 101 ARG A H      1 
ATOM   1468 H HA     . ARG A 1 101 ? 5.061   33.548 76.516 1.00 75.23  ? 101 ARG A HA     1 
ATOM   1469 H HB2    . ARG A 1 101 ? 5.101   36.372 76.442 1.00 74.98  ? 101 ARG A HB2    1 
ATOM   1470 H HB3    . ARG A 1 101 ? 4.044   35.498 77.242 1.00 74.98  ? 101 ARG A HB3    1 
ATOM   1471 H HG2    . ARG A 1 101 ? 6.666   35.102 78.015 1.00 78.27  ? 101 ARG A HG2    1 
ATOM   1472 H HG3    . ARG A 1 101 ? 6.071   36.534 78.376 1.00 78.27  ? 101 ARG A HG3    1 
ATOM   1473 H HD2    . ARG A 1 101 ? 4.514   35.654 79.727 1.00 84.90  ? 101 ARG A HD2    1 
ATOM   1474 H HD3    . ARG A 1 101 ? 4.713   34.196 79.125 1.00 84.90  ? 101 ARG A HD3    1 
ATOM   1475 H HE     . ARG A 1 101 ? 6.927   34.627 80.266 1.00 83.89  ? 101 ARG A HE     1 
ATOM   1476 H HH11   . ARG A 1 101 ? 3.872   34.810 81.531 1.00 129.52 ? 101 ARG A HH11   1 
ATOM   1477 H HH12   . ARG A 1 101 ? 4.261   34.499 82.935 1.00 129.52 ? 101 ARG A HH12   1 
ATOM   1478 H HH21   . ARG A 1 101 ? 7.491   34.139 82.404 1.00 130.07 ? 101 ARG A HH21   1 
ATOM   1479 H HH22   . ARG A 1 101 ? 6.442   34.094 83.461 1.00 130.07 ? 101 ARG A HH22   1 
ATOM   1480 N N      . PHE A 1 102 ? 4.820   34.772 73.638 1.00 58.65  ? 102 PHE A N      1 
ATOM   1481 C CA     . PHE A 1 102 ? 3.971   34.939 72.465 1.00 57.24  ? 102 PHE A CA     1 
ATOM   1482 C C      . PHE A 1 102 ? 4.518   34.230 71.230 1.00 58.71  ? 102 PHE A C      1 
ATOM   1483 O O      . PHE A 1 102 ? 3.979   34.422 70.134 1.00 59.09  ? 102 PHE A O      1 
ATOM   1484 C CB     . PHE A 1 102 ? 3.780   36.428 72.152 1.00 55.13  ? 102 PHE A CB     1 
ATOM   1485 C CG     . PHE A 1 102 ? 3.562   37.282 73.369 1.00 54.94  ? 102 PHE A CG     1 
ATOM   1486 C CD1    . PHE A 1 102 ? 2.318   37.348 73.974 1.00 58.20  ? 102 PHE A CD1    1 
ATOM   1487 C CD2    . PHE A 1 102 ? 4.601   38.024 73.903 1.00 55.90  ? 102 PHE A CD2    1 
ATOM   1488 C CE1    . PHE A 1 102 ? 2.117   38.136 75.093 1.00 59.88  ? 102 PHE A CE1    1 
ATOM   1489 C CE2    . PHE A 1 102 ? 4.407   38.813 75.019 1.00 55.78  ? 102 PHE A CE2    1 
ATOM   1490 C CZ     . PHE A 1 102 ? 3.164   38.869 75.615 1.00 58.23  ? 102 PHE A CZ     1 
ATOM   1491 H H      . PHE A 1 102 ? 5.653   34.924 73.491 1.00 72.76  ? 102 PHE A H      1 
ATOM   1492 H HA     . PHE A 1 102 ? 3.098   34.563 72.657 1.00 71.81  ? 102 PHE A HA     1 
ATOM   1493 H HB2    . PHE A 1 102 ? 4.572   36.756 71.698 1.00 69.80  ? 102 PHE A HB2    1 
ATOM   1494 H HB3    . PHE A 1 102 ? 3.006   36.530 71.577 1.00 69.80  ? 102 PHE A HB3    1 
ATOM   1495 H HD1    . PHE A 1 102 ? 1.610   36.856 73.626 1.00 79.52  ? 102 PHE A HD1    1 
ATOM   1496 H HD2    . PHE A 1 102 ? 5.441   37.989 73.505 1.00 73.91  ? 102 PHE A HD2    1 
ATOM   1497 H HE1    . PHE A 1 102 ? 1.278   38.172 75.492 1.00 82.44  ? 102 PHE A HE1    1 
ATOM   1498 H HE2    . PHE A 1 102 ? 5.114   39.306 75.370 1.00 76.11  ? 102 PHE A HE2    1 
ATOM   1499 H HZ     . PHE A 1 102 ? 3.031   39.399 76.368 1.00 80.22  ? 102 PHE A HZ     1 
ATOM   1500 N N      . LEU A 1 103 ? 5.563   33.420 71.372 1.00 61.31  ? 103 LEU A N      1 
ATOM   1501 C CA     . LEU A 1 103 ? 6.185   32.736 70.248 1.00 64.55  ? 103 LEU A CA     1 
ATOM   1502 C C      . LEU A 1 103 ? 6.034   31.231 70.406 1.00 66.90  ? 103 LEU A C      1 
ATOM   1503 O O      . LEU A 1 103 ? 6.162   30.696 71.511 1.00 66.32  ? 103 LEU A O      1 
ATOM   1504 C CB     . LEU A 1 103 ? 7.668   33.098 70.131 1.00 66.13  ? 103 LEU A CB     1 
ATOM   1505 C CG     . LEU A 1 103 ? 7.975   34.557 69.792 1.00 65.61  ? 103 LEU A CG     1 
ATOM   1506 C CD1    . LEU A 1 103 ? 9.471   34.809 69.870 1.00 65.57  ? 103 LEU A CD1    1 
ATOM   1507 C CD2    . LEU A 1 103 ? 7.445   34.922 68.413 1.00 66.39  ? 103 LEU A CD2    1 
ATOM   1508 H H      . LEU A 1 103 ? 5.937   33.248 72.127 1.00 73.52  ? 103 LEU A H      1 
ATOM   1509 H HA     . LEU A 1 103 ? 5.741   33.001 69.427 1.00 77.43  ? 103 LEU A HA     1 
ATOM   1510 H HB2    . LEU A 1 103 ? 8.097   32.901 70.979 1.00 78.67  ? 103 LEU A HB2    1 
ATOM   1511 H HB3    . LEU A 1 103 ? 8.062   32.550 69.435 1.00 78.67  ? 103 LEU A HB3    1 
ATOM   1512 H HG     . LEU A 1 103 ? 7.540   35.131 70.442 1.00 77.88  ? 103 LEU A HG     1 
ATOM   1513 H HD11   . LEU A 1 103 ? 9.646   35.738 69.652 1.00 78.46  ? 103 LEU A HD11   1 
ATOM   1514 H HD12   . LEU A 1 103 ? 9.776   34.617 70.771 1.00 78.46  ? 103 LEU A HD12   1 
ATOM   1515 H HD13   . LEU A 1 103 ? 9.922   34.230 69.237 1.00 78.46  ? 103 LEU A HD13   1 
ATOM   1516 H HD21   . LEU A 1 103 ? 7.656   35.851 68.230 1.00 77.57  ? 103 LEU A HD21   1 
ATOM   1517 H HD22   . LEU A 1 103 ? 7.865   34.351 67.752 1.00 77.57  ? 103 LEU A HD22   1 
ATOM   1518 H HD23   . LEU A 1 103 ? 6.484   34.792 68.400 1.00 77.57  ? 103 LEU A HD23   1 
ATOM   1519 N N      . GLY A 1 104 ? 5.762   30.558 69.292 1.00 63.42  ? 104 GLY A N      1 
ATOM   1520 C CA     . GLY A 1 104 ? 5.622   29.116 69.281 1.00 68.07  ? 104 GLY A CA     1 
ATOM   1521 C C      . GLY A 1 104 ? 6.720   28.435 68.492 1.00 70.07  ? 104 GLY A C      1 
ATOM   1522 O O      . GLY A 1 104 ? 7.875   28.871 68.518 1.00 69.98  ? 104 GLY A O      1 
ATOM   1523 H H      . GLY A 1 104 ? 5.653   30.924 68.521 1.00 81.40  ? 104 GLY A H      1 
ATOM   1524 H HA2    . GLY A 1 104 ? 5.646   28.783 70.192 1.00 89.34  ? 104 GLY A HA2    1 
ATOM   1525 H HA3    . GLY A 1 104 ? 4.768   28.877 68.889 1.00 89.34  ? 104 GLY A HA3    1 
ATOM   1526 N N      . ALA A 1 105 ? 6.372   27.360 67.786 1.00 102.15 ? 105 ALA A N      1 
ATOM   1527 C CA     . ALA A 1 105 ? 7.332   26.653 66.948 1.00 105.80 ? 105 ALA A CA     1 
ATOM   1528 C C      . ALA A 1 105 ? 7.444   27.270 65.560 1.00 106.35 ? 105 ALA A C      1 
ATOM   1529 O O      . ALA A 1 105 ? 8.550   27.389 65.022 1.00 106.89 ? 105 ALA A O      1 
ATOM   1530 C CB     . ALA A 1 105 ? 6.940   25.179 66.830 1.00 109.48 ? 105 ALA A CB     1 
ATOM   1531 H H      . ALA A 1 105 ? 5.582   27.021 67.777 1.00 137.57 ? 105 ALA A H      1 
ATOM   1532 H HA     . ALA A 1 105 ? 8.207   26.697 67.366 1.00 142.42 ? 105 ALA A HA     1 
ATOM   1533 H HB1    . ALA A 1 105 ? 7.589   24.724 66.270 1.00 150.38 ? 105 ALA A HB1    1 
ATOM   1534 H HB2    . ALA A 1 105 ? 6.931   24.782 67.715 1.00 150.38 ? 105 ALA A HB2    1 
ATOM   1535 H HB3    . ALA A 1 105 ? 6.058   25.118 66.431 1.00 150.38 ? 105 ALA A HB3    1 
ATOM   1536 N N      . ASN A 1 106 ? 6.318   27.662 64.970 1.00 85.18  ? 106 ASN A N      1 
ATOM   1537 C CA     . ASN A 1 106 ? 6.339   28.302 63.662 1.00 85.60  ? 106 ASN A CA     1 
ATOM   1538 C C      . ASN A 1 106 ? 6.891   29.717 63.782 1.00 82.98  ? 106 ASN A C      1 
ATOM   1539 O O      . ASN A 1 106 ? 6.440   30.505 64.621 1.00 80.43  ? 106 ASN A O      1 
ATOM   1540 C CB     . ASN A 1 106 ? 4.933   28.327 63.066 1.00 85.13  ? 106 ASN A CB     1 
ATOM   1541 C CG     . ASN A 1 106 ? 3.923   28.983 63.985 1.00 80.30  ? 106 ASN A CG     1 
ATOM   1542 O OD1    . ASN A 1 106 ? 3.462   28.377 64.953 1.00 79.55  ? 106 ASN A OD1    1 
ATOM   1543 N ND2    . ASN A 1 106 ? 3.569   30.228 63.685 1.00 76.57  ? 106 ASN A ND2    1 
ATOM   1544 H H      . ASN A 1 106 ? 5.532   27.569 65.306 1.00 119.24 ? 106 ASN A H      1 
ATOM   1545 H HA     . ASN A 1 106 ? 6.915   27.799 63.067 1.00 115.28 ? 106 ASN A HA     1 
ATOM   1546 H HB2    . ASN A 1 106 ? 4.951   28.825 62.234 1.00 113.18 ? 106 ASN A HB2    1 
ATOM   1547 H HB3    . ASN A 1 106 ? 4.643   27.416 62.902 1.00 113.18 ? 106 ASN A HB3    1 
ATOM   1548 H HD21   . ASN A 1 106 ? 2.999   30.643 64.177 1.00 97.69  ? 106 ASN A HD21   1 
ATOM   1549 H HD22   . ASN A 1 106 ? 3.911   30.618 62.999 1.00 97.69  ? 106 ASN A HD22   1 
ATOM   1550 N N      . GLN A 1 107 ? 7.868   30.039 62.940 1.00 68.94  ? 107 GLN A N      1 
ATOM   1551 C CA     . GLN A 1 107 ? 8.529   31.334 63.015 1.00 64.47  ? 107 GLN A CA     1 
ATOM   1552 C C      . GLN A 1 107 ? 7.596   32.444 62.548 1.00 60.37  ? 107 GLN A C      1 
ATOM   1553 O O      . GLN A 1 107 ? 6.811   32.268 61.612 1.00 59.78  ? 107 GLN A O      1 
ATOM   1554 C CB     . GLN A 1 107 ? 9.801   31.328 62.169 1.00 61.51  ? 107 GLN A CB     1 
ATOM   1555 C CG     . GLN A 1 107 ? 10.586  32.625 62.231 1.00 56.61  ? 107 GLN A CG     1 
ATOM   1556 C CD     . GLN A 1 107 ? 11.927  32.530 61.534 1.00 58.16  ? 107 GLN A CD     1 
ATOM   1557 O OE1    . GLN A 1 107 ? 12.948  32.950 62.074 1.00 56.73  ? 107 GLN A OE1    1 
ATOM   1558 N NE2    . GLN A 1 107 ? 11.931  31.982 60.325 1.00 61.77  ? 107 GLN A NE2    1 
ATOM   1559 H H      . GLN A 1 107 ? 8.166   29.525 62.317 1.00 92.10  ? 107 GLN A H      1 
ATOM   1560 H HA     . GLN A 1 107 ? 8.777   31.513 63.936 1.00 84.30  ? 107 GLN A HA     1 
ATOM   1561 H HB2    . GLN A 1 107 ? 10.380  30.616 62.482 1.00 81.59  ? 107 GLN A HB2    1 
ATOM   1562 H HB3    . GLN A 1 107 ? 9.559   31.172 61.243 1.00 81.59  ? 107 GLN A HB3    1 
ATOM   1563 H HG2    . GLN A 1 107 ? 10.073  33.326 61.799 1.00 73.52  ? 107 GLN A HG2    1 
ATOM   1564 H HG3    . GLN A 1 107 ? 10.746  32.854 63.159 1.00 73.52  ? 107 GLN A HG3    1 
ATOM   1565 H HE21   . GLN A 1 107 ? 11.196  31.703 59.977 1.00 79.23  ? 107 GLN A HE21   1 
ATOM   1566 H HE22   . GLN A 1 107 ? 12.669  31.906 59.890 1.00 79.23  ? 107 GLN A HE22   1 
ATOM   1567 N N      . VAL A 1 108 ? 7.691   33.597 63.209 1.00 71.00  ? 108 VAL A N      1 
ATOM   1568 C CA     . VAL A 1 108 ? 6.912   34.779 62.876 1.00 62.79  ? 108 VAL A CA     1 
ATOM   1569 C C      . VAL A 1 108 ? 7.867   35.957 62.710 1.00 54.60  ? 108 VAL A C      1 
ATOM   1570 O O      . VAL A 1 108 ? 9.076   35.834 62.904 1.00 54.91  ? 108 VAL A O      1 
ATOM   1571 C CB     . VAL A 1 108 ? 5.837   35.089 63.938 1.00 63.52  ? 108 VAL A CB     1 
ATOM   1572 C CG1    . VAL A 1 108 ? 4.878   33.918 64.076 1.00 70.76  ? 108 VAL A CG1    1 
ATOM   1573 C CG2    . VAL A 1 108 ? 6.482   35.417 65.281 1.00 65.25  ? 108 VAL A CG2    1 
ATOM   1574 H H      . VAL A 1 108 ? 8.220   33.719 63.876 1.00 79.33  ? 108 VAL A H      1 
ATOM   1575 H HA     . VAL A 1 108 ? 6.463   34.633 62.028 1.00 75.70  ? 108 VAL A HA     1 
ATOM   1576 H HB     . VAL A 1 108 ? 5.326   35.863 63.654 1.00 75.66  ? 108 VAL A HB     1 
ATOM   1577 H HG11   . VAL A 1 108 ? 4.212   34.134 64.748 1.00 81.62  ? 108 VAL A HG11   1 
ATOM   1578 H HG12   . VAL A 1 108 ? 4.448   33.761 63.221 1.00 81.62  ? 108 VAL A HG12   1 
ATOM   1579 H HG13   . VAL A 1 108 ? 5.378   33.132 64.346 1.00 81.62  ? 108 VAL A HG13   1 
ATOM   1580 H HG21   . VAL A 1 108 ? 5.785   35.607 65.928 1.00 73.81  ? 108 VAL A HG21   1 
ATOM   1581 H HG22   . VAL A 1 108 ? 7.006   34.654 65.573 1.00 73.81  ? 108 VAL A HG22   1 
ATOM   1582 H HG23   . VAL A 1 108 ? 7.056   36.192 65.174 1.00 73.81  ? 108 VAL A HG23   1 
ATOM   1583 N N      . GLY A 1 109 ? 7.305   37.109 62.356 1.00 59.00  ? 109 GLY A N      1 
ATOM   1584 C CA     . GLY A 1 109 ? 8.098   38.307 62.166 1.00 54.10  ? 109 GLY A CA     1 
ATOM   1585 C C      . GLY A 1 109 ? 8.238   39.127 63.431 1.00 52.39  ? 109 GLY A C      1 
ATOM   1586 O O      . GLY A 1 109 ? 7.236   39.525 64.033 1.00 50.87  ? 109 GLY A O      1 
ATOM   1587 H H      . GLY A 1 109 ? 6.463   37.219 62.221 1.00 72.48  ? 109 GLY A H      1 
ATOM   1588 H HA2    . GLY A 1 109 ? 8.986   38.060 61.861 1.00 70.26  ? 109 GLY A HA2    1 
ATOM   1589 H HA3    . GLY A 1 109 ? 7.685   38.862 61.486 1.00 70.26  ? 109 GLY A HA3    1 
ATOM   1590 N N      . CYS A 1 110 ? 9.477   39.381 63.846 1.00 57.10  ? 110 CYS A N      1 
ATOM   1591 C CA     . CYS A 1 110 ? 9.766   40.187 65.022 1.00 55.80  ? 110 CYS A CA     1 
ATOM   1592 C C      . CYS A 1 110 ? 10.484  41.463 64.604 1.00 49.91  ? 110 CYS A C      1 
ATOM   1593 O O      . CYS A 1 110 ? 11.226  41.480 63.618 1.00 47.38  ? 110 CYS A O      1 
ATOM   1594 C CB     . CYS A 1 110 ? 10.621  39.412 66.029 1.00 60.28  ? 110 CYS A CB     1 
ATOM   1595 S SG     . CYS A 1 110 ? 9.818   37.926 66.677 1.00 62.79  ? 110 CYS A SG     1 
ATOM   1596 H H      . CYS A 1 110 ? 10.182  39.089 63.451 1.00 74.52  ? 110 CYS A H      1 
ATOM   1597 H HA     . CYS A 1 110 ? 8.934   40.433 65.455 1.00 69.59  ? 110 CYS A HA     1 
ATOM   1598 H HB2    . CYS A 1 110 ? 11.444  39.139 65.595 1.00 69.28  ? 110 CYS A HB2    1 
ATOM   1599 H HB3    . CYS A 1 110 ? 10.822  39.992 66.780 1.00 69.28  ? 110 CYS A HB3    1 
ATOM   1600 H HG     . CYS A 1 110 ? 10.559  37.388 67.453 1.00 71.47  ? 110 CYS A HG     1 
ATOM   1601 N N      . THR A 1 111 ? 10.257  42.535 65.362 1.00 60.51  ? 111 THR A N      1 
ATOM   1602 C CA     . THR A 1 111 ? 10.784  43.840 64.996 1.00 56.90  ? 111 THR A CA     1 
ATOM   1603 C C      . THR A 1 111 ? 11.122  44.640 66.245 1.00 56.44  ? 111 THR A C      1 
ATOM   1604 O O      . THR A 1 111 ? 10.494  44.480 67.295 1.00 58.99  ? 111 THR A O      1 
ATOM   1605 C CB     . THR A 1 111 ? 9.786   44.644 64.151 1.00 55.80  ? 111 THR A CB     1 
ATOM   1606 O OG1    . THR A 1 111 ? 8.618   44.934 64.933 1.00 56.94  ? 111 THR A OG1    1 
ATOM   1607 C CG2    . THR A 1 111 ? 9.378   43.881 62.896 1.00 56.60  ? 111 THR A CG2    1 
ATOM   1608 H H      . THR A 1 111 ? 9.800   42.529 66.091 1.00 66.88  ? 111 THR A H      1 
ATOM   1609 H HA     . THR A 1 111 ? 11.597  43.724 64.479 1.00 67.67  ? 111 THR A HA     1 
ATOM   1610 H HB     . THR A 1 111 ? 10.200  45.478 63.877 1.00 72.45  ? 111 THR A HB     1 
ATOM   1611 H HG1    . THR A 1 111 ? 8.831   45.383 65.611 1.00 72.89  ? 111 THR A HG1    1 
ATOM   1612 H HG21   . THR A 1 111 ? 8.748   44.406 62.379 1.00 75.42  ? 111 THR A HG21   1 
ATOM   1613 H HG22   . THR A 1 111 ? 10.160  43.698 62.351 1.00 75.42  ? 111 THR A HG22   1 
ATOM   1614 H HG23   . THR A 1 111 ? 8.961   43.040 63.141 1.00 75.42  ? 111 THR A HG23   1 
ATOM   1615 N N      . TYR A 1 112 ? 12.124  45.507 66.111 1.00 49.17  ? 112 TYR A N      1 
ATOM   1616 C CA     . TYR A 1 112 ? 12.394  46.564 67.077 1.00 49.17  ? 112 TYR A CA     1 
ATOM   1617 C C      . TYR A 1 112 ? 12.523  47.874 66.320 1.00 47.21  ? 112 TYR A C      1 
ATOM   1618 O O      . TYR A 1 112 ? 13.234  47.943 65.313 1.00 46.06  ? 112 TYR A O      1 
ATOM   1619 C CB     . TYR A 1 112 ? 13.668  46.302 67.882 1.00 51.39  ? 112 TYR A CB     1 
ATOM   1620 C CG     . TYR A 1 112 ? 14.064  47.472 68.757 1.00 52.12  ? 112 TYR A CG     1 
ATOM   1621 C CD1    . TYR A 1 112 ? 13.457  47.679 69.988 1.00 53.26  ? 112 TYR A CD1    1 
ATOM   1622 C CD2    . TYR A 1 112 ? 15.037  48.375 68.348 1.00 52.19  ? 112 TYR A CD2    1 
ATOM   1623 C CE1    . TYR A 1 112 ? 13.810  48.745 70.790 1.00 54.90  ? 112 TYR A CE1    1 
ATOM   1624 C CE2    . TYR A 1 112 ? 15.399  49.446 69.144 1.00 53.86  ? 112 TYR A CE2    1 
ATOM   1625 C CZ     . TYR A 1 112 ? 14.781  49.626 70.364 1.00 55.63  ? 112 TYR A CZ     1 
ATOM   1626 O OH     . TYR A 1 112 ? 15.137  50.690 71.160 1.00 58.02  ? 112 TYR A OH     1 
ATOM   1627 H H      . TYR A 1 112 ? 12.674  45.501 65.450 1.00 59.17  ? 112 TYR A H      1 
ATOM   1628 H HA     . TYR A 1 112 ? 11.649  46.636 67.694 1.00 58.51  ? 112 TYR A HA     1 
ATOM   1629 H HB2    . TYR A 1 112 ? 13.527  45.533 68.456 1.00 58.43  ? 112 TYR A HB2    1 
ATOM   1630 H HB3    . TYR A 1 112 ? 14.399  46.128 67.268 1.00 58.43  ? 112 TYR A HB3    1 
ATOM   1631 H HD1    . TYR A 1 112 ? 12.802  47.086 70.280 1.00 57.33  ? 112 TYR A HD1    1 
ATOM   1632 H HD2    . TYR A 1 112 ? 15.455  48.255 67.526 1.00 65.32  ? 112 TYR A HD2    1 
ATOM   1633 H HE1    . TYR A 1 112 ? 13.396  48.869 71.614 1.00 60.22  ? 112 TYR A HE1    1 
ATOM   1634 H HE2    . TYR A 1 112 ? 16.053  50.042 68.859 1.00 67.44  ? 112 TYR A HE2    1 
ATOM   1635 H HH     . TYR A 1 112 ? 14.687  50.680 71.870 1.00 68.03  ? 112 TYR A HH     1 
ATOM   1636 N N      . SER A 1 113 ? 11.843  48.908 66.805 1.00 47.16  ? 113 SER A N      1 
ATOM   1637 C CA     . SER A 1 113 ? 11.845  50.207 66.153 1.00 47.49  ? 113 SER A CA     1 
ATOM   1638 C C      . SER A 1 113 ? 12.099  51.302 67.178 1.00 48.16  ? 113 SER A C      1 
ATOM   1639 O O      . SER A 1 113 ? 11.754  51.170 68.356 1.00 48.51  ? 113 SER A O      1 
ATOM   1640 C CB     . SER A 1 113 ? 10.520  50.474 65.430 1.00 49.03  ? 113 SER A CB     1 
ATOM   1641 O OG     . SER A 1 113 ? 10.559  51.708 64.732 1.00 51.44  ? 113 SER A OG     1 
ATOM   1642 H H      . SER A 1 113 ? 11.365  48.879 67.520 1.00 59.28  ? 113 SER A H      1 
ATOM   1643 H HA     . SER A 1 113 ? 12.560  50.234 65.497 1.00 62.66  ? 113 SER A HA     1 
ATOM   1644 H HB2    . SER A 1 113 ? 10.357  49.759 64.796 1.00 68.60  ? 113 SER A HB2    1 
ATOM   1645 H HB3    . SER A 1 113 ? 9.805   50.506 66.085 1.00 68.60  ? 113 SER A HB3    1 
ATOM   1646 H HG     . SER A 1 113 ? 10.699  52.338 65.269 1.00 74.46  ? 113 SER A HG     1 
ATOM   1647 N N      . ILE A 1 114 ? 12.716  52.387 66.713 1.00 43.18  ? 114 ILE A N      1 
ATOM   1648 C CA     . ILE A 1 114 ? 12.955  53.555 67.551 1.00 46.03  ? 114 ILE A CA     1 
ATOM   1649 C C      . ILE A 1 114 ? 13.066  54.792 66.668 1.00 48.69  ? 114 ILE A C      1 
ATOM   1650 O O      . ILE A 1 114 ? 13.815  54.800 65.685 1.00 49.65  ? 114 ILE A O      1 
ATOM   1651 C CB     . ILE A 1 114 ? 14.217  53.372 68.416 1.00 46.89  ? 114 ILE A CB     1 
ATOM   1652 C CG1    . ILE A 1 114 ? 14.503  54.646 69.217 1.00 50.41  ? 114 ILE A CG1    1 
ATOM   1653 C CG2    . ILE A 1 114 ? 15.414  52.996 67.547 1.00 45.57  ? 114 ILE A CG2    1 
ATOM   1654 C CD1    . ILE A 1 114 ? 15.593  54.495 70.262 1.00 52.12  ? 114 ILE A CD1    1 
ATOM   1655 H H      . ILE A 1 114 ? 13.008  52.469 65.908 1.00 55.92  ? 114 ILE A H      1 
ATOM   1656 H HA     . ILE A 1 114 ? 12.198  53.677 68.146 1.00 58.60  ? 114 ILE A HA     1 
ATOM   1657 H HB     . ILE A 1 114 ? 14.056  52.648 69.042 1.00 56.51  ? 114 ILE A HB     1 
ATOM   1658 H HG12   . ILE A 1 114 ? 14.779  55.344 68.602 1.00 58.49  ? 114 ILE A HG12   1 
ATOM   1659 H HG13   . ILE A 1 114 ? 13.691  54.914 69.674 1.00 58.49  ? 114 ILE A HG13   1 
ATOM   1660 H HG21   . ILE A 1 114 ? 16.193  52.887 68.114 1.00 56.23  ? 114 ILE A HG21   1 
ATOM   1661 H HG22   . ILE A 1 114 ? 15.221  52.165 67.086 1.00 56.23  ? 114 ILE A HG22   1 
ATOM   1662 H HG23   . ILE A 1 114 ? 15.570  53.704 66.903 1.00 56.23  ? 114 ILE A HG23   1 
ATOM   1663 H HD11   . ILE A 1 114 ? 15.709  55.342 70.720 1.00 57.08  ? 114 ILE A HD11   1 
ATOM   1664 H HD12   . ILE A 1 114 ? 15.329  53.810 70.896 1.00 57.08  ? 114 ILE A HD12   1 
ATOM   1665 H HD13   . ILE A 1 114 ? 16.419  54.240 69.823 1.00 57.08  ? 114 ILE A HD13   1 
ATOM   1666 N N      . ARG A 1 115 ? 12.325  55.843 67.011 1.00 55.26  ? 115 ARG A N      1 
ATOM   1667 C CA     . ARG A 1 115 ? 12.353  57.103 66.280 1.00 58.14  ? 115 ARG A CA     1 
ATOM   1668 C C      . ARG A 1 115 ? 12.950  58.186 67.168 1.00 62.25  ? 115 ARG A C      1 
ATOM   1669 O O      . ARG A 1 115 ? 12.542  58.344 68.323 1.00 63.32  ? 115 ARG A O      1 
ATOM   1670 C CB     . ARG A 1 115 ? 10.947  57.505 65.823 1.00 56.98  ? 115 ARG A CB     1 
ATOM   1671 C CG     . ARG A 1 115 ? 10.873  58.880 65.178 1.00 59.05  ? 115 ARG A CG     1 
ATOM   1672 C CD     . ARG A 1 115 ? 9.487   59.174 64.632 1.00 59.87  ? 115 ARG A CD     1 
ATOM   1673 N NE     . ARG A 1 115 ? 8.452   59.070 65.657 1.00 59.82  ? 115 ARG A NE     1 
ATOM   1674 C CZ     . ARG A 1 115 ? 7.149   59.207 65.425 1.00 61.81  ? 115 ARG A CZ     1 
ATOM   1675 N NH1    . ARG A 1 115 ? 6.710   59.450 64.198 1.00 63.99  ? 115 ARG A NH1    1 
ATOM   1676 N NH2    . ARG A 1 115 ? 6.281   59.100 66.422 1.00 62.90  ? 115 ARG A NH2    1 
ATOM   1677 H H      . ARG A 1 115 ? 11.786  55.849 67.681 1.00 66.68  ? 115 ARG A H      1 
ATOM   1678 H HA     . ARG A 1 115 ? 12.913  57.008 65.495 1.00 73.57  ? 115 ARG A HA     1 
ATOM   1679 H HB2    . ARG A 1 115 ? 10.634  56.856 65.174 1.00 74.06  ? 115 ARG A HB2    1 
ATOM   1680 H HB3    . ARG A 1 115 ? 10.358  57.508 66.594 1.00 74.06  ? 115 ARG A HB3    1 
ATOM   1681 H HG2    . ARG A 1 115 ? 11.088  59.555 65.840 1.00 79.06  ? 115 ARG A HG2    1 
ATOM   1682 H HG3    . ARG A 1 115 ? 11.504  58.921 64.442 1.00 79.06  ? 115 ARG A HG3    1 
ATOM   1683 H HD2    . ARG A 1 115 ? 9.470   60.077 64.278 1.00 83.71  ? 115 ARG A HD2    1 
ATOM   1684 H HD3    . ARG A 1 115 ? 9.280   58.537 63.930 1.00 83.71  ? 115 ARG A HD3    1 
ATOM   1685 H HE     . ARG A 1 115 ? 8.701   58.909 66.465 1.00 83.20  ? 115 ARG A HE     1 
ATOM   1686 H HH11   . ARG A 1 115 ? 7.268   59.522 63.547 1.00 91.01  ? 115 ARG A HH11   1 
ATOM   1687 H HH12   . ARG A 1 115 ? 5.867   59.538 64.052 1.00 91.01  ? 115 ARG A HH12   1 
ATOM   1688 H HH21   . ARG A 1 115 ? 6.560   58.941 67.220 1.00 86.78  ? 115 ARG A HH21   1 
ATOM   1689 H HH22   . ARG A 1 115 ? 5.439   59.187 66.271 1.00 86.78  ? 115 ARG A HH22   1 
ATOM   1690 N N      . PHE A 1 116 ? 13.913  58.929 66.626 1.00 49.53  ? 116 PHE A N      1 
ATOM   1691 C CA     . PHE A 1 116 ? 14.579  59.987 67.378 1.00 52.75  ? 116 PHE A CA     1 
ATOM   1692 C C      . PHE A 1 116 ? 15.067  61.043 66.400 1.00 54.81  ? 116 PHE A C      1 
ATOM   1693 O O      . PHE A 1 116 ? 15.804  60.726 65.462 1.00 54.19  ? 116 PHE A O      1 
ATOM   1694 C CB     . PHE A 1 116 ? 15.743  59.425 68.197 1.00 53.86  ? 116 PHE A CB     1 
ATOM   1695 C CG     . PHE A 1 116 ? 16.387  60.429 69.113 1.00 57.59  ? 116 PHE A CG     1 
ATOM   1696 C CD1    . PHE A 1 116 ? 15.666  61.014 70.139 1.00 59.02  ? 116 PHE A CD1    1 
ATOM   1697 C CD2    . PHE A 1 116 ? 17.720  60.774 68.958 1.00 60.94  ? 116 PHE A CD2    1 
ATOM   1698 C CE1    . PHE A 1 116 ? 16.256  61.932 70.987 1.00 63.21  ? 116 PHE A CE1    1 
ATOM   1699 C CE2    . PHE A 1 116 ? 18.316  61.690 69.803 1.00 65.04  ? 116 PHE A CE2    1 
ATOM   1700 C CZ     . PHE A 1 116 ? 17.582  62.269 70.820 1.00 65.90  ? 116 PHE A CZ     1 
ATOM   1701 H H      . PHE A 1 116 ? 14.199  58.839 65.820 1.00 73.61  ? 116 PHE A H      1 
ATOM   1702 H HA     . PHE A 1 116 ? 13.946  60.400 67.986 1.00 75.20  ? 116 PHE A HA     1 
ATOM   1703 H HB2    . PHE A 1 116 ? 15.416  58.694 68.743 1.00 70.50  ? 116 PHE A HB2    1 
ATOM   1704 H HB3    . PHE A 1 116 ? 16.425  59.101 67.588 1.00 70.50  ? 116 PHE A HB3    1 
ATOM   1705 H HD1    . PHE A 1 116 ? 14.771  60.790 70.256 1.00 71.47  ? 116 PHE A HD1    1 
ATOM   1706 H HD2    . PHE A 1 116 ? 18.218  60.387 68.275 1.00 71.09  ? 116 PHE A HD2    1 
ATOM   1707 H HE1    . PHE A 1 116 ? 15.759  62.320 71.671 1.00 74.60  ? 116 PHE A HE1    1 
ATOM   1708 H HE2    . PHE A 1 116 ? 19.210  61.916 69.688 1.00 73.68  ? 116 PHE A HE2    1 
ATOM   1709 H HZ     . PHE A 1 116 ? 17.982  62.887 71.389 1.00 75.55  ? 116 PHE A HZ     1 
ATOM   1710 N N      . ARG A 1 117 ? 14.657  62.291 66.621 1.00 60.49  ? 117 ARG A N      1 
ATOM   1711 C CA     . ARG A 1 117 ? 15.069  63.409 65.772 1.00 61.19  ? 117 ARG A CA     1 
ATOM   1712 C C      . ARG A 1 117 ? 14.669  63.175 64.317 1.00 60.81  ? 117 ARG A C      1 
ATOM   1713 O O      . ARG A 1 117 ? 15.446  63.427 63.392 1.00 62.20  ? 117 ARG A O      1 
ATOM   1714 C CB     . ARG A 1 117 ? 16.575  63.655 65.881 1.00 63.52  ? 117 ARG A CB     1 
ATOM   1715 C CG     . ARG A 1 117 ? 17.029  64.232 67.208 1.00 67.98  ? 117 ARG A CG     1 
ATOM   1716 C CD     . ARG A 1 117 ? 18.510  64.559 67.162 1.00 71.19  ? 117 ARG A CD     1 
ATOM   1717 N NE     . ARG A 1 117 ? 18.938  65.354 68.307 1.00 76.12  ? 117 ARG A NE     1 
ATOM   1718 C CZ     . ARG A 1 117 ? 20.167  65.837 68.462 1.00 79.15  ? 117 ARG A CZ     1 
ATOM   1719 N NH1    . ARG A 1 117 ? 21.097  65.608 67.544 1.00 77.51  ? 117 ARG A NH1    1 
ATOM   1720 N NH2    . ARG A 1 117 ? 20.465  66.553 69.537 1.00 83.13  ? 117 ARG A NH2    1 
ATOM   1721 H H      . ARG A 1 117 ? 14.133  62.520 67.264 1.00 86.26  ? 117 ARG A H      1 
ATOM   1722 H HA     . ARG A 1 117 ? 14.617  64.212 66.076 1.00 89.64  ? 117 ARG A HA     1 
ATOM   1723 H HB2    . ARG A 1 117 ? 17.036  62.811 65.755 1.00 90.60  ? 117 ARG A HB2    1 
ATOM   1724 H HB3    . ARG A 1 117 ? 16.838  64.277 65.185 1.00 90.60  ? 117 ARG A HB3    1 
ATOM   1725 H HG2    . ARG A 1 117 ? 16.539  65.049 67.391 1.00 94.08  ? 117 ARG A HG2    1 
ATOM   1726 H HG3    . ARG A 1 117 ? 16.879  63.582 67.913 1.00 94.08  ? 117 ARG A HG3    1 
ATOM   1727 H HD2    . ARG A 1 117 ? 19.018  63.733 67.162 1.00 99.56  ? 117 ARG A HD2    1 
ATOM   1728 H HD3    . ARG A 1 117 ? 18.698  65.066 66.356 1.00 99.56  ? 117 ARG A HD3    1 
ATOM   1729 H HE     . ARG A 1 117 ? 18.350  65.550 68.903 1.00 104.41 ? 117 ARG A HE     1 
ATOM   1730 H HH11   . ARG A 1 117 ? 20.907  65.145 66.845 1.00 113.79 ? 117 ARG A HH11   1 
ATOM   1731 H HH12   . ARG A 1 117 ? 21.891  65.922 67.648 1.00 113.79 ? 117 ARG A HH12   1 
ATOM   1732 H HH21   . ARG A 1 117 ? 19.865  66.703 70.134 1.00 110.85 ? 117 ARG A HH21   1 
ATOM   1733 H HH22   . ARG A 1 117 ? 21.260  66.865 69.638 1.00 110.85 ? 117 ARG A HH22   1 
ATOM   1734 N N      . GLY A 1 118 ? 13.449  62.686 64.111 1.00 64.34  ? 118 GLY A N      1 
ATOM   1735 C CA     . GLY A 1 118 ? 12.949  62.443 62.772 1.00 64.40  ? 118 GLY A CA     1 
ATOM   1736 C C      . GLY A 1 118 ? 13.692  61.339 62.046 1.00 61.35  ? 118 GLY A C      1 
ATOM   1737 O O      . GLY A 1 118 ? 13.550  61.189 60.829 1.00 62.68  ? 118 GLY A O      1 
ATOM   1738 H H      . GLY A 1 118 ? 12.892  62.488 64.736 1.00 89.49  ? 118 GLY A H      1 
ATOM   1739 H HA2    . GLY A 1 118 ? 12.011  62.199 62.820 1.00 92.22  ? 118 GLY A HA2    1 
ATOM   1740 H HA3    . GLY A 1 118 ? 13.026  63.257 62.249 1.00 92.22  ? 118 GLY A HA3    1 
ATOM   1741 N N      . VAL A 1 119 ? 14.488  60.563 62.780 1.00 57.39  ? 119 VAL A N      1 
ATOM   1742 C CA     . VAL A 1 119 ? 15.207  59.413 62.235 1.00 57.87  ? 119 VAL A CA     1 
ATOM   1743 C C      . VAL A 1 119 ? 14.656  58.158 62.894 1.00 56.67  ? 119 VAL A C      1 
ATOM   1744 O O      . VAL A 1 119 ? 14.653  58.044 64.127 1.00 56.01  ? 119 VAL A O      1 
ATOM   1745 C CB     . VAL A 1 119 ? 16.724  59.522 62.456 1.00 59.33  ? 119 VAL A CB     1 
ATOM   1746 C CG1    . VAL A 1 119 ? 17.442  58.322 61.837 1.00 60.71  ? 119 VAL A CG1    1 
ATOM   1747 C CG2    . VAL A 1 119 ? 17.260  60.819 61.871 1.00 61.19  ? 119 VAL A CG2    1 
ATOM   1748 H H      . VAL A 1 119 ? 14.631  60.686 63.619 1.00 57.67  ? 119 VAL A H      1 
ATOM   1749 H HA     . VAL A 1 119 ? 15.042  59.355 61.281 1.00 59.54  ? 119 VAL A HA     1 
ATOM   1750 H HB     . VAL A 1 119 ? 16.907  59.523 63.409 1.00 62.75  ? 119 VAL A HB     1 
ATOM   1751 H HG11   . VAL A 1 119 ? 18.396  58.412 61.989 1.00 66.65  ? 119 VAL A HG11   1 
ATOM   1752 H HG12   . VAL A 1 119 ? 17.115  57.510 62.254 1.00 66.65  ? 119 VAL A HG12   1 
ATOM   1753 H HG13   . VAL A 1 119 ? 17.259  58.302 60.884 1.00 66.65  ? 119 VAL A HG13   1 
ATOM   1754 H HG21   . VAL A 1 119 ? 18.217  60.863 62.024 1.00 64.19  ? 119 VAL A HG21   1 
ATOM   1755 H HG22   . VAL A 1 119 ? 17.075  60.835 60.919 1.00 64.19  ? 119 VAL A HG22   1 
ATOM   1756 H HG23   . VAL A 1 119 ? 16.820  61.567 62.306 1.00 64.19  ? 119 VAL A HG23   1 
ATOM   1757 N N      . SER A 1 120 ? 14.202  57.216 62.074 1.00 61.56  ? 120 SER A N      1 
ATOM   1758 C CA     . SER A 1 120 ? 13.675  55.943 62.542 1.00 60.02  ? 120 SER A CA     1 
ATOM   1759 C C      . SER A 1 120 ? 14.627  54.826 62.143 1.00 61.73  ? 120 SER A C      1 
ATOM   1760 O O      . SER A 1 120 ? 15.051  54.749 60.985 1.00 64.36  ? 120 SER A O      1 
ATOM   1761 C CB     . SER A 1 120 ? 12.282  55.682 61.966 1.00 61.51  ? 120 SER A CB     1 
ATOM   1762 O OG     . SER A 1 120 ? 11.763  54.448 62.430 1.00 60.20  ? 120 SER A OG     1 
ATOM   1763 H H      . SER A 1 120 ? 14.189  57.296 61.218 1.00 56.73  ? 120 SER A H      1 
ATOM   1764 H HA     . SER A 1 120 ? 13.608  55.958 63.510 1.00 57.93  ? 120 SER A HA     1 
ATOM   1765 H HB2    . SER A 1 120 ? 11.688  56.397 62.241 1.00 64.95  ? 120 SER A HB2    1 
ATOM   1766 H HB3    . SER A 1 120 ? 12.342  55.654 60.998 1.00 64.95  ? 120 SER A HB3    1 
ATOM   1767 H HG     . SER A 1 120 ? 10.999  54.318 62.106 1.00 69.86  ? 120 SER A HG     1 
ATOM   1768 N N      . VAL A 1 121 ? 14.964  53.971 63.105 1.00 47.93  ? 121 VAL A N      1 
ATOM   1769 C CA     . VAL A 1 121 ? 15.785  52.789 62.875 1.00 49.92  ? 121 VAL A CA     1 
ATOM   1770 C C      . VAL A 1 121 ? 14.970  51.569 63.274 1.00 45.16  ? 121 VAL A C      1 
ATOM   1771 O O      . VAL A 1 121 ? 14.402  51.528 64.373 1.00 42.28  ? 121 VAL A O      1 
ATOM   1772 C CB     . VAL A 1 121 ? 17.103  52.846 63.669 1.00 53.36  ? 121 VAL A CB     1 
ATOM   1773 C CG1    . VAL A 1 121 ? 17.971  51.629 63.353 1.00 55.48  ? 121 VAL A CG1    1 
ATOM   1774 C CG2    . VAL A 1 121 ? 17.849  54.134 63.365 1.00 56.72  ? 121 VAL A CG2    1 
ATOM   1775 H H      . VAL A 1 121 ? 14.720  54.060 63.925 1.00 51.50  ? 121 VAL A H      1 
ATOM   1776 H HA     . VAL A 1 121 ? 15.998  52.722 61.931 1.00 57.89  ? 121 VAL A HA     1 
ATOM   1777 H HB     . VAL A 1 121 ? 16.902  52.833 64.618 1.00 62.83  ? 121 VAL A HB     1 
ATOM   1778 H HG11   . VAL A 1 121 ? 18.794  51.687 63.863 1.00 66.65  ? 121 VAL A HG11   1 
ATOM   1779 H HG12   . VAL A 1 121 ? 17.487  50.825 63.596 1.00 66.65  ? 121 VAL A HG12   1 
ATOM   1780 H HG13   . VAL A 1 121 ? 18.170  51.622 62.403 1.00 66.65  ? 121 VAL A HG13   1 
ATOM   1781 H HG21   . VAL A 1 121 ? 18.674  54.149 63.874 1.00 63.28  ? 121 VAL A HG21   1 
ATOM   1782 H HG22   . VAL A 1 121 ? 18.045  54.168 62.415 1.00 63.28  ? 121 VAL A HG22   1 
ATOM   1783 H HG23   . VAL A 1 121 ? 17.291  54.888 63.615 1.00 63.28  ? 121 VAL A HG23   1 
ATOM   1784 N N      . THR A 1 122 ? 14.912  50.580 62.386 1.00 53.85  ? 122 THR A N      1 
ATOM   1785 C CA     . THR A 1 122 ? 14.136  49.372 62.623 1.00 49.53  ? 122 THR A CA     1 
ATOM   1786 C C      . THR A 1 122 ? 15.004  48.147 62.384 1.00 50.16  ? 122 THR A C      1 
ATOM   1787 O O      . THR A 1 122 ? 15.759  48.088 61.408 1.00 52.60  ? 122 THR A O      1 
ATOM   1788 C CB     . THR A 1 122 ? 12.896  49.315 61.721 1.00 47.69  ? 122 THR A CB     1 
ATOM   1789 O OG1    . THR A 1 122 ? 13.295  49.369 60.347 1.00 50.42  ? 122 THR A OG1    1 
ATOM   1790 C CG2    . THR A 1 122 ? 11.959  50.474 62.020 1.00 47.25  ? 122 THR A CG2    1 
ATOM   1791 H H      . THR A 1 122 ? 15.321  50.587 61.630 1.00 62.90  ? 122 THR A H      1 
ATOM   1792 H HA     . THR A 1 122 ? 13.840  49.359 63.546 1.00 61.34  ? 122 THR A HA     1 
ATOM   1793 H HB     . THR A 1 122 ? 12.418  48.486 61.884 1.00 60.37  ? 122 THR A HB     1 
ATOM   1794 H HG1    . THR A 1 122 ? 12.618  49.338 59.850 1.00 62.12  ? 122 THR A HG1    1 
ATOM   1795 H HG21   . THR A 1 122 ? 11.179  50.428 61.444 1.00 56.55  ? 122 THR A HG21   1 
ATOM   1796 H HG22   . THR A 1 122 ? 11.670  50.437 62.945 1.00 56.55  ? 122 THR A HG22   1 
ATOM   1797 H HG23   . THR A 1 122 ? 12.414  51.317 61.866 1.00 56.55  ? 122 THR A HG23   1 
ATOM   1798 N N      . ILE A 1 123 ? 14.889  47.175 63.285 1.00 44.93  ? 123 ILE A N      1 
ATOM   1799 C CA     . ILE A 1 123 ? 15.608  45.908 63.202 1.00 47.07  ? 123 ILE A CA     1 
ATOM   1800 C C      . ILE A 1 123 ? 14.561  44.810 63.090 1.00 44.89  ? 123 ILE A C      1 
ATOM   1801 O O      . ILE A 1 123 ? 13.770  44.608 64.019 1.00 42.74  ? 123 ILE A O      1 
ATOM   1802 C CB     . ILE A 1 123 ? 16.511  45.682 64.425 1.00 50.47  ? 123 ILE A CB     1 
ATOM   1803 C CG1    . ILE A 1 123 ? 17.304  46.951 64.766 1.00 52.33  ? 123 ILE A CG1    1 
ATOM   1804 C CG2    . ILE A 1 123 ? 17.454  44.514 64.183 1.00 54.42  ? 123 ILE A CG2    1 
ATOM   1805 C CD1    . ILE A 1 123 ? 18.242  47.424 63.675 1.00 55.52  ? 123 ILE A CD1    1 
ATOM   1806 H H      . ILE A 1 123 ? 14.382  47.229 63.977 1.00 52.09  ? 123 ILE A H      1 
ATOM   1807 H HA     . ILE A 1 123 ? 16.157  45.897 62.403 1.00 54.49  ? 123 ILE A HA     1 
ATOM   1808 H HB     . ILE A 1 123 ? 15.947  45.464 65.183 1.00 57.20  ? 123 ILE A HB     1 
ATOM   1809 H HG12   . ILE A 1 123 ? 16.677  47.669 64.945 1.00 55.53  ? 123 ILE A HG12   1 
ATOM   1810 H HG13   . ILE A 1 123 ? 17.838  46.779 65.557 1.00 55.53  ? 123 ILE A HG13   1 
ATOM   1811 H HG21   . ILE A 1 123 ? 18.012  44.391 64.967 1.00 63.21  ? 123 ILE A HG21   1 
ATOM   1812 H HG22   . ILE A 1 123 ? 16.930  43.714 64.021 1.00 63.21  ? 123 ILE A HG22   1 
ATOM   1813 H HG23   . ILE A 1 123 ? 18.007  44.710 63.410 1.00 63.21  ? 123 ILE A HG23   1 
ATOM   1814 H HD11   . ILE A 1 123 ? 18.697  48.226 63.976 1.00 56.39  ? 123 ILE A HD11   1 
ATOM   1815 H HD12   . ILE A 1 123 ? 18.889  46.725 63.490 1.00 56.39  ? 123 ILE A HD12   1 
ATOM   1816 H HD13   . ILE A 1 123 ? 17.725  47.616 62.877 1.00 56.39  ? 123 ILE A HD13   1 
ATOM   1817 N N      . SER A 1 124 ? 14.550  44.107 61.958 1.00 53.80  ? 124 SER A N      1 
ATOM   1818 C CA     . SER A 1 124 ? 13.535  43.102 61.678 1.00 52.28  ? 124 SER A CA     1 
ATOM   1819 C C      . SER A 1 124 ? 14.185  41.773 61.322 1.00 53.60  ? 124 SER A C      1 
ATOM   1820 O O      . SER A 1 124 ? 15.303  41.723 60.798 1.00 55.73  ? 124 SER A O      1 
ATOM   1821 C CB     . SER A 1 124 ? 12.610  43.540 60.531 1.00 52.43  ? 124 SER A CB     1 
ATOM   1822 O OG     . SER A 1 124 ? 11.873  44.699 60.879 1.00 52.04  ? 124 SER A OG     1 
ATOM   1823 H H      . SER A 1 124 ? 15.130  44.198 61.329 1.00 65.02  ? 124 SER A H      1 
ATOM   1824 H HA     . SER A 1 124 ? 12.991  42.970 62.471 1.00 66.82  ? 124 SER A HA     1 
ATOM   1825 H HB2    . SER A 1 124 ? 13.149  43.734 59.749 1.00 70.83  ? 124 SER A HB2    1 
ATOM   1826 H HB3    . SER A 1 124 ? 11.990  42.820 60.335 1.00 70.83  ? 124 SER A HB3    1 
ATOM   1827 H HG     . SER A 1 124 ? 11.374  44.924 60.242 1.00 71.66  ? 124 SER A HG     1 
ATOM   1828 N N      . GLY A 1 125 ? 13.464  40.696 61.606 1.00 40.69  ? 125 GLY A N      1 
ATOM   1829 C CA     . GLY A 1 125 ? 13.925  39.363 61.275 1.00 43.42  ? 125 GLY A CA     1 
ATOM   1830 C C      . GLY A 1 125 ? 13.004  38.326 61.872 1.00 43.96  ? 125 GLY A C      1 
ATOM   1831 O O      . GLY A 1 125 ? 12.141  38.623 62.704 1.00 42.17  ? 125 GLY A O      1 
ATOM   1832 H H      . GLY A 1 125 ? 12.697  40.715 61.994 1.00 52.03  ? 125 GLY A H      1 
ATOM   1833 H HA2    . GLY A 1 125 ? 13.943  39.249 60.312 1.00 57.16  ? 125 GLY A HA2    1 
ATOM   1834 H HA3    . GLY A 1 125 ? 14.820  39.227 61.624 1.00 57.16  ? 125 GLY A HA3    1 
ATOM   1835 N N      . GLY A 1 126 ? 13.201  37.089 61.426 1.00 47.12  ? 126 GLY A N      1 
ATOM   1836 C CA     . GLY A 1 126 ? 12.396  35.997 61.935 1.00 48.50  ? 126 GLY A CA     1 
ATOM   1837 C C      . GLY A 1 126 ? 12.643  35.760 63.412 1.00 47.59  ? 126 GLY A C      1 
ATOM   1838 O O      . GLY A 1 126 ? 13.735  35.994 63.931 1.00 47.31  ? 126 GLY A O      1 
ATOM   1839 H H      . GLY A 1 126 ? 13.787  36.863 60.838 1.00 62.75  ? 126 GLY A H      1 
ATOM   1840 H HA2    . GLY A 1 126 ? 11.456  36.198 61.807 1.00 66.01  ? 126 GLY A HA2    1 
ATOM   1841 H HA3    . GLY A 1 126 ? 12.608  35.183 61.451 1.00 66.01  ? 126 GLY A HA3    1 
ATOM   1842 N N      . SER A 1 127 ? 11.603  35.280 64.097 1.00 48.75  ? 127 SER A N      1 
ATOM   1843 C CA     . SER A 1 127 ? 11.688  35.064 65.537 1.00 49.28  ? 127 SER A CA     1 
ATOM   1844 C C      . SER A 1 127 ? 12.809  34.104 65.917 1.00 52.20  ? 127 SER A C      1 
ATOM   1845 O O      . SER A 1 127 ? 13.184  34.045 67.094 1.00 52.94  ? 127 SER A O      1 
ATOM   1846 C CB     . SER A 1 127 ? 10.353  34.536 66.066 1.00 49.29  ? 127 SER A CB     1 
ATOM   1847 O OG     . SER A 1 127 ? 9.995   33.327 65.424 1.00 52.65  ? 127 SER A OG     1 
ATOM   1848 H H      . SER A 1 127 ? 10.843  35.073 63.751 1.00 68.61  ? 127 SER A H      1 
ATOM   1849 H HA     . SER A 1 127 ? 11.865  35.913 65.970 1.00 70.83  ? 127 SER A HA     1 
ATOM   1850 H HB2    . SER A 1 127 ? 10.433  34.376 67.019 1.00 72.64  ? 127 SER A HB2    1 
ATOM   1851 H HB3    . SER A 1 127 ? 9.664   35.198 65.898 1.00 72.64  ? 127 SER A HB3    1 
ATOM   1852 H HG     . SER A 1 127 ? 9.261   33.049 65.724 1.00 77.05  ? 127 SER A HG     1 
ATOM   1853 N N      . ARG A 1 128 ? 13.352  33.353 64.958 1.00 59.42  ? 128 ARG A N      1 
ATOM   1854 C CA     . ARG A 1 128 ? 14.470  32.464 65.249 1.00 62.90  ? 128 ARG A CA     1 
ATOM   1855 C C      . ARG A 1 128 ? 15.793  33.206 65.364 1.00 63.50  ? 128 ARG A C      1 
ATOM   1856 O O      . ARG A 1 128 ? 16.763  32.639 65.879 1.00 66.56  ? 128 ARG A O      1 
ATOM   1857 C CB     . ARG A 1 128 ? 14.584  31.385 64.173 1.00 66.93  ? 128 ARG A CB     1 
ATOM   1858 C CG     . ARG A 1 128 ? 13.462  30.365 64.220 1.00 69.30  ? 128 ARG A CG     1 
ATOM   1859 C CD     . ARG A 1 128 ? 13.375  29.562 62.936 1.00 73.17  ? 128 ARG A CD     1 
ATOM   1860 N NE     . ARG A 1 128 ? 12.304  28.573 62.988 1.00 76.03  ? 128 ARG A NE     1 
ATOM   1861 C CZ     . ARG A 1 128 ? 11.798  27.958 61.924 1.00 79.34  ? 128 ARG A CZ     1 
ATOM   1862 N NH1    . ARG A 1 128 ? 12.257  28.232 60.709 1.00 80.31  ? 128 ARG A NH1    1 
ATOM   1863 N NH2    . ARG A 1 128 ? 10.824  27.072 62.073 1.00 82.29  ? 128 ARG A NH2    1 
ATOM   1864 H H      . ARG A 1 128 ? 13.092  33.341 64.138 1.00 80.03  ? 128 ARG A H      1 
ATOM   1865 H HA     . ARG A 1 128 ? 14.304  32.021 66.096 1.00 86.42  ? 128 ARG A HA     1 
ATOM   1866 H HB2    . ARG A 1 128 ? 14.566  31.808 63.300 1.00 91.24  ? 128 ARG A HB2    1 
ATOM   1867 H HB3    . ARG A 1 128 ? 15.423  30.911 64.292 1.00 91.24  ? 128 ARG A HB3    1 
ATOM   1868 H HG2    . ARG A 1 128 ? 13.621  29.749 64.952 1.00 94.74  ? 128 ARG A HG2    1 
ATOM   1869 H HG3    . ARG A 1 128 ? 12.618  30.825 64.347 1.00 94.74  ? 128 ARG A HG3    1 
ATOM   1870 H HD2    . ARG A 1 128 ? 13.198  30.163 62.196 1.00 98.31  ? 128 ARG A HD2    1 
ATOM   1871 H HD3    . ARG A 1 128 ? 14.213  29.094 62.795 1.00 98.31  ? 128 ARG A HD3    1 
ATOM   1872 H HE     . ARG A 1 128 ? 11.978  28.374 63.759 1.00 102.15 ? 128 ARG A HE     1 
ATOM   1873 H HH11   . ARG A 1 128 ? 12.888  28.807 60.607 1.00 117.60 ? 128 ARG A HH11   1 
ATOM   1874 H HH12   . ARG A 1 128 ? 11.924  27.832 60.024 1.00 117.60 ? 128 ARG A HH12   1 
ATOM   1875 H HH21   . ARG A 1 128 ? 10.523  26.893 62.859 1.00 122.15 ? 128 ARG A HH21   1 
ATOM   1876 H HH22   . ARG A 1 128 ? 10.494  26.675 61.385 1.00 122.15 ? 128 ARG A HH22   1 
ATOM   1877 N N      . THR A 1 129 ? 15.859  34.449 64.888 1.00 63.93  ? 129 THR A N      1 
ATOM   1878 C CA     . THR A 1 129 ? 17.052  35.275 65.008 1.00 64.64  ? 129 THR A CA     1 
ATOM   1879 C C      . THR A 1 129 ? 16.888  36.361 66.064 1.00 62.43  ? 129 THR A C      1 
ATOM   1880 O O      . THR A 1 129 ? 17.605  37.366 66.032 1.00 63.01  ? 129 THR A O      1 
ATOM   1881 C CB     . THR A 1 129 ? 17.404  35.903 63.657 1.00 65.16  ? 129 THR A CB     1 
ATOM   1882 O OG1    . THR A 1 129 ? 16.307  36.699 63.190 1.00 61.99  ? 129 THR A OG1    1 
ATOM   1883 C CG2    . THR A 1 129 ? 17.725  34.824 62.628 1.00 68.59  ? 129 THR A CG2    1 
ATOM   1884 H H      . THR A 1 129 ? 15.209  34.841 64.484 1.00 82.62  ? 129 THR A H      1 
ATOM   1885 H HA     . THR A 1 129 ? 17.796  34.712 65.276 1.00 81.80  ? 129 THR A HA     1 
ATOM   1886 H HB     . THR A 1 129 ? 18.187  36.466 63.760 1.00 82.34  ? 129 THR A HB     1 
ATOM   1887 H HG1    . THR A 1 129 ? 15.622  36.221 63.099 1.00 77.18  ? 129 THR A HG1    1 
ATOM   1888 H HG21   . THR A 1 129 ? 17.946  35.233 61.777 1.00 89.34  ? 129 THR A HG21   1 
ATOM   1889 H HG22   . THR A 1 129 ? 18.480  34.293 62.928 1.00 89.34  ? 129 THR A HG22   1 
ATOM   1890 H HG23   . THR A 1 129 ? 16.958  34.242 62.508 1.00 89.34  ? 129 THR A HG23   1 
ATOM   1891 N N      . LEU A 1 130 ? 15.958  36.175 67.005 1.00 58.96  ? 130 LEU A N      1 
ATOM   1892 C CA     . LEU A 1 130 ? 15.690  37.207 68.001 1.00 58.05  ? 130 LEU A CA     1 
ATOM   1893 C C      . LEU A 1 130 ? 16.950  37.550 68.787 1.00 59.94  ? 130 LEU A C      1 
ATOM   1894 O O      . LEU A 1 130 ? 17.297  38.726 68.943 1.00 59.85  ? 130 LEU A O      1 
ATOM   1895 C CB     . LEU A 1 130 ? 14.574  36.750 68.940 1.00 57.31  ? 130 LEU A CB     1 
ATOM   1896 C CG     . LEU A 1 130 ? 14.165  37.743 70.030 1.00 56.32  ? 130 LEU A CG     1 
ATOM   1897 C CD1    . LEU A 1 130 ? 13.629  39.035 69.426 1.00 54.17  ? 130 LEU A CD1    1 
ATOM   1898 C CD2    . LEU A 1 130 ? 13.136  37.117 70.947 1.00 57.01  ? 130 LEU A CD2    1 
ATOM   1899 H H      . LEU A 1 130 ? 15.476  35.468 67.085 1.00 85.31  ? 130 LEU A H      1 
ATOM   1900 H HA     . LEU A 1 130 ? 15.391  38.012 67.549 1.00 83.24  ? 130 LEU A HA     1 
ATOM   1901 H HB2    . LEU A 1 130 ? 13.785  36.563 68.408 1.00 87.49  ? 130 LEU A HB2    1 
ATOM   1902 H HB3    . LEU A 1 130 ? 14.863  35.937 69.384 1.00 87.49  ? 130 LEU A HB3    1 
ATOM   1903 H HG     . LEU A 1 130 ? 14.945  37.964 70.563 1.00 87.05  ? 130 LEU A HG     1 
ATOM   1904 H HD11   . LEU A 1 130 ? 13.380  39.639 70.144 1.00 78.50  ? 130 LEU A HD11   1 
ATOM   1905 H HD12   . LEU A 1 130 ? 14.320  39.438 68.878 1.00 78.50  ? 130 LEU A HD12   1 
ATOM   1906 H HD13   . LEU A 1 130 ? 12.852  38.830 68.882 1.00 78.50  ? 130 LEU A HD13   1 
ATOM   1907 H HD21   . LEU A 1 130 ? 12.889  37.760 71.630 1.00 93.67  ? 130 LEU A HD21   1 
ATOM   1908 H HD22   . LEU A 1 130 ? 12.356  36.872 70.425 1.00 93.67  ? 130 LEU A HD22   1 
ATOM   1909 H HD23   . LEU A 1 130 ? 13.519  36.327 71.359 1.00 93.67  ? 130 LEU A HD23   1 
ATOM   1910 N N      . GLN A 1 131 ? 17.651  36.530 69.291 1.00 73.66  ? 131 GLN A N      1 
ATOM   1911 C CA     . GLN A 1 131 ? 18.897  36.768 70.012 1.00 75.13  ? 131 GLN A CA     1 
ATOM   1912 C C      . GLN A 1 131 ? 19.834  37.672 69.224 1.00 75.84  ? 131 GLN A C      1 
ATOM   1913 O O      . GLN A 1 131 ? 20.605  38.437 69.815 1.00 77.08  ? 131 GLN A O      1 
ATOM   1914 C CB     . GLN A 1 131 ? 19.585  35.437 70.315 1.00 78.44  ? 131 GLN A CB     1 
ATOM   1915 C CG     . GLN A 1 131 ? 20.065  34.699 69.074 1.00 80.15  ? 131 GLN A CG     1 
ATOM   1916 C CD     . GLN A 1 131 ? 20.379  33.241 69.342 1.00 84.24  ? 131 GLN A CD     1 
ATOM   1917 O OE1    . GLN A 1 131 ? 21.365  32.915 70.004 1.00 87.75  ? 131 GLN A OE1    1 
ATOM   1918 N NE2    . GLN A 1 131 ? 19.537  32.352 68.828 1.00 84.23  ? 131 GLN A NE2    1 
ATOM   1919 H H      . GLN A 1 131 ? 17.427  35.702 69.228 1.00 96.02  ? 131 GLN A H      1 
ATOM   1920 H HA     . GLN A 1 131 ? 18.697  37.203 70.855 1.00 95.59  ? 131 GLN A HA     1 
ATOM   1921 H HB2    . GLN A 1 131 ? 20.358  35.605 70.878 1.00 103.66 ? 131 GLN A HB2    1 
ATOM   1922 H HB3    . GLN A 1 131 ? 18.959  34.860 70.780 1.00 103.66 ? 131 GLN A HB3    1 
ATOM   1923 H HG2    . GLN A 1 131 ? 19.371  34.737 68.397 1.00 105.04 ? 131 GLN A HG2    1 
ATOM   1924 H HG3    . GLN A 1 131 ? 20.872  35.125 68.746 1.00 105.04 ? 131 GLN A HG3    1 
ATOM   1925 H HE21   . GLN A 1 131 ? 18.857  32.617 68.371 1.00 116.08 ? 131 GLN A HE21   1 
ATOM   1926 H HE22   . GLN A 1 131 ? 19.670  31.511 68.951 1.00 116.08 ? 131 GLN A HE22   1 
ATOM   1927 N N      . HIS A 1 132 ? 19.781  37.603 67.893 1.00 57.55  ? 132 HIS A N      1 
ATOM   1928 C CA     . HIS A 1 132 ? 20.640  38.438 67.062 1.00 58.22  ? 132 HIS A CA     1 
ATOM   1929 C C      . HIS A 1 132 ? 20.060  39.838 66.893 1.00 55.28  ? 132 HIS A C      1 
ATOM   1930 O O      . HIS A 1 132 ? 20.804  40.825 66.913 1.00 55.97  ? 132 HIS A O      1 
ATOM   1931 C CB     . HIS A 1 132 ? 20.849  37.773 65.702 1.00 59.78  ? 132 HIS A CB     1 
ATOM   1932 C CG     . HIS A 1 132 ? 21.295  36.346 65.794 1.00 63.16  ? 132 HIS A CG     1 
ATOM   1933 N ND1    . HIS A 1 132 ? 20.412  35.299 65.948 1.00 62.88  ? 132 HIS A ND1    1 
ATOM   1934 C CD2    . HIS A 1 132 ? 22.531  35.793 65.764 1.00 67.25  ? 132 HIS A CD2    1 
ATOM   1935 C CE1    . HIS A 1 132 ? 21.084  34.162 66.003 1.00 66.85  ? 132 HIS A CE1    1 
ATOM   1936 N NE2    . HIS A 1 132 ? 22.372  34.435 65.894 1.00 69.37  ? 132 HIS A NE2    1 
ATOM   1937 H H      . HIS A 1 132 ? 19.257  37.083 67.451 1.00 77.59  ? 132 HIS A H      1 
ATOM   1938 H HA     . HIS A 1 132 ? 21.506  38.523 67.491 1.00 75.02  ? 132 HIS A HA     1 
ATOM   1939 H HB2    . HIS A 1 132 ? 20.013  37.792 65.212 1.00 76.77  ? 132 HIS A HB2    1 
ATOM   1940 H HB3    . HIS A 1 132 ? 21.528  38.265 65.214 1.00 76.77  ? 132 HIS A HB3    1 
ATOM   1941 H HD2    . HIS A 1 132 ? 23.337  36.248 65.670 1.00 90.95  ? 132 HIS A HD2    1 
ATOM   1942 H HE1    . HIS A 1 132 ? 20.713  33.315 66.102 1.00 94.59  ? 132 HIS A HE1    1 
ATOM   1943 H HE2    . HIS A 1 132 ? 23.007  33.855 65.903 1.00 97.23  ? 132 HIS A HE2    1 
ATOM   1944 N N      . LEU A 1 133 ? 18.740  39.946 66.728 1.00 55.57  ? 133 LEU A N      1 
ATOM   1945 C CA     . LEU A 1 133 ? 18.115  41.262 66.658 1.00 54.52  ? 133 LEU A CA     1 
ATOM   1946 C C      . LEU A 1 133 ? 18.421  42.076 67.908 1.00 56.09  ? 133 LEU A C      1 
ATOM   1947 O O      . LEU A 1 133 ? 18.624  43.293 67.831 1.00 55.74  ? 133 LEU A O      1 
ATOM   1948 C CB     . LEU A 1 133 ? 16.604  41.122 66.474 1.00 51.77  ? 133 LEU A CB     1 
ATOM   1949 C CG     . LEU A 1 133 ? 16.114  40.244 65.320 1.00 50.95  ? 133 LEU A CG     1 
ATOM   1950 C CD1    . LEU A 1 133 ? 14.598  40.304 65.223 1.00 48.21  ? 133 LEU A CD1    1 
ATOM   1951 C CD2    . LEU A 1 133 ? 16.749  40.646 64.000 1.00 51.59  ? 133 LEU A CD2    1 
ATOM   1952 H H      . LEU A 1 133 ? 18.196  39.284 66.655 1.00 73.43  ? 133 LEU A H      1 
ATOM   1953 H HA     . LEU A 1 133 ? 18.469  41.741 65.892 1.00 69.59  ? 133 LEU A HA     1 
ATOM   1954 H HB2    . LEU A 1 133 ? 16.235  40.750 67.291 1.00 68.00  ? 133 LEU A HB2    1 
ATOM   1955 H HB3    . LEU A 1 133 ? 16.235  42.008 66.334 1.00 68.00  ? 133 LEU A HB3    1 
ATOM   1956 H HG     . LEU A 1 133 ? 16.363  39.324 65.500 1.00 71.05  ? 133 LEU A HG     1 
ATOM   1957 H HD11   . LEU A 1 133 ? 14.307  39.743 64.488 1.00 69.82  ? 133 LEU A HD11   1 
ATOM   1958 H HD12   . LEU A 1 133 ? 14.216  39.985 66.056 1.00 69.82  ? 133 LEU A HD12   1 
ATOM   1959 H HD13   . LEU A 1 133 ? 14.329  41.223 65.066 1.00 69.82  ? 133 LEU A HD13   1 
ATOM   1960 H HD21   . LEU A 1 133 ? 16.412  40.067 63.299 1.00 70.58  ? 133 LEU A HD21   1 
ATOM   1961 H HD22   . LEU A 1 133 ? 16.517  41.568 63.807 1.00 70.58  ? 133 LEU A HD22   1 
ATOM   1962 H HD23   . LEU A 1 133 ? 17.712  40.555 64.072 1.00 70.58  ? 133 LEU A HD23   1 
ATOM   1963 N N      . CYS A 1 134 ? 18.461  41.421 69.070 1.00 61.21  ? 134 CYS A N      1 
ATOM   1964 C CA     . CYS A 1 134 ? 18.707  42.130 70.321 1.00 62.91  ? 134 CYS A CA     1 
ATOM   1965 C C      . CYS A 1 134 ? 20.071  42.808 70.308 1.00 66.32  ? 134 CYS A C      1 
ATOM   1966 O O      . CYS A 1 134 ? 20.169  44.038 70.386 1.00 67.03  ? 134 CYS A O      1 
ATOM   1967 C CB     . CYS A 1 134 ? 18.596  41.161 71.497 1.00 63.61  ? 134 CYS A CB     1 
ATOM   1968 S SG     . CYS A 1 134 ? 16.931  40.516 71.753 1.00 61.02  ? 134 CYS A SG     1 
ATOM   1969 H H      . CYS A 1 134 ? 18.351  40.573 69.157 1.00 70.49  ? 134 CYS A H      1 
ATOM   1970 H HA     . CYS A 1 134 ? 18.031  42.817 70.433 1.00 77.71  ? 134 CYS A HA     1 
ATOM   1971 H HB2    . CYS A 1 134 ? 19.184  40.406 71.337 1.00 86.46  ? 134 CYS A HB2    1 
ATOM   1972 H HB3    . CYS A 1 134 ? 18.864  41.621 72.308 1.00 86.46  ? 134 CYS A HB3    1 
ATOM   1973 H HG     . CYS A 1 134 ? 16.583  39.929 70.767 1.00 88.03  ? 134 CYS A HG     1 
ATOM   1974 N N      . GLU A 1 135 ? 21.142  42.015 70.219 1.00 66.39  ? 135 GLU A N      1 
ATOM   1975 C CA     . GLU A 1 135 ? 22.487  42.582 70.193 1.00 68.36  ? 135 GLU A CA     1 
ATOM   1976 C C      . GLU A 1 135 ? 22.605  43.672 69.135 1.00 68.34  ? 135 GLU A C      1 
ATOM   1977 O O      . GLU A 1 135 ? 23.288  44.681 69.344 1.00 69.88  ? 135 GLU A O      1 
ATOM   1978 C CB     . GLU A 1 135 ? 23.516  41.478 69.941 1.00 70.58  ? 135 GLU A CB     1 
ATOM   1979 C CG     . GLU A 1 135 ? 23.951  40.718 71.194 1.00 71.50  ? 135 GLU A CG     1 
ATOM   1980 C CD     . GLU A 1 135 ? 22.837  39.888 71.810 1.00 68.95  ? 135 GLU A CD     1 
ATOM   1981 O OE1    . GLU A 1 135 ? 21.659  40.107 71.457 1.00 65.78  ? 135 GLU A OE1    1 
ATOM   1982 O OE2    . GLU A 1 135 ? 23.143  39.014 72.649 1.00 70.62  ? 135 GLU A OE2    1 
ATOM   1983 H H      . GLU A 1 135 ? 21.116  41.156 70.174 1.00 89.07  ? 135 GLU A H      1 
ATOM   1984 H HA     . GLU A 1 135 ? 22.679  42.980 71.056 1.00 88.78  ? 135 GLU A HA     1 
ATOM   1985 H HB2    . GLU A 1 135 ? 23.135  40.835 69.323 1.00 93.60  ? 135 GLU A HB2    1 
ATOM   1986 H HB3    . GLU A 1 135 ? 24.308  41.877 69.549 1.00 93.60  ? 135 GLU A HB3    1 
ATOM   1987 H HG2    . GLU A 1 135 ? 24.676  40.117 70.961 1.00 98.55  ? 135 GLU A HG2    1 
ATOM   1988 H HG3    . GLU A 1 135 ? 24.251  41.356 71.860 1.00 98.55  ? 135 GLU A HG3    1 
ATOM   1989 N N      . MET A 1 136 ? 21.942  43.488 67.993 1.00 69.24  ? 136 MET A N      1 
ATOM   1990 C CA     . MET A 1 136 ? 21.971  44.501 66.946 1.00 69.62  ? 136 MET A CA     1 
ATOM   1991 C C      . MET A 1 136 ? 21.060  45.677 67.270 1.00 67.57  ? 136 MET A C      1 
ATOM   1992 O O      . MET A 1 136 ? 21.343  46.807 66.857 1.00 68.85  ? 136 MET A O      1 
ATOM   1993 C CB     . MET A 1 136 ? 21.566  43.883 65.608 1.00 69.69  ? 136 MET A CB     1 
ATOM   1994 C CG     . MET A 1 136 ? 21.714  44.823 64.425 1.00 70.42  ? 136 MET A CG     1 
ATOM   1995 S SD     . MET A 1 136 ? 23.425  45.321 64.161 1.00 75.14  ? 136 MET A SD     1 
ATOM   1996 C CE     . MET A 1 136 ? 23.214  46.678 63.012 1.00 76.63  ? 136 MET A CE     1 
ATOM   1997 H H      . MET A 1 136 ? 21.473  42.793 67.804 1.00 90.84  ? 136 MET A H      1 
ATOM   1998 H HA     . MET A 1 136 ? 22.880  44.828 66.857 1.00 86.84  ? 136 MET A HA     1 
ATOM   1999 H HB2    . MET A 1 136 ? 22.123  43.107 65.441 1.00 89.36  ? 136 MET A HB2    1 
ATOM   2000 H HB3    . MET A 1 136 ? 20.635  43.614 65.657 1.00 89.36  ? 136 MET A HB3    1 
ATOM   2001 H HG2    . MET A 1 136 ? 21.402  44.375 63.623 1.00 87.04  ? 136 MET A HG2    1 
ATOM   2002 H HG3    . MET A 1 136 ? 21.188  45.622 64.587 1.00 87.04  ? 136 MET A HG3    1 
ATOM   2003 H HE1    . MET A 1 136 ? 24.085  47.039 62.788 1.00 91.25  ? 136 MET A HE1    1 
ATOM   2004 H HE2    . MET A 1 136 ? 22.776  46.348 62.212 1.00 91.25  ? 136 MET A HE2    1 
ATOM   2005 H HE3    . MET A 1 136 ? 22.668  47.362 63.430 1.00 91.25  ? 136 MET A HE3    1 
ATOM   2006 N N      . ALA A 1 137 ? 19.974  45.436 68.007 1.00 66.36  ? 137 ALA A N      1 
ATOM   2007 C CA     . ALA A 1 137 ? 19.030  46.503 68.314 1.00 64.41  ? 137 ALA A CA     1 
ATOM   2008 C C      . ALA A 1 137 ? 19.487  47.339 69.503 1.00 63.48  ? 137 ALA A C      1 
ATOM   2009 O O      . ALA A 1 137 ? 19.307  48.562 69.508 1.00 62.12  ? 137 ALA A O      1 
ATOM   2010 C CB     . ALA A 1 137 ? 17.647  45.913 68.587 1.00 60.74  ? 137 ALA A CB     1 
ATOM   2011 H H      . ALA A 1 137 ? 19.766  44.670 68.336 1.00 78.91  ? 137 ALA A H      1 
ATOM   2012 H HA     . ALA A 1 137 ? 18.958  47.091 67.546 1.00 77.17  ? 137 ALA A HA     1 
ATOM   2013 H HB1    . ALA A 1 137 ? 17.031  46.635 68.790 1.00 77.42  ? 137 ALA A HB1    1 
ATOM   2014 H HB2    . ALA A 1 137 ? 17.347  45.434 67.799 1.00 77.42  ? 137 ALA A HB2    1 
ATOM   2015 H HB3    . ALA A 1 137 ? 17.706  45.306 69.341 1.00 77.42  ? 137 ALA A HB3    1 
ATOM   2016 N N      . ILE A 1 138 ? 20.077  46.703 70.518 1.00 79.75  ? 138 ILE A N      1 
ATOM   2017 C CA     . ILE A 1 138 ? 20.456  47.432 71.726 1.00 79.41  ? 138 ILE A CA     1 
ATOM   2018 C C      . ILE A 1 138 ? 21.500  48.492 71.404 1.00 81.73  ? 138 ILE A C      1 
ATOM   2019 O O      . ILE A 1 138 ? 21.443  49.615 71.921 1.00 81.43  ? 138 ILE A O      1 
ATOM   2020 C CB     . ILE A 1 138 ? 20.953  46.459 72.813 1.00 80.87  ? 138 ILE A CB     1 
ATOM   2021 C CG1    . ILE A 1 138 ? 21.273  47.210 74.112 1.00 81.34  ? 138 ILE A CG1    1 
ATOM   2022 C CG2    . ILE A 1 138 ? 22.181  45.690 72.344 1.00 84.29  ? 138 ILE A CG2    1 
ATOM   2023 C CD1    . ILE A 1 138 ? 20.068  47.848 74.777 1.00 78.60  ? 138 ILE A CD1    1 
ATOM   2024 H H      . ILE A 1 138 ? 20.266  45.864 70.531 1.00 96.69  ? 138 ILE A H      1 
ATOM   2025 H HA     . ILE A 1 138 ? 19.672  47.887 72.073 1.00 97.97  ? 138 ILE A HA     1 
ATOM   2026 H HB     . ILE A 1 138 ? 20.246  45.821 72.997 1.00 104.35 ? 138 ILE A HB     1 
ATOM   2027 H HG12   . ILE A 1 138 ? 21.662  46.585 74.745 1.00 106.54 ? 138 ILE A HG12   1 
ATOM   2028 H HG13   . ILE A 1 138 ? 21.909  47.915 73.915 1.00 106.54 ? 138 ILE A HG13   1 
ATOM   2029 H HG21   . ILE A 1 138 ? 22.466  45.089 73.050 1.00 109.20 ? 138 ILE A HG21   1 
ATOM   2030 H HG22   . ILE A 1 138 ? 21.951  45.183 71.550 1.00 109.20 ? 138 ILE A HG22   1 
ATOM   2031 H HG23   . ILE A 1 138 ? 22.889  46.321 72.140 1.00 109.20 ? 138 ILE A HG23   1 
ATOM   2032 H HD11   . ILE A 1 138 ? 20.356  48.299 75.586 1.00 104.63 ? 138 ILE A HD11   1 
ATOM   2033 H HD12   . ILE A 1 138 ? 19.672  48.488 74.164 1.00 104.63 ? 138 ILE A HD12   1 
ATOM   2034 H HD13   . ILE A 1 138 ? 19.424  47.156 74.995 1.00 104.63 ? 138 ILE A HD13   1 
ATOM   2035 N N      . ARG A 1 139 ? 22.468  48.160 70.552 1.00 75.31  ? 139 ARG A N      1 
ATOM   2036 C CA     . ARG A 1 139 ? 23.519  49.113 70.227 1.00 77.43  ? 139 ARG A CA     1 
ATOM   2037 C C      . ARG A 1 139 ? 23.127  50.041 69.088 1.00 77.39  ? 139 ARG A C      1 
ATOM   2038 O O      . ARG A 1 139 ? 23.580  51.191 69.056 1.00 77.23  ? 139 ARG A O      1 
ATOM   2039 C CB     . ARG A 1 139 ? 24.819  48.380 69.884 1.00 80.67  ? 139 ARG A CB     1 
ATOM   2040 C CG     . ARG A 1 139 ? 24.807  47.635 68.564 1.00 82.39  ? 139 ARG A CG     1 
ATOM   2041 C CD     . ARG A 1 139 ? 26.064  46.791 68.409 1.00 86.13  ? 139 ARG A CD     1 
ATOM   2042 N NE     . ARG A 1 139 ? 27.245  47.440 68.976 1.00 88.75  ? 139 ARG A NE     1 
ATOM   2043 C CZ     . ARG A 1 139 ? 27.825  48.528 68.475 1.00 89.89  ? 139 ARG A CZ     1 
ATOM   2044 N NH1    . ARG A 1 139 ? 27.333  49.115 67.392 1.00 89.00  ? 139 ARG A NH1    1 
ATOM   2045 N NH2    . ARG A 1 139 ? 28.895  49.039 69.068 1.00 92.01  ? 139 ARG A NH2    1 
ATOM   2046 H H      . ARG A 1 139 ? 22.537  47.400 70.155 1.00 91.80  ? 139 ARG A H      1 
ATOM   2047 H HA     . ARG A 1 139 ? 23.690  49.663 71.007 1.00 93.40  ? 139 ARG A HA     1 
ATOM   2048 H HB2    . ARG A 1 139 ? 25.539  49.029 69.847 1.00 99.93  ? 139 ARG A HB2    1 
ATOM   2049 H HB3    . ARG A 1 139 ? 25.001  47.732 70.583 1.00 99.93  ? 139 ARG A HB3    1 
ATOM   2050 H HG2    . ARG A 1 139 ? 24.037  47.046 68.533 1.00 102.61 ? 139 ARG A HG2    1 
ATOM   2051 H HG3    . ARG A 1 139 ? 24.775  48.273 67.835 1.00 102.61 ? 139 ARG A HG3    1 
ATOM   2052 H HD2    . ARG A 1 139 ? 25.936  45.945 68.867 1.00 113.31 ? 139 ARG A HD2    1 
ATOM   2053 H HD3    . ARG A 1 139 ? 26.228  46.638 67.465 1.00 113.31 ? 139 ARG A HD3    1 
ATOM   2054 H HE     . ARG A 1 139 ? 27.590  47.093 69.683 1.00 120.20 ? 139 ARG A HE     1 
ATOM   2055 H HH11   . ARG A 1 139 ? 26.639  48.789 67.004 1.00 114.86 ? 139 ARG A HH11   1 
ATOM   2056 H HH12   . ARG A 1 139 ? 27.712  49.819 67.076 1.00 114.86 ? 139 ARG A HH12   1 
ATOM   2057 H HH21   . ARG A 1 139 ? 29.217  48.664 69.772 1.00 126.07 ? 139 ARG A HH21   1 
ATOM   2058 H HH22   . ARG A 1 139 ? 29.269  49.743 68.747 1.00 126.07 ? 139 ARG A HH22   1 
ATOM   2059 N N      . SER A 1 140 ? 22.294  49.577 68.152 1.00 70.31  ? 140 SER A N      1 
ATOM   2060 C CA     . SER A 1 140 ? 21.684  50.500 67.203 1.00 71.02  ? 140 SER A CA     1 
ATOM   2061 C C      . SER A 1 140 ? 20.927  51.603 67.929 1.00 67.35  ? 140 SER A C      1 
ATOM   2062 O O      . SER A 1 140 ? 20.891  52.747 67.463 1.00 67.25  ? 140 SER A O      1 
ATOM   2063 C CB     . SER A 1 140 ? 20.746  49.747 66.260 1.00 70.87  ? 140 SER A CB     1 
ATOM   2064 O OG     . SER A 1 140 ? 21.458  48.818 65.462 1.00 74.33  ? 140 SER A OG     1 
ATOM   2065 H H      . SER A 1 140 ? 22.072  48.753 68.050 1.00 85.93  ? 140 SER A H      1 
ATOM   2066 H HA     . SER A 1 140 ? 22.380  50.913 66.669 1.00 86.03  ? 140 SER A HA     1 
ATOM   2067 H HB2    . SER A 1 140 ? 20.087  49.269 66.788 1.00 87.48  ? 140 SER A HB2    1 
ATOM   2068 H HB3    . SER A 1 140 ? 20.303  50.386 65.680 1.00 87.48  ? 140 SER A HB3    1 
ATOM   2069 H HG     . SER A 1 140 ? 21.846  48.257 65.952 1.00 91.79  ? 140 SER A HG     1 
ATOM   2070 N N      . LYS A 1 141 ? 20.319  51.275 69.071 1.00 73.70  ? 141 LYS A N      1 
ATOM   2071 C CA     . LYS A 1 141 ? 19.698  52.287 69.916 1.00 70.83  ? 141 LYS A CA     1 
ATOM   2072 C C      . LYS A 1 141 ? 20.737  53.232 70.505 1.00 72.93  ? 141 LYS A C      1 
ATOM   2073 O O      . LYS A 1 141 ? 20.432  54.400 70.769 1.00 72.34  ? 141 LYS A O      1 
ATOM   2074 C CB     . LYS A 1 141 ? 18.903  51.603 71.028 1.00 67.93  ? 141 LYS A CB     1 
ATOM   2075 C CG     . LYS A 1 141 ? 18.213  52.542 72.001 1.00 65.68  ? 141 LYS A CG     1 
ATOM   2076 C CD     . LYS A 1 141 ? 17.571  51.759 73.135 1.00 63.64  ? 141 LYS A CD     1 
ATOM   2077 C CE     . LYS A 1 141 ? 16.825  52.668 74.089 1.00 62.84  ? 141 LYS A CE     1 
ATOM   2078 N NZ     . LYS A 1 141 ? 16.234  51.907 75.222 1.00 62.97  ? 141 LYS A NZ     1 
ATOM   2079 H H      . LYS A 1 141 ? 20.253  50.473 69.375 1.00 84.69  ? 141 LYS A H      1 
ATOM   2080 H HA     . LYS A 1 141 ? 19.081  52.812 69.382 1.00 81.33  ? 141 LYS A HA     1 
ATOM   2081 H HB2    . LYS A 1 141 ? 18.218  51.050 70.621 1.00 79.92  ? 141 LYS A HB2    1 
ATOM   2082 H HB3    . LYS A 1 141 ? 19.509  51.045 71.541 1.00 79.92  ? 141 LYS A HB3    1 
ATOM   2083 H HG2    . LYS A 1 141 ? 18.866  53.151 72.380 1.00 76.04  ? 141 LYS A HG2    1 
ATOM   2084 H HG3    . LYS A 1 141 ? 17.518  53.035 71.537 1.00 76.04  ? 141 LYS A HG3    1 
ATOM   2085 H HD2    . LYS A 1 141 ? 16.939  51.122 72.766 1.00 75.23  ? 141 LYS A HD2    1 
ATOM   2086 H HD3    . LYS A 1 141 ? 18.261  51.295 73.634 1.00 75.23  ? 141 LYS A HD3    1 
ATOM   2087 H HE2    . LYS A 1 141 ? 17.441  53.324 74.453 1.00 73.47  ? 141 LYS A HE2    1 
ATOM   2088 H HE3    . LYS A 1 141 ? 16.106  53.111 73.613 1.00 73.47  ? 141 LYS A HE3    1 
ATOM   2089 H HZ1    . LYS A 1 141 ? 15.802  52.461 75.768 1.00 76.88  ? 141 LYS A HZ1    1 
ATOM   2090 H HZ2    . LYS A 1 141 ? 15.661  51.300 74.914 1.00 76.88  ? 141 LYS A HZ2    1 
ATOM   2091 H HZ3    . LYS A 1 141 ? 16.876  51.493 75.679 1.00 76.88  ? 141 LYS A HZ3    1 
ATOM   2092 N N      . GLN A 1 142 ? 21.963  52.750 70.716 1.00 72.69  ? 142 GLN A N      1 
ATOM   2093 C CA     . GLN A 1 142 ? 23.002  53.583 71.311 1.00 74.16  ? 142 GLN A CA     1 
ATOM   2094 C C      . GLN A 1 142 ? 23.468  54.662 70.340 1.00 74.92  ? 142 GLN A C      1 
ATOM   2095 O O      . GLN A 1 142 ? 23.553  55.841 70.701 1.00 75.43  ? 142 GLN A O      1 
ATOM   2096 C CB     . GLN A 1 142 ? 24.180  52.712 71.752 1.00 76.25  ? 142 GLN A CB     1 
ATOM   2097 C CG     . GLN A 1 142 ? 25.249  53.461 72.535 1.00 79.00  ? 142 GLN A CG     1 
ATOM   2098 C CD     . GLN A 1 142 ? 26.487  52.621 72.787 1.00 82.62  ? 142 GLN A CD     1 
ATOM   2099 O OE1    . GLN A 1 142 ? 26.576  51.475 72.344 1.00 82.08  ? 142 GLN A OE1    1 
ATOM   2100 N NE2    . GLN A 1 142 ? 27.453  53.190 73.500 1.00 86.75  ? 142 GLN A NE2    1 
ATOM   2101 H H      . GLN A 1 142 ? 22.214  51.950 70.524 1.00 84.88  ? 142 GLN A H      1 
ATOM   2102 H HA     . GLN A 1 142 ? 22.643  54.023 72.097 1.00 86.36  ? 142 GLN A HA     1 
ATOM   2103 H HB2    . GLN A 1 142 ? 23.845  51.998 72.317 1.00 89.65  ? 142 GLN A HB2    1 
ATOM   2104 H HB3    . GLN A 1 142 ? 24.601  52.335 70.963 1.00 89.65  ? 142 GLN A HB3    1 
ATOM   2105 H HG2    . GLN A 1 142 ? 25.516  54.246 72.033 1.00 93.83  ? 142 GLN A HG2    1 
ATOM   2106 H HG3    . GLN A 1 142 ? 24.885  53.724 73.395 1.00 93.83  ? 142 GLN A HG3    1 
ATOM   2107 H HE21   . GLN A 1 142 ? 27.356  53.994 73.791 1.00 106.47 ? 142 GLN A HE21   1 
ATOM   2108 H HE22   . GLN A 1 142 ? 28.175  52.756 73.670 1.00 106.47 ? 142 GLN A HE22   1 
ATOM   2109 N N      . GLU A 1 143 ? 23.784  54.276 69.100 1.00 74.09  ? 143 GLU A N      1 
ATOM   2110 C CA     . GLU A 1 143 ? 24.302  55.245 68.139 1.00 74.72  ? 143 GLU A CA     1 
ATOM   2111 C C      . GLU A 1 143 ? 23.259  56.302 67.798 1.00 72.27  ? 143 GLU A C      1 
ATOM   2112 O O      . GLU A 1 143 ? 23.595  57.482 67.639 1.00 73.44  ? 143 GLU A O      1 
ATOM   2113 C CB     . GLU A 1 143 ? 24.774  54.535 66.870 1.00 77.19  ? 143 GLU A CB     1 
ATOM   2114 C CG     . GLU A 1 143 ? 26.069  53.757 67.039 1.00 80.46  ? 143 GLU A CG     1 
ATOM   2115 C CD     . GLU A 1 143 ? 25.844  52.343 67.531 1.00 80.93  ? 143 GLU A CD     1 
ATOM   2116 O OE1    . GLU A 1 143 ? 24.957  51.657 66.980 1.00 80.38  ? 143 GLU A OE1    1 
ATOM   2117 O OE2    . GLU A 1 143 ? 26.552  51.916 68.468 1.00 81.89  ? 143 GLU A OE2    1 
ATOM   2118 H H      . GLU A 1 143 ? 23.709  53.475 68.798 1.00 85.72  ? 143 GLU A H      1 
ATOM   2119 H HA     . GLU A 1 143 ? 25.067  55.697 68.529 1.00 84.74  ? 143 GLU A HA     1 
ATOM   2120 H HB2    . GLU A 1 143 ? 24.088  53.909 66.590 1.00 86.90  ? 143 GLU A HB2    1 
ATOM   2121 H HB3    . GLU A 1 143 ? 24.916  55.198 66.176 1.00 86.90  ? 143 GLU A HB3    1 
ATOM   2122 H HG2    . GLU A 1 143 ? 26.522  53.708 66.183 1.00 94.93  ? 143 GLU A HG2    1 
ATOM   2123 H HG3    . GLU A 1 143 ? 26.630  54.214 67.686 1.00 94.93  ? 143 GLU A HG3    1 
ATOM   2124 N N      . LEU A 1 144 ? 21.991  55.902 67.675 1.00 62.05  ? 144 LEU A N      1 
ATOM   2125 C CA     . LEU A 1 144 ? 20.944  56.865 67.350 1.00 59.44  ? 144 LEU A CA     1 
ATOM   2126 C C      . LEU A 1 144 ? 20.876  57.974 68.392 1.00 57.93  ? 144 LEU A C      1 
ATOM   2127 O O      . LEU A 1 144 ? 20.648  59.142 68.055 1.00 59.12  ? 144 LEU A O      1 
ATOM   2128 C CB     . LEU A 1 144 ? 19.593  56.158 67.236 1.00 58.20  ? 144 LEU A CB     1 
ATOM   2129 C CG     . LEU A 1 144 ? 18.390  57.058 66.932 1.00 56.77  ? 144 LEU A CG     1 
ATOM   2130 C CD1    . LEU A 1 144 ? 18.531  57.716 65.568 1.00 57.85  ? 144 LEU A CD1    1 
ATOM   2131 C CD2    . LEU A 1 144 ? 17.093  56.272 67.014 1.00 55.29  ? 144 LEU A CD2    1 
ATOM   2132 H H      . LEU A 1 144 ? 21.717  55.092 67.774 1.00 70.11  ? 144 LEU A H      1 
ATOM   2133 H HA     . LEU A 1 144 ? 21.144  57.272 66.492 1.00 64.82  ? 144 LEU A HA     1 
ATOM   2134 H HB2    . LEU A 1 144 ? 19.650  55.502 66.524 1.00 64.80  ? 144 LEU A HB2    1 
ATOM   2135 H HB3    . LEU A 1 144 ? 19.412  55.708 68.076 1.00 64.80  ? 144 LEU A HB3    1 
ATOM   2136 H HG     . LEU A 1 144 ? 18.351  57.763 67.598 1.00 64.53  ? 144 LEU A HG     1 
ATOM   2137 H HD11   . LEU A 1 144 ? 17.756  58.277 65.406 1.00 63.98  ? 144 LEU A HD11   1 
ATOM   2138 H HD12   . LEU A 1 144 ? 19.338  58.255 65.559 1.00 63.98  ? 144 LEU A HD12   1 
ATOM   2139 H HD13   . LEU A 1 144 ? 18.587  57.025 64.889 1.00 63.98  ? 144 LEU A HD13   1 
ATOM   2140 H HD21   . LEU A 1 144 ? 16.351  56.865 66.818 1.00 65.19  ? 144 LEU A HD21   1 
ATOM   2141 H HD22   . LEU A 1 144 ? 17.120  55.551 66.366 1.00 65.19  ? 144 LEU A HD22   1 
ATOM   2142 H HD23   . LEU A 1 144 ? 17.000  55.910 67.909 1.00 65.19  ? 144 LEU A HD23   1 
ATOM   2143 N N      . LEU A 1 145 ? 21.069  57.630 69.662 1.00 59.49  ? 145 LEU A N      1 
ATOM   2144 C CA     . LEU A 1 145 ? 20.997  58.596 70.747 1.00 60.53  ? 145 LEU A CA     1 
ATOM   2145 C C      . LEU A 1 145 ? 22.346  59.227 71.069 1.00 69.30  ? 145 LEU A C      1 
ATOM   2146 O O      . LEU A 1 145 ? 22.422  60.051 71.987 1.00 71.02  ? 145 LEU A O      1 
ATOM   2147 C CB     . LEU A 1 145 ? 20.427  57.925 72.001 1.00 56.23  ? 145 LEU A CB     1 
ATOM   2148 C CG     . LEU A 1 145 ? 19.100  57.186 71.805 1.00 46.31  ? 145 LEU A CG     1 
ATOM   2149 C CD1    . LEU A 1 145 ? 18.656  56.530 73.103 1.00 41.66  ? 145 LEU A CD1    1 
ATOM   2150 C CD2    . LEU A 1 145 ? 18.020  58.119 71.284 1.00 64.12  ? 145 LEU A CD2    1 
ATOM   2151 H H      . LEU A 1 145 ? 21.245  56.829 69.922 1.00 70.26  ? 145 LEU A H      1 
ATOM   2152 H HA     . LEU A 1 145 ? 20.391  59.308 70.491 1.00 66.94  ? 145 LEU A HA     1 
ATOM   2153 H HB2    . LEU A 1 145 ? 21.075  57.279 72.324 1.00 58.11  ? 145 LEU A HB2    1 
ATOM   2154 H HB3    . LEU A 1 145 ? 20.285  58.606 72.676 1.00 58.11  ? 145 LEU A HB3    1 
ATOM   2155 H HG     . LEU A 1 145 ? 19.227  56.485 71.147 1.00 51.50  ? 145 LEU A HG     1 
ATOM   2156 H HD11   . LEU A 1 145 ? 17.815  56.071 72.952 1.00 44.95  ? 145 LEU A HD11   1 
ATOM   2157 H HD12   . LEU A 1 145 ? 19.334  55.896 73.383 1.00 44.95  ? 145 LEU A HD12   1 
ATOM   2158 H HD13   . LEU A 1 145 ? 18.542  57.215 73.780 1.00 44.95  ? 145 LEU A HD13   1 
ATOM   2159 H HD21   . LEU A 1 145 ? 17.197  57.618 71.173 1.00 137.01 ? 145 LEU A HD21   1 
ATOM   2160 H HD22   . LEU A 1 145 ? 17.888  58.837 71.923 1.00 137.01 ? 145 LEU A HD22   1 
ATOM   2161 H HD23   . LEU A 1 145 ? 18.304  58.484 70.431 1.00 137.01 ? 145 LEU A HD23   1 
ATOM   2162 N N      . GLN A 1 146 ? 23.400  58.869 70.345 1.00 83.91  ? 146 GLN A N      1 
ATOM   2163 C CA     . GLN A 1 146 ? 24.734  59.433 70.541 1.00 88.69  ? 146 GLN A CA     1 
ATOM   2164 C C      . GLN A 1 146 ? 25.196  60.061 69.228 1.00 91.11  ? 146 GLN A C      1 
ATOM   2165 O O      . GLN A 1 146 ? 26.149  59.592 68.600 1.00 91.06  ? 146 GLN A O      1 
ATOM   2166 C CB     . GLN A 1 146 ? 25.718  58.363 71.025 1.00 86.90  ? 146 GLN A CB     1 
ATOM   2167 C CG     . GLN A 1 146 ? 25.533  57.960 72.482 1.00 84.54  ? 146 GLN A CG     1 
ATOM   2168 C CD     . GLN A 1 146 ? 26.525  56.899 72.938 1.00 80.96  ? 146 GLN A CD     1 
ATOM   2169 O OE1    . GLN A 1 146 ? 26.180  56.010 73.717 1.00 76.10  ? 146 GLN A OE1    1 
ATOM   2170 N NE2    . GLN A 1 146 ? 27.764  56.993 72.463 1.00 82.98  ? 146 GLN A NE2    1 
ATOM   2171 H H      . GLN A 1 146 ? 23.368  58.283 69.716 1.00 99.96  ? 146 GLN A H      1 
ATOM   2172 H HA     . GLN A 1 146 ? 24.691  60.132 71.213 1.00 111.76 ? 146 GLN A HA     1 
ATOM   2173 H HB2    . GLN A 1 146 ? 25.604  57.567 70.482 1.00 108.22 ? 146 GLN A HB2    1 
ATOM   2174 H HB3    . GLN A 1 146 ? 26.621  58.702 70.925 1.00 108.22 ? 146 GLN A HB3    1 
ATOM   2175 H HG2    . GLN A 1 146 ? 25.653  58.742 73.043 1.00 103.47 ? 146 GLN A HG2    1 
ATOM   2176 H HG3    . GLN A 1 146 ? 24.639  57.603 72.599 1.00 103.47 ? 146 GLN A HG3    1 
ATOM   2177 H HE21   . GLN A 1 146 ? 27.971  57.631 71.925 1.00 101.86 ? 146 GLN A HE21   1 
ATOM   2178 H HE22   . GLN A 1 146 ? 28.357  56.415 72.693 1.00 101.86 ? 146 GLN A HE22   1 
ATOM   2179 N N      . LEU A 1 147 ? 24.513  61.126 68.817 1.00 105.47 ? 147 LEU A N      1 
ATOM   2180 C CA     . LEU A 1 147 ? 24.872  61.859 67.612 1.00 107.90 ? 147 LEU A CA     1 
ATOM   2181 C C      . LEU A 1 147 ? 24.527  63.328 67.821 1.00 112.72 ? 147 LEU A C      1 
ATOM   2182 O O      . LEU A 1 147 ? 23.988  63.719 68.861 1.00 113.43 ? 147 LEU A O      1 
ATOM   2183 C CB     . LEU A 1 147 ? 24.163  61.281 66.383 1.00 103.55 ? 147 LEU A CB     1 
ATOM   2184 C CG     . LEU A 1 147 ? 24.751  59.988 65.814 1.00 100.30 ? 147 LEU A CG     1 
ATOM   2185 C CD1    . LEU A 1 147 ? 23.809  59.380 64.788 1.00 96.53  ? 147 LEU A CD1    1 
ATOM   2186 C CD2    . LEU A 1 147 ? 26.116  60.242 65.189 1.00 102.99 ? 147 LEU A CD2    1 
ATOM   2187 H H      . LEU A 1 147 ? 23.828  61.447 69.226 1.00 128.64 ? 147 LEU A H      1 
ATOM   2188 H HA     . LEU A 1 147 ? 25.829  61.790 67.470 1.00 134.07 ? 147 LEU A HA     1 
ATOM   2189 H HB2    . LEU A 1 147 ? 23.240  61.098 66.621 1.00 127.91 ? 147 LEU A HB2    1 
ATOM   2190 H HB3    . LEU A 1 147 ? 24.187  61.945 65.676 1.00 127.91 ? 147 LEU A HB3    1 
ATOM   2191 H HG     . LEU A 1 147 ? 24.864  59.347 66.534 1.00 120.92 ? 147 LEU A HG     1 
ATOM   2192 H HD11   . LEU A 1 147 ? 24.202  58.564 64.443 1.00 118.14 ? 147 LEU A HD11   1 
ATOM   2193 H HD12   . LEU A 1 147 ? 22.961  59.184 65.217 1.00 118.14 ? 147 LEU A HD12   1 
ATOM   2194 H HD13   . LEU A 1 147 ? 23.676  60.015 64.067 1.00 118.14 ? 147 LEU A HD13   1 
ATOM   2195 H HD21   . LEU A 1 147 ? 26.463  59.407 64.838 1.00 124.45 ? 147 LEU A HD21   1 
ATOM   2196 H HD22   . LEU A 1 147 ? 26.020  60.889 64.473 1.00 124.45 ? 147 LEU A HD22   1 
ATOM   2197 H HD23   . LEU A 1 147 ? 26.714  60.589 65.870 1.00 124.45 ? 147 LEU A HD23   1 
ATOM   2198 N N      . THR A 1 148 ? 24.844  64.141 66.825 1.00 117.53 ? 148 THR A N      1 
ATOM   2199 C CA     . THR A 1 148 ? 24.623  65.578 66.872 1.00 121.82 ? 148 THR A CA     1 
ATOM   2200 C C      . THR A 1 148 ? 24.184  66.056 65.507 1.00 122.44 ? 148 THR A C      1 
ATOM   2201 O O      . THR A 1 148 ? 24.475  65.414 64.485 1.00 120.51 ? 148 THR A O      1 
ATOM   2202 C CB     . THR A 1 148 ? 25.888  66.329 67.309 1.00 126.17 ? 148 THR A CB     1 
ATOM   2203 O OG1    . THR A 1 148 ? 26.971  65.990 66.433 1.00 126.02 ? 148 THR A OG1    1 
ATOM   2204 C CG2    . THR A 1 148 ? 26.263  65.958 68.735 1.00 125.69 ? 148 THR A CG2    1 
ATOM   2205 N N      . PRO A 1 149 ? 23.472  67.193 65.433 1.00 129.82 ? 149 PRO A N      1 
ATOM   2206 C CA     . PRO A 1 149 ? 22.989  67.765 64.174 1.00 133.37 ? 149 PRO A CA     1 
ATOM   2207 C C      . PRO A 1 149 ? 24.107  68.394 63.348 1.00 138.16 ? 149 PRO A C      1 
ATOM   2208 O O      . PRO A 1 149 ? 25.190  68.623 63.885 1.00 139.73 ? 149 PRO A O      1 
ATOM   2209 C CB     . PRO A 1 149 ? 21.990  68.828 64.636 1.00 138.85 ? 149 PRO A CB     1 
ATOM   2210 C CG     . PRO A 1 149 ? 22.496  69.245 65.972 1.00 141.06 ? 149 PRO A CG     1 
ATOM   2211 C CD     . PRO A 1 149 ? 23.070  68.004 66.598 1.00 133.69 ? 149 PRO A CD     1 
ATOM   2212 N N      . ARG B 1 3   ? 6.314   66.157 39.567 1.00 95.51  ? 3   ARG B N      1 
ATOM   2213 C CA     . ARG B 1 3   ? 5.565   65.065 38.956 1.00 93.21  ? 3   ARG B CA     1 
ATOM   2214 C C      . ARG B 1 3   ? 6.468   64.222 38.060 1.00 90.67  ? 3   ARG B C      1 
ATOM   2215 O O      . ARG B 1 3   ? 6.498   62.998 38.177 1.00 87.66  ? 3   ARG B O      1 
ATOM   2216 C CB     . ARG B 1 3   ? 4.377   65.607 38.160 1.00 98.67  ? 3   ARG B CB     1 
ATOM   2217 C CG     . ARG B 1 3   ? 3.304   66.256 39.022 1.00 105.70 ? 3   ARG B CG     1 
ATOM   2218 C CD     . ARG B 1 3   ? 2.185   66.841 38.175 1.00 114.51 ? 3   ARG B CD     1 
ATOM   2219 N NE     . ARG B 1 3   ? 2.659   67.926 37.322 1.00 124.17 ? 3   ARG B NE     1 
ATOM   2220 C CZ     . ARG B 1 3   ? 3.080   67.764 36.072 1.00 128.95 ? 3   ARG B CZ     1 
ATOM   2221 N NH1    . ARG B 1 3   ? 3.085   66.558 35.523 1.00 126.18 ? 3   ARG B NH1    1 
ATOM   2222 N NH2    . ARG B 1 3   ? 3.496   68.809 35.371 1.00 135.78 ? 3   ARG B NH2    1 
ATOM   2223 N N      . ALA B 1 4   ? 7.197   64.882 37.159 1.00 84.32  ? 4   ALA B N      1 
ATOM   2224 C CA     . ALA B 1 4   ? 8.215   64.181 36.383 1.00 81.66  ? 4   ALA B CA     1 
ATOM   2225 C C      . ALA B 1 4   ? 9.191   63.468 37.311 1.00 77.90  ? 4   ALA B C      1 
ATOM   2226 O O      . ALA B 1 4   ? 9.407   62.256 37.199 1.00 73.15  ? 4   ALA B O      1 
ATOM   2227 C CB     . ALA B 1 4   ? 8.950   65.164 35.470 1.00 86.66  ? 4   ALA B CB     1 
ATOM   2228 N N      . ILE B 1 5   ? 9.792   64.215 38.240 1.00 154.04 ? 5   ILE B N      1 
ATOM   2229 C CA     . ILE B 1 5   ? 10.549  63.599 39.318 1.00 153.05 ? 5   ILE B CA     1 
ATOM   2230 C C      . ILE B 1 5   ? 9.608   62.727 40.142 1.00 152.44 ? 5   ILE B C      1 
ATOM   2231 O O      . ILE B 1 5   ? 8.403   62.990 40.236 1.00 152.73 ? 5   ILE B O      1 
ATOM   2232 C CB     . ILE B 1 5   ? 11.216  64.668 40.199 1.00 157.72 ? 5   ILE B CB     1 
ATOM   2233 C CG1    . ILE B 1 5   ? 12.137  65.559 39.363 1.00 163.18 ? 5   ILE B CG1    1 
ATOM   2234 C CG2    . ILE B 1 5   ? 11.978  64.016 41.343 1.00 158.46 ? 5   ILE B CG2    1 
ATOM   2235 C CD1    . ILE B 1 5   ? 12.694  66.744 40.130 1.00 169.59 ? 5   ILE B CD1    1 
ATOM   2236 N N      . GLN B 1 6   ? 10.163  61.671 40.740 1.00 70.08  ? 6   GLN B N      1 
ATOM   2237 C CA     . GLN B 1 6   ? 9.383   60.742 41.555 1.00 70.83  ? 6   GLN B CA     1 
ATOM   2238 C C      . GLN B 1 6   ? 8.346   59.976 40.741 1.00 67.79  ? 6   GLN B C      1 
ATOM   2239 O O      . GLN B 1 6   ? 7.607   59.159 41.297 1.00 66.69  ? 6   GLN B O      1 
ATOM   2240 C CB     . GLN B 1 6   ? 8.681   61.484 42.699 1.00 76.00  ? 6   GLN B CB     1 
ATOM   2241 C CG     . GLN B 1 6   ? 9.602   61.915 43.819 1.00 78.31  ? 6   GLN B CG     1 
ATOM   2242 C CD     . GLN B 1 6   ? 10.176  60.732 44.564 1.00 75.82  ? 6   GLN B CD     1 
ATOM   2243 O OE1    . GLN B 1 6   ? 9.497   59.723 44.762 1.00 73.27  ? 6   GLN B OE1    1 
ATOM   2244 N NE2    . GLN B 1 6   ? 11.432  60.841 44.972 1.00 76.56  ? 6   GLN B NE2    1 
ATOM   2245 H H      . GLN B 1 6   ? 10.998  61.471 40.688 1.00 84.42  ? 6   GLN B H      1 
ATOM   2246 H HA     . GLN B 1 6   ? 9.987   60.094 41.950 1.00 87.36  ? 6   GLN B HA     1 
ATOM   2247 H HB2    . GLN B 1 6   ? 8.259   62.281 42.340 1.00 101.34 ? 6   GLN B HB2    1 
ATOM   2248 H HB3    . GLN B 1 6   ? 8.006   60.900 43.080 1.00 101.34 ? 6   GLN B HB3    1 
ATOM   2249 H HG2    . GLN B 1 6   ? 10.339  62.425 43.448 1.00 105.83 ? 6   GLN B HG2    1 
ATOM   2250 H HG3    . GLN B 1 6   ? 9.104   62.458 44.450 1.00 105.83 ? 6   GLN B HG3    1 
ATOM   2251 H HE21   . GLN B 1 6   ? 11.877  61.559 44.809 1.00 97.94  ? 6   GLN B HE21   1 
ATOM   2252 H HE22   . GLN B 1 6   ? 11.803  60.194 45.400 1.00 97.94  ? 6   GLN B HE22   1 
ATOM   2253 N N      . GLY B 1 7   ? 8.282   60.207 39.433 1.00 72.62  ? 7   GLY B N      1 
ATOM   2254 C CA     . GLY B 1 7   ? 7.290   59.529 38.622 1.00 71.01  ? 7   GLY B CA     1 
ATOM   2255 C C      . GLY B 1 7   ? 7.601   58.053 38.467 1.00 68.91  ? 7   GLY B C      1 
ATOM   2256 O O      . GLY B 1 7   ? 8.748   57.618 38.559 1.00 65.90  ? 7   GLY B O      1 
ATOM   2257 H H      . GLY B 1 7   ? 8.795   60.745 39.000 1.00 94.83  ? 7   GLY B H      1 
ATOM   2258 H HA2    . GLY B 1 7   ? 6.417   59.620 39.033 1.00 91.66  ? 7   GLY B HA2    1 
ATOM   2259 H HA3    . GLY B 1 7   ? 7.260   59.933 37.740 1.00 91.66  ? 7   GLY B HA3    1 
ATOM   2260 N N      . ASN B 1 8   ? 6.547   57.265 38.236 1.00 98.56  ? 8   ASN B N      1 
ATOM   2261 C CA     . ASN B 1 8   ? 6.739   55.843 37.981 1.00 98.14  ? 8   ASN B CA     1 
ATOM   2262 C C      . ASN B 1 8   ? 7.624   55.597 36.767 1.00 95.77  ? 8   ASN B C      1 
ATOM   2263 O O      . ASN B 1 8   ? 8.179   54.503 36.630 1.00 94.10  ? 8   ASN B O      1 
ATOM   2264 C CB     . ASN B 1 8   ? 5.389   55.144 37.795 1.00 99.21  ? 8   ASN B CB     1 
ATOM   2265 C CG     . ASN B 1 8   ? 4.467   55.890 36.852 1.00 102.08 ? 8   ASN B CG     1 
ATOM   2266 O OD1    . ASN B 1 8   ? 4.517   55.705 35.636 1.00 103.03 ? 8   ASN B OD1    1 
ATOM   2267 N ND2    . ASN B 1 8   ? 3.610   56.736 37.413 1.00 103.92 ? 8   ASN B ND2    1 
ATOM   2268 H H      . ASN B 1 8   ? 5.728   57.527 38.223 1.00 110.36 ? 8   ASN B H      1 
ATOM   2269 H HA     . ASN B 1 8   ? 7.175   55.444 38.750 1.00 113.10 ? 8   ASN B HA     1 
ATOM   2270 H HB2    . ASN B 1 8   ? 5.540   54.259 37.428 1.00 118.74 ? 8   ASN B HB2    1 
ATOM   2271 H HB3    . ASN B 1 8   ? 4.947   55.076 38.656 1.00 118.74 ? 8   ASN B HB3    1 
ATOM   2272 H HD21   . ASN B 1 8   ? 3.065   57.184 36.923 1.00 132.98 ? 8   ASN B HD21   1 
ATOM   2273 H HD22   . ASN B 1 8   ? 3.600   56.834 38.268 1.00 132.98 ? 8   ASN B HD22   1 
ATOM   2274 N N      . ASP B 1 9   ? 7.769   56.588 35.884 1.00 111.62 ? 9   ASP B N      1 
ATOM   2275 C CA     . ASP B 1 9   ? 8.679   56.458 34.754 1.00 109.27 ? 9   ASP B CA     1 
ATOM   2276 C C      . ASP B 1 9   ? 10.139  56.478 35.186 1.00 107.62 ? 9   ASP B C      1 
ATOM   2277 O O      . ASP B 1 9   ? 11.009  56.085 34.401 1.00 107.80 ? 9   ASP B O      1 
ATOM   2278 C CB     . ASP B 1 9   ? 8.424   57.578 33.744 1.00 111.70 ? 9   ASP B CB     1 
ATOM   2279 C CG     . ASP B 1 9   ? 7.014   57.552 33.187 1.00 111.82 ? 9   ASP B CG     1 
ATOM   2280 O OD1    . ASP B 1 9   ? 6.466   56.445 33.002 1.00 110.26 ? 9   ASP B OD1    1 
ATOM   2281 O OD2    . ASP B 1 9   ? 6.453   58.639 32.936 1.00 113.20 ? 9   ASP B OD2    1 
ATOM   2282 H H      . ASP B 1 9   ? 7.353   57.340 35.920 1.00 142.01 ? 9   ASP B H      1 
ATOM   2283 H HA     . ASP B 1 9   ? 8.511   55.611 34.311 1.00 137.11 ? 9   ASP B HA     1 
ATOM   2284 H HB2    . ASP B 1 9   ? 8.559   58.434 34.180 1.00 143.74 ? 9   ASP B HB2    1 
ATOM   2285 H HB3    . ASP B 1 9   ? 9.042   57.481 33.002 1.00 143.74 ? 9   ASP B HB3    1 
ATOM   2286 N N      . THR B 1 10  ? 10.428  56.924 36.408 1.00 85.81  ? 10  THR B N      1 
ATOM   2287 C CA     . THR B 1 10  ? 11.795  57.003 36.909 1.00 84.57  ? 10  THR B CA     1 
ATOM   2288 C C      . THR B 1 10  ? 12.138  55.883 37.880 1.00 82.51  ? 10  THR B C      1 
ATOM   2289 O O      . THR B 1 10  ? 13.278  55.408 37.885 1.00 81.76  ? 10  THR B O      1 
ATOM   2290 C CB     . THR B 1 10  ? 12.037  58.354 37.593 1.00 86.27  ? 10  THR B CB     1 
ATOM   2291 O OG1    . THR B 1 10  ? 11.126  58.514 38.687 1.00 86.57  ? 10  THR B OG1    1 
ATOM   2292 C CG2    . THR B 1 10  ? 11.848  59.494 36.605 1.00 88.11  ? 10  THR B CG2    1 
ATOM   2293 H H      . THR B 1 10  ? 9.837   57.191 36.974 1.00 107.01 ? 10  THR B H      1 
ATOM   2294 H HA     . THR B 1 10  ? 12.405  56.939 36.157 1.00 102.29 ? 10  THR B HA     1 
ATOM   2295 H HB     . THR B 1 10  ? 12.947  58.387 37.925 1.00 102.38 ? 10  THR B HB     1 
ATOM   2296 H HG1    . THR B 1 10  ? 10.334  58.486 38.409 1.00 99.28  ? 10  THR B HG1    1 
ATOM   2297 H HG21   . THR B 1 10  ? 12.003  60.343 37.046 1.00 107.35 ? 10  THR B HG21   1 
ATOM   2298 H HG22   . THR B 1 10  ? 12.474  59.402 35.870 1.00 107.35 ? 10  THR B HG22   1 
ATOM   2299 H HG23   . THR B 1 10  ? 10.944  59.481 36.254 1.00 107.35 ? 10  THR B HG23   1 
ATOM   2300 N N      . ARG B 1 11  ? 11.187  55.447 38.710 1.00 66.92  ? 11  ARG B N      1 
ATOM   2301 C CA     . ARG B 1 11  ? 11.466  54.322 39.599 1.00 66.22  ? 11  ARG B CA     1 
ATOM   2302 C C      . ARG B 1 11  ? 11.689  53.044 38.801 1.00 63.32  ? 11  ARG B C      1 
ATOM   2303 O O      . ARG B 1 11  ? 12.529  52.215 39.169 1.00 61.99  ? 11  ARG B O      1 
ATOM   2304 C CB     . ARG B 1 11  ? 10.329  54.137 40.608 1.00 68.31  ? 11  ARG B CB     1 
ATOM   2305 C CG     . ARG B 1 11  ? 9.080   53.451 40.063 1.00 67.91  ? 11  ARG B CG     1 
ATOM   2306 C CD     . ARG B 1 11  ? 8.082   53.128 41.165 1.00 67.56  ? 11  ARG B CD     1 
ATOM   2307 N NE     . ARG B 1 11  ? 8.616   52.160 42.120 1.00 65.69  ? 11  ARG B NE     1 
ATOM   2308 C CZ     . ARG B 1 11  ? 7.874   51.435 42.951 1.00 63.06  ? 11  ARG B CZ     1 
ATOM   2309 N NH1    . ARG B 1 11  ? 6.554   51.551 42.947 1.00 62.80  ? 11  ARG B NH1    1 
ATOM   2310 N NH2    . ARG B 1 11  ? 8.453   50.581 43.785 1.00 59.79  ? 11  ARG B NH2    1 
ATOM   2311 H H      . ARG B 1 11  ? 10.395  55.775 38.776 1.00 80.81  ? 11  ARG B H      1 
ATOM   2312 H HA     . ARG B 1 11  ? 12.278  54.509 40.096 1.00 77.52  ? 11  ARG B HA     1 
ATOM   2313 H HB2    . ARG B 1 11  ? 10.658  53.600 41.347 1.00 79.38  ? 11  ARG B HB2    1 
ATOM   2314 H HB3    . ARG B 1 11  ? 10.063  55.010 40.936 1.00 79.38  ? 11  ARG B HB3    1 
ATOM   2315 H HG2    . ARG B 1 11  ? 8.646   54.039 39.425 1.00 79.61  ? 11  ARG B HG2    1 
ATOM   2316 H HG3    . ARG B 1 11  ? 9.335   52.620 39.632 1.00 79.61  ? 11  ARG B HG3    1 
ATOM   2317 H HD2    . ARG B 1 11  ? 7.866   53.941 41.647 1.00 77.61  ? 11  ARG B HD2    1 
ATOM   2318 H HD3    . ARG B 1 11  ? 7.281   52.751 40.768 1.00 77.61  ? 11  ARG B HD3    1 
ATOM   2319 H HE     . ARG B 1 11  ? 9.469   52.051 42.146 1.00 73.90  ? 11  ARG B HE     1 
ATOM   2320 H HH11   . ARG B 1 11  ? 6.173   52.103 42.409 1.00 78.27  ? 11  ARG B HH11   1 
ATOM   2321 H HH12   . ARG B 1 11  ? 6.079   51.078 43.486 1.00 78.27  ? 11  ARG B HH12   1 
ATOM   2322 H HH21   . ARG B 1 11  ? 9.309   50.500 43.790 1.00 71.96  ? 11  ARG B HH21   1 
ATOM   2323 H HH22   . ARG B 1 11  ? 7.972   50.110 44.320 1.00 71.96  ? 11  ARG B HH22   1 
ATOM   2324 N N      . GLU B 1 12  ? 10.942  52.865 37.708 1.00 76.23  ? 12  GLU B N      1 
ATOM   2325 C CA     . GLU B 1 12  ? 11.161  51.710 36.845 1.00 74.47  ? 12  GLU B CA     1 
ATOM   2326 C C      . GLU B 1 12  ? 12.592  51.683 36.330 1.00 72.59  ? 12  GLU B C      1 
ATOM   2327 O O      . GLU B 1 12  ? 13.214  50.618 36.254 1.00 71.48  ? 12  GLU B O      1 
ATOM   2328 C CB     . GLU B 1 12  ? 10.172  51.731 35.679 1.00 75.79  ? 12  GLU B CB     1 
ATOM   2329 C CG     . GLU B 1 12  ? 8.713   51.596 36.096 1.00 78.31  ? 12  GLU B CG     1 
ATOM   2330 C CD     . GLU B 1 12  ? 8.352   50.194 36.545 1.00 79.00  ? 12  GLU B CD     1 
ATOM   2331 O OE1    . GLU B 1 12  ? 9.244   49.319 36.559 1.00 78.09  ? 12  GLU B OE1    1 
ATOM   2332 O OE2    . GLU B 1 12  ? 7.171   49.966 36.882 1.00 80.24  ? 12  GLU B OE2    1 
ATOM   2333 H H      . GLU B 1 12  ? 10.312  53.391 37.451 1.00 86.08  ? 12  GLU B H      1 
ATOM   2334 H HA     . GLU B 1 12  ? 11.008  50.899 37.355 1.00 85.35  ? 12  GLU B HA     1 
ATOM   2335 H HB2    . GLU B 1 12  ? 10.268  52.572 35.205 1.00 91.01  ? 12  GLU B HB2    1 
ATOM   2336 H HB3    . GLU B 1 12  ? 10.378  50.994 35.083 1.00 91.01  ? 12  GLU B HB3    1 
ATOM   2337 H HG2    . GLU B 1 12  ? 8.540   52.200 36.835 1.00 95.64  ? 12  GLU B HG2    1 
ATOM   2338 H HG3    . GLU B 1 12  ? 8.147   51.824 35.342 1.00 95.64  ? 12  GLU B HG3    1 
ATOM   2339 N N      . GLN B 1 13  ? 13.133  52.849 35.971 1.00 55.52  ? 13  GLN B N      1 
ATOM   2340 C CA     . GLN B 1 13  ? 14.530  52.913 35.561 1.00 56.14  ? 13  GLN B CA     1 
ATOM   2341 C C      . GLN B 1 13  ? 15.466  52.710 36.743 1.00 56.15  ? 13  GLN B C      1 
ATOM   2342 O O      . GLN B 1 13  ? 16.550  52.140 36.581 1.00 56.00  ? 13  GLN B O      1 
ATOM   2343 C CB     . GLN B 1 13  ? 14.815  54.250 34.878 1.00 58.63  ? 13  GLN B CB     1 
ATOM   2344 C CG     . GLN B 1 13  ? 14.140  54.408 33.527 1.00 59.47  ? 13  GLN B CG     1 
ATOM   2345 C CD     . GLN B 1 13  ? 14.551  55.682 32.825 1.00 62.86  ? 13  GLN B CD     1 
ATOM   2346 O OE1    . GLN B 1 13  ? 14.671  56.736 33.449 1.00 64.58  ? 13  GLN B OE1    1 
ATOM   2347 N NE2    . GLN B 1 13  ? 14.783  55.592 31.521 1.00 64.38  ? 13  GLN B NE2    1 
ATOM   2348 H H      . GLN B 1 13  ? 12.718  53.602 35.956 1.00 60.44  ? 13  GLN B H      1 
ATOM   2349 H HA     . GLN B 1 13  ? 14.702  52.207 34.918 1.00 62.69  ? 13  GLN B HA     1 
ATOM   2350 H HB2    . GLN B 1 13  ? 14.501  54.967 35.452 1.00 67.17  ? 13  GLN B HB2    1 
ATOM   2351 H HB3    . GLN B 1 13  ? 15.772  54.334 34.743 1.00 67.17  ? 13  GLN B HB3    1 
ATOM   2352 H HG2    . GLN B 1 13  ? 14.384  53.659 32.961 1.00 69.12  ? 13  GLN B HG2    1 
ATOM   2353 H HG3    . GLN B 1 13  ? 13.178  54.430 33.654 1.00 69.12  ? 13  GLN B HG3    1 
ATOM   2354 H HE21   . GLN B 1 13  ? 14.697  54.835 31.121 1.00 78.01  ? 13  GLN B HE21   1 
ATOM   2355 H HE22   . GLN B 1 13  ? 15.020  56.289 31.077 1.00 78.01  ? 13  GLN B HE22   1 
ATOM   2356 N N      . ALA B 1 14  ? 15.072  53.167 37.933 1.00 45.12  ? 14  ALA B N      1 
ATOM   2357 C CA     . ALA B 1 14  ? 15.883  52.924 39.121 1.00 45.28  ? 14  ALA B CA     1 
ATOM   2358 C C      . ALA B 1 14  ? 15.903  51.442 39.470 1.00 42.71  ? 14  ALA B C      1 
ATOM   2359 O O      . ALA B 1 14  ? 16.941  50.909 39.879 1.00 41.84  ? 14  ALA B O      1 
ATOM   2360 C CB     . ALA B 1 14  ? 15.357  53.751 40.294 1.00 47.14  ? 14  ALA B CB     1 
ATOM   2361 H H      . ALA B 1 14  ? 14.351  53.614 38.076 1.00 56.66  ? 14  ALA B H      1 
ATOM   2362 H HA     . ALA B 1 14  ? 16.795  53.202 38.943 1.00 54.88  ? 14  ALA B HA     1 
ATOM   2363 H HB1    . ALA B 1 14  ? 15.907  53.577 41.074 1.00 55.45  ? 14  ALA B HB1    1 
ATOM   2364 H HB2    . ALA B 1 14  ? 15.401  54.692 40.062 1.00 55.45  ? 14  ALA B HB2    1 
ATOM   2365 H HB3    . ALA B 1 14  ? 14.438  53.496 40.473 1.00 55.45  ? 14  ALA B HB3    1 
ATOM   2366 N N      . ASN B 1 15  ? 14.769  50.761 39.309 1.00 59.68  ? 15  ASN B N      1 
ATOM   2367 C CA     . ASN B 1 15  ? 14.734  49.322 39.538 1.00 59.08  ? 15  ASN B CA     1 
ATOM   2368 C C      . ASN B 1 15  ? 15.570  48.583 38.501 1.00 57.52  ? 15  ASN B C      1 
ATOM   2369 O O      . ASN B 1 15  ? 16.331  47.670 38.844 1.00 54.92  ? 15  ASN B O      1 
ATOM   2370 C CB     . ASN B 1 15  ? 13.291  48.826 39.510 1.00 60.85  ? 15  ASN B CB     1 
ATOM   2371 C CG     . ASN B 1 15  ? 13.189  47.336 39.729 1.00 60.57  ? 15  ASN B CG     1 
ATOM   2372 O OD1    . ASN B 1 15  ? 13.429  46.545 38.817 1.00 59.43  ? 15  ASN B OD1    1 
ATOM   2373 N ND2    . ASN B 1 15  ? 12.828  46.943 40.944 1.00 59.59  ? 15  ASN B ND2    1 
ATOM   2374 H H      . ASN B 1 15  ? 14.017  51.105 39.072 1.00 66.01  ? 15  ASN B H      1 
ATOM   2375 H HA     . ASN B 1 15  ? 15.102  49.130 40.414 1.00 66.86  ? 15  ASN B HA     1 
ATOM   2376 H HB2    . ASN B 1 15  ? 12.790  49.269 40.213 1.00 69.43  ? 15  ASN B HB2    1 
ATOM   2377 H HB3    . ASN B 1 15  ? 12.903  49.031 38.645 1.00 69.43  ? 15  ASN B HB3    1 
ATOM   2378 H HD21   . ASN B 1 15  ? 12.755  46.104 41.120 1.00 70.35  ? 15  ASN B HD21   1 
ATOM   2379 H HD22   . ASN B 1 15  ? 12.667  47.527 41.555 1.00 70.35  ? 15  ASN B HD22   1 
ATOM   2380 N N      . GLY B 1 16  ? 15.441  48.962 37.227 1.00 53.29  ? 16  GLY B N      1 
ATOM   2381 C CA     . GLY B 1 16  ? 16.248  48.360 36.182 1.00 53.06  ? 16  GLY B CA     1 
ATOM   2382 C C      . GLY B 1 16  ? 17.705  48.768 36.225 1.00 53.89  ? 16  GLY B C      1 
ATOM   2383 O O      . GLY B 1 16  ? 18.549  48.072 35.651 1.00 53.00  ? 16  GLY B O      1 
ATOM   2384 H H      . GLY B 1 16  ? 14.893  49.564 36.950 1.00 58.59  ? 16  GLY B H      1 
ATOM   2385 H HA2    . GLY B 1 16  ? 16.202  47.394 36.260 1.00 61.13  ? 16  GLY B HA2    1 
ATOM   2386 H HA3    . GLY B 1 16  ? 15.889  48.612 35.317 1.00 61.13  ? 16  GLY B HA3    1 
ATOM   2387 N N      . GLU B 1 17  ? 18.019  49.879 36.894 1.00 54.44  ? 17  GLU B N      1 
ATOM   2388 C CA     . GLU B 1 17  ? 19.407  50.316 36.996 1.00 54.16  ? 17  GLU B CA     1 
ATOM   2389 C C      . GLU B 1 17  ? 20.276  49.253 37.654 1.00 48.86  ? 17  GLU B C      1 
ATOM   2390 O O      . GLU B 1 17  ? 21.459  49.123 37.320 1.00 47.73  ? 17  GLU B O      1 
ATOM   2391 C CB     . GLU B 1 17  ? 19.478  51.631 37.777 1.00 57.12  ? 17  GLU B CB     1 
ATOM   2392 C CG     . GLU B 1 17  ? 20.853  52.283 37.796 1.00 58.06  ? 17  GLU B CG     1 
ATOM   2393 C CD     . GLU B 1 17  ? 21.771  51.707 38.858 1.00 56.00  ? 17  GLU B CD     1 
ATOM   2394 O OE1    . GLU B 1 17  ? 21.271  51.040 39.791 1.00 52.89  ? 17  GLU B OE1    1 
ATOM   2395 O OE2    . GLU B 1 17  ? 22.998  51.924 38.760 1.00 57.00  ? 17  GLU B OE2    1 
ATOM   2396 H H      . GLU B 1 17  ? 17.453  50.390 37.292 1.00 65.48  ? 17  GLU B H      1 
ATOM   2397 H HA     . GLU B 1 17  ? 19.754  50.477 36.105 1.00 65.02  ? 17  GLU B HA     1 
ATOM   2398 H HB2    . GLU B 1 17  ? 18.859  52.262 37.377 1.00 63.92  ? 17  GLU B HB2    1 
ATOM   2399 H HB3    . GLU B 1 17  ? 19.221  51.460 38.696 1.00 63.92  ? 17  GLU B HB3    1 
ATOM   2400 H HG2    . GLU B 1 17  ? 21.275  52.153 36.933 1.00 65.60  ? 17  GLU B HG2    1 
ATOM   2401 H HG3    . GLU B 1 17  ? 20.749  53.231 37.974 1.00 65.60  ? 17  GLU B HG3    1 
ATOM   2402 N N      . ARG B 1 18  ? 19.709  48.488 38.589 1.00 58.02  ? 18  ARG B N      1 
ATOM   2403 C CA     . ARG B 1 18  ? 20.448  47.399 39.218 1.00 51.69  ? 18  ARG B CA     1 
ATOM   2404 C C      . ARG B 1 18  ? 21.004  46.435 38.179 1.00 48.40  ? 18  ARG B C      1 
ATOM   2405 O O      . ARG B 1 18  ? 22.123  45.929 38.321 1.00 44.80  ? 18  ARG B O      1 
ATOM   2406 C CB     . ARG B 1 18  ? 19.529  46.665 40.197 1.00 50.09  ? 18  ARG B CB     1 
ATOM   2407 C CG     . ARG B 1 18  ? 20.122  45.423 40.842 1.00 45.70  ? 18  ARG B CG     1 
ATOM   2408 C CD     . ARG B 1 18  ? 19.106  44.774 41.768 1.00 45.37  ? 18  ARG B CD     1 
ATOM   2409 N NE     . ARG B 1 18  ? 19.652  43.630 42.491 1.00 42.56  ? 18  ARG B NE     1 
ATOM   2410 C CZ     . ARG B 1 18  ? 18.958  42.887 43.348 1.00 43.14  ? 18  ARG B CZ     1 
ATOM   2411 N NH1    . ARG B 1 18  ? 17.684  43.162 43.594 1.00 43.01  ? 18  ARG B NH1    1 
ATOM   2412 N NH2    . ARG B 1 18  ? 19.538  41.865 43.962 1.00 44.53  ? 18  ARG B NH2    1 
ATOM   2413 H H      . ARG B 1 18  ? 18.903  48.581 38.873 1.00 65.55  ? 18  ARG B H      1 
ATOM   2414 H HA     . ARG B 1 18  ? 21.192  47.767 39.720 1.00 58.72  ? 18  ARG B HA     1 
ATOM   2415 H HB2    . ARG B 1 18  ? 19.289  47.277 40.911 1.00 57.44  ? 18  ARG B HB2    1 
ATOM   2416 H HB3    . ARG B 1 18  ? 18.729  46.392 39.721 1.00 57.44  ? 18  ARG B HB3    1 
ATOM   2417 H HG2    . ARG B 1 18  ? 20.363  44.784 40.153 1.00 58.95  ? 18  ARG B HG2    1 
ATOM   2418 H HG3    . ARG B 1 18  ? 20.901  45.670 41.364 1.00 58.95  ? 18  ARG B HG3    1 
ATOM   2419 H HD2    . ARG B 1 18  ? 18.810  45.428 42.421 1.00 61.11  ? 18  ARG B HD2    1 
ATOM   2420 H HD3    . ARG B 1 18  ? 18.352  44.465 41.243 1.00 61.11  ? 18  ARG B HD3    1 
ATOM   2421 H HE     . ARG B 1 18  ? 20.481  43.434 42.368 1.00 62.53  ? 18  ARG B HE     1 
ATOM   2422 H HH11   . ARG B 1 18  ? 17.303  43.824 43.199 1.00 64.43  ? 18  ARG B HH11   1 
ATOM   2423 H HH12   . ARG B 1 18  ? 17.239  42.678 44.149 1.00 64.43  ? 18  ARG B HH12   1 
ATOM   2424 H HH21   . ARG B 1 18  ? 20.364  41.683 43.806 1.00 64.76  ? 18  ARG B HH21   1 
ATOM   2425 H HH22   . ARG B 1 18  ? 19.089  41.385 44.515 1.00 64.76  ? 18  ARG B HH22   1 
ATOM   2426 N N      . TRP B 1 19  ? 20.243  46.182 37.118 1.00 55.64  ? 19  TRP B N      1 
ATOM   2427 C CA     . TRP B 1 19  ? 20.570  45.132 36.156 1.00 59.57  ? 19  TRP B CA     1 
ATOM   2428 C C      . TRP B 1 19  ? 21.415  45.688 35.008 1.00 63.37  ? 19  TRP B C      1 
ATOM   2429 O O      . TRP B 1 19  ? 21.028  45.678 33.840 1.00 68.21  ? 19  TRP B O      1 
ATOM   2430 C CB     . TRP B 1 19  ? 19.288  44.484 35.646 1.00 63.41  ? 19  TRP B CB     1 
ATOM   2431 C CG     . TRP B 1 19  ? 18.388  44.035 36.762 1.00 62.17  ? 19  TRP B CG     1 
ATOM   2432 C CD1    . TRP B 1 19  ? 17.102  44.431 36.991 1.00 64.60  ? 19  TRP B CD1    1 
ATOM   2433 C CD2    . TRP B 1 19  ? 18.717  43.117 37.812 1.00 60.24  ? 19  TRP B CD2    1 
ATOM   2434 N NE1    . TRP B 1 19  ? 16.608  43.810 38.114 1.00 63.98  ? 19  TRP B NE1    1 
ATOM   2435 C CE2    . TRP B 1 19  ? 17.581  43.000 38.637 1.00 60.75  ? 19  TRP B CE2    1 
ATOM   2436 C CE3    . TRP B 1 19  ? 19.862  42.383 38.134 1.00 58.48  ? 19  TRP B CE3    1 
ATOM   2437 C CZ2    . TRP B 1 19  ? 17.556  42.176 39.761 1.00 56.56  ? 19  TRP B CZ2    1 
ATOM   2438 C CZ3    . TRP B 1 19  ? 19.835  41.565 39.250 1.00 56.25  ? 19  TRP B CZ3    1 
ATOM   2439 C CH2    . TRP B 1 19  ? 18.691  41.470 40.050 1.00 54.24  ? 19  TRP B CH2    1 
ATOM   2440 H H      . TRP B 1 19  ? 19.521  46.610 36.930 1.00 51.15  ? 19  TRP B H      1 
ATOM   2441 H HA     . TRP B 1 19  ? 21.091  44.447 36.604 1.00 60.08  ? 19  TRP B HA     1 
ATOM   2442 H HB2    . TRP B 1 19  ? 18.802  45.127 35.107 1.00 60.21  ? 19  TRP B HB2    1 
ATOM   2443 H HB3    . TRP B 1 19  ? 19.517  43.707 35.112 1.00 60.21  ? 19  TRP B HB3    1 
ATOM   2444 H HD1    . TRP B 1 19  ? 16.627  45.030 36.461 1.00 57.69  ? 19  TRP B HD1    1 
ATOM   2445 H HE1    . TRP B 1 19  ? 15.818  43.914 38.436 1.00 59.04  ? 19  TRP B HE1    1 
ATOM   2446 H HE3    . TRP B 1 19  ? 20.627  42.441 37.608 1.00 62.45  ? 19  TRP B HE3    1 
ATOM   2447 H HZ2    . TRP B 1 19  ? 16.797  42.109 40.294 1.00 56.57  ? 19  TRP B HZ2    1 
ATOM   2448 H HZ3    . TRP B 1 19  ? 20.591  41.072 39.474 1.00 64.92  ? 19  TRP B HZ3    1 
ATOM   2449 H HH2    . TRP B 1 19  ? 18.701  40.912 40.794 1.00 59.72  ? 19  TRP B HH2    1 
ATOM   2450 N N      . ASP B 1 20  ? 22.601  46.175 35.370 1.00 74.07  ? 20  ASP B N      1 
ATOM   2451 C CA     . ASP B 1 20  ? 23.556  46.685 34.396 1.00 85.71  ? 20  ASP B CA     1 
ATOM   2452 C C      . ASP B 1 20  ? 24.963  46.346 34.869 1.00 91.70  ? 20  ASP B C      1 
ATOM   2453 O O      . ASP B 1 20  ? 25.167  45.852 35.982 1.00 85.70  ? 20  ASP B O      1 
ATOM   2454 C CB     . ASP B 1 20  ? 23.385  48.195 34.186 1.00 90.08  ? 20  ASP B CB     1 
ATOM   2455 C CG     . ASP B 1 20  ? 22.053  48.545 33.546 1.00 85.50  ? 20  ASP B CG     1 
ATOM   2456 O OD1    . ASP B 1 20  ? 21.636  47.831 32.611 1.00 78.93  ? 20  ASP B OD1    1 
ATOM   2457 O OD2    . ASP B 1 20  ? 21.422  49.531 33.981 1.00 86.63  ? 20  ASP B OD2    1 
ATOM   2458 H H      . ASP B 1 20  ? 22.876  46.219 36.183 1.00 82.80  ? 20  ASP B H      1 
ATOM   2459 H HA     . ASP B 1 20  ? 23.408  46.243 33.545 1.00 95.48  ? 20  ASP B HA     1 
ATOM   2460 H HB2    . ASP B 1 20  ? 23.433  48.642 35.045 1.00 98.80  ? 20  ASP B HB2    1 
ATOM   2461 H HB3    . ASP B 1 20  ? 24.092  48.515 33.604 1.00 98.80  ? 20  ASP B HB3    1 
ATOM   2462 N N      . GLY B 1 21  ? 25.941  46.617 34.007 1.00 155.53 ? 21  GLY B N      1 
ATOM   2463 C CA     . GLY B 1 21  ? 27.317  46.256 34.289 1.00 153.55 ? 21  GLY B CA     1 
ATOM   2464 C C      . GLY B 1 21  ? 27.998  47.213 35.243 1.00 155.04 ? 21  GLY B C      1 
ATOM   2465 O O      . GLY B 1 21  ? 28.242  46.869 36.399 1.00 149.06 ? 21  GLY B O      1 
ATOM   2466 H H      . GLY B 1 21  ? 25.828  47.011 33.251 1.00 189.32 ? 21  GLY B H      1 
ATOM   2467 H HA2    . GLY B 1 21  ? 27.342  45.368 34.679 1.00 185.81 ? 21  GLY B HA2    1 
ATOM   2468 H HA3    . GLY B 1 21  ? 27.821  46.240 33.461 1.00 185.81 ? 21  GLY B HA3    1 
ATOM   2469 N N      . GLY B 1 22  ? 28.320  48.412 34.767 1.00 140.69 ? 22  GLY B N      1 
ATOM   2470 C CA     . GLY B 1 22  ? 28.888  49.451 35.603 1.00 143.07 ? 22  GLY B CA     1 
ATOM   2471 C C      . GLY B 1 22  ? 28.273  50.799 35.295 1.00 148.48 ? 22  GLY B C      1 
ATOM   2472 O O      . GLY B 1 22  ? 28.823  51.842 35.660 1.00 151.39 ? 22  GLY B O      1 
ATOM   2473 H H      . GLY B 1 22  ? 28.215  48.648 33.947 1.00 168.16 ? 22  GLY B H      1 
ATOM   2474 H HA2    . GLY B 1 22  ? 28.730  49.242 36.537 1.00 171.48 ? 22  GLY B HA2    1 
ATOM   2475 H HA3    . GLY B 1 22  ? 29.845  49.504 35.454 1.00 171.48 ? 22  GLY B HA3    1 
ATOM   2476 N N      . SER B 1 23  ? 27.122  50.786 34.621 1.00 180.77 ? 23  SER B N      1 
ATOM   2477 C CA     . SER B 1 23  ? 26.478  52.019 34.191 1.00 185.49 ? 23  SER B CA     1 
ATOM   2478 C C      . SER B 1 23  ? 25.097  51.757 33.599 1.00 181.01 ? 23  SER B C      1 
ATOM   2479 O O      . SER B 1 23  ? 24.962  51.010 32.624 1.00 178.04 ? 23  SER B O      1 
ATOM   2480 C CB     . SER B 1 23  ? 27.357  52.743 33.168 1.00 188.68 ? 23  SER B CB     1 
ATOM   2481 O OG     . SER B 1 23  ? 27.881  51.835 32.217 1.00 188.57 ? 23  SER B OG     1 
ATOM   2482 H H      . SER B 1 23  ? 26.696  50.072 34.402 1.00 218.90 ? 23  SER B H      1 
ATOM   2483 H HA     . SER B 1 23  ? 26.369  52.603 34.958 1.00 226.86 ? 23  SER B HA     1 
ATOM   2484 H HB2    . SER B 1 23  ? 26.822  53.408 32.707 1.00 234.28 ? 23  SER B HB2    1 
ATOM   2485 H HB3    . SER B 1 23  ? 28.092  53.172 33.632 1.00 234.28 ? 23  SER B HB3    1 
ATOM   2486 H HG     . SER B 1 23  ? 27.254  51.455 31.807 1.00 239.75 ? 23  SER B HG     1 
ATOM   2487 N N      . GLY B 1 24  ? 24.070  52.365 34.190 1.00 130.87 ? 24  GLY B N      1 
ATOM   2488 C CA     . GLY B 1 24  ? 22.727  52.329 33.643 1.00 124.67 ? 24  GLY B CA     1 
ATOM   2489 C C      . GLY B 1 24  ? 22.228  53.719 33.309 1.00 120.12 ? 24  GLY B C      1 
ATOM   2490 O O      . GLY B 1 24  ? 22.684  54.703 33.896 1.00 124.15 ? 24  GLY B O      1 
ATOM   2491 H H      . GLY B 1 24  ? 24.133  52.812 34.923 1.00 170.45 ? 24  GLY B H      1 
ATOM   2492 H HA2    . GLY B 1 24  ? 22.718  51.793 32.835 1.00 170.93 ? 24  GLY B HA2    1 
ATOM   2493 H HA3    . GLY B 1 24  ? 22.123  51.929 34.288 1.00 170.93 ? 24  GLY B HA3    1 
ATOM   2494 N N      . GLY B 1 25  ? 21.274  53.811 32.386 1.00 128.43 ? 25  GLY B N      1 
ATOM   2495 C CA     . GLY B 1 25  ? 20.850  55.081 31.824 1.00 127.56 ? 25  GLY B CA     1 
ATOM   2496 C C      . GLY B 1 25  ? 20.691  56.258 32.772 1.00 126.29 ? 25  GLY B C      1 
ATOM   2497 O O      . GLY B 1 25  ? 20.683  57.404 32.312 1.00 128.64 ? 25  GLY B O      1 
ATOM   2498 H H      . GLY B 1 25  ? 20.851  53.134 32.064 1.00 164.58 ? 25  GLY B H      1 
ATOM   2499 H HA2    . GLY B 1 25  ? 21.492  55.343 31.145 1.00 170.70 ? 25  GLY B HA2    1 
ATOM   2500 H HA3    . GLY B 1 25  ? 19.997  54.949 31.383 1.00 170.70 ? 25  GLY B HA3    1 
ATOM   2501 N N      . ILE B 1 26  ? 20.570  56.019 34.079 1.00 107.02 ? 26  ILE B N      1 
ATOM   2502 C CA     . ILE B 1 26  ? 20.279  57.097 35.021 1.00 100.05 ? 26  ILE B CA     1 
ATOM   2503 C C      . ILE B 1 26  ? 21.352  57.184 36.102 1.00 103.42 ? 26  ILE B C      1 
ATOM   2504 O O      . ILE B 1 26  ? 22.297  56.387 36.129 1.00 110.24 ? 26  ILE B O      1 
ATOM   2505 C CB     . ILE B 1 26  ? 18.890  56.910 35.656 1.00 87.52  ? 26  ILE B CB     1 
ATOM   2506 C CG1    . ILE B 1 26  ? 18.784  55.517 36.268 1.00 83.30  ? 26  ILE B CG1    1 
ATOM   2507 C CG2    . ILE B 1 26  ? 17.804  57.132 34.619 1.00 83.26  ? 26  ILE B CG2    1 
ATOM   2508 C CD1    . ILE B 1 26  ? 17.550  55.305 37.096 1.00 75.54  ? 26  ILE B CD1    1 
ATOM   2509 H H      . ILE B 1 26  ? 20.651  55.244 34.443 1.00 153.26 ? 26  ILE B H      1 
ATOM   2510 H HA     . ILE B 1 26  ? 20.274  57.939 34.540 1.00 136.98 ? 26  ILE B HA     1 
ATOM   2511 H HB     . ILE B 1 26  ? 18.782  57.567 36.362 1.00 110.93 ? 26  ILE B HB     1 
ATOM   2512 H HG12   . ILE B 1 26  ? 18.776  54.862 35.553 1.00 96.66  ? 26  ILE B HG12   1 
ATOM   2513 H HG13   . ILE B 1 26  ? 19.553  55.368 36.841 1.00 96.66  ? 26  ILE B HG13   1 
ATOM   2514 H HG21   . ILE B 1 26  ? 16.938  57.009 35.039 1.00 106.16 ? 26  ILE B HG21   1 
ATOM   2515 H HG22   . ILE B 1 26  ? 17.879  58.034 34.272 1.00 106.16 ? 26  ILE B HG22   1 
ATOM   2516 H HG23   . ILE B 1 26  ? 17.918  56.489 33.901 1.00 106.16 ? 26  ILE B HG23   1 
ATOM   2517 H HD11   . ILE B 1 26  ? 17.557  54.401 37.448 1.00 88.11  ? 26  ILE B HD11   1 
ATOM   2518 H HD12   . ILE B 1 26  ? 17.546  55.944 37.826 1.00 88.11  ? 26  ILE B HD12   1 
ATOM   2519 H HD13   . ILE B 1 26  ? 16.768  55.437 36.537 1.00 88.11  ? 26  ILE B HD13   1 
ATOM   2520 N N      . THR B 1 27  ? 21.204  58.159 36.999 1.00 70.05  ? 27  THR B N      1 
ATOM   2521 C CA     . THR B 1 27  ? 22.137  58.349 38.102 1.00 65.29  ? 27  THR B CA     1 
ATOM   2522 C C      . THR B 1 27  ? 21.763  57.447 39.271 1.00 59.05  ? 27  THR B C      1 
ATOM   2523 O O      . THR B 1 27  ? 20.591  57.342 39.643 1.00 55.22  ? 27  THR B O      1 
ATOM   2524 C CB     . THR B 1 27  ? 22.134  59.811 38.557 1.00 66.31  ? 27  THR B CB     1 
ATOM   2525 O OG1    . THR B 1 27  ? 22.521  60.660 37.468 1.00 72.68  ? 27  THR B OG1    1 
ATOM   2526 C CG2    . THR B 1 27  ? 23.093  60.026 39.727 1.00 65.01  ? 27  THR B CG2    1 
ATOM   2527 H H      . THR B 1 27  ? 20.560  58.729 36.988 1.00 96.81  ? 27  THR B H      1 
ATOM   2528 H HA     . THR B 1 27  ? 23.033  58.119 37.810 1.00 81.52  ? 27  THR B HA     1 
ATOM   2529 H HB     . THR B 1 27  ? 21.241  60.053 38.849 1.00 71.81  ? 27  THR B HB     1 
ATOM   2530 H HG1    . THR B 1 27  ? 22.520  61.463 37.715 1.00 78.03  ? 27  THR B HG1    1 
ATOM   2531 H HG21   . THR B 1 27  ? 23.078  60.956 40.001 1.00 68.92  ? 27  THR B HG21   1 
ATOM   2532 H HG22   . THR B 1 27  ? 22.829  59.472 40.478 1.00 68.92  ? 27  THR B HG22   1 
ATOM   2533 H HG23   . THR B 1 27  ? 23.996  59.790 39.463 1.00 68.92  ? 27  THR B HG23   1 
ATOM   2534 N N      . SER B 1 28  ? 22.773  56.808 39.861 1.00 63.27  ? 28  SER B N      1 
ATOM   2535 C CA     . SER B 1 28  ? 22.550  55.859 40.939 1.00 57.22  ? 28  SER B CA     1 
ATOM   2536 C C      . SER B 1 28  ? 23.318  56.269 42.191 1.00 51.28  ? 28  SER B C      1 
ATOM   2537 O O      . SER B 1 28  ? 24.369  56.910 42.095 1.00 54.77  ? 28  SER B O      1 
ATOM   2538 C CB     . SER B 1 28  ? 22.983  54.447 40.531 1.00 62.69  ? 28  SER B CB     1 
ATOM   2539 O OG     . SER B 1 28  ? 22.907  53.558 41.632 1.00 53.65  ? 28  SER B OG     1 
ATOM   2540 H H      . SER B 1 28  ? 23.600  56.910 39.651 1.00 72.51  ? 28  SER B H      1 
ATOM   2541 H HA     . SER B 1 28  ? 21.605  55.836 41.155 1.00 68.25  ? 28  SER B HA     1 
ATOM   2542 H HB2    . SER B 1 28  ? 22.397  54.128 39.826 1.00 71.70  ? 28  SER B HB2    1 
ATOM   2543 H HB3    . SER B 1 28  ? 23.899  54.477 40.212 1.00 71.70  ? 28  SER B HB3    1 
ATOM   2544 H HG     . SER B 1 28  ? 23.146  52.787 41.397 1.00 66.55  ? 28  SER B HG     1 
ATOM   2545 N N      . PRO B 1 29  ? 22.823  55.911 43.381 1.00 49.96  ? 29  PRO B N      1 
ATOM   2546 C CA     . PRO B 1 29  ? 23.574  56.227 44.607 1.00 46.81  ? 29  PRO B CA     1 
ATOM   2547 C C      . PRO B 1 29  ? 24.794  55.352 44.815 1.00 47.47  ? 29  PRO B C      1 
ATOM   2548 O O      . PRO B 1 29  ? 25.703  55.755 45.551 1.00 45.93  ? 29  PRO B O      1 
ATOM   2549 C CB     . PRO B 1 29  ? 22.547  56.002 45.729 1.00 46.36  ? 29  PRO B CB     1 
ATOM   2550 C CG     . PRO B 1 29  ? 21.228  55.807 45.049 1.00 47.01  ? 29  PRO B CG     1 
ATOM   2551 C CD     . PRO B 1 29  ? 21.523  55.293 43.688 1.00 50.55  ? 29  PRO B CD     1 
ATOM   2552 H HA     . PRO B 1 29  ? 23.846  57.159 44.604 1.00 72.08  ? 29  PRO B HA     1 
ATOM   2553 H HB2    . PRO B 1 29  ? 22.789  55.212 46.236 1.00 68.28  ? 29  PRO B HB2    1 
ATOM   2554 H HB3    . PRO B 1 29  ? 22.520  56.782 46.305 1.00 68.28  ? 29  PRO B HB3    1 
ATOM   2555 H HG2    . PRO B 1 29  ? 20.701  55.163 45.548 1.00 67.61  ? 29  PRO B HG2    1 
ATOM   2556 H HG3    . PRO B 1 29  ? 20.763  56.657 44.997 1.00 67.61  ? 29  PRO B HG3    1 
ATOM   2557 H HD2    . PRO B 1 29  ? 21.601  54.326 43.700 1.00 72.77  ? 29  PRO B HD2    1 
ATOM   2558 H HD3    . PRO B 1 29  ? 20.848  55.590 43.059 1.00 72.77  ? 29  PRO B HD3    1 
ATOM   2559 N N      . PHE B 1 30  ? 24.844  54.173 44.203 1.00 47.38  ? 30  PHE B N      1 
ATOM   2560 C CA     . PHE B 1 30  ? 25.900  53.210 44.470 1.00 51.68  ? 30  PHE B CA     1 
ATOM   2561 C C      . PHE B 1 30  ? 27.098  53.451 43.563 1.00 56.33  ? 30  PHE B C      1 
ATOM   2562 O O      . PHE B 1 30  ? 26.960  53.904 42.424 1.00 55.52  ? 30  PHE B O      1 
ATOM   2563 C CB     . PHE B 1 30  ? 25.386  51.781 44.278 1.00 49.84  ? 30  PHE B CB     1 
ATOM   2564 C CG     . PHE B 1 30  ? 24.267  51.408 45.209 1.00 44.23  ? 30  PHE B CG     1 
ATOM   2565 C CD1    . PHE B 1 30  ? 24.527  51.071 46.526 1.00 45.96  ? 30  PHE B CD1    1 
ATOM   2566 C CD2    . PHE B 1 30  ? 22.956  51.387 44.764 1.00 39.29  ? 30  PHE B CD2    1 
ATOM   2567 C CE1    . PHE B 1 30  ? 23.500  50.725 47.384 1.00 43.40  ? 30  PHE B CE1    1 
ATOM   2568 C CE2    . PHE B 1 30  ? 21.926  51.043 45.616 1.00 39.31  ? 30  PHE B CE2    1 
ATOM   2569 C CZ     . PHE B 1 30  ? 22.198  50.711 46.928 1.00 40.94  ? 30  PHE B CZ     1 
ATOM   2570 H H      . PHE B 1 30  ? 24.269  53.906 43.622 1.00 66.90  ? 30  PHE B H      1 
ATOM   2571 H HA     . PHE B 1 30  ? 26.193  53.305 45.390 1.00 65.33  ? 30  PHE B HA     1 
ATOM   2572 H HB2    . PHE B 1 30  ? 25.061  51.685 43.370 1.00 60.92  ? 30  PHE B HB2    1 
ATOM   2573 H HB3    . PHE B 1 30  ? 26.118  51.163 44.432 1.00 60.92  ? 30  PHE B HB3    1 
ATOM   2574 H HD1    . PHE B 1 30  ? 25.403  51.080 46.838 1.00 58.04  ? 30  PHE B HD1    1 
ATOM   2575 H HD2    . PHE B 1 30  ? 22.767  51.610 43.881 1.00 52.71  ? 30  PHE B HD2    1 
ATOM   2576 H HE1    . PHE B 1 30  ? 23.686  50.502 48.268 1.00 57.34  ? 30  PHE B HE1    1 
ATOM   2577 H HE2    . PHE B 1 30  ? 21.049  51.034 45.306 1.00 51.95  ? 30  PHE B HE2    1 
ATOM   2578 H HZ     . PHE B 1 30  ? 21.505  50.479 47.503 1.00 54.96  ? 30  PHE B HZ     1 
ATOM   2579 N N      . LYS B 1 31  ? 28.283  53.134 44.083 1.00 56.38  ? 31  LYS B N      1 
ATOM   2580 C CA     . LYS B 1 31  ? 29.524  53.254 43.334 1.00 61.18  ? 31  LYS B CA     1 
ATOM   2581 C C      . LYS B 1 31  ? 30.070  51.910 42.876 1.00 63.77  ? 31  LYS B C      1 
ATOM   2582 O O      . LYS B 1 31  ? 31.070  51.879 42.151 1.00 67.08  ? 31  LYS B O      1 
ATOM   2583 C CB     . LYS B 1 31  ? 30.584  53.971 44.178 1.00 63.20  ? 31  LYS B CB     1 
ATOM   2584 C CG     . LYS B 1 31  ? 30.177  55.361 44.638 1.00 61.72  ? 31  LYS B CG     1 
ATOM   2585 C CD     . LYS B 1 31  ? 31.386  56.194 45.045 1.00 64.63  ? 31  LYS B CD     1 
ATOM   2586 C CE     . LYS B 1 31  ? 32.172  55.548 46.176 1.00 65.18  ? 31  LYS B CE     1 
ATOM   2587 N NZ     . LYS B 1 31  ? 33.337  56.382 46.582 1.00 67.09  ? 31  LYS B NZ     1 
ATOM   2588 H H      . LYS B 1 31  ? 28.391  52.841 44.884 1.00 71.07  ? 31  LYS B H      1 
ATOM   2589 H HA     . LYS B 1 31  ? 29.361  53.792 42.544 1.00 75.39  ? 31  LYS B HA     1 
ATOM   2590 H HB2    . LYS B 1 31  ? 30.764  53.439 44.970 1.00 78.54  ? 31  LYS B HB2    1 
ATOM   2591 H HB3    . LYS B 1 31  ? 31.394  54.059 43.652 1.00 78.54  ? 31  LYS B HB3    1 
ATOM   2592 H HG2    . LYS B 1 31  ? 29.724  55.818 43.912 1.00 78.53  ? 31  LYS B HG2    1 
ATOM   2593 H HG3    . LYS B 1 31  ? 29.589  55.285 45.405 1.00 78.53  ? 31  LYS B HG3    1 
ATOM   2594 H HD2    . LYS B 1 31  ? 31.978  56.289 44.282 1.00 82.23  ? 31  LYS B HD2    1 
ATOM   2595 H HD3    . LYS B 1 31  ? 31.085  57.066 45.345 1.00 82.23  ? 31  LYS B HD3    1 
ATOM   2596 H HE2    . LYS B 1 31  ? 31.593  55.440 46.947 1.00 86.49  ? 31  LYS B HE2    1 
ATOM   2597 H HE3    . LYS B 1 31  ? 32.504  54.685 45.883 1.00 86.49  ? 31  LYS B HE3    1 
ATOM   2598 H HZ1    . LYS B 1 31  ? 33.780  55.984 47.243 1.00 91.77  ? 31  LYS B HZ1    1 
ATOM   2599 H HZ2    . LYS B 1 31  ? 33.887  56.492 45.891 1.00 91.77  ? 31  LYS B HZ2    1 
ATOM   2600 H HZ3    . LYS B 1 31  ? 33.058  57.180 46.859 1.00 91.77  ? 31  LYS B HZ3    1 
ATOM   2601 N N      . LEU B 1 32  ? 29.450  50.806 43.276 1.00 66.63  ? 32  LEU B N      1 
ATOM   2602 C CA     . LEU B 1 32  ? 29.887  49.473 42.898 1.00 68.61  ? 32  LEU B CA     1 
ATOM   2603 C C      . LEU B 1 32  ? 28.810  48.778 42.079 1.00 67.15  ? 32  LEU B C      1 
ATOM   2604 O O      . LEU B 1 32  ? 27.626  49.124 42.170 1.00 64.08  ? 32  LEU B O      1 
ATOM   2605 C CB     . LEU B 1 32  ? 30.210  48.621 44.133 1.00 68.66  ? 32  LEU B CB     1 
ATOM   2606 C CG     . LEU B 1 32  ? 31.352  49.113 45.022 1.00 70.88  ? 32  LEU B CG     1 
ATOM   2607 C CD1    . LEU B 1 32  ? 31.507  48.193 46.223 1.00 69.64  ? 32  LEU B CD1    1 
ATOM   2608 C CD2    . LEU B 1 32  ? 32.659  49.211 44.249 1.00 73.68  ? 32  LEU B CD2    1 
ATOM   2609 H H      . LEU B 1 32  ? 28.755  50.806 43.782 1.00 78.84  ? 32  LEU B H      1 
ATOM   2610 H HA     . LEU B 1 32  ? 30.688  49.540 42.355 1.00 80.51  ? 32  LEU B HA     1 
ATOM   2611 H HB2    . LEU B 1 32  ? 29.414  48.576 44.687 1.00 82.46  ? 32  LEU B HB2    1 
ATOM   2612 H HB3    . LEU B 1 32  ? 30.443  47.729 43.834 1.00 82.46  ? 32  LEU B HB3    1 
ATOM   2613 H HG     . LEU B 1 32  ? 31.134  49.999 45.352 1.00 88.20  ? 32  LEU B HG     1 
ATOM   2614 H HD11   . LEU B 1 32  ? 32.234  48.517 46.777 1.00 91.75  ? 32  LEU B HD11   1 
ATOM   2615 H HD12   . LEU B 1 32  ? 30.679  48.193 46.729 1.00 91.75  ? 32  LEU B HD12   1 
ATOM   2616 H HD13   . LEU B 1 32  ? 31.703  47.296 45.909 1.00 91.75  ? 32  LEU B HD13   1 
ATOM   2617 H HD21   . LEU B 1 32  ? 33.356  49.525 44.847 1.00 91.23  ? 32  LEU B HD21   1 
ATOM   2618 H HD22   . LEU B 1 32  ? 32.889  48.334 43.906 1.00 91.23  ? 32  LEU B HD22   1 
ATOM   2619 H HD23   . LEU B 1 32  ? 32.546  49.835 43.516 1.00 91.23  ? 32  LEU B HD23   1 
ATOM   2620 N N      . PRO B 1 33  ? 29.180  47.786 41.275 1.00 53.33  ? 33  PRO B N      1 
ATOM   2621 C CA     . PRO B 1 33  ? 28.181  47.072 40.478 1.00 47.64  ? 33  PRO B CA     1 
ATOM   2622 C C      . PRO B 1 33  ? 27.480  45.987 41.281 1.00 48.27  ? 33  PRO B C      1 
ATOM   2623 O O      . PRO B 1 33  ? 27.995  45.469 42.273 1.00 51.15  ? 33  PRO B O      1 
ATOM   2624 C CB     . PRO B 1 33  ? 29.005  46.461 39.338 1.00 46.04  ? 33  PRO B CB     1 
ATOM   2625 C CG     . PRO B 1 33  ? 30.458  46.755 39.650 1.00 52.68  ? 33  PRO B CG     1 
ATOM   2626 C CD     . PRO B 1 33  ? 30.526  47.234 41.059 1.00 56.13  ? 33  PRO B CD     1 
ATOM   2627 H HA     . PRO B 1 33  ? 27.526  47.689 40.116 1.00 61.61  ? 33  PRO B HA     1 
ATOM   2628 H HB2    . PRO B 1 33  ? 28.852  45.504 39.306 1.00 63.45  ? 33  PRO B HB2    1 
ATOM   2629 H HB3    . PRO B 1 33  ? 28.749  46.874 38.498 1.00 63.45  ? 33  PRO B HB3    1 
ATOM   2630 H HG2    . PRO B 1 33  ? 30.978  45.943 39.547 1.00 66.60  ? 33  PRO B HG2    1 
ATOM   2631 H HG3    . PRO B 1 33  ? 30.782  47.441 39.046 1.00 66.60  ? 33  PRO B HG3    1 
ATOM   2632 H HD2    . PRO B 1 33  ? 30.691  46.494 41.663 1.00 67.12  ? 33  PRO B HD2    1 
ATOM   2633 H HD3    . PRO B 1 33  ? 31.197  47.929 41.150 1.00 67.12  ? 33  PRO B HD3    1 
ATOM   2634 N N      . ASP B 1 34  ? 26.275  45.651 40.828 1.00 55.68  ? 34  ASP B N      1 
ATOM   2635 C CA     . ASP B 1 34  ? 25.538  44.546 41.422 1.00 55.51  ? 34  ASP B CA     1 
ATOM   2636 C C      . ASP B 1 34  ? 26.189  43.228 41.029 1.00 59.46  ? 34  ASP B C      1 
ATOM   2637 O O      . ASP B 1 34  ? 26.521  43.010 39.860 1.00 56.76  ? 34  ASP B O      1 
ATOM   2638 C CB     . ASP B 1 34  ? 24.077  44.564 40.974 1.00 45.44  ? 34  ASP B CB     1 
ATOM   2639 C CG     . ASP B 1 34  ? 23.230  43.535 41.702 1.00 44.63  ? 34  ASP B CG     1 
ATOM   2640 O OD1    . ASP B 1 34  ? 22.692  43.862 42.782 1.00 44.07  ? 34  ASP B OD1    1 
ATOM   2641 O OD2    . ASP B 1 34  ? 23.102  42.398 41.199 1.00 45.30  ? 34  ASP B OD2    1 
ATOM   2642 H H      . ASP B 1 34  ? 25.866  46.046 40.183 1.00 67.53  ? 34  ASP B H      1 
ATOM   2643 H HA     . ASP B 1 34  ? 25.563  44.624 42.389 1.00 66.06  ? 34  ASP B HA     1 
ATOM   2644 H HB2    . ASP B 1 34  ? 23.702  45.442 41.152 1.00 60.97  ? 34  ASP B HB2    1 
ATOM   2645 H HB3    . ASP B 1 34  ? 24.034  44.371 40.025 1.00 60.97  ? 34  ASP B HB3    1 
ATOM   2646 N N      . GLU B 1 35  ? 26.375  42.354 42.011 1.00 61.82  ? 35  GLU B N      1 
ATOM   2647 C CA     . GLU B 1 35  ? 26.977  41.044 41.812 1.00 64.65  ? 35  GLU B CA     1 
ATOM   2648 C C      . GLU B 1 35  ? 26.034  39.955 42.307 1.00 63.00  ? 35  GLU B C      1 
ATOM   2649 O O      . GLU B 1 35  ? 26.446  38.982 42.941 1.00 64.75  ? 35  GLU B O      1 
ATOM   2650 C CB     . GLU B 1 35  ? 28.340  40.965 42.501 1.00 68.36  ? 35  GLU B CB     1 
ATOM   2651 C CG     . GLU B 1 35  ? 28.393  41.594 43.893 1.00 67.76  ? 35  GLU B CG     1 
ATOM   2652 C CD     . GLU B 1 35  ? 29.809  41.879 44.363 1.00 70.87  ? 35  GLU B CD     1 
ATOM   2653 O OE1    . GLU B 1 35  ? 30.749  41.748 43.550 1.00 72.73  ? 35  GLU B OE1    1 
ATOM   2654 O OE2    . GLU B 1 35  ? 29.982  42.242 45.546 1.00 69.48  ? 35  GLU B OE2    1 
ATOM   2655 H H      . GLU B 1 35  ? 26.151  42.503 42.828 1.00 71.60  ? 35  GLU B H      1 
ATOM   2656 H HA     . GLU B 1 35  ? 27.117  40.905 40.862 1.00 75.76  ? 35  GLU B HA     1 
ATOM   2657 H HB2    . GLU B 1 35  ? 28.586  40.031 42.592 1.00 80.54  ? 35  GLU B HB2    1 
ATOM   2658 H HB3    . GLU B 1 35  ? 28.993  41.421 41.948 1.00 80.54  ? 35  GLU B HB3    1 
ATOM   2659 H HG2    . GLU B 1 35  ? 27.909  42.434 43.878 1.00 81.27  ? 35  GLU B HG2    1 
ATOM   2660 H HG3    . GLU B 1 35  ? 27.984  40.987 44.529 1.00 81.27  ? 35  GLU B HG3    1 
ATOM   2661 N N      . SER B 1 36  ? 24.750  40.121 42.013 1.00 57.79  ? 36  SER B N      1 
ATOM   2662 C CA     . SER B 1 36  ? 23.758  39.140 42.416 1.00 56.44  ? 36  SER B CA     1 
ATOM   2663 C C      . SER B 1 36  ? 24.084  37.784 41.793 1.00 58.43  ? 36  SER B C      1 
ATOM   2664 O O      . SER B 1 36  ? 24.502  37.719 40.631 1.00 56.75  ? 36  SER B O      1 
ATOM   2665 C CB     . SER B 1 36  ? 22.363  39.595 41.987 1.00 47.36  ? 36  SER B CB     1 
ATOM   2666 O OG     . SER B 1 36  ? 21.403  38.580 42.208 1.00 47.47  ? 36  SER B OG     1 
ATOM   2667 H H      . SER B 1 36  ? 24.430  40.793 41.583 1.00 68.16  ? 36  SER B H      1 
ATOM   2668 H HA     . SER B 1 36  ? 23.768  39.046 43.382 1.00 65.86  ? 36  SER B HA     1 
ATOM   2669 H HB2    . SER B 1 36  ? 22.116  40.379 42.501 1.00 60.86  ? 36  SER B HB2    1 
ATOM   2670 H HB3    . SER B 1 36  ? 22.380  39.811 41.041 1.00 60.86  ? 36  SER B HB3    1 
ATOM   2671 H HG     . SER B 1 36  ? 20.644  38.846 41.967 1.00 63.16  ? 36  SER B HG     1 
ATOM   2672 N N      . PRO B 1 37  ? 23.910  36.687 42.526 1.00 46.32  ? 37  PRO B N      1 
ATOM   2673 C CA     . PRO B 1 37  ? 24.210  35.370 41.961 1.00 48.72  ? 37  PRO B CA     1 
ATOM   2674 C C      . PRO B 1 37  ? 23.054  34.825 41.138 1.00 46.68  ? 37  PRO B C      1 
ATOM   2675 O O      . PRO B 1 37  ? 21.881  35.091 41.406 1.00 43.86  ? 37  PRO B O      1 
ATOM   2676 C CB     . PRO B 1 37  ? 24.453  34.509 43.205 1.00 51.41  ? 37  PRO B CB     1 
ATOM   2677 C CG     . PRO B 1 37  ? 23.529  35.096 44.218 1.00 49.30  ? 37  PRO B CG     1 
ATOM   2678 C CD     . PRO B 1 37  ? 23.474  36.585 43.932 1.00 46.59  ? 37  PRO B CD     1 
ATOM   2679 H HA     . PRO B 1 37  ? 25.015  35.402 41.420 1.00 60.25  ? 37  PRO B HA     1 
ATOM   2680 H HB2    . PRO B 1 37  ? 24.224  33.585 43.018 1.00 63.54  ? 37  PRO B HB2    1 
ATOM   2681 H HB3    . PRO B 1 37  ? 25.377  34.590 43.489 1.00 63.54  ? 37  PRO B HB3    1 
ATOM   2682 H HG2    . PRO B 1 37  ? 22.649  34.698 44.121 1.00 61.50  ? 37  PRO B HG2    1 
ATOM   2683 H HG3    . PRO B 1 37  ? 23.880  34.933 45.107 1.00 61.50  ? 37  PRO B HG3    1 
ATOM   2684 H HD2    . PRO B 1 37  ? 22.566  36.914 44.028 1.00 58.12  ? 37  PRO B HD2    1 
ATOM   2685 H HD3    . PRO B 1 37  ? 24.088  37.063 44.511 1.00 58.12  ? 37  PRO B HD3    1 
ATOM   2686 N N      . SER B 1 38  ? 23.406  34.049 40.118 1.00 50.13  ? 38  SER B N      1 
ATOM   2687 C CA     . SER B 1 38  ? 22.392  33.357 39.339 1.00 47.71  ? 38  SER B CA     1 
ATOM   2688 C C      . SER B 1 38  ? 21.672  32.333 40.212 1.00 50.83  ? 38  SER B C      1 
ATOM   2689 O O      . SER B 1 38  ? 22.125  31.971 41.301 1.00 54.38  ? 38  SER B O      1 
ATOM   2690 C CB     . SER B 1 38  ? 23.022  32.673 38.127 1.00 49.14  ? 38  SER B CB     1 
ATOM   2691 O OG     . SER B 1 38  ? 24.128  31.876 38.511 1.00 53.65  ? 38  SER B OG     1 
ATOM   2692 H H      . SER B 1 38  ? 24.214  33.909 39.860 1.00 62.12  ? 38  SER B H      1 
ATOM   2693 H HA     . SER B 1 38  ? 21.739  33.999 39.021 1.00 61.49  ? 38  SER B HA     1 
ATOM   2694 H HB2    . SER B 1 38  ? 22.358  32.107 37.704 1.00 63.79  ? 38  SER B HB2    1 
ATOM   2695 H HB3    . SER B 1 38  ? 23.325  33.352 37.504 1.00 63.79  ? 38  SER B HB3    1 
ATOM   2696 H HG     . SER B 1 38  ? 24.464  31.506 37.836 1.00 67.98  ? 38  SER B HG     1 
ATOM   2697 N N      . TRP B 1 39  ? 20.520  31.874 39.721 1.00 53.82  ? 39  TRP B N      1 
ATOM   2698 C CA     . TRP B 1 39  ? 19.759  30.860 40.442 1.00 57.10  ? 39  TRP B CA     1 
ATOM   2699 C C      . TRP B 1 39  ? 20.612  29.625 40.707 1.00 62.34  ? 39  TRP B C      1 
ATOM   2700 O O      . TRP B 1 39  ? 20.640  29.103 41.828 1.00 64.75  ? 39  TRP B O      1 
ATOM   2701 C CB     . TRP B 1 39  ? 18.508  30.490 39.645 1.00 54.50  ? 39  TRP B CB     1 
ATOM   2702 C CG     . TRP B 1 39  ? 17.614  29.507 40.335 1.00 57.46  ? 39  TRP B CG     1 
ATOM   2703 C CD1    . TRP B 1 39  ? 17.633  29.164 41.655 1.00 61.55  ? 39  TRP B CD1    1 
ATOM   2704 C CD2    . TRP B 1 39  ? 16.566  28.738 39.735 1.00 57.37  ? 39  TRP B CD2    1 
ATOM   2705 N NE1    . TRP B 1 39  ? 16.661  28.230 41.915 1.00 64.03  ? 39  TRP B NE1    1 
ATOM   2706 C CE2    . TRP B 1 39  ? 15.992  27.951 40.752 1.00 61.81  ? 39  TRP B CE2    1 
ATOM   2707 C CE3    . TRP B 1 39  ? 16.058  28.639 38.437 1.00 56.57  ? 39  TRP B CE3    1 
ATOM   2708 C CZ2    . TRP B 1 39  ? 14.935  27.076 40.512 1.00 63.14  ? 39  TRP B CZ2    1 
ATOM   2709 C CZ3    . TRP B 1 39  ? 15.009  27.771 38.200 1.00 58.16  ? 39  TRP B CZ3    1 
ATOM   2710 C CH2    . TRP B 1 39  ? 14.458  27.000 39.232 1.00 60.58  ? 39  TRP B CH2    1 
ATOM   2711 H H      . TRP B 1 39  ? 20.163  32.130 38.982 1.00 68.65  ? 39  TRP B H      1 
ATOM   2712 H HA     . TRP B 1 39  ? 19.477  31.222 41.297 1.00 70.48  ? 39  TRP B HA     1 
ATOM   2713 H HB2    . TRP B 1 39  ? 17.992  31.295 39.483 1.00 69.55  ? 39  TRP B HB2    1 
ATOM   2714 H HB3    . TRP B 1 39  ? 18.781  30.099 38.801 1.00 69.55  ? 39  TRP B HB3    1 
ATOM   2715 H HD1    . TRP B 1 39  ? 18.218  29.513 42.288 1.00 72.82  ? 39  TRP B HD1    1 
ATOM   2716 H HE1    . TRP B 1 39  ? 16.499  27.877 42.682 1.00 74.43  ? 39  TRP B HE1    1 
ATOM   2717 H HE3    . TRP B 1 39  ? 16.418  29.148 37.746 1.00 70.45  ? 39  TRP B HE3    1 
ATOM   2718 H HZ2    . TRP B 1 39  ? 14.568  26.563 41.195 1.00 74.86  ? 39  TRP B HZ2    1 
ATOM   2719 H HZ3    . TRP B 1 39  ? 14.662  27.696 37.340 1.00 71.67  ? 39  TRP B HZ3    1 
ATOM   2720 H HH2    . TRP B 1 39  ? 13.753  26.424 39.043 1.00 73.85  ? 39  TRP B HH2    1 
ATOM   2721 N N      . THR B 1 40  ? 21.320  29.144 39.683 1.00 67.84  ? 40  THR B N      1 
ATOM   2722 C CA     . THR B 1 40  ? 22.132  27.942 39.844 1.00 73.28  ? 40  THR B CA     1 
ATOM   2723 C C      . THR B 1 40  ? 23.260  28.174 40.843 1.00 74.70  ? 40  THR B C      1 
ATOM   2724 O O      . THR B 1 40  ? 23.466  27.373 41.761 1.00 77.03  ? 40  THR B O      1 
ATOM   2725 C CB     . THR B 1 40  ? 22.688  27.500 38.489 1.00 74.83  ? 40  THR B CB     1 
ATOM   2726 O OG1    . THR B 1 40  ? 23.448  28.567 37.907 1.00 73.13  ? 40  THR B OG1    1 
ATOM   2727 C CG2    . THR B 1 40  ? 21.554  27.114 37.549 1.00 74.23  ? 40  THR B CG2    1 
ATOM   2728 H H      . THR B 1 40  ? 21.346  29.491 38.897 1.00 80.17  ? 40  THR B H      1 
ATOM   2729 H HA     . THR B 1 40  ? 21.572  27.227 40.186 1.00 89.51  ? 40  THR B HA     1 
ATOM   2730 H HB     . THR B 1 40  ? 23.260  26.727 38.613 1.00 94.74  ? 40  THR B HB     1 
ATOM   2731 H HG1    . THR B 1 40  ? 23.755  28.327 37.163 1.00 94.72  ? 40  THR B HG1    1 
ATOM   2732 H HG21   . THR B 1 40  ? 21.914  26.835 36.693 1.00 93.84  ? 40  THR B HG21   1 
ATOM   2733 H HG22   . THR B 1 40  ? 21.043  26.383 37.929 1.00 93.84  ? 40  THR B HG22   1 
ATOM   2734 H HG23   . THR B 1 40  ? 20.965  27.873 37.411 1.00 93.84  ? 40  THR B HG23   1 
ATOM   2735 N N      . GLU B 1 41  ? 24.001  29.274 40.681 1.00 75.96  ? 41  GLU B N      1 
ATOM   2736 C CA     . GLU B 1 41  ? 25.091  29.569 41.606 1.00 77.82  ? 41  GLU B CA     1 
ATOM   2737 C C      . GLU B 1 41  ? 24.585  29.708 43.036 1.00 77.88  ? 41  GLU B C      1 
ATOM   2738 O O      . GLU B 1 41  ? 25.329  29.441 43.987 1.00 80.71  ? 41  GLU B O      1 
ATOM   2739 C CB     . GLU B 1 41  ? 25.814  30.845 41.177 1.00 76.20  ? 41  GLU B CB     1 
ATOM   2740 C CG     . GLU B 1 41  ? 27.129  31.082 41.902 1.00 78.59  ? 41  GLU B CG     1 
ATOM   2741 C CD     . GLU B 1 41  ? 27.688  32.471 41.663 1.00 78.19  ? 41  GLU B CD     1 
ATOM   2742 O OE1    . GLU B 1 41  ? 26.900  33.385 41.340 1.00 75.86  ? 41  GLU B OE1    1 
ATOM   2743 O OE2    . GLU B 1 41  ? 28.918  32.649 41.799 1.00 79.94  ? 41  GLU B OE2    1 
ATOM   2744 H H      . GLU B 1 41  ? 23.894  29.854 40.055 1.00 91.06  ? 41  GLU B H      1 
ATOM   2745 H HA     . GLU B 1 41  ? 25.730  28.840 41.584 1.00 94.70  ? 41  GLU B HA     1 
ATOM   2746 H HB2    . GLU B 1 41  ? 26.005  30.791 40.227 1.00 93.81  ? 41  GLU B HB2    1 
ATOM   2747 H HB3    . GLU B 1 41  ? 25.238  31.605 41.353 1.00 93.81  ? 41  GLU B HB3    1 
ATOM   2748 H HG2    . GLU B 1 41  ? 26.988  30.975 42.856 1.00 99.13  ? 41  GLU B HG2    1 
ATOM   2749 H HG3    . GLU B 1 41  ? 27.783  30.437 41.589 1.00 99.13  ? 41  GLU B HG3    1 
ATOM   2750 N N      . TRP B 1 42  ? 23.331  30.130 43.209 1.00 55.71  ? 42  TRP B N      1 
ATOM   2751 C CA     . TRP B 1 42  ? 22.747  30.212 44.542 1.00 55.74  ? 42  TRP B CA     1 
ATOM   2752 C C      . TRP B 1 42  ? 22.284  28.844 45.024 1.00 59.42  ? 42  TRP B C      1 
ATOM   2753 O O      . TRP B 1 42  ? 22.513  28.479 46.183 1.00 61.99  ? 42  TRP B O      1 
ATOM   2754 C CB     . TRP B 1 42  ? 21.580  31.202 44.542 1.00 51.72  ? 42  TRP B CB     1 
ATOM   2755 C CG     . TRP B 1 42  ? 20.868  31.292 45.856 1.00 51.71  ? 42  TRP B CG     1 
ATOM   2756 C CD1    . TRP B 1 42  ? 21.093  32.198 46.851 1.00 50.82  ? 42  TRP B CD1    1 
ATOM   2757 C CD2    . TRP B 1 42  ? 19.813  30.441 46.319 1.00 53.23  ? 42  TRP B CD2    1 
ATOM   2758 N NE1    . TRP B 1 42  ? 20.244  31.964 47.906 1.00 51.71  ? 42  TRP B NE1    1 
ATOM   2759 C CE2    . TRP B 1 42  ? 19.448  30.890 47.605 1.00 53.19  ? 42  TRP B CE2    1 
ATOM   2760 C CE3    . TRP B 1 42  ? 19.142  29.343 45.773 1.00 54.93  ? 42  TRP B CE3    1 
ATOM   2761 C CZ2    . TRP B 1 42  ? 18.442  30.280 48.350 1.00 54.78  ? 42  TRP B CZ2    1 
ATOM   2762 C CZ3    . TRP B 1 42  ? 18.144  28.739 46.515 1.00 56.49  ? 42  TRP B CZ3    1 
ATOM   2763 C CH2    . TRP B 1 42  ? 17.804  29.209 47.790 1.00 56.39  ? 42  TRP B CH2    1 
ATOM   2764 H H      . TRP B 1 42  ? 22.804  30.371 42.574 1.00 72.09  ? 42  TRP B H      1 
ATOM   2765 H HA     . TRP B 1 42  ? 23.418  30.538 45.162 1.00 72.03  ? 42  TRP B HA     1 
ATOM   2766 H HB2    . TRP B 1 42  ? 21.919  32.085 44.326 1.00 67.45  ? 42  TRP B HB2    1 
ATOM   2767 H HB3    . TRP B 1 42  ? 20.935  30.924 43.873 1.00 67.45  ? 42  TRP B HB3    1 
ATOM   2768 H HD1    . TRP B 1 42  ? 21.730  32.875 46.821 1.00 66.72  ? 42  TRP B HD1    1 
ATOM   2769 H HE1    . TRP B 1 42  ? 20.216  32.417 48.637 1.00 67.32  ? 42  TRP B HE1    1 
ATOM   2770 H HE3    . TRP B 1 42  ? 19.363  29.025 44.927 1.00 69.94  ? 42  TRP B HE3    1 
ATOM   2771 H HZ2    . TRP B 1 42  ? 18.214  30.590 49.197 1.00 69.60  ? 42  TRP B HZ2    1 
ATOM   2772 H HZ3    . TRP B 1 42  ? 17.691  28.008 46.162 1.00 71.09  ? 42  TRP B HZ3    1 
ATOM   2773 H HH2    . TRP B 1 42  ? 17.128  28.782 48.265 1.00 70.89  ? 42  TRP B HH2    1 
ATOM   2774 N N      . ARG B 1 43  ? 21.628  28.079 44.148 1.00 79.97  ? 43  ARG B N      1 
ATOM   2775 C CA     . ARG B 1 43  ? 21.226  26.722 44.498 1.00 83.16  ? 43  ARG B CA     1 
ATOM   2776 C C      . ARG B 1 43  ? 22.432  25.882 44.893 1.00 86.99  ? 43  ARG B C      1 
ATOM   2777 O O      . ARG B 1 43  ? 22.383  25.131 45.875 1.00 90.13  ? 43  ARG B O      1 
ATOM   2778 C CB     . ARG B 1 43  ? 20.488  26.083 43.323 1.00 84.31  ? 43  ARG B CB     1 
ATOM   2779 C CG     . ARG B 1 43  ? 19.999  24.668 43.580 1.00 88.53  ? 43  ARG B CG     1 
ATOM   2780 C CD     . ARG B 1 43  ? 19.415  24.058 42.320 1.00 89.40  ? 43  ARG B CD     1 
ATOM   2781 N NE     . ARG B 1 43  ? 20.405  23.967 41.248 1.00 90.27  ? 43  ARG B NE     1 
ATOM   2782 C CZ     . ARG B 1 43  ? 21.254  22.956 41.085 1.00 95.59  ? 43  ARG B CZ     1 
ATOM   2783 N NH1    . ARG B 1 43  ? 21.249  21.926 41.922 1.00 100.34 ? 43  ARG B NH1    1 
ATOM   2784 N NH2    . ARG B 1 43  ? 22.115  22.973 40.077 1.00 96.46  ? 43  ARG B NH2    1 
ATOM   2785 H H      . ARG B 1 43  ? 21.408  28.322 43.353 1.00 96.87  ? 43  ARG B H      1 
ATOM   2786 H HA     . ARG B 1 43  ? 20.620  26.755 45.255 1.00 100.84 ? 43  ARG B HA     1 
ATOM   2787 H HB2    . ARG B 1 43  ? 19.714  26.627 43.110 1.00 102.53 ? 43  ARG B HB2    1 
ATOM   2788 H HB3    . ARG B 1 43  ? 21.086  26.053 42.560 1.00 102.53 ? 43  ARG B HB3    1 
ATOM   2789 H HG2    . ARG B 1 43  ? 20.744  24.118 43.869 1.00 108.61 ? 43  ARG B HG2    1 
ATOM   2790 H HG3    . ARG B 1 43  ? 19.308  24.685 44.261 1.00 108.61 ? 43  ARG B HG3    1 
ATOM   2791 H HD2    . ARG B 1 43  ? 19.099  23.162 42.516 1.00 109.84 ? 43  ARG B HD2    1 
ATOM   2792 H HD3    . ARG B 1 43  ? 18.681  24.611 42.008 1.00 109.84 ? 43  ARG B HD3    1 
ATOM   2793 H HE     . ARG B 1 43  ? 20.441  24.614 40.683 1.00 111.83 ? 43  ARG B HE     1 
ATOM   2794 H HH11   . ARG B 1 43  ? 20.693  21.908 42.578 1.00 125.41 ? 43  ARG B HH11   1 
ATOM   2795 H HH12   . ARG B 1 43  ? 21.801  21.277 41.809 1.00 125.41 ? 43  ARG B HH12   1 
ATOM   2796 H HH21   . ARG B 1 43  ? 22.123  23.637 39.530 1.00 121.47 ? 43  ARG B HH21   1 
ATOM   2797 H HH22   . ARG B 1 43  ? 22.664  22.320 39.969 1.00 121.47 ? 43  ARG B HH22   1 
ATOM   2798 N N      . LEU B 1 44  ? 23.468  25.963 44.103 1.00 73.91  ? 44  LEU B N      1 
ATOM   2799 C CA     . LEU B 1 44  ? 24.636  25.225 44.449 1.00 78.26  ? 44  LEU B CA     1 
ATOM   2800 C C      . LEU B 1 44  ? 25.166  25.733 45.742 1.00 78.76  ? 44  LEU B C      1 
ATOM   2801 O O      . LEU B 1 44  ? 26.243  25.363 46.147 1.00 81.96  ? 44  LEU B O      1 
ATOM   2802 C CB     . LEU B 1 44  ? 25.697  25.369 43.387 1.00 78.60  ? 44  LEU B CB     1 
ATOM   2803 C CG     . LEU B 1 44  ? 25.193  24.736 42.112 1.00 78.81  ? 44  LEU B CG     1 
ATOM   2804 C CD1    . LEU B 1 44  ? 26.163  24.863 40.980 1.00 79.32  ? 44  LEU B CD1    1 
ATOM   2805 C CD2    . LEU B 1 44  ? 24.845  23.290 42.359 1.00 83.45  ? 44  LEU B CD2    1 
ATOM   2806 H H      . LEU B 1 44  ? 23.508  26.429 43.386 1.00 90.92  ? 44  LEU B H      1 
ATOM   2807 H HA     . LEU B 1 44  ? 24.405  24.284 44.549 1.00 95.62  ? 44  LEU B HA     1 
ATOM   2808 H HB2    . LEU B 1 44  ? 25.872  26.304 43.226 1.00 96.42  ? 44  LEU B HB2    1 
ATOM   2809 H HB3    . LEU B 1 44  ? 26.504  24.917 43.668 1.00 96.42  ? 44  LEU B HB3    1 
ATOM   2810 H HG     . LEU B 1 44  ? 24.380  25.184 41.847 1.00 95.39  ? 44  LEU B HG     1 
ATOM   2811 H HD11   . LEU B 1 44  ? 26.140  24.066 40.451 1.00 95.66  ? 44  LEU B HD11   1 
ATOM   2812 H HD12   . LEU B 1 44  ? 25.910  25.613 40.441 1.00 95.66  ? 44  LEU B HD12   1 
ATOM   2813 H HD13   . LEU B 1 44  ? 27.038  24.993 41.346 1.00 95.66  ? 44  LEU B HD13   1 
ATOM   2814 H HD21   . LEU B 1 44  ? 24.418  22.938 41.577 1.00 100.12 ? 44  LEU B HD21   1 
ATOM   2815 H HD22   . LEU B 1 44  ? 25.651  22.808 42.544 1.00 100.12 ? 44  LEU B HD22   1 
ATOM   2816 H HD23   . LEU B 1 44  ? 24.250  23.231 43.107 1.00 100.12 ? 44  LEU B HD23   1 
ATOM   2817 N N      . TYR B 1 45  ? 24.417  26.587 46.417 1.00 89.95  ? 45  TYR B N      1 
ATOM   2818 C CA     . TYR B 1 45  ? 24.880  27.141 47.660 1.00 91.74  ? 45  TYR B CA     1 
ATOM   2819 C C      . TYR B 1 45  ? 24.192  26.419 48.752 1.00 95.87  ? 45  TYR B C      1 
ATOM   2820 O O      . TYR B 1 45  ? 23.650  26.966 49.672 1.00 94.76  ? 45  TYR B O      1 
ATOM   2821 C CB     . TYR B 1 45  ? 24.679  28.636 47.720 1.00 96.94  ? 45  TYR B CB     1 
ATOM   2822 C CG     . TYR B 1 45  ? 25.861  29.285 48.348 1.00 97.65  ? 45  TYR B CG     1 
ATOM   2823 C CD1    . TYR B 1 45  ? 27.006  29.492 47.640 1.00 98.04  ? 45  TYR B CD1    1 
ATOM   2824 C CD2    . TYR B 1 45  ? 25.851  29.607 49.674 1.00 98.52  ? 45  TYR B CD2    1 
ATOM   2825 C CE1    . TYR B 1 45  ? 28.103  30.053 48.239 1.00 99.07  ? 45  TYR B CE1    1 
ATOM   2826 C CE2    . TYR B 1 45  ? 26.928  30.168 50.274 1.00 99.55  ? 45  TYR B CE2    1 
ATOM   2827 C CZ     . TYR B 1 45  ? 28.052  30.388 49.553 1.00 99.80  ? 45  TYR B CZ     1 
ATOM   2828 O OH     . TYR B 1 45  ? 29.124  30.947 50.190 1.00 101.09 ? 45  TYR B OH     1 
ATOM   2829 H H      . TYR B 1 45  ? 23.631  26.858 46.209 1.00 116.89 ? 45  TYR B H      1 
ATOM   2830 H HA     . TYR B 1 45  ? 25.833  26.934 47.752 1.00 121.03 ? 45  TYR B HA     1 
ATOM   2831 N N      . ASN B 1 46  ? 24.195  25.125 48.572 1.00 101.80 ? 46  ASN B N      1 
ATOM   2832 C CA     . ASN B 1 46  ? 23.712  24.221 49.551 1.00 107.85 ? 46  ASN B CA     1 
ATOM   2833 C C      . ASN B 1 46  ? 24.903  23.308 49.675 1.00 109.32 ? 46  ASN B C      1 
ATOM   2834 O O      . ASN B 1 46  ? 24.735  22.112 49.719 1.00 113.31 ? 46  ASN B O      1 
ATOM   2835 C CB     . ASN B 1 46  ? 22.473  23.459 49.097 1.00 111.90 ? 46  ASN B CB     1 
ATOM   2836 C CG     . ASN B 1 46  ? 21.506  23.141 50.240 1.00 116.51 ? 46  ASN B CG     1 
ATOM   2837 O OD1    . ASN B 1 46  ? 21.249  23.977 51.096 1.00 116.38 ? 46  ASN B OD1    1 
ATOM   2838 N ND2    . ASN B 1 46  ? 20.962  21.943 50.243 1.00 120.71 ? 46  ASN B ND2    1 
ATOM   2839 H H      . ASN B 1 46  ? 24.404  24.761 47.823 1.00 131.16 ? 46  ASN B H      1 
ATOM   2840 H HA     . ASN B 1 46  ? 23.537  24.683 50.392 1.00 141.92 ? 46  ASN B HA     1 
ATOM   2841 H HB2    . ASN B 1 46  ? 22.000  24.006 48.452 1.00 148.72 ? 46  ASN B HB2    1 
ATOM   2842 H HB3    . ASN B 1 46  ? 22.753  22.623 48.693 1.00 148.72 ? 46  ASN B HB3    1 
ATOM   2843 H HD21   . ASN B 1 46  ? 19.990  21.847 50.306 1.00 160.82 ? 46  ASN B HD21   1 
ATOM   2844 H HD22   . ASN B 1 46  ? 21.531  21.149 50.196 1.00 160.82 ? 46  ASN B HD22   1 
ATOM   2845 N N      . ASP B 1 47  ? 26.125  23.846 49.678 1.00 112.45 ? 47  ASP B N      1 
ATOM   2846 C CA     . ASP B 1 47  ? 27.209  22.883 49.829 1.00 113.38 ? 47  ASP B CA     1 
ATOM   2847 C C      . ASP B 1 47  ? 27.718  22.935 51.265 1.00 115.58 ? 47  ASP B C      1 
ATOM   2848 O O      . ASP B 1 47  ? 28.353  23.914 51.671 1.00 112.89 ? 47  ASP B O      1 
ATOM   2849 C CB     . ASP B 1 47  ? 28.339  23.177 48.844 1.00 108.54 ? 47  ASP B CB     1 
ATOM   2850 C CG     . ASP B 1 47  ? 27.931  22.948 47.402 1.00 106.01 ? 47  ASP B CG     1 
ATOM   2851 O OD1    . ASP B 1 47  ? 27.053  22.095 47.159 1.00 108.52 ? 47  ASP B OD1    1 
ATOM   2852 O OD2    . ASP B 1 47  ? 28.493  23.620 46.512 1.00 102.03 ? 47  ASP B OD2    1 
ATOM   2853 H H      . ASP B 1 47  ? 26.399  24.656 49.578 1.00 157.28 ? 47  ASP B H      1 
ATOM   2854 H HA     . ASP B 1 47  ? 26.874  21.990 49.654 1.00 155.81 ? 47  ASP B HA     1 
ATOM   2855 H HB2    . ASP B 1 47  ? 28.606  24.105 48.936 1.00 148.16 ? 47  ASP B HB2    1 
ATOM   2856 H HB3    . ASP B 1 47  ? 29.089  22.594 49.040 1.00 148.16 ? 47  ASP B HB3    1 
ATOM   2857 N N      . GLU B 1 48  ? 27.437  21.882 52.030 1.00 146.15 ? 48  GLU B N      1 
ATOM   2858 C CA     . GLU B 1 48  ? 27.979  21.629 53.360 1.00 151.54 ? 48  GLU B CA     1 
ATOM   2859 C C      . GLU B 1 48  ? 27.285  22.424 54.462 1.00 153.69 ? 48  GLU B C      1 
ATOM   2860 O O      . GLU B 1 48  ? 27.669  22.277 55.626 1.00 161.59 ? 48  GLU B O      1 
ATOM   2861 C CB     . GLU B 1 48  ? 29.486  21.920 53.438 1.00 151.77 ? 48  GLU B CB     1 
ATOM   2862 C CG     . GLU B 1 48  ? 30.319  21.164 52.418 1.00 151.07 ? 48  GLU B CG     1 
ATOM   2863 C CD     . GLU B 1 48  ? 31.722  21.722 52.287 1.00 146.84 ? 48  GLU B CD     1 
ATOM   2864 O OE1    . GLU B 1 48  ? 31.909  22.929 52.549 1.00 141.73 ? 48  GLU B OE1    1 
ATOM   2865 O OE2    . GLU B 1 48  ? 32.638  20.955 51.925 1.00 148.53 ? 48  GLU B OE2    1 
ATOM   2866 N N      . THR B 1 49  ? 26.299  23.262 54.151 1.00 107.78 ? 49  THR B N      1 
ATOM   2867 C CA     . THR B 1 49  ? 25.662  24.094 55.164 1.00 106.35 ? 49  THR B CA     1 
ATOM   2868 C C      . THR B 1 49  ? 24.226  24.376 54.746 1.00 108.56 ? 49  THR B C      1 
ATOM   2869 O O      . THR B 1 49  ? 23.779  23.978 53.667 1.00 109.34 ? 49  THR B O      1 
ATOM   2870 C CB     . THR B 1 49  ? 26.417  25.416 55.364 1.00 100.11 ? 49  THR B CB     1 
ATOM   2871 O OG1    . THR B 1 49  ? 26.493  26.120 54.117 1.00 92.86  ? 49  THR B OG1    1 
ATOM   2872 C CG2    . THR B 1 49  ? 27.826  25.184 55.903 1.00 99.85  ? 49  THR B CG2    1 
ATOM   2873 H H      . THR B 1 49  ? 25.981  23.367 53.359 1.00 156.37 ? 49  THR B H      1 
ATOM   2874 H HA     . THR B 1 49  ? 25.648  23.618 56.009 1.00 149.51 ? 49  THR B HA     1 
ATOM   2875 H HB     . THR B 1 49  ? 25.935  25.961 56.006 1.00 130.55 ? 49  THR B HB     1 
ATOM   2876 H HG1    . THR B 1 49  ? 25.720  26.284 53.832 1.00 121.44 ? 49  THR B HG1    1 
ATOM   2877 H HG21   . THR B 1 49  ? 28.279  26.034 56.020 1.00 125.08 ? 49  THR B HG21   1 
ATOM   2878 H HG22   . THR B 1 49  ? 27.782  24.729 56.758 1.00 125.08 ? 49  THR B HG22   1 
ATOM   2879 H HG23   . THR B 1 49  ? 28.333  24.639 55.281 1.00 125.08 ? 49  THR B HG23   1 
ATOM   2880 N N      . ASN B 1 50  ? 23.499  25.061 55.625 1.00 122.60 ? 50  ASN B N      1 
ATOM   2881 C CA     . ASN B 1 50  ? 22.247  25.685 55.228 1.00 124.85 ? 50  ASN B CA     1 
ATOM   2882 C C      . ASN B 1 50  ? 22.537  26.829 54.263 1.00 121.14 ? 50  ASN B C      1 
ATOM   2883 O O      . ASN B 1 50  ? 23.629  27.404 54.257 1.00 119.31 ? 50  ASN B O      1 
ATOM   2884 C CB     . ASN B 1 50  ? 21.483  26.192 56.453 1.00 131.39 ? 50  ASN B CB     1 
ATOM   2885 C CG     . ASN B 1 50  ? 22.317  27.108 57.331 1.00 133.49 ? 50  ASN B CG     1 
ATOM   2886 O OD1    . ASN B 1 50  ? 23.249  27.763 56.862 1.00 129.69 ? 50  ASN B OD1    1 
ATOM   2887 N ND2    . ASN B 1 50  ? 21.985  27.155 58.617 1.00 139.64 ? 50  ASN B ND2    1 
ATOM   2888 H H      . ASN B 1 50  ? 23.710  25.178 56.450 1.00 145.64 ? 50  ASN B H      1 
ATOM   2889 H HA     . ASN B 1 50  ? 21.694  25.032 54.771 1.00 157.18 ? 50  ASN B HA     1 
ATOM   2890 H HB2    . ASN B 1 50  ? 20.704  26.688 56.156 1.00 165.12 ? 50  ASN B HB2    1 
ATOM   2891 H HB3    . ASN B 1 50  ? 21.207  25.432 56.990 1.00 165.12 ? 50  ASN B HB3    1 
ATOM   2892 H HD21   . ASN B 1 50  ? 22.427  27.658 59.156 1.00 174.48 ? 50  ASN B HD21   1 
ATOM   2893 H HD22   . ASN B 1 50  ? 21.330  26.682 58.909 1.00 174.48 ? 50  ASN B HD22   1 
ATOM   2894 N N      . SER B 1 51  ? 21.549  27.156 53.438 1.00 143.11 ? 51  SER B N      1 
ATOM   2895 C CA     . SER B 1 51  ? 21.769  28.038 52.300 1.00 137.82 ? 51  SER B CA     1 
ATOM   2896 C C      . SER B 1 51  ? 21.486  29.508 52.592 1.00 135.02 ? 51  SER B C      1 
ATOM   2897 O O      . SER B 1 51  ? 21.545  30.321 51.663 1.00 131.06 ? 51  SER B O      1 
ATOM   2898 C CB     . SER B 1 51  ? 20.904  27.588 51.119 1.00 140.33 ? 51  SER B CB     1 
ATOM   2899 O OG     . SER B 1 51  ? 21.229  26.268 50.719 1.00 143.27 ? 51  SER B OG     1 
ATOM   2900 H H      . SER B 1 51  ? 20.738  26.878 53.516 1.00 193.67 ? 51  SER B H      1 
ATOM   2901 H HA     . SER B 1 51  ? 22.698  27.967 52.029 1.00 188.27 ? 51  SER B HA     1 
ATOM   2902 H HB2    . SER B 1 51  ? 19.971  27.616 51.383 1.00 195.27 ? 51  SER B HB2    1 
ATOM   2903 H HB3    . SER B 1 51  ? 21.054  28.188 50.372 1.00 195.27 ? 51  SER B HB3    1 
ATOM   2904 H HG     . SER B 1 51  ? 20.746  26.037 50.071 1.00 201.18 ? 51  SER B HG     1 
ATOM   2905 N N      . ASN B 1 52  ? 21.192  29.884 53.842 1.00 168.09 ? 52  ASN B N      1 
ATOM   2906 C CA     . ASN B 1 52  ? 20.784  31.263 54.106 1.00 168.74 ? 52  ASN B CA     1 
ATOM   2907 C C      . ASN B 1 52  ? 21.262  31.842 55.433 1.00 172.33 ? 52  ASN B C      1 
ATOM   2908 O O      . ASN B 1 52  ? 21.414  33.065 55.517 1.00 171.65 ? 52  ASN B O      1 
ATOM   2909 C CB     . ASN B 1 52  ? 19.254  31.377 54.054 1.00 171.59 ? 52  ASN B CB     1 
ATOM   2910 C CG     . ASN B 1 52  ? 18.785  32.796 53.798 1.00 171.11 ? 52  ASN B CG     1 
ATOM   2911 O OD1    . ASN B 1 52  ? 19.391  33.531 53.019 1.00 166.73 ? 52  ASN B OD1    1 
ATOM   2912 N ND2    . ASN B 1 52  ? 17.704  33.191 54.461 1.00 175.90 ? 52  ASN B ND2    1 
ATOM   2913 H H      . ASN B 1 52  ? 21.219  29.374 54.534 1.00 211.21 ? 52  ASN B H      1 
ATOM   2914 H HA     . ASN B 1 52  ? 21.142  31.825 53.401 1.00 209.81 ? 52  ASN B HA     1 
ATOM   2915 H HB2    . ASN B 1 52  ? 18.919  30.816 53.338 1.00 213.33 ? 52  ASN B HB2    1 
ATOM   2916 H HB3    . ASN B 1 52  ? 18.886  31.088 54.904 1.00 213.33 ? 52  ASN B HB3    1 
ATOM   2917 H HD21   . ASN B 1 52  ? 17.399  33.988 54.350 1.00 217.08 ? 52  ASN B HD21   1 
ATOM   2918 H HD22   . ASN B 1 52  ? 17.310  32.651 55.002 1.00 217.08 ? 52  ASN B HD22   1 
ATOM   2919 N N      . GLN B 1 53  ? 21.506  31.041 56.470 1.00 131.58 ? 53  GLN B N      1 
ATOM   2920 C CA     . GLN B 1 53  ? 21.639  31.591 57.818 1.00 135.46 ? 53  GLN B CA     1 
ATOM   2921 C C      . GLN B 1 53  ? 23.070  32.011 58.155 1.00 132.88 ? 53  GLN B C      1 
ATOM   2922 O O      . GLN B 1 53  ? 23.328  33.190 58.414 1.00 131.91 ? 53  GLN B O      1 
ATOM   2923 C CB     . GLN B 1 53  ? 21.129  30.577 58.847 1.00 142.72 ? 53  GLN B CB     1 
ATOM   2924 C CG     . GLN B 1 53  ? 21.085  31.125 60.262 1.00 149.63 ? 53  GLN B CG     1 
ATOM   2925 C CD     . GLN B 1 53  ? 20.288  30.248 61.206 1.00 156.26 ? 53  GLN B CD     1 
ATOM   2926 O OE1    . GLN B 1 53  ? 19.808  29.180 60.826 1.00 154.92 ? 53  GLN B OE1    1 
ATOM   2927 N NE2    . GLN B 1 53  ? 20.139  30.699 62.447 1.00 164.04 ? 53  GLN B NE2    1 
ATOM   2928 H H      . GLN B 1 53  ? 21.598  30.187 56.421 1.00 174.81 ? 53  GLN B H      1 
ATOM   2929 H HA     . GLN B 1 53  ? 21.080  32.381 57.884 1.00 174.81 ? 53  GLN B HA     1 
ATOM   2930 H HB2    . GLN B 1 53  ? 20.229  30.308 58.603 1.00 185.59 ? 53  GLN B HB2    1 
ATOM   2931 H HB3    . GLN B 1 53  ? 21.716  29.805 58.844 1.00 185.59 ? 53  GLN B HB3    1 
ATOM   2932 H HG2    . GLN B 1 53  ? 21.990  31.189 60.605 1.00 193.84 ? 53  GLN B HG2    1 
ATOM   2933 H HG3    . GLN B 1 53  ? 20.672  32.003 60.248 1.00 193.84 ? 53  GLN B HG3    1 
ATOM   2934 H HE21   . GLN B 1 53  ? 20.487  31.452 62.675 1.00 210.64 ? 53  GLN B HE21   1 
ATOM   2935 H HE22   . GLN B 1 53  ? 19.695  30.238 63.021 1.00 210.64 ? 53  GLN B HE22   1 
ATOM   2936 N N      . ASP B 1 54  ? 24.005  31.060 58.163 1.00 121.04 ? 54  ASP B N      1 
ATOM   2937 C CA     . ASP B 1 54  ? 25.330  31.319 58.729 1.00 122.24 ? 54  ASP B CA     1 
ATOM   2938 C C      . ASP B 1 54  ? 26.209  32.114 57.770 1.00 114.37 ? 54  ASP B C      1 
ATOM   2939 O O      . ASP B 1 54  ? 26.442  33.309 57.969 1.00 112.07 ? 54  ASP B O      1 
ATOM   2940 C CB     . ASP B 1 54  ? 26.001  29.996 59.111 1.00 127.34 ? 54  ASP B CB     1 
ATOM   2941 C CG     . ASP B 1 54  ? 25.584  29.506 60.482 1.00 136.98 ? 54  ASP B CG     1 
ATOM   2942 O OD1    . ASP B 1 54  ? 25.347  30.352 61.373 1.00 140.67 ? 54  ASP B OD1    1 
ATOM   2943 O OD2    . ASP B 1 54  ? 25.494  28.276 60.671 1.00 140.65 ? 54  ASP B OD2    1 
ATOM   2944 H H      . ASP B 1 54  ? 23.899  30.265 57.851 1.00 145.47 ? 54  ASP B H      1 
ATOM   2945 H HA     . ASP B 1 54  ? 25.226  31.843 59.539 1.00 148.97 ? 54  ASP B HA     1 
ATOM   2946 H HB2    . ASP B 1 54  ? 25.755  29.318 58.462 1.00 162.18 ? 54  ASP B HB2    1 
ATOM   2947 H HB3    . ASP B 1 54  ? 26.963  30.119 59.116 1.00 162.18 ? 54  ASP B HB3    1 
ATOM   2948 N N      . ASN B 1 55  ? 26.725  31.457 56.738 1.00 84.16  ? 55  ASN B N      1 
ATOM   2949 C CA     . ASN B 1 55  ? 27.641  32.109 55.813 1.00 78.29  ? 55  ASN B CA     1 
ATOM   2950 C C      . ASN B 1 55  ? 26.993  32.280 54.444 1.00 73.71  ? 55  ASN B C      1 
ATOM   2951 O O      . ASN B 1 55  ? 27.196  31.447 53.552 1.00 71.18  ? 55  ASN B O      1 
ATOM   2952 C CB     . ASN B 1 55  ? 28.937  31.308 55.693 1.00 77.18  ? 55  ASN B CB     1 
ATOM   2953 C CG     . ASN B 1 55  ? 29.895  31.577 56.840 1.00 80.38  ? 55  ASN B CG     1 
ATOM   2954 O OD1    . ASN B 1 55  ? 30.003  32.706 57.322 1.00 80.69  ? 55  ASN B OD1    1 
ATOM   2955 N ND2    . ASN B 1 55  ? 30.595  30.540 57.281 1.00 83.15  ? 55  ASN B ND2    1 
ATOM   2956 H H      . ASN B 1 55  ? 26.561  30.634 56.551 1.00 114.81 ? 55  ASN B H      1 
ATOM   2957 H HA     . ASN B 1 55  ? 27.863  32.990 56.153 1.00 110.40 ? 55  ASN B HA     1 
ATOM   2958 H HB2    . ASN B 1 55  ? 28.725  30.361 55.694 1.00 111.81 ? 55  ASN B HB2    1 
ATOM   2959 H HB3    . ASN B 1 55  ? 29.383  31.548 54.866 1.00 111.81 ? 55  ASN B HB3    1 
ATOM   2960 H HD21   . ASN B 1 55  ? 31.151  30.642 57.929 1.00 120.02 ? 55  ASN B HD21   1 
ATOM   2961 H HD22   . ASN B 1 55  ? 30.493  29.767 56.918 1.00 120.02 ? 55  ASN B HD22   1 
ATOM   2962 N N      . PRO B 1 56  ? 26.224  33.344 54.232 1.00 72.98  ? 56  PRO B N      1 
ATOM   2963 C CA     . PRO B 1 56  ? 25.621  33.574 52.917 1.00 69.09  ? 56  PRO B CA     1 
ATOM   2964 C C      . PRO B 1 56  ? 26.648  34.102 51.924 1.00 63.41  ? 56  PRO B C      1 
ATOM   2965 O O      . PRO B 1 56  ? 27.785  34.426 52.268 1.00 62.28  ? 56  PRO B O      1 
ATOM   2966 C CB     . PRO B 1 56  ? 24.539  34.620 53.203 1.00 71.23  ? 56  PRO B CB     1 
ATOM   2967 C CG     . PRO B 1 56  ? 25.073  35.383 54.365 1.00 73.85  ? 56  PRO B CG     1 
ATOM   2968 C CD     . PRO B 1 56  ? 25.847  34.392 55.199 1.00 76.35  ? 56  PRO B CD     1 
ATOM   2969 H HA     . PRO B 1 56  ? 25.215  32.763 52.575 1.00 99.19  ? 56  PRO B HA     1 
ATOM   2970 H HB2    . PRO B 1 56  ? 24.426  35.197 52.432 1.00 85.67  ? 56  PRO B HB2    1 
ATOM   2971 H HB3    . PRO B 1 56  ? 23.706  34.178 53.432 1.00 85.67  ? 56  PRO B HB3    1 
ATOM   2972 H HG2    . PRO B 1 56  ? 25.658  36.089 54.047 1.00 85.86  ? 56  PRO B HG2    1 
ATOM   2973 H HG3    . PRO B 1 56  ? 24.337  35.754 54.875 1.00 85.86  ? 56  PRO B HG3    1 
ATOM   2974 H HD2    . PRO B 1 56  ? 26.640  34.809 55.570 1.00 104.24 ? 56  PRO B HD2    1 
ATOM   2975 H HD3    . PRO B 1 56  ? 25.281  34.021 55.894 1.00 104.24 ? 56  PRO B HD3    1 
ATOM   2976 N N      . LEU B 1 57  ? 26.220  34.186 50.667 1.00 78.03  ? 57  LEU B N      1 
ATOM   2977 C CA     . LEU B 1 57  ? 27.099  34.663 49.611 1.00 74.55  ? 57  LEU B CA     1 
ATOM   2978 C C      . LEU B 1 57  ? 27.254  36.179 49.612 1.00 72.04  ? 57  LEU B C      1 
ATOM   2979 O O      . LEU B 1 57  ? 28.106  36.698 48.883 1.00 69.07  ? 57  LEU B O      1 
ATOM   2980 C CB     . LEU B 1 57  ? 26.577  34.195 48.249 1.00 74.77  ? 57  LEU B CB     1 
ATOM   2981 C CG     . LEU B 1 57  ? 27.464  34.464 47.028 1.00 72.61  ? 57  LEU B CG     1 
ATOM   2982 C CD1    . LEU B 1 57  ? 28.857  33.868 47.203 1.00 72.22  ? 57  LEU B CD1    1 
ATOM   2983 C CD2    . LEU B 1 57  ? 26.807  33.910 45.775 1.00 72.96  ? 57  LEU B CD2    1 
ATOM   2984 H H      . LEU B 1 57  ? 25.429  33.973 50.403 1.00 102.68 ? 57  LEU B H      1 
ATOM   2985 H HA     . LEU B 1 57  ? 27.979  34.276 49.739 1.00 97.80  ? 57  LEU B HA     1 
ATOM   2986 H HB2    . LEU B 1 57  ? 26.438  33.236 48.294 1.00 100.74 ? 57  LEU B HB2    1 
ATOM   2987 H HB3    . LEU B 1 57  ? 25.728  34.633 48.085 1.00 100.74 ? 57  LEU B HB3    1 
ATOM   2988 H HG     . LEU B 1 57  ? 27.562  35.422 46.915 1.00 101.04 ? 57  LEU B HG     1 
ATOM   2989 H HD11   . LEU B 1 57  ? 29.383  34.061 46.411 1.00 102.55 ? 57  LEU B HD11   1 
ATOM   2990 H HD12   . LEU B 1 57  ? 29.274  34.266 47.983 1.00 102.55 ? 57  LEU B HD12   1 
ATOM   2991 H HD13   . LEU B 1 57  ? 28.777  32.909 47.322 1.00 102.55 ? 57  LEU B HD13   1 
ATOM   2992 H HD21   . LEU B 1 57  ? 27.380  34.089 45.013 1.00 102.29 ? 57  LEU B HD21   1 
ATOM   2993 H HD22   . LEU B 1 57  ? 26.683  32.954 45.879 1.00 102.29 ? 57  LEU B HD22   1 
ATOM   2994 H HD23   . LEU B 1 57  ? 25.948  34.344 45.651 1.00 102.29 ? 57  LEU B HD23   1 
ATOM   2995 N N      . GLY B 1 58  ? 26.469  36.895 50.409 1.00 57.92  ? 58  GLY B N      1 
ATOM   2996 C CA     . GLY B 1 58  ? 26.592  38.339 50.463 1.00 58.07  ? 58  GLY B CA     1 
ATOM   2997 C C      . GLY B 1 58  ? 25.427  38.952 51.214 1.00 61.31  ? 58  GLY B C      1 
ATOM   2998 O O      . GLY B 1 58  ? 24.747  38.277 51.989 1.00 64.55  ? 58  GLY B O      1 
ATOM   2999 H H      . GLY B 1 58  ? 25.862  36.569 50.924 1.00 76.49  ? 58  GLY B H      1 
ATOM   3000 H HA2    . GLY B 1 58  ? 27.416  38.582 50.914 1.00 75.02  ? 58  GLY B HA2    1 
ATOM   3001 H HA3    . GLY B 1 58  ? 26.609  38.701 49.564 1.00 75.02  ? 58  GLY B HA3    1 
ATOM   3002 N N      . PHE B 1 59  ? 25.214  40.243 50.971 1.00 43.44  ? 59  PHE B N      1 
ATOM   3003 C CA     . PHE B 1 59  ? 24.133  40.984 51.598 1.00 42.75  ? 59  PHE B CA     1 
ATOM   3004 C C      . PHE B 1 59  ? 23.413  41.822 50.551 1.00 41.45  ? 59  PHE B C      1 
ATOM   3005 O O      . PHE B 1 59  ? 23.942  42.107 49.474 1.00 40.58  ? 59  PHE B O      1 
ATOM   3006 C CB     . PHE B 1 59  ? 24.643  41.888 52.734 1.00 42.49  ? 59  PHE B CB     1 
ATOM   3007 C CG     . PHE B 1 59  ? 25.506  43.026 52.267 1.00 42.33  ? 59  PHE B CG     1 
ATOM   3008 C CD1    . PHE B 1 59  ? 24.946  44.248 51.937 1.00 42.57  ? 59  PHE B CD1    1 
ATOM   3009 C CD2    . PHE B 1 59  ? 26.879  42.875 52.166 1.00 43.72  ? 59  PHE B CD2    1 
ATOM   3010 C CE1    . PHE B 1 59  ? 25.736  45.297 51.509 1.00 44.69  ? 59  PHE B CE1    1 
ATOM   3011 C CE2    . PHE B 1 59  ? 27.676  43.920 51.739 1.00 46.27  ? 59  PHE B CE2    1 
ATOM   3012 C CZ     . PHE B 1 59  ? 27.104  45.133 51.410 1.00 46.97  ? 59  PHE B CZ     1 
ATOM   3013 H H      . PHE B 1 59  ? 25.693  40.717 50.436 1.00 58.47  ? 59  PHE B H      1 
ATOM   3014 H HA     . PHE B 1 59  ? 23.495  40.358 51.974 1.00 55.03  ? 59  PHE B HA     1 
ATOM   3015 H HB2    . PHE B 1 59  ? 23.881  42.266 53.198 1.00 53.81  ? 59  PHE B HB2    1 
ATOM   3016 H HB3    . PHE B 1 59  ? 25.168  41.351 53.347 1.00 53.81  ? 59  PHE B HB3    1 
ATOM   3017 H HD1    . PHE B 1 59  ? 24.025  44.363 52.002 1.00 55.21  ? 59  PHE B HD1    1 
ATOM   3018 H HD2    . PHE B 1 59  ? 27.269  42.060 52.385 1.00 55.89  ? 59  PHE B HD2    1 
ATOM   3019 H HE1    . PHE B 1 59  ? 25.348  46.113 51.289 1.00 58.68  ? 59  PHE B HE1    1 
ATOM   3020 H HE2    . PHE B 1 59  ? 28.596  43.807 51.673 1.00 59.50  ? 59  PHE B HE2    1 
ATOM   3021 H HZ     . PHE B 1 59  ? 27.638  45.838 51.123 1.00 60.83  ? 59  PHE B HZ     1 
ATOM   3022 N N      . LYS B 1 60  ? 22.189  42.215 50.890 1.00 42.11  ? 60  LYS B N      1 
ATOM   3023 C CA     . LYS B 1 60  ? 21.334  43.003 50.015 1.00 42.17  ? 60  LYS B CA     1 
ATOM   3024 C C      . LYS B 1 60  ? 21.066  44.344 50.681 1.00 41.55  ? 60  LYS B C      1 
ATOM   3025 O O      . LYS B 1 60  ? 20.643  44.388 51.840 1.00 42.06  ? 60  LYS B O      1 
ATOM   3026 C CB     . LYS B 1 60  ? 20.021  42.265 49.737 1.00 44.53  ? 60  LYS B CB     1 
ATOM   3027 C CG     . LYS B 1 60  ? 19.121  42.926 48.708 1.00 45.59  ? 60  LYS B CG     1 
ATOM   3028 C CD     . LYS B 1 60  ? 17.898  42.064 48.430 1.00 49.10  ? 60  LYS B CD     1 
ATOM   3029 C CE     . LYS B 1 60  ? 17.028  42.653 47.332 1.00 50.79  ? 60  LYS B CE     1 
ATOM   3030 N NZ     . LYS B 1 60  ? 15.872  41.769 47.012 1.00 54.76  ? 60  LYS B NZ     1 
ATOM   3031 H H      . LYS B 1 60  ? 21.823  42.030 51.646 1.00 56.22  ? 60  LYS B H      1 
ATOM   3032 H HA     . LYS B 1 60  ? 21.786  43.160 49.172 1.00 56.58  ? 60  LYS B HA     1 
ATOM   3033 H HB2    . LYS B 1 60  ? 20.229  41.374 49.414 1.00 58.83  ? 60  LYS B HB2    1 
ATOM   3034 H HB3    . LYS B 1 60  ? 19.520  42.201 50.566 1.00 58.83  ? 60  LYS B HB3    1 
ATOM   3035 H HG2    . LYS B 1 60  ? 18.821  43.785 49.046 1.00 60.92  ? 60  LYS B HG2    1 
ATOM   3036 H HG3    . LYS B 1 60  ? 19.610  43.041 47.878 1.00 60.92  ? 60  LYS B HG3    1 
ATOM   3037 H HD2    . LYS B 1 60  ? 18.187  41.183 48.147 1.00 64.74  ? 60  LYS B HD2    1 
ATOM   3038 H HD3    . LYS B 1 60  ? 17.364  41.999 49.237 1.00 64.74  ? 60  LYS B HD3    1 
ATOM   3039 H HE2    . LYS B 1 60  ? 16.682  43.511 47.624 1.00 67.16  ? 60  LYS B HE2    1 
ATOM   3040 H HE3    . LYS B 1 60  ? 17.559  42.761 46.527 1.00 67.16  ? 60  LYS B HE3    1 
ATOM   3041 H HZ1    . LYS B 1 60  ? 15.379  42.135 46.367 1.00 71.00  ? 60  LYS B HZ1    1 
ATOM   3042 H HZ2    . LYS B 1 60  ? 16.165  40.974 46.737 1.00 71.00  ? 60  LYS B HZ2    1 
ATOM   3043 H HZ3    . LYS B 1 60  ? 15.366  41.656 47.735 1.00 71.00  ? 60  LYS B HZ3    1 
ATOM   3044 N N      . GLU B 1 61  ? 21.324  45.432 49.957 1.00 44.38  ? 61  GLU B N      1 
ATOM   3045 C CA     . GLU B 1 61  ? 21.098  46.773 50.476 1.00 44.55  ? 61  GLU B CA     1 
ATOM   3046 C C      . GLU B 1 61  ? 20.284  47.582 49.477 1.00 45.31  ? 61  GLU B C      1 
ATOM   3047 O O      . GLU B 1 61  ? 20.313  47.324 48.270 1.00 45.77  ? 61  GLU B O      1 
ATOM   3048 C CB     . GLU B 1 61  ? 22.421  47.495 50.791 1.00 44.82  ? 61  GLU B CB     1 
ATOM   3049 C CG     . GLU B 1 61  ? 23.352  47.678 49.608 1.00 45.89  ? 61  GLU B CG     1 
ATOM   3050 C CD     . GLU B 1 61  ? 24.583  48.493 49.963 1.00 47.91  ? 61  GLU B CD     1 
ATOM   3051 O OE1    . GLU B 1 61  ? 24.700  48.919 51.132 1.00 47.70  ? 61  GLU B OE1    1 
ATOM   3052 O OE2    . GLU B 1 61  ? 25.432  48.712 49.073 1.00 50.65  ? 61  GLU B OE2    1 
ATOM   3053 H H      . GLU B 1 61  ? 21.633  45.416 49.155 1.00 57.15  ? 61  GLU B H      1 
ATOM   3054 H HA     . GLU B 1 61  ? 20.588  46.711 51.298 1.00 57.48  ? 61  GLU B HA     1 
ATOM   3055 H HB2    . GLU B 1 61  ? 22.215  48.377 51.140 1.00 57.24  ? 61  GLU B HB2    1 
ATOM   3056 H HB3    . GLU B 1 61  ? 22.898  46.984 51.463 1.00 57.24  ? 61  GLU B HB3    1 
ATOM   3057 H HG2    . GLU B 1 61  ? 23.646  46.807 49.298 1.00 56.66  ? 61  GLU B HG2    1 
ATOM   3058 H HG3    . GLU B 1 61  ? 22.878  48.140 48.899 1.00 56.66  ? 61  GLU B HG3    1 
ATOM   3059 N N      . SER B 1 62  ? 19.559  48.571 49.996 1.00 47.29  ? 62  SER B N      1 
ATOM   3060 C CA     . SER B 1 62  ? 18.614  49.343 49.204 1.00 48.28  ? 62  SER B CA     1 
ATOM   3061 C C      . SER B 1 62  ? 18.646  50.805 49.626 1.00 48.02  ? 62  SER B C      1 
ATOM   3062 O O      . SER B 1 62  ? 18.756  51.115 50.816 1.00 47.26  ? 62  SER B O      1 
ATOM   3063 C CB     . SER B 1 62  ? 17.190  48.790 49.358 1.00 50.01  ? 62  SER B CB     1 
ATOM   3064 O OG     . SER B 1 62  ? 16.238  49.660 48.772 1.00 51.83  ? 62  SER B OG     1 
ATOM   3065 H H      . SER B 1 62  ? 19.600  48.815 50.820 1.00 59.70  ? 62  SER B H      1 
ATOM   3066 H HA     . SER B 1 62  ? 18.862  49.291 48.268 1.00 60.06  ? 62  SER B HA     1 
ATOM   3067 H HB2    . SER B 1 62  ? 17.139  47.926 48.919 1.00 62.20  ? 62  SER B HB2    1 
ATOM   3068 H HB3    . SER B 1 62  ? 16.990  48.694 50.302 1.00 62.20  ? 62  SER B HB3    1 
ATOM   3069 H HG     . SER B 1 62  ? 15.465  49.343 48.864 1.00 64.47  ? 62  SER B HG     1 
ATOM   3070 N N      . TRP B 1 63  ? 18.551  51.696 48.641 1.00 35.27  ? 63  TRP B N      1 
ATOM   3071 C CA     . TRP B 1 63  ? 18.415  53.129 48.868 1.00 35.82  ? 63  TRP B CA     1 
ATOM   3072 C C      . TRP B 1 63  ? 17.146  53.613 48.184 1.00 36.76  ? 63  TRP B C      1 
ATOM   3073 O O      . TRP B 1 63  ? 16.944  53.360 46.992 1.00 37.93  ? 63  TRP B O      1 
ATOM   3074 C CB     . TRP B 1 63  ? 19.622  53.903 48.332 1.00 37.62  ? 63  TRP B CB     1 
ATOM   3075 C CG     . TRP B 1 63  ? 20.616  54.281 49.387 1.00 37.17  ? 63  TRP B CG     1 
ATOM   3076 C CD1    . TRP B 1 63  ? 21.908  53.853 49.489 1.00 37.68  ? 63  TRP B CD1    1 
ATOM   3077 C CD2    . TRP B 1 63  ? 20.399  55.166 50.492 1.00 36.70  ? 63  TRP B CD2    1 
ATOM   3078 N NE1    . TRP B 1 63  ? 22.509  54.418 50.589 1.00 37.82  ? 63  TRP B NE1    1 
ATOM   3079 C CE2    . TRP B 1 63  ? 21.603  55.227 51.222 1.00 37.34  ? 63  TRP B CE2    1 
ATOM   3080 C CE3    . TRP B 1 63  ? 19.304  55.913 50.935 1.00 36.64  ? 63  TRP B CE3    1 
ATOM   3081 C CZ2    . TRP B 1 63  ? 21.742  56.007 52.369 1.00 38.16  ? 63  TRP B CZ2    1 
ATOM   3082 C CZ3    . TRP B 1 63  ? 19.445  56.685 52.075 1.00 36.95  ? 63  TRP B CZ3    1 
ATOM   3083 C CH2    . TRP B 1 63  ? 20.654  56.725 52.778 1.00 37.83  ? 63  TRP B CH2    1 
ATOM   3084 H H      . TRP B 1 63  ? 18.565  51.485 47.808 1.00 48.87  ? 63  TRP B H      1 
ATOM   3085 H HA     . TRP B 1 63  ? 18.337  53.301 49.819 1.00 47.02  ? 63  TRP B HA     1 
ATOM   3086 H HB2    . TRP B 1 63  ? 20.080  53.353 47.677 1.00 46.70  ? 63  TRP B HB2    1 
ATOM   3087 H HB3    . TRP B 1 63  ? 19.309  54.720 47.913 1.00 46.70  ? 63  TRP B HB3    1 
ATOM   3088 H HD1    . TRP B 1 63  ? 22.322  53.265 48.899 1.00 45.22  ? 63  TRP B HD1    1 
ATOM   3089 H HE1    . TRP B 1 63  ? 23.320  54.284 50.840 1.00 45.07  ? 63  TRP B HE1    1 
ATOM   3090 H HE3    . TRP B 1 63  ? 18.497  55.892 50.473 1.00 45.90  ? 63  TRP B HE3    1 
ATOM   3091 H HZ2    . TRP B 1 63  ? 22.544  56.035 52.839 1.00 47.25  ? 63  TRP B HZ2    1 
ATOM   3092 H HZ3    . TRP B 1 63  ? 18.723  57.186 52.379 1.00 46.84  ? 63  TRP B HZ3    1 
ATOM   3093 H HH2    . TRP B 1 63  ? 20.719  57.253 53.541 1.00 47.98  ? 63  TRP B HH2    1 
ATOM   3094 N N      . GLY B 1 64  ? 16.296  54.303 48.936 1.00 35.65  ? 64  GLY B N      1 
ATOM   3095 C CA     . GLY B 1 64  ? 15.063  54.830 48.389 1.00 37.26  ? 64  GLY B CA     1 
ATOM   3096 C C      . GLY B 1 64  ? 14.885  56.309 48.659 1.00 38.60  ? 64  GLY B C      1 
ATOM   3097 O O      . GLY B 1 64  ? 15.036  56.762 49.797 1.00 38.32  ? 64  GLY B O      1 
ATOM   3098 H H      . GLY B 1 64  ? 16.415  54.479 49.769 1.00 41.55  ? 64  GLY B H      1 
ATOM   3099 H HA2    . GLY B 1 64  ? 15.051  54.691 47.429 1.00 42.55  ? 64  GLY B HA2    1 
ATOM   3100 H HA3    . GLY B 1 64  ? 14.310  54.356 48.776 1.00 42.55  ? 64  GLY B HA3    1 
ATOM   3101 N N      . PHE B 1 65  ? 14.576  57.074 47.616 1.00 39.82  ? 65  PHE B N      1 
ATOM   3102 C CA     . PHE B 1 65  ? 14.241  58.492 47.736 1.00 41.10  ? 65  PHE B CA     1 
ATOM   3103 C C      . PHE B 1 65  ? 12.811  58.643 47.228 1.00 42.19  ? 65  PHE B C      1 
ATOM   3104 O O      . PHE B 1 65  ? 12.582  58.755 46.020 1.00 43.68  ? 65  PHE B O      1 
ATOM   3105 C CB     . PHE B 1 65  ? 15.217  59.360 46.950 1.00 43.00  ? 65  PHE B CB     1 
ATOM   3106 C CG     . PHE B 1 65  ? 16.653  58.967 47.129 1.00 42.55  ? 65  PHE B CG     1 
ATOM   3107 C CD1    . PHE B 1 65  ? 17.300  59.173 48.336 1.00 41.51  ? 65  PHE B CD1    1 
ATOM   3108 C CD2    . PHE B 1 65  ? 17.359  58.391 46.087 1.00 43.80  ? 65  PHE B CD2    1 
ATOM   3109 C CE1    . PHE B 1 65  ? 18.624  58.808 48.499 1.00 41.57  ? 65  PHE B CE1    1 
ATOM   3110 C CE2    . PHE B 1 65  ? 18.679  58.028 46.244 1.00 43.61  ? 65  PHE B CE2    1 
ATOM   3111 C CZ     . PHE B 1 65  ? 19.314  58.236 47.450 1.00 42.43  ? 65  PHE B CZ     1 
ATOM   3112 H H      . PHE B 1 65  ? 14.552  56.786 46.806 1.00 51.06  ? 65  PHE B H      1 
ATOM   3113 H HA     . PHE B 1 65  ? 14.270  58.757 48.669 1.00 52.71  ? 65  PHE B HA     1 
ATOM   3114 H HB2    . PHE B 1 65  ? 15.006  59.292 46.006 1.00 54.20  ? 65  PHE B HB2    1 
ATOM   3115 H HB3    . PHE B 1 65  ? 15.122  60.280 47.243 1.00 54.20  ? 65  PHE B HB3    1 
ATOM   3116 H HD1    . PHE B 1 65  ? 16.838  59.558 49.045 1.00 54.68  ? 65  PHE B HD1    1 
ATOM   3117 H HD2    . PHE B 1 65  ? 16.937  58.248 45.271 1.00 53.36  ? 65  PHE B HD2    1 
ATOM   3118 H HE1    . PHE B 1 65  ? 19.049  58.951 49.313 1.00 54.64  ? 65  PHE B HE1    1 
ATOM   3119 H HE2    . PHE B 1 65  ? 19.142  57.642 45.536 1.00 52.81  ? 65  PHE B HE2    1 
ATOM   3120 H HZ     . PHE B 1 65  ? 20.205  57.991 47.556 1.00 53.27  ? 65  PHE B HZ     1 
ATOM   3121 N N      . GLY B 1 66  ? 11.851  58.638 48.148 1.00 47.29  ? 66  GLY B N      1 
ATOM   3122 C CA     . GLY B 1 66  ? 10.461  58.551 47.738 1.00 48.67  ? 66  GLY B CA     1 
ATOM   3123 C C      . GLY B 1 66  ? 10.172  57.178 47.162 1.00 49.47  ? 66  GLY B C      1 
ATOM   3124 O O      . GLY B 1 66  ? 10.607  56.150 47.691 1.00 47.83  ? 66  GLY B O      1 
ATOM   3125 H H      . GLY B 1 66  ? 11.976  58.683 48.998 1.00 57.17  ? 66  GLY B H      1 
ATOM   3126 H HA2    . GLY B 1 66  ? 9.881   58.701 48.501 1.00 56.81  ? 66  GLY B HA2    1 
ATOM   3127 H HA3    . GLY B 1 66  ? 10.273  59.222 47.063 1.00 56.81  ? 66  GLY B HA3    1 
ATOM   3128 N N      . LYS B 1 67  ? 9.436   57.156 46.052 1.00 47.87  ? 67  LYS B N      1 
ATOM   3129 C CA     . LYS B 1 67  ? 9.133   55.918 45.347 1.00 49.66  ? 67  LYS B CA     1 
ATOM   3130 C C      . LYS B 1 67  ? 10.218  55.539 44.341 1.00 49.05  ? 67  LYS B C      1 
ATOM   3131 O O      . LYS B 1 67  ? 9.960   54.736 43.437 1.00 50.05  ? 67  LYS B O      1 
ATOM   3132 C CB     . LYS B 1 67  ? 7.779   56.033 44.643 1.00 53.37  ? 67  LYS B CB     1 
ATOM   3133 C CG     . LYS B 1 67  ? 7.747   57.057 43.521 1.00 54.71  ? 67  LYS B CG     1 
ATOM   3134 C CD     . LYS B 1 67  ? 6.346   57.216 42.949 1.00 58.24  ? 67  LYS B CD     1 
ATOM   3135 C CE     . LYS B 1 67  ? 5.693   58.513 43.413 1.00 58.59  ? 67  LYS B CE     1 
ATOM   3136 N NZ     . LYS B 1 67  ? 4.472   58.843 42.624 1.00 59.98  ? 67  LYS B NZ     1 
ATOM   3137 H H      . LYS B 1 67  ? 9.097   57.855 45.684 1.00 57.14  ? 67  LYS B H      1 
ATOM   3138 H HA     . LYS B 1 67  ? 9.069   55.199 45.996 1.00 59.26  ? 67  LYS B HA     1 
ATOM   3139 H HB2    . LYS B 1 67  ? 7.551   55.171 44.263 1.00 61.87  ? 67  LYS B HB2    1 
ATOM   3140 H HB3    . LYS B 1 67  ? 7.109   56.290 45.296 1.00 61.87  ? 67  LYS B HB3    1 
ATOM   3141 H HG2    . LYS B 1 67  ? 8.034   57.917 43.865 1.00 65.10  ? 67  LYS B HG2    1 
ATOM   3142 H HG3    . LYS B 1 67  ? 8.336   56.767 42.807 1.00 65.10  ? 67  LYS B HG3    1 
ATOM   3143 H HD2    . LYS B 1 67  ? 6.397   57.232 41.980 1.00 69.27  ? 67  LYS B HD2    1 
ATOM   3144 H HD3    . LYS B 1 67  ? 5.794   56.476 43.244 1.00 69.27  ? 67  LYS B HD3    1 
ATOM   3145 H HE2    . LYS B 1 67  ? 5.435   58.424 44.344 1.00 71.27  ? 67  LYS B HE2    1 
ATOM   3146 H HE3    . LYS B 1 67  ? 6.324   59.242 43.310 1.00 71.27  ? 67  LYS B HE3    1 
ATOM   3147 H HZ1    . LYS B 1 67  ? 4.116   59.603 42.919 1.00 74.25  ? 67  LYS B HZ1    1 
ATOM   3148 H HZ2    . LYS B 1 67  ? 4.682   58.936 41.764 1.00 74.25  ? 67  LYS B HZ2    1 
ATOM   3149 H HZ3    . LYS B 1 67  ? 3.872   58.191 42.706 1.00 74.25  ? 67  LYS B HZ3    1 
ATOM   3150 N N      . VAL B 1 68  ? 11.417  56.097 44.480 1.00 47.30  ? 68  VAL B N      1 
ATOM   3151 C CA     . VAL B 1 68  ? 12.536  55.836 43.581 1.00 47.22  ? 68  VAL B CA     1 
ATOM   3152 C C      . VAL B 1 68  ? 13.550  55.015 44.369 1.00 44.65  ? 68  VAL B C      1 
ATOM   3153 O O      . VAL B 1 68  ? 14.277  55.551 45.214 1.00 44.34  ? 68  VAL B O      1 
ATOM   3154 C CB     . VAL B 1 68  ? 13.152  57.134 43.048 1.00 49.25  ? 68  VAL B CB     1 
ATOM   3155 C CG1    . VAL B 1 68  ? 14.249  56.837 42.035 1.00 50.38  ? 68  VAL B CG1    1 
ATOM   3156 C CG2    . VAL B 1 68  ? 12.075  58.019 42.431 1.00 50.61  ? 68  VAL B CG2    1 
ATOM   3157 H H      . VAL B 1 68  ? 11.612  56.649 45.110 1.00 56.08  ? 68  VAL B H      1 
ATOM   3158 H HA     . VAL B 1 68  ? 12.230  55.307 42.827 1.00 56.22  ? 68  VAL B HA     1 
ATOM   3159 H HB     . VAL B 1 68  ? 13.551  57.620 43.786 1.00 56.00  ? 68  VAL B HB     1 
ATOM   3160 H HG11   . VAL B 1 68  ? 14.619  57.674 41.716 1.00 58.29  ? 68  VAL B HG11   1 
ATOM   3161 H HG12   . VAL B 1 68  ? 14.941  56.311 42.466 1.00 58.29  ? 68  VAL B HG12   1 
ATOM   3162 H HG13   . VAL B 1 68  ? 13.868  56.339 41.295 1.00 58.29  ? 68  VAL B HG13   1 
ATOM   3163 H HG21   . VAL B 1 68  ? 12.487  58.833 42.102 1.00 54.32  ? 68  VAL B HG21   1 
ATOM   3164 H HG22   . VAL B 1 68  ? 11.655  57.540 41.700 1.00 54.32  ? 68  VAL B HG22   1 
ATOM   3165 H HG23   . VAL B 1 68  ? 11.416  58.232 43.110 1.00 54.32  ? 68  VAL B HG23   1 
ATOM   3166 N N      . VAL B 1 69  ? 13.614  53.715 44.087 1.00 44.92  ? 69  VAL B N      1 
ATOM   3167 C CA     . VAL B 1 69  ? 14.367  52.764 44.897 1.00 41.88  ? 69  VAL B CA     1 
ATOM   3168 C C      . VAL B 1 69  ? 15.482  52.160 44.054 1.00 41.35  ? 69  VAL B C      1 
ATOM   3169 O O      . VAL B 1 69  ? 15.240  51.691 42.935 1.00 41.88  ? 69  VAL B O      1 
ATOM   3170 C CB     . VAL B 1 69  ? 13.451  51.662 45.460 1.00 41.82  ? 69  VAL B CB     1 
ATOM   3171 C CG1    . VAL B 1 69  ? 14.245  50.671 46.304 1.00 39.89  ? 69  VAL B CG1    1 
ATOM   3172 C CG2    . VAL B 1 69  ? 12.327  52.283 46.278 1.00 42.55  ? 69  VAL B CG2    1 
ATOM   3173 H H      . VAL B 1 69  ? 13.219  53.353 43.415 1.00 55.99  ? 69  VAL B H      1 
ATOM   3174 H HA     . VAL B 1 69  ? 14.772  53.232 45.645 1.00 51.73  ? 69  VAL B HA     1 
ATOM   3175 H HB     . VAL B 1 69  ? 13.051  51.176 44.721 1.00 49.85  ? 69  VAL B HB     1 
ATOM   3176 H HG11   . VAL B 1 69  ? 13.642  49.991 46.643 1.00 48.99  ? 69  VAL B HG11   1 
ATOM   3177 H HG12   . VAL B 1 69  ? 14.928  50.261 45.750 1.00 48.99  ? 69  VAL B HG12   1 
ATOM   3178 H HG13   . VAL B 1 69  ? 14.658  51.145 47.042 1.00 48.99  ? 69  VAL B HG13   1 
ATOM   3179 H HG21   . VAL B 1 69  ? 11.761  51.575 46.624 1.00 47.72  ? 69  VAL B HG21   1 
ATOM   3180 H HG22   . VAL B 1 69  ? 12.712  52.786 47.012 1.00 47.72  ? 69  VAL B HG22   1 
ATOM   3181 H HG23   . VAL B 1 69  ? 11.809  52.872 45.708 1.00 47.72  ? 69  VAL B HG23   1 
ATOM   3182 N N      . PHE B 1 70  ? 16.697  52.171 44.599 1.00 40.54  ? 70  PHE B N      1 
ATOM   3183 C CA     . PHE B 1 70  ? 17.848  51.493 44.022 1.00 40.64  ? 70  PHE B CA     1 
ATOM   3184 C C      . PHE B 1 70  ? 18.220  50.305 44.899 1.00 38.18  ? 70  PHE B C      1 
ATOM   3185 O O      . PHE B 1 70  ? 18.133  50.381 46.130 1.00 36.10  ? 70  PHE B O      1 
ATOM   3186 C CB     . PHE B 1 70  ? 19.046  52.438 43.908 1.00 42.97  ? 70  PHE B CB     1 
ATOM   3187 C CG     . PHE B 1 70  ? 18.792  53.654 43.059 1.00 46.20  ? 70  PHE B CG     1 
ATOM   3188 C CD1    . PHE B 1 70  ? 18.180  54.775 43.595 1.00 47.57  ? 70  PHE B CD1    1 
ATOM   3189 C CD2    . PHE B 1 70  ? 19.184  53.682 41.732 1.00 47.30  ? 70  PHE B CD2    1 
ATOM   3190 C CE1    . PHE B 1 70  ? 17.955  55.897 42.818 1.00 51.00  ? 70  PHE B CE1    1 
ATOM   3191 C CE2    . PHE B 1 70  ? 18.963  54.797 40.953 1.00 49.82  ? 70  PHE B CE2    1 
ATOM   3192 C CZ     . PHE B 1 70  ? 18.348  55.907 41.495 1.00 51.71  ? 70  PHE B CZ     1 
ATOM   3193 H H      . PHE B 1 70  ? 16.882  52.582 45.332 1.00 49.76  ? 70  PHE B H      1 
ATOM   3194 H HA     . PHE B 1 70  ? 17.625  51.168 43.136 1.00 50.63  ? 70  PHE B HA     1 
ATOM   3195 H HB2    . PHE B 1 70  ? 19.288  52.743 44.796 1.00 51.61  ? 70  PHE B HB2    1 
ATOM   3196 H HB3    . PHE B 1 70  ? 19.789  51.953 43.514 1.00 51.61  ? 70  PHE B HB3    1 
ATOM   3197 H HD1    . PHE B 1 70  ? 17.914  54.772 44.487 1.00 53.24  ? 70  PHE B HD1    1 
ATOM   3198 H HD2    . PHE B 1 70  ? 19.599  52.937 41.361 1.00 52.66  ? 70  PHE B HD2    1 
ATOM   3199 H HE1    . PHE B 1 70  ? 17.540  56.643 43.187 1.00 55.05  ? 70  PHE B HE1    1 
ATOM   3200 H HE2    . PHE B 1 70  ? 19.228  54.801 40.061 1.00 54.80  ? 70  PHE B HE2    1 
ATOM   3201 H HZ     . PHE B 1 70  ? 18.197  56.659 40.969 1.00 56.64  ? 70  PHE B HZ     1 
ATOM   3202 N N      . LYS B 1 71  ? 18.647  49.211 44.269 1.00 48.16  ? 71  LYS B N      1 
ATOM   3203 C CA     . LYS B 1 71  ? 18.967  47.985 44.985 1.00 46.73  ? 71  LYS B CA     1 
ATOM   3204 C C      . LYS B 1 71  ? 20.309  47.433 44.526 1.00 46.41  ? 71  LYS B C      1 
ATOM   3205 O O      . LYS B 1 71  ? 20.743  47.664 43.393 1.00 47.97  ? 71  LYS B O      1 
ATOM   3206 C CB     . LYS B 1 71  ? 17.874  46.929 44.789 1.00 47.89  ? 71  LYS B CB     1 
ATOM   3207 C CG     . LYS B 1 71  ? 16.610  47.205 45.583 1.00 48.93  ? 71  LYS B CG     1 
ATOM   3208 C CD     . LYS B 1 71  ? 15.447  46.364 45.086 1.00 52.22  ? 71  LYS B CD     1 
ATOM   3209 C CE     . LYS B 1 71  ? 14.190  46.623 45.898 1.00 54.87  ? 71  LYS B CE     1 
ATOM   3210 N NZ     . LYS B 1 71  ? 14.357  46.221 47.321 1.00 54.62  ? 71  LYS B NZ     1 
ATOM   3211 H H      . LYS B 1 71  ? 18.760  49.157 43.419 1.00 58.83  ? 71  LYS B H      1 
ATOM   3212 H HA     . LYS B 1 71  ? 19.030  48.179 45.934 1.00 59.15  ? 71  LYS B HA     1 
ATOM   3213 H HB2    . LYS B 1 71  ? 17.634  46.898 43.850 1.00 61.44  ? 71  LYS B HB2    1 
ATOM   3214 H HB3    . LYS B 1 71  ? 18.218  46.067 45.069 1.00 61.44  ? 71  LYS B HB3    1 
ATOM   3215 H HG2    . LYS B 1 71  ? 16.764  46.989 46.516 1.00 61.83  ? 71  LYS B HG2    1 
ATOM   3216 H HG3    . LYS B 1 71  ? 16.371  48.140 45.489 1.00 61.83  ? 71  LYS B HG3    1 
ATOM   3217 H HD2    . LYS B 1 71  ? 15.262  46.587 44.160 1.00 64.95  ? 71  LYS B HD2    1 
ATOM   3218 H HD3    . LYS B 1 71  ? 15.673  45.424 45.167 1.00 64.95  ? 71  LYS B HD3    1 
ATOM   3219 H HE2    . LYS B 1 71  ? 13.984  47.571 45.873 1.00 65.93  ? 71  LYS B HE2    1 
ATOM   3220 H HE3    . LYS B 1 71  ? 13.457  46.112 45.523 1.00 65.93  ? 71  LYS B HE3    1 
ATOM   3221 H HZ1    . LYS B 1 71  ? 13.608  46.383 47.773 1.00 65.87  ? 71  LYS B HZ1    1 
ATOM   3222 H HZ2    . LYS B 1 71  ? 14.543  45.352 47.372 1.00 65.87  ? 71  LYS B HZ2    1 
ATOM   3223 H HZ3    . LYS B 1 71  ? 15.024  46.681 47.691 1.00 65.87  ? 71  LYS B HZ3    1 
ATOM   3224 N N      . ARG B 1 72  ? 20.958  46.696 45.425 1.00 44.24  ? 72  ARG B N      1 
ATOM   3225 C CA     . ARG B 1 72  ? 22.263  46.106 45.161 1.00 44.33  ? 72  ARG B CA     1 
ATOM   3226 C C      . ARG B 1 72  ? 22.426  44.844 45.994 1.00 42.64  ? 72  ARG B C      1 
ATOM   3227 O O      . ARG B 1 72  ? 22.024  44.805 47.160 1.00 41.14  ? 72  ARG B O      1 
ATOM   3228 C CB     . ARG B 1 72  ? 23.401  47.080 45.495 1.00 45.56  ? 72  ARG B CB     1 
ATOM   3229 C CG     . ARG B 1 72  ? 23.652  48.154 44.462 1.00 48.73  ? 72  ARG B CG     1 
ATOM   3230 C CD     . ARG B 1 72  ? 24.160  47.572 43.162 1.00 50.20  ? 72  ARG B CD     1 
ATOM   3231 N NE     . ARG B 1 72  ? 24.552  48.616 42.222 1.00 53.58  ? 72  ARG B NE     1 
ATOM   3232 C CZ     . ARG B 1 72  ? 23.696  49.372 41.543 1.00 54.65  ? 72  ARG B CZ     1 
ATOM   3233 N NH1    . ARG B 1 72  ? 22.388  49.213 41.699 1.00 52.88  ? 72  ARG B NH1    1 
ATOM   3234 N NH2    . ARG B 1 72  ? 24.151  50.296 40.710 1.00 57.68  ? 72  ARG B NH2    1 
ATOM   3235 H H      . ARG B 1 72  ? 20.655  46.521 46.211 1.00 56.39  ? 72  ARG B H      1 
ATOM   3236 H HA     . ARG B 1 72  ? 22.326  45.868 44.223 1.00 56.23  ? 72  ARG B HA     1 
ATOM   3237 H HB2    . ARG B 1 72  ? 23.192  47.523 46.332 1.00 55.63  ? 72  ARG B HB2    1 
ATOM   3238 H HB3    . ARG B 1 72  ? 24.222  46.572 45.592 1.00 55.63  ? 72  ARG B HB3    1 
ATOM   3239 H HG2    . ARG B 1 72  ? 22.822  48.623 44.280 1.00 57.67  ? 72  ARG B HG2    1 
ATOM   3240 H HG3    . ARG B 1 72  ? 24.319  48.772 44.799 1.00 57.67  ? 72  ARG B HG3    1 
ATOM   3241 H HD2    . ARG B 1 72  ? 24.935  47.018 43.342 1.00 61.01  ? 72  ARG B HD2    1 
ATOM   3242 H HD3    . ARG B 1 72  ? 23.457  47.043 42.753 1.00 61.01  ? 72  ARG B HD3    1 
ATOM   3243 H HE     . ARG B 1 72  ? 25.393  48.751 42.099 1.00 64.36  ? 72  ARG B HE     1 
ATOM   3244 H HH11   . ARG B 1 72  ? 22.089  48.615 42.239 1.00 64.30  ? 72  ARG B HH11   1 
ATOM   3245 H HH12   . ARG B 1 72  ? 21.839  49.707 41.258 1.00 64.30  ? 72  ARG B HH12   1 
ATOM   3246 H HH21   . ARG B 1 72  ? 24.999  50.402 40.607 1.00 69.43  ? 72  ARG B HH21   1 
ATOM   3247 H HH22   . ARG B 1 72  ? 23.600  50.788 40.270 1.00 69.43  ? 72  ARG B HH22   1 
ATOM   3248 N N      . TYR B 1 73  ? 23.020  43.818 45.387 1.00 44.05  ? 73  TYR B N      1 
ATOM   3249 C CA     . TYR B 1 73  ? 23.483  42.636 46.102 1.00 43.32  ? 73  TYR B CA     1 
ATOM   3250 C C      . TYR B 1 73  ? 24.996  42.568 45.955 1.00 43.88  ? 73  TYR B C      1 
ATOM   3251 O O      . TYR B 1 73  ? 25.508  42.454 44.836 1.00 45.33  ? 73  TYR B O      1 
ATOM   3252 C CB     . TYR B 1 73  ? 22.830  41.356 45.571 1.00 44.16  ? 73  TYR B CB     1 
ATOM   3253 C CG     . TYR B 1 73  ? 23.150  40.133 46.406 1.00 44.04  ? 73  TYR B CG     1 
ATOM   3254 C CD1    . TYR B 1 73  ? 24.353  39.456 46.250 1.00 44.31  ? 73  TYR B CD1    1 
ATOM   3255 C CD2    . TYR B 1 73  ? 22.253  39.662 47.356 1.00 44.21  ? 73  TYR B CD2    1 
ATOM   3256 C CE1    . TYR B 1 73  ? 24.651  38.343 47.014 1.00 44.41  ? 73  TYR B CE1    1 
ATOM   3257 C CE2    . TYR B 1 73  ? 22.543  38.550 48.124 1.00 44.58  ? 73  TYR B CE2    1 
ATOM   3258 C CZ     . TYR B 1 73  ? 23.742  37.895 47.950 1.00 44.52  ? 73  TYR B CZ     1 
ATOM   3259 O OH     . TYR B 1 73  ? 24.035  36.788 48.712 1.00 45.27  ? 73  TYR B OH     1 
ATOM   3260 H H      . TYR B 1 73  ? 23.168  43.785 44.540 1.00 53.77  ? 73  TYR B H      1 
ATOM   3261 H HA     . TYR B 1 73  ? 23.269  42.723 47.045 1.00 53.70  ? 73  TYR B HA     1 
ATOM   3262 H HB2    . TYR B 1 73  ? 21.867  41.472 45.569 1.00 55.49  ? 73  TYR B HB2    1 
ATOM   3263 H HB3    . TYR B 1 73  ? 23.146  41.193 44.669 1.00 55.49  ? 73  TYR B HB3    1 
ATOM   3264 H HD1    . TYR B 1 73  ? 24.968  39.756 45.621 1.00 57.32  ? 73  TYR B HD1    1 
ATOM   3265 H HD2    . TYR B 1 73  ? 21.443  40.102 47.478 1.00 54.67  ? 73  TYR B HD2    1 
ATOM   3266 H HE1    . TYR B 1 73  ? 25.460  37.898 46.898 1.00 57.45  ? 73  TYR B HE1    1 
ATOM   3267 H HE2    . TYR B 1 73  ? 21.932  38.246 48.756 1.00 54.49  ? 73  TYR B HE2    1 
ATOM   3268 H HH     . TYR B 1 73  ? 23.400  36.625 49.238 1.00 56.46  ? 73  TYR B HH     1 
ATOM   3269 N N      . LEU B 1 74  ? 25.705  42.652 47.076 1.00 41.43  ? 74  LEU B N      1 
ATOM   3270 C CA     . LEU B 1 74  ? 27.158  42.595 47.088 1.00 42.63  ? 74  LEU B CA     1 
ATOM   3271 C C      . LEU B 1 74  ? 27.616  41.378 47.875 1.00 41.35  ? 74  LEU B C      1 
ATOM   3272 O O      . LEU B 1 74  ? 26.991  40.985 48.864 1.00 39.76  ? 74  LEU B O      1 
ATOM   3273 C CB     . LEU B 1 74  ? 27.763  43.863 47.696 1.00 44.77  ? 74  LEU B CB     1 
ATOM   3274 C CG     . LEU B 1 74  ? 27.386  45.183 47.020 1.00 47.23  ? 74  LEU B CG     1 
ATOM   3275 C CD1    . LEU B 1 74  ? 28.150  46.321 47.662 1.00 50.51  ? 74  LEU B CD1    1 
ATOM   3276 C CD2    . LEU B 1 74  ? 27.649  45.146 45.518 1.00 49.38  ? 74  LEU B CD2    1 
ATOM   3277 H H      . LEU B 1 74  ? 25.358  42.744 47.858 1.00 55.24  ? 74  LEU B H      1 
ATOM   3278 H HA     . LEU B 1 74  ? 27.482  42.509 46.178 1.00 55.56  ? 74  LEU B HA     1 
ATOM   3279 H HB2    . LEU B 1 74  ? 27.479  43.922 48.622 1.00 57.25  ? 74  LEU B HB2    1 
ATOM   3280 H HB3    . LEU B 1 74  ? 28.729  43.787 47.661 1.00 57.25  ? 74  LEU B HB3    1 
ATOM   3281 H HG     . LEU B 1 74  ? 26.440  45.346 47.153 1.00 60.60  ? 74  LEU B HG     1 
ATOM   3282 H HD11   . LEU B 1 74  ? 27.904  47.152 47.226 1.00 61.59  ? 74  LEU B HD11   1 
ATOM   3283 H HD12   . LEU B 1 74  ? 27.923  46.361 48.604 1.00 61.59  ? 74  LEU B HD12   1 
ATOM   3284 H HD13   . LEU B 1 74  ? 29.101  46.161 47.557 1.00 61.59  ? 74  LEU B HD13   1 
ATOM   3285 H HD21   . LEU B 1 74  ? 27.397  46.000 45.133 1.00 64.78  ? 74  LEU B HD21   1 
ATOM   3286 H HD22   . LEU B 1 74  ? 28.593  44.981 45.367 1.00 64.78  ? 74  LEU B HD22   1 
ATOM   3287 H HD23   . LEU B 1 74  ? 27.121  44.435 45.123 1.00 64.78  ? 74  LEU B HD23   1 
ATOM   3288 N N      . ARG B 1 75  ? 28.715  40.782 47.423 1.00 43.37  ? 75  ARG B N      1 
ATOM   3289 C CA     . ARG B 1 75  ? 29.260  39.590 48.055 1.00 43.95  ? 75  ARG B CA     1 
ATOM   3290 C C      . ARG B 1 75  ? 30.259  39.994 49.131 1.00 46.50  ? 75  ARG B C      1 
ATOM   3291 O O      . ARG B 1 75  ? 31.152  40.812 48.887 1.00 48.92  ? 75  ARG B O      1 
ATOM   3292 C CB     . ARG B 1 75  ? 29.910  38.686 47.008 1.00 44.37  ? 75  ARG B CB     1 
ATOM   3293 C CG     . ARG B 1 75  ? 28.976  38.401 45.843 1.00 44.31  ? 75  ARG B CG     1 
ATOM   3294 C CD     . ARG B 1 75  ? 29.399  37.212 45.007 1.00 45.77  ? 75  ARG B CD     1 
ATOM   3295 N NE     . ARG B 1 75  ? 28.391  36.918 43.992 1.00 48.15  ? 75  ARG B NE     1 
ATOM   3296 C CZ     . ARG B 1 75  ? 28.419  35.870 43.175 1.00 51.73  ? 75  ARG B CZ     1 
ATOM   3297 N NH1    . ARG B 1 75  ? 29.409  34.990 43.240 1.00 53.51  ? 75  ARG B NH1    1 
ATOM   3298 N NH2    . ARG B 1 75  ? 27.447  35.703 42.291 1.00 53.68  ? 75  ARG B NH2    1 
ATOM   3299 H H      . ARG B 1 75  ? 29.167  41.053 46.744 1.00 50.30  ? 75  ARG B H      1 
ATOM   3300 H HA     . ARG B 1 75  ? 28.541  39.095 48.479 1.00 53.97  ? 75  ARG B HA     1 
ATOM   3301 H HB2    . ARG B 1 75  ? 30.704  39.121 46.660 1.00 54.46  ? 75  ARG B HB2    1 
ATOM   3302 H HB3    . ARG B 1 75  ? 30.147  37.840 47.420 1.00 54.46  ? 75  ARG B HB3    1 
ATOM   3303 H HG2    . ARG B 1 75  ? 28.089  38.220 46.190 1.00 55.49  ? 75  ARG B HG2    1 
ATOM   3304 H HG3    . ARG B 1 75  ? 28.952  39.178 45.264 1.00 55.49  ? 75  ARG B HG3    1 
ATOM   3305 H HD2    . ARG B 1 75  ? 30.236  37.412 44.559 1.00 60.36  ? 75  ARG B HD2    1 
ATOM   3306 H HD3    . ARG B 1 75  ? 29.497  36.433 45.577 1.00 60.36  ? 75  ARG B HD3    1 
ATOM   3307 H HE     . ARG B 1 75  ? 27.729  37.462 43.918 1.00 65.10  ? 75  ARG B HE     1 
ATOM   3308 H HH11   . ARG B 1 75  ? 30.041  35.096 43.813 1.00 75.60  ? 75  ARG B HH11   1 
ATOM   3309 H HH12   . ARG B 1 75  ? 29.420  34.315 42.708 1.00 75.60  ? 75  ARG B HH12   1 
ATOM   3310 H HH21   . ARG B 1 75  ? 26.803  36.271 42.247 1.00 74.35  ? 75  ARG B HH21   1 
ATOM   3311 H HH22   . ARG B 1 75  ? 27.460  35.026 41.760 1.00 74.35  ? 75  ARG B HH22   1 
ATOM   3312 N N      . TYR B 1 76  ? 30.097  39.421 50.322 1.00 50.67  ? 76  TYR B N      1 
ATOM   3313 C CA     . TYR B 1 76  ? 30.868  39.805 51.500 1.00 52.97  ? 76  TYR B CA     1 
ATOM   3314 C C      . TYR B 1 76  ? 31.447  38.543 52.124 1.00 54.56  ? 76  TYR B C      1 
ATOM   3315 O O      . TYR B 1 76  ? 30.711  37.738 52.702 1.00 52.49  ? 76  TYR B O      1 
ATOM   3316 C CB     . TYR B 1 76  ? 29.989  40.565 52.494 1.00 52.24  ? 76  TYR B CB     1 
ATOM   3317 C CG     . TYR B 1 76  ? 30.666  40.899 53.802 1.00 53.63  ? 76  TYR B CG     1 
ATOM   3318 C CD1    . TYR B 1 76  ? 31.893  41.548 53.828 1.00 56.39  ? 76  TYR B CD1    1 
ATOM   3319 C CD2    . TYR B 1 76  ? 30.068  40.581 55.014 1.00 52.98  ? 76  TYR B CD2    1 
ATOM   3320 C CE1    . TYR B 1 76  ? 32.511  41.857 55.025 1.00 58.54  ? 76  TYR B CE1    1 
ATOM   3321 C CE2    . TYR B 1 76  ? 30.677  40.887 56.214 1.00 54.36  ? 76  TYR B CE2    1 
ATOM   3322 C CZ     . TYR B 1 76  ? 31.897  41.526 56.214 1.00 57.09  ? 76  TYR B CZ     1 
ATOM   3323 O OH     . TYR B 1 76  ? 32.506  41.832 57.408 1.00 60.24  ? 76  TYR B OH     1 
ATOM   3324 H H      . TYR B 1 76  ? 29.531  38.792 50.475 1.00 65.66  ? 76  TYR B H      1 
ATOM   3325 H HA     . TYR B 1 76  ? 31.601  40.382 51.234 1.00 69.71  ? 76  TYR B HA     1 
ATOM   3326 H HB2    . TYR B 1 76  ? 29.709  41.399 52.086 1.00 67.81  ? 76  TYR B HB2    1 
ATOM   3327 H HB3    . TYR B 1 76  ? 29.210  40.023 52.696 1.00 67.81  ? 76  TYR B HB3    1 
ATOM   3328 H HD1    . TYR B 1 76  ? 32.309  41.771 53.027 1.00 66.40  ? 76  TYR B HD1    1 
ATOM   3329 H HD2    . TYR B 1 76  ? 29.245  40.149 55.017 1.00 65.57  ? 76  TYR B HD2    1 
ATOM   3330 H HE1    . TYR B 1 76  ? 33.335  42.289 55.028 1.00 65.35  ? 76  TYR B HE1    1 
ATOM   3331 H HE2    . TYR B 1 76  ? 30.266  40.664 57.017 1.00 63.71  ? 76  TYR B HE2    1 
ATOM   3332 H HH     . TYR B 1 76  ? 32.027  41.576 58.049 1.00 65.90  ? 76  TYR B HH     1 
ATOM   3333 N N      . ASP B 1 77  ? 32.764  38.377 52.010 1.00 98.99  ? 77  ASP B N      1 
ATOM   3334 C CA     . ASP B 1 77  ? 33.444  37.163 52.444 1.00 99.91  ? 77  ASP B CA     1 
ATOM   3335 C C      . ASP B 1 77  ? 33.778  37.159 53.932 1.00 100.81 ? 77  ASP B C      1 
ATOM   3336 O O      . ASP B 1 77  ? 34.573  36.317 54.366 1.00 101.60 ? 77  ASP B O      1 
ATOM   3337 C CB     . ASP B 1 77  ? 34.728  36.967 51.632 1.00 101.85 ? 77  ASP B CB     1 
ATOM   3338 C CG     . ASP B 1 77  ? 34.471  36.893 50.138 1.00 101.26 ? 77  ASP B CG     1 
ATOM   3339 O OD1    . ASP B 1 77  ? 33.409  36.372 49.739 1.00 100.07 ? 77  ASP B OD1    1 
ATOM   3340 O OD2    . ASP B 1 77  ? 35.333  37.358 49.362 1.00 102.59 ? 77  ASP B OD2    1 
ATOM   3341 H H      . ASP B 1 77  ? 33.294  38.967 51.678 1.00 123.24 ? 77  ASP B H      1 
ATOM   3342 H HA     . ASP B 1 77  ? 32.865  36.404 52.269 1.00 127.19 ? 77  ASP B HA     1 
ATOM   3343 H HB2    . ASP B 1 77  ? 35.324  37.714 51.798 1.00 131.13 ? 77  ASP B HB2    1 
ATOM   3344 H HB3    . ASP B 1 77  ? 35.151  36.138 51.905 1.00 131.13 ? 77  ASP B HB3    1 
ATOM   3345 N N      . ARG B 1 78  ? 33.203  38.066 54.720 1.00 73.57  ? 78  ARG B N      1 
ATOM   3346 C CA     . ARG B 1 78  ? 33.418  38.128 56.163 1.00 75.30  ? 78  ARG B CA     1 
ATOM   3347 C C      . ARG B 1 78  ? 34.859  38.458 56.533 1.00 77.27  ? 78  ARG B C      1 
ATOM   3348 O O      . ARG B 1 78  ? 35.296  38.159 57.650 1.00 78.28  ? 78  ARG B O      1 
ATOM   3349 C CB     . ARG B 1 78  ? 33.008  36.814 56.840 1.00 75.33  ? 78  ARG B CB     1 
ATOM   3350 C CG     . ARG B 1 78  ? 31.583  36.366 56.549 1.00 74.18  ? 78  ARG B CG     1 
ATOM   3351 C CD     . ARG B 1 78  ? 30.574  37.452 56.870 1.00 73.55  ? 78  ARG B CD     1 
ATOM   3352 N NE     . ARG B 1 78  ? 30.917  38.184 58.086 1.00 74.65  ? 78  ARG B NE     1 
ATOM   3353 C CZ     . ARG B 1 78  ? 30.629  37.780 59.320 1.00 75.21  ? 78  ARG B CZ     1 
ATOM   3354 N NH1    . ARG B 1 78  ? 29.986  36.636 59.524 1.00 75.44  ? 78  ARG B NH1    1 
ATOM   3355 N NH2    . ARG B 1 78  ? 30.990  38.523 60.357 1.00 76.29  ? 78  ARG B NH2    1 
ATOM   3356 H H      . ARG B 1 78  ? 32.668  38.674 54.431 1.00 90.06  ? 78  ARG B H      1 
ATOM   3357 H HA     . ARG B 1 78  ? 32.856  38.830 56.526 1.00 92.12  ? 78  ARG B HA     1 
ATOM   3358 H HB2    . ARG B 1 78  ? 33.605  36.111 56.538 1.00 96.64  ? 78  ARG B HB2    1 
ATOM   3359 H HB3    . ARG B 1 78  ? 33.092  36.922 57.801 1.00 96.64  ? 78  ARG B HB3    1 
ATOM   3360 H HG2    . ARG B 1 78  ? 31.504  36.148 55.607 1.00 96.83  ? 78  ARG B HG2    1 
ATOM   3361 H HG3    . ARG B 1 78  ? 31.376  35.590 57.092 1.00 96.83  ? 78  ARG B HG3    1 
ATOM   3362 H HD2    . ARG B 1 78  ? 30.543  38.085 56.136 1.00 94.51  ? 78  ARG B HD2    1 
ATOM   3363 H HD3    . ARG B 1 78  ? 29.701  37.047 56.998 1.00 94.51  ? 78  ARG B HD3    1 
ATOM   3364 H HE     . ARG B 1 78  ? 31.336  38.930 57.998 1.00 94.17  ? 78  ARG B HE     1 
ATOM   3365 H HH11   . ARG B 1 78  ? 29.750  36.150 58.855 1.00 94.95  ? 78  ARG B HH11   1 
ATOM   3366 H HH12   . ARG B 1 78  ? 29.803  36.382 60.325 1.00 94.95  ? 78  ARG B HH12   1 
ATOM   3367 H HH21   . ARG B 1 78  ? 31.407  39.264 60.230 1.00 94.37  ? 78  ARG B HH21   1 
ATOM   3368 H HH22   . ARG B 1 78  ? 30.805  38.265 61.156 1.00 94.37  ? 78  ARG B HH22   1 
ATOM   3369 N N      . THR B 1 79  ? 35.613  39.069 55.625 1.00 63.76  ? 79  THR B N      1 
ATOM   3370 C CA     . THR B 1 79  ? 36.997  39.439 55.873 1.00 66.71  ? 79  THR B CA     1 
ATOM   3371 C C      . THR B 1 79  ? 37.133  40.955 55.923 1.00 70.33  ? 79  THR B C      1 
ATOM   3372 O O      . THR B 1 79  ? 36.323  41.694 55.356 1.00 69.54  ? 79  THR B O      1 
ATOM   3373 C CB     . THR B 1 79  ? 37.925  38.873 54.791 1.00 65.96  ? 79  THR B CB     1 
ATOM   3374 O OG1    . THR B 1 79  ? 37.561  39.412 53.514 1.00 64.89  ? 79  THR B OG1    1 
ATOM   3375 C CG2    . THR B 1 79  ? 37.835  37.353 54.744 1.00 62.67  ? 79  THR B CG2    1 
ATOM   3376 H H      . THR B 1 79  ? 35.337  39.283 54.839 1.00 77.21  ? 79  THR B H      1 
ATOM   3377 H HA     . THR B 1 79  ? 37.276  39.081 56.731 1.00 74.90  ? 79  THR B HA     1 
ATOM   3378 H HB     . THR B 1 79  ? 38.841  39.119 54.993 1.00 73.69  ? 79  THR B HB     1 
ATOM   3379 H HG1    . THR B 1 79  ? 36.768  39.206 53.330 1.00 71.36  ? 79  THR B HG1    1 
ATOM   3380 H HG21   . THR B 1 79  ? 38.426  37.007 54.057 1.00 74.10  ? 79  THR B HG21   1 
ATOM   3381 H HG22   . THR B 1 79  ? 38.096  36.980 55.601 1.00 74.10  ? 79  THR B HG22   1 
ATOM   3382 H HG23   . THR B 1 79  ? 36.926  37.081 54.545 1.00 74.10  ? 79  THR B HG23   1 
ATOM   3383 N N      . GLU B 1 80  ? 38.175  41.413 56.622 1.00 71.71  ? 80  GLU B N      1 
ATOM   3384 C CA     . GLU B 1 80  ? 38.457  42.843 56.681 1.00 76.13  ? 80  GLU B CA     1 
ATOM   3385 C C      . GLU B 1 80  ? 38.621  43.428 55.284 1.00 76.03  ? 80  GLU B C      1 
ATOM   3386 O O      . GLU B 1 80  ? 38.130  44.527 55.000 1.00 77.15  ? 80  GLU B O      1 
ATOM   3387 C CB     . GLU B 1 80  ? 39.709  43.091 57.525 1.00 81.62  ? 80  GLU B CB     1 
ATOM   3388 C CG     . GLU B 1 80  ? 40.289  44.498 57.412 1.00 86.43  ? 80  GLU B CG     1 
ATOM   3389 C CD     . GLU B 1 80  ? 41.292  44.643 56.278 1.00 88.16  ? 80  GLU B CD     1 
ATOM   3390 O OE1    . GLU B 1 80  ? 41.551  43.647 55.570 1.00 86.51  ? 80  GLU B OE1    1 
ATOM   3391 O OE2    . GLU B 1 80  ? 41.824  45.759 56.095 1.00 90.91  ? 80  GLU B OE2    1 
ATOM   3392 H H      . GLU B 1 80  ? 38.725  40.921 57.063 1.00 86.23  ? 80  GLU B H      1 
ATOM   3393 H HA     . GLU B 1 80  ? 37.712  43.294 57.109 1.00 88.66  ? 80  GLU B HA     1 
ATOM   3394 H HB2    . GLU B 1 80  ? 39.488  42.938 58.458 1.00 98.10  ? 80  GLU B HB2    1 
ATOM   3395 H HB3    . GLU B 1 80  ? 40.397  42.466 57.248 1.00 98.10  ? 80  GLU B HB3    1 
ATOM   3396 H HG2    . GLU B 1 80  ? 39.565  45.124 57.253 1.00 103.56 ? 80  GLU B HG2    1 
ATOM   3397 H HG3    . GLU B 1 80  ? 40.741  44.719 58.241 1.00 103.56 ? 80  GLU B HG3    1 
ATOM   3398 N N      . ALA B 1 81  ? 39.304  42.704 54.396 1.00 58.20  ? 81  ALA B N      1 
ATOM   3399 C CA     . ALA B 1 81  ? 39.511  43.193 53.037 1.00 59.08  ? 81  ALA B CA     1 
ATOM   3400 C C      . ALA B 1 81  ? 38.187  43.327 52.295 1.00 55.96  ? 81  ALA B C      1 
ATOM   3401 O O      . ALA B 1 81  ? 37.933  44.338 51.630 1.00 57.18  ? 81  ALA B O      1 
ATOM   3402 C CB     . ALA B 1 81  ? 40.456  42.255 52.288 1.00 58.29  ? 81  ALA B CB     1 
ATOM   3403 H H      . ALA B 1 81  ? 39.654  41.934 54.555 1.00 68.33  ? 81  ALA B H      1 
ATOM   3404 H HA     . ALA B 1 81  ? 39.924  44.069 53.075 1.00 71.93  ? 81  ALA B HA     1 
ATOM   3405 H HB1    . ALA B 1 81  ? 40.585  42.591 51.387 1.00 74.59  ? 81  ALA B HB1    1 
ATOM   3406 H HB2    . ALA B 1 81  ? 41.306  42.225 52.754 1.00 74.59  ? 81  ALA B HB2    1 
ATOM   3407 H HB3    . ALA B 1 81  ? 40.063  41.369 52.258 1.00 74.59  ? 81  ALA B HB3    1 
ATOM   3408 N N      . SER B 1 82  ? 37.328  42.308 52.390 1.00 68.03  ? 82  SER B N      1 
ATOM   3409 C CA     . SER B 1 82  ? 36.024  42.382 51.740 1.00 63.93  ? 82  SER B CA     1 
ATOM   3410 C C      . SER B 1 82  ? 35.124  43.410 52.411 1.00 64.27  ? 82  SER B C      1 
ATOM   3411 O O      . SER B 1 82  ? 34.258  43.996 51.751 1.00 63.00  ? 82  SER B O      1 
ATOM   3412 C CB     . SER B 1 82  ? 35.352  41.009 51.747 1.00 58.79  ? 82  SER B CB     1 
ATOM   3413 O OG     . SER B 1 82  ? 35.072  40.584 53.070 1.00 57.73  ? 82  SER B OG     1 
ATOM   3414 H H      . SER B 1 82  ? 37.475  41.577 52.818 1.00 79.52  ? 82  SER B H      1 
ATOM   3415 H HA     . SER B 1 82  ? 36.148  42.650 50.816 1.00 74.61  ? 82  SER B HA     1 
ATOM   3416 H HB2    . SER B 1 82  ? 34.521  41.062 51.250 1.00 71.02  ? 82  SER B HB2    1 
ATOM   3417 H HB3    . SER B 1 82  ? 35.946  40.366 51.329 1.00 71.02  ? 82  SER B HB3    1 
ATOM   3418 H HG     . SER B 1 82  ? 34.557  41.133 53.444 1.00 69.18  ? 82  SER B HG     1 
ATOM   3419 N N      . LEU B 1 83  ? 35.304  43.636 53.714 1.00 56.44  ? 83  LEU B N      1 
ATOM   3420 C CA     . LEU B 1 83  ? 34.541  44.676 54.397 1.00 57.05  ? 83  LEU B CA     1 
ATOM   3421 C C      . LEU B 1 83  ? 34.860  46.047 53.817 1.00 62.04  ? 83  LEU B C      1 
ATOM   3422 O O      . LEU B 1 83  ? 33.959  46.791 53.416 1.00 60.63  ? 83  LEU B O      1 
ATOM   3423 C CB     . LEU B 1 83  ? 34.836  44.644 55.897 1.00 58.97  ? 83  LEU B CB     1 
ATOM   3424 C CG     . LEU B 1 83  ? 34.135  45.712 56.744 1.00 59.54  ? 83  LEU B CG     1 
ATOM   3425 C CD1    . LEU B 1 83  ? 32.619  45.548 56.688 1.00 54.29  ? 83  LEU B CD1    1 
ATOM   3426 C CD2    . LEU B 1 83  ? 34.629  45.669 58.184 1.00 61.43  ? 83  LEU B CD2    1 
ATOM   3427 H H      . LEU B 1 83  ? 35.854  43.207 54.216 1.00 68.87  ? 83  LEU B H      1 
ATOM   3428 H HA     . LEU B 1 83  ? 33.594  44.509 54.272 1.00 67.53  ? 83  LEU B HA     1 
ATOM   3429 H HB2    . LEU B 1 83  ? 34.567  43.779 56.242 1.00 70.19  ? 83  LEU B HB2    1 
ATOM   3430 H HB3    . LEU B 1 83  ? 35.791  44.758 56.022 1.00 70.19  ? 83  LEU B HB3    1 
ATOM   3431 H HG     . LEU B 1 83  ? 34.350  46.586 56.384 1.00 71.84  ? 83  LEU B HG     1 
ATOM   3432 H HD11   . LEU B 1 83  ? 32.207  46.237 57.233 1.00 70.38  ? 83  LEU B HD11   1 
ATOM   3433 H HD12   . LEU B 1 83  ? 32.327  45.635 55.767 1.00 70.38  ? 83  LEU B HD12   1 
ATOM   3434 H HD13   . LEU B 1 83  ? 32.384  44.672 57.030 1.00 70.38  ? 83  LEU B HD13   1 
ATOM   3435 H HD21   . LEU B 1 83  ? 34.170  46.353 58.696 1.00 73.58  ? 83  LEU B HD21   1 
ATOM   3436 H HD22   . LEU B 1 83  ? 34.440  44.794 58.556 1.00 73.58  ? 83  LEU B HD22   1 
ATOM   3437 H HD23   . LEU B 1 83  ? 35.585  45.833 58.194 1.00 73.58  ? 83  LEU B HD23   1 
ATOM   3438 N N      . HIS B 1 84  ? 36.148  46.396 53.763 1.00 82.14  ? 84  HIS B N      1 
ATOM   3439 C CA     . HIS B 1 84  ? 36.556  47.659 53.159 1.00 84.30  ? 84  HIS B CA     1 
ATOM   3440 C C      . HIS B 1 84  ? 36.014  47.801 51.744 1.00 81.82  ? 84  HIS B C      1 
ATOM   3441 O O      . HIS B 1 84  ? 35.731  48.917 51.295 1.00 81.87  ? 84  HIS B O      1 
ATOM   3442 C CB     . HIS B 1 84  ? 38.083  47.759 53.155 1.00 86.60  ? 84  HIS B CB     1 
ATOM   3443 C CG     . HIS B 1 84  ? 38.606  49.050 52.605 1.00 87.39  ? 84  HIS B CG     1 
ATOM   3444 N ND1    . HIS B 1 84  ? 38.628  49.329 51.255 1.00 86.93  ? 84  HIS B ND1    1 
ATOM   3445 C CD2    . HIS B 1 84  ? 39.135  50.133 53.222 1.00 89.65  ? 84  HIS B CD2    1 
ATOM   3446 C CE1    . HIS B 1 84  ? 39.143  50.530 51.065 1.00 89.20  ? 84  HIS B CE1    1 
ATOM   3447 N NE2    . HIS B 1 84  ? 39.459  51.040 52.242 1.00 90.76  ? 84  HIS B NE2    1 
ATOM   3448 H H      . HIS B 1 84  ? 36.798  45.922 54.068 1.00 100.04 ? 84  HIS B H      1 
ATOM   3449 H HA     . HIS B 1 84  ? 36.207  48.392 53.690 1.00 101.46 ? 84  HIS B HA     1 
ATOM   3450 H HB2    . HIS B 1 84  ? 38.404  47.675 54.067 1.00 105.94 ? 84  HIS B HB2    1 
ATOM   3451 H HB3    . HIS B 1 84  ? 38.442  47.039 52.613 1.00 105.94 ? 84  HIS B HB3    1 
ATOM   3452 H HD2    . HIS B 1 84  ? 39.253  50.244 54.137 1.00 112.66 ? 84  HIS B HD2    1 
ATOM   3453 H HE1    . HIS B 1 84  ? 39.263  50.946 50.242 1.00 116.39 ? 84  HIS B HE1    1 
ATOM   3454 H HE2    . HIS B 1 84  ? 39.810  51.814 52.373 1.00 118.26 ? 84  HIS B HE2    1 
ATOM   3455 N N      . ARG B 1 85  ? 35.855  46.685 51.030 1.00 87.30  ? 85  ARG B N      1 
ATOM   3456 C CA     . ARG B 1 85  ? 35.351  46.743 49.662 1.00 84.07  ? 85  ARG B CA     1 
ATOM   3457 C C      . ARG B 1 85  ? 33.867  47.084 49.634 1.00 81.75  ? 85  ARG B C      1 
ATOM   3458 O O      . ARG B 1 85  ? 33.423  47.877 48.796 1.00 81.13  ? 85  ARG B O      1 
ATOM   3459 C CB     . ARG B 1 85  ? 35.607  45.412 48.955 1.00 82.21  ? 85  ARG B CB     1 
ATOM   3460 C CG     . ARG B 1 85  ? 35.406  45.456 47.447 1.00 82.04  ? 85  ARG B CG     1 
ATOM   3461 C CD     . ARG B 1 85  ? 35.646  44.093 46.811 1.00 80.48  ? 85  ARG B CD     1 
ATOM   3462 N NE     . ARG B 1 85  ? 35.924  44.193 45.379 1.00 82.06  ? 85  ARG B NE     1 
ATOM   3463 C CZ     . ARG B 1 85  ? 36.131  43.151 44.576 1.00 81.86  ? 85  ARG B CZ     1 
ATOM   3464 N NH1    . ARG B 1 85  ? 36.089  41.914 45.054 1.00 79.98  ? 85  ARG B NH1    1 
ATOM   3465 N NH2    . ARG B 1 85  ? 36.380  43.345 43.288 1.00 83.45  ? 85  ARG B NH2    1 
ATOM   3466 H H      . ARG B 1 85  ? 36.030  45.891 51.313 1.00 100.53 ? 85  ARG B H      1 
ATOM   3467 H HA     . ARG B 1 85  ? 35.828  47.437 49.179 1.00 96.55  ? 85  ARG B HA     1 
ATOM   3468 H HB2    . ARG B 1 85  ? 36.524  45.142 49.123 1.00 100.87 ? 85  ARG B HB2    1 
ATOM   3469 H HB3    . ARG B 1 85  ? 35.000  44.747 49.315 1.00 100.87 ? 85  ARG B HB3    1 
ATOM   3470 H HG2    . ARG B 1 85  ? 34.494  45.725 47.254 1.00 105.90 ? 85  ARG B HG2    1 
ATOM   3471 H HG3    . ARG B 1 85  ? 36.032  46.087 47.059 1.00 105.90 ? 85  ARG B HG3    1 
ATOM   3472 H HD2    . ARG B 1 85  ? 36.409  43.673 47.238 1.00 109.95 ? 85  ARG B HD2    1 
ATOM   3473 H HD3    . ARG B 1 85  ? 34.855  43.544 46.927 1.00 109.95 ? 85  ARG B HD3    1 
ATOM   3474 H HE     . ARG B 1 85  ? 35.956  44.978 45.031 1.00 117.14 ? 85  ARG B HE     1 
ATOM   3475 H HH11   . ARG B 1 85  ? 35.929  41.780 45.889 1.00 123.13 ? 85  ARG B HH11   1 
ATOM   3476 H HH12   . ARG B 1 85  ? 36.223  41.245 44.530 1.00 123.13 ? 85  ARG B HH12   1 
ATOM   3477 H HH21   . ARG B 1 85  ? 36.407  44.145 42.971 1.00 129.29 ? 85  ARG B HH21   1 
ATOM   3478 H HH22   . ARG B 1 85  ? 36.512  42.672 42.769 1.00 129.29 ? 85  ARG B HH22   1 
ATOM   3479 N N      . VAL B 1 86  ? 33.083  46.499 50.543 1.00 62.43  ? 86  VAL B N      1 
ATOM   3480 C CA     . VAL B 1 86  ? 31.639  46.709 50.526 1.00 58.11  ? 86  VAL B CA     1 
ATOM   3481 C C      . VAL B 1 86  ? 31.231  47.989 51.242 1.00 59.95  ? 86  VAL B C      1 
ATOM   3482 O O      . VAL B 1 86  ? 30.147  48.520 50.969 1.00 57.26  ? 86  VAL B O      1 
ATOM   3483 C CB     . VAL B 1 86  ? 30.902  45.509 51.146 1.00 51.33  ? 86  VAL B CB     1 
ATOM   3484 C CG1    . VAL B 1 86  ? 31.225  44.233 50.378 1.00 49.24  ? 86  VAL B CG1    1 
ATOM   3485 C CG2    . VAL B 1 86  ? 31.254  45.350 52.621 1.00 51.33  ? 86  VAL B CG2    1 
ATOM   3486 H H      . VAL B 1 86  ? 33.361  45.983 51.173 1.00 73.93  ? 86  VAL B H      1 
ATOM   3487 H HA     . VAL B 1 86  ? 31.350  46.785 49.603 1.00 69.16  ? 86  VAL B HA     1 
ATOM   3488 H HB     . VAL B 1 86  ? 29.946  45.661 51.082 1.00 62.43  ? 86  VAL B HB     1 
ATOM   3489 H HG11   . VAL B 1 86  ? 30.750  43.491 50.785 1.00 61.72  ? 86  VAL B HG11   1 
ATOM   3490 H HG12   . VAL B 1 86  ? 30.943  44.340 49.456 1.00 61.72  ? 86  VAL B HG12   1 
ATOM   3491 H HG13   . VAL B 1 86  ? 32.181  44.075 50.416 1.00 61.72  ? 86  VAL B HG13   1 
ATOM   3492 H HG21   . VAL B 1 86  ? 30.774  44.587 52.979 1.00 60.65  ? 86  VAL B HG21   1 
ATOM   3493 H HG22   . VAL B 1 86  ? 32.210  45.209 52.704 1.00 60.65  ? 86  VAL B HG22   1 
ATOM   3494 H HG23   . VAL B 1 86  ? 30.996  46.156 53.095 1.00 60.65  ? 86  VAL B HG23   1 
ATOM   3495 N N      . LEU B 1 87  ? 32.059  48.500 52.156 1.00 63.18  ? 87  LEU B N      1 
ATOM   3496 C CA     . LEU B 1 87  ? 31.731  49.759 52.817 1.00 63.57  ? 87  LEU B CA     1 
ATOM   3497 C C      . LEU B 1 87  ? 31.738  50.922 51.834 1.00 64.80  ? 87  LEU B C      1 
ATOM   3498 O O      . LEU B 1 87  ? 31.016  51.905 52.036 1.00 63.58  ? 87  LEU B O      1 
ATOM   3499 C CB     . LEU B 1 87  ? 32.709  50.029 53.961 1.00 67.81  ? 87  LEU B CB     1 
ATOM   3500 C CG     . LEU B 1 87  ? 32.632  49.103 55.177 1.00 67.77  ? 87  LEU B CG     1 
ATOM   3501 C CD1    . LEU B 1 87  ? 33.715  49.466 56.185 1.00 71.86  ? 87  LEU B CD1    1 
ATOM   3502 C CD2    . LEU B 1 87  ? 31.259  49.154 55.830 1.00 63.64  ? 87  LEU B CD2    1 
ATOM   3503 H H      . LEU B 1 87  ? 32.801  48.145 52.405 1.00 72.58  ? 87  LEU B H      1 
ATOM   3504 H HA     . LEU B 1 87  ? 30.840  49.693 53.195 1.00 77.31  ? 87  LEU B HA     1 
ATOM   3505 H HB2    . LEU B 1 87  ? 33.610  49.963 53.608 1.00 85.25  ? 87  LEU B HB2    1 
ATOM   3506 H HB3    . LEU B 1 87  ? 32.557  50.932 54.280 1.00 85.25  ? 87  LEU B HB3    1 
ATOM   3507 H HG     . LEU B 1 87  ? 32.790  48.191 54.887 1.00 89.04  ? 87  LEU B HG     1 
ATOM   3508 H HD11   . LEU B 1 87  ? 33.650  48.870 56.947 1.00 93.73  ? 87  LEU B HD11   1 
ATOM   3509 H HD12   . LEU B 1 87  ? 34.583  49.372 55.763 1.00 93.73  ? 87  LEU B HD12   1 
ATOM   3510 H HD13   . LEU B 1 87  ? 33.584  50.384 56.471 1.00 93.73  ? 87  LEU B HD13   1 
ATOM   3511 H HD21   . LEU B 1 87  ? 31.251  48.556 56.594 1.00 89.25  ? 87  LEU B HD21   1 
ATOM   3512 H HD22   . LEU B 1 87  ? 31.081  50.062 56.119 1.00 89.25  ? 87  LEU B HD22   1 
ATOM   3513 H HD23   . LEU B 1 87  ? 30.592  48.875 55.184 1.00 89.25  ? 87  LEU B HD23   1 
ATOM   3514 N N      . GLY B 1 88  ? 32.538  50.833 50.776 1.00 62.09  ? 88  GLY B N      1 
ATOM   3515 C CA     . GLY B 1 88  ? 32.577  51.855 49.756 1.00 62.91  ? 88  GLY B CA     1 
ATOM   3516 C C      . GLY B 1 88  ? 31.519  51.731 48.686 1.00 61.09  ? 88  GLY B C      1 
ATOM   3517 O O      . GLY B 1 88  ? 31.601  52.424 47.668 1.00 62.10  ? 88  GLY B O      1 
ATOM   3518 H H      . GLY B 1 88  ? 33.074  50.176 50.631 1.00 72.25  ? 88  GLY B H      1 
ATOM   3519 H HA2    . GLY B 1 88  ? 32.475  52.723 50.177 1.00 74.80  ? 88  GLY B HA2    1 
ATOM   3520 H HA3    . GLY B 1 88  ? 33.444  51.833 49.322 1.00 74.80  ? 88  GLY B HA3    1 
ATOM   3521 N N      . SER B 1 89  ? 30.521  50.864 48.880 1.00 61.40  ? 89  SER B N      1 
ATOM   3522 C CA     . SER B 1 89  ? 29.464  50.721 47.884 1.00 58.86  ? 89  SER B CA     1 
ATOM   3523 C C      . SER B 1 89  ? 28.693  52.019 47.703 1.00 56.19  ? 89  SER B C      1 
ATOM   3524 O O      . SER B 1 89  ? 28.145  52.271 46.624 1.00 55.57  ? 89  SER B O      1 
ATOM   3525 C CB     . SER B 1 89  ? 28.516  49.590 48.281 1.00 56.25  ? 89  SER B CB     1 
ATOM   3526 O OG     . SER B 1 89  ? 27.790  49.913 49.453 1.00 52.86  ? 89  SER B OG     1 
ATOM   3527 H H      . SER B 1 89  ? 30.436  50.357 49.569 1.00 76.43  ? 89  SER B H      1 
ATOM   3528 H HA     . SER B 1 89  ? 29.865  50.489 47.031 1.00 71.05  ? 89  SER B HA     1 
ATOM   3529 H HB2    . SER B 1 89  ? 27.890  49.436 47.557 1.00 70.84  ? 89  SER B HB2    1 
ATOM   3530 H HB3    . SER B 1 89  ? 29.036  48.788 48.445 1.00 70.84  ? 89  SER B HB3    1 
ATOM   3531 H HG     . SER B 1 89  ? 27.275  49.280 49.655 1.00 71.20  ? 89  SER B HG     1 
ATOM   3532 N N      . TRP B 1 90  ? 28.635  52.847 48.742 1.00 56.51  ? 90  TRP B N      1 
ATOM   3533 C CA     . TRP B 1 90  ? 28.054  54.176 48.644 1.00 55.90  ? 90  TRP B CA     1 
ATOM   3534 C C      . TRP B 1 90  ? 28.715  55.059 49.693 1.00 56.94  ? 90  TRP B C      1 
ATOM   3535 O O      . TRP B 1 90  ? 29.387  54.576 50.608 1.00 56.46  ? 90  TRP B O      1 
ATOM   3536 C CB     . TRP B 1 90  ? 26.533  54.145 48.828 1.00 52.33  ? 90  TRP B CB     1 
ATOM   3537 C CG     . TRP B 1 90  ? 26.102  53.629 50.161 1.00 49.72  ? 90  TRP B CG     1 
ATOM   3538 C CD1    . TRP B 1 90  ? 25.757  52.346 50.471 1.00 47.35  ? 90  TRP B CD1    1 
ATOM   3539 C CD2    . TRP B 1 90  ? 25.968  54.384 51.371 1.00 49.52  ? 90  TRP B CD2    1 
ATOM   3540 N NE1    . TRP B 1 90  ? 25.416  52.255 51.799 1.00 45.37  ? 90  TRP B NE1    1 
ATOM   3541 C CE2    . TRP B 1 90  ? 25.538  53.492 52.374 1.00 46.86  ? 90  TRP B CE2    1 
ATOM   3542 C CE3    . TRP B 1 90  ? 26.171  55.726 51.703 1.00 51.71  ? 90  TRP B CE3    1 
ATOM   3543 C CZ2    . TRP B 1 90  ? 25.308  53.899 53.685 1.00 46.59  ? 90  TRP B CZ2    1 
ATOM   3544 C CZ3    . TRP B 1 90  ? 25.941  56.128 53.007 1.00 51.33  ? 90  TRP B CZ3    1 
ATOM   3545 C CH2    . TRP B 1 90  ? 25.514  55.218 53.981 1.00 48.91  ? 90  TRP B CH2    1 
ATOM   3546 H H      . TRP B 1 90  ? 28.931  52.655 49.526 1.00 65.21  ? 90  TRP B H      1 
ATOM   3547 H HA     . TRP B 1 90  ? 28.247  54.547 47.769 1.00 64.38  ? 90  TRP B HA     1 
ATOM   3548 H HB2    . TRP B 1 90  ? 26.188  55.047 48.733 1.00 60.60  ? 90  TRP B HB2    1 
ATOM   3549 H HB3    . TRP B 1 90  ? 26.147  53.571 48.148 1.00 60.60  ? 90  TRP B HB3    1 
ATOM   3550 H HD1    . TRP B 1 90  ? 25.752  51.636 49.870 1.00 58.98  ? 90  TRP B HD1    1 
ATOM   3551 H HE1    . TRP B 1 90  ? 25.168  51.538 52.203 1.00 58.11  ? 90  TRP B HE1    1 
ATOM   3552 H HE3    . TRP B 1 90  ? 26.455  56.336 51.062 1.00 64.96  ? 90  TRP B HE3    1 
ATOM   3553 H HZ2    . TRP B 1 90  ? 25.024  53.297 54.334 1.00 59.50  ? 90  TRP B HZ2    1 
ATOM   3554 H HZ3    . TRP B 1 90  ? 26.072  57.018 53.240 1.00 65.94  ? 90  TRP B HZ3    1 
ATOM   3555 H HH2    . TRP B 1 90  ? 25.367  55.517 54.849 1.00 62.97  ? 90  TRP B HH2    1 
ATOM   3556 N N      . THR B 1 91  ? 28.522  56.366 49.547 1.00 62.49  ? 91  THR B N      1 
ATOM   3557 C CA     . THR B 1 91  ? 29.090  57.324 50.481 1.00 64.18  ? 91  THR B CA     1 
ATOM   3558 C C      . THR B 1 91  ? 28.173  58.535 50.561 1.00 64.05  ? 91  THR B C      1 
ATOM   3559 O O      . THR B 1 91  ? 27.182  58.641 49.834 1.00 62.79  ? 91  THR B O      1 
ATOM   3560 C CB     . THR B 1 91  ? 30.507  57.739 50.070 1.00 67.30  ? 91  THR B CB     1 
ATOM   3561 O OG1    . THR B 1 91  ? 31.005  58.721 50.987 1.00 69.09  ? 91  THR B OG1    1 
ATOM   3562 C CG2    . THR B 1 91  ? 30.515  58.310 48.661 1.00 68.31  ? 91  THR B CG2    1 
ATOM   3563 H H      . THR B 1 91  ? 28.064  56.722 48.912 1.00 69.37  ? 91  THR B H      1 
ATOM   3564 H HA     . THR B 1 91  ? 29.136  56.921 51.362 1.00 73.61  ? 91  THR B HA     1 
ATOM   3565 H HB     . THR B 1 91  ? 31.086  56.961 50.087 1.00 76.97  ? 91  THR B HB     1 
ATOM   3566 H HG1    . THR B 1 91  ? 31.782  58.952 50.767 1.00 82.30  ? 91  THR B HG1    1 
ATOM   3567 H HG21   . THR B 1 91  ? 31.417  58.568 48.414 1.00 77.42  ? 91  THR B HG21   1 
ATOM   3568 H HG22   . THR B 1 91  ? 30.194  57.645 48.033 1.00 77.42  ? 91  THR B HG22   1 
ATOM   3569 H HG23   . THR B 1 91  ? 29.941  59.090 48.617 1.00 77.42  ? 91  THR B HG23   1 
ATOM   3570 N N      . GLY B 1 92  ? 28.519  59.452 51.464 1.00 60.43  ? 92  GLY B N      1 
ATOM   3571 C CA     . GLY B 1 92  ? 27.707  60.645 51.642 1.00 60.84  ? 92  GLY B CA     1 
ATOM   3572 C C      . GLY B 1 92  ? 27.492  61.409 50.352 1.00 62.14  ? 92  GLY B C      1 
ATOM   3573 O O      . GLY B 1 92  ? 26.373  61.824 50.044 1.00 61.06  ? 92  GLY B O      1 
ATOM   3574 H H      . GLY B 1 92  ? 29.207  59.406 51.977 1.00 66.50  ? 92  GLY B H      1 
ATOM   3575 H HA2    . GLY B 1 92  ? 26.840  60.394 51.997 1.00 69.96  ? 92  GLY B HA2    1 
ATOM   3576 H HA3    . GLY B 1 92  ? 28.139  61.235 52.279 1.00 69.96  ? 92  GLY B HA3    1 
ATOM   3577 N N      . ASP B 1 93  ? 28.560  61.599 49.572 1.00 93.01  ? 93  ASP B N      1 
ATOM   3578 C CA     . ASP B 1 93  ? 28.445  62.380 48.346 1.00 94.76  ? 93  ASP B CA     1 
ATOM   3579 C C      . ASP B 1 93  ? 27.609  61.653 47.301 1.00 93.85  ? 93  ASP B C      1 
ATOM   3580 O O      . ASP B 1 93  ? 26.784  62.272 46.618 1.00 95.30  ? 93  ASP B O      1 
ATOM   3581 C CB     . ASP B 1 93  ? 29.835  62.699 47.791 1.00 100.18 ? 93  ASP B CB     1 
ATOM   3582 C CG     . ASP B 1 93  ? 30.595  61.457 47.362 1.00 99.45  ? 93  ASP B CG     1 
ATOM   3583 O OD1    . ASP B 1 93  ? 30.309  60.930 46.266 1.00 99.16  ? 93  ASP B OD1    1 
ATOM   3584 O OD2    . ASP B 1 93  ? 31.485  61.013 48.117 1.00 100.65 ? 93  ASP B OD2    1 
ATOM   3585 H H      . ASP B 1 93  ? 29.347  61.290 49.730 1.00 104.19 ? 93  ASP B H      1 
ATOM   3586 H HA     . ASP B 1 93  ? 28.005  63.220 48.548 1.00 106.88 ? 93  ASP B HA     1 
ATOM   3587 H HB2    . ASP B 1 93  ? 29.742  63.276 47.017 1.00 113.86 ? 93  ASP B HB2    1 
ATOM   3588 H HB3    . ASP B 1 93  ? 30.354  63.146 48.478 1.00 113.86 ? 93  ASP B HB3    1 
ATOM   3589 N N      . SER B 1 94  ? 27.799  60.339 47.162 1.00 59.18  ? 94  SER B N      1 
ATOM   3590 C CA     . SER B 1 94  ? 27.084  59.601 46.127 1.00 58.16  ? 94  SER B CA     1 
ATOM   3591 C C      . SER B 1 94  ? 25.584  59.588 46.394 1.00 56.24  ? 94  SER B C      1 
ATOM   3592 O O      . SER B 1 94  ? 24.782  59.677 45.458 1.00 55.87  ? 94  SER B O      1 
ATOM   3593 C CB     . SER B 1 94  ? 27.631  58.175 46.023 1.00 57.01  ? 94  SER B CB     1 
ATOM   3594 O OG     . SER B 1 94  ? 27.446  57.454 47.228 1.00 54.30  ? 94  SER B OG     1 
ATOM   3595 H H      . SER B 1 94  ? 28.326  59.862 47.646 1.00 75.00  ? 94  SER B H      1 
ATOM   3596 H HA     . SER B 1 94  ? 27.230  60.038 45.273 1.00 72.36  ? 94  SER B HA     1 
ATOM   3597 H HB2    . SER B 1 94  ? 27.166  57.713 45.308 1.00 68.16  ? 94  SER B HB2    1 
ATOM   3598 H HB3    . SER B 1 94  ? 28.579  58.217 45.825 1.00 68.16  ? 94  SER B HB3    1 
ATOM   3599 H HG     . SER B 1 94  ? 26.628  57.406 47.412 1.00 62.91  ? 94  SER B HG     1 
ATOM   3600 N N      . VAL B 1 95  ? 25.183  59.487 47.661 1.00 62.79  ? 95  VAL B N      1 
ATOM   3601 C CA     . VAL B 1 95  ? 23.760  59.467 47.989 1.00 60.77  ? 95  VAL B CA     1 
ATOM   3602 C C      . VAL B 1 95  ? 23.144  60.840 47.749 1.00 61.63  ? 95  VAL B C      1 
ATOM   3603 O O      . VAL B 1 95  ? 22.156  60.978 47.018 1.00 61.34  ? 95  VAL B O      1 
ATOM   3604 C CB     . VAL B 1 95  ? 23.544  59.002 49.439 1.00 59.44  ? 95  VAL B CB     1 
ATOM   3605 C CG1    . VAL B 1 95  ? 22.059  59.000 49.783 1.00 57.53  ? 95  VAL B CG1    1 
ATOM   3606 C CG2    . VAL B 1 95  ? 24.134  57.614 49.645 1.00 58.25  ? 95  VAL B CG2    1 
ATOM   3607 H H      . VAL B 1 95  ? 25.708  59.430 48.341 1.00 73.52  ? 95  VAL B H      1 
ATOM   3608 H HA     . VAL B 1 95  ? 23.313  58.834 47.405 1.00 72.04  ? 95  VAL B HA     1 
ATOM   3609 H HB     . VAL B 1 95  ? 23.994  59.616 50.042 1.00 73.67  ? 95  VAL B HB     1 
ATOM   3610 H HG11   . VAL B 1 95  ? 21.948  58.704 50.700 1.00 73.25  ? 95  VAL B HG11   1 
ATOM   3611 H HG12   . VAL B 1 95  ? 21.710  59.899 49.680 1.00 73.25  ? 95  VAL B HG12   1 
ATOM   3612 H HG13   . VAL B 1 95  ? 21.598  58.394 49.181 1.00 73.25  ? 95  VAL B HG13   1 
ATOM   3613 H HG21   . VAL B 1 95  ? 23.988  57.342 50.564 1.00 72.13  ? 95  VAL B HG21   1 
ATOM   3614 H HG22   . VAL B 1 95  ? 23.697  56.993 49.041 1.00 72.13  ? 95  VAL B HG22   1 
ATOM   3615 H HG23   . VAL B 1 95  ? 25.085  57.645 49.456 1.00 72.13  ? 95  VAL B HG23   1 
ATOM   3616 N N      . ASN B 1 96  ? 23.717  61.876 48.367 1.00 60.67  ? 96  ASN B N      1 
ATOM   3617 C CA     . ASN B 1 96  ? 23.196  63.226 48.183 1.00 62.06  ? 96  ASN B CA     1 
ATOM   3618 C C      . ASN B 1 96  ? 23.162  63.604 46.708 1.00 63.81  ? 96  ASN B C      1 
ATOM   3619 O O      . ASN B 1 96  ? 22.174  64.172 46.227 1.00 63.64  ? 96  ASN B O      1 
ATOM   3620 C CB     . ASN B 1 96  ? 24.040  64.229 48.969 1.00 63.82  ? 96  ASN B CB     1 
ATOM   3621 C CG     . ASN B 1 96  ? 23.869  64.085 50.469 1.00 62.28  ? 96  ASN B CG     1 
ATOM   3622 O OD1    . ASN B 1 96  ? 22.916  63.464 50.940 1.00 59.64  ? 96  ASN B OD1    1 
ATOM   3623 N ND2    . ASN B 1 96  ? 24.787  64.674 51.229 1.00 66.44  ? 96  ASN B ND2    1 
ATOM   3624 H H      . ASN B 1 96  ? 24.397  61.822 48.891 1.00 71.06  ? 96  ASN B H      1 
ATOM   3625 H HA     . ASN B 1 96  ? 22.289  63.265 48.523 1.00 73.33  ? 96  ASN B HA     1 
ATOM   3626 H HB2    . ASN B 1 96  ? 24.976  64.088 48.759 1.00 77.59  ? 96  ASN B HB2    1 
ATOM   3627 H HB3    . ASN B 1 96  ? 23.776  65.128 48.721 1.00 77.59  ? 96  ASN B HB3    1 
ATOM   3628 H HD21   . ASN B 1 96  ? 24.734  64.622 52.085 1.00 81.69  ? 96  ASN B HD21   1 
ATOM   3629 H HD22   . ASN B 1 96  ? 25.434  65.107 50.864 1.00 81.69  ? 96  ASN B HD22   1 
ATOM   3630 N N      . TYR B 1 97  ? 24.232  63.297 45.974 1.00 70.21  ? 97  TYR B N      1 
ATOM   3631 C CA     . TYR B 1 97  ? 24.249  63.571 44.542 1.00 72.64  ? 97  TYR B CA     1 
ATOM   3632 C C      . TYR B 1 97  ? 23.076  62.888 43.850 1.00 71.20  ? 97  TYR B C      1 
ATOM   3633 O O      . TYR B 1 97  ? 22.328  63.523 43.098 1.00 72.41  ? 97  TYR B O      1 
ATOM   3634 C CB     . TYR B 1 97  ? 25.578  63.116 43.940 1.00 74.49  ? 97  TYR B CB     1 
ATOM   3635 C CG     . TYR B 1 97  ? 25.734  63.440 42.471 1.00 76.64  ? 97  TYR B CG     1 
ATOM   3636 C CD1    . TYR B 1 97  ? 25.824  64.756 42.037 1.00 80.99  ? 97  TYR B CD1    1 
ATOM   3637 C CD2    . TYR B 1 97  ? 25.803  62.430 41.521 1.00 76.29  ? 97  TYR B CD2    1 
ATOM   3638 C CE1    . TYR B 1 97  ? 25.970  65.057 40.696 1.00 84.52  ? 97  TYR B CE1    1 
ATOM   3639 C CE2    . TYR B 1 97  ? 25.950  62.721 40.178 1.00 78.20  ? 97  TYR B CE2    1 
ATOM   3640 C CZ     . TYR B 1 97  ? 26.035  64.036 39.773 1.00 83.20  ? 97  TYR B CZ     1 
ATOM   3641 O OH     . TYR B 1 97  ? 26.180  64.334 38.437 1.00 87.30  ? 97  TYR B OH     1 
ATOM   3642 H H      . TYR B 1 97  ? 24.951  62.935 46.278 1.00 81.73  ? 97  TYR B H      1 
ATOM   3643 H HA     . TYR B 1 97  ? 24.166  64.527 44.401 1.00 87.08  ? 97  TYR B HA     1 
ATOM   3644 H HB2    . TYR B 1 97  ? 26.302  63.551 44.417 1.00 90.73  ? 97  TYR B HB2    1 
ATOM   3645 H HB3    . TYR B 1 97  ? 25.652  62.154 44.039 1.00 90.73  ? 97  TYR B HB3    1 
ATOM   3646 H HD1    . TYR B 1 97  ? 25.782  65.446 42.658 1.00 101.07 ? 97  TYR B HD1    1 
ATOM   3647 H HD2    . TYR B 1 97  ? 25.746  61.542 41.793 1.00 94.05  ? 97  TYR B HD2    1 
ATOM   3648 H HE1    . TYR B 1 97  ? 26.028  65.943 40.419 1.00 105.45 ? 97  TYR B HE1    1 
ATOM   3649 H HE2    . TYR B 1 97  ? 25.993  62.035 39.553 1.00 98.44  ? 97  TYR B HE2    1 
ATOM   3650 H HH     . TYR B 1 97  ? 26.206  63.626 37.986 1.00 109.62 ? 97  TYR B HH     1 
ATOM   3651 N N      . ALA B 1 98  ? 22.894  61.591 44.101 1.00 56.77  ? 98  ALA B N      1 
ATOM   3652 C CA     . ALA B 1 98  ? 21.745  60.885 43.545 1.00 54.91  ? 98  ALA B CA     1 
ATOM   3653 C C      . ALA B 1 98  ? 20.442  61.462 44.085 1.00 53.35  ? 98  ALA B C      1 
ATOM   3654 O O      . ALA B 1 98  ? 19.498  61.713 43.328 1.00 53.85  ? 98  ALA B O      1 
ATOM   3655 C CB     . ALA B 1 98  ? 21.844  59.393 43.861 1.00 53.43  ? 98  ALA B CB     1 
ATOM   3656 H H      . ALA B 1 98  ? 23.414  61.105 44.583 1.00 66.82  ? 98  ALA B H      1 
ATOM   3657 H HA     . ALA B 1 98  ? 21.744  60.990 42.581 1.00 61.82  ? 98  ALA B HA     1 
ATOM   3658 H HB1    . ALA B 1 98  ? 21.074  58.939 43.485 1.00 59.35  ? 98  ALA B HB1    1 
ATOM   3659 H HB2    . ALA B 1 98  ? 22.659  59.042 43.469 1.00 59.35  ? 98  ALA B HB2    1 
ATOM   3660 H HB3    . ALA B 1 98  ? 21.862  59.275 44.823 1.00 59.35  ? 98  ALA B HB3    1 
ATOM   3661 N N      . ALA B 1 99  ? 20.379  61.686 45.399 1.00 60.07  ? 99  ALA B N      1 
ATOM   3662 C CA     . ALA B 1 99  ? 19.154  62.196 46.005 1.00 58.85  ? 99  ALA B CA     1 
ATOM   3663 C C      . ALA B 1 99  ? 18.777  63.554 45.429 1.00 60.91  ? 99  ALA B C      1 
ATOM   3664 O O      . ALA B 1 99  ? 17.592  63.836 45.213 1.00 60.24  ? 99  ALA B O      1 
ATOM   3665 C CB     . ALA B 1 99  ? 19.320  62.285 47.521 1.00 57.53  ? 99  ALA B CB     1 
ATOM   3666 H H      . ALA B 1 99  ? 21.023  61.551 45.953 1.00 72.73  ? 99  ALA B H      1 
ATOM   3667 H HA     . ALA B 1 99  ? 18.429  61.580 45.819 1.00 71.67  ? 99  ALA B HA     1 
ATOM   3668 H HB1    . ALA B 1 99  ? 18.498  62.626 47.908 1.00 71.37  ? 99  ALA B HB1    1 
ATOM   3669 H HB2    . ALA B 1 99  ? 19.508  61.400 47.870 1.00 71.37  ? 99  ALA B HB2    1 
ATOM   3670 H HB3    . ALA B 1 99  ? 20.055  62.885 47.723 1.00 71.37  ? 99  ALA B HB3    1 
ATOM   3671 N N      . SER B 1 100 ? 19.770  64.410 45.170 1.00 52.80  ? 100 SER B N      1 
ATOM   3672 C CA     . SER B 1 100 ? 19.494  65.706 44.560 1.00 56.43  ? 100 SER B CA     1 
ATOM   3673 C C      . SER B 1 100 ? 18.789  65.559 43.221 1.00 56.06  ? 100 SER B C      1 
ATOM   3674 O O      . SER B 1 100 ? 18.149  66.509 42.757 1.00 58.20  ? 100 SER B O      1 
ATOM   3675 C CB     . SER B 1 100 ? 20.793  66.491 44.371 1.00 61.21  ? 100 SER B CB     1 
ATOM   3676 O OG     . SER B 1 100 ? 21.596  65.914 43.357 1.00 61.89  ? 100 SER B OG     1 
ATOM   3677 H H      . SER B 1 100 ? 20.600  64.263 45.337 1.00 63.43  ? 100 SER B H      1 
ATOM   3678 H HA     . SER B 1 100 ? 18.916  66.216 45.149 1.00 67.76  ? 100 SER B HA     1 
ATOM   3679 H HB2    . SER B 1 100 ? 20.576  67.403 44.121 1.00 72.59  ? 100 SER B HB2    1 
ATOM   3680 H HB3    . SER B 1 100 ? 21.288  66.486 45.206 1.00 72.59  ? 100 SER B HB3    1 
ATOM   3681 H HG     . SER B 1 100 ? 21.792  65.123 43.561 1.00 73.02  ? 100 SER B HG     1 
ATOM   3682 N N      . ARG B 1 101 ? 18.893  64.392 42.597 1.00 66.86  ? 101 ARG B N      1 
ATOM   3683 C CA     . ARG B 1 101 ? 18.274  64.123 41.310 1.00 67.13  ? 101 ARG B CA     1 
ATOM   3684 C C      . ARG B 1 101 ? 16.842  63.622 41.429 1.00 65.33  ? 101 ARG B C      1 
ATOM   3685 O O      . ARG B 1 101 ? 16.219  63.333 40.403 1.00 65.55  ? 101 ARG B O      1 
ATOM   3686 C CB     . ARG B 1 101 ? 19.108  63.091 40.543 1.00 67.63  ? 101 ARG B CB     1 
ATOM   3687 C CG     . ARG B 1 101 ? 20.570  63.472 40.372 1.00 69.71  ? 101 ARG B CG     1 
ATOM   3688 C CD     . ARG B 1 101 ? 20.679  64.630 39.431 1.00 72.56  ? 101 ARG B CD     1 
ATOM   3689 N NE     . ARG B 1 101 ? 22.045  65.062 39.165 1.00 75.20  ? 101 ARG B NE     1 
ATOM   3690 C CZ     . ARG B 1 101 ? 22.752  64.708 38.096 1.00 78.31  ? 101 ARG B CZ     1 
ATOM   3691 N NH1    . ARG B 1 101 ? 22.236  63.901 37.180 1.00 76.95  ? 101 ARG B NH1    1 
ATOM   3692 N NH2    . ARG B 1 101 ? 23.984  65.165 37.942 1.00 83.23  ? 101 ARG B NH2    1 
ATOM   3693 H H      . ARG B 1 101 ? 19.330  63.721 42.911 1.00 84.72  ? 101 ARG B H      1 
ATOM   3694 H HA     . ARG B 1 101 ? 18.262  64.942 40.790 1.00 84.14  ? 101 ARG B HA     1 
ATOM   3695 H HB2    . ARG B 1 101 ? 19.077  62.248 41.023 1.00 84.59  ? 101 ARG B HB2    1 
ATOM   3696 H HB3    . ARG B 1 101 ? 18.727  62.978 39.658 1.00 84.59  ? 101 ARG B HB3    1 
ATOM   3697 H HG2    . ARG B 1 101 ? 20.942  63.733 41.229 1.00 89.65  ? 101 ARG B HG2    1 
ATOM   3698 H HG3    . ARG B 1 101 ? 21.061  62.723 40.000 1.00 89.65  ? 101 ARG B HG3    1 
ATOM   3699 H HD2    . ARG B 1 101 ? 20.279  64.380 38.584 1.00 97.25  ? 101 ARG B HD2    1 
ATOM   3700 H HD3    . ARG B 1 101 ? 20.200  65.383 39.810 1.00 97.25  ? 101 ARG B HD3    1 
ATOM   3701 H HE     . ARG B 1 101 ? 22.420  65.581 39.739 1.00 103.99 ? 101 ARG B HE     1 
ATOM   3702 H HH11   . ARG B 1 101 ? 21.435  63.602 37.271 1.00 107.84 ? 101 ARG B HH11   1 
ATOM   3703 H HH12   . ARG B 1 101 ? 22.702  63.677 36.492 1.00 107.84 ? 101 ARG B HH12   1 
ATOM   3704 H HH21   . ARG B 1 101 ? 24.326  65.687 38.534 1.00 115.23 ? 101 ARG B HH21   1 
ATOM   3705 H HH22   . ARG B 1 101 ? 24.446  64.934 37.254 1.00 115.23 ? 101 ARG B HH22   1 
ATOM   3706 N N      . PHE B 1 102 ? 16.311  63.486 42.642 1.00 54.91  ? 102 PHE B N      1 
ATOM   3707 C CA     . PHE B 1 102 ? 14.943  63.019 42.807 1.00 55.88  ? 102 PHE B CA     1 
ATOM   3708 C C      . PHE B 1 102 ? 14.208  63.685 43.963 1.00 56.89  ? 102 PHE B C      1 
ATOM   3709 O O      . PHE B 1 102 ? 13.060  63.314 44.229 1.00 58.22  ? 102 PHE B O      1 
ATOM   3710 C CB     . PHE B 1 102 ? 14.922  61.491 43.001 1.00 53.10  ? 102 PHE B CB     1 
ATOM   3711 C CG     . PHE B 1 102 ? 15.783  60.744 42.019 1.00 50.98  ? 102 PHE B CG     1 
ATOM   3712 C CD1    . PHE B 1 102 ? 15.360  60.539 40.715 1.00 52.03  ? 102 PHE B CD1    1 
ATOM   3713 C CD2    . PHE B 1 102 ? 17.018  60.249 42.401 1.00 48.48  ? 102 PHE B CD2    1 
ATOM   3714 C CE1    . PHE B 1 102 ? 16.155  59.854 39.811 1.00 50.65  ? 102 PHE B CE1    1 
ATOM   3715 C CE2    . PHE B 1 102 ? 17.816  59.562 41.504 1.00 47.61  ? 102 PHE B CE2    1 
ATOM   3716 C CZ     . PHE B 1 102 ? 17.384  59.365 40.207 1.00 48.55  ? 102 PHE B CZ     1 
ATOM   3717 H H      . PHE B 1 102 ? 16.721  63.656 43.379 1.00 72.10  ? 102 PHE B H      1 
ATOM   3718 H HA     . PHE B 1 102 ? 14.451  63.218 41.995 1.00 70.21  ? 102 PHE B HA     1 
ATOM   3719 H HB2    . PHE B 1 102 ? 15.241  61.285 43.893 1.00 62.60  ? 102 PHE B HB2    1 
ATOM   3720 H HB3    . PHE B 1 102 ? 14.010  61.176 42.896 1.00 62.60  ? 102 PHE B HB3    1 
ATOM   3721 H HD1    . PHE B 1 102 ? 14.533  60.867 40.443 1.00 58.41  ? 102 PHE B HD1    1 
ATOM   3722 H HD2    . PHE B 1 102 ? 17.315  60.379 43.273 1.00 56.11  ? 102 PHE B HD2    1 
ATOM   3723 H HE1    . PHE B 1 102 ? 15.860  59.722 38.939 1.00 59.14  ? 102 PHE B HE1    1 
ATOM   3724 H HE2    . PHE B 1 102 ? 18.644  59.235 41.773 1.00 56.33  ? 102 PHE B HE2    1 
ATOM   3725 H HZ     . PHE B 1 102 ? 17.919  58.904 39.602 1.00 58.07  ? 102 PHE B HZ     1 
ATOM   3726 N N      . LEU B 1 103 ? 14.815  64.651 44.645 1.00 51.48  ? 103 LEU B N      1 
ATOM   3727 C CA     . LEU B 1 103 ? 14.187  65.355 45.752 1.00 53.32  ? 103 LEU B CA     1 
ATOM   3728 C C      . LEU B 1 103 ? 13.963  66.816 45.376 1.00 57.90  ? 103 LEU B C      1 
ATOM   3729 O O      . LEU B 1 103 ? 14.237  67.250 44.253 1.00 59.66  ? 103 LEU B O      1 
ATOM   3730 C CB     . LEU B 1 103 ? 15.039  65.232 47.019 1.00 51.92  ? 103 LEU B CB     1 
ATOM   3731 C CG     . LEU B 1 103 ? 15.160  63.827 47.615 1.00 47.97  ? 103 LEU B CG     1 
ATOM   3732 C CD1    . LEU B 1 103 ? 16.101  63.839 48.811 1.00 47.23  ? 103 LEU B CD1    1 
ATOM   3733 C CD2    . LEU B 1 103 ? 13.795  63.276 48.016 1.00 47.65  ? 103 LEU B CD2    1 
ATOM   3734 H H      . LEU B 1 103 ? 15.614  64.922 44.478 1.00 75.66  ? 103 LEU B H      1 
ATOM   3735 H HA     . LEU B 1 103 ? 13.322  64.955 45.932 1.00 72.87  ? 103 LEU B HA     1 
ATOM   3736 H HB2    . LEU B 1 103 ? 15.937  65.537 46.814 1.00 65.31  ? 103 LEU B HB2    1 
ATOM   3737 H HB3    . LEU B 1 103 ? 14.654  65.803 47.702 1.00 65.31  ? 103 LEU B HB3    1 
ATOM   3738 H HG     . LEU B 1 103 ? 15.536  63.233 46.946 1.00 59.98  ? 103 LEU B HG     1 
ATOM   3739 H HD11   . LEU B 1 103 ? 16.163  62.940 49.172 1.00 60.31  ? 103 LEU B HD11   1 
ATOM   3740 H HD12   . LEU B 1 103 ? 16.976  64.140 48.521 1.00 60.31  ? 103 LEU B HD12   1 
ATOM   3741 H HD13   . LEU B 1 103 ? 15.749  64.442 49.483 1.00 60.31  ? 103 LEU B HD13   1 
ATOM   3742 H HD21   . LEU B 1 103 ? 13.911  62.387 48.388 1.00 58.10  ? 103 LEU B HD21   1 
ATOM   3743 H HD22   . LEU B 1 103 ? 13.401  63.863 48.679 1.00 58.10  ? 103 LEU B HD22   1 
ATOM   3744 H HD23   . LEU B 1 103 ? 13.228  63.235 47.230 1.00 58.10  ? 103 LEU B HD23   1 
ATOM   3745 N N      . GLY B 1 104 ? 13.457  67.574 46.336 1.00 101.79 ? 104 GLY B N      1 
ATOM   3746 C CA     . GLY B 1 104 ? 13.088  68.958 46.131 1.00 104.36 ? 104 GLY B CA     1 
ATOM   3747 C C      . GLY B 1 104 ? 11.586  69.159 46.245 1.00 106.25 ? 104 GLY B C      1 
ATOM   3748 O O      . GLY B 1 104 ? 10.791  68.219 46.226 1.00 106.13 ? 104 GLY B O      1 
ATOM   3749 H H      . GLY B 1 104 ? 13.315  67.297 47.137 1.00 126.14 ? 104 GLY B H      1 
ATOM   3750 H HA2    . GLY B 1 104 ? 13.526  69.513 46.795 1.00 128.16 ? 104 GLY B HA2    1 
ATOM   3751 H HA3    . GLY B 1 104 ? 13.373  69.245 45.250 1.00 128.16 ? 104 GLY B HA3    1 
ATOM   3752 N N      . ALA B 1 105 ? 11.211  70.430 46.369 1.00 88.37  ? 105 ALA B N      1 
ATOM   3753 C CA     . ALA B 1 105 ? 9.810   70.832 46.517 1.00 91.01  ? 105 ALA B CA     1 
ATOM   3754 C C      . ALA B 1 105 ? 9.279   70.181 47.788 1.00 89.87  ? 105 ALA B C      1 
ATOM   3755 O O      . ALA B 1 105 ? 9.852   70.421 48.866 1.00 90.14  ? 105 ALA B O      1 
ATOM   3756 C CB     . ALA B 1 105 ? 9.059   70.495 45.228 1.00 90.91  ? 105 ALA B CB     1 
ATOM   3757 H H      . ALA B 1 105 ? 11.759  71.092 46.369 1.00 104.51 ? 105 ALA B H      1 
ATOM   3758 H HA     . ALA B 1 105 ? 9.772   71.794 46.639 1.00 104.89 ? 105 ALA B HA     1 
ATOM   3759 H HB1    . ALA B 1 105 ? 8.131   70.761 45.324 1.00 101.57 ? 105 ALA B HB1    1 
ATOM   3760 H HB2    . ALA B 1 105 ? 9.466   70.976 44.490 1.00 101.57 ? 105 ALA B HB2    1 
ATOM   3761 H HB3    . ALA B 1 105 ? 9.115   69.539 45.071 1.00 101.57 ? 105 ALA B HB3    1 
ATOM   3762 N N      . ASN B 1 106 ? 8.225   69.371 47.731 1.00 86.78  ? 106 ASN B N      1 
ATOM   3763 C CA     . ASN B 1 106 ? 7.658   68.776 48.932 1.00 86.96  ? 106 ASN B CA     1 
ATOM   3764 C C      . ASN B 1 106 ? 8.532   67.633 49.433 1.00 84.23  ? 106 ASN B C      1 
ATOM   3765 O O      . ASN B 1 106 ? 9.031   66.821 48.648 1.00 84.19  ? 106 ASN B O      1 
ATOM   3766 C CB     . ASN B 1 106 ? 6.243   68.270 48.654 1.00 88.66  ? 106 ASN B CB     1 
ATOM   3767 C CG     . ASN B 1 106 ? 5.271   69.393 48.352 1.00 93.64  ? 106 ASN B CG     1 
ATOM   3768 O OD1    . ASN B 1 106 ? 5.374   70.486 48.909 1.00 97.77  ? 106 ASN B OD1    1 
ATOM   3769 N ND2    . ASN B 1 106 ? 4.319   69.130 47.464 1.00 94.85  ? 106 ASN B ND2    1 
ATOM   3770 H H      . ASN B 1 106 ? 7.821   69.151 47.005 1.00 96.92  ? 106 ASN B H      1 
ATOM   3771 H HA     . ASN B 1 106 ? 7.609   69.449 49.629 1.00 101.76 ? 106 ASN B HA     1 
ATOM   3772 H HB2    . ASN B 1 106 ? 6.264   67.676 47.888 1.00 102.56 ? 106 ASN B HB2    1 
ATOM   3773 H HB3    . ASN B 1 106 ? 5.919   67.794 49.435 1.00 102.56 ? 106 ASN B HB3    1 
ATOM   3774 H HD21   . ASN B 1 106 ? 3.743   69.735 47.259 1.00 108.49 ? 106 ASN B HD21   1 
ATOM   3775 H HD22   . ASN B 1 106 ? 4.278   68.355 47.095 1.00 108.49 ? 106 ASN B HD22   1 
ATOM   3776 N N      . GLN B 1 107 ? 8.714   67.577 50.750 1.00 65.17  ? 107 GLN B N      1 
ATOM   3777 C CA     . GLN B 1 107 ? 9.500   66.514 51.359 1.00 61.21  ? 107 GLN B CA     1 
ATOM   3778 C C      . GLN B 1 107 ? 8.804   65.166 51.195 1.00 58.49  ? 107 GLN B C      1 
ATOM   3779 O O      . GLN B 1 107 ? 7.574   65.069 51.216 1.00 60.11  ? 107 GLN B O      1 
ATOM   3780 C CB     . GLN B 1 107 ? 9.729   66.808 52.843 1.00 62.39  ? 107 GLN B CB     1 
ATOM   3781 C CG     . GLN B 1 107 ? 10.414  65.679 53.598 1.00 58.81  ? 107 GLN B CG     1 
ATOM   3782 C CD     . GLN B 1 107 ? 10.975  66.117 54.941 1.00 60.26  ? 107 GLN B CD     1 
ATOM   3783 O OE1    . GLN B 1 107 ? 12.030  65.645 55.366 1.00 58.10  ? 107 GLN B OE1    1 
ATOM   3784 N NE2    . GLN B 1 107 ? 10.271  67.019 55.617 1.00 64.25  ? 107 GLN B NE2    1 
ATOM   3785 H H      . GLN B 1 107 ? 8.392   68.143 51.311 1.00 88.33  ? 107 GLN B H      1 
ATOM   3786 H HA     . GLN B 1 107 ? 10.364  66.465 50.922 1.00 81.76  ? 107 GLN B HA     1 
ATOM   3787 H HB2    . GLN B 1 107 ? 10.286  67.598 52.922 1.00 82.53  ? 107 GLN B HB2    1 
ATOM   3788 H HB3    . GLN B 1 107 ? 8.871   66.968 53.265 1.00 82.53  ? 107 GLN B HB3    1 
ATOM   3789 H HG2    . GLN B 1 107 ? 9.771   64.971 53.760 1.00 75.19  ? 107 GLN B HG2    1 
ATOM   3790 H HG3    . GLN B 1 107 ? 11.149  65.342 53.063 1.00 75.19  ? 107 GLN B HG3    1 
ATOM   3791 H HE21   . GLN B 1 107 ? 9.537   67.325 55.289 1.00 72.94  ? 107 GLN B HE21   1 
ATOM   3792 H HE22   . GLN B 1 107 ? 10.549  67.297 56.381 1.00 72.94  ? 107 GLN B HE22   1 
ATOM   3793 N N      . VAL B 1 108 ? 9.610   64.118 51.028 1.00 54.70  ? 108 VAL B N      1 
ATOM   3794 C CA     . VAL B 1 108 ? 9.123   62.760 50.841 1.00 52.67  ? 108 VAL B CA     1 
ATOM   3795 C C      . VAL B 1 108 ? 9.873   61.831 51.793 1.00 49.55  ? 108 VAL B C      1 
ATOM   3796 O O      . VAL B 1 108 ? 10.737  62.261 52.560 1.00 49.61  ? 108 VAL B O      1 
ATOM   3797 C CB     . VAL B 1 108 ? 9.271   62.280 49.382 1.00 54.52  ? 108 VAL B CB     1 
ATOM   3798 C CG1    . VAL B 1 108 ? 8.451   63.155 48.453 1.00 58.36  ? 108 VAL B CG1    1 
ATOM   3799 C CG2    . VAL B 1 108 ? 10.736  62.272 48.963 1.00 52.85  ? 108 VAL B CG2    1 
ATOM   3800 H H      . VAL B 1 108 ? 10.468  64.175 51.019 1.00 66.50  ? 108 VAL B H      1 
ATOM   3801 H HA     . VAL B 1 108 ? 8.181   62.729 51.072 1.00 65.24  ? 108 VAL B HA     1 
ATOM   3802 H HB     . VAL B 1 108 ? 8.935   61.373 49.313 1.00 67.29  ? 108 VAL B HB     1 
ATOM   3803 H HG11   . VAL B 1 108 ? 8.558   62.837 47.543 1.00 70.87  ? 108 VAL B HG11   1 
ATOM   3804 H HG12   . VAL B 1 108 ? 7.518   63.105 48.715 1.00 70.87  ? 108 VAL B HG12   1 
ATOM   3805 H HG13   . VAL B 1 108 ? 8.766   64.070 48.523 1.00 70.87  ? 108 VAL B HG13   1 
ATOM   3806 H HG21   . VAL B 1 108 ? 10.800  61.967 48.045 1.00 67.73  ? 108 VAL B HG21   1 
ATOM   3807 H HG22   . VAL B 1 108 ? 11.091  63.171 49.039 1.00 67.73  ? 108 VAL B HG22   1 
ATOM   3808 H HG23   . VAL B 1 108 ? 11.227  61.672 49.546 1.00 67.73  ? 108 VAL B HG23   1 
ATOM   3809 N N      . GLY B 1 109 ? 9.537   60.549 51.726 1.00 52.41  ? 109 GLY B N      1 
ATOM   3810 C CA     . GLY B 1 109 ? 10.141  59.555 52.593 1.00 49.32  ? 109 GLY B CA     1 
ATOM   3811 C C      . GLY B 1 109 ? 11.361  58.925 51.943 1.00 46.79  ? 109 GLY B C      1 
ATOM   3812 O O      . GLY B 1 109 ? 11.306  58.501 50.788 1.00 47.37  ? 109 GLY B O      1 
ATOM   3813 H H      . GLY B 1 109 ? 8.954   60.229 51.180 1.00 67.38  ? 109 GLY B H      1 
ATOM   3814 H HA2    . GLY B 1 109 ? 10.412  59.969 53.427 1.00 64.24  ? 109 GLY B HA2    1 
ATOM   3815 H HA3    . GLY B 1 109 ? 9.496   58.856 52.788 1.00 64.24  ? 109 GLY B HA3    1 
ATOM   3816 N N      . CYS B 1 110 ? 12.455  58.876 52.696 1.00 52.93  ? 110 CYS B N      1 
ATOM   3817 C CA     . CYS B 1 110 ? 13.693  58.258 52.243 1.00 50.77  ? 110 CYS B CA     1 
ATOM   3818 C C      . CYS B 1 110 ? 14.043  57.091 53.155 1.00 48.56  ? 110 CYS B C      1 
ATOM   3819 O O      . CYS B 1 110 ? 13.768  57.118 54.358 1.00 48.14  ? 110 CYS B O      1 
ATOM   3820 C CB     . CYS B 1 110 ? 14.843  59.270 52.223 1.00 50.64  ? 110 CYS B CB     1 
ATOM   3821 S SG     . CYS B 1 110 ? 14.544  60.692 51.148 1.00 54.16  ? 110 CYS B SG     1 
ATOM   3822 H H      . CYS B 1 110 ? 12.504  59.201 53.491 1.00 61.33  ? 110 CYS B H      1 
ATOM   3823 H HA     . CYS B 1 110 ? 13.571  57.917 51.343 1.00 59.52  ? 110 CYS B HA     1 
ATOM   3824 H HB2    . CYS B 1 110 ? 14.982  59.603 53.124 1.00 62.46  ? 110 CYS B HB2    1 
ATOM   3825 H HB3    . CYS B 1 110 ? 15.646  58.825 51.910 1.00 62.46  ? 110 CYS B HB3    1 
ATOM   3826 H HG     . CYS B 1 110 ? 15.493  61.426 51.197 1.00 67.04  ? 110 CYS B HG     1 
ATOM   3827 N N      . THR B 1 111 ? 14.650  56.059 52.572 1.00 53.08  ? 111 THR B N      1 
ATOM   3828 C CA     . THR B 1 111 ? 14.954  54.845 53.313 1.00 52.29  ? 111 THR B CA     1 
ATOM   3829 C C      . THR B 1 111 ? 16.263  54.248 52.822 1.00 49.47  ? 111 THR B C      1 
ATOM   3830 O O      . THR B 1 111 ? 16.548  54.254 51.621 1.00 49.02  ? 111 THR B O      1 
ATOM   3831 C CB     . THR B 1 111 ? 13.841  53.796 53.166 1.00 55.29  ? 111 THR B CB     1 
ATOM   3832 O OG1    . THR B 1 111 ? 13.640  53.499 51.777 1.00 56.42  ? 111 THR B OG1    1 
ATOM   3833 C CG2    . THR B 1 111 ? 12.531  54.285 53.782 1.00 58.13  ? 111 THR B CG2    1 
ATOM   3834 H H      . THR B 1 111 ? 14.895  56.040 51.748 1.00 58.30  ? 111 THR B H      1 
ATOM   3835 H HA     . THR B 1 111 ? 15.050  55.058 54.255 1.00 59.11  ? 111 THR B HA     1 
ATOM   3836 H HB     . THR B 1 111 ? 14.106  52.986 53.629 1.00 63.14  ? 111 THR B HB     1 
ATOM   3837 H HG1    . THR B 1 111 ? 13.032  52.926 51.691 1.00 64.13  ? 111 THR B HG1    1 
ATOM   3838 H HG21   . THR B 1 111 ? 11.843  53.609 53.678 1.00 66.18  ? 111 THR B HG21   1 
ATOM   3839 H HG22   . THR B 1 111 ? 12.655  54.466 54.727 1.00 66.18  ? 111 THR B HG22   1 
ATOM   3840 H HG23   . THR B 1 111 ? 12.241  55.099 53.341 1.00 66.18  ? 111 THR B HG23   1 
ATOM   3841 N N      . TYR B 1 112 ? 17.055  53.742 53.762 1.00 47.28  ? 112 TYR B N      1 
ATOM   3842 C CA     . TYR B 1 112 ? 18.145  52.824 53.467 1.00 45.48  ? 112 TYR B CA     1 
ATOM   3843 C C      . TYR B 1 112 ? 17.883  51.529 54.217 1.00 45.65  ? 112 TYR B C      1 
ATOM   3844 O O      . TYR B 1 112 ? 17.576  51.554 55.413 1.00 46.75  ? 112 TYR B O      1 
ATOM   3845 C CB     . TYR B 1 112 ? 19.509  53.389 53.866 1.00 44.57  ? 112 TYR B CB     1 
ATOM   3846 C CG     . TYR B 1 112 ? 20.616  52.371 53.731 1.00 43.30  ? 112 TYR B CG     1 
ATOM   3847 C CD1    . TYR B 1 112 ? 21.140  52.049 52.485 1.00 42.85  ? 112 TYR B CD1    1 
ATOM   3848 C CD2    . TYR B 1 112 ? 21.122  51.714 54.843 1.00 43.27  ? 112 TYR B CD2    1 
ATOM   3849 C CE1    . TYR B 1 112 ? 22.144  51.110 52.353 1.00 42.25  ? 112 TYR B CE1    1 
ATOM   3850 C CE2    . TYR B 1 112 ? 22.128  50.774 54.722 1.00 42.97  ? 112 TYR B CE2    1 
ATOM   3851 C CZ     . TYR B 1 112 ? 22.634  50.475 53.473 1.00 42.32  ? 112 TYR B CZ     1 
ATOM   3852 O OH     . TYR B 1 112 ? 23.636  49.541 53.344 1.00 42.18  ? 112 TYR B OH     1 
ATOM   3853 H H      . TYR B 1 112 ? 16.977  53.922 54.599 1.00 55.80  ? 112 TYR B H      1 
ATOM   3854 H HA     . TYR B 1 112 ? 18.157  52.632 52.516 1.00 53.76  ? 112 TYR B HA     1 
ATOM   3855 H HB2    . TYR B 1 112 ? 19.721  54.142 53.291 1.00 54.08  ? 112 TYR B HB2    1 
ATOM   3856 H HB3    . TYR B 1 112 ? 19.475  53.677 54.792 1.00 54.08  ? 112 TYR B HB3    1 
ATOM   3857 H HD1    . TYR B 1 112 ? 20.810  52.475 51.727 1.00 52.19  ? 112 TYR B HD1    1 
ATOM   3858 H HD2    . TYR B 1 112 ? 20.782  51.913 55.686 1.00 52.79  ? 112 TYR B HD2    1 
ATOM   3859 H HE1    . TYR B 1 112 ? 22.488  50.908 51.512 1.00 52.07  ? 112 TYR B HE1    1 
ATOM   3860 H HE2    . TYR B 1 112 ? 22.460  50.344 55.477 1.00 52.95  ? 112 TYR B HE2    1 
ATOM   3861 H HH     . TYR B 1 112 ? 23.849  49.459 52.535 1.00 52.34  ? 112 TYR B HH     1 
ATOM   3862 N N      . SER B 1 113 ? 17.995  50.404 53.516 1.00 41.08  ? 113 SER B N      1 
ATOM   3863 C CA     . SER B 1 113 ? 17.750  49.096 54.102 1.00 41.60  ? 113 SER B CA     1 
ATOM   3864 C C      . SER B 1 113 ? 18.883  48.151 53.733 1.00 40.17  ? 113 SER B C      1 
ATOM   3865 O O      . SER B 1 113 ? 19.461  48.243 52.647 1.00 38.59  ? 113 SER B O      1 
ATOM   3866 C CB     . SER B 1 113 ? 16.411  48.511 53.634 1.00 43.87  ? 113 SER B CB     1 
ATOM   3867 O OG     . SER B 1 113 ? 16.091  47.337 54.363 1.00 46.42  ? 113 SER B OG     1 
ATOM   3868 H H      . SER B 1 113 ? 18.216  50.375 52.685 1.00 54.14  ? 113 SER B H      1 
ATOM   3869 H HA     . SER B 1 113 ? 17.725  49.179 55.068 1.00 51.30  ? 113 SER B HA     1 
ATOM   3870 H HB2    . SER B 1 113 ? 15.713  49.170 53.774 1.00 49.27  ? 113 SER B HB2    1 
ATOM   3871 H HB3    . SER B 1 113 ? 16.475  48.290 52.692 1.00 49.27  ? 113 SER B HB3    1 
ATOM   3872 H HG     . SER B 1 113 ? 16.032  47.514 55.182 1.00 49.77  ? 113 SER B HG     1 
ATOM   3873 N N      . ILE B 1 114 ? 19.195  47.241 54.652 1.00 42.58  ? 114 ILE B N      1 
ATOM   3874 C CA     . ILE B 1 114 ? 20.260  46.265 54.449 1.00 42.04  ? 114 ILE B CA     1 
ATOM   3875 C C      . ILE B 1 114 ? 19.874  44.979 55.166 1.00 45.02  ? 114 ILE B C      1 
ATOM   3876 O O      . ILE B 1 114 ? 19.413  45.005 56.311 1.00 46.45  ? 114 ILE B O      1 
ATOM   3877 C CB     . ILE B 1 114 ? 21.621  46.802 54.942 1.00 40.85  ? 114 ILE B CB     1 
ATOM   3878 C CG1    . ILE B 1 114 ? 22.710  45.741 54.757 1.00 41.03  ? 114 ILE B CG1    1 
ATOM   3879 C CG2    . ILE B 1 114 ? 21.525  47.240 56.395 1.00 41.99  ? 114 ILE B CG2    1 
ATOM   3880 C CD1    . ILE B 1 114 ? 24.117  46.250 54.996 1.00 40.84  ? 114 ILE B CD1    1 
ATOM   3881 H H      . ILE B 1 114 ? 18.799  47.169 55.412 1.00 48.93  ? 114 ILE B H      1 
ATOM   3882 H HA     . ILE B 1 114 ? 20.337  46.071 53.502 1.00 49.47  ? 114 ILE B HA     1 
ATOM   3883 H HB     . ILE B 1 114 ? 21.856  47.575 54.406 1.00 50.58  ? 114 ILE B HB     1 
ATOM   3884 H HG12   . ILE B 1 114 ? 22.548  45.016 55.382 1.00 51.83  ? 114 ILE B HG12   1 
ATOM   3885 H HG13   . ILE B 1 114 ? 22.667  45.405 53.848 1.00 51.83  ? 114 ILE B HG13   1 
ATOM   3886 H HG21   . ILE B 1 114 ? 22.390  47.573 56.682 1.00 51.69  ? 114 ILE B HG21   1 
ATOM   3887 H HG22   . ILE B 1 114 ? 20.859  47.941 56.469 1.00 51.69  ? 114 ILE B HG22   1 
ATOM   3888 H HG23   . ILE B 1 114 ? 21.266  46.479 56.937 1.00 51.69  ? 114 ILE B HG23   1 
ATOM   3889 H HD11   . ILE B 1 114 ? 24.743  45.522 54.860 1.00 53.13  ? 114 ILE B HD11   1 
ATOM   3890 H HD12   . ILE B 1 114 ? 24.303  46.968 54.371 1.00 53.13  ? 114 ILE B HD12   1 
ATOM   3891 H HD13   . ILE B 1 114 ? 24.183  46.578 55.906 1.00 53.13  ? 114 ILE B HD13   1 
ATOM   3892 N N      . ARG B 1 115 ? 20.070  43.852 54.484 1.00 46.27  ? 115 ARG B N      1 
ATOM   3893 C CA     . ARG B 1 115 ? 19.710  42.535 54.997 1.00 50.87  ? 115 ARG B CA     1 
ATOM   3894 C C      . ARG B 1 115 ? 20.936  41.635 54.961 1.00 50.08  ? 115 ARG B C      1 
ATOM   3895 O O      . ARG B 1 115 ? 21.614  41.543 53.932 1.00 47.54  ? 115 ARG B O      1 
ATOM   3896 C CB     . ARG B 1 115 ? 18.576  41.916 54.175 1.00 53.94  ? 115 ARG B CB     1 
ATOM   3897 C CG     . ARG B 1 115 ? 18.003  40.639 54.763 1.00 58.67  ? 115 ARG B CG     1 
ATOM   3898 C CD     . ARG B 1 115 ? 17.134  39.910 53.752 1.00 59.52  ? 115 ARG B CD     1 
ATOM   3899 N NE     . ARG B 1 115 ? 16.309  38.880 54.379 1.00 62.90  ? 115 ARG B NE     1 
ATOM   3900 C CZ     . ARG B 1 115 ? 16.713  37.638 54.635 1.00 63.46  ? 115 ARG B CZ     1 
ATOM   3901 N NH1    . ARG B 1 115 ? 17.943  37.248 54.322 1.00 61.72  ? 115 ARG B NH1    1 
ATOM   3902 N NH2    . ARG B 1 115 ? 15.883  36.779 55.210 1.00 65.68  ? 115 ARG B NH2    1 
ATOM   3903 H H      . ARG B 1 115 ? 20.420  43.826 53.699 1.00 55.32  ? 115 ARG B H      1 
ATOM   3904 H HA     . ARG B 1 115 ? 19.415  42.616 55.918 1.00 59.17  ? 115 ARG B HA     1 
ATOM   3905 H HB2    . ARG B 1 115 ? 17.853  42.560 54.108 1.00 60.58  ? 115 ARG B HB2    1 
ATOM   3906 H HB3    . ARG B 1 115 ? 18.912  41.708 53.289 1.00 60.58  ? 115 ARG B HB3    1 
ATOM   3907 H HG2    . ARG B 1 115 ? 18.729  40.051 55.021 1.00 63.05  ? 115 ARG B HG2    1 
ATOM   3908 H HG3    . ARG B 1 115 ? 17.456  40.858 55.533 1.00 63.05  ? 115 ARG B HG3    1 
ATOM   3909 H HD2    . ARG B 1 115 ? 16.544  40.547 53.320 1.00 65.86  ? 115 ARG B HD2    1 
ATOM   3910 H HD3    . ARG B 1 115 ? 17.703  39.482 53.093 1.00 65.86  ? 115 ARG B HD3    1 
ATOM   3911 H HE     . ARG B 1 115 ? 15.505  39.091 54.599 1.00 69.67  ? 115 ARG B HE     1 
ATOM   3912 H HH11   . ARG B 1 115 ? 18.487  37.800 53.950 1.00 69.48  ? 115 ARG B HH11   1 
ATOM   3913 H HH12   . ARG B 1 115 ? 18.195  36.444 54.492 1.00 69.48  ? 115 ARG B HH12   1 
ATOM   3914 H HH21   . ARG B 1 115 ? 15.085  37.025 55.415 1.00 73.18  ? 115 ARG B HH21   1 
ATOM   3915 H HH22   . ARG B 1 115 ? 16.142  35.976 55.376 1.00 73.18  ? 115 ARG B HH22   1 
ATOM   3916 N N      . PHE B 1 116 ? 21.212  40.963 56.078 1.00 51.74  ? 116 PHE B N      1 
ATOM   3917 C CA     . PHE B 1 116 ? 22.399  40.126 56.185 1.00 51.55  ? 116 PHE B CA     1 
ATOM   3918 C C      . PHE B 1 116 ? 22.225  39.168 57.352 1.00 56.28  ? 116 PHE B C      1 
ATOM   3919 O O      . PHE B 1 116 ? 21.935  39.602 58.470 1.00 56.53  ? 116 PHE B O      1 
ATOM   3920 C CB     . PHE B 1 116 ? 23.653  40.988 56.376 1.00 47.58  ? 116 PHE B CB     1 
ATOM   3921 C CG     . PHE B 1 116 ? 24.931  40.202 56.435 1.00 47.35  ? 116 PHE B CG     1 
ATOM   3922 C CD1    . PHE B 1 116 ? 25.369  39.483 55.336 1.00 46.25  ? 116 PHE B CD1    1 
ATOM   3923 C CD2    . PHE B 1 116 ? 25.702  40.196 57.585 1.00 48.32  ? 116 PHE B CD2    1 
ATOM   3924 C CE1    . PHE B 1 116 ? 26.546  38.765 55.386 1.00 46.68  ? 116 PHE B CE1    1 
ATOM   3925 C CE2    . PHE B 1 116 ? 26.881  39.478 57.640 1.00 48.94  ? 116 PHE B CE2    1 
ATOM   3926 C CZ     . PHE B 1 116 ? 27.303  38.763 56.539 1.00 48.22  ? 116 PHE B CZ     1 
ATOM   3927 H H      . PHE B 1 116 ? 20.726  40.978 56.787 1.00 60.99  ? 116 PHE B H      1 
ATOM   3928 H HA     . PHE B 1 116 ? 22.504  39.606 55.373 1.00 61.05  ? 116 PHE B HA     1 
ATOM   3929 H HB2    . PHE B 1 116 ? 23.721  41.608 55.633 1.00 57.76  ? 116 PHE B HB2    1 
ATOM   3930 H HB3    . PHE B 1 116 ? 23.569  41.480 57.207 1.00 57.76  ? 116 PHE B HB3    1 
ATOM   3931 H HD1    . PHE B 1 116 ? 24.863  39.480 54.557 1.00 54.45  ? 116 PHE B HD1    1 
ATOM   3932 H HD2    . PHE B 1 116 ? 25.421  40.676 58.330 1.00 57.06  ? 116 PHE B HD2    1 
ATOM   3933 H HE1    . PHE B 1 116 ? 26.829  38.283 54.643 1.00 54.68  ? 116 PHE B HE1    1 
ATOM   3934 H HE2    . PHE B 1 116 ? 27.390  39.478 58.418 1.00 57.25  ? 116 PHE B HE2    1 
ATOM   3935 H HZ     . PHE B 1 116 ? 28.096  38.279 56.574 1.00 56.22  ? 116 PHE B HZ     1 
ATOM   3936 N N      . ARG B 1 117 ? 22.396  37.870 57.089 1.00 65.00  ? 117 ARG B N      1 
ATOM   3937 C CA     . ARG B 1 117 ? 22.306  36.835 58.116 1.00 69.80  ? 117 ARG B CA     1 
ATOM   3938 C C      . ARG B 1 117 ? 20.894  36.713 58.680 1.00 73.05  ? 117 ARG B C      1 
ATOM   3939 O O      . ARG B 1 117 ? 20.713  36.371 59.850 1.00 74.76  ? 117 ARG B O      1 
ATOM   3940 C CB     . ARG B 1 117 ? 23.296  37.095 59.255 1.00 69.23  ? 117 ARG B CB     1 
ATOM   3941 C CG     . ARG B 1 117 ? 24.741  37.263 58.809 1.00 66.64  ? 117 ARG B CG     1 
ATOM   3942 C CD     . ARG B 1 117 ? 25.486  35.944 58.808 1.00 69.86  ? 117 ARG B CD     1 
ATOM   3943 N NE     . ARG B 1 117 ? 25.575  35.367 60.146 1.00 73.91  ? 117 ARG B NE     1 
ATOM   3944 C CZ     . ARG B 1 117 ? 26.427  35.773 61.084 1.00 73.32  ? 117 ARG B CZ     1 
ATOM   3945 N NH1    . ARG B 1 117 ? 27.271  36.768 60.842 1.00 69.85  ? 117 ARG B NH1    1 
ATOM   3946 N NH2    . ARG B 1 117 ? 26.431  35.185 62.272 1.00 76.39  ? 117 ARG B NH2    1 
ATOM   3947 H H      . ARG B 1 117 ? 22.570  37.561 56.305 1.00 70.96  ? 117 ARG B H      1 
ATOM   3948 H HA     . ARG B 1 117 ? 22.536  35.982 57.716 1.00 75.85  ? 117 ARG B HA     1 
ATOM   3949 H HB2    . ARG B 1 117 ? 23.034  37.909 59.715 1.00 76.47  ? 117 ARG B HB2    1 
ATOM   3950 H HB3    . ARG B 1 117 ? 23.264  36.347 59.872 1.00 76.47  ? 117 ARG B HB3    1 
ATOM   3951 H HG2    . ARG B 1 117 ? 24.757  37.621 57.908 1.00 77.54  ? 117 ARG B HG2    1 
ATOM   3952 H HG3    . ARG B 1 117 ? 25.195  37.866 59.417 1.00 77.54  ? 117 ARG B HG3    1 
ATOM   3953 H HD2    . ARG B 1 117 ? 25.018  35.314 58.237 1.00 82.47  ? 117 ARG B HD2    1 
ATOM   3954 H HD3    . ARG B 1 117 ? 26.387  36.087 58.479 1.00 82.47  ? 117 ARG B HD3    1 
ATOM   3955 H HE     . ARG B 1 117 ? 25.041  34.722 60.341 1.00 87.83  ? 117 ARG B HE     1 
ATOM   3956 H HH11   . ARG B 1 117 ? 27.273  37.153 60.073 1.00 87.85  ? 117 ARG B HH11   1 
ATOM   3957 H HH12   . ARG B 1 117 ? 27.819  37.026 61.453 1.00 87.85  ? 117 ARG B HH12   1 
ATOM   3958 H HH21   . ARG B 1 117 ? 25.885  34.540 62.435 1.00 92.11  ? 117 ARG B HH21   1 
ATOM   3959 H HH22   . ARG B 1 117 ? 26.980  35.447 62.880 1.00 92.11  ? 117 ARG B HH22   1 
ATOM   3960 N N      . GLY B 1 118 ? 19.883  36.990 57.860 1.00 50.87  ? 118 GLY B N      1 
ATOM   3961 C CA     . GLY B 1 118 ? 18.514  36.968 58.332 1.00 51.59  ? 118 GLY B CA     1 
ATOM   3962 C C      . GLY B 1 118 ? 18.133  38.129 59.221 1.00 50.67  ? 118 GLY B C      1 
ATOM   3963 O O      . GLY B 1 118 ? 17.079  38.079 59.860 1.00 51.12  ? 118 GLY B O      1 
ATOM   3964 H H      . GLY B 1 118 ? 19.969  37.193 57.028 1.00 64.24  ? 118 GLY B H      1 
ATOM   3965 H HA2    . GLY B 1 118 ? 17.917  36.968 57.568 1.00 64.13  ? 118 GLY B HA2    1 
ATOM   3966 H HA3    . GLY B 1 118 ? 18.366  36.149 58.830 1.00 64.13  ? 118 GLY B HA3    1 
ATOM   3967 N N      . VAL B 1 119 ? 18.960  39.170 59.284 1.00 51.80  ? 119 VAL B N      1 
ATOM   3968 C CA     . VAL B 1 119 ? 18.698  40.358 60.089 1.00 51.26  ? 119 VAL B CA     1 
ATOM   3969 C C      . VAL B 1 119 ? 18.585  41.543 59.142 1.00 51.82  ? 119 VAL B C      1 
ATOM   3970 O O      . VAL B 1 119 ? 19.503  41.806 58.356 1.00 52.74  ? 119 VAL B O      1 
ATOM   3971 C CB     . VAL B 1 119 ? 19.800  40.597 61.133 1.00 51.98  ? 119 VAL B CB     1 
ATOM   3972 C CG1    . VAL B 1 119 ? 19.512  41.859 61.943 1.00 53.92  ? 119 VAL B CG1    1 
ATOM   3973 C CG2    . VAL B 1 119 ? 19.935  39.392 62.051 1.00 52.07  ? 119 VAL B CG2    1 
ATOM   3974 H H      . VAL B 1 119 ? 19.704  39.211 58.854 1.00 69.99  ? 119 VAL B H      1 
ATOM   3975 H HA     . VAL B 1 119 ? 17.852  40.253 60.553 1.00 67.21  ? 119 VAL B HA     1 
ATOM   3976 H HB     . VAL B 1 119 ? 20.647  40.722 60.675 1.00 62.71  ? 119 VAL B HB     1 
ATOM   3977 H HG11   . VAL B 1 119 ? 20.222  41.986 62.592 1.00 65.35  ? 119 VAL B HG11   1 
ATOM   3978 H HG12   . VAL B 1 119 ? 19.475  42.619 61.341 1.00 65.35  ? 119 VAL B HG12   1 
ATOM   3979 H HG13   . VAL B 1 119 ? 18.662  41.754 62.398 1.00 65.35  ? 119 VAL B HG13   1 
ATOM   3980 H HG21   . VAL B 1 119 ? 20.635  39.567 62.699 1.00 64.45  ? 119 VAL B HG21   1 
ATOM   3981 H HG22   . VAL B 1 119 ? 19.091  39.247 62.505 1.00 64.45  ? 119 VAL B HG22   1 
ATOM   3982 H HG23   . VAL B 1 119 ? 20.163  38.614 61.518 1.00 64.45  ? 119 VAL B HG23   1 
ATOM   3983 N N      . SER B 1 120 ? 17.465  42.253 59.217 1.00 53.22  ? 120 SER B N      1 
ATOM   3984 C CA     . SER B 1 120 ? 17.219  43.427 58.394 1.00 53.80  ? 120 SER B CA     1 
ATOM   3985 C C      . SER B 1 120 ? 17.356  44.687 59.238 1.00 55.08  ? 120 SER B C      1 
ATOM   3986 O O      . SER B 1 120 ? 16.922  44.725 60.393 1.00 55.84  ? 120 SER B O      1 
ATOM   3987 C CB     . SER B 1 120 ? 15.825  43.373 57.765 1.00 53.46  ? 120 SER B CB     1 
ATOM   3988 O OG     . SER B 1 120 ? 15.540  44.564 57.053 1.00 54.22  ? 120 SER B OG     1 
ATOM   3989 H H      . SER B 1 120 ? 16.817  42.068 59.752 1.00 59.62  ? 120 SER B H      1 
ATOM   3990 H HA     . SER B 1 120 ? 17.875  43.463 57.681 1.00 61.71  ? 120 SER B HA     1 
ATOM   3991 H HB2    . SER B 1 120 ? 15.785  42.622 57.152 1.00 65.46  ? 120 SER B HB2    1 
ATOM   3992 H HB3    . SER B 1 120 ? 15.166  43.260 58.468 1.00 65.46  ? 120 SER B HB3    1 
ATOM   3993 H HG     . SER B 1 120 ? 14.773  44.519 56.714 1.00 67.46  ? 120 SER B HG     1 
ATOM   3994 N N      . VAL B 1 121 ? 17.967  45.713 58.655 1.00 45.44  ? 121 VAL B N      1 
ATOM   3995 C CA     . VAL B 1 121 ? 18.137  47.007 59.302 1.00 47.39  ? 121 VAL B CA     1 
ATOM   3996 C C      . VAL B 1 121 ? 17.695  48.079 58.318 1.00 47.26  ? 121 VAL B C      1 
ATOM   3997 O O      . VAL B 1 121 ? 18.153  48.098 57.171 1.00 46.09  ? 121 VAL B O      1 
ATOM   3998 C CB     . VAL B 1 121 ? 19.594  47.241 59.744 1.00 50.46  ? 121 VAL B CB     1 
ATOM   3999 C CG1    . VAL B 1 121 ? 19.731  48.581 60.459 1.00 54.69  ? 121 VAL B CG1    1 
ATOM   4000 C CG2    . VAL B 1 121 ? 20.066  46.101 60.639 1.00 51.28  ? 121 VAL B CG2    1 
ATOM   4001 H H      . VAL B 1 121 ? 18.300  45.682 57.862 1.00 59.73  ? 121 VAL B H      1 
ATOM   4002 H HA     . VAL B 1 121 ? 17.567  47.054 60.085 1.00 58.22  ? 121 VAL B HA     1 
ATOM   4003 H HB     . VAL B 1 121 ? 20.163  47.261 58.958 1.00 58.11  ? 121 VAL B HB     1 
ATOM   4004 H HG11   . VAL B 1 121 ? 20.655  48.703 60.726 1.00 58.72  ? 121 VAL B HG11   1 
ATOM   4005 H HG12   . VAL B 1 121 ? 19.464  49.290 59.853 1.00 58.72  ? 121 VAL B HG12   1 
ATOM   4006 H HG13   . VAL B 1 121 ? 19.158  48.581 61.241 1.00 58.72  ? 121 VAL B HG13   1 
ATOM   4007 H HG21   . VAL B 1 121 ? 20.984  46.268 60.905 1.00 60.33  ? 121 VAL B HG21   1 
ATOM   4008 H HG22   . VAL B 1 121 ? 19.496  46.060 61.423 1.00 60.33  ? 121 VAL B HG22   1 
ATOM   4009 H HG23   . VAL B 1 121 ? 20.011  45.269 60.144 1.00 60.33  ? 121 VAL B HG23   1 
ATOM   4010 N N      . THR B 1 122 ? 16.804  48.963 58.763 1.00 56.87  ? 122 THR B N      1 
ATOM   4011 C CA     . THR B 1 122 ? 16.255  50.012 57.915 1.00 57.02  ? 122 THR B CA     1 
ATOM   4012 C C      . THR B 1 122 ? 16.337  51.345 58.642 1.00 61.49  ? 122 THR B C      1 
ATOM   4013 O O      . THR B 1 122 ? 15.941  51.447 59.808 1.00 63.02  ? 122 THR B O      1 
ATOM   4014 C CB     . THR B 1 122 ? 14.801  49.713 57.526 1.00 55.45  ? 122 THR B CB     1 
ATOM   4015 O OG1    . THR B 1 122 ? 14.702  48.381 57.007 1.00 53.41  ? 122 THR B OG1    1 
ATOM   4016 C CG2    . THR B 1 122 ? 14.310  50.701 56.473 1.00 56.15  ? 122 THR B CG2    1 
ATOM   4017 H H      . THR B 1 122 ? 16.498  48.975 59.567 1.00 64.93  ? 122 THR B H      1 
ATOM   4018 H HA     . THR B 1 122 ? 16.781  50.075 57.102 1.00 65.93  ? 122 THR B HA     1 
ATOM   4019 H HB     . THR B 1 122 ? 14.235  49.796 58.310 1.00 67.71  ? 122 THR B HB     1 
ATOM   4020 H HG1    . THR B 1 122 ? 13.906  48.214 56.794 1.00 67.97  ? 122 THR B HG1    1 
ATOM   4021 H HG21   . THR B 1 122 ? 13.391  50.502 56.236 1.00 70.18  ? 122 THR B HG21   1 
ATOM   4022 H HG22   . THR B 1 122 ? 14.358  51.605 56.819 1.00 70.18  ? 122 THR B HG22   1 
ATOM   4023 H HG23   . THR B 1 122 ? 14.862  50.637 55.678 1.00 70.18  ? 122 THR B HG23   1 
ATOM   4024 N N      . ILE B 1 123 ? 16.857  52.357 57.953 1.00 51.88  ? 123 ILE B N      1 
ATOM   4025 C CA     . ILE B 1 123 ? 16.911  53.726 58.453 1.00 56.40  ? 123 ILE B CA     1 
ATOM   4026 C C      . ILE B 1 123 ? 15.936  54.546 57.621 1.00 54.42  ? 123 ILE B C      1 
ATOM   4027 O O      . ILE B 1 123 ? 16.076  54.631 56.395 1.00 50.84  ? 123 ILE B O      1 
ATOM   4028 C CB     . ILE B 1 123 ? 18.336  54.301 58.383 1.00 56.68  ? 123 ILE B CB     1 
ATOM   4029 C CG1    . ILE B 1 123 ? 19.219  53.682 59.472 1.00 58.99  ? 123 ILE B CG1    1 
ATOM   4030 C CG2    . ILE B 1 123 ? 18.332  55.819 58.535 1.00 57.58  ? 123 ILE B CG2    1 
ATOM   4031 C CD1    . ILE B 1 123 ? 19.751  52.306 59.143 1.00 58.19  ? 123 ILE B CD1    1 
ATOM   4032 H H      . ILE B 1 123 ? 17.195  52.271 57.167 1.00 63.02  ? 123 ILE B H      1 
ATOM   4033 H HA     . ILE B 1 123 ? 16.617  53.744 59.378 1.00 65.04  ? 123 ILE B HA     1 
ATOM   4034 H HB     . ILE B 1 123 ? 18.714  54.080 57.518 1.00 69.41  ? 123 ILE B HB     1 
ATOM   4035 H HG12   . ILE B 1 123 ? 19.981  54.264 59.621 1.00 71.62  ? 123 ILE B HG12   1 
ATOM   4036 H HG13   . ILE B 1 123 ? 18.700  53.609 60.288 1.00 71.62  ? 123 ILE B HG13   1 
ATOM   4037 H HG21   . ILE B 1 123 ? 19.245  56.143 58.485 1.00 73.54  ? 123 ILE B HG21   1 
ATOM   4038 H HG22   . ILE B 1 123 ? 17.805  56.206 57.819 1.00 73.54  ? 123 ILE B HG22   1 
ATOM   4039 H HG23   . ILE B 1 123 ? 17.945  56.049 59.394 1.00 73.54  ? 123 ILE B HG23   1 
ATOM   4040 H HD11   . ILE B 1 123 ? 20.296  51.994 59.882 1.00 69.69  ? 123 ILE B HD11   1 
ATOM   4041 H HD12   . ILE B 1 123 ? 19.003  51.704 59.005 1.00 69.69  ? 123 ILE B HD12   1 
ATOM   4042 H HD13   . ILE B 1 123 ? 20.287  52.360 58.336 1.00 69.69  ? 123 ILE B HD13   1 
ATOM   4043 N N      . SER B 1 124 ? 14.948  55.146 58.284 1.00 50.02  ? 124 SER B N      1 
ATOM   4044 C CA     . SER B 1 124 ? 13.873  55.857 57.609 1.00 49.63  ? 124 SER B CA     1 
ATOM   4045 C C      . SER B 1 124 ? 13.758  57.269 58.163 1.00 52.19  ? 124 SER B C      1 
ATOM   4046 O O      . SER B 1 124 ? 13.960  57.496 59.360 1.00 53.10  ? 124 SER B O      1 
ATOM   4047 C CB     . SER B 1 124 ? 12.535  55.127 57.778 1.00 48.74  ? 124 SER B CB     1 
ATOM   4048 O OG     . SER B 1 124 ? 12.674  53.739 57.527 1.00 44.59  ? 124 SER B OG     1 
ATOM   4049 H H      . SER B 1 124 ? 14.881  55.153 59.141 1.00 56.56  ? 124 SER B H      1 
ATOM   4050 H HA     . SER B 1 124 ? 14.071  55.916 56.662 1.00 57.50  ? 124 SER B HA     1 
ATOM   4051 H HB2    . SER B 1 124 ? 12.220  55.252 58.687 1.00 58.74  ? 124 SER B HB2    1 
ATOM   4052 H HB3    . SER B 1 124 ? 11.893  55.497 57.152 1.00 58.74  ? 124 SER B HB3    1 
ATOM   4053 H HG     . SER B 1 124 ? 11.934  53.353 57.623 1.00 56.65  ? 124 SER B HG     1 
ATOM   4054 N N      . GLY B 1 125 ? 13.428  58.210 57.286 1.00 45.73  ? 125 GLY B N      1 
ATOM   4055 C CA     . GLY B 1 125 ? 13.242  59.590 57.694 1.00 49.30  ? 125 GLY B CA     1 
ATOM   4056 C C      . GLY B 1 125 ? 12.831  60.439 56.512 1.00 51.83  ? 125 GLY B C      1 
ATOM   4057 O O      . GLY B 1 125 ? 12.630  59.946 55.396 1.00 50.89  ? 125 GLY B O      1 
ATOM   4058 H H      . GLY B 1 125 ? 13.306  58.072 56.446 1.00 54.56  ? 125 GLY B H      1 
ATOM   4059 H HA2    . GLY B 1 125 ? 12.552  59.643 58.374 1.00 59.53  ? 125 GLY B HA2    1 
ATOM   4060 H HA3    . GLY B 1 125 ? 14.069  59.940 58.059 1.00 59.53  ? 125 GLY B HA3    1 
ATOM   4061 N N      . GLY B 1 126 ? 12.707  61.740 56.775 1.00 55.63  ? 126 GLY B N      1 
ATOM   4062 C CA     . GLY B 1 126 ? 12.308  62.668 55.742 1.00 58.99  ? 126 GLY B CA     1 
ATOM   4063 C C      . GLY B 1 126 ? 13.474  63.137 54.889 1.00 59.19  ? 126 GLY B C      1 
ATOM   4064 O O      . GLY B 1 126 ? 14.641  63.038 55.264 1.00 57.69  ? 126 GLY B O      1 
ATOM   4065 H H      . GLY B 1 126 ? 12.849  62.101 57.543 1.00 66.66  ? 126 GLY B H      1 
ATOM   4066 H HA2    . GLY B 1 126 ? 11.656  62.244 55.162 1.00 69.64  ? 126 GLY B HA2    1 
ATOM   4067 H HA3    . GLY B 1 126 ? 11.896  63.446 56.149 1.00 69.64  ? 126 GLY B HA3    1 
ATOM   4068 N N      . SER B 1 127 ? 13.135  63.660 53.708 1.00 69.84  ? 127 SER B N      1 
ATOM   4069 C CA     . SER B 1 127 ? 14.151  64.146 52.779 1.00 68.81  ? 127 SER B CA     1 
ATOM   4070 C C      . SER B 1 127 ? 15.099  65.147 53.431 1.00 70.44  ? 127 SER B C      1 
ATOM   4071 O O      . SER B 1 127 ? 16.286  65.189 53.090 1.00 69.99  ? 127 SER B O      1 
ATOM   4072 C CB     . SER B 1 127 ? 13.482  64.790 51.565 1.00 71.77  ? 127 SER B CB     1 
ATOM   4073 O OG     . SER B 1 127 ? 12.567  63.901 50.954 1.00 70.44  ? 127 SER B OG     1 
ATOM   4074 H H      . SER B 1 127 ? 12.327  63.744 53.425 1.00 77.87  ? 127 SER B H      1 
ATOM   4075 H HA     . SER B 1 127 ? 14.679  63.394 52.467 1.00 79.51  ? 127 SER B HA     1 
ATOM   4076 H HB2    . SER B 1 127 ? 13.004  65.584 51.854 1.00 82.68  ? 127 SER B HB2    1 
ATOM   4077 H HB3    . SER B 1 127 ? 14.165  65.032 50.920 1.00 82.68  ? 127 SER B HB3    1 
ATOM   4078 H HG     . SER B 1 127 ? 12.968  63.208 50.698 1.00 79.55  ? 127 SER B HG     1 
ATOM   4079 N N      . ARG B 1 128 ? 14.598  65.964 54.358 1.00 68.17  ? 128 ARG B N      1 
ATOM   4080 C CA     . ARG B 1 128 ? 15.435  66.972 54.997 1.00 71.33  ? 128 ARG B CA     1 
ATOM   4081 C C      . ARG B 1 128 ? 16.377  66.377 56.035 1.00 68.48  ? 128 ARG B C      1 
ATOM   4082 O O      . ARG B 1 128 ? 17.330  67.049 56.445 1.00 71.00  ? 128 ARG B O      1 
ATOM   4083 C CB     . ARG B 1 128 ? 14.557  68.045 55.647 1.00 76.15  ? 128 ARG B CB     1 
ATOM   4084 C CG     . ARG B 1 128 ? 13.545  68.660 54.693 1.00 79.86  ? 128 ARG B CG     1 
ATOM   4085 C CD     . ARG B 1 128 ? 12.800  69.820 55.332 1.00 85.61  ? 128 ARG B CD     1 
ATOM   4086 N NE     . ARG B 1 128 ? 11.703  70.294 54.490 1.00 89.48  ? 128 ARG B NE     1 
ATOM   4087 C CZ     . ARG B 1 128 ? 11.842  71.136 53.469 1.00 93.70  ? 128 ARG B CZ     1 
ATOM   4088 N NH1    . ARG B 1 128 ? 13.037  71.611 53.141 1.00 94.64  ? 128 ARG B NH1    1 
ATOM   4089 N NH2    . ARG B 1 128 ? 10.778  71.502 52.768 1.00 97.61  ? 128 ARG B NH2    1 
ATOM   4090 H H      . ARG B 1 128 ? 13.783  65.953 54.631 1.00 82.46  ? 128 ARG B H      1 
ATOM   4091 H HA     . ARG B 1 128 ? 15.977  67.404 54.319 1.00 87.95  ? 128 ARG B HA     1 
ATOM   4092 H HB2    . ARG B 1 128 ? 14.068  67.646 56.383 1.00 94.16  ? 128 ARG B HB2    1 
ATOM   4093 H HB3    . ARG B 1 128 ? 15.126  68.758 55.977 1.00 94.16  ? 128 ARG B HB3    1 
ATOM   4094 H HG2    . ARG B 1 128 ? 14.008  68.992 53.908 1.00 96.77  ? 128 ARG B HG2    1 
ATOM   4095 H HG3    . ARG B 1 128 ? 12.896  67.986 54.439 1.00 96.77  ? 128 ARG B HG3    1 
ATOM   4096 H HD2    . ARG B 1 128 ? 12.427  69.532 56.180 1.00 104.11 ? 128 ARG B HD2    1 
ATOM   4097 H HD3    . ARG B 1 128 ? 13.415  70.557 55.470 1.00 104.11 ? 128 ARG B HD3    1 
ATOM   4098 H HE     . ARG B 1 128 ? 10.912  70.008 54.668 1.00 126.25 ? 128 ARG B HE     1 
ATOM   4099 H HH11   . ARG B 1 128 ? 13.731  71.377 53.591 1.00 113.02 ? 128 ARG B HH11   1 
ATOM   4100 H HH12   . ARG B 1 128 ? 13.116  72.154 52.479 1.00 113.02 ? 128 ARG B HH12   1 
ATOM   4101 H HH21   . ARG B 1 128 ? 10.001  71.198 52.975 1.00 113.00 ? 128 ARG B HH21   1 
ATOM   4102 H HH22   . ARG B 1 128 ? 10.865  72.046 52.107 1.00 113.00 ? 128 ARG B HH22   1 
ATOM   4103 N N      . THR B 1 129 ? 16.132  65.143 56.468 1.00 83.71  ? 129 THR B N      1 
ATOM   4104 C CA     . THR B 1 129 ? 17.019  64.444 57.386 1.00 82.98  ? 129 THR B CA     1 
ATOM   4105 C C      . THR B 1 129 ? 17.978  63.508 56.662 1.00 81.08  ? 129 THR B C      1 
ATOM   4106 O O      . THR B 1 129 ? 18.666  62.715 57.314 1.00 80.21  ? 129 THR B O      1 
ATOM   4107 C CB     . THR B 1 129 ? 16.204  63.653 58.413 1.00 82.49  ? 129 THR B CB     1 
ATOM   4108 O OG1    . THR B 1 129 ? 15.445  62.633 57.748 1.00 80.87  ? 129 THR B OG1    1 
ATOM   4109 C CG2    . THR B 1 129 ? 15.259  64.572 59.177 1.00 85.41  ? 129 THR B CG2    1 
ATOM   4110 H H      . THR B 1 129 ? 15.444  64.681 56.237 1.00 106.91 ? 129 THR B H      1 
ATOM   4111 H HA     . THR B 1 129 ? 17.549  65.098 57.868 1.00 107.33 ? 129 THR B HA     1 
ATOM   4112 H HB     . THR B 1 129 ? 16.807  63.239 59.050 1.00 103.96 ? 129 THR B HB     1 
ATOM   4113 H HG1    . THR B 1 129 ? 14.921  62.982 57.192 1.00 97.39  ? 129 THR B HG1    1 
ATOM   4114 H HG21   . THR B 1 129 ? 14.749  64.060 59.824 1.00 111.13 ? 129 THR B HG21   1 
ATOM   4115 H HG22   . THR B 1 129 ? 15.767  65.254 59.644 1.00 111.13 ? 129 THR B HG22   1 
ATOM   4116 H HG23   . THR B 1 129 ? 14.646  65.003 58.561 1.00 111.13 ? 129 THR B HG23   1 
ATOM   4117 N N      . LEU B 1 130 ? 18.039  63.584 55.329 1.00 67.40  ? 130 LEU B N      1 
ATOM   4118 C CA     . LEU B 1 130 ? 18.905  62.688 54.570 1.00 64.34  ? 130 LEU B CA     1 
ATOM   4119 C C      . LEU B 1 130 ? 20.350  62.768 55.043 1.00 65.19  ? 130 LEU B C      1 
ATOM   4120 O O      . LEU B 1 130 ? 21.069  61.763 55.013 1.00 63.38  ? 130 LEU B O      1 
ATOM   4121 C CB     . LEU B 1 130 ? 18.813  63.018 53.080 1.00 62.99  ? 130 LEU B CB     1 
ATOM   4122 C CG     . LEU B 1 130 ? 19.625  62.142 52.125 1.00 60.10  ? 130 LEU B CG     1 
ATOM   4123 C CD1    . LEU B 1 130 ? 19.153  60.695 52.166 1.00 56.09  ? 130 LEU B CD1    1 
ATOM   4124 C CD2    . LEU B 1 130 ? 19.534  62.695 50.714 1.00 63.26  ? 130 LEU B CD2    1 
ATOM   4125 H H      . LEU B 1 130 ? 17.594  64.141 54.849 1.00 84.69  ? 130 LEU B H      1 
ATOM   4126 H HA     . LEU B 1 130 ? 18.600  61.776 54.694 1.00 80.54  ? 130 LEU B HA     1 
ATOM   4127 H HB2    . LEU B 1 130 ? 17.883  62.947 52.812 1.00 78.15  ? 130 LEU B HB2    1 
ATOM   4128 H HB3    . LEU B 1 130 ? 19.112  63.932 52.954 1.00 78.15  ? 130 LEU B HB3    1 
ATOM   4129 H HG     . LEU B 1 130 ? 20.556  62.161 52.395 1.00 72.78  ? 130 LEU B HG     1 
ATOM   4130 H HD11   . LEU B 1 130 ? 19.689  60.171 51.551 1.00 65.07  ? 130 LEU B HD11   1 
ATOM   4131 H HD12   . LEU B 1 130 ? 19.258  60.355 53.069 1.00 65.07  ? 130 LEU B HD12   1 
ATOM   4132 H HD13   . LEU B 1 130 ? 18.219  60.660 51.905 1.00 65.07  ? 130 LEU B HD13   1 
ATOM   4133 H HD21   . LEU B 1 130 ? 20.053  62.130 50.120 1.00 77.00  ? 130 LEU B HD21   1 
ATOM   4134 H HD22   . LEU B 1 130 ? 18.605  62.701 50.437 1.00 77.00  ? 130 LEU B HD22   1 
ATOM   4135 H HD23   . LEU B 1 130 ? 19.888  63.598 50.706 1.00 77.00  ? 130 LEU B HD23   1 
ATOM   4136 N N      . GLN B 1 131 ? 20.795  63.950 55.478 1.00 77.21  ? 131 GLN B N      1 
ATOM   4137 C CA     . GLN B 1 131 ? 22.133  64.069 56.049 1.00 78.59  ? 131 GLN B CA     1 
ATOM   4138 C C      . GLN B 1 131 ? 22.301  63.136 57.242 1.00 76.56  ? 131 GLN B C      1 
ATOM   4139 O O      . GLN B 1 131 ? 23.343  62.486 57.391 1.00 75.08  ? 131 GLN B O      1 
ATOM   4140 C CB     . GLN B 1 131 ? 22.404  65.520 56.459 1.00 84.33  ? 131 GLN B CB     1 
ATOM   4141 C CG     . GLN B 1 131 ? 21.347  66.130 57.379 1.00 85.82  ? 131 GLN B CG     1 
ATOM   4142 C CD     . GLN B 1 131 ? 21.763  67.477 57.951 1.00 92.24  ? 131 GLN B CD     1 
ATOM   4143 O OE1    . GLN B 1 131 ? 22.938  67.844 57.916 1.00 95.42  ? 131 GLN B OE1    1 
ATOM   4144 N NE2    . GLN B 1 131 ? 20.796  68.222 58.478 1.00 94.72  ? 131 GLN B NE2    1 
ATOM   4145 H H      . GLN B 1 131 ? 20.349  64.685 55.452 1.00 95.06  ? 131 GLN B H      1 
ATOM   4146 H HA     . GLN B 1 131 ? 22.787  63.819 55.378 1.00 97.29  ? 131 GLN B HA     1 
ATOM   4147 H HB2    . GLN B 1 131 ? 23.255  65.556 56.924 1.00 105.59 ? 131 GLN B HB2    1 
ATOM   4148 H HB3    . GLN B 1 131 ? 22.447  66.065 55.658 1.00 105.59 ? 131 GLN B HB3    1 
ATOM   4149 H HG2    . GLN B 1 131 ? 20.527  66.259 56.876 1.00 108.92 ? 131 GLN B HG2    1 
ATOM   4150 H HG3    . GLN B 1 131 ? 21.188  65.526 58.121 1.00 108.92 ? 131 GLN B HG3    1 
ATOM   4151 H HE21   . GLN B 1 131 ? 19.986  67.934 58.483 1.00 123.36 ? 131 GLN B HE21   1 
ATOM   4152 H HE22   . GLN B 1 131 ? 20.981  68.991 58.815 1.00 123.36 ? 131 GLN B HE22   1 
ATOM   4153 N N      . HIS B 1 132 ? 21.279  63.046 58.095 1.00 68.17  ? 132 HIS B N      1 
ATOM   4154 C CA     . HIS B 1 132 ? 21.374  62.225 59.296 1.00 68.02  ? 132 HIS B CA     1 
ATOM   4155 C C      . HIS B 1 132 ? 21.158  60.748 58.998 1.00 65.53  ? 132 HIS B C      1 
ATOM   4156 O O      . HIS B 1 132 ? 21.712  59.894 59.700 1.00 65.31  ? 132 HIS B O      1 
ATOM   4157 C CB     . HIS B 1 132 ? 20.363  62.703 60.339 1.00 69.17  ? 132 HIS B CB     1 
ATOM   4158 C CG     . HIS B 1 132 ? 20.609  64.098 60.824 1.00 70.07  ? 132 HIS B CG     1 
ATOM   4159 N ND1    . HIS B 1 132 ? 19.947  65.193 60.310 1.00 71.64  ? 132 HIS B ND1    1 
ATOM   4160 C CD2    . HIS B 1 132 ? 21.447  64.577 61.774 1.00 72.25  ? 132 HIS B CD2    1 
ATOM   4161 C CE1    . HIS B 1 132 ? 20.365  66.286 60.924 1.00 76.22  ? 132 HIS B CE1    1 
ATOM   4162 N NE2    . HIS B 1 132 ? 21.275  65.940 61.816 1.00 76.72  ? 132 HIS B NE2    1 
ATOM   4163 H H      . HIS B 1 132 ? 20.525  63.448 58.000 1.00 92.62  ? 132 HIS B H      1 
ATOM   4164 H HA     . HIS B 1 132 ? 22.262  62.325 59.674 1.00 90.48  ? 132 HIS B HA     1 
ATOM   4165 H HB2    . HIS B 1 132 ? 19.475  62.677 59.949 1.00 93.66  ? 132 HIS B HB2    1 
ATOM   4166 H HB3    . HIS B 1 132 ? 20.402  62.111 61.107 1.00 93.66  ? 132 HIS B HB3    1 
ATOM   4167 H HD2    . HIS B 1 132 ? 22.029  64.078 62.299 1.00 102.39 ? 132 HIS B HD2    1 
ATOM   4168 H HE1    . HIS B 1 132 ? 20.069  67.151 60.756 1.00 106.62 ? 132 HIS B HE1    1 
ATOM   4169 H HE2    . HIS B 1 132 ? 21.693  66.480 62.339 1.00 107.97 ? 132 HIS B HE2    1 
ATOM   4170 N N      . LEU B 1 133 ? 20.362  60.424 57.978 1.00 65.86  ? 133 LEU B N      1 
ATOM   4171 C CA     . LEU B 1 133 ? 20.173  59.025 57.608 1.00 63.01  ? 133 LEU B CA     1 
ATOM   4172 C C      . LEU B 1 133 ? 21.482  58.410 57.132 1.00 60.72  ? 133 LEU B C      1 
ATOM   4173 O O      . LEU B 1 133 ? 21.869  57.321 57.573 1.00 59.90  ? 133 LEU B O      1 
ATOM   4174 C CB     . LEU B 1 133 ? 19.100  58.906 56.523 1.00 61.59  ? 133 LEU B CB     1 
ATOM   4175 C CG     . LEU B 1 133 ? 17.750  59.571 56.799 1.00 63.67  ? 133 LEU B CG     1 
ATOM   4176 C CD1    . LEU B 1 133 ? 16.753  59.190 55.717 1.00 62.37  ? 133 LEU B CD1    1 
ATOM   4177 C CD2    . LEU B 1 133 ? 17.208  59.212 58.177 1.00 65.66  ? 133 LEU B CD2    1 
ATOM   4178 H H      . LEU B 1 133 ? 19.929  60.986 57.492 1.00 87.82  ? 133 LEU B H      1 
ATOM   4179 H HA     . LEU B 1 133 ? 19.872  58.529 58.385 1.00 80.18  ? 133 LEU B HA     1 
ATOM   4180 H HB2    . LEU B 1 133 ? 19.451  59.299 55.709 1.00 78.26  ? 133 LEU B HB2    1 
ATOM   4181 H HB3    . LEU B 1 133 ? 18.928  57.963 56.373 1.00 78.26  ? 133 LEU B HB3    1 
ATOM   4182 H HG     . LEU B 1 133 ? 17.865  60.533 56.769 1.00 80.11  ? 133 LEU B HG     1 
ATOM   4183 H HD11   . LEU B 1 133 ? 15.904  59.618 55.905 1.00 77.32  ? 133 LEU B HD11   1 
ATOM   4184 H HD12   . LEU B 1 133 ? 17.091  59.488 54.858 1.00 77.32  ? 133 LEU B HD12   1 
ATOM   4185 H HD13   . LEU B 1 133 ? 16.644  58.226 55.714 1.00 77.32  ? 133 LEU B HD13   1 
ATOM   4186 H HD21   . LEU B 1 133 ? 16.355  59.655 58.305 1.00 80.99  ? 133 LEU B HD21   1 
ATOM   4187 H HD22   . LEU B 1 133 ? 17.094  58.250 58.230 1.00 80.99  ? 133 LEU B HD22   1 
ATOM   4188 H HD23   . LEU B 1 133 ? 17.840  59.508 58.851 1.00 80.99  ? 133 LEU B HD23   1 
ATOM   4189 N N      . CYS B 1 134 ? 22.181  59.100 56.228 1.00 61.55  ? 134 CYS B N      1 
ATOM   4190 C CA     . CYS B 1 134 ? 23.436  58.580 55.696 1.00 60.92  ? 134 CYS B CA     1 
ATOM   4191 C C      . CYS B 1 134 ? 24.432  58.297 56.812 1.00 63.10  ? 134 CYS B C      1 
ATOM   4192 O O      . CYS B 1 134 ? 24.981  57.194 56.905 1.00 62.38  ? 134 CYS B O      1 
ATOM   4193 C CB     . CYS B 1 134 ? 24.029  59.570 54.695 1.00 61.99  ? 134 CYS B CB     1 
ATOM   4194 S SG     . CYS B 1 134 ? 23.071  59.752 53.180 1.00 61.22  ? 134 CYS B SG     1 
ATOM   4195 H H      . CYS B 1 134 ? 21.950  59.865 55.910 1.00 66.45  ? 134 CYS B H      1 
ATOM   4196 H HA     . CYS B 1 134 ? 23.262  57.747 55.229 1.00 68.30  ? 134 CYS B HA     1 
ATOM   4197 H HB2    . CYS B 1 134 ? 24.084  60.442 55.116 1.00 75.13  ? 134 CYS B HB2    1 
ATOM   4198 H HB3    . CYS B 1 134 ? 24.917  59.269 54.448 1.00 75.13  ? 134 CYS B HB3    1 
ATOM   4199 H HG     . CYS B 1 134 ? 23.003  58.688 52.631 1.00 76.74  ? 134 CYS B HG     1 
ATOM   4200 N N      . GLU B 1 135 ? 24.681  59.287 57.670 1.00 85.49  ? 135 GLU B N      1 
ATOM   4201 C CA     . GLU B 1 135 ? 25.659  59.106 58.736 1.00 87.26  ? 135 GLU B CA     1 
ATOM   4202 C C      . GLU B 1 135 ? 25.260  57.976 59.673 1.00 88.74  ? 135 GLU B C      1 
ATOM   4203 O O      . GLU B 1 135 ? 26.125  57.365 60.310 1.00 90.12  ? 135 GLU B O      1 
ATOM   4204 C CB     . GLU B 1 135 ? 25.838  60.415 59.508 1.00 88.35  ? 135 GLU B CB     1 
ATOM   4205 C CG     . GLU B 1 135 ? 26.415  61.539 58.664 1.00 89.22  ? 135 GLU B CG     1 
ATOM   4206 C CD     . GLU B 1 135 ? 26.708  62.788 59.471 1.00 94.30  ? 135 GLU B CD     1 
ATOM   4207 O OE1    . GLU B 1 135 ? 26.252  62.868 60.631 1.00 94.75  ? 135 GLU B OE1    1 
ATOM   4208 O OE2    . GLU B 1 135 ? 27.399  63.689 58.947 1.00 98.44  ? 135 GLU B OE2    1 
ATOM   4209 H H      . GLU B 1 135 ? 24.302  60.059 57.656 1.00 107.46 ? 135 GLU B H      1 
ATOM   4210 H HA     . GLU B 1 135 ? 26.514  58.876 58.340 1.00 108.74 ? 135 GLU B HA     1 
ATOM   4211 H HB2    . GLU B 1 135 ? 24.974  60.704 59.839 1.00 110.71 ? 135 GLU B HB2    1 
ATOM   4212 H HB3    . GLU B 1 135 ? 26.442  60.260 60.251 1.00 110.71 ? 135 GLU B HB3    1 
ATOM   4213 H HG2    . GLU B 1 135 ? 27.246  61.239 58.263 1.00 112.15 ? 135 GLU B HG2    1 
ATOM   4214 H HG3    . GLU B 1 135 ? 25.778  61.773 57.971 1.00 112.15 ? 135 GLU B HG3    1 
ATOM   4215 N N      . MET B 1 136 ? 23.964  57.677 59.768 1.00 60.78  ? 136 MET B N      1 
ATOM   4216 C CA     . MET B 1 136 ? 23.509  56.532 60.545 1.00 61.54  ? 136 MET B CA     1 
ATOM   4217 C C      . MET B 1 136 ? 23.490  55.249 59.728 1.00 59.40  ? 136 MET B C      1 
ATOM   4218 O O      . MET B 1 136 ? 23.717  54.166 60.281 1.00 60.09  ? 136 MET B O      1 
ATOM   4219 C CB     . MET B 1 136 ? 22.109  56.791 61.108 1.00 62.01  ? 136 MET B CB     1 
ATOM   4220 C CG     . MET B 1 136 ? 22.102  57.344 62.525 1.00 63.39  ? 136 MET B CG     1 
ATOM   4221 S SD     . MET B 1 136 ? 22.783  56.198 63.745 1.00 64.52  ? 136 MET B SD     1 
ATOM   4222 C CE     . MET B 1 136 ? 21.559  54.890 63.725 1.00 62.96  ? 136 MET B CE     1 
ATOM   4223 H H      . MET B 1 136 ? 23.332  58.123 59.393 1.00 83.75  ? 136 MET B H      1 
ATOM   4224 H HA     . MET B 1 136 ? 24.109  56.411 61.297 1.00 80.69  ? 136 MET B HA     1 
ATOM   4225 H HB2    . MET B 1 136 ? 21.657  57.432 60.538 1.00 80.28  ? 136 MET B HB2    1 
ATOM   4226 H HB3    . MET B 1 136 ? 21.616  55.955 61.115 1.00 80.28  ? 136 MET B HB3    1 
ATOM   4227 H HG2    . MET B 1 136 ? 22.634  58.155 62.549 1.00 83.78  ? 136 MET B HG2    1 
ATOM   4228 H HG3    . MET B 1 136 ? 21.187  57.542 62.781 1.00 83.78  ? 136 MET B HG3    1 
ATOM   4229 H HE1    . MET B 1 136 ? 21.823  54.202 64.355 1.00 73.87  ? 136 MET B HE1    1 
ATOM   4230 H HE2    . MET B 1 136 ? 20.699  55.260 63.979 1.00 73.87  ? 136 MET B HE2    1 
ATOM   4231 H HE3    . MET B 1 136 ? 21.509  54.519 62.830 1.00 73.87  ? 136 MET B HE3    1 
ATOM   4232 N N      . ALA B 1 137 ? 23.221  55.346 58.425 1.00 56.26  ? 137 ALA B N      1 
ATOM   4233 C CA     . ALA B 1 137 ? 23.237  54.160 57.579 1.00 53.84  ? 137 ALA B CA     1 
ATOM   4234 C C      . ALA B 1 137 ? 24.629  53.548 57.504 1.00 53.95  ? 137 ALA B C      1 
ATOM   4235 O O      . ALA B 1 137 ? 24.762  52.324 57.401 1.00 52.87  ? 137 ALA B O      1 
ATOM   4236 C CB     . ALA B 1 137 ? 22.735  54.512 56.180 1.00 51.05  ? 137 ALA B CB     1 
ATOM   4237 H H      . ALA B 1 137 ? 23.030  56.077 58.014 1.00 64.89  ? 137 ALA B H      1 
ATOM   4238 H HA     . ALA B 1 137 ? 22.638  53.496 57.955 1.00 63.39  ? 137 ALA B HA     1 
ATOM   4239 H HB1    . ALA B 1 137 ? 22.752  53.713 55.629 1.00 63.58  ? 137 ALA B HB1    1 
ATOM   4240 H HB2    . ALA B 1 137 ? 21.829  54.850 56.246 1.00 63.58  ? 137 ALA B HB2    1 
ATOM   4241 H HB3    . ALA B 1 137 ? 23.315  55.189 55.798 1.00 63.58  ? 137 ALA B HB3    1 
ATOM   4242 N N      . ILE B 1 138 ? 25.674  54.376 57.562 1.00 72.33  ? 138 ILE B N      1 
ATOM   4243 C CA     . ILE B 1 138 ? 27.034  53.861 57.436 1.00 72.80  ? 138 ILE B CA     1 
ATOM   4244 C C      . ILE B 1 138 ? 27.430  53.078 58.682 1.00 75.38  ? 138 ILE B C      1 
ATOM   4245 O O      . ILE B 1 138 ? 28.037  52.005 58.586 1.00 74.74  ? 138 ILE B O      1 
ATOM   4246 C CB     . ILE B 1 138 ? 28.018  55.013 57.148 1.00 74.61  ? 138 ILE B CB     1 
ATOM   4247 C CG1    . ILE B 1 138 ? 29.449  54.486 56.983 1.00 75.81  ? 138 ILE B CG1    1 
ATOM   4248 C CG2    . ILE B 1 138 ? 27.978  56.068 58.249 1.00 77.86  ? 138 ILE B CG2    1 
ATOM   4249 C CD1    . ILE B 1 138 ? 29.639  53.568 55.793 1.00 73.49  ? 138 ILE B CD1    1 
ATOM   4250 H H      . ILE B 1 138 ? 25.622  55.227 57.672 1.00 83.83  ? 138 ILE B H      1 
ATOM   4251 H HA     . ILE B 1 138 ? 27.067  53.251 56.683 1.00 84.97  ? 138 ILE B HA     1 
ATOM   4252 H HB     . ILE B 1 138 ? 27.754  55.435 56.316 1.00 90.88  ? 138 ILE B HB     1 
ATOM   4253 H HG12   . ILE B 1 138 ? 30.047  55.241 56.872 1.00 93.29  ? 138 ILE B HG12   1 
ATOM   4254 H HG13   . ILE B 1 138 ? 29.692  53.990 57.780 1.00 93.29  ? 138 ILE B HG13   1 
ATOM   4255 H HG21   . ILE B 1 138 ? 28.608  56.773 58.033 1.00 95.37  ? 138 ILE B HG21   1 
ATOM   4256 H HG22   . ILE B 1 138 ? 27.081  56.431 58.305 1.00 95.37  ? 138 ILE B HG22   1 
ATOM   4257 H HG23   . ILE B 1 138 ? 28.221  55.654 59.092 1.00 95.37  ? 138 ILE B HG23   1 
ATOM   4258 H HD11   . ILE B 1 138 ? 30.565  53.281 55.761 1.00 91.84  ? 138 ILE B HD11   1 
ATOM   4259 H HD12   . ILE B 1 138 ? 29.057  52.798 55.893 1.00 91.84  ? 138 ILE B HD12   1 
ATOM   4260 H HD13   . ILE B 1 138 ? 29.413  54.050 54.983 1.00 91.84  ? 138 ILE B HD13   1 
ATOM   4261 N N      . ARG B 1 139 ? 27.098  53.594 59.866 1.00 71.40  ? 139 ARG B N      1 
ATOM   4262 C CA     . ARG B 1 139 ? 27.448  52.895 61.098 1.00 74.43  ? 139 ARG B CA     1 
ATOM   4263 C C      . ARG B 1 139 ? 26.631  51.619 61.248 1.00 73.21  ? 139 ARG B C      1 
ATOM   4264 O O      . ARG B 1 139 ? 27.170  50.559 61.589 1.00 73.91  ? 139 ARG B O      1 
ATOM   4265 C CB     . ARG B 1 139 ? 27.237  53.812 62.302 1.00 78.28  ? 139 ARG B CB     1 
ATOM   4266 C CG     . ARG B 1 139 ? 28.047  55.096 62.250 1.00 80.15  ? 139 ARG B CG     1 
ATOM   4267 C CD     . ARG B 1 139 ? 27.246  56.278 62.770 1.00 80.38  ? 139 ARG B CD     1 
ATOM   4268 N NE     . ARG B 1 139 ? 27.831  57.556 62.370 1.00 79.77  ? 139 ARG B NE     1 
ATOM   4269 C CZ     . ARG B 1 139 ? 28.660  58.284 63.114 1.00 82.36  ? 139 ARG B CZ     1 
ATOM   4270 N NH1    . ARG B 1 139 ? 29.021  57.881 64.324 1.00 84.72  ? 139 ARG B NH1    1 
ATOM   4271 N NH2    . ARG B 1 139 ? 29.129  59.430 62.641 1.00 83.30  ? 139 ARG B NH2    1 
ATOM   4272 H H      . ARG B 1 139 ? 26.677  54.335 59.980 1.00 83.50  ? 139 ARG B H      1 
ATOM   4273 H HA     . ARG B 1 139 ? 28.386  52.649 61.067 1.00 83.46  ? 139 ARG B HA     1 
ATOM   4274 H HB2    . ARG B 1 139 ? 26.300  54.056 62.348 1.00 90.12  ? 139 ARG B HB2    1 
ATOM   4275 H HB3    . ARG B 1 139 ? 27.492  53.334 63.106 1.00 90.12  ? 139 ARG B HB3    1 
ATOM   4276 H HG2    . ARG B 1 139 ? 28.839  54.999 62.802 1.00 99.70  ? 139 ARG B HG2    1 
ATOM   4277 H HG3    . ARG B 1 139 ? 28.298  55.280 61.331 1.00 99.70  ? 139 ARG B HG3    1 
ATOM   4278 H HD2    . ARG B 1 139 ? 26.345  56.233 62.413 1.00 102.32 ? 139 ARG B HD2    1 
ATOM   4279 H HD3    . ARG B 1 139 ? 27.224  56.246 63.739 1.00 102.32 ? 139 ARG B HD3    1 
ATOM   4280 H HE     . ARG B 1 139 ? 27.624  57.861 61.593 1.00 104.74 ? 139 ARG B HE     1 
ATOM   4281 H HH11   . ARG B 1 139 ? 28.721  57.139 64.638 1.00 113.94 ? 139 ARG B HH11   1 
ATOM   4282 H HH12   . ARG B 1 139 ? 29.557  58.362 64.795 1.00 113.94 ? 139 ARG B HH12   1 
ATOM   4283 H HH21   . ARG B 1 139 ? 28.899  59.699 61.857 1.00 118.84 ? 139 ARG B HH21   1 
ATOM   4284 H HH22   . ARG B 1 139 ? 29.664  59.905 63.119 1.00 118.84 ? 139 ARG B HH22   1 
ATOM   4285 N N      . SER B 1 140 ? 25.322  51.703 61.003 1.00 68.69  ? 140 SER B N      1 
ATOM   4286 C CA     . SER B 1 140 ? 24.479  50.514 61.046 1.00 68.83  ? 140 SER B CA     1 
ATOM   4287 C C      . SER B 1 140 ? 25.018  49.436 60.115 1.00 65.15  ? 140 SER B C      1 
ATOM   4288 O O      . SER B 1 140 ? 25.182  48.277 60.512 1.00 65.13  ? 140 SER B O      1 
ATOM   4289 C CB     . SER B 1 140 ? 23.043  50.881 60.671 1.00 68.29  ? 140 SER B CB     1 
ATOM   4290 O OG     . SER B 1 140 ? 22.499  51.813 61.589 1.00 71.48  ? 140 SER B OG     1 
ATOM   4291 H H      . SER B 1 140 ? 24.904  52.430 60.812 1.00 82.87  ? 140 SER B H      1 
ATOM   4292 H HA     . SER B 1 140 ? 24.475  50.160 61.949 1.00 81.74  ? 140 SER B HA     1 
ATOM   4293 H HB2    . SER B 1 140 ? 23.040  51.275 59.784 1.00 81.27  ? 140 SER B HB2    1 
ATOM   4294 H HB3    . SER B 1 140 ? 22.500  50.078 60.679 1.00 81.27  ? 140 SER B HB3    1 
ATOM   4295 H HG     . SER B 1 140 ? 22.960  52.515 61.593 1.00 85.19  ? 140 SER B HG     1 
ATOM   4296 N N      . LYS B 1 141 ? 25.306  49.807 58.866 1.00 71.25  ? 141 LYS B N      1 
ATOM   4297 C CA     . LYS B 1 141 ? 25.853  48.849 57.913 1.00 68.67  ? 141 LYS B CA     1 
ATOM   4298 C C      . LYS B 1 141 ? 27.161  48.257 58.423 1.00 71.84  ? 141 LYS B C      1 
ATOM   4299 O O      . LYS B 1 141 ? 27.358  47.037 58.394 1.00 71.71  ? 141 LYS B O      1 
ATOM   4300 C CB     . LYS B 1 141 ? 26.061  49.526 56.558 1.00 65.56  ? 141 LYS B CB     1 
ATOM   4301 C CG     . LYS B 1 141 ? 26.760  48.655 55.529 1.00 63.51  ? 141 LYS B CG     1 
ATOM   4302 C CD     . LYS B 1 141 ? 26.898  49.376 54.204 1.00 61.89  ? 141 LYS B CD     1 
ATOM   4303 C CE     . LYS B 1 141 ? 27.632  48.521 53.192 1.00 61.97  ? 141 LYS B CE     1 
ATOM   4304 N NZ     . LYS B 1 141 ? 27.710  49.186 51.869 1.00 61.59  ? 141 LYS B NZ     1 
ATOM   4305 H H      . LYS B 1 141 ? 25.193  50.599 58.551 1.00 79.66  ? 141 LYS B H      1 
ATOM   4306 H HA     . LYS B 1 141 ? 25.221  48.123 57.793 1.00 80.47  ? 141 LYS B HA     1 
ATOM   4307 H HB2    . LYS B 1 141 ? 25.196  49.772 56.197 1.00 78.07  ? 141 LYS B HB2    1 
ATOM   4308 H HB3    . LYS B 1 141 ? 26.601  50.321 56.687 1.00 78.07  ? 141 LYS B HB3    1 
ATOM   4309 H HG2    . LYS B 1 141 ? 27.649  48.431 55.848 1.00 74.97  ? 141 LYS B HG2    1 
ATOM   4310 H HG3    . LYS B 1 141 ? 26.241  47.849 55.385 1.00 74.97  ? 141 LYS B HG3    1 
ATOM   4311 H HD2    . LYS B 1 141 ? 26.016  49.575 53.854 1.00 73.76  ? 141 LYS B HD2    1 
ATOM   4312 H HD3    . LYS B 1 141 ? 27.402  50.194 54.335 1.00 73.76  ? 141 LYS B HD3    1 
ATOM   4313 H HE2    . LYS B 1 141 ? 28.536  48.360 53.505 1.00 73.01  ? 141 LYS B HE2    1 
ATOM   4314 H HE3    . LYS B 1 141 ? 27.160  47.680 53.082 1.00 73.01  ? 141 LYS B HE3    1 
ATOM   4315 H HZ1    . LYS B 1 141 ? 28.145  48.666 51.293 1.00 73.95  ? 141 LYS B HZ1    1 
ATOM   4316 H HZ2    . LYS B 1 141 ? 26.891  49.342 51.558 1.00 73.95  ? 141 LYS B HZ2    1 
ATOM   4317 H HZ3    . LYS B 1 141 ? 28.143  49.960 51.943 1.00 73.95  ? 141 LYS B HZ3    1 
ATOM   4318 N N      . GLN B 1 142 ? 28.071  49.112 58.895 1.00 73.32  ? 142 GLN B N      1 
ATOM   4319 C CA     . GLN B 1 142 ? 29.360  48.625 59.373 1.00 75.36  ? 142 GLN B CA     1 
ATOM   4320 C C      . GLN B 1 142 ? 29.184  47.630 60.512 1.00 77.41  ? 142 GLN B C      1 
ATOM   4321 O O      . GLN B 1 142 ? 29.946  46.663 60.625 1.00 78.00  ? 142 GLN B O      1 
ATOM   4322 C CB     . GLN B 1 142 ? 30.232  49.798 59.820 1.00 77.74  ? 142 GLN B CB     1 
ATOM   4323 C CG     . GLN B 1 142 ? 31.625  49.391 60.280 1.00 80.23  ? 142 GLN B CG     1 
ATOM   4324 C CD     . GLN B 1 142 ? 32.472  50.576 60.699 1.00 83.65  ? 142 GLN B CD     1 
ATOM   4325 O OE1    . GLN B 1 142 ? 32.009  51.717 60.700 1.00 83.60  ? 142 GLN B OE1    1 
ATOM   4326 N NE2    . GLN B 1 142 ? 33.723  50.310 61.059 1.00 86.89  ? 142 GLN B NE2    1 
ATOM   4327 H H      . GLN B 1 142 ? 27.966  49.964 58.948 1.00 94.04  ? 142 GLN B H      1 
ATOM   4328 H HA     . GLN B 1 142 ? 29.816  48.172 58.647 1.00 95.21  ? 142 GLN B HA     1 
ATOM   4329 H HB2    . GLN B 1 142 ? 30.333  50.413 59.077 1.00 96.42  ? 142 GLN B HB2    1 
ATOM   4330 H HB3    . GLN B 1 142 ? 29.795  50.248 60.561 1.00 96.42  ? 142 GLN B HB3    1 
ATOM   4331 H HG2    . GLN B 1 142 ? 31.545  48.796 61.041 1.00 98.31  ? 142 GLN B HG2    1 
ATOM   4332 H HG3    . GLN B 1 142 ? 32.079  48.940 59.551 1.00 98.31  ? 142 GLN B HG3    1 
ATOM   4333 H HE21   . GLN B 1 142 ? 34.011  49.500 61.046 1.00 109.04 ? 142 GLN B HE21   1 
ATOM   4334 H HE22   . GLN B 1 142 ? 34.245  50.948 61.305 1.00 109.04 ? 142 GLN B HE22   1 
ATOM   4335 N N      . GLU B 1 143 ? 28.185  47.848 61.366 1.00 78.94  ? 143 GLU B N      1 
ATOM   4336 C CA     . GLU B 1 143 ? 27.981  46.968 62.510 1.00 80.50  ? 143 GLU B CA     1 
ATOM   4337 C C      . GLU B 1 143 ? 27.348  45.648 62.087 1.00 76.57  ? 143 GLU B C      1 
ATOM   4338 O O      . GLU B 1 143 ? 27.812  44.574 62.484 1.00 76.11  ? 143 GLU B O      1 
ATOM   4339 C CB     . GLU B 1 143 ? 27.112  47.665 63.556 1.00 83.78  ? 143 GLU B CB     1 
ATOM   4340 C CG     . GLU B 1 143 ? 27.106  46.975 64.901 1.00 85.48  ? 143 GLU B CG     1 
ATOM   4341 C CD     . GLU B 1 143 ? 28.465  47.007 65.574 1.00 89.53  ? 143 GLU B CD     1 
ATOM   4342 O OE1    . GLU B 1 143 ? 29.277  47.892 65.232 1.00 91.48  ? 143 GLU B OE1    1 
ATOM   4343 O OE2    . GLU B 1 143 ? 28.725  46.147 66.442 1.00 90.38  ? 143 GLU B OE2    1 
ATOM   4344 H H      . GLU B 1 143 ? 27.618  48.492 61.305 1.00 97.55  ? 143 GLU B H      1 
ATOM   4345 H HA     . GLU B 1 143 ? 28.840  46.773 62.915 1.00 96.45  ? 143 GLU B HA     1 
ATOM   4346 H HB2    . GLU B 1 143 ? 27.444  48.567 63.687 1.00 97.75  ? 143 GLU B HB2    1 
ATOM   4347 H HB3    . GLU B 1 143 ? 26.198  47.695 63.233 1.00 97.75  ? 143 GLU B HB3    1 
ATOM   4348 H HG2    . GLU B 1 143 ? 26.471  47.420 65.483 1.00 100.28 ? 143 GLU B HG2    1 
ATOM   4349 H HG3    . GLU B 1 143 ? 26.852  46.046 64.779 1.00 100.28 ? 143 GLU B HG3    1 
ATOM   4350 N N      . LEU B 1 144 ? 26.286  45.713 61.280 1.00 62.35  ? 144 LEU B N      1 
ATOM   4351 C CA     . LEU B 1 144 ? 25.620  44.499 60.818 1.00 58.94  ? 144 LEU B CA     1 
ATOM   4352 C C      . LEU B 1 144 ? 26.615  43.517 60.213 1.00 58.85  ? 144 LEU B C      1 
ATOM   4353 O O      . LEU B 1 144 ? 26.474  42.299 60.372 1.00 59.19  ? 144 LEU B O      1 
ATOM   4354 C CB     . LEU B 1 144 ? 24.542  44.858 59.794 1.00 55.74  ? 144 LEU B CB     1 
ATOM   4355 C CG     . LEU B 1 144 ? 23.692  43.703 59.257 1.00 52.80  ? 144 LEU B CG     1 
ATOM   4356 C CD1    . LEU B 1 144 ? 22.737  43.193 60.322 1.00 52.81  ? 144 LEU B CD1    1 
ATOM   4357 C CD2    . LEU B 1 144 ? 22.934  44.133 58.015 1.00 50.86  ? 144 LEU B CD2    1 
ATOM   4358 H H      . LEU B 1 144 ? 25.936  46.443 60.989 1.00 73.63  ? 144 LEU B H      1 
ATOM   4359 H HA     . LEU B 1 144 ? 25.189  44.066 61.571 1.00 71.49  ? 144 LEU B HA     1 
ATOM   4360 H HB2    . LEU B 1 144 ? 23.935  45.494 60.204 1.00 67.23  ? 144 LEU B HB2    1 
ATOM   4361 H HB3    . LEU B 1 144 ? 24.974  45.274 59.032 1.00 67.23  ? 144 LEU B HB3    1 
ATOM   4362 H HG     . LEU B 1 144 ? 24.279  42.971 59.009 1.00 64.76  ? 144 LEU B HG     1 
ATOM   4363 H HD11   . LEU B 1 144 ? 22.214  42.464 59.954 1.00 64.64  ? 144 LEU B HD11   1 
ATOM   4364 H HD12   . LEU B 1 144 ? 23.250  42.881 61.083 1.00 64.64  ? 144 LEU B HD12   1 
ATOM   4365 H HD13   . LEU B 1 144 ? 22.151  43.918 60.592 1.00 64.64  ? 144 LEU B HD13   1 
ATOM   4366 H HD21   . LEU B 1 144 ? 22.404  43.386 57.694 1.00 63.73  ? 144 LEU B HD21   1 
ATOM   4367 H HD22   . LEU B 1 144 ? 22.354  44.877 58.242 1.00 63.73  ? 144 LEU B HD22   1 
ATOM   4368 H HD23   . LEU B 1 144 ? 23.570  44.405 57.335 1.00 63.73  ? 144 LEU B HD23   1 
ATOM   4369 N N      . LEU B 1 145 ? 27.627  44.028 59.518 1.00 50.33  ? 145 LEU B N      1 
ATOM   4370 C CA     . LEU B 1 145 ? 28.595  43.187 58.830 1.00 50.15  ? 145 LEU B CA     1 
ATOM   4371 C C      . LEU B 1 145 ? 29.738  42.724 59.725 1.00 53.57  ? 145 LEU B C      1 
ATOM   4372 O O      . LEU B 1 145 ? 30.502  41.844 59.315 1.00 56.17  ? 145 LEU B O      1 
ATOM   4373 C CB     . LEU B 1 145 ? 29.169  43.935 57.622 1.00 49.79  ? 145 LEU B CB     1 
ATOM   4374 C CG     . LEU B 1 145 ? 28.150  44.443 56.600 1.00 46.45  ? 145 LEU B CG     1 
ATOM   4375 C CD1    . LEU B 1 145 ? 28.841  45.257 55.516 1.00 47.86  ? 145 LEU B CD1    1 
ATOM   4376 C CD2    . LEU B 1 145 ? 27.369  43.296 55.985 1.00 45.19  ? 145 LEU B CD2    1 
ATOM   4377 H H      . LEU B 1 145 ? 27.776  44.871 59.431 1.00 67.14  ? 145 LEU B H      1 
ATOM   4378 H HA     . LEU B 1 145 ? 28.140  42.396 58.500 1.00 65.92  ? 145 LEU B HA     1 
ATOM   4379 H HB2    . LEU B 1 145 ? 29.661  44.706 57.947 1.00 64.39  ? 145 LEU B HB2    1 
ATOM   4380 H HB3    . LEU B 1 145 ? 29.775  43.340 57.154 1.00 64.39  ? 145 LEU B HB3    1 
ATOM   4381 H HG     . LEU B 1 145 ? 27.518  45.025 57.050 1.00 60.29  ? 145 LEU B HG     1 
ATOM   4382 H HD11   . LEU B 1 145 ? 28.176  45.567 54.882 1.00 62.08  ? 145 LEU B HD11   1 
ATOM   4383 H HD12   . LEU B 1 145 ? 29.286  46.015 55.927 1.00 62.08  ? 145 LEU B HD12   1 
ATOM   4384 H HD13   . LEU B 1 145 ? 29.491  44.695 55.066 1.00 62.08  ? 145 LEU B HD13   1 
ATOM   4385 H HD21   . LEU B 1 145 ? 26.735  43.653 55.345 1.00 57.71  ? 145 LEU B HD21   1 
ATOM   4386 H HD22   . LEU B 1 145 ? 27.989  42.697 55.540 1.00 57.71  ? 145 LEU B HD22   1 
ATOM   4387 H HD23   . LEU B 1 145 ? 26.899  42.822 56.689 1.00 57.71  ? 145 LEU B HD23   1 
ATOM   4388 N N      . GLN B 1 146 ? 29.880  43.288 60.927 1.00 64.66  ? 146 GLN B N      1 
ATOM   4389 C CA     . GLN B 1 146 ? 30.954  42.908 61.837 1.00 81.16  ? 146 GLN B CA     1 
ATOM   4390 C C      . GLN B 1 146 ? 30.427  42.270 63.119 1.00 88.52  ? 146 GLN B C      1 
ATOM   4391 O O      . GLN B 1 146 ? 31.155  42.203 64.115 1.00 95.53  ? 146 GLN B O      1 
ATOM   4392 C CB     . GLN B 1 146 ? 31.829  44.119 62.172 1.00 90.07  ? 146 GLN B CB     1 
ATOM   4393 C CG     . GLN B 1 146 ? 32.621  44.656 60.991 1.00 80.72  ? 146 GLN B CG     1 
ATOM   4394 C CD     . GLN B 1 146 ? 33.750  45.578 61.413 1.00 85.39  ? 146 GLN B CD     1 
ATOM   4395 O OE1    . GLN B 1 146 ? 33.694  46.788 61.194 1.00 81.91  ? 146 GLN B OE1    1 
ATOM   4396 N NE2    . GLN B 1 146 ? 34.785  45.007 62.019 1.00 89.41  ? 146 GLN B NE2    1 
ATOM   4397 H H      . GLN B 1 146 ? 29.360  43.899 61.238 1.00 111.42 ? 146 GLN B H      1 
ATOM   4398 H HA     . GLN B 1 146 ? 31.517  42.254 61.395 1.00 128.59 ? 146 GLN B HA     1 
ATOM   4399 H HB2    . GLN B 1 146 ? 31.260  44.834 62.496 1.00 125.53 ? 146 GLN B HB2    1 
ATOM   4400 H HB3    . GLN B 1 146 ? 32.462  43.865 62.862 1.00 125.53 ? 146 GLN B HB3    1 
ATOM   4401 H HG2    . GLN B 1 146 ? 33.008  43.911 60.504 1.00 116.91 ? 146 GLN B HG2    1 
ATOM   4402 H HG3    . GLN B 1 146 ? 32.025  45.157 60.412 1.00 116.91 ? 146 GLN B HG3    1 
ATOM   4403 H HE21   . GLN B 1 146 ? 34.790  44.157 62.152 1.00 123.77 ? 146 GLN B HE21   1 
ATOM   4404 H HE22   . GLN B 1 146 ? 35.450  45.487 62.277 1.00 123.77 ? 146 GLN B HE22   1 
ATOM   4405 N N      . LEU B 1 147 ? 29.184  41.798 63.117 1.00 100.24 ? 147 LEU B N      1 
ATOM   4406 C CA     . LEU B 1 147 ? 28.614  41.103 64.263 1.00 102.42 ? 147 LEU B CA     1 
ATOM   4407 C C      . LEU B 1 147 ? 28.716  39.597 64.064 1.00 94.45  ? 147 LEU B C      1 
ATOM   4408 O O      . LEU B 1 147 ? 28.554  39.092 62.949 1.00 86.34  ? 147 LEU B O      1 
ATOM   4409 C CB     . LEU B 1 147 ? 27.149  41.493 64.481 1.00 99.00  ? 147 LEU B CB     1 
ATOM   4410 C CG     . LEU B 1 147 ? 26.824  42.878 65.049 1.00 110.34 ? 147 LEU B CG     1 
ATOM   4411 C CD1    . LEU B 1 147 ? 25.365  42.927 65.477 1.00 103.58 ? 147 LEU B CD1    1 
ATOM   4412 C CD2    . LEU B 1 147 ? 27.730  43.257 66.214 1.00 118.28 ? 147 LEU B CD2    1 
ATOM   4413 H H      . LEU B 1 147 ? 28.643  41.870 62.452 1.00 112.97 ? 147 LEU B H      1 
ATOM   4414 H HA     . LEU B 1 147 ? 29.113  41.339 65.060 1.00 126.73 ? 147 LEU B HA     1 
ATOM   4415 H HB2    . LEU B 1 147 ? 26.698  41.431 63.624 1.00 115.97 ? 147 LEU B HB2    1 
ATOM   4416 H HB3    . LEU B 1 147 ? 26.760  40.844 65.088 1.00 115.97 ? 147 LEU B HB3    1 
ATOM   4417 H HG     . LEU B 1 147 ? 26.949  43.539 64.351 1.00 106.01 ? 147 LEU B HG     1 
ATOM   4418 H HD11   . LEU B 1 147 ? 25.171  43.807 65.835 1.00 101.57 ? 147 LEU B HD11   1 
ATOM   4419 H HD12   . LEU B 1 147 ? 24.804  42.752 64.706 1.00 101.57 ? 147 LEU B HD12   1 
ATOM   4420 H HD13   . LEU B 1 147 ? 25.214  42.252 66.157 1.00 101.57 ? 147 LEU B HD13   1 
ATOM   4421 H HD21   . LEU B 1 147 ? 27.481  44.139 66.533 1.00 112.42 ? 147 LEU B HD21   1 
ATOM   4422 H HD22   . LEU B 1 147 ? 27.621  42.605 66.923 1.00 112.42 ? 147 LEU B HD22   1 
ATOM   4423 H HD23   . LEU B 1 147 ? 28.651  43.263 65.908 1.00 112.42 ? 147 LEU B HD23   1 
ATOM   4424 N N      . THR B 1 148 ? 28.988  38.886 65.154 1.00 123.66 ? 148 THR B N      1 
ATOM   4425 C CA     . THR B 1 148 ? 29.051  37.430 65.131 1.00 116.92 ? 148 THR B CA     1 
ATOM   4426 C C      . THR B 1 148 ? 28.527  36.855 66.442 1.00 118.88 ? 148 THR B C      1 
ATOM   4427 O O      . THR B 1 148 ? 28.517  37.534 67.470 1.00 120.26 ? 148 THR B O      1 
ATOM   4428 C CB     . THR B 1 148 ? 30.488  36.923 64.898 1.00 122.62 ? 148 THR B CB     1 
ATOM   4429 O OG1    . THR B 1 148 ? 31.343  37.391 65.949 1.00 127.56 ? 148 THR B OG1    1 
ATOM   4430 C CG2    . THR B 1 148 ? 31.022  37.405 63.557 1.00 121.50 ? 148 THR B CG2    1 
ATOM   4431 H H      . THR B 1 148 ? 29.141  39.229 65.927 1.00 164.24 ? 148 THR B H      1 
ATOM   4432 H HA     . THR B 1 148 ? 28.493  37.099 64.410 1.00 177.84 ? 148 THR B HA     1 
ATOM   4433 H HB     . THR B 1 148 ? 30.488  35.953 64.894 1.00 192.37 ? 148 THR B HB     1 
ATOM   4434 H HG1    . THR B 1 148 ? 32.127  37.116 65.825 1.00 200.85 ? 148 THR B HG1    1 
ATOM   4435 H HG21   . THR B 1 148 ? 31.926  37.079 63.424 1.00 184.58 ? 148 THR B HG21   1 
ATOM   4436 H HG22   . THR B 1 148 ? 30.459  37.076 62.839 1.00 184.58 ? 148 THR B HG22   1 
ATOM   4437 H HG23   . THR B 1 148 ? 31.030  38.375 63.533 1.00 184.58 ? 148 THR B HG23   1 
ATOM   4438 O OP3    . U   C 2 1   ? 19.978  35.320 50.051 1.00 66.61  ? 1   U   C OP3    1 
ATOM   4439 P P      . U   C 2 1   ? 18.620  35.240 49.464 1.00 65.21  ? 1   U   C P      1 
ATOM   4440 O OP1    . U   C 2 1   ? 18.138  33.846 49.625 1.00 65.20  ? 1   U   C OP1    1 
ATOM   4441 O OP2    . U   C 2 1   ? 17.811  36.348 50.030 1.00 65.07  ? 1   U   C OP2    1 
ATOM   4442 O "O5'"  . U   C 2 1   ? 18.753  35.522 47.903 1.00 64.04  ? 1   U   C "O5'"  1 
ATOM   4443 C "C5'"  . U   C 2 1   ? 19.773  36.375 47.407 1.00 64.66  ? 1   U   C "C5'"  1 
ATOM   4444 C "C4'"  . U   C 2 1   ? 19.844  36.345 45.902 1.00 64.26  ? 1   U   C "C4'"  1 
ATOM   4445 O "O4'"  . U   C 2 1   ? 19.933  34.971 45.436 1.00 64.10  ? 1   U   C "O4'"  1 
ATOM   4446 C "C3'"  . U   C 2 1   ? 18.639  36.900 45.159 1.00 64.03  ? 1   U   C "C3'"  1 
ATOM   4447 O "O3'"  . U   C 2 1   ? 18.616  38.318 45.109 1.00 64.78  ? 1   U   C "O3'"  1 
ATOM   4448 C "C2'"  . U   C 2 1   ? 18.765  36.231 43.797 1.00 63.40  ? 1   U   C "C2'"  1 
ATOM   4449 O "O2'"  . U   C 2 1   ? 19.755  36.862 42.998 1.00 63.33  ? 1   U   C "O2'"  1 
ATOM   4450 C "C1'"  . U   C 2 1   ? 19.272  34.844 44.192 1.00 63.71  ? 1   U   C "C1'"  1 
ATOM   4451 N N1     . U   C 2 1   ? 18.163  33.874 44.330 1.00 64.47  ? 1   U   C N1     1 
ATOM   4452 C C2     . U   C 2 1   ? 17.676  33.291 43.174 1.00 64.18  ? 1   U   C C2     1 
ATOM   4453 O O2     . U   C 2 1   ? 18.122  33.535 42.066 1.00 63.95  ? 1   U   C O2     1 
ATOM   4454 N N3     . U   C 2 1   ? 16.645  32.407 43.365 1.00 64.34  ? 1   U   C N3     1 
ATOM   4455 C C4     . U   C 2 1   ? 16.064  32.057 44.566 1.00 65.06  ? 1   U   C C4     1 
ATOM   4456 O O4     . U   C 2 1   ? 15.141  31.242 44.571 1.00 64.99  ? 1   U   C O4     1 
ATOM   4457 C C5     . U   C 2 1   ? 16.619  32.703 45.716 1.00 65.95  ? 1   U   C C5     1 
ATOM   4458 C C6     . U   C 2 1   ? 17.625  33.570 45.557 1.00 65.69  ? 1   U   C C6     1 
ATOM   4459 H "H5'"  . U   C 2 1   ? 20.627  36.090 47.769 1.00 78.15  ? 1   U   C "H5'"  1 
ATOM   4460 H "H5''" . U   C 2 1   ? 19.594  37.283 47.696 1.00 78.15  ? 1   U   C "H5''" 1 
ATOM   4461 H "H4'"  . U   C 2 1   ? 20.637  36.824 45.616 1.00 81.59  ? 1   U   C "H4'"  1 
ATOM   4462 H "H3'"  . U   C 2 1   ? 17.830  36.587 45.592 1.00 82.05  ? 1   U   C "H3'"  1 
ATOM   4463 H "H2'"  . U   C 2 1   ? 17.910  36.182 43.341 1.00 84.08  ? 1   U   C "H2'"  1 
ATOM   4464 H "HO2'" . U   C 2 1   ? 19.483  37.625 42.777 1.00 83.95  ? 1   U   C "HO2'" 1 
ATOM   4465 H "H1'"  . U   C 2 1   ? 19.899  34.526 43.524 1.00 87.20  ? 1   U   C "H1'"  1 
ATOM   4466 H H3     . U   C 2 1   ? 16.327  32.030 42.661 1.00 95.31  ? 1   U   C H3     1 
ATOM   4467 H H5     . U   C 2 1   ? 16.284  32.522 46.564 1.00 93.93  ? 1   U   C H5     1 
ATOM   4468 H H6     . U   C 2 1   ? 17.977  33.985 46.312 1.00 92.81  ? 1   U   C H6     1 
ATOM   4469 P P      . C   C 2 2   ? 17.215  39.109 45.121 1.00 56.83  ? 2   C   C P      1 
ATOM   4470 O OP1    . C   C 2 2   ? 17.508  40.559 45.236 1.00 58.14  ? 2   C   C OP1    1 
ATOM   4471 O OP2    . C   C 2 2   ? 16.312  38.477 46.114 1.00 57.09  ? 2   C   C OP2    1 
ATOM   4472 O "O5'"  . C   C 2 2   ? 16.620  38.854 43.667 1.00 56.34  ? 2   C   C "O5'"  1 
ATOM   4473 C "C5'"  . C   C 2 2   ? 17.283  39.357 42.516 1.00 55.93  ? 2   C   C "C5'"  1 
ATOM   4474 C "C4'"  . C   C 2 2   ? 16.644  38.865 41.242 1.00 55.44  ? 2   C   C "C4'"  1 
ATOM   4475 O "O4'"  . C   C 2 2   ? 16.771  37.422 41.135 1.00 53.31  ? 2   C   C "O4'"  1 
ATOM   4476 C "C3'"  . C   C 2 2   ? 15.151  39.103 41.111 1.00 56.87  ? 2   C   C "C3'"  1 
ATOM   4477 O "O3'"  . C   C 2 2   ? 14.823  40.434 40.763 1.00 59.64  ? 2   C   C "O3'"  1 
ATOM   4478 C "C2'"  . C   C 2 2   ? 14.752  38.072 40.066 1.00 55.63  ? 2   C   C "C2'"  1 
ATOM   4479 O "O2'"  . C   C 2 2   ? 15.103  38.500 38.758 1.00 56.14  ? 2   C   C "O2'"  1 
ATOM   4480 C "C1'"  . C   C 2 2   ? 15.646  36.894 40.458 1.00 53.13  ? 2   C   C "C1'"  1 
ATOM   4481 N N1     . C   C 2 2   ? 14.940  35.951 41.354 1.00 52.06  ? 2   C   C N1     1 
ATOM   4482 C C2     . C   C 2 2   ? 14.060  35.036 40.773 1.00 52.19  ? 2   C   C C2     1 
ATOM   4483 O O2     . C   C 2 2   ? 13.916  35.041 39.541 1.00 52.45  ? 2   C   C O2     1 
ATOM   4484 N N3     . C   C 2 2   ? 13.390  34.163 41.558 1.00 52.39  ? 2   C   C N3     1 
ATOM   4485 C C4     . C   C 2 2   ? 13.567  34.185 42.879 1.00 52.52  ? 2   C   C C4     1 
ATOM   4486 N N4     . C   C 2 2   ? 12.881  33.302 43.609 1.00 53.10  ? 2   C   C N4     1 
ATOM   4487 C C5     . C   C 2 2   ? 14.454  35.112 43.502 1.00 52.45  ? 2   C   C C5     1 
ATOM   4488 C C6     . C   C 2 2   ? 15.112  35.970 42.711 1.00 52.18  ? 2   C   C C6     1 
ATOM   4489 H "H5'"  . C   C 2 2   ? 18.210  39.072 42.536 1.00 71.82  ? 2   C   C "H5'"  1 
ATOM   4490 H "H5''" . C   C 2 2   ? 17.250  40.326 42.532 1.00 71.82  ? 2   C   C "H5''" 1 
ATOM   4491 H "H4'"  . C   C 2 2   ? 17.094  39.275 40.488 1.00 71.08  ? 2   C   C "H4'"  1 
ATOM   4492 H "H3'"  . C   C 2 2   ? 14.721  38.882 41.952 1.00 71.81  ? 2   C   C "H3'"  1 
ATOM   4493 H "H2'"  . C   C 2 2   ? 13.812  37.842 40.132 1.00 70.81  ? 2   C   C "H2'"  1 
ATOM   4494 H "HO2'" . C   C 2 2   ? 14.612  39.147 38.541 1.00 72.92  ? 2   C   C "HO2'" 1 
ATOM   4495 H "H1'"  . C   C 2 2   ? 15.937  36.428 39.659 1.00 67.98  ? 2   C   C "H1'"  1 
ATOM   4496 H H41    . C   C 2 2   ? 12.972  33.288 44.464 1.00 60.89  ? 2   C   C H41    1 
ATOM   4497 H H42    . C   C 2 2   ? 12.349  32.747 43.225 1.00 60.89  ? 2   C   C H42    1 
ATOM   4498 H H5     . C   C 2 2   ? 14.572  35.119 44.425 1.00 60.15  ? 2   C   C H5     1 
ATOM   4499 H H6     . C   C 2 2   ? 15.697  36.586 43.089 1.00 61.73  ? 2   C   C H6     1 
ATOM   4500 P P      . G   C 2 3   ? 13.636  41.190 41.536 1.00 63.30  ? 3   G   C P      1 
ATOM   4501 O OP1    . G   C 2 3   ? 13.758  42.642 41.250 1.00 65.48  ? 3   G   C OP1    1 
ATOM   4502 O OP2    . G   C 2 3   ? 13.624  40.718 42.944 1.00 62.32  ? 3   G   C OP2    1 
ATOM   4503 O "O5'"  . G   C 2 3   ? 12.316  40.650 40.828 1.00 64.82  ? 3   G   C "O5'"  1 
ATOM   4504 C "C5'"  . G   C 2 3   ? 12.125  40.816 39.431 1.00 65.68  ? 3   G   C "C5'"  1 
ATOM   4505 C "C4'"  . G   C 2 3   ? 10.999  39.958 38.912 1.00 65.80  ? 3   G   C "C4'"  1 
ATOM   4506 O "O4'"  . G   C 2 3   ? 11.325  38.554 39.079 1.00 63.12  ? 3   G   C "O4'"  1 
ATOM   4507 C "C3'"  . G   C 2 3   ? 9.660   40.107 39.614 1.00 67.71  ? 3   G   C "C3'"  1 
ATOM   4508 O "O3'"  . G   C 2 3   ? 8.937   41.249 39.189 1.00 71.83  ? 3   G   C "O3'"  1 
ATOM   4509 C "C2'"  . G   C 2 3   ? 8.969   38.791 39.287 1.00 66.60  ? 3   G   C "C2'"  1 
ATOM   4510 O "O2'"  . G   C 2 3   ? 8.420   38.812 37.977 1.00 68.00  ? 3   G   C "O2'"  1 
ATOM   4511 C "C1'"  . G   C 2 3   ? 10.146  37.813 39.316 1.00 63.45  ? 3   G   C "C1'"  1 
ATOM   4512 N N9     . G   C 2 3   ? 10.265  37.128 40.617 1.00 62.03  ? 3   G   C N9     1 
ATOM   4513 C C8     . G   C 2 3   ? 11.118  37.432 41.649 1.00 60.77  ? 3   G   C C8     1 
ATOM   4514 N N7     . G   C 2 3   ? 10.982  36.638 42.677 1.00 60.01  ? 3   G   C N7     1 
ATOM   4515 C C5     . G   C 2 3   ? 9.978   35.756 42.302 1.00 60.61  ? 3   G   C C5     1 
ATOM   4516 C C6     . G   C 2 3   ? 9.394   34.668 43.003 1.00 60.34  ? 3   G   C C6     1 
ATOM   4517 O O6     . G   C 2 3   ? 9.657   34.250 44.138 1.00 59.38  ? 3   G   C O6     1 
ATOM   4518 N N1     . G   C 2 3   ? 8.407   34.044 42.247 1.00 61.57  ? 3   G   C N1     1 
ATOM   4519 C C2     . G   C 2 3   ? 8.030   34.417 40.980 1.00 63.11  ? 3   G   C C2     1 
ATOM   4520 N N2     . G   C 2 3   ? 7.057   33.692 40.410 1.00 64.32  ? 3   G   C N2     1 
ATOM   4521 N N3     . G   C 2 3   ? 8.565   35.428 40.315 1.00 63.47  ? 3   G   C N3     1 
ATOM   4522 C C4     . G   C 2 3   ? 9.525   36.048 41.032 1.00 62.05  ? 3   G   C C4     1 
ATOM   4523 H "H5'"  . G   C 2 3   ? 12.944  40.575 38.970 1.00 81.25  ? 3   G   C "H5'"  1 
ATOM   4524 H "H5''" . G   C 2 3   ? 11.923  41.747 39.249 1.00 81.25  ? 3   G   C "H5''" 1 
ATOM   4525 H "H4'"  . G   C 2 3   ? 10.878  40.140 37.967 1.00 80.79  ? 3   G   C "H4'"  1 
ATOM   4526 H "H3'"  . G   C 2 3   ? 9.806   40.161 40.572 1.00 79.21  ? 3   G   C "H3'"  1 
ATOM   4527 H "H2'"  . G   C 2 3   ? 8.302   38.563 39.953 1.00 77.71  ? 3   G   C "H2'"  1 
ATOM   4528 H "HO2'" . G   C 2 3   ? 8.059   38.070 37.820 1.00 80.01  ? 3   G   C "HO2'" 1 
ATOM   4529 H "H1'"  . G   C 2 3   ? 10.034  37.154 38.614 1.00 78.09  ? 3   G   C "H1'"  1 
ATOM   4530 H H8     . G   C 2 3   ? 11.730  38.132 41.620 1.00 73.13  ? 3   G   C H8     1 
ATOM   4531 H H1     . G   C 2 3   ? 8.002   33.372 42.600 1.00 77.83  ? 3   G   C H1     1 
ATOM   4532 H H21    . G   C 2 3   ? 6.705   33.034 40.837 1.00 83.56  ? 3   G   C H21    1 
ATOM   4533 H H22    . G   C 2 3   ? 6.785   33.885 39.617 1.00 83.56  ? 3   G   C H22    1 
ATOM   4534 P P      . A   C 2 4   ? 7.877   41.946 40.174 1.00 76.81  ? 4   A   C P      1 
ATOM   4535 O OP1    . A   C 2 4   ? 7.384   43.179 39.509 1.00 79.37  ? 4   A   C OP1    1 
ATOM   4536 O OP2    . A   C 2 4   ? 8.492   42.037 41.522 1.00 75.63  ? 4   A   C OP2    1 
ATOM   4537 O "O5'"  . A   C 2 4   ? 6.670   40.908 40.239 1.00 78.93  ? 4   A   C "O5'"  1 
ATOM   4538 C "C5'"  . A   C 2 4   ? 5.891   40.634 39.084 1.00 82.07  ? 4   A   C "C5'"  1 
ATOM   4539 C "C4'"  . A   C 2 4   ? 4.889   39.532 39.325 1.00 83.87  ? 4   A   C "C4'"  1 
ATOM   4540 O "O4'"  . A   C 2 4   ? 5.575   38.282 39.605 1.00 80.37  ? 4   A   C "O4'"  1 
ATOM   4541 C "C3'"  . A   C 2 4   ? 3.959   39.705 40.514 1.00 86.36  ? 4   A   C "C3'"  1 
ATOM   4542 O "O3'"  . A   C 2 4   ? 2.888   40.599 40.270 1.00 90.31  ? 4   A   C "O3'"  1 
ATOM   4543 C "C2'"  . A   C 2 4   ? 3.513   38.275 40.784 1.00 86.06  ? 4   A   C "C2'"  1 
ATOM   4544 O "O2'"  . A   C 2 4   ? 2.505   37.868 39.867 1.00 89.19  ? 4   A   C "O2'"  1 
ATOM   4545 C "C1'"  . A   C 2 4   ? 4.799   37.500 40.493 1.00 80.83  ? 4   A   C "C1'"  1 
ATOM   4546 N N9     . A   C 2 4   ? 5.572   37.249 41.725 1.00 76.27  ? 4   A   C N9     1 
ATOM   4547 C C8     . A   C 2 4   ? 6.657   37.933 42.218 1.00 73.57  ? 4   A   C C8     1 
ATOM   4548 N N7     . A   C 2 4   ? 7.110   37.454 43.353 1.00 70.57  ? 4   A   C N7     1 
ATOM   4549 C C5     . A   C 2 4   ? 6.264   36.388 43.628 1.00 70.45  ? 4   A   C C5     1 
ATOM   4550 C C6     . A   C 2 4   ? 6.210   35.465 44.688 1.00 68.10  ? 4   A   C C6     1 
ATOM   4551 N N6     . A   C 2 4   ? 7.059   35.466 45.718 1.00 65.96  ? 4   A   C N6     1 
ATOM   4552 N N1     . A   C 2 4   ? 5.239   34.526 44.657 1.00 68.72  ? 4   A   C N1     1 
ATOM   4553 C C2     . A   C 2 4   ? 4.385   34.520 43.626 1.00 71.12  ? 4   A   C C2     1 
ATOM   4554 N N3     . A   C 2 4   ? 4.335   35.331 42.574 1.00 73.70  ? 4   A   C N3     1 
ATOM   4555 C C4     . A   C 2 4   ? 5.312   36.253 42.635 1.00 73.59  ? 4   A   C C4     1 
ATOM   4556 H "H5'"  . A   C 2 4   ? 6.482   40.371 38.361 1.00 101.48 ? 4   A   C "H5'"  1 
ATOM   4557 H "H5''" . A   C 2 4   ? 5.417   41.440 38.826 1.00 101.48 ? 4   A   C "H5''" 1 
ATOM   4558 H "H4'"  . A   C 2 4   ? 4.353   39.420 38.524 1.00 105.20 ? 4   A   C "H4'"  1 
ATOM   4559 H "H3'"  . A   C 2 4   ? 4.472   40.025 41.273 1.00 104.99 ? 4   A   C "H3'"  1 
ATOM   4560 H "H2'"  . A   C 2 4   ? 3.229   38.159 41.704 1.00 106.43 ? 4   A   C "H2'"  1 
ATOM   4561 H "HO2'" . A   C 2 4   ? 2.823   37.285 39.352 1.00 111.78 ? 4   A   C "HO2'" 1 
ATOM   4562 H "H1'"  . A   C 2 4   ? 4.579   36.655 40.071 1.00 102.68 ? 4   A   C "H1'"  1 
ATOM   4563 H H8     . A   C 2 4   ? 7.037   38.664 41.786 1.00 88.85  ? 4   A   C H8     1 
ATOM   4564 H H61    . A   C 2 4   ? 6.980   34.877 46.341 1.00 74.67  ? 4   A   C H61    1 
ATOM   4565 H H62    . A   C 2 4   ? 7.685   36.054 45.760 1.00 74.67  ? 4   A   C H62    1 
ATOM   4566 H H2     . A   C 2 4   ? 3.736   33.854 43.650 1.00 82.96  ? 4   A   C H2     1 
ATOM   4567 P P      . A   C 2 5   ? 2.114   41.274 41.506 1.00 92.46  ? 5   A   C P      1 
ATOM   4568 O OP1    . A   C 2 5   ? 1.117   42.226 40.954 1.00 97.04  ? 5   A   C OP1    1 
ATOM   4569 O OP2    . A   C 2 5   ? 3.125   41.753 42.484 1.00 89.47  ? 5   A   C OP2    1 
ATOM   4570 O "O5'"  . A   C 2 5   ? 1.317   40.064 42.169 1.00 92.14  ? 5   A   C "O5'"  1 
ATOM   4571 C "C5'"  . A   C 2 5   ? 0.254   39.431 41.473 1.00 94.07  ? 5   A   C "C5'"  1 
ATOM   4572 C "C4'"  . A   C 2 5   ? -0.349  38.304 42.274 1.00 93.69  ? 5   A   C "C4'"  1 
ATOM   4573 O "O4'"  . A   C 2 5   ? 0.622   37.237 42.449 1.00 89.39  ? 5   A   C "O4'"  1 
ATOM   4574 C "C3'"  . A   C 2 5   ? -0.775  38.639 43.693 1.00 95.00  ? 5   A   C "C3'"  1 
ATOM   4575 O "O3'"  . A   C 2 5   ? -2.010  39.330 43.764 1.00 100.56 ? 5   A   C "O3'"  1 
ATOM   4576 C "C2'"  . A   C 2 5   ? -0.794  37.269 44.355 1.00 92.07  ? 5   A   C "C2'"  1 
ATOM   4577 O "O2'"  . A   C 2 5   ? -1.960  36.540 44.000 1.00 94.60  ? 5   A   C "O2'"  1 
ATOM   4578 C "C1'"  . A   C 2 5   ? 0.418   36.607 43.700 1.00 87.89  ? 5   A   C "C1'"  1 
ATOM   4579 N N9     . A   C 2 5   ? 1.635   36.764 44.519 1.00 84.00  ? 5   A   C N9     1 
ATOM   4580 C C8     . A   C 2 5   ? 2.649   37.677 44.368 1.00 83.12  ? 5   A   C C8     1 
ATOM   4581 N N7     . A   C 2 5   ? 3.597   37.568 45.267 1.00 79.68  ? 5   A   C N7     1 
ATOM   4582 C C5     . A   C 2 5   ? 3.177   36.515 46.068 1.00 77.85  ? 5   A   C C5     1 
ATOM   4583 C C6     . A   C 2 5   ? 3.743   35.904 47.199 1.00 74.33  ? 5   A   C C6     1 
ATOM   4584 N N6     . A   C 2 5   ? 4.902   36.283 47.739 1.00 71.94  ? 5   A   C N6     1 
ATOM   4585 N N1     . A   C 2 5   ? 3.071   34.877 47.763 1.00 74.03  ? 5   A   C N1     1 
ATOM   4586 C C2     . A   C 2 5   ? 1.908   34.497 47.219 1.00 76.44  ? 5   A   C C2     1 
ATOM   4587 N N3     . A   C 2 5   ? 1.275   34.993 46.157 1.00 79.69  ? 5   A   C N3     1 
ATOM   4588 C C4     . A   C 2 5   ? 1.970   36.012 45.621 1.00 80.48  ? 5   A   C C4     1 
ATOM   4589 H "H5'"  . A   C 2 5   ? 0.591   39.078 40.635 1.00 108.03 ? 5   A   C "H5'"  1 
ATOM   4590 H "H5''" . A   C 2 5   ? -0.435  40.088 41.285 1.00 108.03 ? 5   A   C "H5''" 1 
ATOM   4591 H "H4'"  . A   C 2 5   ? -1.115  37.954 41.792 1.00 108.64 ? 5   A   C "H4'"  1 
ATOM   4592 H "H3'"  . A   C 2 5   ? -0.086  39.181 44.109 1.00 108.26 ? 5   A   C "H3'"  1 
ATOM   4593 H "H2'"  . A   C 2 5   ? -0.687  37.335 45.317 1.00 107.32 ? 5   A   C "H2'"  1 
ATOM   4594 H "HO2'" . A   C 2 5   ? -2.628  36.902 44.358 1.00 110.82 ? 5   A   C "HO2'" 1 
ATOM   4595 H "H1'"  . A   C 2 5   ? 0.238   35.664 43.562 1.00 106.04 ? 5   A   C "H1'"  1 
ATOM   4596 H H8     . A   C 2 5   ? 2.664   38.312 43.689 1.00 98.64  ? 5   A   C H8     1 
ATOM   4597 H H61    . A   C 2 5   ? 5.207   35.876 48.433 1.00 83.32  ? 5   A   C H61    1 
ATOM   4598 H H62    . A   C 2 5   ? 5.345   36.935 47.394 1.00 83.32  ? 5   A   C H62    1 
ATOM   4599 H H2     . A   C 2 5   ? 1.482   33.787 47.642 1.00 91.30  ? 5   A   C H2     1 
ATOM   4600 P P      . G   C 2 6   ? -2.262  40.403 44.934 1.00 88.24  ? 6   G   C P      1 
ATOM   4601 O OP1    . G   C 2 6   ? -3.519  41.129 44.619 1.00 92.48  ? 6   G   C OP1    1 
ATOM   4602 O OP2    . G   C 2 6   ? -1.010  41.173 45.144 1.00 85.75  ? 6   G   C OP2    1 
ATOM   4603 O "O5'"  . G   C 2 6   ? -2.511  39.508 46.229 1.00 84.96  ? 6   G   C "O5'"  1 
ATOM   4604 C "C5'"  . G   C 2 6   ? -3.633  38.642 46.306 1.00 86.45  ? 6   G   C "C5'"  1 
ATOM   4605 C "C4'"  . G   C 2 6   ? -3.468  37.593 47.378 1.00 81.73  ? 6   G   C "C4'"  1 
ATOM   4606 O "O4'"  . G   C 2 6   ? -2.211  36.892 47.205 1.00 77.66  ? 6   G   C "O4'"  1 
ATOM   4607 C "C3'"  . G   C 2 6   ? -3.411  38.095 48.811 1.00 78.47  ? 6   G   C "C3'"  1 
ATOM   4608 O "O3'"  . G   C 2 6   ? -4.693  38.385 49.339 1.00 80.40  ? 6   G   C "O3'"  1 
ATOM   4609 C "C2'"  . G   C 2 6   ? -2.703  36.956 49.534 1.00 74.20  ? 6   G   C "C2'"  1 
ATOM   4610 O "O2'"  . G   C 2 6   ? -3.606  35.907 49.853 1.00 75.59  ? 6   G   C "O2'"  1 
ATOM   4611 C "C1'"  . G   C 2 6   ? -1.728  36.463 48.461 1.00 72.83  ? 6   G   C "C1'"  1 
ATOM   4612 N N9     . G   C 2 6   ? -0.362  36.980 48.661 1.00 68.35  ? 6   G   C N9     1 
ATOM   4613 C C8     . G   C 2 6   ? 0.325   37.894 47.899 1.00 68.84  ? 6   G   C C8     1 
ATOM   4614 N N7     . G   C 2 6   ? 1.528   38.132 48.350 1.00 65.79  ? 6   G   C N7     1 
ATOM   4615 C C5     . G   C 2 6   ? 1.641   37.325 49.475 1.00 62.37  ? 6   G   C C5     1 
ATOM   4616 C C6     . G   C 2 6   ? 2.717   37.149 50.384 1.00 58.88  ? 6   G   C C6     1 
ATOM   4617 O O6     . G   C 2 6   ? 3.827   37.694 50.376 1.00 57.85  ? 6   G   C O6     1 
ATOM   4618 N N1     . G   C 2 6   ? 2.400   36.231 51.381 1.00 56.95  ? 6   G   C N1     1 
ATOM   4619 C C2     . G   C 2 6   ? 1.203   35.565 51.492 1.00 58.02  ? 6   G   C C2     1 
ATOM   4620 N N2     . G   C 2 6   ? 1.083   34.718 52.525 1.00 56.11  ? 6   G   C N2     1 
ATOM   4621 N N3     . G   C 2 6   ? 0.194   35.720 50.653 1.00 61.27  ? 6   G   C N3     1 
ATOM   4622 C C4     . G   C 2 6   ? 0.483   36.607 49.677 1.00 63.61  ? 6   G   C C4     1 
ATOM   4623 H "H5'"  . G   C 2 6   ? -3.750  38.202 45.449 1.00 107.65 ? 6   G   C "H5'"  1 
ATOM   4624 H "H5''" . G   C 2 6   ? -4.424  39.169 46.500 1.00 107.65 ? 6   G   C "H5''" 1 
ATOM   4625 H "H4'"  . G   C 2 6   ? -4.194  36.954 47.301 1.00 102.90 ? 6   G   C "H4'"  1 
ATOM   4626 H "H3'"  . G   C 2 6   ? -2.860  38.892 48.850 1.00 99.90  ? 6   G   C "H3'"  1 
ATOM   4627 H "H2'"  . G   C 2 6   ? -2.232  37.273 50.320 1.00 97.64  ? 6   G   C "H2'"  1 
ATOM   4628 H "HO2'" . G   C 2 6   ? -3.187  35.296 50.248 1.00 103.17 ? 6   G   C "HO2'" 1 
ATOM   4629 H "H1'"  . G   C 2 6   ? -1.704  35.493 48.476 1.00 92.07  ? 6   G   C "H1'"  1 
ATOM   4630 H H8     . G   C 2 6   ? -0.030  38.301 47.142 1.00 78.79  ? 6   G   C H8     1 
ATOM   4631 H H1     . G   C 2 6   ? 3.000   36.068 51.975 1.00 69.12  ? 6   G   C H1     1 
ATOM   4632 H H21    . G   C 2 6   ? 1.737   34.613 53.074 1.00 71.53  ? 6   G   C H21    1 
ATOM   4633 H H22    . G   C 2 6   ? 0.353   34.278 52.638 1.00 71.53  ? 6   G   C H22    1 
ATOM   4634 P P      . U   C 2 7   ? -4.876  39.534 50.447 1.00 77.44  ? 7   U   C P      1 
ATOM   4635 O OP1    . U   C 2 7   ? -6.336  39.767 50.596 1.00 81.28  ? 7   U   C OP1    1 
ATOM   4636 O OP2    . U   C 2 7   ? -3.975  40.666 50.111 1.00 76.57  ? 7   U   C OP2    1 
ATOM   4637 O "O5'"  . U   C 2 7   ? -4.346  38.864 51.791 1.00 72.01  ? 7   U   C "O5'"  1 
ATOM   4638 C "C5'"  . U   C 2 7   ? -4.996  37.728 52.338 1.00 71.23  ? 7   U   C "C5'"  1 
ATOM   4639 C "C4'"  . U   C 2 7   ? -4.191  37.101 53.447 1.00 66.04  ? 7   U   C "C4'"  1 
ATOM   4640 O "O4'"  . U   C 2 7   ? -2.907  36.652 52.939 1.00 63.87  ? 7   U   C "O4'"  1 
ATOM   4641 C "C3'"  . U   C 2 7   ? -3.823  38.009 54.609 1.00 63.04  ? 7   U   C "C3'"  1 
ATOM   4642 O "O3'"  . U   C 2 7   ? -4.887  38.195 55.525 1.00 62.50  ? 7   U   C "O3'"  1 
ATOM   4643 C "C2'"  . U   C 2 7   ? -2.615  37.299 55.207 1.00 60.07  ? 7   U   C "C2'"  1 
ATOM   4644 O "O2'"  . U   C 2 7   ? -3.011  36.196 56.012 1.00 59.73  ? 7   U   C "O2'"  1 
ATOM   4645 C "C1'"  . U   C 2 7   ? -1.926  36.765 53.951 1.00 60.23  ? 7   U   C "C1'"  1 
ATOM   4646 N N1     . U   C 2 7   ? -0.849  37.663 53.478 1.00 58.98  ? 7   U   C N1     1 
ATOM   4647 C C2     . U   C 2 7   ? 0.392   37.529 54.070 1.00 55.49  ? 7   U   C C2     1 
ATOM   4648 O O2     . U   C 2 7   ? 0.621   36.716 54.948 1.00 53.34  ? 7   U   C O2     1 
ATOM   4649 N N3     . U   C 2 7   ? 1.355   38.382 53.594 1.00 54.94  ? 7   U   C N3     1 
ATOM   4650 C C4     . U   C 2 7   ? 1.204   39.336 52.609 1.00 57.01  ? 7   U   C C4     1 
ATOM   4651 O O4     . U   C 2 7   ? 2.171   40.030 52.291 1.00 56.29  ? 7   U   C O4     1 
ATOM   4652 C C5     . U   C 2 7   ? -0.109  39.416 52.045 1.00 60.44  ? 7   U   C C5     1 
ATOM   4653 C C6     . U   C 2 7   ? -1.066  38.595 52.491 1.00 61.42  ? 7   U   C C6     1 
ATOM   4654 H "H5'"  . U   C 2 7   ? -5.130  37.072 51.635 1.00 92.84  ? 7   U   C "H5'"  1 
ATOM   4655 H "H5''" . U   C 2 7   ? -5.860  37.997 52.688 1.00 92.84  ? 7   U   C "H5''" 1 
ATOM   4656 H "H4'"  . U   C 2 7   ? -4.676  36.335 53.791 1.00 88.10  ? 7   U   C "H4'"  1 
ATOM   4657 H "H3'"  . U   C 2 7   ? -3.546  38.872 54.264 1.00 84.18  ? 7   U   C "H3'"  1 
ATOM   4658 H "H2'"  . U   C 2 7   ? -2.043  37.914 55.693 1.00 84.23  ? 7   U   C "H2'"  1 
ATOM   4659 H "HO2'" . U   C 2 7   ? -3.390  36.485 56.704 1.00 88.40  ? 7   U   C "HO2'" 1 
ATOM   4660 H "H1'"  . U   C 2 7   ? -1.555  35.889 54.136 1.00 81.85  ? 7   U   C "H1'"  1 
ATOM   4661 H H3     . U   C 2 7   ? 2.135   38.316 53.949 1.00 68.10  ? 7   U   C H3     1 
ATOM   4662 H H5     . U   C 2 7   ? -0.295  40.033 51.374 1.00 71.84  ? 7   U   C H5     1 
ATOM   4663 H H6     . U   C 2 7   ? -1.914  38.655 52.116 1.00 76.40  ? 7   U   C H6     1 
ATOM   4664 P P      . A   C 2 8   ? -5.070  39.602 56.277 1.00 68.64  ? 8   A   C P      1 
ATOM   4665 O OP1    . A   C 2 8   ? -6.362  39.550 57.007 1.00 70.17  ? 8   A   C OP1    1 
ATOM   4666 O OP2    . A   C 2 8   ? -4.822  40.696 55.303 1.00 70.58  ? 8   A   C OP2    1 
ATOM   4667 O "O5'"  . A   C 2 8   ? -3.894  39.618 57.353 1.00 64.61  ? 8   A   C "O5'"  1 
ATOM   4668 C "C5'"  . A   C 2 8   ? -3.892  38.696 58.433 1.00 62.97  ? 8   A   C "C5'"  1 
ATOM   4669 C "C4'"  . A   C 2 8   ? -2.600  38.736 59.210 1.00 60.29  ? 8   A   C "C4'"  1 
ATOM   4670 O "O4'"  . A   C 2 8   ? -1.488  38.365 58.356 1.00 59.81  ? 8   A   C "O4'"  1 
ATOM   4671 C "C3'"  . A   C 2 8   ? -2.192  40.088 59.772 1.00 60.05  ? 8   A   C "C3'"  1 
ATOM   4672 O "O3'"  . A   C 2 8   ? -2.892  40.420 60.961 1.00 59.84  ? 8   A   C "O3'"  1 
ATOM   4673 C "C2'"  . A   C 2 8   ? -0.687  39.925 59.966 1.00 58.28  ? 8   A   C "C2'"  1 
ATOM   4674 O "O2'"  . A   C 2 8   ? -0.390  39.244 61.177 1.00 56.91  ? 8   A   C "O2'"  1 
ATOM   4675 C "C1'"  . A   C 2 8   ? -0.313  39.021 58.787 0.61 58.74  ? 8   A   C "C1'"  1 
ATOM   4676 N N9     . A   C 2 8   ? 0.271   39.771 57.658 1.00 60.07  ? 8   A   C N9     1 
ATOM   4677 C C8     . A   C 2 8   ? -0.360  40.292 56.556 1.00 62.14  ? 8   A   C C8     1 
ATOM   4678 N N7     . A   C 2 8   ? 0.449   40.909 55.726 1.00 61.79  ? 8   A   C N7     1 
ATOM   4679 C C5     . A   C 2 8   ? 1.697   40.787 56.322 1.00 59.83  ? 8   A   C C5     1 
ATOM   4680 C C6     . A   C 2 8   ? 2.978   41.227 55.944 1.00 58.91  ? 8   A   C C6     1 
ATOM   4681 N N6     . A   C 2 8   ? 3.231   41.911 54.826 1.00 59.94  ? 8   A   C N6     1 
ATOM   4682 N N1     . A   C 2 8   ? 4.012   40.939 56.764 1.00 56.90  ? 8   A   C N1     1 
ATOM   4683 C C2     . A   C 2 8   ? 3.765   40.253 57.885 1.00 55.92  ? 8   A   C C2     1 
ATOM   4684 N N3     . A   C 2 8   ? 2.609   39.784 58.348 1.00 56.51  ? 8   A   C N3     1 
ATOM   4685 C C4     . A   C 2 8   ? 1.601   40.089 57.511 1.00 58.76  ? 8   A   C C4     1 
ATOM   4686 H "H5'"  . A   C 2 8   ? -4.022  37.801 58.083 1.00 82.48  ? 8   A   C "H5'"  1 
ATOM   4687 H "H5''" . A   C 2 8   ? -4.626  38.909 59.031 1.00 82.48  ? 8   A   C "H5''" 1 
ATOM   4688 H "H4'"  . A   C 2 8   ? -2.657  38.100 59.940 0.00 80.90  ? 8   A   C "H4'"  1 
ATOM   4689 H "H3'"  . A   C 2 8   ? -2.355  40.772 59.104 1.00 81.09  ? 8   A   C "H3'"  1 
ATOM   4690 H "H2'"  . A   C 2 8   ? -0.229  40.779 59.914 0.00 79.73  ? 8   A   C "H2'"  1 
ATOM   4691 H "HO2'" . A   C 2 8   ? -0.594  39.738 61.825 1.00 81.02  ? 8   A   C "HO2'" 1 
ATOM   4692 H "H1'"  . A   C 2 8   ? 0.326   38.357 59.089 1.00 79.31  ? 8   A   C "H1'"  1 
ATOM   4693 H H8     . A   C 2 8   ? -1.275  40.215 56.411 1.00 79.23  ? 8   A   C H8     1 
ATOM   4694 H H61    . A   C 2 8   ? 4.035   42.155 54.644 1.00 69.56  ? 8   A   C H61    1 
ATOM   4695 H H62    . A   C 2 8   ? 2.590   42.107 54.287 1.00 69.56  ? 8   A   C H62    1 
ATOM   4696 H H2     . A   C 2 8   ? 4.507   40.078 58.417 1.00 71.32  ? 8   A   C H2     1 
ATOM   4697 P P      . U   C 2 9   ? -2.931  41.939 61.484 1.00 62.37  ? 9   U   C P      1 
ATOM   4698 O OP1    . U   C 2 9   ? -2.961  41.909 62.969 1.00 61.32  ? 9   U   C OP1    1 
ATOM   4699 O OP2    . U   C 2 9   ? -3.993  42.672 60.749 1.00 65.03  ? 9   U   C OP2    1 
ATOM   4700 O "O5'"  . U   C 2 9   ? -1.528  42.527 61.021 1.00 60.67  ? 9   U   C "O5'"  1 
ATOM   4701 C "C5'"  . U   C 2 9   ? -0.910  43.594 61.720 1.00 59.46  ? 9   U   C "C5'"  1 
ATOM   4702 C "C4'"  . U   C 2 9   ? 0.541   43.292 61.987 1.00 57.60  ? 9   U   C "C4'"  1 
ATOM   4703 O "O4'"  . U   C 2 9   ? 1.089   42.506 60.896 1.00 57.47  ? 9   U   C "O4'"  1 
ATOM   4704 C "C3'"  . U   C 2 9   ? 1.461   44.498 62.077 1.00 57.84  ? 9   U   C "C3'"  1 
ATOM   4705 O "O3'"  . U   C 2 9   ? 1.424   45.121 63.347 1.00 58.28  ? 9   U   C "O3'"  1 
ATOM   4706 C "C2'"  . U   C 2 9   ? 2.817   43.907 61.718 1.00 56.24  ? 9   U   C "C2'"  1 
ATOM   4707 O "O2'"  . U   C 2 9   ? 3.388   43.220 62.822 1.00 54.90  ? 9   U   C "O2'"  1 
ATOM   4708 C "C1'"  . U   C 2 9   ? 2.427   42.882 60.655 1.00 56.69  ? 9   U   C "C1'"  1 
ATOM   4709 N N1     . U   C 2 9   ? 2.512   43.431 59.284 1.00 58.32  ? 9   U   C N1     1 
ATOM   4710 C C2     . U   C 2 9   ? 3.761   43.715 58.772 1.00 58.08  ? 9   U   C C2     1 
ATOM   4711 O O2     . U   C 2 9   ? 4.791   43.545 59.401 1.00 56.81  ? 9   U   C O2     1 
ATOM   4712 N N3     . U   C 2 9   ? 3.751   44.215 57.495 1.00 59.63  ? 9   U   C N3     1 
ATOM   4713 C C4     . U   C 2 9   ? 2.649   44.447 56.699 1.00 61.96  ? 9   U   C C4     1 
ATOM   4714 O O4     . U   C 2 9   ? 2.810   44.899 55.565 1.00 64.00  ? 9   U   C O4     1 
ATOM   4715 C C5     . U   C 2 9   ? 1.393   44.122 57.300 1.00 62.31  ? 9   U   C C5     1 
ATOM   4716 C C6     . U   C 2 9   ? 1.373   43.635 58.542 1.00 60.44  ? 9   U   C C6     1 
ATOM   4717 H "H5'"  . U   C 2 9   ? -1.368  43.729 62.564 1.00 75.82  ? 9   U   C "H5'"  1 
ATOM   4718 H "H5''" . U   C 2 9   ? -0.975  44.403 61.189 1.00 75.82  ? 9   U   C "H5''" 1 
ATOM   4719 H "H4'"  . U   C 2 9   ? 0.611   42.781 62.808 1.00 73.54  ? 9   U   C "H4'"  1 
ATOM   4720 H "H3'"  . U   C 2 9   ? 1.206   45.143 61.399 1.00 74.32  ? 9   U   C "H3'"  1 
ATOM   4721 H "H2'"  . U   C 2 9   ? 3.418   44.580 61.361 1.00 70.57  ? 9   U   C "H2'"  1 
ATOM   4722 H "HO2'" . U   C 2 9   ? 3.605   43.780 63.410 1.00 70.52  ? 9   U   C "HO2'" 1 
ATOM   4723 H "H1'"  . U   C 2 9   ? 3.001   42.104 60.729 1.00 69.87  ? 9   U   C "H1'"  1 
ATOM   4724 H H3     . U   C 2 9   ? 4.517   44.403 57.152 1.00 70.52  ? 9   U   C H3     1 
ATOM   4725 H H5     . U   C 2 9   ? 0.600   44.249 56.831 1.00 73.29  ? 9   U   C H5     1 
ATOM   4726 H H6     . U   C 2 9   ? 0.551   43.427 58.925 1.00 72.51  ? 9   U   C H6     1 
ATOM   4727 P P      . U   C 2 10  ? 1.372   46.722 63.461 1.00 53.91  ? 10  U   C P      1 
ATOM   4728 O OP1    . U   C 2 10  ? 0.996   47.065 64.855 1.00 54.23  ? 10  U   C OP1    1 
ATOM   4729 O OP2    . U   C 2 10  ? 0.554   47.248 62.340 1.00 56.03  ? 10  U   C OP2    1 
ATOM   4730 O "O5'"  . U   C 2 10  ? 2.883   47.164 63.226 1.00 52.43  ? 10  U   C "O5'"  1 
ATOM   4731 C "C5'"  . U   C 2 10  ? 3.928   46.634 64.028 1.00 50.62  ? 10  U   C "C5'"  1 
ATOM   4732 C "C4'"  . U   C 2 10  ? 5.276   46.856 63.394 1.00 49.15  ? 10  U   C "C4'"  1 
ATOM   4733 O "O4'"  . U   C 2 10  ? 5.356   46.129 62.139 1.00 49.21  ? 10  U   C "O4'"  1 
ATOM   4734 C "C3'"  . U   C 2 10  ? 5.600   48.291 63.008 1.00 48.55  ? 10  U   C "C3'"  1 
ATOM   4735 O "O3'"  . U   C 2 10  ? 6.041   49.076 64.101 1.00 47.60  ? 10  U   C "O3'"  1 
ATOM   4736 C "C2'"  . U   C 2 10  ? 6.645   48.109 61.918 1.00 47.78  ? 10  U   C "C2'"  1 
ATOM   4737 O "O2'"  . U   C 2 10  ? 7.919   47.810 62.470 0.53 46.25  ? 10  U   C "O2'"  1 
ATOM   4738 C "C1'"  . U   C 2 10  ? 6.122   46.863 61.207 1.00 48.48  ? 10  U   C "C1'"  1 
ATOM   4739 N N1     . U   C 2 10  ? 5.266   47.191 60.045 1.00 49.69  ? 10  U   C N1     1 
ATOM   4740 C C2     . U   C 2 10  ? 5.887   47.650 58.902 1.00 49.70  ? 10  U   C C2     1 
ATOM   4741 O O2     . U   C 2 10  ? 7.093   47.807 58.820 1.00 48.34  ? 10  U   C O2     1 
ATOM   4742 N N3     . U   C 2 10  ? 5.040   47.924 57.860 1.00 51.30  ? 10  U   C N3     1 
ATOM   4743 C C4     . U   C 2 10  ? 3.668   47.784 57.846 1.00 53.19  ? 10  U   C C4     1 
ATOM   4744 O O4     . U   C 2 10  ? 3.046   48.073 56.823 1.00 55.66  ? 10  U   C O4     1 
ATOM   4745 C C5     . U   C 2 10  ? 3.098   47.299 59.067 1.00 52.46  ? 10  U   C C5     1 
ATOM   4746 C C6     . U   C 2 10  ? 3.902   47.025 60.098 1.00 50.81  ? 10  U   C C6     1 
ATOM   4747 H "H5'"  . U   C 2 10  ? 3.786   45.682 64.145 1.00 70.45  ? 10  U   C "H5'"  1 
ATOM   4748 H "H5''" . U   C 2 10  ? 3.911   47.066 64.896 1.00 70.45  ? 10  U   C "H5''" 1 
ATOM   4749 H "H4'"  . U   C 2 10  ? 5.965   46.528 63.993 1.00 65.22  ? 10  U   C "H4'"  1 
ATOM   4750 H "H3'"  . U   C 2 10  ? 4.810   48.700 62.623 1.00 61.03  ? 10  U   C "H3'"  1 
ATOM   4751 H "H2'"  . U   C 2 10  ? 6.679   48.873 61.321 1.00 58.36  ? 10  U   C "H2'"  1 
ATOM   4752 H "HO2'" . U   C 2 10  ? 8.213   48.491 62.863 1.00 56.39  ? 10  U   C "HO2'" 1 
ATOM   4753 H "H1'"  . U   C 2 10  ? 6.872   46.323 60.911 1.00 59.57  ? 10  U   C "H1'"  1 
ATOM   4754 H H3     . U   C 2 10  ? 5.403   48.215 57.136 1.00 58.07  ? 10  U   C H3     1 
ATOM   4755 H H5     . U   C 2 10  ? 2.179   47.175 59.141 1.00 60.16  ? 10  U   C H5     1 
ATOM   4756 H H6     . U   C 2 10  ? 3.523   46.708 60.885 1.00 60.02  ? 10  U   C H6     1 
ATOM   4757 P P      . C   C 2 11  ? 5.599   50.617 64.214 1.00 51.34  ? 11  C   C P      1 
ATOM   4758 O OP1    . C   C 2 11  ? 6.044   51.130 65.533 1.00 50.87  ? 11  C   C OP1    1 
ATOM   4759 O OP2    . C   C 2 11  ? 4.170   50.722 63.829 1.00 52.83  ? 11  C   C OP2    1 
ATOM   4760 O "O5'"  . C   C 2 11  ? 6.470   51.344 63.099 1.00 51.24  ? 11  C   C "O5'"  1 
ATOM   4761 C "C5'"  . C   C 2 11  ? 7.886   51.321 63.167 1.00 50.45  ? 11  C   C "C5'"  1 
ATOM   4762 C "C4'"  . C   C 2 11  ? 8.519   51.812 61.890 1.00 50.70  ? 11  C   C "C4'"  1 
ATOM   4763 O "O4'"  . C   C 2 11  ? 8.202   50.921 60.788 1.00 51.08  ? 11  C   C "O4'"  1 
ATOM   4764 C "C3'"  . C   C 2 11  ? 8.059   53.170 61.393 1.00 51.62  ? 11  C   C "C3'"  1 
ATOM   4765 O "O3'"  . C   C 2 11  ? 8.638   54.248 62.102 1.00 51.21  ? 11  C   C "O3'"  1 
ATOM   4766 C "C2'"  . C   C 2 11  ? 8.446   53.120 59.923 1.00 51.56  ? 11  C   C "C2'"  1 
ATOM   4767 O "O2'"  . C   C 2 11  ? 9.836   53.350 59.748 1.00 50.64  ? 11  C   C "O2'"  1 
ATOM   4768 C "C1'"  . C   C 2 11  ? 8.143   51.661 59.583 1.00 51.40  ? 11  C   C "C1'"  1 
ATOM   4769 N N1     . C   C 2 11  ? 6.803   51.501 58.974 1.00 52.85  ? 11  C   C N1     1 
ATOM   4770 C C2     . C   C 2 11  ? 6.672   51.780 57.611 1.00 53.07  ? 11  C   C C2     1 
ATOM   4771 O O2     . C   C 2 11  ? 7.675   52.144 56.978 1.00 51.69  ? 11  C   C O2     1 
ATOM   4772 N N3     . C   C 2 11  ? 5.465   51.645 57.018 1.00 54.88  ? 11  C   C N3     1 
ATOM   4773 C C4     . C   C 2 11  ? 4.412   51.251 57.735 1.00 56.06  ? 11  C   C C4     1 
ATOM   4774 N N4     . C   C 2 11  ? 3.241   51.132 57.104 1.00 58.78  ? 11  C   C N4     1 
ATOM   4775 C C5     . C   C 2 11  ? 4.515   50.963 59.128 1.00 55.33  ? 11  C   C C5     1 
ATOM   4776 C C6     . C   C 2 11  ? 5.718   51.100 59.703 1.00 53.82  ? 11  C   C C6     1 
ATOM   4777 H "H5'"  . C   C 2 11  ? 8.179   50.412 63.335 1.00 62.72  ? 11  C   C "H5'"  1 
ATOM   4778 H "H5''" . C   C 2 11  ? 8.175   51.886 63.900 1.00 62.72  ? 11  C   C "H5''" 1 
ATOM   4779 H "H4'"  . C   C 2 11  ? 9.481   51.833 62.008 1.00 63.67  ? 11  C   C "H4'"  1 
ATOM   4780 H "H3'"  . C   C 2 11  ? 7.093   53.224 61.466 1.00 64.80  ? 11  C   C "H3'"  1 
ATOM   4781 H "H2'"  . C   C 2 11  ? 7.910   53.728 59.391 1.00 64.97  ? 11  C   C "H2'"  1 
ATOM   4782 H "HO2'" . C   C 2 11  ? 10.202  52.637 59.495 1.00 65.01  ? 11  C   C "HO2'" 1 
ATOM   4783 H "H1'"  . C   C 2 11  ? 8.816   51.328 58.969 0.00 63.67  ? 11  C   C "H1'"  1 
ATOM   4784 H H41    . C   C 2 11  ? 2.542   50.880 57.538 1.00 67.86  ? 11  C   C H41    1 
ATOM   4785 H H42    . C   C 2 11  ? 3.185   51.307 56.263 1.00 67.86  ? 11  C   C H42    1 
ATOM   4786 H H5     . C   C 2 11  ? 3.775   50.688 59.619 1.00 65.49  ? 11  C   C H5     1 
ATOM   4787 H H6     . C   C 2 11  ? 5.816   50.917 60.609 1.00 65.28  ? 11  C   C H6     1 
ATOM   4788 P P      . C   C 2 12  ? 7.877   55.660 62.172 1.00 52.77  ? 12  C   C P      1 
ATOM   4789 O OP1    . C   C 2 12  ? 8.519   56.461 63.244 1.00 52.76  ? 12  C   C OP1    1 
ATOM   4790 O OP2    . C   C 2 12  ? 6.416   55.393 62.234 1.00 54.19  ? 12  C   C OP2    1 
ATOM   4791 O "O5'"  . C   C 2 12  ? 8.214   56.340 60.771 1.00 52.51  ? 12  C   C "O5'"  1 
ATOM   4792 C "C5'"  . C   C 2 12  ? 9.562   56.514 60.362 1.00 51.19  ? 12  C   C "C5'"  1 
ATOM   4793 C "C4'"  . C   C 2 12  ? 9.666   56.976 58.930 1.00 51.03  ? 12  C   C "C4'"  1 
ATOM   4794 O "O4'"  . C   C 2 12  ? 9.244   55.915 58.030 1.00 51.14  ? 12  C   C "O4'"  1 
ATOM   4795 C "C3'"  . C   C 2 12  ? 8.789   58.153 58.541 1.00 52.12  ? 12  C   C "C3'"  1 
ATOM   4796 O "O3'"  . C   C 2 12  ? 9.314   59.402 58.953 1.00 51.80  ? 12  C   C "O3'"  1 
ATOM   4797 C "C2'"  . C   C 2 12  ? 8.687   57.995 57.032 1.00 52.78  ? 12  C   C "C2'"  1 
ATOM   4798 O "O2'"  . C   C 2 12  ? 9.865   58.459 56.387 1.00 52.38  ? 12  C   C "O2'"  1 
ATOM   4799 C "C1'"  . C   C 2 12  ? 8.607   56.474 56.899 1.00 52.46  ? 12  C   C "C1'"  1 
ATOM   4800 N N1     . C   C 2 12  ? 7.205   56.002 56.867 1.00 54.41  ? 12  C   C N1     1 
ATOM   4801 C C2     . C   C 2 12  ? 6.526   56.005 55.648 1.00 55.74  ? 12  C   C C2     1 
ATOM   4802 O O2     . C   C 2 12  ? 7.125   56.394 54.635 1.00 55.39  ? 12  C   C O2     1 
ATOM   4803 N N3     . C   C 2 12  ? 5.242   55.583 55.604 1.00 57.75  ? 12  C   C N3     1 
ATOM   4804 C C4     . C   C 2 12  ? 4.637   55.173 56.720 1.00 58.56  ? 12  C   C C4     1 
ATOM   4805 N N4     . C   C 2 12  ? 3.370   54.764 56.631 1.00 61.01  ? 12  C   C N4     1 
ATOM   4806 C C5     . C   C 2 12  ? 5.304   55.165 57.980 1.00 57.06  ? 12  C   C C5     1 
ATOM   4807 C C6     . C   C 2 12  ? 6.574   55.587 58.006 1.00 55.24  ? 12  C   C C6     1 
ATOM   4808 H "H5'"  . C   C 2 12  ? 10.032  55.671 60.456 1.00 61.95  ? 12  C   C "H5'"  1 
ATOM   4809 H "H5''" . C   C 2 12  ? 9.983   57.174 60.936 1.00 61.95  ? 12  C   C "H5''" 1 
ATOM   4810 H "H4'"  . C   C 2 12  ? 10.590  57.199 58.740 1.00 61.67  ? 12  C   C "H4'"  1 
ATOM   4811 H "H3'"  . C   C 2 12  ? 7.909   58.035 58.932 1.00 63.15  ? 12  C   C "H3'"  1 
ATOM   4812 H "H2'"  . C   C 2 12  ? 7.891   58.424 56.681 1.00 65.64  ? 12  C   C "H2'"  1 
ATOM   4813 H "HO2'" . C   C 2 12  ? 10.277  57.802 56.064 1.00 66.67  ? 12  C   C "HO2'" 1 
ATOM   4814 H "H1'"  . C   C 2 12  ? 9.066   56.191 56.092 1.00 64.54  ? 12  C   C "H1'"  1 
ATOM   4815 H H41    . C   C 2 12  ? 2.954   54.495 57.334 1.00 75.42  ? 12  C   C H41    1 
ATOM   4816 H H42    . C   C 2 12  ? 2.968   54.771 55.870 1.00 75.42  ? 12  C   C H42    1 
ATOM   4817 H H5     . C   C 2 12  ? 4.874   54.877 58.752 1.00 70.57  ? 12  C   C H5     1 
ATOM   4818 H H6     . C   C 2 12  ? 7.037   55.591 58.813 1.00 68.70  ? 12  C   C H6     1 
ATOM   4819 P P      . G   C 2 13  ? 8.325   60.646 59.182 1.00 51.42  ? 13  G   C P      1 
ATOM   4820 O OP1    . G   C 2 13  ? 9.129   61.781 59.702 1.00 51.51  ? 13  G   C OP1    1 
ATOM   4821 O OP2    . G   C 2 13  ? 7.156   60.166 59.960 1.00 52.47  ? 13  G   C OP2    1 
ATOM   4822 O "O5'"  . G   C 2 13  ? 7.830   61.014 57.713 1.00 51.96  ? 13  G   C "O5'"  1 
ATOM   4823 C "C5'"  . G   C 2 13  ? 8.746   61.476 56.732 1.00 51.33  ? 13  G   C "C5'"  1 
ATOM   4824 C "C4'"  . G   C 2 13  ? 8.089   61.635 55.383 1.00 52.22  ? 13  G   C "C4'"  1 
ATOM   4825 O "O4'"  . G   C 2 13  ? 7.643   60.343 54.894 1.00 52.09  ? 13  G   C "O4'"  1 
ATOM   4826 C "C3'"  . G   C 2 13  ? 6.834   62.493 55.342 1.00 54.22  ? 13  G   C "C3'"  1 
ATOM   4827 O "O3'"  . G   C 2 13  ? 7.109   63.884 55.319 1.00 55.69  ? 13  G   C "O3'"  1 
ATOM   4828 C "C2'"  . G   C 2 13  ? 6.130   61.989 54.090 1.00 54.97  ? 13  G   C "C2'"  1 
ATOM   4829 O "O2'"  . G   C 2 13  ? 6.701   62.549 52.916 1.00 55.49  ? 13  G   C "O2'"  1 
ATOM   4830 C "C1'"  . G   C 2 13  ? 6.461   60.498 54.135 1.00 53.78  ? 13  G   C "C1'"  1 
ATOM   4831 N N9     . G   C 2 13  ? 5.383   59.711 54.763 1.00 54.79  ? 13  G   C N9     1 
ATOM   4832 C C8     . G   C 2 13  ? 5.344   59.213 56.042 1.00 54.41  ? 13  G   C C8     1 
ATOM   4833 N N7     . G   C 2 13  ? 4.249   58.555 56.303 1.00 55.86  ? 13  G   C N7     1 
ATOM   4834 C C5     . G   C 2 13  ? 3.519   58.624 55.124 1.00 57.34  ? 13  G   C C5     1 
ATOM   4835 C C6     . G   C 2 13  ? 2.244   58.093 54.798 1.00 59.55  ? 13  G   C C6     1 
ATOM   4836 O O6     . G   C 2 13  ? 1.478   57.437 55.512 1.00 60.67  ? 13  G   C O6     1 
ATOM   4837 N N1     . G   C 2 13  ? 1.881   58.402 53.492 1.00 60.72  ? 13  G   C N1     1 
ATOM   4838 C C2     . G   C 2 13  ? 2.645   59.124 52.609 1.00 60.25  ? 13  G   C C2     1 
ATOM   4839 N N2     . G   C 2 13  ? 2.119   59.315 51.390 1.00 62.52  ? 13  G   C N2     1 
ATOM   4840 N N3     . G   C 2 13  ? 3.835   59.623 52.899 1.00 57.84  ? 13  G   C N3     1 
ATOM   4841 C C4     . G   C 2 13  ? 4.205   59.336 54.165 1.00 56.66  ? 13  G   C C4     1 
ATOM   4842 H "H5'"  . G   C 2 13  ? 9.475   60.841 56.655 1.00 62.93  ? 13  G   C "H5'"  1 
ATOM   4843 H "H5''" . G   C 2 13  ? 9.103   62.334 57.012 1.00 62.93  ? 13  G   C "H5''" 1 
ATOM   4844 H "H4'"  . G   C 2 13  ? 8.737   61.998 54.760 1.00 64.60  ? 13  G   C "H4'"  1 
ATOM   4845 H "H3'"  . G   C 2 13  ? 6.287   62.291 56.117 1.00 67.76  ? 13  G   C "H3'"  1 
ATOM   4846 H "H2'"  . G   C 2 13  ? 5.174   62.142 54.133 1.00 68.94  ? 13  G   C "H2'"  1 
ATOM   4847 H "HO2'" . G   C 2 13  ? 6.927   63.343 53.074 1.00 69.95  ? 13  G   C "HO2'" 1 
ATOM   4848 H "H1'"  . G   C 2 13  ? 6.613   60.174 53.234 1.00 66.06  ? 13  G   C "H1'"  1 
ATOM   4849 H H8     . G   C 2 13  ? 6.030   59.330 56.659 1.00 64.98  ? 13  G   C H8     1 
ATOM   4850 H H1     . G   C 2 13  ? 1.118   58.116 53.215 1.00 72.52  ? 13  G   C H1     1 
ATOM   4851 H H21    . G   C 2 13  ? 1.345   58.991 51.200 1.00 79.05  ? 13  G   C H21    1 
ATOM   4852 H H22    . G   C 2 13  ? 2.556   59.760 50.798 1.00 79.05  ? 13  G   C H22    1 
ATOM   4853 P P      . C   C 2 14  ? 6.169   64.904 56.130 1.00 60.75  ? 14  C   C P      1 
ATOM   4854 O OP1    . C   C 2 14  ? 6.822   66.238 56.136 1.00 62.72  ? 14  C   C OP1    1 
ATOM   4855 O OP2    . C   C 2 14  ? 5.808   64.252 57.416 1.00 59.56  ? 14  C   C OP2    1 
ATOM   4856 O "O5'"  . C   C 2 14  ? 4.858   65.023 55.233 1.00 62.87  ? 14  C   C "O5'"  1 
ATOM   4857 C "C5'"  . C   C 2 14  ? 4.904   65.678 53.975 1.00 64.88  ? 14  C   C "C5'"  1 
ATOM   4858 C "C4'"  . C   C 2 14  ? 3.727   65.315 53.105 1.00 67.63  ? 14  C   C "C4'"  1 
ATOM   4859 O "O4'"  . C   C 2 14  ? 3.608   63.872 53.004 1.00 66.19  ? 14  C   C "O4'"  1 
ATOM   4860 C "C3'"  . C   C 2 14  ? 2.359   65.757 53.597 1.00 68.93  ? 14  C   C "C3'"  1 
ATOM   4861 O "O3'"  . C   C 2 14  ? 2.093   67.126 53.341 1.00 72.46  ? 14  C   C "O3'"  1 
ATOM   4862 C "C2'"  . C   C 2 14  ? 1.424   64.803 52.863 1.00 70.43  ? 14  C   C "C2'"  1 
ATOM   4863 O "O2'"  . C   C 2 14  ? 1.207   65.222 51.524 1.00 71.63  ? 14  C   C "O2'"  1 
ATOM   4864 C "C1'"  . C   C 2 14  ? 2.250   63.514 52.850 1.00 67.10  ? 14  C   C "C1'"  1 
ATOM   4865 N N1     . C   C 2 14  ? 1.862   62.591 53.941 1.00 65.14  ? 14  C   C N1     1 
ATOM   4866 C C2     . C   C 2 14  ? 0.705   61.829 53.768 1.00 66.39  ? 14  C   C C2     1 
ATOM   4867 O O2     . C   C 2 14  ? 0.057   61.958 52.718 1.00 67.90  ? 14  C   C O2     1 
ATOM   4868 N N3     . C   C 2 14  ? 0.318   60.977 54.745 1.00 66.59  ? 14  C   C N3     1 
ATOM   4869 C C4     . C   C 2 14  ? 1.042   60.872 55.859 1.00 65.11  ? 14  C   C C4     1 
ATOM   4870 N N4     . C   C 2 14  ? 0.621   60.015 56.793 1.00 65.74  ? 14  C   C N4     1 
ATOM   4871 C C5     . C   C 2 14  ? 2.229   61.635 56.062 1.00 63.21  ? 14  C   C C5     1 
ATOM   4872 C C6     . C   C 2 14  ? 2.599   62.476 55.086 1.00 63.02  ? 14  C   C C6     1 
ATOM   4873 H "H5'"  . C   C 2 14  ? 5.723   65.428 53.519 1.00 78.30  ? 14  C   C "H5'"  1 
ATOM   4874 H "H5''" . C   C 2 14  ? 4.905   66.637 54.120 1.00 78.30  ? 14  C   C "H5''" 1 
ATOM   4875 H "H4'"  . C   C 2 14  ? 3.872   65.679 52.218 1.00 85.74  ? 14  C   C "H4'"  1 
ATOM   4876 H "H3'"  . C   C 2 14  ? 2.296   65.594 54.551 1.00 84.44  ? 14  C   C "H3'"  1 
ATOM   4877 H "H2'"  . C   C 2 14  ? 0.589   64.684 53.343 1.00 90.40  ? 14  C   C "H2'"  1 
ATOM   4878 H "HO2'" . C   C 2 14  ? 0.754   65.929 51.529 1.00 88.67  ? 14  C   C "HO2'" 1 
ATOM   4879 H "H1'"  . C   C 2 14  ? 2.131   63.068 51.997 1.00 87.77  ? 14  C   C "H1'"  1 
ATOM   4880 H H41    . C   C 2 14  ? 1.066   59.923 57.524 1.00 76.75  ? 14  C   C H41    1 
ATOM   4881 H H42    . C   C 2 14  ? -0.094  59.555 56.664 1.00 76.75  ? 14  C   C H42    1 
ATOM   4882 H H5     . C   C 2 14  ? 2.727   61.554 56.843 1.00 75.18  ? 14  C   C H5     1 
ATOM   4883 H H6     . C   C 2 14  ? 3.368   62.988 55.190 1.00 76.37  ? 14  C   C H6     1 
ATOM   4884 P P      . G   C 2 15  ? 1.276   68.005 54.410 1.00 72.53  ? 15  G   C P      1 
ATOM   4885 O OP1    . G   C 2 15  ? 1.260   69.414 53.938 1.00 76.18  ? 15  G   C OP1    1 
ATOM   4886 O OP2    . G   C 2 15  ? 1.799   67.692 55.764 1.00 70.09  ? 15  G   C OP2    1 
ATOM   4887 O "O5'"  . G   C 2 15  ? -0.211  67.442 54.311 1.00 74.17  ? 15  G   C "O5'"  1 
ATOM   4888 C "C5'"  . G   C 2 15  ? -0.987  67.659 53.143 1.00 77.19  ? 15  G   C "C5'"  1 
ATOM   4889 C "C4'"  . G   C 2 15  ? -2.307  66.930 53.197 1.00 80.99  ? 15  G   C "C4'"  1 
ATOM   4890 O "O4'"  . G   C 2 15  ? -2.089  65.494 53.213 1.00 77.06  ? 15  G   C "O4'"  1 
ATOM   4891 C "C3'"  . G   C 2 15  ? -3.169  67.174 54.425 1.00 82.23  ? 15  G   C "C3'"  1 
ATOM   4892 O "O3'"  . G   C 2 15  ? -3.862  68.410 54.395 1.00 87.04  ? 15  G   C "O3'"  1 
ATOM   4893 C "C2'"  . G   C 2 15  ? -4.080  65.954 54.424 1.00 81.70  ? 15  G   C "C2'"  1 
ATOM   4894 O "O2'"  . G   C 2 15  ? -5.122  66.086 53.468 1.00 83.59  ? 15  G   C "O2'"  1 
ATOM   4895 C "C1'"  . G   C 2 15  ? -3.118  64.863 53.951 1.00 79.25  ? 15  G   C "C1'"  1 
ATOM   4896 N N9     . G   C 2 15  ? -2.523  64.131 55.084 1.00 73.97  ? 15  G   C N9     1 
ATOM   4897 C C8     . G   C 2 15  ? -1.262  64.273 55.610 1.00 70.14  ? 15  G   C C8     1 
ATOM   4898 N N7     . G   C 2 15  ? -1.038  63.480 56.622 1.00 67.82  ? 15  G   C N7     1 
ATOM   4899 C C5     . G   C 2 15  ? -2.223  62.775 56.776 1.00 69.93  ? 15  G   C C5     1 
ATOM   4900 C C6     . G   C 2 15  ? -2.580  61.772 57.711 1.00 70.44  ? 15  G   C C6     1 
ATOM   4901 O O6     . G   C 2 15  ? -1.894  61.292 58.620 1.00 68.33  ? 15  G   C O6     1 
ATOM   4902 N N1     . G   C 2 15  ? -3.883  61.326 57.511 1.00 72.64  ? 15  G   C N1     1 
ATOM   4903 C C2     . G   C 2 15  ? -4.735  61.785 56.537 1.00 74.45  ? 15  G   C C2     1 
ATOM   4904 N N2     . G   C 2 15  ? -5.956  61.229 56.505 1.00 76.53  ? 15  G   C N2     1 
ATOM   4905 N N3     . G   C 2 15  ? -4.413  62.720 55.659 1.00 74.21  ? 15  G   C N3     1 
ATOM   4906 C C4     . G   C 2 15  ? -3.151  63.167 55.836 1.00 72.76  ? 15  G   C C4     1 
ATOM   4907 H "H5'"  . G   C 2 15  ? -0.488  67.349 52.371 1.00 94.37  ? 15  G   C "H5'"  1 
ATOM   4908 H "H5''" . G   C 2 15  ? -1.156  68.609 53.049 1.00 94.37  ? 15  G   C "H5''" 1 
ATOM   4909 H "H4'"  . G   C 2 15  ? -2.821  67.159 52.407 1.00 108.12 ? 15  G   C "H4'"  1 
ATOM   4910 H "H3'"  . G   C 2 15  ? -2.607  67.147 55.216 1.00 108.52 ? 15  G   C "H3'"  1 
ATOM   4911 H "H2'"  . G   C 2 15  ? -4.425  65.764 55.310 1.00 108.22 ? 15  G   C "H2'"  1 
ATOM   4912 H "HO2'" . G   C 2 15  ? -5.558  65.368 53.437 1.00 104.38 ? 15  G   C "HO2'" 1 
ATOM   4913 H "H1'"  . G   C 2 15  ? -3.592  64.241 53.378 1.00 110.23 ? 15  G   C "H1'"  1 
ATOM   4914 H H8     . G   C 2 15  ? -0.632  64.871 55.277 1.00 91.48  ? 15  G   C H8     1 
ATOM   4915 H H1     . G   C 2 15  ? -4.178  60.714 58.039 1.00 92.14  ? 15  G   C H1     1 
ATOM   4916 H H21    . G   C 2 15  ? -6.166  60.620 57.075 1.00 101.33 ? 15  G   C H21    1 
ATOM   4917 H H22    . G   C 2 15  ? -6.527  61.481 55.914 1.00 101.33 ? 15  G   C H22    1 
ATOM   4918 P P      . U   C 2 16  ? -4.363  69.086 55.766 1.00 99.88  ? 16  U   C P      1 
ATOM   4919 O OP1    . U   C 2 16  ? -4.860  70.450 55.454 1.00 101.10 ? 16  U   C OP1    1 
ATOM   4920 O OP2    . U   C 2 16  ? -3.304  68.914 56.793 1.00 101.03 ? 16  U   C OP2    1 
ATOM   4921 O "O5'"  . U   C 2 16  ? -5.608  68.193 56.198 1.00 98.13  ? 16  U   C "O5'"  1 
ATOM   4922 C "C5'"  . U   C 2 16  ? -6.730  68.060 55.340 1.00 94.60  ? 16  U   C "C5'"  1 
ATOM   4923 C "C4'"  . U   C 2 16  ? -7.731  67.067 55.874 1.00 91.11  ? 16  U   C "C4'"  1 
ATOM   4924 O "O4'"  . U   C 2 16  ? -7.171  65.726 55.868 1.00 91.81  ? 16  U   C "O4'"  1 
ATOM   4925 C "C3'"  . U   C 2 16  ? -8.171  67.264 57.313 1.00 91.93  ? 16  U   C "C3'"  1 
ATOM   4926 O "O3'"  . U   C 2 16  ? -9.116  68.308 57.469 1.00 88.03  ? 16  U   C "O3'"  1 
ATOM   4927 C "C2'"  . U   C 2 16  ? -8.702  65.885 57.678 1.00 91.16  ? 16  U   C "C2'"  1 
ATOM   4928 O "O2'"  . U   C 2 16  ? -9.998  65.672 57.138 1.00 85.33  ? 16  U   C "O2'"  1 
ATOM   4929 C "C1'"  . U   C 2 16  ? -7.711  64.981 56.943 1.00 92.31  ? 16  U   C "C1'"  1 
ATOM   4930 N N1     . U   C 2 16  ? -6.608  64.537 57.826 1.00 97.61  ? 16  U   C N1     1 
ATOM   4931 C C2     . U   C 2 16  ? -6.842  63.441 58.633 1.00 96.97  ? 16  U   C C2     1 
ATOM   4932 O O2     . U   C 2 16  ? -7.900  62.835 58.638 1.00 95.19  ? 16  U   C O2     1 
ATOM   4933 N N3     . U   C 2 16  ? -5.788  63.076 59.432 1.00 95.72  ? 16  U   C N3     1 
ATOM   4934 C C4     . U   C 2 16  ? -4.553  63.688 59.505 1.00 93.16  ? 16  U   C C4     1 
ATOM   4935 O O4     . U   C 2 16  ? -3.703  63.240 60.276 1.00 85.97  ? 16  U   C O4     1 
ATOM   4936 C C5     . U   C 2 16  ? -4.388  64.817 58.642 1.00 97.29  ? 16  U   C C5     1 
ATOM   4937 C C6     . U   C 2 16  ? -5.400  65.192 57.853 1.00 100.27 ? 16  U   C C6     1 
ATOM   4938 H "H5'"  . U   C 2 16  ? -6.426  67.764 54.468 1.00 127.53 ? 16  U   C "H5'"  1 
ATOM   4939 H "H5''" . U   C 2 16  ? -7.161  68.924 55.249 1.00 127.53 ? 16  U   C "H5''" 1 
ATOM   4940 H "H4'"  . U   C 2 16  ? -8.515  67.079 55.304 1.00 121.35 ? 16  U   C "H4'"  1 
ATOM   4941 H "H3'"  . U   C 2 16  ? -7.393  67.458 57.858 1.00 114.95 ? 16  U   C "H3'"  1 
ATOM   4942 H "H2'"  . U   C 2 16  ? -8.679  65.734 58.636 1.00 114.48 ? 16  U   C "H2'"  1 
ATOM   4943 H "HO2'" . U   C 2 16  ? -10.546 66.166 57.539 1.00 120.07 ? 16  U   C "HO2'" 1 
ATOM   4944 H "H1'"  . U   C 2 16  ? -8.178  64.205 56.595 1.00 110.85 ? 16  U   C "H1'"  1 
ATOM   4945 H H3     . U   C 2 16  ? -5.910  62.395 59.942 1.00 101.89 ? 16  U   C H3     1 
ATOM   4946 H H5     . U   C 2 16  ? -3.585  65.285 58.630 1.00 109.13 ? 16  U   C H5     1 
ATOM   4947 H H6     . U   C 2 16  ? -5.281  65.927 57.297 1.00 114.63 ? 16  U   C H6     1 
ATOM   4948 P P      . A   C 2 17  ? -9.106  69.209 58.799 1.00 89.56  ? 17  A   C P      1 
ATOM   4949 O OP1    . A   C 2 17  ? -9.963  70.398 58.555 1.00 95.51  ? 17  A   C OP1    1 
ATOM   4950 O OP2    . A   C 2 17  ? -7.696  69.398 59.227 1.00 92.35  ? 17  A   C OP2    1 
ATOM   4951 O "O5'"  . A   C 2 17  ? -9.829  68.292 59.880 1.00 87.17  ? 17  A   C "O5'"  1 
ATOM   4952 C "C5'"  . A   C 2 17  ? -11.166 67.862 59.678 1.00 85.52  ? 17  A   C "C5'"  1 
ATOM   4953 C "C4'"  . A   C 2 17  ? -11.534 66.727 60.599 1.00 81.46  ? 17  A   C "C4'"  1 
ATOM   4954 O "O4'"  . A   C 2 17  ? -10.702 65.567 60.328 1.00 83.76  ? 17  A   C "O4'"  1 
ATOM   4955 C "C3'"  . A   C 2 17  ? -11.329 66.979 62.082 1.00 85.93  ? 17  A   C "C3'"  1 
ATOM   4956 O "O3'"  . A   C 2 17  ? -12.352 67.771 62.658 1.00 84.30  ? 17  A   C "O3'"  1 
ATOM   4957 C "C2'"  . A   C 2 17  ? -11.246 65.565 62.640 1.00 85.70  ? 17  A   C "C2'"  1 
ATOM   4958 O "O2'"  . A   C 2 17  ? -12.536 64.983 62.765 1.00 80.06  ? 17  A   C "O2'"  1 
ATOM   4959 C "C1'"  . A   C 2 17  ? -10.479 64.849 61.526 1.00 86.48  ? 17  A   C "C1'"  1 
ATOM   4960 N N9     . A   C 2 17  ? -9.029  64.809 61.797 1.00 90.39  ? 17  A   C N9     1 
ATOM   4961 C C8     . A   C 2 17  ? -8.044  65.620 61.292 1.00 91.81  ? 17  A   C C8     1 
ATOM   4962 N N7     . A   C 2 17  ? -6.844  65.331 61.733 1.00 89.12  ? 17  A   C N7     1 
ATOM   4963 C C5     . A   C 2 17  ? -7.053  64.259 62.590 1.00 86.33  ? 17  A   C C5     1 
ATOM   4964 C C6     . A   C 2 17  ? -6.181  63.488 63.378 1.00 79.09  ? 17  A   C C6     1 
ATOM   4965 N N6     . A   C 2 17  ? -4.862  63.685 63.436 1.00 74.33  ? 17  A   C N6     1 
ATOM   4966 N N1     . A   C 2 17  ? -6.715  62.492 64.118 1.00 76.96  ? 17  A   C N1     1 
ATOM   4967 C C2     . A   C 2 17  ? -8.037  62.290 64.063 1.00 81.24  ? 17  A   C C2     1 
ATOM   4968 N N3     . A   C 2 17  ? -8.959  62.946 63.363 1.00 85.93  ? 17  A   C N3     1 
ATOM   4969 C C4     . A   C 2 17  ? -8.395  63.929 62.640 1.00 88.59  ? 17  A   C C4     1 
ATOM   4970 H "H5'"  . A   C 2 17  ? -11.269 67.569 58.759 1.00 110.49 ? 17  A   C "H5'"  1 
ATOM   4971 H "H5''" . A   C 2 17  ? -11.766 68.608 59.841 1.00 110.49 ? 17  A   C "H5''" 1 
ATOM   4972 H "H4'"  . A   C 2 17  ? -12.462 66.490 60.447 1.00 107.79 ? 17  A   C "H4'"  1 
ATOM   4973 H "H3'"  . A   C 2 17  ? -10.475 67.421 62.212 1.00 109.31 ? 17  A   C "H3'"  1 
ATOM   4974 H "H2'"  . A   C 2 17  ? -10.758 65.541 63.478 1.00 105.02 ? 17  A   C "H2'"  1 
ATOM   4975 H "HO2'" . A   C 2 17  ? -12.613 64.365 62.201 1.00 104.19 ? 17  A   C "HO2'" 1 
ATOM   4976 H "H1'"  . A   C 2 17  ? -10.816 63.945 61.430 1.00 103.05 ? 17  A   C "H1'"  1 
ATOM   4977 H H8     . A   C 2 17  ? -8.212  66.309 60.690 1.00 104.30 ? 17  A   C H8     1 
ATOM   4978 H H61    . A   C 2 17  ? -4.374  63.183 63.936 1.00 91.16  ? 17  A   C H61    1 
ATOM   4979 H H62    . A   C 2 17  ? -4.501  64.313 62.973 1.00 91.16  ? 17  A   C H62    1 
ATOM   4980 H H2     . A   C 2 17  ? -8.356  61.593 64.590 1.00 92.01  ? 17  A   C H2     1 
ATOM   4981 P P      . C   C 2 18  ? -12.020 68.750 63.890 1.00 101.12 ? 18  C   C P      1 
ATOM   4982 O OP1    . C   C 2 18  ? -13.168 69.675 64.067 1.00 99.19  ? 18  C   C OP1    1 
ATOM   4983 O OP2    . C   C 2 18  ? -10.659 69.310 63.694 1.00 103.33 ? 18  C   C OP2    1 
ATOM   4984 O "O5'"  . C   C 2 18  ? -11.978 67.771 65.144 1.00 101.07 ? 18  C   C "O5'"  1 
ATOM   4985 C "C5'"  . C   C 2 18  ? -13.050 66.874 65.391 1.00 96.99  ? 18  C   C "C5'"  1 
ATOM   4986 C "C4'"  . C   C 2 18  ? -12.660 65.792 66.365 1.00 96.25  ? 18  C   C "C4'"  1 
ATOM   4987 O "O4'"  . C   C 2 18  ? -11.657 64.921 65.778 1.00 96.45  ? 18  C   C "O4'"  1 
ATOM   4988 C "C3'"  . C   C 2 18  ? -12.021 66.262 67.659 1.00 96.08  ? 18  C   C "C3'"  1 
ATOM   4989 O "O3'"  . C   C 2 18  ? -12.965 66.746 68.598 1.00 96.13  ? 18  C   C "O3'"  1 
ATOM   4990 C "C2'"  . C   C 2 18  ? -11.266 65.022 68.121 1.00 92.08  ? 18  C   C "C2'"  1 
ATOM   4991 O "O2'"  . C   C 2 18  ? -12.139 64.088 68.741 1.00 89.88  ? 18  C   C "O2'"  1 
ATOM   4992 C "C1'"  . C   C 2 18  ? -10.788 64.444 66.787 1.00 93.39  ? 18  C   C "C1'"  1 
ATOM   4993 N N1     . C   C 2 18  ? -9.403  64.856 66.464 1.00 91.57  ? 18  C   C N1     1 
ATOM   4994 C C2     . C   C 2 18  ? -8.348  64.159 67.057 1.00 87.44  ? 18  C   C C2     1 
ATOM   4995 O O2     . C   C 2 18  ? -8.610  63.223 67.828 1.00 84.49  ? 18  C   C O2     1 
ATOM   4996 N N3     . C   C 2 18  ? -7.074  64.517 66.778 1.00 85.98  ? 18  C   C N3     1 
ATOM   4997 C C4     . C   C 2 18  ? -6.834  65.529 65.944 1.00 88.96  ? 18  C   C C4     1 
ATOM   4998 N N4     . C   C 2 18  ? -5.562  65.847 65.698 1.00 87.07  ? 18  C   C N4     1 
ATOM   4999 C C5     . C   C 2 18  ? -7.889  66.259 65.324 1.00 93.68  ? 18  C   C C5     1 
ATOM   5000 C C6     . C   C 2 18  ? -9.145  65.893 65.611 1.00 94.71  ? 18  C   C C6     1 
ATOM   5001 H "H5'"  . C   C 2 18  ? -13.318 66.463 64.554 1.00 122.25 ? 18  C   C "H5'"  1 
ATOM   5002 H "H5''" . C   C 2 18  ? -13.800 67.370 65.754 1.00 122.25 ? 18  C   C "H5''" 1 
ATOM   5003 H "H4'"  . C   C 2 18  ? -13.446 65.265 66.578 1.00 116.97 ? 18  C   C "H4'"  1 
ATOM   5004 H "H3'"  . C   C 2 18  ? -11.383 66.965 67.460 1.00 119.84 ? 18  C   C "H3'"  1 
ATOM   5005 H "H2'"  . C   C 2 18  ? -10.519 65.253 68.695 1.00 114.14 ? 18  C   C "H2'"  1 
ATOM   5006 H "HO2'" . C   C 2 18  ? -12.402 64.404 69.473 1.00 111.36 ? 18  C   C "HO2'" 1 
ATOM   5007 H "H1'"  . C   C 2 18  ? -10.836 63.476 66.821 1.00 108.74 ? 18  C   C "H1'"  1 
ATOM   5008 H H41    . C   C 2 18  ? -5.376  66.495 65.164 1.00 115.83 ? 18  C   C H41    1 
ATOM   5009 H H42    . C   C 2 18  ? -4.927  65.404 66.073 1.00 115.83 ? 18  C   C H42    1 
ATOM   5010 H H5     . C   C 2 18  ? -7.712  66.964 64.744 1.00 113.15 ? 18  C   C H5     1 
ATOM   5011 H H6     . C   C 2 18  ? -9.855  66.351 65.221 1.00 109.57 ? 18  C   C H6     1 
ATOM   5012 P P      . G   C 2 19  ? -12.519 67.816 69.709 1.00 100.78 ? 19  G   C P      1 
ATOM   5013 O OP1    . G   C 2 19  ? -13.742 68.470 70.241 1.00 102.53 ? 19  G   C OP1    1 
ATOM   5014 O OP2    . G   C 2 19  ? -11.432 68.656 69.143 1.00 101.31 ? 19  G   C OP2    1 
ATOM   5015 O "O5'"  . G   C 2 19  ? -11.902 66.913 70.865 1.00 95.59  ? 19  G   C "O5'"  1 
ATOM   5016 C "C5'"  . G   C 2 19  ? -10.857 67.399 71.691 1.00 93.57  ? 19  G   C "C5'"  1 
ATOM   5017 C "C4'"  . G   C 2 19  ? -10.129 66.272 72.377 1.00 90.02  ? 19  G   C "C4'"  1 
ATOM   5018 O "O4'"  . G   C 2 19  ? -9.452  65.464 71.380 1.00 88.06  ? 19  G   C "O4'"  1 
ATOM   5019 C "C3'"  . G   C 2 19  ? -9.032  66.702 73.339 1.00 91.87  ? 19  G   C "C3'"  1 
ATOM   5020 O "O3'"  . G   C 2 19  ? -9.540  66.970 74.634 1.00 93.11  ? 19  G   C "O3'"  1 
ATOM   5021 C "C2'"  . G   C 2 19  ? -8.045  65.541 73.290 1.00 89.73  ? 19  G   C "C2'"  1 
ATOM   5022 O "O2'"  . G   C 2 19  ? -8.448  64.487 74.151 1.00 87.22  ? 19  G   C "O2'"  1 
ATOM   5023 C "C1'"  . G   C 2 19  ? -8.178  65.078 71.840 1.00 87.79  ? 19  G   C "C1'"  1 
ATOM   5024 N N9     . G   C 2 19  ? -7.177  65.692 70.950 1.00 89.74  ? 19  G   C N9     1 
ATOM   5025 C C8     . G   C 2 19  ? -7.454  66.587 69.949 1.00 91.44  ? 19  G   C C8     1 
ATOM   5026 N N7     . G   C 2 19  ? -6.397  66.973 69.293 1.00 92.94  ? 19  G   C N7     1 
ATOM   5027 C C5     . G   C 2 19  ? -5.358  66.283 69.895 1.00 92.12  ? 19  G   C C5     1 
ATOM   5028 C C6     . G   C 2 19  ? -3.973  66.299 69.603 1.00 93.30  ? 19  G   C C6     1 
ATOM   5029 O O6     . G   C 2 19  ? -3.378  66.949 68.733 1.00 95.20  ? 19  G   C O6     1 
ATOM   5030 N N1     . G   C 2 19  ? -3.271  65.454 70.454 1.00 92.61  ? 19  G   C N1     1 
ATOM   5031 C C2     . G   C 2 19  ? -3.832  64.694 71.451 1.00 91.07  ? 19  G   C C2     1 
ATOM   5032 N N2     . G   C 2 19  ? -2.989  63.941 72.164 1.00 90.26  ? 19  G   C N2     1 
ATOM   5033 N N3     . G   C 2 19  ? -5.123  64.667 71.733 1.00 89.72  ? 19  G   C N3     1 
ATOM   5034 C C4     . G   C 2 19  ? -5.822  65.481 70.919 1.00 90.29  ? 19  G   C C4     1 
ATOM   5035 H "H5'"  . G   C 2 19  ? -11.233 67.989 72.364 1.00 121.27 ? 19  G   C "H5'"  1 
ATOM   5036 H "H5''" . G   C 2 19  ? -10.229 67.898 71.147 1.00 121.27 ? 19  G   C "H5''" 1 
ATOM   5037 H "H4'"  . G   C 2 19  ? -10.770 65.720 72.851 1.00 114.52 ? 19  G   C "H4'"  1 
ATOM   5038 H "H3'"  . G   C 2 19  ? -8.601  67.500 72.995 1.00 114.36 ? 19  G   C "H3'"  1 
ATOM   5039 H "H2'"  . G   C 2 19  ? -7.142  65.835 73.484 1.00 111.36 ? 19  G   C "H2'"  1 
ATOM   5040 H "HO2'" . G   C 2 19  ? -8.190  64.658 74.932 1.00 107.54 ? 19  G   C "HO2'" 1 
ATOM   5041 H "H1'"  . G   C 2 19  ? -8.099  64.112 71.800 1.00 110.14 ? 19  G   C "H1'"  1 
ATOM   5042 H H8     . G   C 2 19  ? -8.312  66.892 69.760 1.00 114.47 ? 19  G   C H8     1 
ATOM   5043 H H1     . G   C 2 19  ? -2.419  65.403 70.348 1.00 111.52 ? 19  G   C H1     1 
ATOM   5044 H H21    . G   C 2 19  ? -2.147  63.953 71.987 1.00 104.55 ? 19  G   C H21    1 
ATOM   5045 H H22    . G   C 2 19  ? -3.287  63.444 72.799 1.00 104.55 ? 19  G   C H22    1 
ATOM   5046 P P      . U   C 2 20  ? -9.334  68.413 75.307 1.00 122.75 ? 20  U   C P      1 
ATOM   5047 O OP1    . U   C 2 20  ? -10.357 68.538 76.378 1.00 123.67 ? 20  U   C OP1    1 
ATOM   5048 O OP2    . U   C 2 20  ? -9.258  69.449 74.245 1.00 125.67 ? 20  U   C OP2    1 
ATOM   5049 O "O5'"  . U   C 2 20  ? -7.906  68.297 75.999 1.00 125.02 ? 20  U   C "O5'"  1 
ATOM   5050 C "C5'"  . U   C 2 20  ? -7.803  67.945 77.368 1.00 125.60 ? 20  U   C "C5'"  1 
ATOM   5051 C "C4'"  . U   C 2 20  ? -6.657  67.002 77.634 1.00 124.48 ? 20  U   C "C4'"  1 
ATOM   5052 O "O4'"  . U   C 2 20  ? -5.945  67.470 78.811 1.00 129.16 ? 20  U   C "O4'"  1 
ATOM   5053 C "C3'"  . U   C 2 20  ? -7.050  65.563 77.971 1.00 120.16 ? 20  U   C "C3'"  1 
ATOM   5054 O "O3'"  . U   C 2 20  ? -7.203  64.735 76.833 1.00 115.75 ? 20  U   C "O3'"  1 
ATOM   5055 C "C2'"  . U   C 2 20  ? -5.934  65.117 78.900 1.00 122.93 ? 20  U   C "C2'"  1 
ATOM   5056 O "O2'"  . U   C 2 20  ? -4.759  64.832 78.156 1.00 123.37 ? 20  U   C "O2'"  1 
ATOM   5057 C "C1'"  . U   C 2 20  ? -5.697  66.397 79.687 1.00 128.28 ? 20  U   C "C1'"  1 
ATOM   5058 N N1     . U   C 2 20  ? -6.659  66.533 80.802 1.00 128.80 ? 20  U   C N1     1 
ATOM   5059 C C2     . U   C 2 20  ? -6.341  66.036 82.048 1.00 131.02 ? 20  U   C C2     1 
ATOM   5060 O O2     . U   C 2 20  ? -5.286  65.475 82.288 1.00 133.15 ? 20  U   C O2     1 
ATOM   5061 N N3     . U   C 2 20  ? -7.315  66.229 82.999 1.00 131.04 ? 20  U   C N3     1 
ATOM   5062 C C4     . U   C 2 20  ? -8.539  66.850 82.830 1.00 128.91 ? 20  U   C C4     1 
ATOM   5063 O O4     . U   C 2 20  ? -9.313  66.949 83.781 1.00 129.08 ? 20  U   C O4     1 
ATOM   5064 C C5     . U   C 2 20  ? -8.789  67.336 81.511 1.00 127.59 ? 20  U   C C5     1 
ATOM   5065 C C6     . U   C 2 20  ? -7.861  67.163 80.573 1.00 127.41 ? 20  U   C C6     1 
ATOM   5066 P P      . U   C 2 21  ? -7.710  63.215 76.992 1.00 214.04 ? 21  U   C P      1 
ATOM   5067 O OP1    . U   C 2 21  ? -6.570  62.334 77.356 1.00 214.23 ? 21  U   C OP1    1 
ATOM   5068 O OP2    . U   C 2 21  ? -8.525  62.927 75.786 1.00 214.11 ? 21  U   C OP2    1 
ATOM   5069 O "O5'"  . U   C 2 21  ? -8.702  63.249 78.236 1.00 212.37 ? 21  U   C "O5'"  1 
ATOM   5070 C "C5'"  . U   C 2 21  ? -8.533  62.355 79.327 1.00 211.15 ? 21  U   C "C5'"  1 
ATOM   5071 C "C4'"  . U   C 2 21  ? -9.052  60.969 79.019 1.00 209.90 ? 21  U   C "C4'"  1 
ATOM   5072 O "O4'"  . U   C 2 21  ? -9.728  60.449 80.193 1.00 208.61 ? 21  U   C "O4'"  1 
ATOM   5073 C "C3'"  . U   C 2 21  ? -10.092 60.858 77.911 1.00 209.78 ? 21  U   C "C3'"  1 
ATOM   5074 O "O3'"  . U   C 2 21  ? -9.519  60.800 76.617 1.00 211.13 ? 21  U   C "O3'"  1 
ATOM   5075 C "C2'"  . U   C 2 21  ? -10.854 59.596 78.292 1.00 208.68 ? 21  U   C "C2'"  1 
ATOM   5076 O "O2'"  . U   C 2 21  ? -10.120 58.434 77.934 1.00 209.27 ? 21  U   C "O2'"  1 
ATOM   5077 C "C1'"  . U   C 2 21  ? -10.867 59.708 79.814 1.00 207.74 ? 21  U   C "C1'"  1 
ATOM   5078 N N1     . U   C 2 21  ? -12.062 60.437 80.290 1.00 207.07 ? 21  U   C N1     1 
ATOM   5079 C C2     . U   C 2 21  ? -12.156 60.681 81.644 1.00 206.46 ? 21  U   C C2     1 
ATOM   5080 O O2     . U   C 2 21  ? -11.294 60.339 82.436 1.00 206.68 ? 21  U   C O2     1 
ATOM   5081 N N3     . U   C 2 21  ? -13.284 61.361 82.030 1.00 206.15 ? 21  U   C N3     1 
ATOM   5082 C C4     . U   C 2 21  ? -14.309 61.796 81.215 1.00 206.76 ? 21  U   C C4     1 
ATOM   5083 O O4     . U   C 2 21  ? -15.265 62.393 81.713 1.00 206.94 ? 21  U   C O4     1 
ATOM   5084 C C5     . U   C 2 21  ? -14.142 61.493 79.826 1.00 207.67 ? 21  U   C C5     1 
ATOM   5085 C C6     . U   C 2 21  ? -13.050 60.837 79.421 1.00 207.63 ? 21  U   C C6     1 
ATOM   5086 O OP3    . C   D 3 1   ? 5.926   62.292 67.279 1.00 64.77  ? 1   C   D OP3    1 
ATOM   5087 P P      . C   D 3 1   ? 5.773   63.437 68.207 1.00 65.04  ? 1   C   D P      1 
ATOM   5088 O OP1    . C   D 3 1   ? 7.102   63.716 68.808 1.00 67.18  ? 1   C   D OP1    1 
ATOM   5089 O OP2    . C   D 3 1   ? 5.071   64.526 67.485 1.00 65.29  ? 1   C   D OP2    1 
ATOM   5090 O "O5'"  . C   D 3 1   ? 4.812   62.970 69.385 1.00 63.63  ? 1   C   D "O5'"  1 
ATOM   5091 C "C5'"  . C   D 3 1   ? 5.339   62.579 70.643 1.00 64.30  ? 1   C   D "C5'"  1 
ATOM   5092 C "C4'"  . C   D 3 1   ? 4.246   62.420 71.667 1.00 63.71  ? 1   C   D "C4'"  1 
ATOM   5093 O "O4'"  . C   D 3 1   ? 3.639   63.713 71.942 1.00 64.27  ? 1   C   D "O4'"  1 
ATOM   5094 C "C3'"  . C   D 3 1   ? 3.073   61.545 71.256 1.00 63.04  ? 1   C   D "C3'"  1 
ATOM   5095 O "O3'"  . C   D 3 1   ? 3.330   60.158 71.395 1.00 62.90  ? 1   C   D "O3'"  1 
ATOM   5096 C "C2'"  . C   D 3 1   ? 1.953   62.058 72.149 1.00 63.07  ? 1   C   D "C2'"  1 
ATOM   5097 O "O2'"  . C   D 3 1   ? 2.071   61.542 73.468 1.00 63.14  ? 1   C   D "O2'"  1 
ATOM   5098 C "C1'"  . C   D 3 1   ? 2.254   63.556 72.167 1.00 63.73  ? 1   C   D "C1'"  1 
ATOM   5099 N N1     . C   D 3 1   ? 1.520   64.269 71.099 1.00 64.00  ? 1   C   D N1     1 
ATOM   5100 C C2     . C   D 3 1   ? 0.153   64.489 71.265 1.00 64.06  ? 1   C   D C2     1 
ATOM   5101 O O2     . C   D 3 1   ? -0.397  64.088 72.302 1.00 63.53  ? 1   C   D O2     1 
ATOM   5102 N N3     . C   D 3 1   ? -0.539  65.131 70.296 1.00 65.33  ? 1   C   D N3     1 
ATOM   5103 C C4     . C   D 3 1   ? 0.089   65.546 69.196 1.00 65.63  ? 1   C   D C4     1 
ATOM   5104 N N4     . C   D 3 1   ? -0.637  66.175 68.269 1.00 66.36  ? 1   C   D N4     1 
ATOM   5105 C C5     . C   D 3 1   ? 1.485   65.333 68.998 1.00 65.32  ? 1   C   D C5     1 
ATOM   5106 C C6     . C   D 3 1   ? 2.155   64.694 69.966 1.00 64.75  ? 1   C   D C6     1 
ATOM   5107 H "H5'"  . C   D 3 1   ? 5.965   63.254 70.949 1.00 79.76  ? 1   C   D "H5'"  1 
ATOM   5108 H "H5''" . C   D 3 1   ? 5.806   61.735 70.544 1.00 79.76  ? 1   C   D "H5''" 1 
ATOM   5109 H "H4'"  . C   D 3 1   ? 4.629   62.071 72.487 1.00 79.14  ? 1   C   D "H4'"  1 
ATOM   5110 H "H3'"  . C   D 3 1   ? 2.849   61.732 70.331 1.00 79.26  ? 1   C   D "H3'"  1 
ATOM   5111 H "H2'"  . C   D 3 1   ? 1.081   61.875 71.767 1.00 77.29  ? 1   C   D "H2'"  1 
ATOM   5112 H "HO2'" . C   D 3 1   ? 2.281   62.167 73.988 1.00 77.30  ? 1   C   D "HO2'" 1 
ATOM   5113 H "H1'"  . C   D 3 1   ? 2.018   63.928 73.032 1.00 77.95  ? 1   C   D "H1'"  1 
ATOM   5114 H H41    . C   D 3 1   ? -0.262  66.455 67.548 1.00 84.59  ? 1   C   D H41    1 
ATOM   5115 H H42    . C   D 3 1   ? -1.478  66.299 68.394 1.00 84.59  ? 1   C   D H42    1 
ATOM   5116 H H5     . C   D 3 1   ? 1.913   65.626 68.226 1.00 83.03  ? 1   C   D H5     1 
ATOM   5117 H H6     . C   D 3 1   ? 3.067   64.539 69.866 1.00 81.48  ? 1   C   D H6     1 
ATOM   5118 P P      . G   D 3 2   ? 2.587   59.104 70.435 1.00 54.33  ? 2   G   D P      1 
ATOM   5119 O OP1    . G   D 3 2   ? 3.066   57.742 70.778 1.00 54.53  ? 2   G   D OP1    1 
ATOM   5120 O OP2    . G   D 3 2   ? 2.703   59.586 69.035 1.00 55.65  ? 2   G   D OP2    1 
ATOM   5121 O "O5'"  . G   D 3 2   ? 1.060   59.197 70.878 1.00 53.74  ? 2   G   D "O5'"  1 
ATOM   5122 C "C5'"  . G   D 3 2   ? 0.659   58.814 72.185 1.00 53.05  ? 2   G   D "C5'"  1 
ATOM   5123 C "C4'"  . G   D 3 2   ? -0.833  58.932 72.363 1.00 54.19  ? 2   G   D "C4'"  1 
ATOM   5124 O "O4'"  . G   D 3 2   ? -1.228  60.330 72.339 1.00 54.32  ? 2   G   D "O4'"  1 
ATOM   5125 C "C3'"  . G   D 3 2   ? -1.686  58.298 71.278 1.00 55.61  ? 2   G   D "C3'"  1 
ATOM   5126 O "O3'"  . G   D 3 2   ? -1.805  56.893 71.408 1.00 56.90  ? 2   G   D "O3'"  1 
ATOM   5127 C "C2'"  . G   D 3 2   ? -3.003  59.047 71.422 1.00 57.66  ? 2   G   D "C2'"  1 
ATOM   5128 O "O2'"  . G   D 3 2   ? -3.760  58.559 72.520 1.00 59.93  ? 2   G   D "O2'"  1 
ATOM   5129 C "C1'"  . G   D 3 2   ? -2.508  60.454 71.753 1.00 55.98  ? 2   G   D "C1'"  1 
ATOM   5130 N N9     . G   D 3 2   ? -2.402  61.297 70.549 1.00 55.84  ? 2   G   D N9     1 
ATOM   5131 C C8     . G   D 3 2   ? -1.263  61.665 69.873 1.00 54.97  ? 2   G   D C8     1 
ATOM   5132 N N7     . G   D 3 2   ? -1.505  62.419 68.836 1.00 55.78  ? 2   G   D N7     1 
ATOM   5133 C C5     . G   D 3 2   ? -2.887  62.554 68.825 1.00 57.06  ? 2   G   D C5     1 
ATOM   5134 C C6     . G   D 3 2   ? -3.736  63.262 67.937 1.00 58.43  ? 2   G   D C6     1 
ATOM   5135 O O6     . G   D 3 2   ? -3.424  63.933 66.944 1.00 58.78  ? 2   G   D O6     1 
ATOM   5136 N N1     . G   D 3 2   ? -5.074  63.130 68.297 1.00 60.14  ? 2   G   D N1     1 
ATOM   5137 C C2     . G   D 3 2   ? -5.536  62.413 69.374 1.00 61.62  ? 2   G   D C2     1 
ATOM   5138 N N2     . G   D 3 2   ? -6.863  62.403 69.562 1.00 64.59  ? 2   G   D N2     1 
ATOM   5139 N N3     . G   D 3 2   ? -4.755  61.750 70.211 1.00 60.12  ? 2   G   D N3     1 
ATOM   5140 C C4     . G   D 3 2   ? -3.454  61.865 69.876 1.00 57.28  ? 2   G   D C4     1 
ATOM   5141 H "H5'"  . G   D 3 2   ? 1.102   59.385 72.832 1.00 69.54  ? 2   G   D "H5'"  1 
ATOM   5142 H "H5''" . G   D 3 2   ? 0.925   57.894 72.341 1.00 69.54  ? 2   G   D "H5''" 1 
ATOM   5143 H "H4'"  . G   D 3 2   ? -1.078  58.551 73.220 1.00 69.42  ? 2   G   D "H4'"  1 
ATOM   5144 H "H3'"  . G   D 3 2   ? -1.299  58.503 70.413 1.00 71.20  ? 2   G   D "H3'"  1 
ATOM   5145 H "H2'"  . G   D 3 2   ? -3.513  59.034 70.597 1.00 70.16  ? 2   G   D "H2'"  1 
ATOM   5146 H "HO2'" . G   D 3 2   ? -3.632  57.732 72.595 1.00 71.86  ? 2   G   D "HO2'" 1 
ATOM   5147 H "H1'"  . G   D 3 2   ? -3.115  60.870 72.387 1.00 68.49  ? 2   G   D "H1'"  1 
ATOM   5148 H H8     . G   D 3 2   ? -0.408  61.405 70.130 1.00 67.40  ? 2   G   D H8     1 
ATOM   5149 H H1     . G   D 3 2   ? -5.658  63.530 67.807 1.00 74.68  ? 2   G   D H1     1 
ATOM   5150 H H21    . G   D 3 2   ? -7.377  62.831 69.022 1.00 79.80  ? 2   G   D H21    1 
ATOM   5151 H H22    . G   D 3 2   ? -7.201  61.968 70.223 1.00 79.80  ? 2   G   D H22    1 
ATOM   5152 P P      . U   D 3 3   ? -1.909  55.974 70.095 1.00 65.87  ? 3   U   D P      1 
ATOM   5153 O OP1    . U   D 3 3   ? -1.803  54.559 70.531 1.00 66.56  ? 3   U   D OP1    1 
ATOM   5154 O OP2    . U   D 3 3   ? -0.955  56.496 69.083 1.00 64.32  ? 3   U   D OP2    1 
ATOM   5155 O "O5'"  . U   D 3 3   ? -3.389  56.231 69.562 1.00 69.41  ? 3   U   D "O5'"  1 
ATOM   5156 C "C5'"  . U   D 3 3   ? -4.514  55.897 70.362 1.00 72.33  ? 3   U   D "C5'"  1 
ATOM   5157 C "C4'"  . U   D 3 3   ? -5.806  56.396 69.763 1.00 75.98  ? 3   U   D "C4'"  1 
ATOM   5158 O "O4'"  . U   D 3 3   ? -5.812  57.847 69.715 1.00 74.81  ? 3   U   D "O4'"  1 
ATOM   5159 C "C3'"  . U   D 3 3   ? -6.090  55.988 68.328 1.00 77.97  ? 3   U   D "C3'"  1 
ATOM   5160 O "O3'"  . U   D 3 3   ? -6.560  54.658 68.204 1.00 80.88  ? 3   U   D "O3'"  1 
ATOM   5161 C "C2'"  . U   D 3 3   ? -7.098  57.041 67.888 1.00 80.49  ? 3   U   D "C2'"  1 
ATOM   5162 O "O2'"  . U   D 3 3   ? -8.395  56.758 68.394 1.00 85.91  ? 3   U   D "O2'"  1 
ATOM   5163 C "C1'"  . U   D 3 3   ? -6.557  58.284 68.595 1.00 77.00  ? 3   U   D "C1'"  1 
ATOM   5164 N N1     . U   D 3 3   ? -5.678  59.082 67.711 1.00 74.62  ? 3   U   D N1     1 
ATOM   5165 C C2     . U   D 3 3   ? -6.293  59.898 66.780 1.00 75.78  ? 3   U   D C2     1 
ATOM   5166 O O2     . U   D 3 3   ? -7.504  59.982 66.671 1.00 78.46  ? 3   U   D O2     1 
ATOM   5167 N N3     . U   D 3 3   ? -5.436  60.613 65.983 1.00 74.34  ? 3   U   D N3     1 
ATOM   5168 C C4     . U   D 3 3   ? -4.057  60.593 66.020 1.00 72.23  ? 3   U   D C4     1 
ATOM   5169 O O4     . U   D 3 3   ? -3.423  61.299 65.233 1.00 71.49  ? 3   U   D O4     1 
ATOM   5170 C C5     . U   D 3 3   ? -3.494  59.724 67.008 1.00 71.08  ? 3   U   D C5     1 
ATOM   5171 C C6     . U   D 3 3   ? -4.308  59.014 67.799 1.00 72.07  ? 3   U   D C6     1 
ATOM   5172 H "H5'"  . U   D 3 3   ? -4.402  56.290 71.242 1.00 87.66  ? 3   U   D "H5'"  1 
ATOM   5173 H "H5''" . U   D 3 3   ? -4.561  54.932 70.451 1.00 87.66  ? 3   U   D "H5''" 1 
ATOM   5174 H "H4'"  . U   D 3 3   ? -6.542  56.100 70.322 1.00 90.24  ? 3   U   D "H4'"  1 
ATOM   5175 H "H3'"  . U   D 3 3   ? -5.280  56.088 67.804 1.00 94.85  ? 3   U   D "H3'"  1 
ATOM   5176 H "H2'"  . U   D 3 3   ? -7.102  57.152 66.924 1.00 96.79  ? 3   U   D "H2'"  1 
ATOM   5177 H "HO2'" . U   D 3 3   ? -8.695  56.075 68.008 1.00 105.35 ? 3   U   D "HO2'" 1 
ATOM   5178 H "H1'"  . U   D 3 3   ? -7.299  58.833 68.894 1.00 90.59  ? 3   U   D "H1'"  1 
ATOM   5179 H H3     . U   D 3 3   ? -5.797  61.129 65.398 1.00 92.79  ? 3   U   D H3     1 
ATOM   5180 H H5     . U   D 3 3   ? -2.571  59.652 67.100 1.00 91.08  ? 3   U   D H5     1 
ATOM   5181 H H6     . U   D 3 3   ? -3.930  58.453 68.437 1.00 89.35  ? 3   U   D H6     1 
ATOM   5182 P P      . A   D 3 4   ? -6.214  53.805 66.887 1.00 82.18  ? 4   A   D P      1 
ATOM   5183 O OP1    . A   D 3 4   ? -6.628  52.400 67.129 1.00 84.03  ? 4   A   D OP1    1 
ATOM   5184 O OP2    . A   D 3 4   ? -4.811  54.098 66.500 1.00 78.48  ? 4   A   D OP2    1 
ATOM   5185 O "O5'"  . A   D 3 4   ? -7.174  54.416 65.773 1.00 85.65  ? 4   A   D "O5'"  1 
ATOM   5186 C "C5'"  . A   D 3 4   ? -8.581  54.242 65.856 1.00 90.47  ? 4   A   D "C5'"  1 
ATOM   5187 C "C4'"  . A   D 3 4   ? -9.309  55.006 64.779 1.00 92.56  ? 4   A   D "C4'"  1 
ATOM   5188 O "O4'"  . A   D 3 4   ? -9.174  56.437 64.994 1.00 90.26  ? 4   A   D "O4'"  1 
ATOM   5189 C "C3'"  . A   D 3 4   ? -8.808  54.813 63.359 1.00 91.69  ? 4   A   D "C3'"  1 
ATOM   5190 O "O3'"  . A   D 3 4   ? -9.215  53.590 62.771 1.00 94.28  ? 4   A   D "O3'"  1 
ATOM   5191 C "C2'"  . A   D 3 4   ? -9.351  56.049 62.659 1.00 92.05  ? 4   A   D "C2'"  1 
ATOM   5192 O "O2'"  . A   D 3 4   ? -10.736 55.916 62.375 1.00 96.79  ? 4   A   D "O2'"  1 
ATOM   5193 C "C1'"  . A   D 3 4   ? -9.169  57.107 63.747 1.00 89.37  ? 4   A   D "C1'"  1 
ATOM   5194 N N9     . A   D 3 4   ? -7.892  57.827 63.587 1.00 84.57  ? 4   A   D N9     1 
ATOM   5195 C C8     . A   D 3 4   ? -6.700  57.618 64.235 1.00 81.07  ? 4   A   D C8     1 
ATOM   5196 N N7     . A   D 3 4   ? -5.742  58.427 63.850 1.00 77.58  ? 4   A   D N7     1 
ATOM   5197 C C5     . A   D 3 4   ? -6.341  59.217 62.878 1.00 78.61  ? 4   A   D C5     1 
ATOM   5198 C C6     . A   D 3 4   ? -5.861  60.271 62.078 1.00 76.61  ? 4   A   D C6     1 
ATOM   5199 N N6     . A   D 3 4   ? -4.611  60.734 62.132 1.00 73.67  ? 4   A   D N6     1 
ATOM   5200 N N1     . A   D 3 4   ? -6.721  60.843 61.208 1.00 78.16  ? 4   A   D N1     1 
ATOM   5201 C C2     . A   D 3 4   ? -7.977  60.383 61.152 1.00 81.45  ? 4   A   D C2     1 
ATOM   5202 N N3     . A   D 3 4   ? -8.545  59.402 61.849 1.00 84.13  ? 4   A   D N3     1 
ATOM   5203 C C4     . A   D 3 4   ? -7.663  58.855 62.704 1.00 82.72  ? 4   A   D C4     1 
ATOM   5204 H "H5'"  . A   D 3 4   ? -8.886  54.552 66.724 1.00 116.75 ? 4   A   D "H5'"  1 
ATOM   5205 H "H5''" . A   D 3 4   ? -8.787  53.298 65.768 1.00 116.75 ? 4   A   D "H5''" 1 
ATOM   5206 H "H4'"  . A   D 3 4   ? -10.250 54.773 64.813 1.00 118.66 ? 4   A   D "H4'"  1 
ATOM   5207 H "H3'"  . A   D 3 4   ? -7.838  54.853 63.360 1.00 119.89 ? 4   A   D "H3'"  1 
ATOM   5208 H "H2'"  . A   D 3 4   ? -8.838  56.265 61.864 1.00 119.24 ? 4   A   D "H2'"  1 
ATOM   5209 H "HO2'" . A   D 3 4   ? -10.838 55.335 61.777 1.00 127.24 ? 4   A   D "HO2'" 1 
ATOM   5210 H "H1'"  . A   D 3 4   ? -9.905  57.738 63.714 1.00 112.10 ? 4   A   D "H1'"  1 
ATOM   5211 H H8     . A   D 3 4   ? -6.584  56.968 64.889 1.00 99.27  ? 4   A   D H8     1 
ATOM   5212 H H61    . A   D 3 4   ? -4.370  61.382 61.620 1.00 88.94  ? 4   A   D H61    1 
ATOM   5213 H H62    . A   D 3 4   ? -4.045  60.385 62.678 1.00 88.94  ? 4   A   D H62    1 
ATOM   5214 H H2     . A   D 3 4   ? -8.531  60.809 60.538 1.00 101.76 ? 4   A   D H2     1 
ATOM   5215 P P      . C   D 3 5   ? -8.192  52.777 61.836 1.00 98.38  ? 5   C   D P      1 
ATOM   5216 O OP1    . C   D 3 5   ? -8.745  51.414 61.625 1.00 101.17 ? 5   C   D OP1    1 
ATOM   5217 O OP2    . C   D 3 5   ? -6.824  52.937 62.391 1.00 94.05  ? 5   C   D OP2    1 
ATOM   5218 O "O5'"  . C   D 3 5   ? -8.251  53.544 60.442 1.00 99.79  ? 5   C   D "O5'"  1 
ATOM   5219 C "C5'"  . C   D 3 5   ? -9.289  53.269 59.515 1.00 104.29 ? 5   C   D "C5'"  1 
ATOM   5220 C "C4'"  . C   D 3 5   ? -9.755  54.515 58.805 1.00 104.76 ? 5   C   D "C4'"  1 
ATOM   5221 O "O4'"  . C   D 3 5   ? -9.461  55.692 59.605 1.00 102.12 ? 5   C   D "O4'"  1 
ATOM   5222 C "C3'"  . C   D 3 5   ? -9.091  54.813 57.472 1.00 103.99 ? 5   C   D "C3'"  1 
ATOM   5223 O "O3'"  . C   D 3 5   ? -9.590  54.026 56.408 1.00 107.73 ? 5   C   D "O3'"  1 
ATOM   5224 C "C2'"  . C   D 3 5   ? -9.344  56.305 57.316 1.00 102.61 ? 5   C   D "C2'"  1 
ATOM   5225 O "O2'"  . C   D 3 5   ? -10.684 56.563 56.921 1.00 105.84 ? 5   C   D "O2'"  1 
ATOM   5226 C "C1'"  . C   D 3 5   ? -9.161  56.783 58.755 1.00 100.05 ? 5   C   D "C1'"  1 
ATOM   5227 N N1     . C   D 3 5   ? -7.773  57.228 59.013 1.00 95.77  ? 5   C   D N1     1 
ATOM   5228 C C2     . C   D 3 5   ? -7.341  58.432 58.447 1.00 93.95  ? 5   C   D C2     1 
ATOM   5229 O O2     . C   D 3 5   ? -8.134  59.084 57.752 1.00 95.67  ? 5   C   D O2     1 
ATOM   5230 N N3     . C   D 3 5   ? -6.075  58.852 58.668 1.00 90.82  ? 5   C   D N3     1 
ATOM   5231 C C4     . C   D 3 5   ? -5.254  58.119 59.422 1.00 89.41  ? 5   C   D C4     1 
ATOM   5232 N N4     . C   D 3 5   ? -4.014  58.570 59.617 1.00 86.65  ? 5   C   D N4     1 
ATOM   5233 C C5     . C   D 3 5   ? -5.666  56.889 60.010 1.00 90.73  ? 5   C   D C5     1 
ATOM   5234 C C6     . C   D 3 5   ? -6.922  56.483 59.781 1.00 93.81  ? 5   C   D C6     1 
ATOM   5235 H "H5'"  . C   D 3 5   ? -10.039 52.877 59.988 1.00 134.84 ? 5   C   D "H5'"  1 
ATOM   5236 H "H5''" . C   D 3 5   ? -8.965  52.634 58.857 1.00 134.84 ? 5   C   D "H5''" 1 
ATOM   5237 H "H4'"  . C   D 3 5   ? -10.714 54.459 58.671 1.00 135.27 ? 5   C   D "H4'"  1 
ATOM   5238 H "H3'"  . C   D 3 5   ? -8.136  54.663 57.555 1.00 137.66 ? 5   C   D "H3'"  1 
ATOM   5239 H "H2'"  . C   D 3 5   ? -8.703  56.718 56.717 1.00 134.10 ? 5   C   D "H2'"  1 
ATOM   5240 H "HO2'" . C   D 3 5   ? -10.792 56.302 56.130 1.00 141.02 ? 5   C   D "HO2'" 1 
ATOM   5241 H "H1'"  . C   D 3 5   ? -9.775  57.512 58.935 1.00 125.38 ? 5   C   D "H1'"  1 
ATOM   5242 H H41    . C   D 3 5   ? -3.463  58.119 60.098 1.00 104.31 ? 5   C   D H41    1 
ATOM   5243 H H42    . C   D 3 5   ? -3.765  59.313 59.261 1.00 104.31 ? 5   C   D H42    1 
ATOM   5244 H H5     . C   D 3 5   ? -5.085  56.386 60.533 1.00 109.05 ? 5   C   D H5     1 
ATOM   5245 H H6     . C   D 3 5   ? -7.220  55.684 60.153 1.00 113.09 ? 5   C   D H6     1 
ATOM   5246 P P      . G   D 3 6   ? -8.579  53.455 55.299 1.00 93.29  ? 6   G   D P      1 
ATOM   5247 O OP1    . G   D 3 6   ? -9.337  52.533 54.415 1.00 96.21  ? 6   G   D OP1    1 
ATOM   5248 O OP2    . G   D 3 6   ? -7.357  52.967 55.990 1.00 90.14  ? 6   G   D OP2    1 
ATOM   5249 O "O5'"  . G   D 3 6   ? -8.180  54.745 54.456 1.00 93.47  ? 6   G   D "O5'"  1 
ATOM   5250 C "C5'"  . G   D 3 6   ? -9.180  55.551 53.851 1.00 96.60  ? 6   G   D "C5'"  1 
ATOM   5251 C "C4'"  . G   D 3 6   ? -8.577  56.695 53.079 1.00 94.79  ? 6   G   D "C4'"  1 
ATOM   5252 O "O4'"  . G   D 3 6   ? -8.081  57.708 53.993 1.00 91.78  ? 6   G   D "O4'"  1 
ATOM   5253 C "C3'"  . G   D 3 6   ? -7.370  56.354 52.222 1.00 92.06  ? 6   G   D "C3'"  1 
ATOM   5254 O "O3'"  . G   D 3 6   ? -7.720  55.744 50.993 1.00 94.47  ? 6   G   D "O3'"  1 
ATOM   5255 C "C2'"  . G   D 3 6   ? -6.684  57.704 52.072 1.00 91.31  ? 6   G   D "C2'"  1 
ATOM   5256 O "O2'"  . G   D 3 6   ? -7.331  58.504 51.093 1.00 95.10  ? 6   G   D "O2'"  1 
ATOM   5257 C "C1'"  . G   D 3 6   ? -6.927  58.318 53.452 1.00 89.79  ? 6   G   D "C1'"  1 
ATOM   5258 N N9     . G   D 3 6   ? -5.795  58.089 54.369 1.00 85.22  ? 6   G   D N9     1 
ATOM   5259 C C8     . G   D 3 6   ? -5.743  57.229 55.439 1.00 82.74  ? 6   G   D C8     1 
ATOM   5260 N N7     . G   D 3 6   ? -4.595  57.252 56.060 1.00 80.09  ? 6   G   D N7     1 
ATOM   5261 C C5     . G   D 3 6   ? -3.844  58.185 55.358 1.00 80.51  ? 6   G   D C5     1 
ATOM   5262 C C6     . G   D 3 6   ? -2.517  58.641 55.562 1.00 80.22  ? 6   G   D C6     1 
ATOM   5263 O O6     . G   D 3 6   ? -1.710  58.297 56.434 1.00 79.52  ? 6   G   D O6     1 
ATOM   5264 N N1     . G   D 3 6   ? -2.152  59.593 54.616 1.00 81.28  ? 6   G   D N1     1 
ATOM   5265 C C2     . G   D 3 6   ? -2.960  60.050 53.604 1.00 82.42  ? 6   G   D C2     1 
ATOM   5266 N N2     . G   D 3 6   ? -2.432  60.973 52.787 1.00 83.64  ? 6   G   D N2     1 
ATOM   5267 N N3     . G   D 3 6   ? -4.199  59.636 53.403 1.00 84.35  ? 6   G   D N3     1 
ATOM   5268 C C4     . G   D 3 6   ? -4.571  58.710 54.312 1.00 83.17  ? 6   G   D C4     1 
ATOM   5269 H "H5'"  . G   D 3 6   ? -9.761  55.907 54.542 1.00 115.74 ? 6   G   D "H5'"  1 
ATOM   5270 H "H5''" . G   D 3 6   ? -9.705  55.004 53.246 1.00 115.74 ? 6   G   D "H5''" 1 
ATOM   5271 H "H4'"  . G   D 3 6   ? -9.261  57.089 52.516 1.00 109.52 ? 6   G   D "H4'"  1 
ATOM   5272 H "H3'"  . G   D 3 6   ? -6.789  55.757 52.718 1.00 104.33 ? 6   G   D "H3'"  1 
ATOM   5273 H "H2'"  . G   D 3 6   ? -5.737  57.605 51.889 1.00 103.96 ? 6   G   D "H2'"  1 
ATOM   5274 H "HO2'" . G   D 3 6   ? -7.025  59.285 51.133 1.00 105.71 ? 6   G   D "HO2'" 1 
ATOM   5275 H "H1'"  . G   D 3 6   ? -7.080  59.272 53.359 1.00 104.58 ? 6   G   D "H1'"  1 
ATOM   5276 H H8     . G   D 3 6   ? -6.453  56.685 55.694 1.00 98.61  ? 6   G   D H8     1 
ATOM   5277 H H1     . G   D 3 6   ? -1.359  59.921 54.668 1.00 95.34  ? 6   G   D H1     1 
ATOM   5278 H H21    . G   D 3 6   ? -1.627  61.247 52.912 1.00 96.48  ? 6   G   D H21    1 
ATOM   5279 H H22    . G   D 3 6   ? -2.899  61.291 52.139 1.00 96.48  ? 6   G   D H22    1 
ATOM   5280 P P      . C   D 3 7   ? -6.792  54.589 50.371 1.00 81.64  ? 7   C   D P      1 
ATOM   5281 O OP1    . C   D 3 7   ? -7.543  53.946 49.263 1.00 85.77  ? 7   C   D OP1    1 
ATOM   5282 O OP2    . C   D 3 7   ? -6.280  53.750 51.485 1.00 77.74  ? 7   C   D OP2    1 
ATOM   5283 O "O5'"  . C   D 3 7   ? -5.568  55.389 49.742 1.00 81.52  ? 7   C   D "O5'"  1 
ATOM   5284 C "C5'"  . C   D 3 7   ? -5.795  56.492 48.877 1.00 85.36  ? 7   C   D "C5'"  1 
ATOM   5285 C "C4'"  . C   D 3 7   ? -4.540  57.300 48.657 1.00 83.91  ? 7   C   D "C4'"  1 
ATOM   5286 O "O4'"  . C   D 3 7   ? -4.188  58.022 49.866 1.00 80.40  ? 7   C   D "O4'"  1 
ATOM   5287 C "C3'"  . C   D 3 7   ? -3.286  56.510 48.327 1.00 82.35  ? 7   C   D "C3'"  1 
ATOM   5288 O "O3'"  . C   D 3 7   ? -3.233  56.094 46.974 1.00 85.78  ? 7   C   D "O3'"  1 
ATOM   5289 C "C2'"  . C   D 3 7   ? -2.177  57.478 48.720 1.00 80.14  ? 7   C   D "C2'"  1 
ATOM   5290 O "O2'"  . C   D 3 7   ? -1.971  58.462 47.716 1.00 83.16  ? 7   C   D "O2'"  1 
ATOM   5291 C "C1'"  . C   D 3 7   ? -2.783  58.145 49.958 1.00 77.69  ? 7   C   D "C1'"  1 
ATOM   5292 N N1     . C   D 3 7   ? -2.325  57.507 51.212 1.00 72.74  ? 7   C   D N1     1 
ATOM   5293 C C2     . C   D 3 7   ? -1.055  57.836 51.691 1.00 70.19  ? 7   C   D C2     1 
ATOM   5294 O O2     . C   D 3 7   ? -0.366  58.644 51.051 1.00 71.44  ? 7   C   D O2     1 
ATOM   5295 N N3     . C   D 3 7   ? -0.612  57.268 52.836 1.00 66.80  ? 7   C   D N3     1 
ATOM   5296 C C4     . C   D 3 7   ? -1.386  56.403 53.492 1.00 65.31  ? 7   C   D C4     1 
ATOM   5297 N N4     . C   D 3 7   ? -0.909  55.867 54.617 1.00 63.36  ? 7   C   D N4     1 
ATOM   5298 C C5     . C   D 3 7   ? -2.686  56.050 53.026 1.00 67.48  ? 7   C   D C5     1 
ATOM   5299 C C6     . C   D 3 7   ? -3.112  56.620 51.892 1.00 71.13  ? 7   C   D C6     1 
ATOM   5300 H "H5'"  . C   D 3 7   ? -6.474  57.065 49.268 1.00 98.51  ? 7   C   D "H5'"  1 
ATOM   5301 H "H5''" . C   D 3 7   ? -6.113  56.163 48.022 1.00 98.51  ? 7   C   D "H5''" 1 
ATOM   5302 H "H4'"  . C   D 3 7   ? -4.702  57.940 47.946 1.00 98.17  ? 7   C   D "H4'"  1 
ATOM   5303 H "H3'"  . C   D 3 7   ? -3.243  55.729 48.901 1.00 96.65  ? 7   C   D "H3'"  1 
ATOM   5304 H "H2'"  . C   D 3 7   ? -1.357  57.009 48.937 1.00 95.96  ? 7   C   D "H2'"  1 
ATOM   5305 H "HO2'" . C   D 3 7   ? -2.224  59.208 48.008 1.00 99.51  ? 7   C   D "HO2'" 1 
ATOM   5306 H "H1'"  . C   D 3 7   ? -2.542  59.084 49.967 1.00 93.60  ? 7   C   D "H1'"  1 
ATOM   5307 H H41    . C   D 3 7   ? -1.386  55.305 55.062 1.00 79.34  ? 7   C   D H41    1 
ATOM   5308 H H42    . C   D 3 7   ? -0.126  56.082 54.898 1.00 79.34  ? 7   C   D H42    1 
ATOM   5309 H H5     . C   D 3 7   ? -3.218  55.446 53.491 1.00 82.65  ? 7   C   D H5     1 
ATOM   5310 H H6     . C   D 3 7   ? -3.955  56.410 51.562 1.00 85.15  ? 7   C   D H6     1 
ATOM   5311 P P      . G   D 3 8   ? -2.432  54.760 46.571 1.00 88.52  ? 8   G   D P      1 
ATOM   5312 O OP1    . G   D 3 8   ? -2.739  54.460 45.150 1.00 92.78  ? 8   G   D OP1    1 
ATOM   5313 O OP2    . G   D 3 8   ? -2.673  53.725 47.608 1.00 84.52  ? 8   G   D OP2    1 
ATOM   5314 O "O5'"  . G   D 3 8   ? -0.905  55.198 46.666 1.00 86.73  ? 8   G   D "O5'"  1 
ATOM   5315 C "C5'"  . G   D 3 8   ? -0.426  56.308 45.924 1.00 88.71  ? 8   G   D "C5'"  1 
ATOM   5316 C "C4'"  . G   D 3 8   ? 0.991   56.654 46.299 1.00 86.04  ? 8   G   D "C4'"  1 
ATOM   5317 O "O4'"  . G   D 3 8   ? 1.030   57.223 47.633 1.00 82.51  ? 8   G   D "O4'"  1 
ATOM   5318 C "C3'"  . G   D 3 8   ? 1.960   55.487 46.371 1.00 84.48  ? 8   G   D "C3'"  1 
ATOM   5319 O "O3'"  . G   D 3 8   ? 2.428   55.081 45.097 1.00 87.10  ? 8   G   D "O3'"  1 
ATOM   5320 C "C2'"  . G   D 3 8   ? 3.051   56.020 47.290 1.00 81.36  ? 8   G   D "C2'"  1 
ATOM   5321 O "O2'"  . G   D 3 8   ? 3.944   56.873 46.589 1.00 83.00  ? 8   G   D "O2'"  1 
ATOM   5322 C "C1'"  . G   D 3 8   ? 2.235   56.860 48.275 1.00 79.17  ? 8   G   D "C1'"  1 
ATOM   5323 N N9     . G   D 3 8   ? 1.911   56.118 49.508 1.00 74.40  ? 8   G   D N9     1 
ATOM   5324 C C8     . G   D 3 8   ? 0.785   55.373 49.760 1.00 73.26  ? 8   G   D C8     1 
ATOM   5325 N N7     . G   D 3 8   ? 0.783   54.833 50.947 1.00 69.28  ? 8   G   D N7     1 
ATOM   5326 C C5     . G   D 3 8   ? 1.981   55.246 51.514 1.00 67.34  ? 8   G   D C5     1 
ATOM   5327 C C6     . G   D 3 8   ? 2.532   54.975 52.792 1.00 63.46  ? 8   G   D C6     1 
ATOM   5328 O O6     . G   D 3 8   ? 2.055   54.292 53.705 1.00 60.65  ? 8   G   D O6     1 
ATOM   5329 N N1     . G   D 3 8   ? 3.769   55.590 52.959 1.00 63.76  ? 8   G   D N1     1 
ATOM   5330 C C2     . G   D 3 8   ? 4.397   56.369 52.017 1.00 66.32  ? 8   G   D C2     1 
ATOM   5331 N N2     . G   D 3 8   ? 5.588   56.880 52.366 1.00 65.97  ? 8   G   D N2     1 
ATOM   5332 N N3     . G   D 3 8   ? 3.891   56.631 50.822 1.00 69.29  ? 8   G   D N3     1 
ATOM   5333 C C4     . G   D 3 8   ? 2.690   56.040 50.639 1.00 70.23  ? 8   G   D C4     1 
ATOM   5334 H "H5'"  . G   D 3 8   ? -0.996  57.074 46.097 1.00 105.49 ? 8   G   D "H5'"  1 
ATOM   5335 H "H5''" . G   D 3 8   ? -0.460  56.095 44.978 1.00 105.49 ? 8   G   D "H5''" 1 
ATOM   5336 H "H4'"  . G   D 3 8   ? 1.332   57.307 45.668 1.00 103.90 ? 8   G   D "H4'"  1 
ATOM   5337 H "H3'"  . G   D 3 8   ? 1.521   54.737 46.801 1.00 101.19 ? 8   G   D "H3'"  1 
ATOM   5338 H "H2'"  . G   D 3 8   ? 3.520   55.301 47.741 1.00 100.21 ? 8   G   D "H2'"  1 
ATOM   5339 H "HO2'" . G   D 3 8   ? 4.466   56.403 46.127 1.00 103.80 ? 8   G   D "HO2'" 1 
ATOM   5340 H "H1'"  . G   D 3 8   ? 2.732   57.661 48.503 1.00 98.03  ? 8   G   D "H1'"  1 
ATOM   5341 H H8     . G   D 3 8   ? 0.094   55.265 49.147 1.00 86.19  ? 8   G   D H8     1 
ATOM   5342 H H1     . G   D 3 8   ? 4.171   55.475 53.710 1.00 76.01  ? 8   G   D H1     1 
ATOM   5343 H H21    . G   D 3 8   ? 5.918   56.711 53.142 1.00 79.56  ? 8   G   D H21    1 
ATOM   5344 H H22    . G   D 3 8   ? 6.022   57.376 51.813 1.00 79.56  ? 8   G   D H22    1 
ATOM   5345 P P      . G   D 3 9   ? 3.123   53.646 44.917 1.00 87.66  ? 9   G   D P      1 
ATOM   5346 O OP1    . G   D 3 9   ? 3.370   53.436 43.468 1.00 91.19  ? 9   G   D OP1    1 
ATOM   5347 O OP2    . G   D 3 9   ? 2.337   52.646 45.686 1.00 84.30  ? 9   G   D OP2    1 
ATOM   5348 O "O5'"  . G   D 3 9   ? 4.531   53.822 45.637 1.00 84.86  ? 9   G   D "O5'"  1 
ATOM   5349 C "C5'"  . G   D 3 9   ? 5.187   52.720 46.240 1.00 82.26  ? 9   G   D "C5'"  1 
ATOM   5350 C "C4'"  . G   D 3 9   ? 6.237   53.183 47.216 1.00 79.09  ? 9   G   D "C4'"  1 
ATOM   5351 O "O4'"  . G   D 3 9   ? 5.616   53.968 48.268 1.00 76.07  ? 9   G   D "O4'"  1 
ATOM   5352 C "C3'"  . G   D 3 9   ? 6.981   52.089 47.962 1.00 76.49  ? 9   G   D "C3'"  1 
ATOM   5353 O "O3'"  . G   D 3 9   ? 8.026   51.514 47.198 1.00 78.06  ? 9   G   D "O3'"  1 
ATOM   5354 C "C2'"  . G   D 3 9   ? 7.458   52.810 49.214 1.00 73.07  ? 9   G   D "C2'"  1 
ATOM   5355 O "O2'"  . G   D 3 9   ? 8.608   53.599 48.949 1.00 73.64  ? 9   G   D "O2'"  1 
ATOM   5356 C "C1'"  . G   D 3 9   ? 6.276   53.737 49.495 1.00 72.16  ? 9   G   D "C1'"  1 
ATOM   5357 N N9     . G   D 3 9   ? 5.315   53.134 50.435 1.00 68.27  ? 9   G   D N9     1 
ATOM   5358 C C8     . G   D 3 9   ? 4.049   52.683 50.153 1.00 68.12  ? 9   G   D C8     1 
ATOM   5359 N N7     . G   D 3 9   ? 3.434   52.196 51.196 1.00 64.76  ? 9   G   D N7     1 
ATOM   5360 C C5     . G   D 3 9   ? 4.351   52.334 52.230 1.00 62.52  ? 9   G   D C5     1 
ATOM   5361 C C6     . G   D 3 9   ? 4.252   51.985 53.602 1.00 59.80  ? 9   G   D C6     1 
ATOM   5362 O O6     . G   D 3 9   ? 3.301   51.463 54.198 1.00 58.18  ? 9   G   D O6     1 
ATOM   5363 N N1     . G   D 3 9   ? 5.416   52.301 54.295 1.00 59.60  ? 9   G   D N1     1 
ATOM   5364 C C2     . G   D 3 9   ? 6.531   52.880 53.740 1.00 61.36  ? 9   G   D C2     1 
ATOM   5365 N N2     . G   D 3 9   ? 7.558   53.108 54.571 1.00 61.12  ? 9   G   D N2     1 
ATOM   5366 N N3     . G   D 3 9   ? 6.636   53.212 52.464 1.00 63.51  ? 9   G   D N3     1 
ATOM   5367 C C4     . G   D 3 9   ? 5.516   52.913 51.775 1.00 64.44  ? 9   G   D C4     1 
ATOM   5368 H "H5'"  . G   D 3 9   ? 5.609   52.184 45.550 1.00 98.95  ? 9   G   D "H5'"  1 
ATOM   5369 H "H5''" . G   D 3 9   ? 4.534   52.178 46.709 1.00 98.95  ? 9   G   D "H5''" 1 
ATOM   5370 H "H4'"  . G   D 3 9   ? 6.880   53.738 46.747 1.00 95.61  ? 9   G   D "H4'"  1 
ATOM   5371 H "H3'"  . G   D 3 9   ? 6.353   51.394 48.215 1.00 92.87  ? 9   G   D "H3'"  1 
ATOM   5372 H "H2'"  . G   D 3 9   ? 7.606   52.192 49.947 1.00 89.58  ? 9   G   D "H2'"  1 
ATOM   5373 H "HO2'" . G   D 3 9   ? 9.097   53.194 48.399 1.00 91.68  ? 9   G   D "HO2'" 1 
ATOM   5374 H "H1'"  . G   D 3 9   ? 6.600   54.578 49.854 1.00 87.57  ? 9   G   D "H1'"  1 
ATOM   5375 H H8     . G   D 3 9   ? 3.668   52.720 49.305 1.00 78.62  ? 9   G   D H8     1 
ATOM   5376 H H1     . G   D 3 9   ? 5.439   52.120 55.136 1.00 72.85  ? 9   G   D H1     1 
ATOM   5377 H H21    . G   D 3 9   ? 7.495   52.894 55.401 1.00 74.36  ? 9   G   D H21    1 
ATOM   5378 H H22    . G   D 3 9   ? 8.280   53.468 54.273 1.00 74.36  ? 9   G   D H22    1 
ATOM   5379 P P      . A   D 3 10  ? 8.313   49.936 47.278 1.00 72.39  ? 10  A   D P      1 
ATOM   5380 O OP1    . A   D 3 10  ? 9.141   49.560 46.105 0.82 74.74  ? 10  A   D OP1    1 
ATOM   5381 O OP2    . A   D 3 10  ? 7.021   49.240 47.513 1.00 70.90  ? 10  A   D OP2    1 
ATOM   5382 O "O5'"  . A   D 3 10  ? 9.205   49.779 48.587 1.00 69.37  ? 10  A   D "O5'"  1 
ATOM   5383 C "C5'"  . A   D 3 10  ? 10.399  50.530 48.747 1.00 69.12  ? 10  A   D "C5'"  1 
ATOM   5384 C "C4'"  . A   D 3 10  ? 10.801  50.627 50.196 1.00 66.26  ? 10  A   D "C4'"  1 
ATOM   5385 O "O4'"  . A   D 3 10  ? 9.743   51.267 50.958 1.00 64.72  ? 10  A   D "O4'"  1 
ATOM   5386 C "C3'"  . A   D 3 10  ? 11.024  49.303 50.911 1.00 64.39  ? 10  A   D "C3'"  1 
ATOM   5387 O "O3'"  . A   D 3 10  ? 12.305  48.753 50.660 1.00 63.76  ? 10  A   D "O3'"  1 
ATOM   5388 C "C2'"  . A   D 3 10  ? 10.786  49.669 52.369 1.00 62.01  ? 10  A   D "C2'"  1 
ATOM   5389 O "O2'"  . A   D 3 10  ? 11.920  50.313 52.932 1.00 61.47  ? 10  A   D "O2'"  1 
ATOM   5390 C "C1'"  . A   D 3 10  ? 9.655   50.688 52.243 1.00 61.98  ? 10  A   D "C1'"  1 
ATOM   5391 N N9     . A   D 3 10  ? 8.322   50.071 52.389 1.00 60.09  ? 10  A   D N9     1 
ATOM   5392 C C8     . A   D 3 10  ? 7.394   49.830 51.405 1.00 60.85  ? 10  A   D C8     1 
ATOM   5393 N N7     . A   D 3 10  ? 6.290   49.274 51.840 1.00 58.45  ? 10  A   D N7     1 
ATOM   5394 C C5     . A   D 3 10  ? 6.505   49.141 53.204 1.00 55.89  ? 10  A   D C5     1 
ATOM   5395 C C6     . A   D 3 10  ? 5.709   48.620 54.238 1.00 53.01  ? 10  A   D C6     1 
ATOM   5396 N N6     . A   D 3 10  ? 4.487   48.117 54.045 1.00 51.94  ? 10  A   D N6     1 
ATOM   5397 N N1     . A   D 3 10  ? 6.216   48.634 55.491 1.00 52.42  ? 10  A   D N1     1 
ATOM   5398 C C2     . A   D 3 10  ? 7.442   49.138 55.680 1.00 53.36  ? 10  A   D C2     1 
ATOM   5399 N N3     . A   D 3 10  ? 8.286   49.657 54.790 1.00 55.39  ? 10  A   D N3     1 
ATOM   5400 C C4     . A   D 3 10  ? 7.750   49.629 53.557 1.00 56.92  ? 10  A   D C4     1 
ATOM   5401 H "H5'"  . A   D 3 10  ? 10.260  51.424 48.396 1.00 83.36  ? 10  A   D "H5'"  1 
ATOM   5402 H "H5''" . A   D 3 10  ? 11.112  50.102 48.248 1.00 83.36  ? 10  A   D "H5''" 1 
ATOM   5403 H "H4'"  . A   D 3 10  ? 11.607  51.163 50.265 1.00 80.56  ? 10  A   D "H4'"  1 
ATOM   5404 H "H3'"  . A   D 3 10  ? 10.346  48.671 50.627 1.00 76.78  ? 10  A   D "H3'"  1 
ATOM   5405 H "H2'"  . A   D 3 10  ? 10.513  48.898 52.891 1.00 75.47  ? 10  A   D "H2'"  1 
ATOM   5406 H "HO2'" . A   D 3 10  ? 12.544  49.756 53.003 1.00 75.39  ? 10  A   D "HO2'" 1 
ATOM   5407 H "H1'"  . A   D 3 10  ? 9.766   51.378 52.916 0.00 75.98  ? 10  A   D "H1'"  1 
ATOM   5408 H H8     . A   D 3 10  ? 7.536   50.043 50.510 1.00 71.84  ? 10  A   D H8     1 
ATOM   5409 H H61    . A   D 3 10  ? 4.039   47.810 54.712 1.00 64.08  ? 10  A   D H61    1 
ATOM   5410 H H62    . A   D 3 10  ? 4.149   48.100 53.255 1.00 64.08  ? 10  A   D H62    1 
ATOM   5411 H H2     . A   D 3 10  ? 7.747   49.127 56.559 1.00 64.18  ? 10  A   D H2     1 
ATOM   5412 P P      . A   D 3 11  ? 12.477  47.168 50.457 1.00 63.00  ? 11  A   D P      1 
ATOM   5413 O OP1    . A   D 3 11  ? 13.865  46.915 49.995 1.00 63.27  ? 11  A   D OP1    1 
ATOM   5414 O OP2    . A   D 3 11  ? 11.331  46.672 49.654 1.00 63.53  ? 11  A   D OP2    1 
ATOM   5415 O "O5'"  . A   D 3 11  ? 12.346  46.581 51.930 1.00 60.66  ? 11  A   D "O5'"  1 
ATOM   5416 C "C5'"  . A   D 3 11  ? 13.277  46.948 52.935 1.00 60.01  ? 11  A   D "C5'"  1 
ATOM   5417 C "C4'"  . A   D 3 11  ? 12.844  46.471 54.297 1.00 58.73  ? 11  A   D "C4'"  1 
ATOM   5418 O "O4'"  . A   D 3 11  ? 11.638  47.167 54.713 1.00 57.46  ? 11  A   D "O4'"  1 
ATOM   5419 C "C3'"  . A   D 3 11  ? 12.467  45.003 54.401 1.00 57.56  ? 11  A   D "C3'"  1 
ATOM   5420 O "O3'"  . A   D 3 11  ? 13.588  44.141 54.471 1.00 58.55  ? 11  A   D "O3'"  1 
ATOM   5421 C "C2'"  . A   D 3 11  ? 11.592  44.986 55.645 1.00 55.70  ? 11  A   D "C2'"  1 
ATOM   5422 O "O2'"  . A   D 3 11  ? 12.379  45.045 56.827 1.00 56.56  ? 11  A   D "O2'"  1 
ATOM   5423 C "C1'"  . A   D 3 11  ? 10.831  46.303 55.489 1.00 55.61  ? 11  A   D "C1'"  1 
ATOM   5424 N N9     . A   D 3 11  ? 9.541   46.111 54.799 1.00 54.62  ? 11  A   D N9     1 
ATOM   5425 C C8     . A   D 3 11  ? 9.252   46.273 53.465 1.00 55.51  ? 11  A   D C8     1 
ATOM   5426 N N7     . A   D 3 11  ? 8.004   46.014 53.158 1.00 54.31  ? 11  A   D N7     1 
ATOM   5427 C C5     . A   D 3 11  ? 7.432   45.651 54.371 1.00 52.42  ? 11  A   D C5     1 
ATOM   5428 C C6     . A   D 3 11  ? 6.129   45.258 54.726 1.00 50.86  ? 11  A   D C6     1 
ATOM   5429 N N6     . A   D 3 11  ? 5.122   45.162 53.855 1.00 50.65  ? 11  A   D N6     1 
ATOM   5430 N N1     . A   D 3 11  ? 5.893   44.964 56.025 1.00 50.29  ? 11  A   D N1     1 
ATOM   5431 C C2     . A   D 3 11  ? 6.904   45.061 56.898 1.00 51.16  ? 11  A   D C2     1 
ATOM   5432 N N3     . A   D 3 11  ? 8.169   45.419 56.685 1.00 52.43  ? 11  A   D N3     1 
ATOM   5433 C C4     . A   D 3 11  ? 8.368   45.703 55.387 1.00 52.88  ? 11  A   D C4     1 
ATOM   5434 H "H5'"  . A   D 3 11  ? 13.361  47.914 52.951 1.00 70.72  ? 11  A   D "H5'"  1 
ATOM   5435 H "H5''" . A   D 3 11  ? 14.140  46.559 52.724 1.00 70.72  ? 11  A   D "H5''" 1 
ATOM   5436 H "H4'"  . A   D 3 11  ? 13.551  46.659 54.934 1.00 68.51  ? 11  A   D "H4'"  1 
ATOM   5437 H "H3'"  . A   D 3 11  ? 11.928  44.760 53.632 1.00 68.01  ? 11  A   D "H3'"  1 
ATOM   5438 H "H2'"  . A   D 3 11  ? 10.990  44.225 55.649 1.00 64.53  ? 11  A   D "H2'"  1 
ATOM   5439 H "HO2'" . A   D 3 11  ? 12.264  45.791 57.195 1.00 64.82  ? 11  A   D "HO2'" 1 
ATOM   5440 H "H1'"  . A   D 3 11  ? 10.679  46.697 56.362 1.00 64.73  ? 11  A   D "H1'"  1 
ATOM   5441 H H8     . A   D 3 11  ? 9.883   46.546 52.838 1.00 65.38  ? 11  A   D H8     1 
ATOM   5442 H H61    . A   D 3 11  ? 4.343   44.917 54.124 1.00 64.49  ? 11  A   D H61    1 
ATOM   5443 H H62    . A   D 3 11  ? 5.253   45.345 53.025 1.00 64.49  ? 11  A   D H62    1 
ATOM   5444 H H2     . A   D 3 11  ? 6.693   44.849 57.778 1.00 65.74  ? 11  A   D H2     1 
ATOM   5445 P P      . U   D 3 12  ? 13.466  42.624 53.957 1.00 58.30  ? 12  U   D P      1 
ATOM   5446 O OP1    . U   D 3 12  ? 14.834  42.051 53.912 1.00 59.06  ? 12  U   D OP1    1 
ATOM   5447 O OP2    . U   D 3 12  ? 12.619  42.610 52.737 1.00 58.90  ? 12  U   D OP2    1 
ATOM   5448 O "O5'"  . U   D 3 12  ? 12.677  41.888 55.127 1.00 56.52  ? 12  U   D "O5'"  1 
ATOM   5449 C "C5'"  . U   D 3 12  ? 13.174  41.925 56.455 1.00 56.54  ? 12  U   D "C5'"  1 
ATOM   5450 C "C4'"  . U   D 3 12  ? 12.161  41.429 57.454 1.00 55.10  ? 12  U   D "C4'"  1 
ATOM   5451 O "O4'"  . U   D 3 12  ? 11.002  42.306 57.479 1.00 54.34  ? 12  U   D "O4'"  1 
ATOM   5452 C "C3'"  . U   D 3 12  ? 11.566  40.057 57.193 1.00 53.72  ? 12  U   D "C3'"  1 
ATOM   5453 O "O3'"  . U   D 3 12  ? 12.434  38.992 57.541 1.00 54.72  ? 12  U   D "O3'"  1 
ATOM   5454 C "C2'"  . U   D 3 12  ? 10.284  40.107 58.013 1.00 53.19  ? 12  U   D "C2'"  1 
ATOM   5455 O "O2'"  . U   D 3 12  ? 10.552  39.932 59.397 1.00 55.10  ? 12  U   D "O2'"  1 
ATOM   5456 C "C1'"  . U   D 3 12  ? 9.845   41.553 57.789 1.00 52.99  ? 12  U   D "C1'"  1 
ATOM   5457 N N1     . U   D 3 12  ? 8.870   41.676 56.680 1.00 51.45  ? 12  U   D N1     1 
ATOM   5458 C C2     . U   D 3 12  ? 7.549   41.382 56.960 1.00 50.46  ? 12  U   D C2     1 
ATOM   5459 O O2     . U   D 3 12  ? 7.166   41.030 58.061 1.00 51.02  ? 12  U   D O2     1 
ATOM   5460 N N3     . U   D 3 12  ? 6.688   41.515 55.900 1.00 49.87  ? 12  U   D N3     1 
ATOM   5461 C C4     . U   D 3 12  ? 7.009   41.903 54.616 1.00 54.68  ? 12  U   D C4     1 
ATOM   5462 O O4     . U   D 3 12  ? 6.118   41.975 53.768 1.00 53.34  ? 12  U   D O4     1 
ATOM   5463 C C5     . U   D 3 12  ? 8.395   42.189 54.402 1.00 51.35  ? 12  U   D C5     1 
ATOM   5464 C C6     . U   D 3 12  ? 9.255   42.067 55.419 1.00 51.82  ? 12  U   D C6     1 
ATOM   5465 H "H5'"  . U   D 3 12  ? 13.413  42.838 56.676 1.00 64.89  ? 12  U   D "H5'"  1 
ATOM   5466 H "H5''" . U   D 3 12  ? 13.967  41.370 56.509 1.00 64.89  ? 12  U   D "H5''" 1 
ATOM   5467 H "H4'"  . U   D 3 12  ? 12.568  41.428 58.335 1.00 61.49  ? 12  U   D "H4'"  1 
ATOM   5468 H "H3'"  . U   D 3 12  ? 11.337  39.985 56.253 1.00 61.73  ? 12  U   D "H3'"  1 
ATOM   5469 H "H2'"  . U   D 3 12  ? 9.623   39.477 57.688 1.00 61.25  ? 12  U   D "H2'"  1 
ATOM   5470 H "HO2'" . U   D 3 12  ? 10.795  39.139 59.530 1.00 61.48  ? 12  U   D "HO2'" 1 
ATOM   5471 H "H1'"  . U   D 3 12  ? 9.448   41.898 58.604 1.00 60.67  ? 12  U   D "H1'"  1 
ATOM   5472 H H3     . U   D 3 12  ? 5.861   41.336 56.053 1.00 61.02  ? 12  U   D H3     1 
ATOM   5473 H H5     . U   D 3 12  ? 8.695   42.458 53.563 1.00 61.33  ? 12  U   D H5     1 
ATOM   5474 H H6     . U   D 3 12  ? 10.153  42.258 55.267 1.00 60.96  ? 12  U   D H6     1 
ATOM   5475 P P      . A   D 3 13  ? 12.371  37.599 56.739 1.00 55.16  ? 13  A   D P      1 
ATOM   5476 O OP1    . A   D 3 13  ? 13.536  36.781 57.159 1.00 56.46  ? 13  A   D OP1    1 
ATOM   5477 O OP2    . A   D 3 13  ? 12.174  37.884 55.296 1.00 54.67  ? 13  A   D OP2    1 
ATOM   5478 O "O5'"  . A   D 3 13  ? 11.050  36.902 57.291 1.00 54.35  ? 13  A   D "O5'"  1 
ATOM   5479 C "C5'"  . A   D 3 13  ? 10.947  36.523 58.656 1.00 55.53  ? 13  A   D "C5'"  1 
ATOM   5480 C "C4'"  . A   D 3 13  ? 9.531   36.168 59.034 1.00 55.41  ? 13  A   D "C4'"  1 
ATOM   5481 O "O4'"  . A   D 3 13  ? 8.657   37.312 58.849 1.00 54.30  ? 13  A   D "O4'"  1 
ATOM   5482 C "C3'"  . A   D 3 13  ? 8.873   35.075 58.210 1.00 54.87  ? 13  A   D "C3'"  1 
ATOM   5483 O "O3'"  . A   D 3 13  ? 9.284   33.770 58.582 1.00 56.81  ? 13  A   D "O3'"  1 
ATOM   5484 C "C2'"  . A   D 3 13  ? 7.392   35.344 58.434 1.00 54.59  ? 13  A   D "C2'"  1 
ATOM   5485 O "O2'"  . A   D 3 13  ? 6.963   34.848 59.694 1.00 57.24  ? 13  A   D "O2'"  1 
ATOM   5486 C "C1'"  . A   D 3 13  ? 7.366   36.872 58.474 1.00 53.51  ? 13  A   D "C1'"  1 
ATOM   5487 N N9     . A   D 3 13  ? 7.015   37.458 57.165 1.00 51.63  ? 13  A   D N9     1 
ATOM   5488 C C8     . A   D 3 13  ? 7.844   38.040 56.237 1.00 51.00  ? 13  A   D C8     1 
ATOM   5489 N N7     . A   D 3 13  ? 7.225   38.471 55.164 1.00 50.96  ? 13  A   D N7     1 
ATOM   5490 C C5     . A   D 3 13  ? 5.895   38.148 55.398 1.00 51.24  ? 13  A   D C5     1 
ATOM   5491 C C6     . A   D 3 13  ? 4.726   38.337 54.639 1.00 51.75  ? 13  A   D C6     1 
ATOM   5492 N N6     . A   D 3 13  ? 4.707   38.922 53.440 1.00 52.00  ? 13  A   D N6     1 
ATOM   5493 N N1     . A   D 3 13  ? 3.559   37.897 55.162 1.00 52.42  ? 13  A   D N1     1 
ATOM   5494 C C2     . A   D 3 13  ? 3.575   37.309 56.364 1.00 52.58  ? 13  A   D C2     1 
ATOM   5495 N N3     . A   D 3 13  ? 4.608   37.076 57.172 1.00 52.46  ? 13  A   D N3     1 
ATOM   5496 C C4     . A   D 3 13  ? 5.751   37.523 56.625 1.00 51.44  ? 13  A   D C4     1 
ATOM   5497 H "H5'"  . A   D 3 13  ? 11.246  37.260 59.211 1.00 66.18  ? 13  A   D "H5'"  1 
ATOM   5498 H "H5''" . A   D 3 13  ? 11.518  35.756 58.814 1.00 66.18  ? 13  A   D "H5''" 1 
ATOM   5499 H "H4'"  . A   D 3 13  ? 9.513   35.908 59.969 1.00 66.01  ? 13  A   D "H4'"  1 
ATOM   5500 H "H3'"  . A   D 3 13  ? 9.082   35.217 57.273 1.00 68.54  ? 13  A   D "H3'"  1 
ATOM   5501 H "H2'"  . A   D 3 13  ? 6.851   34.998 57.707 1.00 67.06  ? 13  A   D "H2'"  1 
ATOM   5502 H "HO2'" . A   D 3 13  ? 6.976   34.009 59.676 1.00 67.37  ? 13  A   D "HO2'" 1 
ATOM   5503 H "H1'"  . A   D 3 13  ? 6.722   37.165 59.138 1.00 64.73  ? 13  A   D "H1'"  1 
ATOM   5504 H H8     . A   D 3 13  ? 8.762   38.126 56.361 1.00 63.93  ? 13  A   D H8     1 
ATOM   5505 H H61    . A   D 3 13  ? 3.964   39.012 53.017 1.00 65.90  ? 13  A   D H61    1 
ATOM   5506 H H62    . A   D 3 13  ? 5.439   39.209 53.090 1.00 65.90  ? 13  A   D H62    1 
ATOM   5507 H H2     . A   D 3 13  ? 2.748   37.025 56.681 1.00 66.68  ? 13  A   D H2     1 
ATOM   5508 P P      . C   D 3 14  ? 9.557   32.662 57.451 1.00 59.31  ? 14  C   D P      1 
ATOM   5509 O OP1    . C   D 3 14  ? 10.272  31.520 58.074 1.00 60.99  ? 14  C   D OP1    1 
ATOM   5510 O OP2    . C   D 3 14  ? 10.152  33.351 56.276 1.00 58.31  ? 14  C   D OP2    1 
ATOM   5511 O "O5'"  . C   D 3 14  ? 8.101   32.156 57.058 1.00 59.82  ? 14  C   D "O5'"  1 
ATOM   5512 C "C5'"  . C   D 3 14  ? 7.284   31.506 58.019 1.00 61.78  ? 14  C   D "C5'"  1 
ATOM   5513 C "C4'"  . C   D 3 14  ? 5.833   31.511 57.615 1.00 62.03  ? 14  C   D "C4'"  1 
ATOM   5514 O "O4'"  . C   D 3 14  ? 5.372   32.877 57.438 1.00 60.03  ? 14  C   D "O4'"  1 
ATOM   5515 C "C3'"  . C   D 3 14  ? 5.501   30.843 56.291 1.00 62.03  ? 14  C   D "C3'"  1 
ATOM   5516 O "O3'"  . C   D 3 14  ? 5.450   29.428 56.371 1.00 64.34  ? 14  C   D "O3'"  1 
ATOM   5517 C "C2'"  . C   D 3 14  ? 4.172   31.490 55.929 1.00 62.05  ? 14  C   D "C2'"  1 
ATOM   5518 O "O2'"  . C   D 3 14  ? 3.105   30.919 56.669 1.00 64.63  ? 14  C   D "O2'"  1 
ATOM   5519 C "C1'"  . C   D 3 14  ? 4.396   32.922 56.417 1.00 60.07  ? 14  C   D "C1'"  1 
ATOM   5520 N N1     . C   D 3 14  ? 4.876   33.806 55.330 1.00 58.51  ? 14  C   D N1     1 
ATOM   5521 C C2     . C   D 3 14  ? 3.935   34.336 54.444 1.00 58.98  ? 14  C   D C2     1 
ATOM   5522 O O2     . C   D 3 14  ? 2.738   34.052 54.605 1.00 60.75  ? 14  C   D O2     1 
ATOM   5523 N N3     . C   D 3 14  ? 4.351   35.142 53.440 1.00 58.08  ? 14  C   D N3     1 
ATOM   5524 C C4     . C   D 3 14  ? 5.648   35.420 53.304 1.00 56.09  ? 14  C   D C4     1 
ATOM   5525 N N4     . C   D 3 14  ? 6.011   36.218 52.298 1.00 55.96  ? 14  C   D N4     1 
ATOM   5526 C C5     . C   D 3 14  ? 6.629   34.890 54.192 1.00 55.96  ? 14  C   D C5     1 
ATOM   5527 C C6     . C   D 3 14  ? 6.203   34.093 55.180 1.00 57.39  ? 14  C   D C6     1 
ATOM   5528 H "H5'"  . C   D 3 14  ? 7.376   31.961 58.871 1.00 75.03  ? 14  C   D "H5'"  1 
ATOM   5529 H "H5''" . C   D 3 14  ? 7.582   30.588 58.118 1.00 75.03  ? 14  C   D "H5''" 1 
ATOM   5530 H "H4'"  . C   D 3 14  ? 5.311   31.092 58.317 1.00 75.11  ? 14  C   D "H4'"  1 
ATOM   5531 H "H3'"  . C   D 3 14  ? 6.166   31.098 55.633 1.00 76.32  ? 14  C   D "H3'"  1 
ATOM   5532 H "H2'"  . C   D 3 14  ? 4.007   31.460 54.974 1.00 76.07  ? 14  C   D "H2'"  1 
ATOM   5533 H "HO2'" . C   D 3 14  ? 2.978   30.132 56.405 0.00 77.85  ? 14  C   D "HO2'" 1 
ATOM   5534 H "H1'"  . C   D 3 14  ? 3.567   33.274 56.778 1.00 73.27  ? 14  C   D "H1'"  1 
ATOM   5535 H H41    . C   D 3 14  ? 6.840   36.416 52.184 1.00 69.26  ? 14  C   D H41    1 
ATOM   5536 H H42    . C   D 3 14  ? 5.416   36.535 51.764 1.00 69.26  ? 14  C   D H42    1 
ATOM   5537 H H5     . C   D 3 14  ? 7.532   35.090 54.088 1.00 69.06  ? 14  C   D H5     1 
ATOM   5538 H H6     . C   D 3 14  ? 6.820   33.733 55.776 1.00 71.98  ? 14  C   D H6     1 
ATOM   5539 P P      . U   D 3 15  ? 5.923   28.536 55.120 1.00 72.11  ? 15  U   D P      1 
ATOM   5540 O OP1    . U   D 3 15  ? 5.924   27.109 55.529 1.00 75.00  ? 15  U   D OP1    1 
ATOM   5541 O OP2    . U   D 3 15  ? 7.162   29.143 54.572 1.00 70.83  ? 15  U   D OP2    1 
ATOM   5542 O "O5'"  . U   D 3 15  ? 4.764   28.736 54.048 1.00 73.74  ? 15  U   D "O5'"  1 
ATOM   5543 C "C5'"  . U   D 3 15  ? 3.458   28.243 54.302 1.00 76.10  ? 15  U   D "C5'"  1 
ATOM   5544 C "C4'"  . U   D 3 15  ? 2.492   28.610 53.204 1.00 77.72  ? 15  U   D "C4'"  1 
ATOM   5545 O "O4'"  . U   D 3 15  ? 2.299   30.049 53.155 1.00 74.84  ? 15  U   D "O4'"  1 
ATOM   5546 C "C3'"  . U   D 3 15  ? 2.907   28.258 51.787 1.00 80.16  ? 15  U   D "C3'"  1 
ATOM   5547 O "O3'"  . U   D 3 15  ? 2.747   26.883 51.479 1.00 84.26  ? 15  U   D "O3'"  1 
ATOM   5548 C "C2'"  . U   D 3 15  ? 2.023   29.182 50.958 1.00 80.40  ? 15  U   D "C2'"  1 
ATOM   5549 O "O2'"  . U   D 3 15  ? 0.703   28.668 50.847 1.00 83.64  ? 15  U   D "O2'"  1 
ATOM   5550 C "C1'"  . U   D 3 15  ? 2.002   30.443 51.829 1.00 76.17  ? 15  U   D "C1'"  1 
ATOM   5551 N N1     . U   D 3 15  ? 2.996   31.444 51.373 1.00 73.75  ? 15  U   D N1     1 
ATOM   5552 C C2     . U   D 3 15  ? 2.621   32.269 50.326 1.00 73.92  ? 15  U   D C2     1 
ATOM   5553 O O2     . U   D 3 15  ? 1.527   32.210 49.790 1.00 75.93  ? 15  U   D O2     1 
ATOM   5554 N N3     . U   D 3 15  ? 3.572   33.174 49.927 1.00 71.92  ? 15  U   D N3     1 
ATOM   5555 C C4     . U   D 3 15  ? 4.836   33.334 50.454 1.00 69.99  ? 15  U   D C4     1 
ATOM   5556 O O4     . U   D 3 15  ? 5.576   34.198 49.982 1.00 66.88  ? 15  U   D O4     1 
ATOM   5557 C C5     . U   D 3 15  ? 5.155   32.443 51.529 1.00 69.91  ? 15  U   D C5     1 
ATOM   5558 C C6     . U   D 3 15  ? 4.245   31.549 51.938 1.00 71.71  ? 15  U   D C6     1 
ATOM   5559 H "H5'"  . U   D 3 15  ? 3.139   28.614 55.140 1.00 93.04  ? 15  U   D "H5'"  1 
ATOM   5560 H "H5''" . U   D 3 15  ? 3.496   27.277 54.379 1.00 93.04  ? 15  U   D "H5''" 1 
ATOM   5561 H "H4'"  . U   D 3 15  ? 1.638   28.189 53.391 1.00 95.87  ? 15  U   D "H4'"  1 
ATOM   5562 H "H3'"  . U   D 3 15  ? 3.836   28.506 51.657 1.00 98.73  ? 15  U   D "H3'"  1 
ATOM   5563 H "H2'"  . U   D 3 15  ? 2.413   29.360 50.088 1.00 99.97  ? 15  U   D "H2'"  1 
ATOM   5564 H "HO2'" . U   D 3 15  ? 0.180   29.161 51.282 1.00 104.03 ? 15  U   D "HO2'" 1 
ATOM   5565 H "H1'"  . U   D 3 15  ? 1.115   30.836 51.802 0.00 95.30  ? 15  U   D "H1'"  1 
ATOM   5566 H H3     . U   D 3 15  ? 3.356   33.698 49.280 1.00 89.96  ? 15  U   D H3     1 
ATOM   5567 H H5     . U   D 3 15  ? 5.988   32.485 51.940 1.00 87.64  ? 15  U   D H5     1 
ATOM   5568 H H6     . U   D 3 15  ? 4.466   30.977 52.637 1.00 90.06  ? 15  U   D H6     1 
ATOM   5569 P P      . U   D 3 16  ? 3.698   26.176 50.390 1.00 78.50  ? 16  U   D P      1 
ATOM   5570 O OP1    . U   D 3 16  ? 3.461   24.712 50.456 1.00 80.09  ? 16  U   D OP1    1 
ATOM   5571 O OP2    . U   D 3 16  ? 5.080   26.692 50.561 1.00 79.47  ? 16  U   D OP2    1 
ATOM   5572 O "O5'"  . U   D 3 16  ? 3.141   26.708 48.995 1.00 79.07  ? 16  U   D "O5'"  1 
ATOM   5573 C "C5'"  . U   D 3 16  ? 1.791   26.477 48.622 1.00 81.51  ? 16  U   D "C5'"  1 
ATOM   5574 C "C4'"  . U   D 3 16  ? 1.378   27.319 47.440 1.00 84.18  ? 16  U   D "C4'"  1 
ATOM   5575 O "O4'"  . U   D 3 16  ? 1.415   28.730 47.785 1.00 82.75  ? 16  U   D "O4'"  1 
ATOM   5576 C "C3'"  . U   D 3 16  ? 2.257   27.229 46.206 1.00 83.79  ? 16  U   D "C3'"  1 
ATOM   5577 O "O3'"  . U   D 3 16  ? 2.035   26.057 45.443 1.00 85.34  ? 16  U   D "O3'"  1 
ATOM   5578 C "C2'"  . U   D 3 16  ? 1.911   28.517 45.472 1.00 85.15  ? 16  U   D "C2'"  1 
ATOM   5579 O "O2'"  . U   D 3 16  ? 0.669   28.406 44.793 1.00 90.45  ? 16  U   D "O2'"  1 
ATOM   5580 C "C1'"  . U   D 3 16  ? 1.751   29.490 46.640 1.00 83.02  ? 16  U   D "C1'"  1 
ATOM   5581 N N1     . U   D 3 16  ? 2.999   30.241 46.906 1.00 78.73  ? 16  U   D N1     1 
ATOM   5582 C C2     . U   D 3 16  ? 3.245   31.351 46.124 1.00 78.44  ? 16  U   D C2     1 
ATOM   5583 O O2     . U   D 3 16  ? 2.482   31.723 45.249 1.00 81.00  ? 16  U   D O2     1 
ATOM   5584 N N3     . U   D 3 16  ? 4.415   32.010 46.408 1.00 76.04  ? 16  U   D N3     1 
ATOM   5585 C C4     . U   D 3 16  ? 5.345   31.674 47.371 1.00 75.30  ? 16  U   D C4     1 
ATOM   5586 O O4     . U   D 3 16  ? 6.354   32.368 47.506 1.00 74.94  ? 16  U   D O4     1 
ATOM   5587 C C5     . U   D 3 16  ? 5.021   30.510 48.138 1.00 75.97  ? 16  U   D C5     1 
ATOM   5588 C C6     . U   D 3 16  ? 3.886   29.850 47.880 1.00 76.88  ? 16  U   D C6     1 
ATOM   5589 H "H5'"  . U   D 3 16  ? 1.216   26.687 49.375 1.00 100.91 ? 16  U   D "H5'"  1 
ATOM   5590 H "H5''" . U   D 3 16  ? 1.683   25.540 48.395 1.00 100.91 ? 16  U   D "H5''" 1 
ATOM   5591 H "H4'"  . U   D 3 16  ? 0.470   27.083 47.193 1.00 97.52  ? 16  U   D "H4'"  1 
ATOM   5592 H "H3'"  . U   D 3 16  ? 3.188   27.259 46.477 1.00 95.52  ? 16  U   D "H3'"  1 
ATOM   5593 H "H2'"  . U   D 3 16  ? 2.626   28.791 44.876 1.00 92.70  ? 16  U   D "H2'"  1 
ATOM   5594 H "HO2'" . U   D 3 16  ? 0.754   27.871 44.151 1.00 95.19  ? 16  U   D "HO2'" 1 
ATOM   5595 H "H1'"  . U   D 3 16  ? 1.034   30.114 46.445 1.00 92.02  ? 16  U   D "H1'"  1 
ATOM   5596 H H3     . U   D 3 16  ? 4.588   32.706 45.934 1.00 87.32  ? 16  U   D H3     1 
ATOM   5597 H H5     . U   D 3 16  ? 5.594   30.215 48.809 1.00 91.59  ? 16  U   D H5     1 
ATOM   5598 H H6     . U   D 3 16  ? 3.686   29.096 48.386 1.00 92.49  ? 16  U   D H6     1 
ATOM   5599 P P      . C   D 3 17  ? 3.263   25.353 44.685 1.00 80.31  ? 17  C   D P      1 
ATOM   5600 O OP1    . C   D 3 17  ? 2.811   24.014 44.229 1.00 82.73  ? 17  C   D OP1    1 
ATOM   5601 O OP2    . C   D 3 17  ? 4.472   25.472 45.539 1.00 78.99  ? 17  C   D OP2    1 
ATOM   5602 O "O5'"  . C   D 3 17  ? 3.485   26.258 43.395 1.00 81.88  ? 17  C   D "O5'"  1 
ATOM   5603 C "C5'"  . C   D 3 17  ? 2.465   26.376 42.417 1.00 84.34  ? 17  C   D "C5'"  1 
ATOM   5604 C "C4'"  . C   D 3 17  ? 2.715   27.533 41.485 1.00 84.99  ? 17  C   D "C4'"  1 
ATOM   5605 O "O4'"  . C   D 3 17  ? 2.763   28.774 42.238 1.00 83.92  ? 17  C   D "O4'"  1 
ATOM   5606 C "C3'"  . C   D 3 17  ? 4.030   27.531 40.720 1.00 83.86  ? 17  C   D "C3'"  1 
ATOM   5607 O "O3'"  . C   D 3 17  ? 4.053   26.634 39.621 1.00 83.42  ? 17  C   D "O3'"  1 
ATOM   5608 C "C2'"  . C   D 3 17  ? 4.166   29.000 40.331 1.00 83.01  ? 17  C   D "C2'"  1 
ATOM   5609 O "O2'"  . C   D 3 17  ? 3.294   29.342 39.256 1.00 82.70  ? 17  C   D "O2'"  1 
ATOM   5610 C "C1'"  . C   D 3 17  ? 3.634   29.685 41.592 1.00 81.21  ? 17  C   D "C1'"  1 
ATOM   5611 N N1     . C   D 3 17  ? 4.704   30.085 42.533 1.00 77.67  ? 17  C   D N1     1 
ATOM   5612 C C2     . C   D 3 17  ? 5.441   31.237 42.242 1.00 74.98  ? 17  C   D C2     1 
ATOM   5613 O O2     . C   D 3 17  ? 5.184   31.857 41.199 1.00 73.88  ? 17  C   D O2     1 
ATOM   5614 N N3     . C   D 3 17  ? 6.411   31.633 43.091 1.00 72.80  ? 17  C   D N3     1 
ATOM   5615 C C4     . C   D 3 17  ? 6.640   30.923 44.196 1.00 72.40  ? 17  C   D C4     1 
ATOM   5616 N N4     . C   D 3 17  ? 7.601   31.349 45.011 1.00 71.71  ? 17  C   D N4     1 
ATOM   5617 C C5     . C   D 3 17  ? 5.897   29.752 44.525 1.00 73.97  ? 17  C   D C5     1 
ATOM   5618 C C6     . C   D 3 17  ? 4.943   29.374 43.673 1.00 76.76  ? 17  C   D C6     1 
ATOM   5619 H "H5'"  . C   D 3 17  ? 1.614   26.509 42.863 1.00 102.24 ? 17  C   D "H5'"  1 
ATOM   5620 H "H5''" . C   D 3 17  ? 2.427   25.556 41.900 1.00 102.24 ? 17  C   D "H5''" 1 
ATOM   5621 H "H4'"  . C   D 3 17  ? 1.985   27.582 40.848 1.00 100.19 ? 17  C   D "H4'"  1 
ATOM   5622 H "H3'"  . C   D 3 17  ? 4.748   27.300 41.330 1.00 99.54  ? 17  C   D "H3'"  1 
ATOM   5623 H "H2'"  . C   D 3 17  ? 5.087   29.245 40.149 1.00 97.31  ? 17  C   D "H2'"  1 
ATOM   5624 H "HO2'" . C   D 3 17  ? 2.684   29.840 39.547 1.00 99.24  ? 17  C   D "HO2'" 1 
ATOM   5625 H "H1'"  . C   D 3 17  ? 3.131   30.473 41.334 1.00 95.24  ? 17  C   D "H1'"  1 
ATOM   5626 H H41    . C   D 3 17  ? 7.776   30.915 45.733 1.00 92.90  ? 17  C   D H41    1 
ATOM   5627 H H42    . C   D 3 17  ? 8.048   32.057 44.816 1.00 92.90  ? 17  C   D H42    1 
ATOM   5628 H H5     . C   D 3 17  ? 6.072   29.270 45.301 1.00 93.03  ? 17  C   D H5     1 
ATOM   5629 H H6     . C   D 3 17  ? 4.438   28.614 43.855 1.00 93.20  ? 17  C   D H6     1 
ATOM   5630 P P      . G   D 3 18  ? 5.439   25.962 39.153 1.00 89.96  ? 18  G   D P      1 
ATOM   5631 O OP1    . G   D 3 18  ? 5.131   24.884 38.185 1.00 89.95  ? 18  G   D OP1    1 
ATOM   5632 O OP2    . G   D 3 18  ? 6.258   25.647 40.345 1.00 88.93  ? 18  G   D OP2    1 
ATOM   5633 O "O5'"  . G   D 3 18  ? 6.180   27.126 38.362 1.00 91.36  ? 18  G   D "O5'"  1 
ATOM   5634 C "C5'"  . G   D 3 18  ? 5.574   27.711 37.220 1.00 91.57  ? 18  G   D "C5'"  1 
ATOM   5635 C "C4'"  . G   D 3 18  ? 6.313   28.943 36.773 1.00 92.08  ? 18  G   D "C4'"  1 
ATOM   5636 O "O4'"  . G   D 3 18  ? 6.253   29.976 37.793 1.00 90.54  ? 18  G   D "O4'"  1 
ATOM   5637 C "C3'"  . G   D 3 18  ? 7.799   28.747 36.551 1.00 94.07  ? 18  G   D "C3'"  1 
ATOM   5638 O "O3'"  . G   D 3 18  ? 8.095   28.093 35.334 1.00 93.86  ? 18  G   D "O3'"  1 
ATOM   5639 C "C2'"  . G   D 3 18  ? 8.329   30.166 36.658 1.00 91.84  ? 18  G   D "C2'"  1 
ATOM   5640 O "O2'"  . G   D 3 18  ? 8.074   30.903 35.471 1.00 89.22  ? 18  G   D "O2'"  1 
ATOM   5641 C "C1'"  . G   D 3 18  ? 7.457   30.718 37.787 1.00 88.60  ? 18  G   D "C1'"  1 
ATOM   5642 N N9     . G   D 3 18  ? 8.115   30.576 39.100 1.00 88.01  ? 18  G   D N9     1 
ATOM   5643 C C8     . G   D 3 18  ? 7.825   29.667 40.087 1.00 88.71  ? 18  G   D C8     1 
ATOM   5644 N N7     . G   D 3 18  ? 8.592   29.782 41.136 1.00 85.57  ? 18  G   D N7     1 
ATOM   5645 C C5     . G   D 3 18  ? 9.448   30.827 40.821 1.00 83.51  ? 18  G   D C5     1 
ATOM   5646 C C6     . G   D 3 18  ? 10.499  31.403 41.577 1.00 79.96  ? 18  G   D C6     1 
ATOM   5647 O O6     . G   D 3 18  ? 10.893  31.094 42.709 1.00 78.74  ? 18  G   D O6     1 
ATOM   5648 N N1     . G   D 3 18  ? 11.113  32.442 40.882 1.00 78.18  ? 18  G   D N1     1 
ATOM   5649 C C2     . G   D 3 18  ? 10.757  32.865 39.623 1.00 80.75  ? 18  G   D C2     1 
ATOM   5650 N N2     . G   D 3 18  ? 11.460  33.881 39.111 1.00 77.79  ? 18  G   D N2     1 
ATOM   5651 N N3     . G   D 3 18  ? 9.778   32.334 38.909 1.00 83.09  ? 18  G   D N3     1 
ATOM   5652 C C4     . G   D 3 18  ? 9.170   31.325 39.566 1.00 84.97  ? 18  G   D C4     1 
ATOM   5653 H "H5'"  . G   D 3 18  ? 4.659   27.951 37.434 1.00 111.67 ? 18  G   D "H5'"  1 
ATOM   5654 H "H5''" . G   D 3 18  ? 5.571   27.064 36.497 1.00 111.67 ? 18  G   D "H5''" 1 
ATOM   5655 H "H4'"  . G   D 3 18  ? 5.911   29.277 35.956 1.00 111.68 ? 18  G   D "H4'"  1 
ATOM   5656 H "H3'"  . G   D 3 18  ? 8.158   28.222 37.284 1.00 113.23 ? 18  G   D "H3'"  1 
ATOM   5657 H "H2'"  . G   D 3 18  ? 9.269   30.179 36.896 1.00 108.25 ? 18  G   D "H2'"  1 
ATOM   5658 H "HO2'" . G   D 3 18  ? 8.377   31.681 35.562 1.00 106.84 ? 18  G   D "HO2'" 1 
ATOM   5659 H "H1'"  . G   D 3 18  ? 7.262   31.654 37.620 1.00 105.44 ? 18  G   D "H1'"  1 
ATOM   5660 H H8     . G   D 3 18  ? 7.145   29.037 40.017 1.00 106.48 ? 18  G   D H8     1 
ATOM   5661 H H1     . G   D 3 18  ? 11.764  32.849 41.269 1.00 98.68  ? 18  G   D H1     1 
ATOM   5662 H H21    . G   D 3 18  ? 12.099  34.235 39.565 1.00 98.77  ? 18  G   D H21    1 
ATOM   5663 H H22    . G   D 3 18  ? 11.273  34.182 38.327 1.00 98.77  ? 18  G   D H22    1 
ATOM   5664 P P      . A   D 3 19  ? 9.291   27.023 35.282 1.00 91.18  ? 19  A   D P      1 
ATOM   5665 O OP1    . A   D 3 19  ? 9.196   26.282 33.999 1.00 91.41  ? 19  A   D OP1    1 
ATOM   5666 O OP2    . A   D 3 19  ? 9.299   26.269 36.560 1.00 91.41  ? 19  A   D OP2    1 
ATOM   5667 O "O5'"  . A   D 3 19  ? 10.589  27.939 35.230 1.00 92.22  ? 19  A   D "O5'"  1 
ATOM   5668 C "C5'"  . A   D 3 19  ? 10.695  28.954 34.246 1.00 92.51  ? 19  A   D "C5'"  1 
ATOM   5669 C "C4'"  . A   D 3 19  ? 11.862  29.871 34.500 1.00 94.02  ? 19  A   D "C4'"  1 
ATOM   5670 O "O4'"  . A   D 3 19  ? 11.618  30.698 35.668 1.00 88.75  ? 19  A   D "O4'"  1 
ATOM   5671 C "C3'"  . A   D 3 19  ? 13.188  29.199 34.804 1.00 94.18  ? 19  A   D "C3'"  1 
ATOM   5672 O "O3'"  . A   D 3 19  ? 13.835  28.709 33.643 1.00 95.89  ? 19  A   D "O3'"  1 
ATOM   5673 C "C2'"  . A   D 3 19  ? 13.961  30.304 35.514 1.00 88.57  ? 19  A   D "C2'"  1 
ATOM   5674 O "O2'"  . A   D 3 19  ? 14.527  31.214 34.582 1.00 88.78  ? 19  A   D "O2'"  1 
ATOM   5675 C "C1'"  . A   D 3 19  ? 12.847  31.010 36.294 1.00 84.30  ? 19  A   D "C1'"  1 
ATOM   5676 N N9     . A   D 3 19  ? 12.801  30.586 37.706 1.00 81.12  ? 19  A   D N9     1 
ATOM   5677 C C8     . A   D 3 19  ? 11.958  29.695 38.323 1.00 82.51  ? 19  A   D C8     1 
ATOM   5678 N N7     . A   D 3 19  ? 12.198  29.548 39.605 1.00 80.23  ? 19  A   D N7     1 
ATOM   5679 C C5     . A   D 3 19  ? 13.269  30.397 39.847 1.00 77.63  ? 19  A   D C5     1 
ATOM   5680 C C6     . A   D 3 19  ? 13.999  30.703 41.010 1.00 77.74  ? 19  A   D C6     1 
ATOM   5681 N N6     . A   D 3 19  ? 13.752  30.163 42.206 1.00 79.04  ? 19  A   D N6     1 
ATOM   5682 N N1     . A   D 3 19  ? 15.008  31.595 40.902 1.00 77.68  ? 19  A   D N1     1 
ATOM   5683 C C2     . A   D 3 19  ? 15.260  32.139 39.705 1.00 76.38  ? 19  A   D C2     1 
ATOM   5684 N N3     . A   D 3 19  ? 14.645  31.932 38.543 1.00 75.40  ? 19  A   D N3     1 
ATOM   5685 C C4     . A   D 3 19  ? 13.649  31.041 38.686 1.00 77.02  ? 19  A   D C4     1 
ATOM   5686 H "H5'"  . A   D 3 19  ? 9.878   29.477 34.243 1.00 113.70 ? 19  A   D "H5'"  1 
ATOM   5687 H "H5''" . A   D 3 19  ? 10.806  28.538 33.376 1.00 113.70 ? 19  A   D "H5''" 1 
ATOM   5688 H "H4'"  . A   D 3 19  ? 11.977  30.449 33.729 1.00 111.46 ? 19  A   D "H4'"  1 
ATOM   5689 H "H3'"  . A   D 3 19  ? 13.041  28.466 35.421 1.00 113.88 ? 19  A   D "H3'"  1 
ATOM   5690 H "H2'"  . A   D 3 19  ? 14.633  29.939 36.110 1.00 105.45 ? 19  A   D "H2'"  1 
ATOM   5691 H "HO2'" . A   D 3 19  ? 14.135  31.954 34.649 0.00 106.22 ? 19  A   D "HO2'" 1 
ATOM   5692 H "H1'"  . A   D 3 19  ? 12.989  31.968 36.254 1.00 96.36  ? 19  A   D "H1'"  1 
ATOM   5693 H H8     . A   D 3 19  ? 11.282  29.239 37.875 1.00 94.79  ? 19  A   D H8     1 
ATOM   5694 H H61    . A   D 3 19  ? 14.231  30.386 42.885 1.00 101.41 ? 19  A   D H61    1 
ATOM   5695 H H62    . A   D 3 19  ? 13.115  29.593 42.297 1.00 101.41 ? 19  A   D H62    1 
ATOM   5696 H H2     . A   D 3 19  ? 15.963  32.747 39.682 1.00 96.38  ? 19  A   D H2     1 
ATOM   5697 P P      . U   D 3 20  ? 14.544  27.267 33.661 1.00 120.97 ? 20  U   D P      1 
ATOM   5698 O OP1    . U   D 3 20  ? 13.788  26.373 32.748 1.00 120.00 ? 20  U   D OP1    1 
ATOM   5699 O OP2    . U   D 3 20  ? 14.748  26.863 35.072 1.00 119.49 ? 20  U   D OP2    1 
ATOM   5700 O "O5'"  . U   D 3 20  ? 15.983  27.518 33.023 1.00 122.93 ? 20  U   D "O5'"  1 
ATOM   5701 C "C5'"  . U   D 3 20  ? 16.421  28.819 32.638 1.00 124.82 ? 20  U   D "C5'"  1 
ATOM   5702 C "C4'"  . U   D 3 20  ? 16.351  29.004 31.142 1.00 126.84 ? 20  U   D "C4'"  1 
ATOM   5703 O "O4'"  . U   D 3 20  ? 17.291  30.042 30.737 1.00 127.51 ? 20  U   D "O4'"  1 
ATOM   5704 C "C3'"  . U   D 3 20  ? 16.717  27.771 30.317 1.00 127.90 ? 20  U   D "C3'"  1 
ATOM   5705 O "O3'"  . U   D 3 20  ? 15.960  27.788 29.106 1.00 128.81 ? 20  U   D "O3'"  1 
ATOM   5706 C "C2'"  . U   D 3 20  ? 18.188  28.018 30.007 1.00 128.13 ? 20  U   D "C2'"  1 
ATOM   5707 O "O2'"  . U   D 3 20  ? 18.704  27.295 28.909 1.00 131.64 ? 20  U   D "O2'"  1 
ATOM   5708 C "C1'"  . U   D 3 20  ? 18.163  29.517 29.753 1.00 127.81 ? 20  U   D "C1'"  1 
ATOM   5709 N N1     . U   D 3 20  ? 19.465  30.196 29.828 1.00 126.47 ? 20  U   D N1     1 
ATOM   5710 C C2     . U   D 3 20  ? 19.891  30.775 31.010 1.00 123.40 ? 20  U   D C2     1 
ATOM   5711 O O2     . U   D 3 20  ? 19.259  30.739 32.052 1.00 122.77 ? 20  U   D O2     1 
ATOM   5712 N N3     . U   D 3 20  ? 21.115  31.391 30.930 1.00 119.86 ? 20  U   D N3     1 
ATOM   5713 C C4     . U   D 3 20  ? 21.925  31.497 29.818 1.00 120.35 ? 20  U   D C4     1 
ATOM   5714 O O4     . U   D 3 20  ? 22.998  32.091 29.915 1.00 118.71 ? 20  U   D O4     1 
ATOM   5715 C C5     . U   D 3 20  ? 21.409  30.886 28.632 1.00 124.55 ? 20  U   D C5     1 
ATOM   5716 C C6     . U   D 3 20  ? 20.223  30.277 28.684 1.00 126.71 ? 20  U   D C6     1 
ATOM   5717 H "H5'"  . U   D 3 20  ? 17.337  28.944 32.930 1.00 153.13 ? 20  U   D "H5'"  1 
ATOM   5718 H "H5''" . U   D 3 20  ? 15.858  29.483 33.066 1.00 153.13 ? 20  U   D "H5''" 1 
ATOM   5719 H "H4'"  . U   D 3 20  ? 15.453  29.284 30.904 1.00 157.31 ? 20  U   D "H4'"  1 
ATOM   5720 H "H3'"  . U   D 3 20  ? 16.586  26.950 30.818 1.00 171.83 ? 20  U   D "H3'"  1 
ATOM   5721 H "H2'"  . U   D 3 20  ? 18.721  27.833 30.796 1.00 175.51 ? 20  U   D "H2'"  1 
ATOM   5722 H "HO2'" . U   D 3 20  ? 18.909  27.835 28.299 1.00 186.61 ? 20  U   D "HO2'" 1 
ATOM   5723 H "H1'"  . U   D 3 20  ? 17.778  29.678 28.877 1.00 162.19 ? 20  U   D "H1'"  1 
ATOM   5724 H H3     . U   D 3 20  ? 21.409  31.753 31.652 1.00 154.89 ? 20  U   D H3     1 
ATOM   5725 H H5     . U   D 3 20  ? 21.893  30.911 27.838 1.00 160.00 ? 20  U   D H5     1 
ATOM   5726 H H6     . U   D 3 20  ? 19.895  29.884 27.908 1.00 161.83 ? 20  U   D H6     1 
ATOM   5727 P P      . U   D 3 21  ? 14.963  26.582 28.748 1.00 188.85 ? 21  U   D P      1 
ATOM   5728 O OP1    . U   D 3 21  ? 14.815  26.544 27.270 1.00 188.17 ? 21  U   D OP1    1 
ATOM   5729 O OP2    . U   D 3 21  ? 13.752  26.660 29.605 1.00 191.58 ? 21  U   D OP2    1 
ATOM   5730 O "O5'"  . U   D 3 21  ? 15.789  25.296 29.178 1.00 183.15 ? 21  U   D "O5'"  1 
ATOM   5731 C "C5'"  . U   D 3 21  ? 16.989  24.961 28.505 1.00 178.94 ? 21  U   D "C5'"  1 
ATOM   5732 C "C4'"  . U   D 3 21  ? 16.777  23.773 27.610 1.00 174.42 ? 21  U   D "C4'"  1 
ATOM   5733 O "O4'"  . U   D 3 21  ? 17.915  22.879 27.721 1.00 167.71 ? 21  U   D "O4'"  1 
ATOM   5734 C "C3'"  . U   D 3 21  ? 15.579  22.906 27.971 1.00 169.05 ? 21  U   D "C3'"  1 
ATOM   5735 O "O3'"  . U   D 3 21  ? 14.360  23.392 27.436 1.00 170.71 ? 21  U   D "O3'"  1 
ATOM   5736 C "C2'"  . U   D 3 21  ? 15.983  21.544 27.436 1.00 165.19 ? 21  U   D "C2'"  1 
ATOM   5737 O "O2'"  . U   D 3 21  ? 15.828  21.501 26.025 1.00 165.66 ? 21  U   D "O2'"  1 
ATOM   5738 C "C1'"  . U   D 3 21  ? 17.475  21.541 27.753 1.00 164.75 ? 21  U   D "C1'"  1 
ATOM   5739 N N1     . U   D 3 21  ? 17.758  21.013 29.104 1.00 164.45 ? 21  U   D N1     1 
ATOM   5740 C C2     . U   D 3 21  ? 17.194  19.816 29.506 1.00 162.26 ? 21  U   D C2     1 
ATOM   5741 O O2     . U   D 3 21  ? 16.446  19.154 28.806 1.00 160.59 ? 21  U   D O2     1 
ATOM   5742 N N3     . U   D 3 21  ? 17.531  19.429 30.779 1.00 166.87 ? 21  U   D N3     1 
ATOM   5743 C C4     . U   D 3 21  ? 18.361  20.093 31.661 1.00 169.06 ? 21  U   D C4     1 
ATOM   5744 O O4     . U   D 3 21  ? 18.571  19.613 32.775 1.00 169.13 ? 21  U   D O4     1 
ATOM   5745 C C5     . U   D 3 21  ? 18.908  21.317 31.165 1.00 171.32 ? 21  U   D C5     1 
ATOM   5746 C C6     . U   D 3 21  ? 18.595  21.721 29.933 1.00 166.61 ? 21  U   D C6     1 
HETATM 5747 O O      . HOH E 4 .   ? 7.454   67.891 82.379 1.00 80.97  ? 201 HOH A O      1 
HETATM 5748 O O      . HOH E 4 .   ? 0.185   45.108 69.903 1.00 30.59  ? 202 HOH A O      1 
HETATM 5749 O O      . HOH E 4 .   ? 10.332  28.873 59.057 1.00 46.07  ? 203 HOH A O      1 
HETATM 5750 O O      . HOH E 4 .   ? 11.350  69.428 59.610 1.00 45.02  ? 204 HOH A O      1 
HETATM 5751 O O      . HOH E 4 .   ? 0.879   51.041 72.751 1.00 44.05  ? 205 HOH A O      1 
HETATM 5752 O O      . HOH E 4 .   ? 8.436   47.498 66.035 1.00 15.33  ? 206 HOH A O      1 
HETATM 5753 O O      . HOH E 4 .   ? 2.496   48.736 75.108 1.00 18.89  ? 207 HOH A O      1 
HETATM 5754 O O      . HOH E 4 .   ? 9.124   53.601 66.410 1.00 52.41  ? 208 HOH A O      1 
HETATM 5755 O O      . HOH E 4 .   ? 29.540  51.315 67.323 1.00 58.44  ? 209 HOH A O      1 
HETATM 5756 O O      . HOH E 4 .   ? -1.778  47.275 68.140 1.00 56.39  ? 210 HOH A O      1 
HETATM 5757 O O      . HOH E 4 .   ? 1.162   48.877 70.849 1.00 36.95  ? 211 HOH A O      1 
HETATM 5758 O O      . HOH E 4 .   ? 8.727   63.710 65.100 1.00 65.76  ? 212 HOH A O      1 
HETATM 5759 O O      . HOH E 4 .   ? 16.442  76.059 66.913 1.00 59.46  ? 213 HOH A O      1 
HETATM 5760 O O      . HOH E 4 .   ? 0.212   59.499 79.083 1.00 48.52  ? 214 HOH A O      1 
HETATM 5761 O O      . HOH E 4 .   ? -5.332  46.473 64.808 1.00 49.82  ? 215 HOH A O      1 
HETATM 5762 O O      . HOH E 4 .   ? 5.525   50.328 85.699 1.00 46.57  ? 216 HOH A O      1 
HETATM 5763 O O      . HOH E 4 .   ? 16.726  54.031 90.277 1.00 43.40  ? 217 HOH A O      1 
HETATM 5764 O O      . HOH E 4 .   ? 10.209  62.597 83.969 1.00 60.15  ? 218 HOH A O      1 
HETATM 5765 O O      . HOH E 4 .   ? -6.296  26.851 67.804 1.00 50.36  ? 219 HOH A O      1 
HETATM 5766 O O      . HOH E 4 .   ? 12.367  68.459 80.831 1.00 55.96  ? 220 HOH A O      1 
HETATM 5767 O O      . HOH F 4 .   ? 31.000  32.262 42.366 1.00 35.35  ? 201 HOH B O      1 
HETATM 5768 O O      . HOH F 4 .   ? 3.998   66.434 33.301 1.00 146.97 ? 202 HOH B O      1 
HETATM 5769 O O      . HOH F 4 .   ? 11.280  66.192 47.997 1.00 44.40  ? 203 HOH B O      1 
HETATM 5770 O O      . HOH F 4 .   ? 20.208  37.431 55.351 1.00 73.65  ? 204 HOH B O      1 
HETATM 5771 O O      . HOH F 4 .   ? 12.716  52.560 59.824 1.00 41.46  ? 205 HOH B O      1 
HETATM 5772 O O      . HOH F 4 .   ? 12.463  51.878 41.947 1.00 14.74  ? 206 HOH B O      1 
HETATM 5773 O O      . HOH F 4 .   ? 14.502  43.750 48.638 1.00 40.15  ? 207 HOH B O      1 
HETATM 5774 O O      . HOH F 4 .   ? 25.615  67.437 37.353 1.00 52.72  ? 208 HOH B O      1 
HETATM 5775 O O      . HOH F 4 .   ? 3.765   72.608 50.000 1.00 42.36  ? 209 HOH B O      1 
HETATM 5776 O O      . HOH F 4 .   ? 23.410  36.980 37.838 1.00 45.05  ? 210 HOH B O      1 
HETATM 5777 O O      . HOH F 4 .   ? 27.679  38.633 40.070 1.00 73.41  ? 211 HOH B O      1 
HETATM 5778 O O      . HOH F 4 .   ? 11.395  49.766 42.551 1.00 39.70  ? 212 HOH B O      1 
HETATM 5779 O O      . HOH F 4 .   ? 29.316  43.629 35.688 1.00 46.60  ? 213 HOH B O      1 
HETATM 5780 O O      . HOH F 4 .   ? 16.248  29.461 59.400 1.00 49.01  ? 214 HOH B O      1 
HETATM 5781 O O      . HOH F 4 .   ? 13.683  33.658 53.288 1.00 42.40  ? 215 HOH B O      1 
HETATM 5782 O O      . HOH F 4 .   ? 1.674   67.530 31.498 1.00 53.06  ? 216 HOH B O      1 
HETATM 5783 O O      . HOH F 4 .   ? 33.051  37.488 42.289 1.00 41.70  ? 217 HOH B O      1 
HETATM 5784 O O      . HOH F 4 .   ? 27.004  36.088 36.651 1.00 63.05  ? 218 HOH B O      1 
HETATM 5785 O O      . HOH F 4 .   ? 12.340  46.995 32.738 1.00 78.89  ? 219 HOH B O      1 
HETATM 5786 O O      . HOH G 4 .   ? 13.774  39.140 44.836 1.00 42.19  ? 101 HOH C O      1 
HETATM 5787 O O      . HOH G 4 .   ? 15.112  44.197 42.725 1.00 40.72  ? 102 HOH C O      1 
HETATM 5788 O O      . HOH G 4 .   ? 15.925  35.924 48.370 1.00 42.15  ? 103 HOH C O      1 
HETATM 5789 O O      . HOH G 4 .   ? -9.488  58.599 83.131 1.00 52.35  ? 104 HOH C O      1 
HETATM 5790 O O      . HOH G 4 .   ? 10.714  56.846 54.309 1.00 37.77  ? 105 HOH C O      1 
HETATM 5791 O O      . HOH G 4 .   ? 6.014   68.937 56.807 1.00 57.58  ? 106 HOH C O      1 
HETATM 5792 O O      . HOH G 4 .   ? 5.455   53.849 66.383 1.00 50.70  ? 107 HOH C O      1 
HETATM 5793 O O      . HOH G 4 .   ? 2.624   42.067 49.748 1.00 53.17  ? 108 HOH C O      1 
HETATM 5794 O O      . HOH G 4 .   ? 15.520  38.694 50.550 1.00 48.10  ? 109 HOH C O      1 
HETATM 5795 O O      . HOH G 4 .   ? 11.689  35.623 46.491 1.00 46.83  ? 110 HOH C O      1 
HETATM 5796 O O      . HOH G 4 .   ? -3.950  61.950 80.233 1.00 66.01  ? 111 HOH C O      1 
HETATM 5797 O O      . HOH G 4 .   ? 3.003   41.000 36.644 1.00 55.65  ? 112 HOH C O      1 
HETATM 5798 O O      . HOH G 4 .   ? 5.460   40.025 47.439 1.00 62.99  ? 113 HOH C O      1 
HETATM 5799 O O      . HOH G 4 .   ? 14.060  35.432 47.069 1.00 51.50  ? 114 HOH C O      1 
HETATM 5800 O O      . HOH G 4 .   ? -10.249 59.190 72.592 1.00 28.34  ? 115 HOH C O      1 
HETATM 5801 O O      . HOH G 4 .   ? 6.088   63.953 62.031 1.00 56.80  ? 116 HOH C O      1 
HETATM 5802 O O      . HOH H 4 .   ? 6.287   39.801 59.676 1.00 34.29  ? 101 HOH D O      1 
HETATM 5803 O O      . HOH H 4 .   ? 0.041   58.277 68.058 1.00 37.98  ? 102 HOH D O      1 
HETATM 5804 O O      . HOH H 4 .   ? -0.908  61.423 64.555 1.00 79.22  ? 103 HOH D O      1 
HETATM 5805 O O      . HOH H 4 .   ? 7.320   24.864 55.820 1.00 38.05  ? 104 HOH D O      1 
HETATM 5806 O O      . HOH H 4 .   ? -1.740  53.185 55.370 1.00 88.64  ? 105 HOH D O      1 
HETATM 5807 O O      . HOH H 4 .   ? -3.245  51.242 44.645 1.00 97.35  ? 106 HOH D O      1 
HETATM 5808 O O      . HOH H 4 .   ? 9.807   27.302 55.944 1.00 44.61  ? 107 HOH D O      1 
HETATM 5809 O O      . HOH H 4 .   ? -10.073 49.061 64.041 1.00 61.91  ? 108 HOH D O      1 
HETATM 5810 O O      . HOH H 4 .   ? 4.944   45.564 45.873 1.00 65.89  ? 109 HOH D O      1 
HETATM 5811 O O      . HOH H 4 .   ? -3.538  52.879 58.901 1.00 87.17  ? 110 HOH D O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLU A 2   ? 1.2952 1.1228 1.5929 -0.0844 -0.2579 -0.2052 2   GLU A N     
2    C CA    . GLU A 2   ? 1.3602 1.1473 1.7499 -0.1340 -0.2232 -0.2047 2   GLU A CA    
3    C C     . GLU A 2   ? 1.3766 1.1756 1.8602 -0.1418 -0.1834 -0.2097 2   GLU A C     
4    O O     . GLU A 2   ? 1.3571 1.2487 2.0068 -0.1477 -0.1768 -0.2252 2   GLU A O     
5    C CB    . GLU A 2   ? 1.3925 1.0509 1.6681 -0.1702 -0.1806 -0.1736 2   GLU A CB    
6    C CG    . GLU A 2   ? 1.4405 1.0867 1.7636 -0.1982 -0.1854 -0.1718 2   GLU A CG    
7    C CD    . GLU A 2   ? 1.4909 1.0471 1.6734 -0.2059 -0.1647 -0.1549 2   GLU A CD    
8    O OE1   . GLU A 2   ? 1.4532 1.0056 1.5305 -0.1775 -0.1629 -0.1518 2   GLU A OE1   
9    O OE2   . GLU A 2   ? 1.5613 1.0653 1.7621 -0.2353 -0.1479 -0.1455 2   GLU A OE2   
10   N N     . ARG A 3   ? 1.3540 1.0812 1.7094 -0.1285 -0.1362 -0.1815 3   ARG A N     
11   C CA    . ARG A 3   ? 1.3653 0.9916 1.5429 -0.1223 -0.1476 -0.1710 3   ARG A CA    
12   C C     . ARG A 3   ? 1.4716 0.9680 1.5455 -0.1407 -0.0754 -0.1332 3   ARG A C     
13   O O     . ARG A 3   ? 1.4608 0.8994 1.3990 -0.1230 -0.0669 -0.1244 3   ARG A O     
14   C CB    . ARG A 3   ? 1.3447 1.0078 1.4623 -0.0756 -0.1685 -0.1799 3   ARG A CB    
15   C CG    . ARG A 3   ? 1.3040 0.9640 1.2925 -0.0587 -0.1753 -0.1585 3   ARG A CG    
16   C CD    . ARG A 3   ? 1.2783 0.9661 1.2276 -0.0202 -0.1798 -0.1529 3   ARG A CD    
17   N NE    . ARG A 3   ? 1.1921 0.9827 1.2026 0.0206  -0.2246 -0.1603 3   ARG A NE    
18   C CZ    . ARG A 3   ? 1.1094 0.9246 1.0881 0.0485  -0.2273 -0.1363 3   ARG A CZ    
19   N NH1   . ARG A 3   ? 1.1086 0.8814 1.0191 0.0377  -0.2055 -0.1092 3   ARG A NH1   
20   N NH2   . ARG A 3   ? 1.0645 0.9391 1.0911 0.0893  -0.2408 -0.1441 3   ARG A NH2   
21   N N     . ALA A 4   ? 2.0648 1.5498 2.2042 -0.1639 -0.0093 -0.1039 4   ALA A N     
22   C CA    . ALA A 4   ? 2.0432 1.6126 2.3702 -0.1891 -0.0001 -0.1070 4   ALA A CA    
23   C C     . ALA A 4   ? 2.1412 1.6858 2.4959 -0.1998 0.1025  -0.0576 4   ALA A C     
24   O O     . ALA A 4   ? 2.2157 1.6543 2.4269 -0.1908 0.1594  -0.0218 4   ALA A O     
25   C CB    . ALA A 4   ? 2.0065 1.5507 2.3759 -0.2230 -0.0483 -0.1220 4   ALA A CB    
26   N N     . ILE A 5   ? 1.6078 1.2534 2.1477 -0.2142 0.1249  -0.0576 5   ILE A N     
27   C CA    . ILE A 5   ? 1.5187 1.2926 2.2283 -0.2175 0.0489  -0.1097 5   ILE A CA    
28   C C     . ILE A 5   ? 1.5259 1.4103 2.2441 -0.1662 0.0212  -0.1365 5   ILE A C     
29   O O     . ILE A 5   ? 1.4491 1.4258 2.2359 -0.1460 -0.0589 -0.1852 5   ILE A O     
30   C CB    . ILE A 5   ? 1.4827 1.3209 2.4071 -0.2559 0.0801  -0.1045 5   ILE A CB    
31   C CG1   . ILE A 5   ? 1.3480 1.3165 2.4502 -0.2556 -0.0126 -0.1714 5   ILE A CG1   
32   C CG2   . ILE A 5   ? 1.5497 1.4370 2.5266 -0.2435 0.1711  -0.0663 5   ILE A CG2   
33   C CD1   . ILE A 5   ? 1.3331 1.2643 2.3389 -0.2453 -0.0968 -0.1984 5   ILE A CD1   
34   N N     . GLN A 6   ? 1.3484 1.2214 1.9930 -0.1391 0.0888  -0.1036 6   GLN A N     
35   C CA    . GLN A 6   ? 1.3605 1.3214 1.9968 -0.0861 0.0748  -0.1194 6   GLN A CA    
36   C C     . GLN A 6   ? 1.3217 1.2272 1.8062 -0.0602 0.0242  -0.1324 6   GLN A C     
37   O O     . GLN A 6   ? 1.3736 1.1679 1.7064 -0.0579 0.0579  -0.1068 6   GLN A O     
38   C CB    . GLN A 6   ? 1.4705 1.4264 2.0772 -0.0659 0.1655  -0.0793 6   GLN A CB    
39   C CG    . GLN A 6   ? 1.4857 1.5105 2.2528 -0.0864 0.2233  -0.0618 6   GLN A CG    
40   C CD    . GLN A 6   ? 1.5237 1.4421 2.2690 -0.1307 0.2876  -0.0178 6   GLN A CD    
41   O OE1   . GLN A 6   ? 1.5564 1.3439 2.1458 -0.1393 0.2923  -0.0005 6   GLN A OE1   
42   N NE2   . GLN A 6   ? 1.5081 1.4849 2.4128 -0.1549 0.3396  0.0020  6   GLN A NE2   
43   N N     . GLY A 7   ? 1.5054 1.4919 2.0351 -0.0367 -0.0574 -0.1738 7   GLY A N     
44   C CA    . GLY A 7   ? 1.4289 1.3720 1.8328 -0.0128 -0.1052 -0.1831 7   GLY A CA    
45   C C     . GLY A 7   ? 1.4485 1.3734 1.7557 0.0278  -0.0661 -0.1597 7   GLY A C     
46   O O     . GLY A 7   ? 1.4134 1.2515 1.5943 0.0310  -0.0736 -0.1516 7   GLY A O     
47   N N     . ASN A 8   ? 1.2346 1.2408 1.6064 0.0598  -0.0251 -0.1502 8   ASN A N     
48   C CA    . ASN A 8   ? 1.2117 1.2034 1.5057 0.1020  0.0141  -0.1278 8   ASN A CA    
49   C C     . ASN A 8   ? 1.3189 1.2021 1.5251 0.0850  0.0928  -0.0936 8   ASN A C     
50   O O     . ASN A 8   ? 1.3108 1.1483 1.4331 0.1128  0.1212  -0.0782 8   ASN A O     
51   C CB    . ASN A 8   ? 1.1271 1.2582 1.5219 0.1555  0.0200  -0.1340 8   ASN A CB    
52   C CG    . ASN A 8   ? 0.9771 1.2138 1.4255 0.1970  -0.0578 -0.1671 8   ASN A CG    
53   O OD1   . ASN A 8   ? 0.9263 1.1250 1.3065 0.2004  -0.1047 -0.1743 8   ASN A OD1   
54   N ND2   . ASN A 8   ? 0.8909 1.2653 1.4607 0.2350  -0.0730 -0.1887 8   ASN A ND2   
61   N N     . ASP A 9   ? 0.9895 0.8291 1.2144 0.0445  0.1299  -0.0806 9   ASP A N     
62   C CA    . ASP A 9   ? 1.0665 0.8081 1.2000 0.0406  0.2068  -0.0473 9   ASP A CA    
63   C C     . ASP A 9   ? 1.0203 0.6200 0.9913 0.0316  0.1972  -0.0457 9   ASP A C     
64   O O     . ASP A 9   ? 1.0619 0.5825 0.9325 0.0493  0.2433  -0.0301 9   ASP A O     
65   C CB    . ASP A 9   ? 1.1344 0.8764 1.3395 0.0075  0.2568  -0.0264 9   ASP A CB    
66   C CG    . ASP A 9   ? 1.1490 1.0279 1.5152 0.0207  0.2828  -0.0254 9   ASP A CG    
67   O OD1   . ASP A 9   ? 1.0897 1.0555 1.4903 0.0629  0.2674  -0.0392 9   ASP A OD1   
68   O OD2   . ASP A 9   ? 1.1414 1.0419 1.6032 -0.0085 0.3213  -0.0093 9   ASP A OD2   
73   N N     . THR A 10  ? 1.1590 0.7261 1.1029 0.0079  0.1346  -0.0659 10  THR A N     
74   C CA    . THR A 10  ? 1.1183 0.5636 0.9156 0.0040  0.1162  -0.0712 10  THR A CA    
75   C C     . THR A 10  ? 1.0565 0.5066 0.8137 0.0380  0.0981  -0.0804 10  THR A C     
76   O O     . THR A 10  ? 1.0609 0.4320 0.7188 0.0448  0.1096  -0.0777 10  THR A O     
77   C CB    . THR A 10  ? 1.0528 0.4698 0.8368 -0.0267 0.0528  -0.0904 10  THR A CB    
78   O OG1   . THR A 10  ? 1.0166 0.3817 0.6932 -0.0255 0.0316  -0.0895 10  THR A OG1   
79   C CG2   . THR A 10  ? 0.9554 0.4794 0.8289 -0.0166 -0.0172 -0.1165 10  THR A CG2   
87   N N     . ARG A 11  ? 0.9785 0.5408 0.8259 0.0620  0.0669  -0.0889 11  ARG A N     
88   C CA    . ARG A 11  ? 0.9185 0.4942 0.7466 0.1006  0.0667  -0.0858 11  ARG A CA    
89   C C     . ARG A 11  ? 0.9684 0.5134 0.7704 0.1232  0.1378  -0.0653 11  ARG A C     
90   O O     . ARG A 11  ? 0.9519 0.4363 0.6910 0.1387  0.1495  -0.0618 11  ARG A O     
91   C CB    . ARG A 11  ? 0.8430 0.5551 0.7732 0.1346  0.0303  -0.0923 11  ARG A CB    
92   C CG    . ARG A 11  ? 0.7725 0.5203 0.7077 0.1860  0.0506  -0.0763 11  ARG A CG    
93   C CD    . ARG A 11  ? 0.6630 0.5508 0.6892 0.2309  0.0143  -0.0820 11  ARG A CD    
94   N NE    . ARG A 11  ? 0.5810 0.5076 0.6139 0.2775  0.0401  -0.0569 11  ARG A NE    
95   C CZ    . ARG A 11  ? 0.5520 0.4591 0.5528 0.2667  0.0257  -0.0408 11  ARG A CZ    
96   N NH1   . ARG A 11  ? 0.5491 0.3996 0.5021 0.2415  -0.0126 -0.0522 11  ARG A NH1   
97   N NH2   . ARG A 11  ? 0.5474 0.4903 0.5646 0.2776  0.0484  -0.0159 11  ARG A NH2   
111  N N     . GLU A 12  ? 1.0597 0.6523 0.9199 0.1244  0.1839  -0.0520 12  GLU A N     
112  C CA    . GLU A 12  ? 1.1030 0.6736 0.9395 0.1506  0.2535  -0.0318 12  GLU A CA    
113  C C     . GLU A 12  ? 1.1739 0.5990 0.8773 0.1405  0.2823  -0.0296 12  GLU A C     
114  O O     . GLU A 12  ? 1.1845 0.5746 0.8390 0.1618  0.3077  -0.0216 12  GLU A O     
115  C CB    . GLU A 12  ? 1.1610 0.8194 1.0961 0.1509  0.2948  -0.0183 12  GLU A CB    
116  C CG    . GLU A 12  ? 1.1516 0.8375 1.0976 0.1916  0.3585  0.0014  12  GLU A CG    
117  C CD    . GLU A 12  ? 1.1768 0.9662 1.2391 0.1921  0.3955  0.0129  12  GLU A CD    
118  O OE1   . GLU A 12  ? 1.2334 1.0440 1.3565 0.1529  0.3840  0.0097  12  GLU A OE1   
119  O OE2   . GLU A 12  ? 1.1302 0.9803 1.2305 0.2319  0.4369  0.0251  12  GLU A OE2   
126  N N     . GLN A 13  ? 1.1369 0.4945 0.7866 0.1061  0.2677  -0.0350 13  GLN A N     
127  C CA    . GLN A 13  ? 1.1820 0.4403 0.7095 0.0998  0.2786  -0.0319 13  GLN A CA    
128  C C     . GLN A 13  ? 1.0944 0.3711 0.5939 0.0905  0.2123  -0.0442 13  GLN A C     
129  O O     . GLN A 13  ? 1.1192 0.3633 0.5624 0.0986  0.2174  -0.0418 13  GLN A O     
130  C CB    . GLN A 13  ? 1.2585 0.4564 0.7434 0.0730  0.2848  -0.0277 13  GLN A CB    
131  C CG    . GLN A 13  ? 1.3611 0.5864 0.9092 0.0710  0.3527  0.0020  13  GLN A CG    
132  C CD    . GLN A 13  ? 1.3987 0.5809 0.9326 0.0388  0.3562  0.0153  13  GLN A CD    
133  O OE1   . GLN A 13  ? 1.3673 0.5087 0.8632 0.0167  0.3000  -0.0037 13  GLN A OE1   
134  N NE2   . GLN A 13  ? 1.4564 0.6470 1.0236 0.0384  0.4263  0.0514  13  GLN A NE2   
143  N N     . ALA A 14  ? 0.9926 0.3254 0.5449 0.0763  0.1526  -0.0573 14  ALA A N     
144  C CA    . ALA A 14  ? 0.9076 0.2713 0.4638 0.0685  0.1027  -0.0646 14  ALA A CA    
145  C C     . ALA A 14  ? 0.8997 0.2735 0.4754 0.0896  0.1196  -0.0604 14  ALA A C     
146  O O     . ALA A 14  ? 0.9096 0.2742 0.4724 0.0853  0.1032  -0.0662 14  ALA A O     
147  C CB    . ALA A 14  ? 0.8121 0.2408 0.4291 0.0566  0.0506  -0.0732 14  ALA A CB    
153  N N     . ASN A 15  ? 1.0660 0.4636 0.6832 0.1157  0.1539  -0.0502 15  ASN A N     
154  C CA    . ASN A 15  ? 1.0718 0.4801 0.7089 0.1380  0.1754  -0.0404 15  ASN A CA    
155  C C     . ASN A 15  ? 1.1636 0.5116 0.7394 0.1447  0.2136  -0.0360 15  ASN A C     
156  O O     . ASN A 15  ? 1.1807 0.5146 0.7549 0.1497  0.2111  -0.0390 15  ASN A O     
157  C CB    . ASN A 15  ? 1.0505 0.5222 0.7539 0.1730  0.2033  -0.0245 15  ASN A CB    
158  C CG    . ASN A 15  ? 1.0545 0.5523 0.7890 0.1937  0.2145  -0.0095 15  ASN A CG    
159  O OD1   . ASN A 15  ? 1.1131 0.5639 0.8154 0.1896  0.2281  -0.0094 15  ASN A OD1   
160  N ND2   . ASN A 15  ? 0.9992 0.5750 0.7977 0.2183  0.2067  0.0030  15  ASN A ND2   
167  N N     . GLY A 16  ? 1.0453 0.3537 0.5737 0.1476  0.2513  -0.0293 16  GLY A N     
168  C CA    . GLY A 16  ? 1.1441 0.3888 0.6007 0.1601  0.2871  -0.0235 16  GLY A CA    
169  C C     . GLY A 16  ? 1.1900 0.3851 0.5802 0.1450  0.2490  -0.0409 16  GLY A C     
170  O O     . GLY A 16  ? 1.2712 0.4167 0.6072 0.1612  0.2640  -0.0433 16  GLY A O     
174  N N     . GLU A 17  ? 1.1674 0.3823 0.5676 0.1193  0.1981  -0.0536 17  GLU A N     
175  C CA    . GLU A 17  ? 1.2520 0.4378 0.6065 0.1107  0.1608  -0.0689 17  GLU A CA    
176  C C     . GLU A 17  ? 1.2501 0.4440 0.6391 0.1162  0.1397  -0.0875 17  GLU A C     
177  O O     . GLU A 17  ? 1.2757 0.4220 0.6117 0.1226  0.1255  -0.1026 17  GLU A O     
178  C CB    . GLU A 17  ? 1.1837 0.4095 0.5639 0.0853  0.1131  -0.0744 17  GLU A CB    
179  C CG    . GLU A 17  ? 1.2405 0.4283 0.5607 0.0828  0.0810  -0.0839 17  GLU A CG    
180  C CD    . GLU A 17  ? 1.2358 0.4308 0.5815 0.0809  0.0469  -0.1000 17  GLU A CD    
181  O OE1   . GLU A 17  ? 1.1559 0.4029 0.5791 0.0739  0.0399  -0.1007 17  GLU A OE1   
182  O OE2   . GLU A 17  ? 1.3163 0.4634 0.6090 0.0893  0.0281  -0.1135 17  GLU A OE2   
189  N N     . ARG A 18  ? 1.1119 0.3493 0.5779 0.1181  0.1411  -0.0862 18  ARG A N     
190  C CA    . ARG A 18  ? 1.1381 0.3600 0.6312 0.1240  0.1312  -0.1016 18  ARG A CA    
191  C C     . ARG A 18  ? 1.2386 0.4024 0.6800 0.1467  0.1573  -0.1095 18  ARG A C     
192  O O     . ARG A 18  ? 1.3046 0.4264 0.7332 0.1511  0.1392  -0.1341 18  ARG A O     
193  C CB    . ARG A 18  ? 1.0663 0.3383 0.6454 0.1286  0.1393  -0.0895 18  ARG A CB    
194  C CG    . ARG A 18  ? 1.0978 0.3482 0.7186 0.1345  0.1344  -0.1015 18  ARG A CG    
195  C CD    . ARG A 18  ? 1.0322 0.3305 0.7294 0.1430  0.1453  -0.0801 18  ARG A CD    
196  N NE    . ARG A 18  ? 1.0682 0.3406 0.8137 0.1485  0.1429  -0.0870 18  ARG A NE    
197  C CZ    . ARG A 18  ? 1.0363 0.3367 0.8405 0.1599  0.1559  -0.0643 18  ARG A CZ    
198  N NH1   . ARG A 18  ? 0.9651 0.3275 0.7859 0.1703  0.1711  -0.0359 18  ARG A NH1   
199  N NH2   . ARG A 18  ? 1.0839 0.3495 0.9305 0.1638  0.1541  -0.0695 18  ARG A NH2   
213  N N     . TRP A 19  ? 1.0300 0.4651 0.7702 -0.0080 -0.1239 -0.0076 19  TRP A N     
214  C CA    . TRP A 19  ? 1.1605 0.4812 0.7833 0.0516  -0.1460 -0.0678 19  TRP A CA    
215  C C     . TRP A 19  ? 1.4373 0.6260 0.8395 0.1226  -0.0701 -0.0881 19  TRP A C     
216  O O     . TRP A 19  ? 1.5839 0.6395 0.8306 0.1866  -0.1474 -0.1160 19  TRP A O     
217  C CB    . TRP A 19  ? 1.0838 0.4907 0.8186 0.0415  -0.0812 -0.1139 19  TRP A CB    
218  C CG    . TRP A 19  ? 0.9355 0.4959 0.8931 -0.0299 -0.1225 -0.0871 19  TRP A CG    
219  C CD1   . TRP A 19  ? 0.7726 0.4749 0.8784 -0.0737 -0.0259 -0.0816 19  TRP A CD1   
220  C CD2   . TRP A 19  ? 0.8445 0.4378 0.9043 -0.0639 -0.2758 -0.0561 19  TRP A CD2   
221  N NE1   . TRP A 19  ? 0.6256 0.4532 0.9087 -0.1250 -0.1041 -0.0528 19  TRP A NE1   
222  C CE2   . TRP A 19  ? 0.6588 0.4277 0.9218 -0.1240 -0.2553 -0.0301 19  TRP A CE2   
223  C CE3   . TRP A 19  ? 0.8978 0.3895 0.9023 -0.0496 -0.4342 -0.0438 19  TRP A CE3   
224  C CZ2   . TRP A 19  ? 0.5032 0.3751 0.8248 -0.1162 -0.3037 0.0273  19  TRP A CZ2   
225  C CZ3   . TRP A 19  ? 0.7928 0.3951 0.9309 -0.0685 -0.4919 0.0255  19  TRP A CZ3   
226  C CH2   . TRP A 19  ? 0.6296 0.3973 0.8953 -0.0953 -0.4049 0.0582  19  TRP A CH2   
237  N N     . ASP A 20  ? 1.4304 0.6523 0.8161 0.1152  0.0740  -0.0722 20  ASP A N     
238  C CA    . ASP A 20  ? 1.6223 0.7354 0.8067 0.1782  0.1554  -0.0764 20  ASP A CA    
239  C C     . ASP A 20  ? 1.7358 0.7602 0.8070 0.1881  0.1012  -0.0326 20  ASP A C     
240  O O     . ASP A 20  ? 1.6427 0.6971 0.7944 0.1480  0.0003  -0.0002 20  ASP A O     
241  C CB    . ASP A 20  ? 1.5770 0.7605 0.8043 0.1591  0.3239  -0.0663 20  ASP A CB    
242  C CG    . ASP A 20  ? 1.4582 0.7353 0.8360 0.0845  0.3601  -0.0213 20  ASP A CG    
243  O OD1   . ASP A 20  ? 1.4651 0.7126 0.8168 0.0724  0.3012  0.0166  20  ASP A OD1   
244  O OD2   . ASP A 20  ? 1.3159 0.6985 0.8383 0.0436  0.4421  -0.0273 20  ASP A OD2   
249  N N     . GLY A 21  ? 2.6391 1.5627 1.5221 0.2447  0.1696  -0.0271 21  GLY A N     
250  C CA    . GLY A 21  ? 2.7269 1.5478 1.4735 0.2681  0.1186  0.0070  21  GLY A CA    
251  C C     . GLY A 21  ? 2.5565 1.4421 1.4102 0.2028  0.1129  0.0621  21  GLY A C     
252  O O     . GLY A 21  ? 2.5188 1.3971 1.3929 0.1891  -0.0056 0.0837  21  GLY A O     
256  N N     . GLY A 22  ? 2.0394 0.9916 0.9649 0.1658  0.2331  0.0857  22  GLY A N     
257  C CA    . GLY A 22  ? 2.0749 1.0532 1.0052 0.1716  0.3681  0.0704  22  GLY A CA    
258  C C     . GLY A 22  ? 2.0334 1.0377 1.0112 0.1460  0.4581  0.1056  22  GLY A C     
259  O O     . GLY A 22  ? 1.9385 0.9807 0.9921 0.1127  0.4253  0.1257  22  GLY A O     
263  N N     . SER A 23  ? 1.9646 0.9885 0.9574 0.1596  0.5360  0.1054  23  SER A N     
264  C CA    . SER A 23  ? 2.0058 1.0683 1.0025 0.1832  0.5747  0.0786  23  SER A CA    
265  C C     . SER A 23  ? 2.0565 1.1797 1.1182 0.1732  0.6552  0.1012  23  SER A C     
266  O O     . SER A 23  ? 2.1998 1.3140 1.1692 0.2231  0.6864  0.1002  23  SER A O     
267  C CB    . SER A 23  ? 1.8480 1.0062 0.9892 0.1441  0.5643  0.0434  23  SER A CB    
268  O OG    . SER A 23  ? 1.8397 1.0890 1.0693 0.1422  0.6142  0.0260  23  SER A OG    
274  N N     . GLY A 24  ? 1.7825 0.9705 0.9921 0.1165  0.6801  0.1193  24  GLY A N     
275  C CA    . GLY A 24  ? 1.6150 0.8422 0.9470 0.0677  0.6388  0.1138  24  GLY A CA    
276  C C     . GLY A 24  ? 1.6391 0.8221 0.9431 0.0628  0.6295  0.1411  24  GLY A C     
277  O O     . GLY A 24  ? 1.6190 0.8358 0.9999 0.0385  0.6610  0.1557  24  GLY A O     
281  N N     . GLY A 25  ? 1.6312 0.7397 0.8231 0.0863  0.5778  0.1474  25  GLY A N     
282  C CA    . GLY A 25  ? 1.6525 0.7297 0.8188 0.0841  0.5542  0.1672  25  GLY A CA    
283  C C     . GLY A 25  ? 1.4900 0.6414 0.7618 0.0523  0.4947  0.1596  25  GLY A C     
284  O O     . GLY A 25  ? 1.5017 0.6348 0.7483 0.0550  0.4628  0.1739  25  GLY A O     
288  N N     . ILE A 26  ? 1.5862 0.8287 0.9751 0.0260  0.4766  0.1397  26  ILE A N     
289  C CA    . ILE A 26  ? 1.4335 0.7729 0.9365 0.0000  0.4208  0.1387  26  ILE A CA    
290  C C     . ILE A 26  ? 1.4469 0.7565 0.8639 0.0166  0.3415  0.1602  26  ILE A C     
291  O O     . ILE A 26  ? 1.4798 0.7493 0.8248 0.0297  0.3007  0.1631  26  ILE A O     
292  C CB    . ILE A 26  ? 1.2859 0.7392 0.9359 -0.0278 0.4143  0.1143  26  ILE A CB    
293  C CG1   . ILE A 26  ? 1.1324 0.7001 0.9032 -0.0471 0.3588  0.1179  26  ILE A CG1   
294  C CG2   . ILE A 26  ? 1.3151 0.7354 0.9048 -0.0218 0.3986  0.1126  26  ILE A CG2   
295  C CD1   . ILE A 26  ? 0.9828 0.6770 0.9118 -0.0674 0.3482  0.0870  26  ILE A CD1   
307  N N     . THR A 27  ? 1.1873 0.5112 0.6101 0.0190  0.3086  0.1756  27  THR A N     
308  C CA    . THR A 27  ? 1.1882 0.5100 0.5564 0.0356  0.2229  0.1953  27  THR A CA    
309  C C     . THR A 27  ? 1.0922 0.5273 0.5645 0.0149  0.1546  0.2099  27  THR A C     
310  O O     . THR A 27  ? 0.9146 0.4492 0.5112 -0.0089 0.1673  0.2109  27  THR A O     
311  C CB    . THR A 27  ? 1.2026 0.5223 0.5618 0.0459  0.2096  0.2068  27  THR A CB    
312  O OG1   . THR A 27  ? 1.0778 0.4901 0.5566 0.0277  0.2109  0.2102  27  THR A OG1   
313  C CG2   . THR A 27  ? 1.3478 0.5600 0.6219 0.0590  0.2759  0.2026  27  THR A CG2   
321  N N     . SER A 28  ? 1.0644 0.4908 0.4963 0.0251  0.0774  0.2217  28  SER A N     
322  C CA    . SER A 28  ? 0.9329 0.4803 0.4791 0.0063  -0.0004 0.2464  28  SER A CA    
323  C C     . SER A 28  ? 0.8820 0.5272 0.4719 0.0244  -0.0656 0.2683  28  SER A C     
324  O O     . SER A 28  ? 0.9755 0.5596 0.4842 0.0426  -0.0751 0.2626  28  SER A O     
325  C CB    . SER A 28  ? 0.9823 0.4749 0.4942 0.0054  -0.0465 0.2357  28  SER A CB    
326  O OG    . SER A 28  ? 0.8552 0.4810 0.4992 -0.0144 -0.1281 0.2493  28  SER A OG    
332  N N     . PRO A 29  ? 0.5841 0.5331 0.3892 0.0213  0.0902  0.0273  29  PRO A N     
333  C CA    . PRO A 29  ? 0.6341 0.5819 0.4243 0.0071  0.0694  0.0272  29  PRO A CA    
334  C C     . PRO A 29  ? 0.7246 0.6368 0.4727 0.0095  0.0469  0.0221  29  PRO A C     
335  O O     . PRO A 29  ? 0.7613 0.6696 0.5049 0.0009  0.0287  0.0199  29  PRO A O     
336  C CB    . PRO A 29  ? 0.5988 0.5764 0.4241 -0.0090 0.0605  0.0262  29  PRO A CB    
337  C CG    . PRO A 29  ? 0.5576 0.5376 0.3920 -0.0005 0.0623  0.0219  29  PRO A CG    
338  C CD    . PRO A 29  ? 0.5420 0.5163 0.3839 0.0149  0.0835  0.0217  29  PRO A CD    
346  N N     . PHE A 30  ? 0.7255 0.6119 0.4499 0.0212  0.0460  0.0182  30  PHE A N     
347  C CA    . PHE A 30  ? 0.7864 0.6353 0.4774 0.0237  0.0221  0.0089  30  PHE A CA    
348  C C     . PHE A 30  ? 0.8206 0.6317 0.4543 0.0492  0.0189  0.0020  30  PHE A C     
349  O O     . PHE A 30  ? 0.8086 0.6130 0.4208 0.0711  0.0460  0.0095  30  PHE A O     
350  C CB    . PHE A 30  ? 0.8091 0.6435 0.4977 0.0267  0.0228  0.0076  30  PHE A CB    
351  C CG    . PHE A 30  ? 0.8043 0.6646 0.5320 0.0106  0.0230  0.0144  30  PHE A CG    
352  C CD1   . PHE A 30  ? 0.8280 0.6854 0.5746 -0.0061 0.0090  0.0165  30  PHE A CD1   
353  C CD2   . PHE A 30  ? 0.7634 0.6483 0.5102 0.0167  0.0377  0.0188  30  PHE A CD2   
354  C CE1   . PHE A 30  ? 0.8131 0.6861 0.5831 -0.0123 0.0158  0.0272  30  PHE A CE1   
355  C CE2   . PHE A 30  ? 0.7434 0.6457 0.5098 0.0115  0.0353  0.0238  30  PHE A CE2   
356  C CZ    . PHE A 30  ? 0.7731 0.6667 0.5440 -0.0008 0.0274  0.0303  30  PHE A CZ    
366  N N     . LYS A 31  ? 1.0458 0.8291 0.6569 0.0498  -0.0143 -0.0128 31  LYS A N     
367  C CA    . LYS A 31  ? 1.0754 0.8143 0.6178 0.0815  -0.0281 -0.0255 31  LYS A CA    
368  C C     . LYS A 31  ? 1.1199 0.8113 0.6226 0.0965  -0.0457 -0.0417 31  LYS A C     
369  O O     . LYS A 31  ? 1.1585 0.8042 0.5906 0.1301  -0.0594 -0.0554 31  LYS A O     
370  C CB    . LYS A 31  ? 1.0777 0.8172 0.6215 0.0783  -0.0625 -0.0381 31  LYS A CB    
371  C CG    . LYS A 31  ? 1.0376 0.8193 0.6145 0.0666  -0.0456 -0.0224 31  LYS A CG    
372  C CD    . LYS A 31  ? 1.0411 0.8200 0.6123 0.0710  -0.0802 -0.0351 31  LYS A CD    
373  C CE    . LYS A 31  ? 1.0928 0.8311 0.5756 0.1179  -0.0839 -0.0415 31  LYS A CE    
374  N NZ    . LYS A 31  ? 1.0825 0.8313 0.5460 0.1347  -0.0341 -0.0158 31  LYS A NZ    
388  N N     . LEU A 32  ? 0.9944 0.6909 0.5342 0.0769  -0.0456 -0.0407 32  LEU A N     
389  C CA    . LEU A 32  ? 1.0589 0.7094 0.5670 0.0895  -0.0595 -0.0554 32  LEU A CA    
390  C C     . LEU A 32  ? 1.0584 0.7112 0.5625 0.0978  -0.0244 -0.0401 32  LEU A C     
391  O O     . LEU A 32  ? 1.0229 0.7189 0.5753 0.0811  -0.0023 -0.0231 32  LEU A O     
392  C CB    . LEU A 32  ? 1.0783 0.7245 0.6394 0.0619  -0.0894 -0.0677 32  LEU A CB    
393  C CG    . LEU A 32  ? 1.0849 0.7293 0.6727 0.0512  -0.1299 -0.0869 32  LEU A CG    
394  C CD1   . LEU A 32  ? 1.0734 0.7150 0.7366 0.0220  -0.1476 -0.0935 32  LEU A CD1   
395  C CD2   . LEU A 32  ? 1.1463 0.7427 0.6613 0.0861  -0.1634 -0.1151 32  LEU A CD2   
407  N N     . PRO A 33  ? 1.0365 0.6429 0.4844 0.1262  -0.0208 -0.0473 33  PRO A N     
408  C CA    . PRO A 33  ? 1.0267 0.6368 0.4794 0.1349  0.0120  -0.0327 33  PRO A CA    
409  C C     . PRO A 33  ? 1.0273 0.6498 0.5277 0.1106  0.0049  -0.0310 33  PRO A C     
410  O O     . PRO A 33  ? 1.0372 0.6567 0.5657 0.0888  -0.0208 -0.0400 33  PRO A O     
411  C CB    . PRO A 33  ? 1.0860 0.6343 0.4585 0.1749  0.0154  -0.0422 33  PRO A CB    
412  C CG    . PRO A 33  ? 1.1251 0.6400 0.4409 0.1933  -0.0132 -0.0608 33  PRO A CG    
413  C CD    . PRO A 33  ? 1.0982 0.6444 0.4723 0.1565  -0.0477 -0.0709 33  PRO A CD    
421  N N     . ASP A 34  ? 0.9460 0.5811 0.4595 0.1178  0.0308  -0.0179 34  ASP A N     
422  C CA    . ASP A 34  ? 0.9493 0.5914 0.4955 0.1047  0.0289  -0.0130 34  ASP A CA    
423  C C     . ASP A 34  ? 1.0037 0.5889 0.5152 0.1150  0.0161  -0.0257 34  ASP A C     
424  O O     . ASP A 34  ? 1.0394 0.5841 0.4966 0.1416  0.0195  -0.0342 34  ASP A O     
425  C CB    . ASP A 34  ? 0.9085 0.5855 0.4821 0.1133  0.0552  0.0020  34  ASP A CB    
426  C CG    . ASP A 34  ? 0.9106 0.5929 0.5064 0.1081  0.0531  0.0084  34  ASP A CG    
427  O OD1   . ASP A 34  ? 0.8968 0.6033 0.5225 0.0906  0.0455  0.0138  34  ASP A OD1   
428  O OD2   . ASP A 34  ? 0.9290 0.5884 0.5083 0.1256  0.0622  0.0100  34  ASP A OD2   
433  N N     . GLU A 35  ? 0.9398 0.5176 0.4828 0.0968  0.0042  -0.0260 35  GLU A N     
434  C CA    . GLU A 35  ? 0.9838 0.5068 0.5098 0.1021  -0.0085 -0.0392 35  GLU A CA    
435  C C     . GLU A 35  ? 0.9819 0.5066 0.5334 0.1001  0.0089  -0.0226 35  GLU A C     
436  O O     . GLU A 35  ? 0.9965 0.4868 0.5658 0.0920  0.0012  -0.0270 35  GLU A O     
437  C CB    . GLU A 35  ? 0.9934 0.4926 0.5430 0.0834  -0.0422 -0.0596 35  GLU A CB    
438  C CG    . GLU A 35  ? 1.0066 0.4991 0.5233 0.0915  -0.0665 -0.0794 35  GLU A CG    
439  C CD    . GLU A 35  ? 1.0105 0.4935 0.5721 0.0702  -0.1042 -0.1002 35  GLU A CD    
440  O OE1   . GLU A 35  ? 0.9849 0.4804 0.6182 0.0434  -0.1016 -0.0911 35  GLU A OE1   
441  O OE2   . GLU A 35  ? 1.0385 0.5001 0.5656 0.0836  -0.1356 -0.1253 35  GLU A OE2   
448  N N     . SER A 36  ? 1.0815 0.6443 0.6388 0.1099  0.0317  -0.0044 36  SER A N     
449  C CA    . SER A 36  ? 1.0788 0.6441 0.6511 0.1157  0.0459  0.0116  36  SER A CA    
450  C C     . SER A 36  ? 1.1012 0.6120 0.6436 0.1322  0.0490  0.0055  36  SER A C     
451  O O     . SER A 36  ? 1.1184 0.6109 0.6230 0.1521  0.0535  -0.0027 36  SER A O     
452  C CB    . SER A 36  ? 1.0517 0.6670 0.6351 0.1295  0.0610  0.0243  36  SER A CB    
453  O OG    . SER A 36  ? 1.0205 0.6827 0.6307 0.1158  0.0569  0.0268  36  SER A OG    
459  N N     . PRO A 37  ? 1.0343 0.5146 0.5926 0.1272  0.0511  0.0111  37  PRO A N     
460  C CA    . PRO A 37  ? 1.0598 0.4856 0.5918 0.1433  0.0550  0.0047  37  PRO A CA    
461  C C     . PRO A 37  ? 1.0398 0.4796 0.5528 0.1704  0.0770  0.0203  37  PRO A C     
462  O O     . PRO A 37  ? 1.0003 0.4868 0.5317 0.1755  0.0869  0.0374  37  PRO A O     
463  C CB    . PRO A 37  ? 1.0593 0.4538 0.6309 0.1279  0.0566  0.0108  37  PRO A CB    
464  C CG    . PRO A 37  ? 1.0220 0.4634 0.6270 0.1185  0.0690  0.0344  37  PRO A CG    
465  C CD    . PRO A 37  ? 1.0104 0.5005 0.6123 0.1101  0.0562  0.0267  37  PRO A CD    
473  N N     . SER A 38  ? 1.0435 0.4408 0.5198 0.1907  0.0819  0.0119  38  SER A N     
474  C CA    . SER A 38  ? 1.0496 0.4558 0.5149 0.2179  0.1028  0.0262  38  SER A CA    
475  C C     . SER A 38  ? 1.0587 0.4585 0.5414 0.2222  0.1135  0.0449  38  SER A C     
476  O O     . SER A 38  ? 1.0677 0.4475 0.5711 0.2048  0.1107  0.0486  38  SER A O     
477  C CB    . SER A 38  ? 1.1105 0.4650 0.5284 0.2411  0.1092  0.0144  38  SER A CB    
478  O OG    . SER A 38  ? 1.2242 0.5131 0.6253 0.2349  0.0959  -0.0020 38  SER A OG    
484  N N     . TRP A 39  ? 1.0614 0.4772 0.5389 0.2490  0.1283  0.0586  39  TRP A N     
485  C CA    . TRP A 39  ? 1.0826 0.4877 0.5635 0.2633  0.1405  0.0785  39  TRP A CA    
486  C C     . TRP A 39  ? 1.1464 0.4786 0.6159 0.2603  0.1482  0.0767  39  TRP A C     
487  O O     . TRP A 39  ? 1.1617 0.4724 0.6504 0.2513  0.1562  0.0894  39  TRP A O     
488  C CB    . TRP A 39  ? 1.0822 0.5156 0.5592 0.2971  0.1496  0.0886  39  TRP A CB    
489  C CG    . TRP A 39  ? 1.1048 0.5364 0.5773 0.3203  0.1590  0.1102  39  TRP A CG    
490  C CD1   . TRP A 39  ? 1.1192 0.5338 0.5914 0.3153  0.1656  0.1258  39  TRP A CD1   
491  C CD2   . TRP A 39  ? 1.1242 0.5684 0.5897 0.3577  0.1655  0.1207  39  TRP A CD2   
492  N NE1   . TRP A 39  ? 1.1524 0.5640 0.6065 0.3510  0.1775  0.1468  39  TRP A NE1   
493  C CE2   . TRP A 39  ? 1.1548 0.5862 0.6046 0.3772  0.1738  0.1421  39  TRP A CE2   
494  C CE3   . TRP A 39  ? 1.1230 0.5872 0.5972 0.3795  0.1672  0.1156  39  TRP A CE3   
495  C CZ2   . TRP A 39  ? 1.1863 0.6244 0.6206 0.4196  0.1781  0.1558  39  TRP A CZ2   
496  C CZ3   . TRP A 39  ? 1.1472 0.6228 0.6193 0.4172  0.1704  0.1281  39  TRP A CZ3   
497  C CH2   . TRP A 39  ? 1.1794 0.6421 0.6277 0.4379  0.1730  0.1466  39  TRP A CH2   
508  N N     . THR A 40  ? 1.2627 0.5524 0.7037 0.2698  0.1485  0.0614  40  THR A N     
509  C CA    . THR A 40  ? 1.3541 0.5701 0.7874 0.2681  0.1518  0.0537  40  THR A CA    
510  C C     . THR A 40  ? 1.3831 0.5746 0.8489 0.2345  0.1335  0.0375  40  THR A C     
511  O O     . THR A 40  ? 1.4129 0.5700 0.9137 0.2241  0.1428  0.0456  40  THR A O     
512  C CB    . THR A 40  ? 1.4284 0.6019 0.8156 0.2881  0.1515  0.0355  40  THR A CB    
513  O OG1   . THR A 40  ? 1.4229 0.6063 0.7894 0.2816  0.1335  0.0139  40  THR A OG1   
514  C CG2   . THR A 40  ? 1.4234 0.6189 0.7938 0.3221  0.1736  0.0539  40  THR A CG2   
522  N N     . GLU A 41  ? 1.3919 0.6001 0.8529 0.2190  0.1093  0.0155  41  GLU A N     
523  C CA    . GLU A 41  ? 1.4116 0.6013 0.9103 0.1885  0.0858  -0.0039 41  GLU A CA    
524  C C     . GLU A 41  ? 1.3627 0.5789 0.9213 0.1685  0.0988  0.0202  41  GLU A C     
525  O O     . GLU A 41  ? 1.3940 0.5820 1.0061 0.1452  0.0915  0.0124  41  GLU A O     
526  C CB    . GLU A 41  ? 1.3970 0.6104 0.8738 0.1818  0.0597  -0.0262 41  GLU A CB    
527  C CG    . GLU A 41  ? 1.4301 0.6213 0.9418 0.1555  0.0265  -0.0539 41  GLU A CG    
528  C CD    . GLU A 41  ? 1.4104 0.6272 0.8932 0.1545  0.0025  -0.0720 41  GLU A CD    
529  O OE1   . GLU A 41  ? 1.3470 0.6066 0.7979 0.1682  0.0182  -0.0572 41  GLU A OE1   
530  O OE2   . GLU A 41  ? 1.4469 0.6404 0.9442 0.1416  -0.0325 -0.1018 41  GLU A OE2   
537  N N     . TRP A 42  ? 1.1595 0.4275 0.7127 0.1800  0.1179  0.0485  42  TRP A N     
538  C CA    . TRP A 42  ? 1.1404 0.4265 0.7334 0.1717  0.1358  0.0753  42  TRP A CA    
539  C C     . TRP A 42  ? 1.1908 0.4344 0.7908 0.1894  0.1677  0.1009  42  TRP A C     
540  O O     . TRP A 42  ? 1.2057 0.4309 0.8508 0.1795  0.1878  0.1199  42  TRP A O     
541  C CB    . TRP A 42  ? 1.0844 0.4385 0.6606 0.1827  0.1379  0.0905  42  TRP A CB    
542  C CG    . TRP A 42  ? 1.0808 0.4475 0.6746 0.1883  0.1599  0.1209  42  TRP A CG    
543  C CD1   . TRP A 42  ? 1.0570 0.4398 0.6870 0.1676  0.1616  0.1281  42  TRP A CD1   
544  C CD2   . TRP A 42  ? 1.1116 0.4719 0.6803 0.2231  0.1856  0.1500  42  TRP A CD2   
545  N NE1   . TRP A 42  ? 1.0750 0.4581 0.6996 0.1890  0.1904  0.1615  42  TRP A NE1   
546  C CE2   . TRP A 42  ? 1.1114 0.4799 0.6944 0.2251  0.2041  0.1749  42  TRP A CE2   
547  C CE3   . TRP A 42  ? 1.1452 0.4919 0.6774 0.2569  0.1953  0.1582  42  TRP A CE3   
548  C CZ2   . TRP A 42  ? 1.1514 0.5104 0.7028 0.2641  0.2318  0.2075  42  TRP A CZ2   
549  C CZ3   . TRP A 42  ? 1.1794 0.5212 0.6865 0.2930  0.2189  0.1888  42  TRP A CZ3   
550  C CH2   . TRP A 42  ? 1.1861 0.5319 0.6977 0.2985  0.2368  0.2131  42  TRP A CH2   
561  N N     . ARG A 43  ? 1.2574 0.4832 0.8163 0.2177  0.1770  0.1043  43  ARG A N     
562  C CA    . ARG A 43  ? 1.2936 0.4726 0.8544 0.2380  0.2086  0.1285  43  ARG A CA    
563  C C     . ARG A 43  ? 1.3657 0.4765 0.9761 0.2155  0.2116  0.1157  43  ARG A C     
564  O O     . ARG A 43  ? 1.3885 0.4737 1.0400 0.2153  0.2412  0.1390  43  ARG A O     
565  C CB    . ARG A 43  ? 1.3018 0.4766 0.8111 0.2727  0.2141  0.1309  43  ARG A CB    
566  C CG    . ARG A 43  ? 1.3591 0.4966 0.8688 0.2935  0.2447  0.1534  43  ARG A CG    
567  C CD    . ARG A 43  ? 1.3780 0.5215 0.8445 0.3240  0.2462  0.1519  43  ARG A CD    
568  N NE    . ARG A 43  ? 1.3963 0.5069 0.8472 0.3166  0.2291  0.1211  43  ARG A NE    
569  C CZ    . ARG A 43  ? 1.4503 0.5059 0.9124 0.3067  0.2301  0.1058  43  ARG A CZ    
570  N NH1   . ARG A 43  ? 1.4808 0.5080 0.9822 0.2998  0.2503  0.1201  43  ARG A NH1   
571  N NH2   . ARG A 43  ? 1.4893 0.5190 0.9243 0.3061  0.2113  0.0757  43  ARG A NH2   
585  N N     . LEU A 44  ? 1.3365 0.4265 0.9493 0.1970  0.1787  0.0762  44  LEU A N     
586  C CA    . LEU A 44  ? 1.3927 0.4156 1.0552 0.1782  0.1705  0.0532  44  LEU A CA    
587  C C     . LEU A 44  ? 1.3774 0.4030 1.1242 0.1417  0.1587  0.0444  44  LEU A C     
588  O O     . LEU A 44  ? 1.4208 0.3991 1.2430 0.1253  0.1653  0.0394  44  LEU A O     
589  C CB    . LEU A 44  ? 1.4260 0.4176 1.0424 0.1835  0.1355  0.0103  44  LEU A CB    
590  C CG    . LEU A 44  ? 1.4515 0.4313 0.9945 0.2204  0.1509  0.0182  44  LEU A CG    
591  C CD1   . LEU A 44  ? 1.4837 0.4404 0.9726 0.2298  0.1199  -0.0208 44  LEU A CD1   
592  C CD2   . LEU A 44  ? 1.4963 0.4490 1.0681 0.2282  0.1786  0.0364  44  LEU A CD2   
604  N N     . TYR A 45  ? 1.5621 0.6455 1.3090 0.1278  0.1411  0.0418  45  TYR A N     
605  C CA    . TYR A 45  ? 1.5805 0.6710 1.4135 0.0949  0.1335  0.0378  45  TYR A CA    
606  C C     . TYR A 45  ? 1.5847 0.6650 1.4778 0.0951  0.1844  0.0827  45  TYR A C     
607  O O     . TYR A 45  ? 1.6048 0.6736 1.5952 0.0687  0.1884  0.0823  45  TYR A O     
608  C CB    . TYR A 45  ? 1.5257 0.6812 1.3395 0.0843  0.1100  0.0310  45  TYR A CB    
609  C CG    . TYR A 45  ? 1.5375 0.7048 1.4416 0.0519  0.1021  0.0278  45  TYR A CG    
610  C CD1   . TYR A 45  ? 1.5410 0.6885 1.4936 0.0287  0.0571  -0.0161 45  TYR A CD1   
611  C CD2   . TYR A 45  ? 1.5078 0.7040 1.4484 0.0488  0.1386  0.0677  45  TYR A CD2   
612  C CE1   . TYR A 45  ? 1.5207 0.6826 1.5685 -0.0007 0.0480  -0.0200 45  TYR A CE1   
613  C CE2   . TYR A 45  ? 1.5041 0.7112 1.5345 0.0204  0.1363  0.0677  45  TYR A CE2   
614  C CZ    . TYR A 45  ? 1.5051 0.6977 1.5954 -0.0062 0.0906  0.0238  45  TYR A CZ    
615  O OH    . TYR A 45  ? 1.4893 0.6964 1.6810 -0.0343 0.0863  0.0227  45  TYR A OH    
625  N N     . ASN A 46  ? 1.6863 0.7759 1.5247 0.1279  0.2223  0.1218  46  ASN A N     
626  C CA    . ASN A 46  ? 1.6904 0.7966 1.5682 0.1358  0.2662  0.1631  46  ASN A CA    
627  C C     . ASN A 46  ? 1.7331 0.8004 1.6475 0.1395  0.2860  0.1673  46  ASN A C     
628  O O     . ASN A 46  ? 1.7341 0.8091 1.6363 0.1638  0.3271  0.2028  46  ASN A O     
629  C CB    . ASN A 46  ? 1.6319 0.7802 1.4285 0.1734  0.2876  0.1957  46  ASN A CB    
630  C CG    . ASN A 46  ? 1.6324 0.8027 1.4539 0.1858  0.3308  0.2345  46  ASN A CG    
631  O OD1   . ASN A 46  ? 1.6426 0.8022 1.4508 0.2109  0.3630  0.2564  46  ASN A OD1   
632  N ND2   . ASN A 46  ? 1.6317 0.8313 1.4853 0.1714  0.3339  0.2427  46  ASN A ND2   
639  N N     . ASP A 47  ? 1.4223 0.4456 1.3771 0.1190  0.2562  0.1294  47  ASP A N     
640  C CA    . ASP A 47  ? 1.4860 0.4680 1.4792 0.1206  0.2703  0.1288  47  ASP A CA    
641  C C     . ASP A 47  ? 1.5193 0.4709 1.6218 0.0842  0.2465  0.0980  47  ASP A C     
642  O O     . ASP A 47  ? 1.5767 0.4962 1.7275 0.0825  0.2631  0.1011  47  ASP A O     
643  C CB    . ASP A 47  ? 1.5119 0.4636 1.4273 0.1435  0.2549  0.1095  47  ASP A CB    
644  C CG    . ASP A 47  ? 1.4955 0.4783 1.3161 0.1831  0.2814  0.1420  47  ASP A CG    
645  O OD1   . ASP A 47  ? 1.4815 0.4996 1.2972 0.1970  0.3146  0.1799  47  ASP A OD1   
646  O OD2   . ASP A 47  ? 1.5022 0.4759 1.2532 0.2030  0.2671  0.1274  47  ASP A OD2   
651  N N     . GLU A 48  ? 2.8177 1.1906 1.3559 0.2271  0.4352  0.1149  48  GLU A N     
652  C CA    . GLU A 48  ? 2.8510 1.1874 1.3940 0.1827  0.4627  0.1023  48  GLU A CA    
653  C C     . GLU A 48  ? 2.9013 1.2257 1.4351 0.1796  0.4809  0.1362  48  GLU A C     
654  O O     . GLU A 48  ? 2.9785 1.2751 1.5472 0.1690  0.5099  0.1681  48  GLU A O     
655  C CB    . GLU A 48  ? 2.7879 1.1440 1.3021 0.1513  0.4457  0.0574  48  GLU A CB    
656  C CG    . GLU A 48  ? 2.7052 1.1038 1.2522 0.1383  0.4221  0.0404  48  GLU A CG    
657  C CD    . GLU A 48  ? 2.6297 1.0700 1.1573 0.1756  0.3851  0.0438  48  GLU A CD    
658  O OE1   . GLU A 48  ? 2.6540 1.0872 1.1525 0.2178  0.3824  0.0533  48  GLU A OE1   
659  O OE2   . GLU A 48  ? 2.5297 1.0193 1.0932 0.1625  0.3544  0.0369  48  GLU A OE2   
662  N N     . THR A 49  ? 2.8127 1.1709 1.3103 0.1863  0.4605  0.1325  49  THR A N     
663  C CA    . THR A 49  ? 2.8315 1.2190 1.3243 0.1824  0.4694  0.1715  49  THR A CA    
664  C C     . THR A 49  ? 2.8152 1.2790 1.3109 0.2226  0.4434  0.2066  49  THR A C     
665  O O     . THR A 49  ? 2.7528 1.2897 1.2374 0.2295  0.4157  0.1979  49  THR A O     
666  C CB    . THR A 49  ? 2.7843 1.1854 1.2524 0.1499  0.4639  0.1405  49  THR A CB    
667  O OG1   . THR A 49  ? 2.8059 1.2617 1.2710 0.1447  0.4707  0.1779  49  THR A OG1   
668  C CG2   . THR A 49  ? 2.6897 1.1364 1.1531 0.1611  0.4191  0.1019  49  THR A CG2   
671  N N     . ASN A 50  ? 2.4148 0.8735 0.9380 0.2462  0.4506  0.2449  50  ASN A N     
672  C CA    . ASN A 50  ? 2.4040 0.9350 0.9368 0.2824  0.4279  0.2798  50  ASN A CA    
673  C C     . ASN A 50  ? 2.3881 1.0108 0.9034 0.2811  0.4122  0.2954  50  ASN A C     
674  O O     . ASN A 50  ? 2.4385 1.0747 0.9489 0.2603  0.4323  0.3292  50  ASN A O     
675  C CB    . ASN A 50  ? 2.4731 0.9867 1.0437 0.2919  0.4474  0.3371  50  ASN A CB    
676  C CG    . ASN A 50  ? 2.4849 0.9270 1.0888 0.2902  0.4616  0.3201  50  ASN A CG    
677  O OD1   . ASN A 50  ? 2.5194 0.9009 1.1406 0.2616  0.4889  0.3107  50  ASN A OD1   
678  N ND2   . ASN A 50  ? 2.4532 0.9128 1.0727 0.3183  0.4424  0.3144  50  ASN A ND2   
679  N N     . SER A 51  ? 2.7170 1.4129 1.2308 0.3006  0.3756  0.2694  51  SER A N     
680  C CA    . SER A 51  ? 2.6842 1.4887 1.1930 0.2963  0.3568  0.2723  51  SER A CA    
681  C C     . SER A 51  ? 2.6048 1.4879 1.1358 0.3250  0.3153  0.2471  51  SER A C     
682  O O     . SER A 51  ? 2.5842 1.4380 1.1306 0.3504  0.3045  0.2404  51  SER A O     
683  C CB    . SER A 51  ? 2.6634 1.4664 1.1575 0.2604  0.3620  0.2377  51  SER A CB    
684  O OG    . SER A 51  ? 2.6221 1.5450 1.1208 0.2551  0.3415  0.2305  51  SER A OG    
685  N N     . ASN A 52  ? 2.6841 1.6736 1.2234 0.3185  0.2926  0.2304  52  ASN A N     
686  C CA    . ASN A 52  ? 2.6000 1.6761 1.1743 0.3399  0.2528  0.2027  52  ASN A CA    
687  C C     . ASN A 52  ? 2.5163 1.6526 1.1194 0.3216  0.2260  0.1492  52  ASN A C     
688  O O     . ASN A 52  ? 2.4348 1.6135 1.0820 0.3361  0.1923  0.1186  52  ASN A O     
689  C CB    . ASN A 52  ? 2.6186 1.7984 1.1952 0.3519  0.2465  0.2384  52  ASN A CB    
690  C CG    . ASN A 52  ? 2.6596 1.9089 1.2133 0.3237  0.2610  0.2566  52  ASN A CG    
691  O OD1   . ASN A 52  ? 2.6559 1.8991 1.2018 0.2968  0.2687  0.2303  52  ASN A OD1   
692  N ND2   . ASN A 52  ? 2.6988 2.0190 1.2429 0.3268  0.2644  0.3013  52  ASN A ND2   
693  N N     . GLN A 53  ? 2.2262 1.3726 0.8158 0.2887  0.2396  0.1374  53  GLN A N     
694  C CA    . GLN A 53  ? 2.1571 1.3669 0.7866 0.2676  0.2145  0.0854  53  GLN A CA    
695  C C     . GLN A 53  ? 2.1743 1.3160 0.7915 0.2327  0.2325  0.0666  53  GLN A C     
696  O O     . GLN A 53  ? 2.1147 1.3178 0.7675 0.2090  0.2166  0.0274  53  GLN A O     
697  C CB    . GLN A 53  ? 2.1418 1.4886 0.7841 0.2589  0.2050  0.0770  53  GLN A CB    
698  C CG    . GLN A 53  ? 2.1028 1.5342 0.7724 0.2851  0.1796  0.0791  53  GLN A CG    
699  C CD    . GLN A 53  ? 1.9955 1.4517 0.7314 0.2946  0.1417  0.0359  53  GLN A CD    
700  O OE1   . GLN A 53  ? 1.9528 1.3559 0.7139 0.2846  0.1328  0.0119  53  GLN A OE1   
701  N NE2   . GLN A 53  ? 1.9507 1.4900 0.7190 0.3109  0.1195  0.0286  53  GLN A NE2   
710  N N     . ASP A 54  ? 2.2770 1.2980 0.8517 0.2264  0.2660  0.0912  54  ASP A N     
711  C CA    . ASP A 54  ? 2.2952 1.2447 0.8589 0.1891  0.2853  0.0718  54  ASP A CA    
712  C C     . ASP A 54  ? 2.3764 1.1843 0.9051 0.1882  0.3166  0.0900  54  ASP A C     
713  O O     . ASP A 54  ? 2.4578 1.2246 0.9561 0.1982  0.3478  0.1334  54  ASP A O     
714  C CB    . ASP A 54  ? 2.3284 1.3150 0.8698 0.1616  0.3104  0.0819  54  ASP A CB    
715  C CG    . ASP A 54  ? 2.3278 1.2478 0.8642 0.1197  0.3298  0.0583  54  ASP A CG    
716  O OD1   . ASP A 54  ? 2.2582 1.1640 0.8308 0.1062  0.3076  0.0198  54  ASP A OD1   
717  O OD2   . ASP A 54  ? 2.3951 1.2840 0.8989 0.0978  0.3661  0.0811  54  ASP A OD2   
722  N N     . ASN A 55  ? 2.5606 1.3029 1.1025 0.1735  0.3090  0.0596  55  ASN A N     
723  C CA    . ASN A 55  ? 2.4604 1.2658 1.0623 0.1564  0.2678  0.0182  55  ASN A CA    
724  C C     . ASN A 55  ? 2.3756 1.2302 1.0221 0.1889  0.2264  0.0123  55  ASN A C     
725  O O     . ASN A 55  ? 2.4280 1.2243 1.0499 0.2184  0.2337  0.0323  55  ASN A O     
726  C CB    . ASN A 55  ? 2.4722 1.2027 1.0803 0.1162  0.2783  -0.0006 55  ASN A CB    
727  C CG    . ASN A 55  ? 2.5333 1.2290 1.1126 0.0780  0.3147  -0.0031 55  ASN A CG    
728  O OD1   . ASN A 55  ? 2.4883 1.2623 1.1007 0.0561  0.3012  -0.0241 55  ASN A OD1   
729  N ND2   . ASN A 55  ? 2.6341 1.2146 1.1572 0.0700  0.3628  0.0163  55  ASN A ND2   
736  N N     . PRO A 56  ? 1.9445 0.9094 0.6633 0.1835  0.1847  -0.0162 56  PRO A N     
737  C CA    . PRO A 56  ? 1.8396 0.8540 0.6111 0.2095  0.1462  -0.0214 56  PRO A CA    
738  C C     . PRO A 56  ? 1.7640 0.7657 0.5852 0.1890  0.1248  -0.0342 56  PRO A C     
739  O O     . PRO A 56  ? 1.7362 0.7480 0.5845 0.1506  0.1252  -0.0516 56  PRO A O     
740  C CB    . PRO A 56  ? 1.7618 0.9119 0.5895 0.2116  0.1185  -0.0441 56  PRO A CB    
741  C CG    . PRO A 56  ? 1.7727 0.9488 0.6011 0.1750  0.1320  -0.0641 56  PRO A CG    
742  C CD    . PRO A 56  ? 1.8807 0.9357 0.6421 0.1551  0.1726  -0.0457 56  PRO A CD    
750  N N     . LEU A 57  ? 1.6502 0.6421 0.4892 0.2128  0.1056  -0.0239 57  LEU A N     
751  C CA    . LEU A 57  ? 1.5839 0.5837 0.4721 0.1914  0.0854  -0.0295 57  LEU A CA    
752  C C     . LEU A 57  ? 1.4602 0.5827 0.4470 0.1748  0.0474  -0.0566 57  LEU A C     
753  O O     . LEU A 57  ? 1.4012 0.5508 0.4378 0.1461  0.0355  -0.0665 57  LEU A O     
754  C CB    . LEU A 57  ? 1.6477 0.6045 0.5222 0.2216  0.0779  -0.0080 57  LEU A CB    
755  C CG    . LEU A 57  ? 1.5796 0.5605 0.5017 0.1993  0.0583  -0.0095 57  LEU A CG    
756  C CD1   . LEU A 57  ? 1.6173 0.5521 0.5165 0.1575  0.0856  -0.0120 57  LEU A CD1   
757  C CD2   . LEU A 57  ? 1.5854 0.5405 0.4948 0.2305  0.0500  0.0110  57  LEU A CD2   
769  N N     . GLY A 58  ? 0.8609 0.4376 0.6440 -0.0265 0.1112  -0.0031 58  GLY A N     
770  C CA    . GLY A 58  ? 0.8336 0.4531 0.5981 -0.0268 0.0923  -0.0056 58  GLY A CA    
771  C C     . GLY A 58  ? 0.7763 0.4782 0.5934 -0.0062 0.0867  0.0184  58  GLY A C     
772  O O     . GLY A 58  ? 0.7612 0.4927 0.6217 -0.0002 0.0889  0.0403  58  GLY A O     
776  N N     . PHE A 59  ? 0.8630 0.5955 0.6690 0.0031  0.0805  0.0138  59  PHE A N     
777  C CA    . PHE A 59  ? 0.8272 0.6327 0.6749 0.0220  0.0763  0.0286  59  PHE A CA    
778  C C     . PHE A 59  ? 0.8183 0.6282 0.6538 0.0369  0.0896  0.0170  59  PHE A C     
779  O O     . PHE A 59  ? 0.8326 0.5930 0.6227 0.0292  0.0994  0.0002  59  PHE A O     
780  C CB    . PHE A 59  ? 0.8090 0.6590 0.6722 0.0135  0.0481  0.0354  59  PHE A CB    
781  C CG    . PHE A 59  ? 0.8336 0.6635 0.6576 0.0070  0.0279  0.0226  59  PHE A CG    
782  C CD1   . PHE A 59  ? 0.8861 0.6702 0.6705 -0.0158 0.0078  0.0137  59  PHE A CD1   
783  C CD2   . PHE A 59  ? 0.8142 0.6667 0.6374 0.0229  0.0263  0.0202  59  PHE A CD2   
784  C CE1   . PHE A 59  ? 0.9200 0.6819 0.6595 -0.0202 -0.0163 0.0070  59  PHE A CE1   
785  C CE2   . PHE A 59  ? 0.8400 0.6644 0.6227 0.0187  0.0061  0.0142  59  PHE A CE2   
786  C CZ    . PHE A 59  ? 0.8949 0.6745 0.6332 -0.0017 -0.0166 0.0098  59  PHE A CZ    
796  N N     . LYS A 60  ? 0.7180 0.5866 0.5912 0.0550  0.0912  0.0251  60  LYS A N     
797  C CA    . LYS A 60  ? 0.6875 0.5694 0.5628 0.0663  0.1034  0.0136  60  LYS A CA    
798  C C     . LYS A 60  ? 0.6693 0.5924 0.5525 0.0703  0.0864  0.0137  60  LYS A C     
799  O O     . LYS A 60  ? 0.6736 0.6448 0.5848 0.0761  0.0748  0.0247  60  LYS A O     
800  C CB    . LYS A 60  ? 0.6476 0.5618 0.5649 0.0851  0.1187  0.0179  60  LYS A CB    
801  C CG    . LYS A 60  ? 0.5883 0.5227 0.5205 0.0926  0.1318  0.0026  60  LYS A CG    
802  C CD    . LYS A 60  ? 0.5544 0.5221 0.5356 0.1117  0.1418  0.0060  60  LYS A CD    
803  C CE    . LYS A 60  ? 0.5014 0.4930 0.5089 0.1142  0.1564  -0.0133 60  LYS A CE    
804  N NZ    . LYS A 60  ? 0.4691 0.4951 0.5346 0.1344  0.1638  -0.0119 60  LYS A NZ    
818  N N     . GLU A 61  ? 0.6283 0.5277 0.4851 0.0668  0.0882  0.0014  61  GLU A N     
819  C CA    . GLU A 61  ? 0.6017 0.5262 0.4657 0.0728  0.0735  -0.0009 61  GLU A CA    
820  C C     . GLU A 61  ? 0.5810 0.4929 0.4387 0.0731  0.0896  -0.0146 61  GLU A C     
821  O O     . GLU A 61  ? 0.5830 0.4566 0.4185 0.0638  0.1109  -0.0218 61  GLU A O     
822  C CB    . GLU A 61  ? 0.6270 0.5233 0.4622 0.0654  0.0482  0.0033  61  GLU A CB    
823  C CG    . GLU A 61  ? 0.6738 0.4952 0.4433 0.0500  0.0492  -0.0005 61  GLU A CG    
824  C CD    . GLU A 61  ? 0.7061 0.5043 0.4465 0.0462  0.0143  0.0066  61  GLU A CD    
825  O OE1   . GLU A 61  ? 0.6777 0.5240 0.4629 0.0578  -0.0077 0.0121  61  GLU A OE1   
826  O OE2   . GLU A 61  ? 0.7537 0.4876 0.4266 0.0323  0.0088  0.0064  61  GLU A OE2   
833  N N     . SER A 62  ? 0.5524 0.4964 0.4320 0.0820  0.0825  -0.0207 62  SER A N     
834  C CA    . SER A 62  ? 0.5540 0.4896 0.4365 0.0787  0.0971  -0.0356 62  SER A CA    
835  C C     . SER A 62  ? 0.5623 0.4911 0.4423 0.0842  0.0830  -0.0411 62  SER A C     
836  O O     . SER A 62  ? 0.5544 0.5150 0.4526 0.0971  0.0654  -0.0380 62  SER A O     
837  C CB    . SER A 62  ? 0.5241 0.5173 0.4532 0.0851  0.1075  -0.0448 62  SER A CB    
838  O OG    . SER A 62  ? 0.5103 0.5594 0.4642 0.0984  0.0921  -0.0443 62  SER A OG    
844  N N     . TRP A 63  ? 0.5779 0.4622 0.4379 0.0739  0.0943  -0.0495 63  TRP A N     
845  C CA    . TRP A 63  ? 0.5982 0.4638 0.4586 0.0796  0.0849  -0.0567 63  TRP A CA    
846  C C     . TRP A 63  ? 0.5985 0.4743 0.4836 0.0697  0.1041  -0.0782 63  TRP A C     
847  O O     . TRP A 63  ? 0.6105 0.4618 0.4865 0.0505  0.1273  -0.0817 63  TRP A O     
848  C CB    . TRP A 63  ? 0.6535 0.4377 0.4578 0.0737  0.0760  -0.0422 63  TRP A CB    
849  C CG    . TRP A 63  ? 0.6603 0.4440 0.4598 0.0904  0.0430  -0.0278 63  TRP A CG    
850  C CD1   . TRP A 63  ? 0.6739 0.4408 0.4419 0.0867  0.0259  -0.0114 63  TRP A CD1   
851  C CD2   . TRP A 63  ? 0.6545 0.4597 0.4893 0.1132  0.0230  -0.0319 63  TRP A CD2   
852  N NE1   . TRP A 63  ? 0.6677 0.4514 0.4561 0.1047  -0.0067 -0.0033 63  TRP A NE1   
853  C CE2   . TRP A 63  ? 0.6521 0.4602 0.4843 0.1233  -0.0068 -0.0154 63  TRP A CE2   
854  C CE3   . TRP A 63  ? 0.6524 0.4749 0.5234 0.1258  0.0283  -0.0513 63  TRP A CE3   
855  C CZ2   . TRP A 63  ? 0.6314 0.4664 0.5063 0.1484  -0.0296 -0.0162 63  TRP A CZ2   
856  C CZ3   . TRP A 63  ? 0.6440 0.4845 0.5484 0.1514  0.0089  -0.0540 63  TRP A CZ3   
857  C CH2   . TRP A 63  ? 0.6267 0.4768 0.5377 0.1638  -0.0189 -0.0358 63  TRP A CH2   
868  N N     . GLY A 64  ? 0.5283 0.4422 0.4463 0.0806  0.0961  -0.0955 64  GLY A N     
869  C CA    . GLY A 64  ? 0.5396 0.4653 0.4830 0.0685  0.1087  -0.1208 64  GLY A CA    
870  C C     . GLY A 64  ? 0.5869 0.4675 0.5251 0.0702  0.1050  -0.1348 64  GLY A C     
871  O O     . GLY A 64  ? 0.5768 0.4704 0.5230 0.0916  0.0899  -0.1398 64  GLY A O     
875  N N     . PHE A 65  ? 0.6085 0.4330 0.5361 0.0478  0.1219  -0.1415 65  PHE A N     
876  C CA    . PHE A 65  ? 0.6580 0.4289 0.5839 0.0455  0.1219  -0.1572 65  PHE A CA    
877  C C     . PHE A 65  ? 0.6731 0.4738 0.6377 0.0216  0.1364  -0.1906 65  PHE A C     
878  O O     . PHE A 65  ? 0.7063 0.4810 0.6731 -0.0082 0.1588  -0.1919 65  PHE A O     
879  C CB    . PHE A 65  ? 0.7287 0.3963 0.6033 0.0354  0.1281  -0.1331 65  PHE A CB    
880  C CG    . PHE A 65  ? 0.7341 0.3785 0.5661 0.0515  0.1108  -0.0993 65  PHE A CG    
881  C CD1   . PHE A 65  ? 0.7332 0.3791 0.5690 0.0831  0.0819  -0.0910 65  PHE A CD1   
882  C CD2   . PHE A 65  ? 0.7461 0.3697 0.5376 0.0341  0.1238  -0.0793 65  PHE A CD2   
883  C CE1   . PHE A 65  ? 0.7417 0.3728 0.5448 0.0947  0.0607  -0.0621 65  PHE A CE1   
884  C CE2   . PHE A 65  ? 0.7608 0.3613 0.5079 0.0451  0.1045  -0.0526 65  PHE A CE2   
885  C CZ    . PHE A 65  ? 0.7575 0.3635 0.5119 0.0742  0.0701  -0.0434 65  PHE A CZ    
895  N N     . GLY A 66  ? 0.6269 0.4847 0.6217 0.0325  0.1243  -0.2193 66  GLY A N     
896  C CA    . GLY A 66  ? 0.6194 0.5271 0.6529 0.0102  0.1290  -0.2517 66  GLY A CA    
897  C C     . GLY A 66  ? 0.5671 0.5423 0.6240 0.0039  0.1318  -0.2402 66  GLY A C     
898  O O     . GLY A 66  ? 0.5226 0.5365 0.5711 0.0250  0.1218  -0.2188 66  GLY A O     
902  N N     . LYS A 67  ? 0.5778 0.5659 0.6705 -0.0257 0.1469  -0.2547 67  LYS A N     
903  C CA    . LYS A 67  ? 0.5367 0.5869 0.6651 -0.0298 0.1526  -0.2460 67  LYS A CA    
904  C C     . LYS A 67  ? 0.5507 0.5499 0.6574 -0.0385 0.1809  -0.2186 67  LYS A C     
905  O O     . LYS A 67  ? 0.5318 0.5707 0.6758 -0.0463 0.1961  -0.2169 67  LYS A O     
906  C CB    . LYS A 67  ? 0.5405 0.6482 0.7343 -0.0561 0.1531  -0.2790 67  LYS A CB    
907  C CG    . LYS A 67  ? 0.6019 0.6507 0.8071 -0.0939 0.1764  -0.2998 67  LYS A CG    
908  C CD    . LYS A 67  ? 0.6012 0.7196 0.8864 -0.1243 0.1792  -0.3307 67  LYS A CD    
909  C CE    . LYS A 67  ? 0.6694 0.7375 0.9693 -0.1641 0.1928  -0.3618 67  LYS A CE    
910  N NZ    . LYS A 67  ? 0.6910 0.7488 0.9677 -0.1558 0.1645  -0.3906 67  LYS A NZ    
924  N N     . VAL A 68  ? 0.6403 0.5536 0.6869 -0.0359 0.1875  -0.1983 68  VAL A N     
925  C CA    . VAL A 68  ? 0.6695 0.5241 0.6741 -0.0456 0.2122  -0.1726 68  VAL A CA    
926  C C     . VAL A 68  ? 0.6278 0.4888 0.5979 -0.0166 0.1939  -0.1475 68  VAL A C     
927  O O     . VAL A 68  ? 0.6510 0.4715 0.5790 -0.0005 0.1746  -0.1330 68  VAL A O     
928  C CB    . VAL A 68  ? 0.7575 0.5070 0.7086 -0.0639 0.2264  -0.1630 68  VAL A CB    
929  C CG1   . VAL A 68  ? 0.8056 0.4949 0.7023 -0.0799 0.2558  -0.1386 68  VAL A CG1   
930  C CG2   . VAL A 68  ? 0.8036 0.5435 0.7936 -0.0939 0.2413  -0.1909 68  VAL A CG2   
940  N N     . VAL A 69  ? 0.5652 0.4767 0.5591 -0.0101 0.1995  -0.1429 69  VAL A N     
941  C CA    . VAL A 69  ? 0.5203 0.4501 0.4961 0.0148  0.1809  -0.1236 69  VAL A CA    
942  C C     . VAL A 69  ? 0.5455 0.4262 0.4787 0.0076  0.2019  -0.1070 69  VAL A C     
943  O O     . VAL A 69  ? 0.5606 0.4432 0.5120 -0.0076 0.2334  -0.1146 69  VAL A O     
944  C CB    . VAL A 69  ? 0.4567 0.4758 0.4881 0.0311  0.1670  -0.1297 69  VAL A CB    
945  C CG1   . VAL A 69  ? 0.4311 0.4599 0.4427 0.0526  0.1515  -0.1073 69  VAL A CG1   
946  C CG2   . VAL A 69  ? 0.4413 0.5063 0.5004 0.0350  0.1462  -0.1500 69  VAL A CG2   
956  N N     . PHE A 70  ? 0.5997 0.4398 0.4789 0.0178  0.1849  -0.0874 70  PHE A N     
957  C CA    . PHE A 70  ? 0.6265 0.4194 0.4541 0.0118  0.1974  -0.0741 70  PHE A CA    
958  C C     . PHE A 70  ? 0.5819 0.4100 0.4205 0.0309  0.1778  -0.0646 70  PHE A C     
959  O O     . PHE A 70  ? 0.5480 0.4180 0.4113 0.0477  0.1506  -0.0605 70  PHE A O     
960  C CB    . PHE A 70  ? 0.6996 0.4077 0.4468 0.0029  0.1887  -0.0583 70  PHE A CB    
961  C CG    . PHE A 70  ? 0.7673 0.4227 0.4917 -0.0180 0.2090  -0.0613 70  PHE A CG    
962  C CD1   . PHE A 70  ? 0.7751 0.4333 0.5252 -0.0132 0.1942  -0.0671 70  PHE A CD1   
963  C CD2   . PHE A 70  ? 0.8371 0.4344 0.5110 -0.0442 0.2465  -0.0591 70  PHE A CD2   
964  C CE1   . PHE A 70  ? 0.8528 0.4521 0.5820 -0.0352 0.2139  -0.0687 70  PHE A CE1   
965  C CE2   . PHE A 70  ? 0.9219 0.4645 0.5717 -0.0679 0.2691  -0.0583 70  PHE A CE2   
966  C CZ    . PHE A 70  ? 0.9320 0.4731 0.6109 -0.0638 0.2514  -0.0620 70  PHE A CZ    
976  N N     . LYS A 71  ? 0.7530 0.5595 0.5714 0.0265  0.1955  -0.0625 71  LYS A N     
977  C CA    . LYS A 71  ? 0.7258 0.5559 0.5571 0.0408  0.1818  -0.0542 71  LYS A CA    
978  C C     . LYS A 71  ? 0.7706 0.5362 0.5385 0.0296  0.1910  -0.0509 71  LYS A C     
979  O O     . LYS A 71  ? 0.8086 0.5284 0.5399 0.0139  0.2229  -0.0602 71  LYS A O     
980  C CB    . LYS A 71  ? 0.6775 0.5688 0.5792 0.0539  0.1937  -0.0609 71  LYS A CB    
981  C CG    . LYS A 71  ? 0.6318 0.5938 0.5851 0.0684  0.1704  -0.0601 71  LYS A CG    
982  C CD    . LYS A 71  ? 0.5869 0.6087 0.6071 0.0801  0.1778  -0.0666 71  LYS A CD    
983  C CE    . LYS A 71  ? 0.5519 0.6401 0.6055 0.0920  0.1508  -0.0663 71  LYS A CE    
984  N NZ    . LYS A 71  ? 0.5358 0.6862 0.6540 0.1027  0.1499  -0.0728 71  LYS A NZ    
998  N N     . ARG A 72  ? 0.7472 0.5098 0.5012 0.0351  0.1647  -0.0397 72  ARG A N     
999  C CA    . ARG A 72  ? 0.7992 0.5035 0.4939 0.0228  0.1665  -0.0400 72  ARG A CA    
1000 C C     . ARG A 72  ? 0.7994 0.5269 0.5272 0.0318  0.1557  -0.0347 72  ARG A C     
1001 O O     . ARG A 72  ? 0.7691 0.5503 0.5446 0.0445  0.1345  -0.0229 72  ARG A O     
1002 C CB    . ARG A 72  ? 0.8447 0.5029 0.4712 0.0115  0.1359  -0.0304 72  ARG A CB    
1003 C CG    . ARG A 72  ? 0.8942 0.4909 0.4512 -0.0043 0.1510  -0.0319 72  ARG A CG    
1004 C CD    . ARG A 72  ? 0.9605 0.5003 0.4588 -0.0222 0.1896  -0.0462 72  ARG A CD    
1005 N NE    . ARG A 72  ? 1.0529 0.5258 0.4680 -0.0418 0.2062  -0.0437 72  ARG A NE    
1006 C CZ    . ARG A 72  ? 1.0585 0.5326 0.4891 -0.0475 0.2357  -0.0455 72  ARG A CZ    
1007 N NH1   . ARG A 72  ? 0.9768 0.5215 0.5054 -0.0344 0.2470  -0.0531 72  ARG A NH1   
1008 N NH2   . ARG A 72  ? 1.1519 0.5546 0.4966 -0.0689 0.2526  -0.0389 72  ARG A NH2   
1022 N N     . TYR A 73  ? 0.8198 0.5008 0.5178 0.0236  0.1737  -0.0444 73  TYR A N     
1023 C CA    . TYR A 73  ? 0.8417 0.5199 0.5559 0.0258  0.1637  -0.0397 73  TYR A CA    
1024 C C     . TYR A 73  ? 0.9094 0.5175 0.5458 0.0026  0.1545  -0.0488 73  TYR A C     
1025 O O     . TYR A 73  ? 0.9538 0.5045 0.5368 -0.0084 0.1829  -0.0676 73  TYR A O     
1026 C CB    . TYR A 73  ? 0.8269 0.5126 0.5896 0.0414  0.1944  -0.0461 73  TYR A CB    
1027 C CG    . TYR A 73  ? 0.8478 0.5271 0.6338 0.0458  0.1840  -0.0358 73  TYR A CG    
1028 C CD1   . TYR A 73  ? 0.9049 0.5175 0.6431 0.0278  0.1849  -0.0469 73  TYR A CD1   
1029 C CD2   . TYR A 73  ? 0.8161 0.5502 0.6655 0.0651  0.1733  -0.0149 73  TYR A CD2   
1030 C CE1   . TYR A 73  ? 0.9218 0.5206 0.6832 0.0277  0.1773  -0.0376 73  TYR A CE1   
1031 C CE2   . TYR A 73  ? 0.8334 0.5527 0.6994 0.0664  0.1665  -0.0008 73  TYR A CE2   
1032 C CZ    . TYR A 73  ? 0.8846 0.5350 0.7107 0.0471  0.1696  -0.0123 73  TYR A CZ    
1033 O OH    . TYR A 73  ? 0.9078 0.5357 0.7523 0.0445  0.1646  0.0014  73  TYR A OH    
1043 N N     . LEU A 74  ? 0.8861 0.5019 0.5166 -0.0062 0.1157  -0.0378 74  LEU A N     
1044 C CA    . LEU A 74  ? 0.9458 0.5042 0.5061 -0.0304 0.0951  -0.0466 74  LEU A CA    
1045 C C     . LEU A 74  ? 0.9638 0.5146 0.5483 -0.0395 0.0872  -0.0483 74  LEU A C     
1046 O O     . LEU A 74  ? 0.9231 0.5242 0.5785 -0.0284 0.0831  -0.0325 74  LEU A O     
1047 C CB    . LEU A 74  ? 0.9563 0.5302 0.4962 -0.0358 0.0505  -0.0339 74  LEU A CB    
1048 C CG    . LEU A 74  ? 0.9435 0.5161 0.4599 -0.0270 0.0544  -0.0281 74  LEU A CG    
1049 C CD1   . LEU A 74  ? 0.9414 0.5378 0.4619 -0.0231 0.0072  -0.0123 74  LEU A CD1   
1050 C CD2   . LEU A 74  ? 1.0033 0.4983 0.4251 -0.0430 0.0798  -0.0415 74  LEU A CD2   
1062 N N     . ARG A 75  ? 1.0187 0.5007 0.5375 -0.0626 0.0862  -0.0681 75  ARG A N     
1063 C CA    . ARG A 75  ? 1.0468 0.5072 0.5818 -0.0777 0.0784  -0.0739 75  ARG A CA    
1064 C C     . ARG A 75  ? 1.0620 0.5548 0.6105 -0.0964 0.0273  -0.0629 75  ARG A C     
1065 O O     . ARG A 75  ? 1.0930 0.5860 0.5974 -0.1055 -0.0053 -0.0629 75  ARG A O     
1066 C CB    . ARG A 75  ? 1.1260 0.4953 0.5835 -0.0967 0.1000  -0.1066 75  ARG A CB    
1067 C CG    . ARG A 75  ? 1.1327 0.4726 0.5727 -0.0794 0.1539  -0.1226 75  ARG A CG    
1068 C CD    . ARG A 75  ? 1.1656 0.4595 0.6279 -0.0731 0.1908  -0.1416 75  ARG A CD    
1069 N NE    . ARG A 75  ? 1.1692 0.4559 0.6430 -0.0506 0.2434  -0.1552 75  ARG A NE    
1070 C CZ    . ARG A 75  ? 1.2185 0.4754 0.7133 -0.0406 0.2797  -0.1732 75  ARG A CZ    
1071 N NH1   . ARG A 75  ? 1.3034 0.5120 0.7933 -0.0520 0.2736  -0.1846 75  ARG A NH1   
1072 N NH2   . ARG A 75  ? 1.2119 0.5017 0.7462 -0.0207 0.3168  -0.1761 75  ARG A NH2   
1086 N N     . TYR A 76  ? 1.0078 0.5292 0.6213 -0.1019 0.0207  -0.0517 76  TYR A N     
1087 C CA    . TYR A 76  ? 1.0080 0.5787 0.6597 -0.1191 -0.0218 -0.0405 76  TYR A CA    
1088 C C     . TYR A 76  ? 1.0275 0.5807 0.7141 -0.1431 -0.0204 -0.0420 76  TYR A C     
1089 O O     . TYR A 76  ? 0.9939 0.5563 0.7289 -0.1310 0.0076  -0.0265 76  TYR A O     
1090 C CB    . TYR A 76  ? 0.9339 0.5942 0.6546 -0.0950 -0.0271 -0.0148 76  TYR A CB    
1091 C CG    . TYR A 76  ? 0.9161 0.6401 0.6929 -0.1088 -0.0636 -0.0044 76  TYR A CG    
1092 C CD1   . TYR A 76  ? 0.9600 0.6837 0.7123 -0.1254 -0.1086 -0.0137 76  TYR A CD1   
1093 C CD2   . TYR A 76  ? 0.8592 0.6469 0.7146 -0.1047 -0.0529 0.0154  76  TYR A CD2   
1094 C CE1   . TYR A 76  ? 0.9393 0.7323 0.7596 -0.1359 -0.1423 -0.0060 76  TYR A CE1   
1095 C CE2   . TYR A 76  ? 0.8361 0.6896 0.7524 -0.1182 -0.0792 0.0224  76  TYR A CE2   
1096 C CZ    . TYR A 76  ? 0.8725 0.7327 0.7792 -0.1327 -0.1241 0.0106  76  TYR A CZ    
1097 O OH    . TYR A 76  ? 0.8518 0.7878 0.8353 -0.1443 -0.1509 0.0158  76  TYR A OH    
1107 N N     . ASP A 77  ? 1.2831 0.8085 0.9432 -0.1785 -0.0529 -0.0596 77  ASP A N     
1108 C CA    . ASP A 77  ? 1.3270 0.8260 1.0167 -0.2099 -0.0539 -0.0655 77  ASP A CA    
1109 C C     . ASP A 77  ? 1.3236 0.8972 1.0843 -0.2336 -0.0916 -0.0530 77  ASP A C     
1110 O O     . ASP A 77  ? 1.3604 0.9145 1.1439 -0.2705 -0.1018 -0.0620 77  ASP A O     
1111 C CB    . ASP A 77  ? 1.4232 0.8241 1.0293 -0.2386 -0.0574 -0.1036 77  ASP A CB    
1112 C CG    . ASP A 77  ? 1.4802 0.8737 1.0121 -0.2537 -0.1012 -0.1219 77  ASP A CG    
1113 O OD1   . ASP A 77  ? 1.4715 0.9333 1.0416 -0.2628 -0.1474 -0.1101 77  ASP A OD1   
1114 O OD2   . ASP A 77  ? 1.5409 0.8604 0.9756 -0.2553 -0.0888 -0.1473 77  ASP A OD2   
1119 N N     . ARG A 78  ? 1.1676 0.8264 0.9693 -0.2139 -0.1102 -0.0347 78  ARG A N     
1120 C CA    . ARG A 78  ? 1.1392 0.8857 1.0277 -0.2288 -0.1371 -0.0218 78  ARG A CA    
1121 C C     . ARG A 78  ? 1.2066 0.9521 1.0894 -0.2672 -0.1900 -0.0433 78  ARG A C     
1122 O O     . ARG A 78  ? 1.2007 1.0046 1.1633 -0.2940 -0.2084 -0.0397 78  ARG A O     
1123 C CB    . ARG A 78  ? 1.1003 0.8688 1.0592 -0.2401 -0.1041 -0.0019 78  ARG A CB    
1124 C CG    . ARG A 78  ? 1.0308 0.8186 1.0021 -0.2016 -0.0619 0.0235  78  ARG A CG    
1125 C CD    . ARG A 78  ? 0.9999 0.8187 1.0352 -0.2136 -0.0350 0.0498  78  ARG A CD    
1126 N NE    . ARG A 78  ? 1.0661 0.8114 1.0952 -0.2491 -0.0261 0.0448  78  ARG A NE    
1127 C CZ    . ARG A 78  ? 1.1164 0.7738 1.1021 -0.2402 0.0005  0.0441  78  ARG A CZ    
1128 N NH1   . ARG A 78  ? 1.1032 0.7446 1.0532 -0.1981 0.0199  0.0482  78  ARG A NH1   
1129 N NH2   . ARG A 78  ? 1.1822 0.7676 1.1667 -0.2736 0.0078  0.0378  78  ARG A NH2   
1143 N N     . THR A 79  ? 1.0439 0.7262 0.8324 -0.2723 -0.2152 -0.0658 79  THR A N     
1144 C CA    . THR A 79  ? 1.1140 0.8006 0.8844 -0.3040 -0.2765 -0.0850 79  THR A CA    
1145 C C     . THR A 79  ? 1.0899 0.8289 0.8555 -0.2762 -0.3181 -0.0730 79  THR A C     
1146 O O     . THR A 79  ? 1.0518 0.7828 0.7834 -0.2383 -0.2963 -0.0595 79  THR A O     
1147 C CB    . THR A 79  ? 1.2330 0.8088 0.8868 -0.3313 -0.2825 -0.1192 79  THR A CB    
1148 O OG1   . THR A 79  ? 1.2513 0.7699 0.8050 -0.3021 -0.2620 -0.1212 79  THR A OG1   
1149 C CG2   . THR A 79  ? 1.2676 0.7800 0.9289 -0.3552 -0.2399 -0.1329 79  THR A CG2   
1157 N N     . GLU A 80  ? 1.6402 1.4332 1.4464 -0.2955 -0.3800 -0.0777 80  GLU A N     
1158 C CA    . GLU A 80  ? 1.6414 1.4814 1.4499 -0.2665 -0.4270 -0.0639 80  GLU A CA    
1159 C C     . GLU A 80  ? 1.7172 1.4670 1.3839 -0.2504 -0.4314 -0.0666 80  GLU A C     
1160 O O     . GLU A 80  ? 1.7012 1.4622 1.3554 -0.2121 -0.4314 -0.0467 80  GLU A O     
1161 C CB    . GLU A 80  ? 1.6875 1.5905 1.5540 -0.2927 -0.5010 -0.0724 80  GLU A CB    
1162 C CG    . GLU A 80  ? 1.7183 1.6467 1.5635 -0.2646 -0.5643 -0.0598 80  GLU A CG    
1163 C CD    . GLU A 80  ? 1.6295 1.6132 1.5349 -0.2108 -0.5418 -0.0323 80  GLU A CD    
1164 O OE1   . GLU A 80  ? 1.5383 1.5700 1.5271 -0.1997 -0.4872 -0.0247 80  GLU A OE1   
1165 O OE2   . GLU A 80  ? 1.6618 1.6353 1.5254 -0.1804 -0.5792 -0.0183 80  GLU A OE2   
1172 N N     . ALA A 81  ? 1.5743 1.2296 1.1306 -0.2811 -0.4315 -0.0924 81  ALA A N     
1173 C CA    . ALA A 81  ? 1.6408 1.2062 1.0530 -0.2712 -0.4274 -0.0965 81  ALA A CA    
1174 C C     . ALA A 81  ? 1.5622 1.1044 0.9617 -0.2361 -0.3578 -0.0829 81  ALA A C     
1175 O O     . ALA A 81  ? 1.5853 1.0980 0.9171 -0.2129 -0.3554 -0.0699 81  ALA A O     
1176 C CB    . ALA A 81  ? 1.7674 1.2359 1.0664 -0.3130 -0.4292 -0.1332 81  ALA A CB    
1182 N N     . SER A 82  ? 1.2924 0.8468 0.7570 -0.2331 -0.3027 -0.0843 82  SER A N     
1183 C CA    . SER A 82  ? 1.2388 0.7800 0.7018 -0.2012 -0.2412 -0.0734 82  SER A CA    
1184 C C     . SER A 82  ? 1.1354 0.7614 0.6864 -0.1652 -0.2392 -0.0448 82  SER A C     
1185 O O     . SER A 82  ? 1.1117 0.7302 0.6528 -0.1381 -0.2004 -0.0356 82  SER A O     
1186 C CB    . SER A 82  ? 1.2194 0.7359 0.7130 -0.2090 -0.1886 -0.0841 82  SER A CB    
1187 O OG    . SER A 82  ? 1.2143 0.7081 0.6924 -0.1807 -0.1338 -0.0791 82  SER A OG    
1193 N N     . LEU A 83  ? 1.2002 0.9083 0.8407 -0.1654 -0.2785 -0.0340 83  LEU A N     
1194 C CA    . LEU A 83  ? 1.1172 0.9039 0.8395 -0.1303 -0.2750 -0.0122 83  LEU A CA    
1195 C C     . LEU A 83  ? 1.1440 0.9179 0.8194 -0.1065 -0.3081 -0.0014 83  LEU A C     
1196 O O     . LEU A 83  ? 1.1064 0.8881 0.7894 -0.0754 -0.2835 0.0107  83  LEU A O     
1197 C CB    . LEU A 83  ? 1.0768 0.9596 0.9198 -0.1385 -0.2968 -0.0070 83  LEU A CB    
1198 C CG    . LEU A 83  ? 1.0006 0.9709 0.9347 -0.1030 -0.2936 0.0098  83  LEU A CG    
1199 C CD1   . LEU A 83  ? 0.9352 0.9045 0.8729 -0.0787 -0.2342 0.0177  83  LEU A CD1   
1200 C CD2   . LEU A 83  ? 0.9685 1.0352 1.0229 -0.1167 -0.3091 0.0110  83  LEU A CD2   
1212 N N     . HIS A 84  ? 1.4574 1.2078 1.0816 -0.1215 -0.3663 -0.0049 84  HIS A N     
1213 C CA    . HIS A 84  ? 1.5073 1.2316 1.0742 -0.0990 -0.4023 0.0108  84  HIS A CA    
1214 C C     . HIS A 84  ? 1.5474 1.1862 1.0092 -0.0899 -0.3576 0.0134  84  HIS A C     
1215 O O     . HIS A 84  ? 1.5455 1.1751 0.9950 -0.0619 -0.3570 0.0314  84  HIS A O     
1216 C CB    . HIS A 84  ? 1.6248 1.3249 1.1317 -0.1215 -0.4746 0.0067  84  HIS A CB    
1217 C CG    . HIS A 84  ? 1.7288 1.3640 1.1284 -0.1059 -0.5066 0.0244  84  HIS A CG    
1218 N ND1   . HIS A 84  ? 1.8204 1.3566 1.0859 -0.1198 -0.4748 0.0187  84  HIS A ND1   
1219 C CD2   . HIS A 84  ? 1.7446 1.4099 1.1806 -0.0734 -0.5402 0.0480  84  HIS A CD2   
1220 C CE1   . HIS A 84  ? 1.8857 1.3923 1.1051 -0.1005 -0.4912 0.0405  84  HIS A CE1   
1221 N NE2   . HIS A 84  ? 1.8439 1.4232 1.1618 -0.0716 -0.5325 0.0587  84  HIS A NE2   
1229 N N     . ARG A 85  ? 1.3806 0.9556 0.7712 -0.1138 -0.3174 -0.0058 85  ARG A N     
1230 C CA    . ARG A 85  ? 1.4414 0.9417 0.7404 -0.1086 -0.2695 -0.0068 85  ARG A CA    
1231 C C     . ARG A 85  ? 1.3595 0.9001 0.7325 -0.0800 -0.2195 0.0023  85  ARG A C     
1232 O O     . ARG A 85  ? 1.3690 0.8900 0.7161 -0.0614 -0.2083 0.0156  85  ARG A O     
1233 C CB    . ARG A 85  ? 1.5387 0.9694 0.7602 -0.1383 -0.2346 -0.0345 85  ARG A CB    
1234 C CG    . ARG A 85  ? 1.6105 0.9731 0.7503 -0.1346 -0.1770 -0.0394 85  ARG A CG    
1235 C CD    . ARG A 85  ? 1.7164 1.0042 0.7711 -0.1623 -0.1441 -0.0709 85  ARG A CD    
1236 N NE    . ARG A 85  ? 1.7791 1.0106 0.7631 -0.1595 -0.0881 -0.0747 85  ARG A NE    
1237 C CZ    . ARG A 85  ? 1.8447 1.0356 0.7558 -0.1652 -0.0911 -0.0632 85  ARG A CZ    
1238 N NH1   . ARG A 85  ? 1.8815 1.0679 0.7554 -0.1725 -0.1521 -0.0499 85  ARG A NH1   
1239 N NH2   . ARG A 85  ? 1.8658 1.0228 0.7468 -0.1643 -0.0335 -0.0651 85  ARG A NH2   
1253 N N     . VAL A 86  ? 1.2538 0.8468 0.7148 -0.0781 -0.1901 -0.0042 86  VAL A N     
1254 C CA    . VAL A 86  ? 1.1764 0.8090 0.7004 -0.0532 -0.1463 0.0024  86  VAL A CA    
1255 C C     . VAL A 86  ? 1.1009 0.7857 0.6796 -0.0257 -0.1686 0.0194  86  VAL A C     
1256 O O     . VAL A 86  ? 1.0842 0.7718 0.6727 -0.0062 -0.1408 0.0237  86  VAL A O     
1257 C CB    . VAL A 86  ? 1.0949 0.7732 0.6965 -0.0564 -0.1198 -0.0024 86  VAL A CB    
1258 C CG1   . VAL A 86  ? 1.1784 0.7933 0.7280 -0.0785 -0.0929 -0.0207 86  VAL A CG1   
1259 C CG2   . VAL A 86  ? 1.0399 0.7862 0.7201 -0.0627 -0.1554 0.0037  86  VAL A CG2   
1269 N N     . LEU A 87  ? 1.1030 0.8309 0.7245 -0.0234 -0.2187 0.0265  87  LEU A N     
1270 C CA    . LEU A 87  ? 1.0642 0.8343 0.7375 0.0068  -0.2414 0.0402  87  LEU A CA    
1271 C C     . LEU A 87  ? 1.1452 0.8428 0.7334 0.0176  -0.2508 0.0515  87  LEU A C     
1272 O O     . LEU A 87  ? 1.1111 0.8228 0.7328 0.0452  -0.2512 0.0610  87  LEU A O     
1273 C CB    . LEU A 87  ? 1.0626 0.8945 0.8037 0.0076  -0.2961 0.0444  87  LEU A CB    
1274 C CG    . LEU A 87  ? 0.9839 0.9037 0.8331 0.0004  -0.2832 0.0377  87  LEU A CG    
1275 C CD1   . LEU A 87  ? 1.0010 0.9796 0.9153 -0.0066 -0.3389 0.0386  87  LEU A CD1   
1276 C CD2   . LEU A 87  ? 0.8989 0.8774 0.8232 0.0284  -0.2452 0.0398  87  LEU A CD2   
1288 N N     . GLY A 88  ? 1.2842 0.8993 0.7592 -0.0049 -0.2555 0.0500  88  GLY A N     
1289 C CA    . GLY A 88  ? 1.3808 0.9153 0.7590 -0.0014 -0.2527 0.0628  88  GLY A CA    
1290 C C     . GLY A 88  ? 1.3975 0.8994 0.7520 -0.0031 -0.1871 0.0556  88  GLY A C     
1291 O O     . GLY A 88  ? 1.4802 0.9090 0.7488 -0.0080 -0.1738 0.0647  88  GLY A O     
1295 N N     . SER A 89  ? 1.1640 0.7198 0.5940 -0.0004 -0.1464 0.0410  89  SER A N     
1296 C CA    . SER A 89  ? 1.1704 0.7102 0.5957 -0.0005 -0.0890 0.0326  89  SER A CA    
1297 C C     . SER A 89  ? 1.1751 0.7003 0.6031 0.0163  -0.0837 0.0440  89  SER A C     
1298 O O     . SER A 89  ? 1.2163 0.6957 0.6009 0.0072  -0.0452 0.0414  89  SER A O     
1299 C CB    . SER A 89  ? 1.0780 0.6887 0.5943 0.0062  -0.0600 0.0205  89  SER A CB    
1300 O OG    . SER A 89  ? 1.0875 0.6904 0.6066 0.0064  -0.0104 0.0112  89  SER A OG    
1306 N N     . TRP A 90  ? 1.1568 0.7201 0.6414 0.0401  -0.1189 0.0547  90  TRP A N     
1307 C CA    . TRP A 90  ? 1.1707 0.7110 0.6602 0.0580  -0.1181 0.0644  90  TRP A CA    
1308 C C     . TRP A 90  ? 1.1213 0.6903 0.6578 0.0848  -0.1708 0.0775  90  TRP A C     
1309 O O     . TRP A 90  ? 1.0267 0.6715 0.6391 0.0938  -0.1899 0.0714  90  TRP A O     
1310 C CB    . TRP A 90  ? 1.1236 0.7085 0.6815 0.0662  -0.0750 0.0482  90  TRP A CB    
1311 C CG    . TRP A 90  ? 0.9875 0.6672 0.6419 0.0805  -0.0767 0.0368  90  TRP A CG    
1312 C CD1   . TRP A 90  ? 0.9116 0.6368 0.5964 0.0709  -0.0536 0.0258  90  TRP A CD1   
1313 C CD2   . TRP A 90  ? 0.8875 0.6244 0.6174 0.1069  -0.0996 0.0366  90  TRP A CD2   
1314 N NE1   . TRP A 90  ? 0.7682 0.5723 0.5335 0.0863  -0.0604 0.0218  90  TRP A NE1   
1315 C CE2   . TRP A 90  ? 0.7526 0.5690 0.5486 0.1079  -0.0858 0.0258  90  TRP A CE2   
1316 C CE3   . TRP A 90  ? 0.9005 0.6264 0.6493 0.1313  -0.1283 0.0447  90  TRP A CE3   
1317 C CZ2   . TRP A 90  ? 0.6731 0.5617 0.5489 0.1289  -0.0947 0.0207  90  TRP A CZ2   
1318 C CZ3   . TRP A 90  ? 0.7868 0.5872 0.6254 0.1563  -0.1383 0.0365  90  TRP A CZ3   
1319 C CH2   . TRP A 90  ? 0.7033 0.5859 0.6023 0.1532  -0.1191 0.0236  90  TRP A CH2   
1330 N N     . THR A 91  ? 1.2057 0.7133 0.7007 0.0974  -0.1924 0.0964  91  THR A N     
1331 C CA    . THR A 91  ? 1.1795 0.7078 0.7258 0.1300  -0.2424 0.1100  91  THR A CA    
1332 C C     . THR A 91  ? 1.1569 0.6830 0.7554 0.1555  -0.2221 0.1054  91  THR A C     
1333 O O     . THR A 91  ? 1.1735 0.6851 0.7663 0.1437  -0.1736 0.0916  91  THR A O     
1334 C CB    . THR A 91  ? 1.2951 0.7471 0.7497 0.1291  -0.2948 0.1392  91  THR A CB    
1335 O OG1   . THR A 91  ? 1.3272 0.7983 0.8429 0.1678  -0.3447 0.1542  91  THR A OG1   
1336 C CG2   . THR A 91  ? 1.4039 0.7430 0.7402 0.1111  -0.2691 0.1550  91  THR A CG2   
1344 N N     . GLY A 92  ? 1.2155 0.7588 0.8719 0.1911  -0.2609 0.1142  92  GLY A N     
1345 C CA    . GLY A 92  ? 1.2161 0.7515 0.9241 0.2178  -0.2433 0.1056  92  GLY A CA    
1346 C C     . GLY A 92  ? 1.3469 0.7682 0.9692 0.2077  -0.2265 0.1209  92  GLY A C     
1347 O O     . GLY A 92  ? 1.3691 0.7765 1.0127 0.2072  -0.1876 0.1038  92  GLY A O     
1351 N N     . ASP A 93  ? 1.5667 0.9029 1.0867 0.1964  -0.2552 0.1530  93  ASP A N     
1352 C CA    . ASP A 93  ? 1.6679 0.8867 1.0965 0.1827  -0.2367 0.1730  93  ASP A CA    
1353 C C     . ASP A 93  ? 1.6925 0.8950 1.0739 0.1394  -0.1733 0.1561  93  ASP A C     
1354 O O     . ASP A 93  ? 1.7291 0.8776 1.0952 0.1273  -0.1353 0.1530  93  ASP A O     
1355 C CB    . ASP A 93  ? 1.7595 0.9321 1.1113 0.1725  -0.2729 0.2031  93  ASP A CB    
1356 C CG    . ASP A 93  ? 1.7735 0.9929 1.1956 0.2099  -0.3315 0.2146  93  ASP A CG    
1357 O OD1   . ASP A 93  ? 1.7072 0.9808 1.2372 0.2453  -0.3366 0.2004  93  ASP A OD1   
1358 O OD2   . ASP A 93  ? 1.8509 1.0557 1.2230 0.2038  -0.3698 0.2353  93  ASP A OD2   
1363 N N     . SER A 94  ? 1.2872 0.5369 0.6529 0.1157  -0.1606 0.1435  94  SER A N     
1364 C CA    . SER A 94  ? 1.2814 0.5209 0.6115 0.0789  -0.1014 0.1269  94  SER A CA    
1365 C C     . SER A 94  ? 1.2318 0.5303 0.6542 0.0815  -0.0601 0.0963  94  SER A C     
1366 O O     . SER A 94  ? 1.2438 0.5148 0.6480 0.0564  -0.0135 0.0864  94  SER A O     
1367 C CB    . SER A 94  ? 1.2525 0.5321 0.5601 0.0599  -0.0990 0.1168  94  SER A CB    
1368 O OG    . SER A 94  ? 1.1654 0.5492 0.5742 0.0767  -0.1100 0.0972  94  SER A OG    
1374 N N     . VAL A 95  ? 1.1042 0.4864 0.6251 0.1096  -0.0762 0.0797  95  VAL A N     
1375 C CA    . VAL A 95  ? 1.0662 0.5051 0.6646 0.1123  -0.0425 0.0493  95  VAL A CA    
1376 C C     . VAL A 95  ? 1.1192 0.5019 0.7275 0.1225  -0.0369 0.0475  95  VAL A C     
1377 O O     . VAL A 95  ? 1.1300 0.5059 0.7517 0.1045  0.0004  0.0280  95  VAL A O     
1378 C CB    . VAL A 95  ? 0.9587 0.5044 0.6454 0.1348  -0.0559 0.0319  95  VAL A CB    
1379 C CG1   . VAL A 95  ? 0.9372 0.4937 0.6586 0.1689  -0.1016 0.0439  95  VAL A CG1   
1380 C CG2   . VAL A 95  ? 0.9018 0.5033 0.6543 0.1378  -0.0251 0.0007  95  VAL A CG2   
1390 N N     . ASN A 96  ? 1.2227 0.5630 0.8292 0.1515  -0.0755 0.0667  96  ASN A N     
1391 C CA    . ASN A 96  ? 1.2857 0.5530 0.8950 0.1622  -0.0707 0.0677  96  ASN A CA    
1392 C C     . ASN A 96  ? 1.3707 0.5333 0.8903 0.1256  -0.0425 0.0856  96  ASN A C     
1393 O O     . ASN A 96  ? 1.4002 0.5279 0.9325 0.1102  -0.0094 0.0697  96  ASN A O     
1394 C CB    . ASN A 96  ? 1.2975 0.5336 0.9217 0.2050  -0.1215 0.0902  96  ASN A CB    
1395 C CG    . ASN A 96  ? 1.2064 0.5435 0.9402 0.2427  -0.1362 0.0643  96  ASN A CG    
1396 O OD1   . ASN A 96  ? 1.1444 0.5470 0.9369 0.2399  -0.1042 0.0275  96  ASN A OD1   
1397 N ND2   . ASN A 96  ? 1.1922 0.5446 0.9537 0.2775  -0.1848 0.0831  96  ASN A ND2   
1404 N N     . TYR A 97  ? 1.4749 0.5863 0.9010 0.1080  -0.0530 0.1169  97  TYR A N     
1405 C CA    . TYR A 97  ? 1.5371 0.5524 0.8692 0.0683  -0.0179 0.1343  97  TYR A CA    
1406 C C     . TYR A 97  ? 1.4928 0.5527 0.8605 0.0335  0.0416  0.1005  97  TYR A C     
1407 O O     . TYR A 97  ? 1.5264 0.5329 0.8879 0.0093  0.0773  0.0956  97  TYR A O     
1408 C CB    . TYR A 97  ? 1.5786 0.5626 0.8095 0.0528  -0.0348 0.1625  97  TYR A CB    
1409 C CG    . TYR A 97  ? 1.6706 0.5912 0.8168 0.0110  0.0036  0.1740  97  TYR A CG    
1410 C CD1   . TYR A 97  ? 1.7930 0.6429 0.8932 0.0106  -0.0103 0.2013  97  TYR A CD1   
1411 C CD2   . TYR A 97  ? 1.6571 0.5912 0.7739 -0.0261 0.0554  0.1571  97  TYR A CD2   
1412 C CE1   . TYR A 97  ? 1.8899 0.6817 0.9110 -0.0273 0.0267  0.2117  97  TYR A CE1   
1413 C CE2   . TYR A 97  ? 1.7472 0.6313 0.7945 -0.0623 0.0941  0.1631  97  TYR A CE2   
1414 C CZ    . TYR A 97  ? 1.8627 0.6743 0.8586 -0.0636 0.0797  0.1908  97  TYR A CZ    
1415 O OH    . TYR A 97  ? 1.9600 0.7193 0.8841 -0.0999 0.1201  0.1973  97  TYR A OH    
1425 N N     . ALA A 98  ? 1.2322 0.3906 0.6427 0.0303  0.0513  0.0773  98  ALA A N     
1426 C CA    . ALA A 98  ? 1.1740 0.3872 0.6315 0.0037  0.1002  0.0457  98  ALA A CA    
1427 C C     . ALA A 98  ? 1.1443 0.3984 0.6907 0.0136  0.1067  0.0155  98  ALA A C     
1428 O O     . ALA A 98  ? 1.1251 0.3811 0.6968 -0.0140 0.1443  -0.0049 98  ALA A O     
1429 C CB    . ALA A 98  ? 1.1092 0.4121 0.5935 0.0050  0.1024  0.0319  98  ALA A CB    
1435 N N     . ALA A 99  ? 1.0928 0.3823 0.6892 0.0511  0.0713  0.0093  99  ALA A N     
1436 C CA    . ALA A 99  ? 1.0815 0.4072 0.7531 0.0615  0.0777  -0.0243 99  ALA A CA    
1437 C C     . ALA A 99  ? 1.1431 0.3711 0.7955 0.0457  0.0942  -0.0239 99  ALA A C     
1438 O O     . ALA A 99  ? 1.1257 0.3697 0.8211 0.0265  0.1201  -0.0560 99  ALA A O     
1439 C CB    . ALA A 99  ? 1.0667 0.4409 0.7885 0.1059  0.0418  -0.0302 99  ALA A CB    
1445 N N     . SER A 100 ? 1.4114 0.5342 0.9972 0.0520  0.0774  0.0130  100 SER A N     
1446 C CA    . SER A 100 ? 1.4852 0.4968 1.0437 0.0363  0.0930  0.0207  100 SER A CA    
1447 C C     . SER A 100 ? 1.4757 0.4631 1.0145 -0.0186 0.1449  0.0119  100 SER A C     
1448 O O     . SER A 100 ? 1.5167 0.4440 1.0575 -0.0398 0.1627  0.0099  100 SER A O     
1449 C CB    . SER A 100 ? 1.5578 0.4721 1.0397 0.0516  0.0614  0.0710  100 SER A CB    
1450 O OG    . SER A 100 ? 1.5558 0.4938 1.0679 0.1036  0.0116  0.0789  100 SER A OG    
1456 N N     . ARG A 101 ? 1.3118 0.3678 0.8487 -0.0413 0.1676  0.0052  101 ARG A N     
1457 C CA    . ARG A 101 ? 1.3382 0.3818 0.8650 -0.0921 0.2197  -0.0027 101 ARG A CA    
1458 C C     . ARG A 101 ? 1.2519 0.3884 0.8780 -0.1085 0.2416  -0.0514 101 ARG A C     
1459 O O     . ARG A 101 ? 1.2809 0.4083 0.9216 -0.1519 0.2838  -0.0640 101 ARG A O     
1460 C CB    . ARG A 101 ? 1.3296 0.3927 0.8014 -0.1061 0.2357  0.0146  101 ARG A CB    
1461 C CG    . ARG A 101 ? 1.4236 0.3993 0.7850 -0.0941 0.2098  0.0609  101 ARG A CG    
1462 C CD    . ARG A 101 ? 1.5386 0.4520 0.8282 -0.1286 0.2392  0.0827  101 ARG A CD    
1463 N NE    . ARG A 101 ? 1.6368 0.4847 0.8377 -0.1113 0.2002  0.1228  101 ARG A NE    
1464 C CZ    . ARG A 101 ? 1.7596 0.5541 0.8729 -0.1350 0.2163  0.1450  101 ARG A CZ    
1465 N NH1   . ARG A 101 ? 1.7835 0.5833 0.8877 -0.1757 0.2744  0.1305  101 ARG A NH1   
1466 N NH2   . ARG A 101 ? 1.8497 0.5894 0.8884 -0.1170 0.1735  0.1797  101 ARG A NH2   
1480 N N     . PHE A 102 ? 0.9018 0.6193 0.7072 0.0281  0.1469  0.2065  102 PHE A N     
1481 C CA    . PHE A 102 ? 0.8491 0.6052 0.7204 0.0168  0.1481  0.1688  102 PHE A CA    
1482 C C     . PHE A 102 ? 0.8611 0.5943 0.7753 0.0142  0.1267  0.1450  102 PHE A C     
1483 O O     . PHE A 102 ? 0.8432 0.6065 0.7956 0.0033  0.1182  0.1113  102 PHE A O     
1484 C CB    . PHE A 102 ? 0.8098 0.6166 0.6683 0.0327  0.1398  0.1421  102 PHE A CB    
1485 C CG    . PHE A 102 ? 0.8214 0.6407 0.6251 0.0409  0.1615  0.1555  102 PHE A CG    
1486 C CD1   . PHE A 102 ? 0.8466 0.6937 0.6709 0.0262  0.2006  0.1609  102 PHE A CD1   
1487 C CD2   . PHE A 102 ? 0.8618 0.6662 0.5959 0.0605  0.1456  0.1584  102 PHE A CD2   
1488 C CE1   . PHE A 102 ? 0.8844 0.7388 0.6518 0.0318  0.2289  0.1660  102 PHE A CE1   
1489 C CE2   . PHE A 102 ? 0.8787 0.6889 0.5518 0.0636  0.1668  0.1633  102 PHE A CE2   
1490 C CZ    . PHE A 102 ? 0.8983 0.7307 0.5835 0.0497  0.2112  0.1655  102 PHE A CZ    
1500 N N     . LEU A 103 ? 0.9131 0.5938 0.8224 0.0234  0.1178  0.1610  103 LEU A N     
1501 C CA    . LEU A 103 ? 0.9498 0.6027 0.9002 0.0229  0.1065  0.1328  103 LEU A CA    
1502 C C     . LEU A 103 ? 0.9840 0.5787 0.9791 0.0060  0.1220  0.1501  103 LEU A C     
1503 O O     . LEU A 103 ? 0.9931 0.5529 0.9738 0.0087  0.1299  0.1978  103 LEU A O     
1504 C CB    . LEU A 103 ? 0.9802 0.6216 0.9110 0.0528  0.0858  0.1298  103 LEU A CB    
1505 C CG    . LEU A 103 ? 0.9703 0.6593 0.8632 0.0669  0.0706  0.1084  103 LEU A CG    
1506 C CD1   . LEU A 103 ? 0.9764 0.6548 0.8603 0.0923  0.0530  0.1115  103 LEU A CD1   
1507 C CD2   . LEU A 103 ? 0.9657 0.6823 0.8744 0.0522  0.0681  0.0646  103 LEU A CD2   
1519 N N     . GLY A 104 ? 0.9286 0.5085 0.9725 -0.0142 0.1255  0.1115  104 GLY A N     
1520 C CA    . GLY A 104 ? 0.9915 0.5077 1.0870 -0.0331 0.1420  0.1184  104 GLY A CA    
1521 C C     . GLY A 104 ? 1.0232 0.4884 1.1507 -0.0198 0.1393  0.0902  104 GLY A C     
1522 O O     . GLY A 104 ? 1.0268 0.4938 1.1385 0.0131  0.1264  0.0926  104 GLY A O     
1526 N N     . ALA A 105 ? 1.4276 0.8474 1.6063 -0.0467 0.1544  0.0597  105 ALA A N     
1527 C CA    . ALA A 105 ? 1.4793 0.8457 1.6949 -0.0371 0.1619  0.0216  105 ALA A CA    
1528 C C     . ALA A 105 ? 1.4829 0.8859 1.6721 -0.0474 0.1562  -0.0454 105 ALA A C     
1529 O O     . ALA A 105 ? 1.4933 0.8851 1.6830 -0.0247 0.1598  -0.0709 105 ALA A O     
1530 C CB    . ALA A 105 ? 1.5305 0.8187 1.8105 -0.0638 0.1850  0.0143  105 ALA A CB    
1536 N N     . ASN A 106 ? 1.2066 0.6552 1.3747 -0.0825 0.1470  -0.0719 106 ASN A N     
1537 C CA    . ASN A 106 ? 1.2136 0.6977 1.3409 -0.0964 0.1349  -0.1273 106 ASN A CA    
1538 C C     . ASN A 106 ? 1.1794 0.7202 1.2532 -0.0652 0.1171  -0.1110 106 ASN A C     
1539 O O     . ASN A 106 ? 1.1376 0.7225 1.1958 -0.0533 0.1046  -0.0706 106 ASN A O     
1540 C CB    . ASN A 106 ? 1.1953 0.7173 1.3220 -0.1426 0.1198  -0.1512 106 ASN A CB    
1541 C CG    . ASN A 106 ? 1.1115 0.6932 1.2463 -0.1421 0.1080  -0.1044 106 ASN A CG    
1542 O OD1   . ASN A 106 ? 1.0951 0.6571 1.2703 -0.1473 0.1245  -0.0680 106 ASN A OD1   
1543 N ND2   . ASN A 106 ? 1.0530 0.7052 1.1511 -0.1362 0.0831  -0.1045 106 ASN A ND2   
1550 N N     . GLN A 107 ? 1.0119 0.5484 1.0589 -0.0542 0.1208  -0.1453 107 GLN A N     
1551 C CA    . GLN A 107 ? 0.9552 0.5364 0.9579 -0.0270 0.1074  -0.1314 107 GLN A CA    
1552 C C     . GLN A 107 ? 0.8993 0.5417 0.8528 -0.0438 0.0813  -0.1344 107 GLN A C     
1553 O O     . GLN A 107 ? 0.8934 0.5451 0.8328 -0.0786 0.0717  -0.1666 107 GLN A O     
1554 C CB    . GLN A 107 ? 0.9272 0.4880 0.9220 -0.0161 0.1253  -0.1690 107 GLN A CB    
1555 C CG    . GLN A 107 ? 0.8634 0.4663 0.8211 0.0085  0.1148  -0.1551 107 GLN A CG    
1556 C CD    . GLN A 107 ? 0.8855 0.4704 0.8538 0.0200  0.1407  -0.1884 107 GLN A CD    
1557 O OE1   . GLN A 107 ? 0.8552 0.4525 0.8476 0.0506  0.1412  -0.1671 107 GLN A OE1   
1558 N NE2   . GLN A 107 ? 0.9458 0.5038 0.8973 -0.0073 0.1638  -0.2438 107 GLN A NE2   
1567 N N     . VAL A 108 ? 1.0282 0.7110 0.9585 -0.0193 0.0673  -0.1004 108 VAL A N     
1568 C CA    . VAL A 108 ? 0.9176 0.6553 0.8130 -0.0256 0.0428  -0.0961 108 VAL A CA    
1569 C C     . VAL A 108 ? 0.8233 0.5759 0.6752 -0.0025 0.0373  -0.0924 108 VAL A C     
1570 O O     . VAL A 108 ? 0.8340 0.5628 0.6895 0.0164  0.0519  -0.0936 108 VAL A O     
1571 C CB    . VAL A 108 ? 0.9071 0.6779 0.8284 -0.0215 0.0372  -0.0594 108 VAL A CB    
1572 C CG1   . VAL A 108 ? 0.9865 0.7444 0.9578 -0.0499 0.0462  -0.0621 108 VAL A CG1   
1573 C CG2   . VAL A 108 ? 0.9334 0.6959 0.8499 0.0105  0.0476  -0.0225 108 VAL A CG2   
1583 N N     . GLY A 109 ? 0.8759 0.6690 0.6967 -0.0043 0.0152  -0.0859 109 GLY A N     
1584 C CA    . GLY A 109 ? 0.8237 0.6275 0.6042 0.0130  0.0098  -0.0803 109 GLY A CA    
1585 C C     . GLY A 109 ? 0.7949 0.6126 0.5832 0.0418  0.0087  -0.0471 109 GLY A C     
1586 O O     . GLY A 109 ? 0.7621 0.6051 0.5655 0.0455  0.0011  -0.0282 109 GLY A O     
1590 N N     . CYS A 110 ? 0.8616 0.6648 0.6431 0.0604  0.0176  -0.0429 110 CYS A N     
1591 C CA    . CYS A 110 ? 0.8437 0.6560 0.6204 0.0828  0.0139  -0.0175 110 CYS A CA    
1592 C C     . CYS A 110 ? 0.7767 0.5972 0.5224 0.0892  0.0071  -0.0216 110 CYS A C     
1593 O O     . CYS A 110 ? 0.7512 0.5643 0.4848 0.0805  0.0128  -0.0405 110 CYS A O     
1594 C CB    . CYS A 110 ? 0.9000 0.6908 0.6996 0.0968  0.0216  -0.0033 110 CYS A CB    
1595 S SG    . CYS A 110 ? 0.9275 0.6964 0.7617 0.0885  0.0323  0.0118  110 CYS A SG    
1601 N N     . THR A 111 ? 0.9115 0.7438 0.6439 0.1020  -0.0004 -0.0058 111 THR A N     
1602 C CA    . THR A 111 ? 0.8735 0.7079 0.5804 0.1056  -0.0069 -0.0076 111 THR A CA    
1603 C C     . THR A 111 ? 0.8707 0.7037 0.5702 0.1209  -0.0088 0.0033  111 THR A C     
1604 O O     . THR A 111 ? 0.9014 0.7373 0.6025 0.1280  -0.0056 0.0138  111 THR A O     
1605 C CB    . THR A 111 ? 0.8605 0.7065 0.5532 0.0992  -0.0195 -0.0048 111 THR A CB    
1606 O OG1   . THR A 111 ? 0.8625 0.7244 0.5763 0.1097  -0.0221 0.0079  111 THR A OG1   
1607 C CG2   . THR A 111 ? 0.8720 0.7208 0.5576 0.0775  -0.0244 -0.0176 111 THR A CG2   
1615 N N     . TYR A 112 ? 0.7845 0.6118 0.4717 0.1218  -0.0118 -0.0014 112 TYR A N     
1616 C CA    . TYR A 112 ? 0.7913 0.6136 0.4633 0.1302  -0.0166 0.0018  112 TYR A CA    
1617 C C     . TYR A 112 ? 0.7740 0.5871 0.4326 0.1261  -0.0189 -0.0017 112 TYR A C     
1618 O O     . TYR A 112 ? 0.7609 0.5714 0.4179 0.1146  -0.0162 -0.0065 112 TYR A O     
1619 C CB    . TYR A 112 ? 0.8170 0.6398 0.4959 0.1319  -0.0231 0.0016  112 TYR A CB    
1620 C CG    . TYR A 112 ? 0.8363 0.6521 0.4919 0.1328  -0.0316 -0.0022 112 TYR A CG    
1621 C CD1   . TYR A 112 ? 0.8631 0.6726 0.4880 0.1378  -0.0317 0.0007  112 TYR A CD1   
1622 C CD2   . TYR A 112 ? 0.8362 0.6490 0.4979 0.1244  -0.0355 -0.0120 112 TYR A CD2   
1623 C CE1   . TYR A 112 ? 0.8977 0.6949 0.4933 0.1346  -0.0375 -0.0106 112 TYR A CE1   
1624 C CE2   . TYR A 112 ? 0.8675 0.6692 0.5096 0.1207  -0.0439 -0.0204 112 TYR A CE2   
1625 C CZ    . TYR A 112 ? 0.9050 0.6974 0.5114 0.1258  -0.0458 -0.0219 112 TYR A CZ    
1626 O OH    . TYR A 112 ? 0.9499 0.7257 0.5289 0.1183  -0.0523 -0.0378 112 TYR A OH    
1636 N N     . SER A 113 ? 0.7794 0.5834 0.4291 0.1347  -0.0198 0.0009  113 SER A N     
1637 C CA    . SER A 113 ? 0.7921 0.5779 0.4344 0.1333  -0.0229 0.0034  113 SER A CA    
1638 C C     . SER A 113 ? 0.8103 0.5748 0.4446 0.1392  -0.0199 -0.0060 113 SER A C     
1639 O O     . SER A 113 ? 0.8165 0.5827 0.4438 0.1469  -0.0139 -0.0135 113 SER A O     
1640 C CB    . SER A 113 ? 0.8063 0.5969 0.4596 0.1399  -0.0293 0.0170  113 SER A CB    
1641 O OG    . SER A 113 ? 0.8472 0.6139 0.4933 0.1394  -0.0363 0.0277  113 SER A OG    
1647 N N     . ILE A 114 ? 0.7569 0.4971 0.3865 0.1315  -0.0215 -0.0068 114 ILE A N     
1648 C CA    . ILE A 114 ? 0.8051 0.5156 0.4283 0.1329  -0.0181 -0.0206 114 ILE A CA    
1649 C C     . ILE A 114 ? 0.8489 0.5244 0.4767 0.1279  -0.0182 -0.0109 114 ILE A C     
1650 O O     . ILE A 114 ? 0.8627 0.5375 0.4861 0.1112  -0.0200 -0.0007 114 ILE A O     
1651 C CB    . ILE A 114 ? 0.8173 0.5342 0.4304 0.1190  -0.0240 -0.0376 114 ILE A CB    
1652 C CG1   . ILE A 114 ? 0.8779 0.5596 0.4780 0.1131  -0.0224 -0.0582 114 ILE A CG1   
1653 C CG2   . ILE A 114 ? 0.7892 0.5225 0.4199 0.1022  -0.0280 -0.0329 114 ILE A CG2   
1654 C CD1   . ILE A 114 ? 0.9010 0.5934 0.4859 0.0971  -0.0371 -0.0763 114 ILE A CD1   
1666 N N     . ARG A 115 ? 0.9394 0.5824 0.5776 0.1421  -0.0125 -0.0132 115 ARG A N     
1667 C CA    . ARG A 115 ? 0.9877 0.5860 0.6352 0.1403  -0.0135 0.0011  115 ARG A CA    
1668 C C     . ARG A 115 ? 1.0547 0.6095 0.7011 0.1329  -0.0035 -0.0257 115 ARG A C     
1669 O O     . ARG A 115 ? 1.0714 0.6187 0.7156 0.1434  0.0074  -0.0526 115 ARG A O     
1670 C CB    . ARG A 115 ? 0.9655 0.5560 0.6434 0.1659  -0.0180 0.0240  115 ARG A CB    
1671 C CG    . ARG A 115 ? 1.0052 0.5401 0.6986 0.1692  -0.0217 0.0454  115 ARG A CG    
1672 C CD    . ARG A 115 ? 1.0007 0.5373 0.7370 0.1974  -0.0354 0.0761  115 ARG A CD    
1673 N NE    . ARG A 115 ? 0.9787 0.5335 0.7607 0.2253  -0.0198 0.0541  115 ARG A NE    
1674 C CZ    . ARG A 115 ? 0.9778 0.5498 0.8208 0.2538  -0.0278 0.0738  115 ARG A CZ    
1675 N NH1   . ARG A 115 ? 0.9999 0.5723 0.8591 0.2583  -0.0604 0.1197  115 ARG A NH1   
1676 N NH2   . ARG A 115 ? 0.9699 0.5614 0.8586 0.2763  -0.0034 0.0487  115 ARG A NH2   
1690 N N     . PHE A 116 ? 0.9045 0.4286 0.5488 0.1107  -0.0045 -0.0208 116 PHE A N     
1691 C CA    . PHE A 116 ? 0.9595 0.4389 0.6059 0.0961  0.0028  -0.0488 116 PHE A CA    
1692 C C     . PHE A 116 ? 0.9981 0.4283 0.6560 0.0792  0.0055  -0.0266 116 PHE A C     
1693 O O     . PHE A 116 ? 0.9869 0.4351 0.6370 0.0583  0.0036  -0.0057 116 PHE A O     
1694 C CB    . PHE A 116 ? 0.9671 0.4801 0.5992 0.0726  -0.0047 -0.0772 116 PHE A CB    
1695 C CG    . PHE A 116 ? 1.0288 0.5018 0.6574 0.0526  -0.0032 -0.1131 116 PHE A CG    
1696 C CD1   . PHE A 116 ? 1.0644 0.5007 0.6774 0.0651  0.0081  -0.1435 116 PHE A CD1   
1697 C CD2   . PHE A 116 ? 1.0660 0.5398 0.7095 0.0184  -0.0106 -0.1207 116 PHE A CD2   
1698 C CE1   . PHE A 116 ? 1.1354 0.5298 0.7365 0.0420  0.0096  -0.1837 116 PHE A CE1   
1699 C CE2   . PHE A 116 ? 1.1304 0.5686 0.7722 -0.0055 -0.0134 -0.1572 116 PHE A CE2   
1700 C CZ    . PHE A 116 ? 1.1647 0.5598 0.7794 0.0054  -0.0046 -0.1903 116 PHE A CZ    
1710 N N     . ARG A 117 ? 1.0859 0.4501 0.7624 0.0874  0.0144  -0.0313 117 ARG A N     
1711 C CA    . ARG A 117 ? 1.1111 0.4141 0.7997 0.0708  0.0182  -0.0059 117 ARG A CA    
1712 C C     . ARG A 117 ? 1.1076 0.4180 0.7848 0.0756  0.0079  0.0505  117 ARG A C     
1713 O O     . ARG A 117 ? 1.1360 0.4312 0.7961 0.0469  0.0110  0.0761  117 ARG A O     
1714 C CB    . ARG A 117 ? 1.1426 0.4429 0.8281 0.0272  0.0227  -0.0253 117 ARG A CB    
1715 C CG    . ARG A 117 ? 1.2051 0.4801 0.8977 0.0136  0.0266  -0.0790 117 ARG A CG    
1716 C CD    . ARG A 117 ? 1.2410 0.5174 0.9464 -0.0331 0.0260  -0.0926 117 ARG A CD    
1717 N NE    . ARG A 117 ? 1.3146 0.5525 1.0253 -0.0534 0.0258  -0.1434 117 ARG A NE    
1718 C CZ    . ARG A 117 ? 1.3473 0.5800 1.0800 -0.0976 0.0222  -0.1638 117 ARG A CZ    
1719 N NH1   . ARG A 117 ? 1.3071 0.5730 1.0652 -0.1239 0.0249  -0.1364 117 ARG A NH1   
1720 N NH2   . ARG A 117 ? 1.4110 0.6063 1.1412 -0.1184 0.0183  -0.2148 117 ARG A NH2   
1734 N N     . GLY A 118 ? 1.1417 0.4773 0.8256 0.1084  -0.0040 0.0695  118 GLY A N     
1735 C CA    . GLY A 118 ? 1.1454 0.4906 0.8108 0.1115  -0.0222 0.1217  118 GLY A CA    
1736 C C     . GLY A 118 ? 1.1050 0.5029 0.7232 0.0838  -0.0229 0.1263  118 GLY A C     
1737 O O     . GLY A 118 ? 1.1336 0.5325 0.7156 0.0734  -0.0339 0.1654  118 GLY A O     
1741 N N     . VAL A 119 ? 1.0411 0.4810 0.6584 0.0714  -0.0113 0.0864  119 VAL A N     
1742 C CA    . VAL A 119 ? 1.0388 0.5309 0.6293 0.0507  -0.0066 0.0826  119 VAL A CA    
1743 C C     . VAL A 119 ? 1.0024 0.5501 0.6006 0.0709  -0.0138 0.0616  119 VAL A C     
1744 O O     . VAL A 119 ? 0.9840 0.5415 0.6026 0.0821  -0.0123 0.0322  119 VAL A O     
1745 C CB    . VAL A 119 ? 1.0521 0.5494 0.6530 0.0187  0.0116  0.0598  119 VAL A CB    
1746 C CG1   . VAL A 119 ? 1.0557 0.6070 0.6441 0.0019  0.0227  0.0546  119 VAL A CG1   
1747 C CG2   . VAL A 119 ? 1.0965 0.5336 0.6949 -0.0058 0.0231  0.0806  119 VAL A CG2   
1757 N N     . SER A 120 ? 1.0611 0.6413 0.6365 0.0716  -0.0211 0.0766  120 SER A N     
1758 C CA    . SER A 120 ? 1.0227 0.6512 0.6066 0.0860  -0.0262 0.0606  120 SER A CA    
1759 C C     . SER A 120 ? 1.0372 0.6999 0.6085 0.0661  -0.0139 0.0464  120 SER A C     
1760 O O     . SER A 120 ? 1.0824 0.7411 0.6220 0.0445  -0.0054 0.0579  120 SER A O     
1761 C CB    . SER A 120 ? 1.0388 0.6784 0.6199 0.1023  -0.0458 0.0841  120 SER A CB    
1762 O OG    . SER A 120 ? 1.0032 0.6865 0.5976 0.1119  -0.0476 0.0683  120 SER A OG    
1768 N N     . VAL A 121 ? 0.8440 0.5374 0.4396 0.0732  -0.0111 0.0222  121 VAL A N     
1769 C CA    . VAL A 121 ? 0.8554 0.5820 0.4593 0.0625  0.0002  0.0078  121 VAL A CA    
1770 C C     . VAL A 121 ? 0.7842 0.5366 0.3951 0.0788  -0.0074 0.0032  121 VAL A C     
1771 O O     . VAL A 121 ? 0.7425 0.4983 0.3657 0.0961  -0.0162 0.0003  121 VAL A O     
1772 C CB    . VAL A 121 ? 0.8824 0.6222 0.5227 0.0549  0.0057  -0.0107 121 VAL A CB    
1773 C CG1   . VAL A 121 ? 0.8881 0.6633 0.5565 0.0485  0.0191  -0.0233 121 VAL A CG1   
1774 C CG2   . VAL A 121 ? 0.9338 0.6460 0.5752 0.0347  0.0140  -0.0075 121 VAL A CG2   
1784 N N     . THR A 122 ? 0.8932 0.6599 0.4929 0.0700  -0.0003 0.0005  122 THR A N     
1785 C CA    . THR A 122 ? 0.8290 0.6146 0.4383 0.0801  -0.0055 -0.0042 122 THR A CA    
1786 C C     . THR A 122 ? 0.8254 0.6257 0.4546 0.0726  0.0118  -0.0228 122 THR A C     
1787 O O     . THR A 122 ? 0.8610 0.6588 0.4787 0.0548  0.0311  -0.0326 122 THR A O     
1788 C CB    . THR A 122 ? 0.8154 0.6000 0.3965 0.0761  -0.0186 0.0084  122 THR A CB    
1789 O OG1   . THR A 122 ? 0.8678 0.6425 0.4055 0.0520  -0.0109 0.0086  122 THR A OG1   
1790 C CG2   . THR A 122 ? 0.8127 0.5857 0.3968 0.0907  -0.0362 0.0290  122 THR A CG2   
1798 N N     . ILE A 123 ? 0.7445 0.5572 0.4055 0.0864  0.0083  -0.0269 123 ILE A N     
1799 C CA    . ILE A 123 ? 0.7569 0.5786 0.4531 0.0861  0.0228  -0.0416 123 ILE A CA    
1800 C C     . ILE A 123 ? 0.7309 0.5499 0.4247 0.0873  0.0208  -0.0432 123 ILE A C     
1801 O O     . ILE A 123 ? 0.7007 0.5223 0.4011 0.0991  0.0078  -0.0300 123 ILE A O     
1802 C CB    . ILE A 123 ? 0.7802 0.6144 0.5231 0.1005  0.0149  -0.0379 123 ILE A CB    
1803 C CG1   . ILE A 123 ? 0.8022 0.6402 0.5461 0.0960  0.0082  -0.0361 123 ILE A CG1   
1804 C CG2   . ILE A 123 ? 0.8088 0.6521 0.6069 0.1032  0.0311  -0.0508 123 ILE A CG2   
1805 C CD1   . ILE A 123 ? 0.8388 0.6795 0.5910 0.0777  0.0307  -0.0480 123 ILE A CD1   
1817 N N     . SER A 124 ? 0.8498 0.6624 0.5321 0.0713  0.0367  -0.0619 124 SER A N     
1818 C CA    . SER A 124 ? 0.8335 0.6411 0.5119 0.0645  0.0339  -0.0687 124 SER A CA    
1819 C C     . SER A 124 ? 0.8435 0.6384 0.5548 0.0601  0.0591  -0.0948 124 SER A C     
1820 O O     . SER A 124 ? 0.8670 0.6595 0.5907 0.0562  0.0838  -0.1135 124 SER A O     
1821 C CB    . SER A 124 ? 0.8542 0.6615 0.4764 0.0433  0.0223  -0.0700 124 SER A CB    
1822 O OG    . SER A 124 ? 0.8504 0.6670 0.4597 0.0525  -0.0018 -0.0436 124 SER A OG    
1828 N N     . GLY A 125 ? 0.6760 0.4614 0.4088 0.0603  0.0566  -0.0972 125 GLY A N     
1829 C CA    . GLY A 125 ? 0.7055 0.4685 0.4758 0.0567  0.0815  -0.1235 125 GLY A CA    
1830 C C     . GLY A 125 ? 0.7077 0.4567 0.5059 0.0576  0.0738  -0.1153 125 GLY A C     
1831 O O     . GLY A 125 ? 0.6817 0.4438 0.4766 0.0638  0.0529  -0.0871 125 GLY A O     
1835 N N     . GLY A 126 ? 0.7475 0.4664 0.5764 0.0495  0.0964  -0.1429 126 GLY A N     
1836 C CA    . GLY A 126 ? 0.7613 0.4581 0.6234 0.0462  0.0937  -0.1361 126 GLY A CA    
1837 C C     . GLY A 126 ? 0.7356 0.4296 0.6432 0.0741  0.0837  -0.0938 126 GLY A C     
1838 O O     . GLY A 126 ? 0.7208 0.4206 0.6559 0.0974  0.0832  -0.0800 126 GLY A O     
1842 N N     . SER A 127 ? 0.7502 0.4372 0.6647 0.0683  0.0748  -0.0717 127 SER A N     
1843 C CA    . SER A 127 ? 0.7517 0.4329 0.6880 0.0886  0.0653  -0.0267 127 SER A CA    
1844 C C     . SER A 127 ? 0.7800 0.4267 0.7766 0.1093  0.0734  -0.0172 127 SER A C     
1845 O O     . SER A 127 ? 0.7865 0.4308 0.7941 0.1287  0.0579  0.0247  127 SER A O     
1846 C CB    . SER A 127 ? 0.7538 0.4281 0.6910 0.0723  0.0651  -0.0084 127 SER A CB    
1847 O OG    . SER A 127 ? 0.7968 0.4346 0.7693 0.0523  0.0812  -0.0324 127 SER A OG    
1853 N N     . ARG A 128 ? 0.8674 0.4867 0.9037 0.1056  0.0968  -0.0550 128 ARG A N     
1854 C CA    . ARG A 128 ? 0.8957 0.4840 1.0101 0.1308  0.1067  -0.0478 128 ARG A CA    
1855 C C     . ARG A 128 ? 0.8842 0.5068 1.0217 0.1550  0.0993  -0.0437 128 ARG A C     
1856 O O     . ARG A 128 ? 0.9014 0.5131 1.1143 0.1820  0.0955  -0.0240 128 ARG A O     
1857 C CB    . ARG A 128 ? 0.9476 0.4904 1.1050 0.1186  0.1428  -0.0975 128 ARG A CB    
1858 C CG    . ARG A 128 ? 0.9909 0.4890 1.1532 0.0956  0.1492  -0.0985 128 ARG A CG    
1859 C CD    . ARG A 128 ? 1.0488 0.5063 1.2249 0.0709  0.1840  -0.1635 128 ARG A CD    
1860 N NE    . ARG A 128 ? 1.0958 0.5092 1.2838 0.0441  0.1885  -0.1669 128 ARG A NE    
1861 C CZ    . ARG A 128 ? 1.1518 0.5335 1.3293 0.0084  0.2097  -0.2247 128 ARG A CZ    
1862 N NH1   . ARG A 128 ? 1.1740 0.5614 1.3161 -0.0050 0.2304  -0.2836 128 ARG A NH1   
1863 N NH2   . ARG A 128 ? 1.1952 0.5386 1.3928 -0.0184 0.2110  -0.2246 128 ARG A NH2   
1877 N N     . THR A 129 ? 0.8941 0.5582 0.9770 0.1453  0.0957  -0.0597 129 THR A N     
1878 C CA    . THR A 129 ? 0.8838 0.5843 0.9878 0.1617  0.0886  -0.0563 129 THR A CA    
1879 C C     . THR A 129 ? 0.8613 0.5937 0.9172 0.1665  0.0520  -0.0185 129 THR A C     
1880 O O     . THR A 129 ? 0.8594 0.6252 0.9095 0.1690  0.0443  -0.0217 129 THR A O     
1881 C CB    . THR A 129 ? 0.8937 0.6097 0.9725 0.1439  0.1174  -0.1031 129 THR A CB    
1882 O OG1   . THR A 129 ? 0.8811 0.6056 0.8685 0.1185  0.1096  -0.1094 129 THR A OG1   
1883 C CG2   . THR A 129 ? 0.9337 0.6156 1.0567 0.1378  0.1606  -0.1489 129 THR A CG2   
1891 N N     . LEU A 130 ? 0.8328 0.5532 0.8540 0.1650  0.0336  0.0145  130 LEU A N     
1892 C CA    . LEU A 130 ? 0.8322 0.5771 0.7965 0.1660  0.0067  0.0422  130 LEU A CA    
1893 C C     . LEU A 130 ? 0.8391 0.6052 0.8330 0.1843  -0.0198 0.0634  130 LEU A C     
1894 O O     . LEU A 130 ? 0.8385 0.6338 0.8019 0.1811  -0.0329 0.0587  130 LEU A O     
1895 C CB    . LEU A 130 ? 0.8408 0.5662 0.7705 0.1606  0.0006  0.0736  130 LEU A CB    
1896 C CG    . LEU A 130 ? 0.8443 0.5888 0.7068 0.1590  -0.0177 0.0965  130 LEU A CG    
1897 C CD1   . LEU A 130 ? 0.8225 0.5924 0.6432 0.1484  -0.0112 0.0692  130 LEU A CD1   
1898 C CD2   . LEU A 130 ? 0.8697 0.5929 0.7037 0.1516  -0.0133 0.1274  130 LEU A CD2   
1910 N N     . GLN A 131 ? 0.9959 0.7472 1.0557 0.2030  -0.0311 0.0881  131 GLN A N     
1911 C CA    . GLN A 131 ? 0.9908 0.7697 1.0940 0.2206  -0.0647 0.1111  131 GLN A CA    
1912 C C     . GLN A 131 ? 0.9753 0.7943 1.1118 0.2183  -0.0556 0.0763  131 GLN A C     
1913 O O     . GLN A 131 ? 0.9777 0.8315 1.1194 0.2206  -0.0860 0.0874  131 GLN A O     
1914 C CB    . GLN A 131 ? 1.0085 0.7655 1.2063 0.2450  -0.0738 0.1385  131 GLN A CB    
1915 C CG    . GLN A 131 ? 1.0037 0.7478 1.2938 0.2533  -0.0323 0.0986  131 GLN A CG    
1916 C CD    . GLN A 131 ? 1.0389 0.7415 1.4201 0.2772  -0.0327 0.1242  131 GLN A CD    
1917 O OE1   . GLN A 131 ? 1.0525 0.7692 1.5125 0.3034  -0.0651 0.1594  131 GLN A OE1   
1918 N NE2   . GLN A 131 ? 1.0579 0.7080 1.4346 0.2675  0.0005  0.1080  131 GLN A NE2   
1927 N N     . HIS A 132 ? 0.7397 0.5532 0.8937 0.2094  -0.0135 0.0335  132 HIS A N     
1928 C CA    . HIS A 132 ? 0.7286 0.5758 0.9077 0.2024  0.0041  0.0016  132 HIS A CA    
1929 C C     . HIS A 132 ? 0.7185 0.5770 0.8049 0.1803  0.0010  -0.0077 132 HIS A C     
1930 O O     . HIS A 132 ? 0.7145 0.6035 0.8085 0.1747  -0.0070 -0.0128 132 HIS A O     
1931 C CB    . HIS A 132 ? 0.7391 0.5707 0.9615 0.1982  0.0548  -0.0408 132 HIS A CB    
1932 C CG    . HIS A 132 ? 0.7574 0.5655 1.0770 0.2215  0.0653  -0.0372 132 HIS A CG    
1933 N ND1   . HIS A 132 ? 0.7741 0.5337 1.0815 0.2229  0.0689  -0.0282 132 HIS A ND1   
1934 C CD2   . HIS A 132 ? 0.7626 0.5878 1.2048 0.2451  0.0738  -0.0403 132 HIS A CD2   
1935 C CE1   . HIS A 132 ? 0.7958 0.5353 1.2088 0.2470  0.0793  -0.0253 132 HIS A CE1   
1936 N NE2   . HIS A 132 ? 0.7849 0.5657 1.2852 0.2631  0.0821  -0.0323 132 HIS A NE2   
1944 N N     . LEU A 133 ? 0.7559 0.5904 0.7650 0.1676  0.0068  -0.0092 133 LEU A N     
1945 C CA    . LEU A 133 ? 0.7655 0.6072 0.6987 0.1524  0.0010  -0.0126 133 LEU A CA    
1946 C C     . LEU A 133 ? 0.7864 0.6442 0.7004 0.1570  -0.0328 0.0096  133 LEU A C     
1947 O O     . LEU A 133 ? 0.7872 0.6566 0.6740 0.1469  -0.0368 0.0008  133 LEU A O     
1948 C CB    . LEU A 133 ? 0.7570 0.5776 0.6323 0.1430  0.0068  -0.0117 133 LEU A CB    
1949 C CG    . LEU A 133 ? 0.7508 0.5525 0.6326 0.1320  0.0330  -0.0354 133 LEU A CG    
1950 C CD1   . LEU A 133 ? 0.7351 0.5289 0.5676 0.1200  0.0293  -0.0318 133 LEU A CD1   
1951 C CD2   . LEU A 133 ? 0.7577 0.5653 0.6372 0.1183  0.0575  -0.0669 133 LEU A CD2   
1963 N N     . CYS A 134 ? 0.8500 0.7037 0.7719 0.1694  -0.0577 0.0387  134 CYS A N     
1964 C CA    . CYS A 134 ? 0.8798 0.7452 0.7652 0.1686  -0.0923 0.0576  134 CYS A CA    
1965 C C     . CYS A 134 ? 0.8955 0.7948 0.8295 0.1666  -0.1097 0.0487  134 CYS A C     
1966 O O     . CYS A 134 ? 0.9138 0.8211 0.8121 0.1526  -0.1148 0.0349  134 CYS A O     
1967 C CB    . CYS A 134 ? 0.8950 0.7475 0.7744 0.1793  -0.1172 0.0957  134 CYS A CB    
1968 S SG    . CYS A 134 ? 0.8947 0.7105 0.7133 0.1745  -0.0951 0.1090  134 CYS A SG    
1974 N N     . GLU A 135 ? 0.8587 0.7783 0.8853 0.1803  -0.1180 0.0562  135 GLU A N     
1975 C CA    . GLU A 135 ? 0.8464 0.8089 0.9421 0.1776  -0.1341 0.0480  135 GLU A CA    
1976 C C     . GLU A 135 ? 0.8474 0.8165 0.9328 0.1579  -0.1009 0.0133  135 GLU A C     
1977 O O     . GLU A 135 ? 0.8558 0.8494 0.9501 0.1436  -0.1162 0.0054  135 GLU A O     
1978 C CB    . GLU A 135 ? 0.8253 0.8102 1.0461 0.1991  -0.1335 0.0553  135 GLU A CB    
1979 C CG    . GLU A 135 ? 0.8222 0.8165 1.0780 0.2179  -0.1871 0.0999  135 GLU A CG    
1980 C CD    . GLU A 135 ? 0.8300 0.7754 1.0143 0.2248  -0.1922 0.1297  135 GLU A CD    
1981 O OE1   . GLU A 135 ? 0.8288 0.7411 0.9294 0.2122  -0.1611 0.1144  135 GLU A OE1   
1982 O OE2   . GLU A 135 ? 0.8416 0.7828 1.0588 0.2421  -0.2284 0.1717  135 GLU A OE2   
1989 N N     . MET A 136 ? 0.8743 0.8193 0.9370 0.1535  -0.0577 -0.0061 136 MET A N     
1990 C CA    . MET A 136 ? 0.8879 0.8318 0.9254 0.1327  -0.0276 -0.0310 136 MET A CA    
1991 C C     . MET A 136 ? 0.9002 0.8216 0.8454 0.1201  -0.0389 -0.0281 136 MET A C     
1992 O O     . MET A 136 ? 0.9210 0.8429 0.8522 0.1029  -0.0307 -0.0393 136 MET A O     
1993 C CB    . MET A 136 ? 0.8971 0.8217 0.9291 0.1288  0.0171  -0.0513 136 MET A CB    
1994 C CG    . MET A 136 ? 0.9175 0.8394 0.9187 0.1048  0.0494  -0.0717 136 MET A CG    
1995 S SD    . MET A 136 ? 0.9313 0.8973 1.0265 0.0944  0.0659  -0.0854 136 MET A SD    
1996 C CE    . MET A 136 ? 0.9830 0.9277 1.0010 0.0607  0.0966  -0.0954 136 MET A CE    
2006 N N     . ALA A 137 ? 0.9111 0.8107 0.7995 0.1283  -0.0537 -0.0133 137 ALA A N     
2007 C CA    . ALA A 137 ? 0.9186 0.7964 0.7323 0.1206  -0.0575 -0.0140 137 ALA A CA    
2008 C C     . ALA A 137 ? 0.9109 0.7945 0.7065 0.1150  -0.0873 -0.0121 137 ALA A C     
2009 O O     . ALA A 137 ? 0.9101 0.7786 0.6714 0.1032  -0.0850 -0.0238 137 ALA A O     
2010 C CB    . ALA A 137 ? 0.8934 0.7509 0.6635 0.1295  -0.0533 -0.0030 137 ALA A CB    
2016 N N     . ILE A 138 ? 1.1043 1.0058 0.9202 0.1217  -0.1176 0.0030  138 ILE A N     
2017 C CA    . ILE A 138 ? 1.1098 1.0158 0.8916 0.1112  -0.1518 0.0032  138 ILE A CA    
2018 C C     . ILE A 138 ? 1.1204 1.0443 0.9408 0.0926  -0.1573 -0.0169 138 ILE A C     
2019 O O     . ILE A 138 ? 1.1368 1.0451 0.9120 0.0761  -0.1668 -0.0323 138 ILE A O     
2020 C CB    . ILE A 138 ? 1.1182 1.0424 0.9122 0.1201  -0.1911 0.0307  138 ILE A CB    
2021 C CG1   . ILE A 138 ? 1.1427 1.0693 0.8786 0.1032  -0.2310 0.0291  138 ILE A CG1   
2022 C CG2   . ILE A 138 ? 1.1113 1.0742 1.0171 0.1303  -0.2019 0.0394  138 ILE A CG2   
2023 C CD1   . ILE A 138 ? 1.1578 1.0442 0.7843 0.0953  -0.2158 0.0182  138 ILE A CD1   
2035 N N     . ARG A 139 ? 0.9995 0.9544 0.9076 0.0928  -0.1470 -0.0199 139 ARG A N     
2036 C CA    . ARG A 139 ? 1.0026 0.9797 0.9598 0.0713  -0.1479 -0.0373 139 ARG A CA    
2037 C C     . ARG A 139 ? 1.0205 0.9677 0.9523 0.0573  -0.1063 -0.0530 139 ARG A C     
2038 O O     . ARG A 139 ? 1.0196 0.9613 0.9536 0.0346  -0.1069 -0.0665 139 ARG A O     
2039 C CB    . ARG A 139 ? 0.9861 1.0169 1.0623 0.0764  -0.1515 -0.0339 139 ARG A CB    
2040 C CG    . ARG A 139 ? 0.9927 1.0241 1.1136 0.0868  -0.1022 -0.0396 139 ARG A CG    
2041 C CD    . ARG A 139 ? 0.9787 1.0637 1.2302 0.0981  -0.1036 -0.0380 139 ARG A CD    
2042 N NE    . ARG A 139 ? 0.9714 1.1056 1.2952 0.0824  -0.1371 -0.0403 139 ARG A NE    
2043 C CZ    . ARG A 139 ? 0.9742 1.1210 1.3201 0.0534  -0.1183 -0.0601 139 ARG A CZ    
2044 N NH1   . ARG A 139 ? 0.9934 1.1028 1.2855 0.0383  -0.0672 -0.0747 139 ARG A NH1   
2045 N NH2   . ARG A 139 ? 0.9596 1.1556 1.3807 0.0367  -0.1540 -0.0628 139 ARG A NH2   
2059 N N     . SER A 140 ? 0.9467 0.8720 0.8528 0.0678  -0.0733 -0.0495 140 SER A N     
2060 C CA    . SER A 140 ? 0.9829 0.8726 0.8430 0.0556  -0.0446 -0.0552 140 SER A CA    
2061 C C     . SER A 140 ? 0.9697 0.8224 0.7668 0.0520  -0.0587 -0.0576 140 SER A C     
2062 O O     . SER A 140 ? 0.9832 0.8077 0.7642 0.0368  -0.0463 -0.0627 140 SER A O     
2063 C CB    . SER A 140 ? 0.9958 0.8700 0.8268 0.0667  -0.0197 -0.0493 140 SER A CB    
2064 O OG    . SER A 140 ? 1.0134 0.9124 0.8984 0.0667  0.0030  -0.0558 140 SER A OG    
2070 N N     . LYS A 141 ? 1.0637 0.9118 0.8248 0.0651  -0.0806 -0.0541 141 LYS A N     
2071 C CA    . LYS A 141 ? 1.0574 0.8715 0.7624 0.0611  -0.0886 -0.0645 141 LYS A CA    
2072 C C     . LYS A 141 ? 1.0783 0.8947 0.7979 0.0371  -0.1085 -0.0827 141 LYS A C     
2073 O O     . LYS A 141 ? 1.0951 0.8721 0.7816 0.0263  -0.1039 -0.0991 141 LYS A O     
2074 C CB    . LYS A 141 ? 1.0366 0.8490 0.6954 0.0760  -0.1010 -0.0580 141 LYS A CB    
2075 C CG    . LYS A 141 ? 1.0408 0.8180 0.6368 0.0721  -0.1008 -0.0752 141 LYS A CG    
2076 C CD    . LYS A 141 ? 1.0310 0.8110 0.5762 0.0814  -0.1083 -0.0671 141 LYS A CD    
2077 C CE    . LYS A 141 ? 1.0553 0.7988 0.5335 0.0766  -0.0967 -0.0907 141 LYS A CE    
2078 N NZ    . LYS A 141 ? 1.0766 0.8222 0.4940 0.0802  -0.0979 -0.0822 141 LYS A NZ    
2092 N N     . GLN A 142 ? 1.0407 0.9028 0.8185 0.0282  -0.1312 -0.0813 142 GLN A N     
2093 C CA    . GLN A 142 ? 1.0473 0.9213 0.8491 0.0010  -0.1572 -0.0994 142 GLN A CA    
2094 C C     . GLN A 142 ? 1.0511 0.9080 0.8877 -0.0216 -0.1307 -0.1106 142 GLN A C     
2095 O O     . GLN A 142 ? 1.0757 0.8990 0.8913 -0.0436 -0.1349 -0.1305 142 GLN A O     
2096 C CB    . GLN A 142 ? 1.0285 0.9663 0.9023 0.0000  -0.1932 -0.0897 142 GLN A CB    
2097 C CG    . GLN A 142 ? 1.0461 1.0077 0.9480 -0.0308 -0.2333 -0.1075 142 GLN A CG    
2098 C CD    . GLN A 142 ? 1.0341 1.0697 1.0356 -0.0295 -0.2712 -0.0931 142 GLN A CD    
2099 O OE1   . GLN A 142 ? 1.0004 1.0638 1.0544 -0.0032 -0.2619 -0.0712 142 GLN A OE1   
2100 N NE2   . GLN A 142 ? 1.0642 1.1319 1.0998 -0.0583 -0.3156 -0.1066 142 GLN A NE2   
2109 N N     . GLU A 143 ? 1.0182 0.8927 0.9040 -0.0195 -0.1003 -0.0991 143 GLU A N     
2110 C CA    . GLU A 143 ? 1.0222 0.8806 0.9362 -0.0455 -0.0715 -0.1040 143 GLU A CA    
2111 C C     . GLU A 143 ? 1.0382 0.8249 0.8829 -0.0464 -0.0527 -0.1019 143 GLU A C     
2112 O O     . GLU A 143 ? 1.0622 0.8153 0.9128 -0.0718 -0.0446 -0.1101 143 GLU A O     
2113 C CB    . GLU A 143 ? 1.0268 0.9157 0.9905 -0.0445 -0.0360 -0.0935 143 GLU A CB    
2114 C CG    . GLU A 143 ? 1.0098 0.9707 1.0768 -0.0475 -0.0459 -0.0987 143 GLU A CG    
2115 C CD    . GLU A 143 ? 1.0015 0.9925 1.0811 -0.0147 -0.0659 -0.0889 143 GLU A CD    
2116 O OE1   . GLU A 143 ? 1.0168 0.9854 1.0518 0.0054  -0.0446 -0.0800 143 GLU A OE1   
2117 O OE2   . GLU A 143 ? 0.9803 1.0158 1.1153 -0.0107 -0.1061 -0.0879 143 GLU A OE2   
2124 N N     . LEU A 144 ? 0.9355 0.6980 0.7241 -0.0190 -0.0461 -0.0895 144 LEU A N     
2125 C CA    . LEU A 144 ? 0.9395 0.6396 0.6792 -0.0139 -0.0319 -0.0834 144 LEU A CA    
2126 C C     . LEU A 144 ? 0.9400 0.5997 0.6616 -0.0240 -0.0449 -0.1071 144 LEU A C     
2127 O O     . LEU A 144 ? 0.9760 0.5801 0.6901 -0.0336 -0.0311 -0.1074 144 LEU A O     
2128 C CB    . LEU A 144 ? 0.9389 0.6341 0.6382 0.0176  -0.0290 -0.0688 144 LEU A CB    
2129 C CG    . LEU A 144 ? 0.9502 0.5905 0.6162 0.0301  -0.0191 -0.0587 144 LEU A CG    
2130 C CD1   . LEU A 144 ? 0.9730 0.5851 0.6400 0.0159  -0.0022 -0.0358 144 LEU A CD1   
2131 C CD2   . LEU A 144 ? 0.9354 0.5862 0.5790 0.0594  -0.0204 -0.0481 144 LEU A CD2   
2143 N N     . LEU A 145 ? 0.9081 0.5789 0.7733 -0.0294 -0.1255 0.1620  145 LEU A N     
2144 C CA    . LEU A 145 ? 0.9579 0.5401 0.8018 -0.0536 -0.1203 0.1288  145 LEU A CA    
2145 C C     . LEU A 145 ? 1.0652 0.6595 0.9084 -0.1446 -0.1052 0.1032  145 LEU A C     
2146 O O     . LEU A 145 ? 1.1201 0.6429 0.9353 -0.1852 -0.0945 0.0668  145 LEU A O     
2147 C CB    . LEU A 145 ? 0.8751 0.5129 0.7483 -0.0146 -0.1443 0.0943  145 LEU A CB    
2148 C CG    . LEU A 145 ? 0.7457 0.3879 0.6260 0.0751  -0.1627 0.1169  145 LEU A CG    
2149 C CD1   . LEU A 145 ? 0.6554 0.3589 0.5686 0.1083  -0.1854 0.0807  145 LEU A CD1   
2150 C CD2   . LEU A 145 ? 1.0363 0.5299 0.8701 0.1099  -0.1472 0.1540  145 LEU A CD2   
2162 N N     . GLN A 146 ? 1.2121 0.8930 1.0830 -0.1827 -0.0997 0.1203  146 GLN A N     
2163 C CA    . GLN A 146 ? 1.2621 0.9694 1.1384 -0.2718 -0.0871 0.1061  146 GLN A CA    
2164 C C     . GLN A 146 ? 1.3244 0.9669 1.1705 -0.3005 -0.0611 0.1406  146 GLN A C     
2165 O O     . GLN A 146 ? 1.2811 1.0159 1.1630 -0.3292 -0.0536 0.1581  146 GLN A O     
2166 C CB    . GLN A 146 ? 1.1480 1.0456 1.1081 -0.2945 -0.1021 0.1029  146 GLN A CB    
2167 C CG    . GLN A 146 ? 1.0822 1.0577 1.0723 -0.2932 -0.1287 0.0711  146 GLN A CG    
2168 C CD    . GLN A 146 ? 0.9337 1.1156 1.0268 -0.3137 -0.1416 0.0871  146 GLN A CD    
2169 O OE1   . GLN A 146 ? 0.8203 1.1033 0.9679 -0.2749 -0.1629 0.0842  146 GLN A OE1   
2170 N NE2   . GLN A 146 ? 0.9247 1.1741 1.0542 -0.3731 -0.1261 0.1112  146 GLN A NE2   
2179 N N     . LEU A 147 ? 1.5785 1.0631 1.3657 -0.2914 -0.0427 0.1554  147 LEU A N     
2180 C CA    . LEU A 147 ? 1.6429 1.0576 1.3995 -0.3198 -0.0178 0.1942  147 LEU A CA    
2181 C C     . LEU A 147 ? 1.7778 1.0175 1.4874 -0.3417 0.0129  0.1921  147 LEU A C     
2182 O O     . LEU A 147 ? 1.8143 0.9838 1.5116 -0.3347 0.0195  0.1567  147 LEU A O     
2183 C CB    . LEU A 147 ? 1.5848 1.0167 1.3331 -0.2642 -0.0234 0.2460  147 LEU A CB    
2184 C CG    . LEU A 147 ? 1.4817 1.0612 1.2679 -0.2636 -0.0292 0.2496  147 LEU A CG    
2185 C CD1   . LEU A 147 ? 1.4393 1.0286 1.1998 -0.2139 -0.0344 0.2888  147 LEU A CD1   
2186 C CD2   . LEU A 147 ? 1.5018 1.1145 1.2970 -0.3341 -0.0058 0.2562  147 LEU A CD2   
2198 N N     . THR A 148 ? 1.8714 1.0370 1.5573 -0.3698 0.0389  0.2303  148 THR A N     
2199 C CA    . THR A 148 ? 1.9941 0.9874 1.6472 -0.3932 0.0815  0.2371  148 THR A CA    
2200 C C     . THR A 148 ? 2.0096 0.9722 1.6705 -0.3555 0.0949  0.3102  148 THR A C     
2201 O O     . THR A 148 ? 1.9579 1.0052 1.6156 -0.3557 0.0773  0.3469  148 THR A O     
2202 C CB    . THR A 148 ? 2.0592 1.0344 1.7004 -0.4898 0.1051  0.1924  148 THR A CB    
2203 O OG1   . THR A 148 ? 2.0215 1.0921 1.6748 -0.5317 0.0958  0.2150  148 THR A OG1   
2204 C CG2   . THR A 148 ? 2.0321 1.0686 1.6749 -0.5318 0.0894  0.1223  148 THR A CG2   
2205 N N     . PRO A 149 ? 2.1245 0.9945 1.8136 -0.3224 0.1255  0.3343  149 PRO A N     
2206 C CA    . PRO A 149 ? 2.1569 1.0287 1.8818 -0.2885 0.1319  0.4142  149 PRO A CA    
2207 C C     . PRO A 149 ? 2.2218 1.0887 1.9390 -0.3482 0.1523  0.4286  149 PRO A C     
2208 O O     . PRO A 149 ? 2.2558 1.1041 1.9490 -0.4150 0.1657  0.3724  149 PRO A O     
2209 C CB    . PRO A 149 ? 2.2446 1.0236 2.0073 -0.2516 0.1474  0.4267  149 PRO A CB    
2210 C CG    . PRO A 149 ? 2.3077 1.0076 2.0445 -0.2944 0.1797  0.3406  149 PRO A CG    
2211 C CD    . PRO A 149 ? 2.2033 0.9762 1.9002 -0.3216 0.1534  0.2875  149 PRO A CD    
2212 N N     . ARG B 3   ? 1.8438 0.7131 1.0719 0.4154  -0.1522 -0.1328 3   ARG B N     
2213 C CA    . ARG B 3   ? 1.7854 0.7280 1.0282 0.4313  -0.1453 -0.1067 3   ARG B CA    
2214 C C     . ARG B 3   ? 1.7594 0.6770 1.0084 0.3673  -0.1136 -0.0795 3   ARG B C     
2215 O O     . ARG B 3   ? 1.6790 0.6783 0.9735 0.3626  -0.0974 -0.0718 3   ARG B O     
2216 C CB    . ARG B 3   ? 1.8809 0.7961 1.0719 0.4733  -0.1713 -0.0932 3   ARG B CB    
2217 C CG    . ARG B 3   ? 1.9537 0.9185 1.1440 0.5425  -0.1998 -0.1172 3   ARG B CG    
2218 C CD    . ARG B 3   ? 2.0942 1.0264 1.2303 0.5823  -0.2267 -0.1081 3   ARG B CD    
2219 N NE    . ARG B 3   ? 2.2951 1.0773 1.3456 0.5583  -0.2314 -0.0989 3   ARG B NE    
2220 C CZ    . ARG B 3   ? 2.3917 1.1047 1.4031 0.5190  -0.2173 -0.0708 3   ARG B CZ    
2221 N NH1   . ARG B 3   ? 2.3248 1.0990 1.3706 0.4999  -0.2041 -0.0528 3   ARG B NH1   
2222 N NH2   . ARG B 3   ? 2.5460 1.1299 1.4831 0.5008  -0.2148 -0.0600 3   ARG B NH2   
2223 N N     . ALA B 4   ? 1.7300 0.5394 0.9344 0.3198  -0.1012 -0.0624 4   ALA B N     
2224 C CA    . ALA B 4   ? 1.6987 0.4921 0.9117 0.2555  -0.0643 -0.0367 4   ALA B CA    
2225 C C     . ALA B 4   ? 1.6100 0.4600 0.8898 0.2222  -0.0429 -0.0564 4   ALA B C     
2226 O O     . ALA B 4   ? 1.5201 0.4315 0.8276 0.2061  -0.0220 -0.0442 4   ALA B O     
2227 C CB    . ALA B 4   ? 1.8134 0.4961 0.9832 0.2127  -0.0472 -0.0175 4   ALA B CB    
2228 N N     . ILE B 5   ? 2.5729 1.4025 1.8776 0.2137  -0.0506 -0.0903 5   ILE B N     
2229 C CA    . ILE B 5   ? 2.5181 1.4149 1.8822 0.2000  -0.0419 -0.1221 5   ILE B CA    
2230 C C     . ILE B 5   ? 2.4494 1.4924 1.8503 0.2567  -0.0512 -0.1297 5   ILE B C     
2231 O O     . ILE B 5   ? 2.4595 1.5108 1.8328 0.3193  -0.0746 -0.1295 5   ILE B O     
2232 C CB    . ILE B 5   ? 2.5823 1.4409 1.9694 0.1901  -0.0615 -0.1642 5   ILE B CB    
2233 C CG1   . ILE B 5   ? 2.6866 1.4396 2.0738 0.1247  -0.0454 -0.1480 5   ILE B CG1   
2234 C CG2   . ILE B 5   ? 2.5405 1.4899 1.9902 0.1830  -0.0596 -0.2024 5   ILE B CG2   
2235 C CD1   . ILE B 5   ? 2.7754 1.4769 2.1912 0.1148  -0.0698 -0.1896 5   ILE B CD1   
2236 N N     . GLN B 6   ? 1.3434 0.5076 0.8116 0.2355  -0.0297 -0.1336 6   GLN B N     
2237 C CA    . GLN B 6   ? 1.2909 0.5982 0.8019 0.2820  -0.0274 -0.1333 6   GLN B CA    
2238 C C     . GLN B 6   ? 1.2368 0.5878 0.7512 0.2950  -0.0223 -0.0949 6   GLN B C     
2239 O O     . GLN B 6   ? 1.1679 0.6369 0.7293 0.3277  -0.0162 -0.0875 6   GLN B O     
2240 C CB    . GLN B 6   ? 1.3564 0.6785 0.8528 0.3552  -0.0555 -0.1676 6   GLN B CB    
2241 C CG    . GLN B 6   ? 1.3824 0.7036 0.8893 0.3567  -0.0663 -0.2139 6   GLN B CG    
2242 C CD    . GLN B 6   ? 1.2886 0.7387 0.8534 0.3466  -0.0412 -0.2153 6   GLN B CD    
2243 O OE1   . GLN B 6   ? 1.2112 0.7685 0.8042 0.3712  -0.0200 -0.1889 6   GLN B OE1   
2244 N NE2   . GLN B 6   ? 1.2943 0.7337 0.8810 0.3102  -0.0440 -0.2460 6   GLN B NE2   
2253 N N     . GLY B 7   ? 1.3451 0.6023 0.8118 0.2711  -0.0248 -0.0704 7   GLY B N     
2254 C CA    . GLY B 7   ? 1.3126 0.6049 0.7807 0.2873  -0.0312 -0.0419 7   GLY B CA    
2255 C C     . GLY B 7   ? 1.2344 0.6243 0.7596 0.2509  -0.0048 -0.0220 7   GLY B C     
2256 O O     . GLY B 7   ? 1.1883 0.5863 0.7294 0.2041  0.0220  -0.0221 7   GLY B O     
2260 N N     . ASN B 8   ? 1.5721 1.0385 1.1343 0.2740  -0.0145 -0.0062 8   ASN B N     
2261 C CA    . ASN B 8   ? 1.5245 1.0677 1.1368 0.2405  0.0054  0.0133  8   ASN B CA    
2262 C C     . ASN B 8   ? 1.5405 0.9989 1.0994 0.1920  0.0164  0.0292  8   ASN B C     
2263 O O     . ASN B 8   ? 1.4943 0.9990 1.0819 0.1584  0.0383  0.0405  8   ASN B O     
2264 C CB    . ASN B 8   ? 1.4928 1.1170 1.1599 0.2695  -0.0137 0.0257  8   ASN B CB    
2265 C CG    . ASN B 8   ? 1.5693 1.1222 1.1872 0.3028  -0.0545 0.0258  8   ASN B CG    
2266 O OD1   . ASN B 8   ? 1.6202 1.1048 1.1897 0.2869  -0.0693 0.0372  8   ASN B OD1   
2267 N ND2   . ASN B 8   ? 1.5863 1.1534 1.2089 0.3569  -0.0741 0.0121  8   ASN B ND2   
2274 N N     . ASP B 9   ? 1.8113 1.1424 1.2872 0.1921  0.0047  0.0326  9   ASP B N     
2275 C CA    . ASP B 9   ? 1.8306 1.0749 1.2461 0.1511  0.0244  0.0520  9   ASP B CA    
2276 C C     . ASP B 9   ? 1.8042 1.0469 1.2381 0.1024  0.0636  0.0469  9   ASP B C     
2277 O O     . ASP B 9   ? 1.8277 1.0340 1.2344 0.0652  0.0906  0.0648  9   ASP B O     
2278 C CB    . ASP B 9   ? 1.9429 1.0436 1.2575 0.1698  0.0074  0.0621  9   ASP B CB    
2279 C CG    . ASP B 9   ? 1.9518 1.0528 1.2441 0.2224  -0.0376 0.0641  9   ASP B CG    
2280 O OD1   . ASP B 9   ? 1.8880 1.0736 1.2277 0.2260  -0.0506 0.0673  9   ASP B OD1   
2281 O OD2   . ASP B 9   ? 2.0130 1.0386 1.2494 0.2580  -0.0619 0.0594  9   ASP B OD2   
2286 N N     . THR B 10  ? 1.4989 0.7829 0.9785 0.1062  0.0653  0.0208  10  THR B N     
2287 C CA    . THR B 10  ? 1.4706 0.7623 0.9805 0.0635  0.0932  0.0075  10  THR B CA    
2288 C C     . THR B 10  ? 1.3758 0.8000 0.9593 0.0600  0.1072  -0.0034 10  THR B C     
2289 O O     . THR B 10  ? 1.3502 0.7984 0.9580 0.0211  0.1341  -0.0040 10  THR B O     
2290 C CB    . THR B 10  ? 1.5146 0.7451 1.0182 0.0705  0.0789  -0.0216 10  THR B CB    
2291 O OG1   . THR B 10  ? 1.4895 0.7833 1.0165 0.1249  0.0515  -0.0455 10  THR B OG1   
2292 C CG2   . THR B 10  ? 1.6147 0.6952 1.0381 0.0701  0.0710  -0.0067 10  THR B CG2   
2300 N N     . ARG B 11  ? 1.1372 0.6488 0.7565 0.1026  0.0927  -0.0099 11  ARG B N     
2301 C CA    . ARG B 11  ? 1.0701 0.6979 0.7481 0.1038  0.1109  -0.0131 11  ARG B CA    
2302 C C     . ARG B 11  ? 1.0226 0.6757 0.7078 0.0746  0.1301  0.0142  11  ARG B C     
2303 O O     . ARG B 11  ? 0.9775 0.6863 0.6914 0.0554  0.1533  0.0130  11  ARG B O     
2304 C CB    . ARG B 11  ? 1.0574 0.7684 0.7697 0.1581  0.0997  -0.0175 11  ARG B CB    
2305 C CG    . ARG B 11  ? 1.0344 0.7798 0.7662 0.1743  0.0916  0.0094  11  ARG B CG    
2306 C CD    . ARG B 11  ? 0.9778 0.8257 0.7633 0.2229  0.0943  0.0106  11  ARG B CD    
2307 N NE    . ARG B 11  ? 0.9127 0.8461 0.7368 0.2215  0.1250  0.0136  11  ARG B NE    
2308 C CZ    . ARG B 11  ? 0.8301 0.8599 0.7061 0.2533  0.1429  0.0291  11  ARG B CZ    
2309 N NH1   . ARG B 11  ? 0.8030 0.8692 0.7140 0.2852  0.1334  0.0418  11  ARG B NH1   
2310 N NH2   . ARG B 11  ? 0.7618 0.8533 0.6567 0.2550  0.1727  0.0339  11  ARG B NH2   
2324 N N     . GLU B 12  ? 1.2107 0.8203 0.8654 0.0761  0.1165  0.0356  12  GLU B N     
2325 C CA    . GLU B 12  ? 1.1885 0.8040 0.8372 0.0518  0.1280  0.0569  12  GLU B CA    
2326 C C     . GLU B 12  ? 1.1889 0.7613 0.8080 0.0109  0.1575  0.0597  12  GLU B C     
2327 O O     . GLU B 12  ? 1.1553 0.7703 0.7903 -0.0072 0.1782  0.0670  12  GLU B O     
2328 C CB    . GLU B 12  ? 1.2379 0.7962 0.8455 0.0658  0.0990  0.0717  12  GLU B CB    
2329 C CG    . GLU B 12  ? 1.2329 0.8522 0.8902 0.1038  0.0698  0.0701  12  GLU B CG    
2330 C CD    . GLU B 12  ? 1.1830 0.9028 0.9157 0.0994  0.0780  0.0795  12  GLU B CD    
2331 O OE1   . GLU B 12  ? 1.1649 0.9013 0.9009 0.0713  0.1036  0.0854  12  GLU B OE1   
2332 O OE2   . GLU B 12  ? 1.1585 0.9402 0.9502 0.1247  0.0606  0.0824  12  GLU B OE2   
2339 N N     . GLN B 13  ? 1.0143 0.5017 0.5937 -0.0034 0.1619  0.0554  13  GLN B N     
2340 C CA    . GLN B 13  ? 1.0352 0.4929 0.6051 -0.0451 0.1964  0.0593  13  GLN B CA    
2341 C C     . GLN B 13  ? 0.9839 0.5264 0.6232 -0.0583 0.2110  0.0340  13  GLN B C     
2342 O O     . GLN B 13  ? 0.9663 0.5378 0.6235 -0.0864 0.2397  0.0367  13  GLN B O     
2343 C CB    . GLN B 13  ? 1.1238 0.4627 0.6413 -0.0600 0.2012  0.0657  13  GLN B CB    
2344 C CG    . GLN B 13  ? 1.1917 0.4423 0.6256 -0.0437 0.1905  0.0919  13  GLN B CG    
2345 C CD    . GLN B 13  ? 1.2719 0.4438 0.6728 -0.0543 0.1963  0.0956  13  GLN B CD    
2346 O OE1   . GLN B 13  ? 1.3069 0.4305 0.7163 -0.0614 0.1936  0.0836  13  GLN B OE1   
2347 N NE2   . GLN B 13  ? 1.3098 0.4637 0.6727 -0.0528 0.2044  0.1110  13  GLN B NE2   
2356 N N     . ALA B 14  ? 0.8185 0.4027 0.4931 -0.0322 0.1902  0.0074  14  ALA B N     
2357 C CA    . ALA B 14  ? 0.7740 0.4410 0.5052 -0.0325 0.1964  -0.0210 14  ALA B CA    
2358 C C     . ALA B 14  ? 0.7022 0.4626 0.4581 -0.0212 0.2107  -0.0107 14  ALA B C     
2359 O O     . ALA B 14  ? 0.6627 0.4777 0.4493 -0.0340 0.2277  -0.0224 14  ALA B O     
2360 C CB    . ALA B 14  ? 0.7882 0.4696 0.5333 0.0053  0.1680  -0.0523 14  ALA B CB    
2366 N N     . ASN B 15  ? 0.9140 0.6924 0.6611 0.0028  0.2028  0.0107  15  ASN B N     
2367 C CA    . ASN B 15  ? 0.8754 0.7250 0.6445 0.0092  0.2176  0.0253  15  ASN B CA    
2368 C C     . ASN B 15  ? 0.8707 0.6963 0.6185 -0.0240 0.2369  0.0408  15  ASN B C     
2369 O O     . ASN B 15  ? 0.8007 0.6940 0.5920 -0.0246 0.2282  0.0352  15  ASN B O     
2370 C CB    . ASN B 15  ? 0.8879 0.7569 0.6673 0.0350  0.2034  0.0450  15  ASN B CB    
2371 C CG    . ASN B 15  ? 0.8549 0.7847 0.6618 0.0373  0.2193  0.0631  15  ASN B CG    
2372 O OD1   . ASN B 15  ? 0.8493 0.7586 0.6501 0.0141  0.2109  0.0733  15  ASN B OD1   
2373 N ND2   . ASN B 15  ? 0.8023 0.8074 0.6545 0.0642  0.2173  0.0599  15  ASN B ND2   
2380 N N     . GLY B 16  ? 0.8608 0.6030 0.5611 -0.0413 0.2332  0.0559  16  GLY B N     
2381 C CA    . GLY B 16  ? 0.8578 0.5967 0.5617 -0.0567 0.2257  0.0604  16  GLY B CA    
2382 C C     . GLY B 16  ? 0.8584 0.6068 0.5824 -0.0794 0.2447  0.0485  16  GLY B C     
2383 O O     . GLY B 16  ? 0.8331 0.6083 0.5722 -0.0831 0.2422  0.0512  16  GLY B O     
2387 N N     . GLU B 17  ? 0.8733 0.5977 0.5973 -0.0960 0.2672  0.0349  17  GLU B N     
2388 C CA    . GLU B 17  ? 0.8540 0.5911 0.6127 -0.1267 0.2903  0.0205  17  GLU B CA    
2389 C C     . GLU B 17  ? 0.7342 0.5748 0.5476 -0.1155 0.2846  0.0070  17  GLU B C     
2390 O O     . GLU B 17  ? 0.7027 0.5667 0.5442 -0.1320 0.2951  0.0048  17  GLU B O     
2391 C CB    . GLU B 17  ? 0.8922 0.6037 0.6743 -0.1390 0.2867  -0.0060 17  GLU B CB    
2392 C CG    . GLU B 17  ? 0.8852 0.5996 0.7211 -0.1812 0.3067  -0.0236 17  GLU B CG    
2393 C CD    . GLU B 17  ? 0.7981 0.6248 0.7050 -0.1763 0.3047  -0.0577 17  GLU B CD    
2394 O OE1   . GLU B 17  ? 0.7374 0.6277 0.6443 -0.1346 0.2846  -0.0711 17  GLU B OE1   
2395 O OE2   . GLU B 17  ? 0.7828 0.6356 0.7472 -0.2119 0.3247  -0.0703 17  GLU B OE2   
2402 N N     . ARG B 18  ? 0.8247 0.7273 0.6526 -0.0829 0.2657  0.0018  18  ARG B N     
2403 C CA    . ARG B 18  ? 0.7029 0.6924 0.5688 -0.0636 0.2514  -0.0032 18  ARG B CA    
2404 C C     . ARG B 18  ? 0.6612 0.6547 0.5232 -0.0653 0.2411  0.0168  18  ARG B C     
2405 O O     . ARG B 18  ? 0.5915 0.6331 0.4774 -0.0629 0.2437  0.0126  18  ARG B O     
2406 C CB    . ARG B 18  ? 0.6631 0.7047 0.5352 -0.0269 0.2282  -0.0005 18  ARG B CB    
2407 C CG    . ARG B 18  ? 0.5734 0.6949 0.4683 -0.0059 0.2090  -0.0004 18  ARG B CG    
2408 C CD    . ARG B 18  ? 0.5571 0.7098 0.4571 0.0049  0.1914  -0.0080 18  ARG B CD    
2409 N NE    . ARG B 18  ? 0.5159 0.6775 0.4236 0.0057  0.1912  -0.0210 18  ARG B NE    
2410 C CZ    . ARG B 18  ? 0.5292 0.6756 0.4343 0.0268  0.1953  -0.0111 18  ARG B CZ    
2411 N NH1   . ARG B 18  ? 0.5301 0.6671 0.4370 0.0392  0.1920  0.0026  18  ARG B NH1   
2412 N NH2   . ARG B 18  ? 0.5456 0.6974 0.4489 0.0453  0.1963  -0.0060 18  ARG B NH2   
2426 N N     . TRP B 19  ? 0.4021 0.7156 0.9965 0.0967  -0.1786 -0.1418 19  TRP B N     
2427 C CA    . TRP B 19  ? 0.4325 0.7880 1.0429 0.0974  -0.1761 -0.1783 19  TRP B CA    
2428 C C     . TRP B 19  ? 0.4403 0.8657 1.1017 0.0952  -0.1450 -0.2019 19  TRP B C     
2429 O O     . TRP B 19  ? 0.5088 0.9616 1.1213 0.0987  -0.1249 -0.1992 19  TRP B O     
2430 C CB    . TRP B 19  ? 0.4922 0.8644 1.0528 0.1056  -0.1881 -0.1724 19  TRP B CB    
2431 C CG    . TRP B 19  ? 0.5127 0.8241 1.0253 0.0983  -0.2048 -0.1552 19  TRP B CG    
2432 C CD1   . TRP B 19  ? 0.5585 0.8715 1.0246 0.1012  -0.2096 -0.1292 19  TRP B CD1   
2433 C CD2   . TRP B 19  ? 0.5119 0.7561 1.0210 0.0891  -0.2170 -0.1692 19  TRP B CD2   
2434 N NE1   . TRP B 19  ? 0.5778 0.8352 1.0182 0.0871  -0.2189 -0.1284 19  TRP B NE1   
2435 C CE2   . TRP B 19  ? 0.5447 0.7541 1.0096 0.0821  -0.2253 -0.1514 19  TRP B CE2   
2436 C CE3   . TRP B 19  ? 0.4900 0.7023 1.0296 0.0910  -0.2236 -0.1996 19  TRP B CE3   
2437 C CZ2   . TRP B 19  ? 0.5190 0.6580 0.9721 0.0761  -0.2391 -0.1612 19  TRP B CZ2   
2438 C CZ3   . TRP B 19  ? 0.4917 0.6304 1.0150 0.0917  -0.2425 -0.2085 19  TRP B CZ3   
2439 C CH2   . TRP B 19  ? 0.4932 0.5929 0.9747 0.0839  -0.2498 -0.1880 19  TRP B CH2   
2450 N N     . ASP B 20  ? 0.5610 0.9832 1.2703 0.0789  -0.1259 -0.2184 20  ASP B N     
2451 C CA    . ASP B 20  ? 0.6991 1.1502 1.4075 0.0567  -0.0751 -0.2386 20  ASP B CA    
2452 C C     . ASP B 20  ? 0.7293 1.2185 1.5365 0.0444  -0.0756 -0.2936 20  ASP B C     
2453 O O     . ASP B 20  ? 0.6750 1.1089 1.4725 0.0547  -0.1082 -0.2922 20  ASP B O     
2454 C CB    . ASP B 20  ? 0.7992 1.1974 1.4259 0.0415  -0.0314 -0.1942 20  ASP B CB    
2455 C CG    . ASP B 20  ? 0.7860 1.1552 1.3072 0.0645  -0.0323 -0.1480 20  ASP B CG    
2456 O OD1   . ASP B 20  ? 0.6956 1.1053 1.1980 0.0768  -0.0371 -0.1604 20  ASP B OD1   
2457 O OD2   . ASP B 20  ? 0.8413 1.1514 1.2988 0.0735  -0.0301 -0.1030 20  ASP B OD2   
2462 N N     . GLY B 21  ? 1.5177 2.0509 2.3409 0.0184  -0.0294 -0.3286 21  GLY B N     
2463 C CA    . GLY B 21  ? 1.4588 2.0274 2.3480 0.0084  -0.0268 -0.3859 21  GLY B CA    
2464 C C     . GLY B 21  ? 1.4764 2.0252 2.3891 -0.0117 -0.0118 -0.3873 21  GLY B C     
2465 O O     . GLY B 21  ? 1.4200 1.9189 2.3246 0.0086  -0.0491 -0.3849 21  GLY B O     
2469 N N     . GLY B 22  ? 1.2913 1.8549 2.1994 -0.0548 0.0502  -0.3869 22  GLY B N     
2470 C CA    . GLY B 22  ? 1.3231 1.8654 2.2474 -0.0832 0.0742  -0.3874 22  GLY B CA    
2471 C C     . GLY B 22  ? 1.4634 1.9120 2.2664 -0.1089 0.1224  -0.3243 22  GLY B C     
2472 O O     . GLY B 22  ? 1.5132 1.9340 2.3051 -0.1471 0.1641  -0.3262 22  GLY B O     
2476 N N     . SER B 23  ? 1.9217 2.3191 2.6275 -0.0859 0.1163  -0.2713 23  SER B N     
2477 C CA    . SER B 23  ? 2.0590 2.3588 2.6299 -0.0973 0.1573  -0.2122 23  SER B CA    
2478 C C     . SER B 23  ? 2.0426 2.3095 2.5254 -0.0536 0.1296  -0.1631 23  SER B C     
2479 O O     . SER B 23  ? 1.9923 2.3036 2.4689 -0.0435 0.1276  -0.1801 23  SER B O     
2480 C CB    . SER B 23  ? 2.1217 2.4092 2.6379 -0.1511 0.2365  -0.2360 23  SER B CB    
2481 O OG    . SER B 23  ? 2.0773 2.4488 2.6389 -0.1579 0.2446  -0.2866 23  SER B OG    
2487 N N     . GLY B 24  ? 1.4522 1.6498 1.8703 -0.0268 0.1075  -0.1074 24  GLY B N     
2488 C CA    . GLY B 24  ? 1.4136 1.5843 1.7392 0.0159  0.0848  -0.0650 24  GLY B CA    
2489 C C     . GLY B 24  ? 1.4402 1.5039 1.6200 0.0218  0.1195  -0.0130 24  GLY B C     
2490 O O     . GLY B 24  ? 1.5204 1.5187 1.6779 -0.0036 0.1486  0.0005  24  GLY B O     
2494 N N     . GLY B 25  ? 1.5883 1.6294 1.6619 0.0588  0.1147  0.0146  25  GLY B N     
2495 C CA    . GLY B 25  ? 1.6702 1.5973 1.5791 0.0732  0.1487  0.0604  25  GLY B CA    
2496 C C     . GLY B 25  ? 1.7034 1.5339 1.5611 0.0742  0.1555  0.0982  25  GLY B C     
2497 O O     . GLY B 25  ? 1.8206 1.5334 1.5340 0.0732  0.1979  0.1304  25  GLY B O     
2501 N N     . ILE B 26  ? 1.4129 1.2791 1.3743 0.0760  0.1165  0.0953  26  ILE B N     
2502 C CA    . ILE B 26  ? 1.3686 1.1492 1.2838 0.0825  0.1167  0.1321  26  ILE B CA    
2503 C C     . ILE B 26  ? 1.3699 1.1645 1.3953 0.0317  0.1306  0.1070  26  ILE B C     
2504 O O     . ILE B 26  ? 1.3920 1.2670 1.5297 -0.0022 0.1355  0.0587  26  ILE B O     
2505 C CB    . ILE B 26  ? 1.2018 1.0052 1.1182 0.1401  0.0532  0.1566  26  ILE B CB    
2506 C CG1   . ILE B 26  ? 1.0602 0.9808 1.1241 0.1381  0.0035  0.1212  26  ILE B CG1   
2507 C CG2   . ILE B 26  ? 1.1989 0.9790 0.9856 0.1967  0.0426  0.1808  26  ILE B CG2   
2508 C CD1   . ILE B 26  ? 0.9476 0.8947 1.0280 0.1767  -0.0520 0.1358  26  ILE B CD1   
2520 N N     . THR B 27  ? 0.9833 0.7027 0.9755 0.0305  0.1349  0.1364  27  THR B N     
2521 C CA    . THR B 27  ? 0.8864 0.6178 0.9765 -0.0136 0.1457  0.1136  27  THR B CA    
2522 C C     . THR B 27  ? 0.7385 0.5500 0.9552 0.0076  0.0790  0.1021  27  THR B C     
2523 O O     . THR B 27  ? 0.6990 0.5066 0.8927 0.0516  0.0339  0.1313  27  THR B O     
2524 C CB    . THR B 27  ? 0.9733 0.5813 0.9650 -0.0268 0.1821  0.1499  27  THR B CB    
2525 O OG1   . THR B 27  ? 1.1330 0.6430 0.9856 -0.0520 0.2500  0.1602  27  THR B OG1   
2526 C CG2   . THR B 27  ? 0.9144 0.5439 1.0116 -0.0736 0.1934  0.1222  27  THR B CG2   
2534 N N     . SER B 28  ? 0.7258 0.6077 1.0703 -0.0236 0.0736  0.0554  28  SER B N     
2535 C CA    . SER B 28  ? 0.5926 0.5362 1.0453 -0.0052 0.0121  0.0403  28  SER B CA    
2536 C C     . SER B 28  ? 0.4947 0.4339 1.0197 -0.0317 0.0131  0.0252  28  SER B C     
2537 O O     . SER B 28  ? 0.5386 0.4697 1.0726 -0.0737 0.0626  0.0015  28  SER B O     
2538 C CB    . SER B 28  ? 0.6027 0.6379 1.1414 -0.0022 -0.0115 -0.0075 28  SER B CB    
2539 O OG    . SER B 28  ? 0.4464 0.5181 1.0741 0.0124  -0.0668 -0.0243 28  SER B OG    
2545 N N     . PRO B 29  ? 0.7632 0.5808 0.5544 0.0394  0.1481  0.0804  29  PRO B N     
2546 C CA    . PRO B 29  ? 0.7750 0.4986 0.5051 0.0484  0.1341  0.0913  29  PRO B CA    
2547 C C     . PRO B 29  ? 0.7996 0.4732 0.5307 0.0512  0.1243  0.1042  29  PRO B C     
2548 O O     . PRO B 29  ? 0.7989 0.4091 0.5373 0.0549  0.0799  0.1125  29  PRO B O     
2549 C CB    . PRO B 29  ? 0.8027 0.4874 0.4714 0.0547  0.1191  0.0683  29  PRO B CB    
2550 C CG    . PRO B 29  ? 0.7883 0.5140 0.4839 0.0560  0.1373  0.0573  29  PRO B CG    
2551 C CD    . PRO B 29  ? 0.7901 0.5828 0.5478 0.0479  0.1511  0.0634  29  PRO B CD    
2559 N N     . PHE B 30  ? 0.7810 0.4875 0.5317 0.0503  0.1488  0.0986  30  PHE B N     
2560 C CA    . PHE B 30  ? 0.8513 0.5006 0.6117 0.0564  0.1334  0.1064  30  PHE B CA    
2561 C C     . PHE B 30  ? 0.8444 0.5616 0.7342 0.0524  0.1318  0.1147  30  PHE B C     
2562 O O     . PHE B 30  ? 0.7830 0.5941 0.7324 0.0434  0.1724  0.1252  30  PHE B O     
2563 C CB    . PHE B 30  ? 0.8336 0.4952 0.5648 0.0566  0.1588  0.0902  30  PHE B CB    
2564 C CG    . PHE B 30  ? 0.7956 0.4309 0.4538 0.0578  0.1435  0.0665  30  PHE B CG    
2565 C CD1   . PHE B 30  ? 0.8649 0.4208 0.4605 0.0638  0.1046  0.0631  30  PHE B CD1   
2566 C CD2   . PHE B 30  ? 0.6960 0.4042 0.3927 0.0483  0.1469  0.0515  30  PHE B CD2   
2567 C CE1   . PHE B 30  ? 0.8557 0.3938 0.3997 0.0646  0.0999  0.0440  30  PHE B CE1   
2568 C CE2   . PHE B 30  ? 0.7197 0.3949 0.3788 0.0500  0.1358  0.0405  30  PHE B CE2   
2569 C CZ    . PHE B 30  ? 0.7878 0.3886 0.3790 0.0571  0.1169  0.0358  30  PHE B CZ    
2579 N N     . LYS B 31  ? 0.8403 0.5227 0.7793 0.0585  0.0814  0.1076  31  LYS B N     
2580 C CA    . LYS B 31  ? 0.8328 0.5881 0.9036 0.0550  0.0717  0.1106  31  LYS B CA    
2581 C C     . LYS B 31  ? 0.8356 0.6296 0.9577 0.0607  0.0794  0.0932  31  LYS B C     
2582 O O     . LYS B 31  ? 0.8156 0.6836 1.0497 0.0596  0.0777  0.0935  31  LYS B O     
2583 C CB    . LYS B 31  ? 0.8653 0.5639 0.9721 0.0577  0.0068  0.1151  31  LYS B CB    
2584 C CG    . LYS B 31  ? 0.8734 0.5303 0.9413 0.0532  -0.0072 0.1288  31  LYS B CG    
2585 C CD    . LYS B 31  ? 0.8915 0.5278 1.0362 0.0505  -0.0640 0.1349  31  LYS B CD    
2586 C CE    . LYS B 31  ? 0.9279 0.5022 1.0463 0.0607  -0.1172 0.1138  31  LYS B CE    
2587 N NZ    . LYS B 31  ? 0.9290 0.5072 1.1129 0.0539  -0.1653 0.1126  31  LYS B NZ    
2601 N N     . LEU B 32  ? 0.9127 0.6598 0.9591 0.0670  0.0873  0.0786  32  LEU B N     
2602 C CA    . LEU B 32  ? 0.9152 0.6875 1.0042 0.0739  0.0930  0.0596  32  LEU B CA    
2603 C C     . LEU B 32  ? 0.8911 0.7138 0.9466 0.0683  0.1530  0.0500  32  LEU B C     
2604 O O     . LEU B 32  ? 0.8850 0.6931 0.8565 0.0611  0.1815  0.0578  32  LEU B O     
2605 C CB    . LEU B 32  ? 0.9685 0.6343 1.0059 0.0863  0.0431  0.0505  32  LEU B CB    
2606 C CG    . LEU B 32  ? 1.0035 0.6159 1.0736 0.0939  -0.0226 0.0558  32  LEU B CG    
2607 C CD1   . LEU B 32  ? 1.0434 0.5532 1.0495 0.1070  -0.0671 0.0488  32  LEU B CD1   
2608 C CD2   . LEU B 32  ? 0.9654 0.6594 1.1749 0.0954  -0.0326 0.0533  32  LEU B CD2   
2620 N N     . PRO B 33  ? 0.6744 0.5576 0.7942 0.0724  0.1726  0.0311  33  PRO B N     
2621 C CA    . PRO B 33  ? 0.5955 0.5276 0.6872 0.0667  0.2271  0.0178  33  PRO B CA    
2622 C C     . PRO B 33  ? 0.6643 0.5056 0.6643 0.0690  0.2196  0.0072  33  PRO B C     
2623 O O     . PRO B 33  ? 0.7361 0.4908 0.7165 0.0787  0.1730  0.0053  33  PRO B O     
2624 C CB    . PRO B 33  ? 0.5040 0.5361 0.7090 0.0726  0.2447  -0.0015 33  PRO B CB    
2625 C CG    . PRO B 33  ? 0.5614 0.5889 0.8512 0.0822  0.1963  0.0029  33  PRO B CG    
2626 C CD    . PRO B 33  ? 0.6664 0.5774 0.8888 0.0837  0.1449  0.0184  33  PRO B CD    
2634 N N     . ASP B 34  ? 0.7665 0.6346 0.7145 0.0550  0.2494  0.0037  34  ASP B N     
2635 C CA    . ASP B 34  ? 0.8113 0.6108 0.6868 0.0530  0.2479  -0.0038 34  ASP B CA    
2636 C C     . ASP B 34  ? 0.8403 0.6461 0.7727 0.0652  0.2567  -0.0322 34  ASP B C     
2637 O O     . ASP B 34  ? 0.7458 0.6531 0.7579 0.0581  0.2538  -0.0436 34  ASP B O     
2638 C CB    . ASP B 34  ? 0.6687 0.5268 0.5312 0.0294  0.2173  -0.0003 34  ASP B CB    
2639 C CG    . ASP B 34  ? 0.6996 0.4928 0.5034 0.0257  0.2153  -0.0011 34  ASP B CG    
2640 O OD1   . ASP B 34  ? 0.7359 0.4619 0.4767 0.0275  0.2040  0.0107  34  ASP B OD1   
2641 O OD2   . ASP B 34  ? 0.6955 0.5071 0.5188 0.0218  0.2224  -0.0148 34  ASP B OD2   
2646 N N     . GLU B 35  ? 0.9162 0.6222 0.8105 0.0736  0.2227  -0.0351 35  GLU B N     
2647 C CA    . GLU B 35  ? 0.9369 0.6335 0.8861 0.0841  0.2101  -0.0594 35  GLU B CA    
2648 C C     . GLU B 35  ? 0.9665 0.5904 0.8367 0.0768  0.2164  -0.0623 35  GLU B C     
2649 O O     . GLU B 35  ? 1.0136 0.5636 0.8831 0.0860  0.1822  -0.0666 35  GLU B O     
2650 C CB    . GLU B 35  ? 0.9826 0.6316 0.9831 0.1021  0.1515  -0.0569 35  GLU B CB    
2651 C CG    . GLU B 35  ? 1.0324 0.5845 0.9577 0.1037  0.1059  -0.0298 35  GLU B CG    
2652 C CD    . GLU B 35  ? 1.0557 0.5897 1.0475 0.1195  0.0515  -0.0268 35  GLU B CD    
2653 O OE1   . GLU B 35  ? 1.0187 0.6255 1.1192 0.1282  0.0528  -0.0428 35  GLU B OE1   
2654 O OE2   . GLU B 35  ? 1.0844 0.5356 1.0199 0.1236  0.0074  -0.0089 35  GLU B OE2   
2661 N N     . SER B 36  ? 0.9085 0.5664 0.7207 0.0557  0.2510  -0.0531 36  SER B N     
2662 C CA    . SER B 36  ? 0.9279 0.5391 0.6774 0.0416  0.2532  -0.0481 36  SER B CA    
2663 C C     . SER B 36  ? 0.9269 0.5540 0.7391 0.0457  0.2556  -0.0783 36  SER B C     
2664 O O     . SER B 36  ? 0.8444 0.5696 0.7422 0.0468  0.2636  -0.0978 36  SER B O     
2665 C CB    . SER B 36  ? 0.7897 0.4739 0.5359 0.0157  0.2471  -0.0289 36  SER B CB    
2666 O OG    . SER B 36  ? 0.8120 0.4652 0.5263 0.0037  0.2487  -0.0282 36  SER B OG    
2672 N N     . PRO B 37  ? 0.8157 0.3543 0.5900 0.0470  0.2385  -0.0791 37  PRO B N     
2673 C CA    . PRO B 37  ? 0.8214 0.3703 0.6594 0.0516  0.2351  -0.1082 37  PRO B CA    
2674 C C     . PRO B 37  ? 0.7779 0.3864 0.6095 0.0283  0.2691  -0.1155 37  PRO B C     
2675 O O     . PRO B 37  ? 0.7658 0.3695 0.5313 0.0067  0.2821  -0.0905 37  PRO B O     
2676 C CB    . PRO B 37  ? 0.9038 0.3418 0.7078 0.0580  0.1878  -0.0933 37  PRO B CB    
2677 C CG    . PRO B 37  ? 0.9295 0.3195 0.6240 0.0436  0.1885  -0.0565 37  PRO B CG    
2678 C CD    . PRO B 37  ? 0.8846 0.3223 0.5635 0.0433  0.2107  -0.0487 37  PRO B CD    
2686 N N     . SER B 38  ? 0.7755 0.4443 0.6849 0.0332  0.2722  -0.1469 38  SER B N     
2687 C CA    . SER B 38  ? 0.7284 0.4449 0.6395 0.0131  0.2883  -0.1540 38  SER B CA    
2688 C C     . SER B 38  ? 0.8224 0.4362 0.6728 0.0026  0.2920  -0.1498 38  SER B C     
2689 O O     . SER B 38  ? 0.9116 0.4226 0.7319 0.0143  0.2660  -0.1412 38  SER B O     
2690 C CB    . SER B 38  ? 0.6943 0.4828 0.6898 0.0248  0.2851  -0.1884 38  SER B CB    
2691 O OG    . SER B 38  ? 0.7567 0.4857 0.7960 0.0494  0.2663  -0.2132 38  SER B OG    
2697 N N     . TRP B 39  ? 0.8547 0.4990 0.6911 -0.0209 0.3094  -0.1483 39  TRP B N     
2698 C CA    . TRP B 39  ? 0.9458 0.4985 0.7253 -0.0350 0.3178  -0.1438 39  TRP B CA    
2699 C C     . TRP B 39  ? 1.0213 0.5045 0.8427 -0.0159 0.2893  -0.1689 39  TRP B C     
2700 O O     . TRP B 39  ? 1.0994 0.4817 0.8791 -0.0145 0.2609  -0.1481 39  TRP B O     
2701 C CB    . TRP B 39  ? 0.8918 0.5018 0.6771 -0.0615 0.3352  -0.1453 39  TRP B CB    
2702 C CG    . TRP B 39  ? 0.9801 0.5003 0.7029 -0.0817 0.3518  -0.1390 39  TRP B CG    
2703 C CD1   . TRP B 39  ? 1.0972 0.4983 0.7431 -0.0796 0.3432  -0.1186 39  TRP B CD1   
2704 C CD2   . TRP B 39  ? 0.9681 0.5110 0.7007 -0.1059 0.3677  -0.1499 39  TRP B CD2   
2705 N NE1   . TRP B 39  ? 1.1594 0.5092 0.7642 -0.1024 0.3565  -0.1146 39  TRP B NE1   
2706 C CE2   . TRP B 39  ? 1.0876 0.5184 0.7423 -0.1210 0.3809  -0.1370 39  TRP B CE2   
2707 C CE3   . TRP B 39  ? 0.9036 0.5475 0.6984 -0.1126 0.3625  -0.1675 39  TRP B CE3   
2708 C CZ2   . TRP B 39  ? 1.1130 0.5309 0.7552 -0.1488 0.4018  -0.1443 39  TRP B CZ2   
2709 C CZ3   . TRP B 39  ? 0.9310 0.5623 0.7165 -0.1373 0.3780  -0.1764 39  TRP B CZ3   
2710 C CH2   . TRP B 39  ? 1.0230 0.5425 0.7364 -0.1587 0.4031  -0.1663 39  TRP B CH2   
2721 N N     . THR B 40  ? 1.0410 0.5856 0.9509 -0.0009 0.2839  -0.2061 40  THR B N     
2722 C CA    . THR B 40  ? 1.1130 0.5987 1.0728 0.0186  0.2476  -0.2278 40  THR B CA    
2723 C C     . THR B 40  ? 1.1524 0.5704 1.1155 0.0422  0.2008  -0.2100 40  THR B C     
2724 O O     . THR B 40  ? 1.2167 0.5429 1.1672 0.0469  0.1601  -0.1953 40  THR B O     
2725 C CB    . THR B 40  ? 1.0749 0.6487 1.1198 0.0319  0.2542  -0.2695 40  THR B CB    
2726 O OG1   . THR B 40  ? 1.0126 0.6728 1.0933 0.0450  0.2598  -0.2708 40  THR B OG1   
2727 C CG2   . THR B 40  ? 1.0472 0.6829 1.0904 0.0075  0.2874  -0.2835 40  THR B CG2   
2735 N N     . GLU B 41  ? 1.1452 0.6122 1.1286 0.0558  0.2018  -0.2078 41  GLU B N     
2736 C CA    . GLU B 41  ? 1.1861 0.5952 1.1755 0.0772  0.1549  -0.1903 41  GLU B CA    
2737 C C     . GLU B 41  ? 1.2422 0.5645 1.1522 0.0648  0.1310  -0.1467 41  GLU B C     
2738 O O     . GLU B 41  ? 1.2941 0.5569 1.2156 0.0779  0.0806  -0.1299 41  GLU B O     
2739 C CB    . GLU B 41  ? 1.1308 0.6115 1.1528 0.0888  0.1662  -0.1926 41  GLU B CB    
2740 C CG    . GLU B 41  ? 1.1678 0.6032 1.2149 0.1137  0.1172  -0.1817 41  GLU B CG    
2741 C CD    . GLU B 41  ? 1.1344 0.6302 1.2063 0.1200  0.1284  -0.1765 41  GLU B CD    
2742 O OE1   . GLU B 41  ? 1.0999 0.6439 1.1384 0.1027  0.1674  -0.1684 41  GLU B OE1   
2743 O OE2   . GLU B 41  ? 1.1391 0.6358 1.2625 0.1412  0.0990  -0.1775 41  GLU B OE2   
2750 N N     . TRP B 42  ? 0.9868 0.3115 0.8183 0.0395  0.1670  -0.1260 42  TRP B N     
2751 C CA    . TRP B 42  ? 1.0392 0.2943 0.7845 0.0278  0.1493  -0.0826 42  TRP B CA    
2752 C C     . TRP B 42  ? 1.1083 0.3027 0.8467 0.0180  0.1325  -0.0750 42  TRP B C     
2753 O O     . TRP B 42  ? 1.1655 0.3031 0.8868 0.0213  0.0940  -0.0459 42  TRP B O     
2754 C CB    . TRP B 42  ? 1.0102 0.2894 0.6654 0.0076  0.1943  -0.0638 42  TRP B CB    
2755 C CG    . TRP B 42  ? 1.0617 0.2832 0.6197 -0.0027 0.1801  -0.0233 42  TRP B CG    
2756 C CD1   . TRP B 42  ? 1.0715 0.2792 0.5801 0.0052  0.1557  0.0025  42  TRP B CD1   
2757 C CD2   . TRP B 42  ? 1.1120 0.2946 0.6160 -0.0218 0.1881  -0.0082 42  TRP B CD2   
2758 N NE1   . TRP B 42  ? 1.1210 0.2930 0.5506 -0.0055 0.1483  0.0283  42  TRP B NE1   
2759 C CE2   . TRP B 42  ? 1.1467 0.3022 0.5722 -0.0223 0.1680  0.0244  42  TRP B CE2   
2760 C CE3   . TRP B 42  ? 1.1308 0.3051 0.6512 -0.0384 0.2088  -0.0223 42  TRP B CE3   
2761 C CZ2   . TRP B 42  ? 1.1951 0.3224 0.5637 -0.0375 0.1684  0.0431  42  TRP B CZ2   
2762 C CZ3   . TRP B 42  ? 1.1846 0.3192 0.6425 -0.0562 0.2092  0.0017  42  TRP B CZ3   
2763 C CH2   . TRP B 42  ? 1.2142 0.3295 0.5990 -0.0549 0.1891  0.0344  42  TRP B CH2   
2774 N N     . ARG B 43  ? 1.3563 0.5690 1.1133 0.0051  0.1623  -0.1004 43  ARG B N     
2775 C CA    . ARG B 43  ? 1.4144 0.5686 1.1769 -0.0045 0.1449  -0.0962 43  ARG B CA    
2776 C C     . ARG B 43  ? 1.4514 0.5626 1.2912 0.0191  0.0885  -0.1024 43  ARG B C     
2777 O O     . ARG B 43  ? 1.5131 0.5628 1.3487 0.0154  0.0596  -0.0747 43  ARG B O     
2778 C CB    . ARG B 43  ? 1.4080 0.6004 1.1951 -0.0198 0.1841  -0.1313 43  ARG B CB    
2779 C CG    . ARG B 43  ? 1.4788 0.6101 1.2749 -0.0323 0.1675  -0.1295 43  ARG B CG    
2780 C CD    . ARG B 43  ? 1.4617 0.6402 1.2948 -0.0446 0.2025  -0.1715 43  ARG B CD    
2781 N NE    . ARG B 43  ? 1.4250 0.6632 1.3418 -0.0191 0.1974  -0.2175 43  ARG B NE    
2782 C CZ    . ARG B 43  ? 1.4844 0.6882 1.4596 0.0024  0.1589  -0.2399 43  ARG B CZ    
2783 N NH1   . ARG B 43  ? 1.5791 0.6866 1.5468 0.0005  0.1176  -0.2210 43  ARG B NH1   
2784 N NH2   . ARG B 43  ? 1.4530 0.7215 1.4905 0.0255  0.1631  -0.2782 43  ARG B NH2   
2798 N N     . LEU B 44  ? 1.2504 0.3979 1.1601 0.0431  0.0769  -0.1381 44  LEU B N     
2799 C CA    . LEU B 44  ? 1.2992 0.4026 1.2719 0.0681  0.0213  -0.1454 44  LEU B CA    
2800 C C     . LEU B 44  ? 1.3050 0.3924 1.2951 0.0696  0.0086  -0.1051 44  LEU B C     
2801 O O     . LEU B 44  ? 1.3348 0.4098 1.3695 0.0833  0.0183  -0.0978 44  LEU B O     
2802 C CB    . LEU B 44  ? 1.2912 0.4226 1.2726 0.0972  0.0271  -0.1811 44  LEU B CB    
2803 C CG    . LEU B 44  ? 1.2610 0.4506 1.2826 0.0895  0.0689  -0.2200 44  LEU B CG    
2804 C CD1   . LEU B 44  ? 1.2139 0.4885 1.3114 0.1109  0.0882  -0.2564 44  LEU B CD1   
2805 C CD2   . LEU B 44  ? 1.3505 0.4599 1.3601 0.0833  0.0498  -0.2206 44  LEU B CD2   
2817 N N     . TYR B 45  ? 1.4805 0.5644 1.3727 0.0538  0.0230  -0.0691 45  TYR B N     
2818 C CA    . TYR B 45  ? 1.5223 0.5835 1.3800 0.0598  0.0029  -0.0308 45  TYR B CA    
2819 C C     . TYR B 45  ? 1.6133 0.6172 1.4121 0.0468  -0.0076 0.0059  45  TYR B C     
2820 O O     . TYR B 45  ? 1.6322 0.6237 1.3444 0.0383  -0.0111 0.0384  45  TYR B O     
2821 C CB    . TYR B 45  ? 1.5969 0.6953 1.3909 0.0574  0.0143  -0.0207 45  TYR B CB    
2822 C CG    . TYR B 45  ? 1.5966 0.6982 1.4156 0.0761  -0.0129 -0.0100 45  TYR B CG    
2823 C CD1   . TYR B 45  ? 1.5619 0.6961 1.4669 0.0945  -0.0133 -0.0366 45  TYR B CD1   
2824 C CD2   . TYR B 45  ? 1.6400 0.7106 1.3928 0.0758  -0.0362 0.0255  45  TYR B CD2   
2825 C CE1   . TYR B 45  ? 1.5732 0.7049 1.4862 0.1106  -0.0350 -0.0241 45  TYR B CE1   
2826 C CE2   . TYR B 45  ? 1.6478 0.7196 1.4149 0.0921  -0.0629 0.0334  45  TYR B CE2   
2827 C CZ    . TYR B 45  ? 1.6148 0.7161 1.4610 0.1087  -0.0632 0.0099  45  TYR B CZ    
2828 O OH    . TYR B 45  ? 1.6301 0.7302 1.4809 0.1238  -0.0928 0.0192  45  TYR B OH    
2831 N N     . ASN B 46  ? 1.5295 0.9302 1.4081 0.2096  -0.1336 0.3979  46  ASN B N     
2832 C CA    . ASN B 46  ? 1.6265 1.0105 1.4610 0.2170  -0.1427 0.4348  46  ASN B CA    
2833 C C     . ASN B 46  ? 1.6609 1.0316 1.4611 0.2468  -0.1406 0.4292  46  ASN B C     
2834 O O     . ASN B 46  ? 1.7241 1.0716 1.5097 0.2412  -0.1507 0.4610  46  ASN B O     
2835 C CB    . ASN B 46  ? 1.6627 1.0539 1.5350 0.1725  -0.1500 0.4733  46  ASN B CB    
2836 C CG    . ASN B 46  ? 1.7221 1.1241 1.5806 0.1692  -0.1513 0.5143  46  ASN B CG    
2837 O OD1   . ASN B 46  ? 1.7085 1.1373 1.5761 0.1771  -0.1424 0.5168  46  ASN B OD1   
2838 N ND2   . ASN B 46  ? 1.7844 1.1716 1.6305 0.1536  -0.1615 0.5475  46  ASN B ND2   
2845 N N     . ASP B 47  ? 1.6821 1.0880 1.5026 0.2721  -0.1244 0.3954  47  ASP B N     
2846 C CA    . ASP B 47  ? 1.6791 1.1014 1.5275 0.2847  -0.1282 0.4099  47  ASP B CA    
2847 C C     . ASP B 47  ? 1.6844 1.1703 1.5368 0.3153  -0.1214 0.4290  47  ASP B C     
2848 O O     . ASP B 47  ? 1.5892 1.1613 1.5387 0.3095  -0.1180 0.4240  47  ASP B O     
2849 C CB    . ASP B 47  ? 1.5989 1.0202 1.5048 0.2740  -0.1345 0.3745  47  ASP B CB    
2850 C CG    . ASP B 47  ? 1.5844 0.9556 1.4878 0.2338  -0.1466 0.3563  47  ASP B CG    
2851 O OD1   . ASP B 47  ? 1.6336 0.9739 1.5158 0.2111  -0.1585 0.3828  47  ASP B OD1   
2852 O OD2   . ASP B 47  ? 1.5251 0.8980 1.4536 0.2179  -0.1490 0.3136  47  ASP B OD2   
2857 N N     . GLU B 48  ? 2.1009 1.5599 1.8921 0.3266  -0.1368 0.4617  48  GLU B N     
2858 C CA    . GLU B 48  ? 2.1495 1.6678 1.9404 0.3495  -0.1409 0.4916  48  GLU B CA    
2859 C C     . GLU B 48  ? 2.2813 1.6809 1.8772 0.3593  -0.1922 0.4293  48  GLU B C     
2860 O O     . GLU B 48  ? 2.3838 1.7540 2.0018 0.2820  -0.3224 0.4350  48  GLU B O     
2861 C CB    . GLU B 48  ? 2.0903 1.6734 2.0028 0.3323  -0.1726 0.4900  48  GLU B CB    
2862 C CG    . GLU B 48  ? 2.1134 1.6146 2.0118 0.3393  -0.1873 0.4622  48  GLU B CG    
2863 C CD    . GLU B 48  ? 2.0490 1.5482 1.9820 0.3496  -0.2073 0.4196  48  GLU B CD    
2864 O OE1   . GLU B 48  ? 1.9624 1.5011 1.9216 0.3490  -0.2067 0.3922  48  GLU B OE1   
2865 O OE2   . GLU B 48  ? 2.0906 1.5396 2.0131 0.3581  -0.2239 0.4009  48  GLU B OE2   
2866 N N     . THR B 49  ? 1.6975 1.0673 1.3304 0.3002  -0.2348 0.4176  49  THR B N     
2867 C CA    . THR B 49  ? 1.6448 1.0677 1.3283 0.2707  -0.2513 0.4538  49  THR B CA    
2868 C C     . THR B 49  ? 1.6710 1.0884 1.3652 0.2615  -0.2097 0.4787  49  THR B C     
2869 O O     . THR B 49  ? 1.6864 1.0781 1.3899 0.2576  -0.1892 0.4782  49  THR B O     
2870 C CB    . THR B 49  ? 1.5017 1.0115 1.2905 0.2899  -0.2411 0.4558  49  THR B CB    
2871 O OG1   . THR B 49  ? 1.3928 0.8948 1.2406 0.2784  -0.2319 0.3960  49  THR B OG1   
2872 C CG2   . THR B 49  ? 1.4715 1.0332 1.2891 0.3048  -0.2614 0.4623  49  THR B CG2   
2880 N N     . ASN B 50  ? 1.8062 1.2977 1.5543 0.2592  -0.1779 0.5356  50  ASN B N     
2881 C CA    . ASN B 50  ? 1.7955 1.3250 1.6234 0.2384  -0.1326 0.5517  50  ASN B CA    
2882 C C     . ASN B 50  ? 1.7160 1.2642 1.6226 0.2454  -0.1163 0.5041  50  ASN B C     
2883 O O     . ASN B 50  ? 1.6831 1.2468 1.6034 0.2735  -0.1224 0.4702  50  ASN B O     
2884 C CB    . ASN B 50  ? 1.8269 1.4551 1.7100 0.2405  -0.0772 0.6225  50  ASN B CB    
2885 C CG    . ASN B 50  ? 1.8213 1.5319 1.7190 0.2882  -0.0367 0.6356  50  ASN B CG    
2886 O OD1   . ASN B 50  ? 1.7652 1.4762 1.6863 0.3195  -0.0388 0.5852  50  ASN B OD1   
2887 N ND2   . ASN B 50  ? 1.8867 1.6694 1.7495 0.2961  0.0066  0.6992  50  ASN B ND2   
2894 N N     . SER B 51  ? 1.9742 1.5273 1.9359 0.2176  -0.0964 0.5003  51  SER B N     
2895 C CA    . SER B 51  ? 1.8872 1.4469 1.9026 0.2135  -0.0894 0.4538  51  SER B CA    
2896 C C     . SER B 51  ? 1.7730 1.4261 1.9309 0.2237  -0.0357 0.4635  51  SER B C     
2897 O O     . SER B 51  ? 1.7007 1.3669 1.9121 0.2133  -0.0295 0.4264  51  SER B O     
2898 C CB    . SER B 51  ? 1.9041 1.4638 1.9639 0.1754  -0.0883 0.4728  51  SER B CB    
2899 O OG    . SER B 51  ? 1.9870 1.4878 1.9686 0.1734  -0.1150 0.4780  51  SER B OG    
2905 N N     . ASN B 52  ? 2.1491 1.8699 2.3679 0.2477  0.0155  0.5146  52  ASN B N     
2906 C CA    . ASN B 52  ? 2.0795 1.8824 2.4493 0.2646  0.0910  0.5243  52  ASN B CA    
2907 C C     . ASN B 52  ? 2.0991 1.9589 2.4896 0.3280  0.1599  0.5467  52  ASN B C     
2908 O O     . ASN B 52  ? 2.0348 1.9526 2.5344 0.3555  0.2208  0.5030  52  ASN B O     
2909 C CB    . ASN B 52  ? 2.0681 1.9082 2.5435 0.2249  0.1222  0.5723  52  ASN B CB    
2910 C CG    . ASN B 52  ? 1.9794 1.8871 2.6347 0.2236  0.1851  0.5616  52  ASN B CG    
2911 O OD1   . ASN B 52  ? 1.9154 1.8248 2.5949 0.2234  0.1747  0.5048  52  ASN B OD1   
2912 N ND2   . ASN B 52  ? 1.9795 1.9410 2.7630 0.2179  0.2528  0.6128  52  ASN B ND2   
2919 N N     . GLN B 53  ? 1.6212 1.4812 1.8969 0.3456  0.1539  0.5901  53  GLN B N     
2920 C CA    . GLN B 53  ? 1.6437 1.6131 1.8900 0.3413  0.2199  0.5364  53  GLN B CA    
2921 C C     . GLN B 53  ? 1.6244 1.6260 1.7985 0.3784  0.2141  0.4515  53  GLN B C     
2922 O O     . GLN B 53  ? 1.5643 1.6438 1.8037 0.3866  0.2757  0.3709  53  GLN B O     
2923 C CB    . GLN B 53  ? 1.7675 1.7471 1.9083 0.3116  0.2138  0.6000  53  GLN B CB    
2924 C CG    . GLN B 53  ? 1.8278 1.9226 1.9348 0.2899  0.2886  0.5502  53  GLN B CG    
2925 C CD    . GLN B 53  ? 1.9328 2.0430 1.9615 0.2472  0.2944  0.6186  53  GLN B CD    
2926 O OE1   . GLN B 53  ? 1.9521 1.9852 1.9488 0.2389  0.2382  0.7058  53  GLN B OE1   
2927 N NE2   . GLN B 53  ? 2.0092 2.2195 2.0040 0.2153  0.3649  0.5774  53  GLN B NE2   
2936 N N     . ASP B 54  ? 1.5358 1.4789 1.5844 0.4003  0.1416  0.4693  54  ASP B N     
2937 C CA    . ASP B 54  ? 1.5647 1.5474 1.5325 0.4300  0.1338  0.4001  54  ASP B CA    
2938 C C     . ASP B 54  ? 1.4520 1.4121 1.4812 0.4690  0.1264  0.3279  54  ASP B C     
2939 O O     . ASP B 54  ? 1.3772 1.4132 1.4679 0.4774  0.1850  0.2493  54  ASP B O     
2940 C CB    . ASP B 54  ? 1.6925 1.6228 1.5228 0.4380  0.0572  0.4519  54  ASP B CB    
2941 C CG    . ASP B 54  ? 1.8236 1.8175 1.5635 0.4011  0.0732  0.4915  54  ASP B CG    
2942 O OD1   . ASP B 54  ? 1.8332 1.9304 1.5811 0.3780  0.1460  0.4425  54  ASP B OD1   
2943 O OD2   . ASP B 54  ? 1.9139 1.8546 1.5755 0.3912  0.0149  0.5702  54  ASP B OD2   
2948 N N     . ASN B 55  ? 1.1099 0.9658 1.1222 0.4903  0.0571  0.3506  55  ASN B N     
2949 C CA    . ASN B 55  ? 1.0287 0.8624 1.0836 0.5019  0.0418  0.2703  55  ASN B CA    
2950 C C     . ASN B 55  ? 0.9579 0.7450 1.0979 0.4345  0.0183  0.2587  55  ASN B C     
2951 O O     . ASN B 55  ? 0.9596 0.6740 1.0710 0.3889  -0.0506 0.2563  55  ASN B O     
2952 C CB    . ASN B 55  ? 1.0583 0.8449 1.0293 0.4980  -0.0249 0.2448  55  ASN B CB    
2953 C CG    . ASN B 55  ? 1.1064 0.9534 0.9941 0.5661  -0.0113 0.2167  55  ASN B CG    
2954 O OD1   . ASN B 55  ? 1.0698 1.0058 0.9903 0.5802  0.0481  0.1529  55  ASN B OD1   
2955 N ND2   . ASN B 55  ? 1.1818 0.9988 0.9788 0.5661  -0.0671 0.2452  55  ASN B ND2   
2962 N N     . PRO B 56  ? 0.8984 0.7332 1.1414 0.4247  0.0711  0.2451  56  PRO B N     
2963 C CA    . PRO B 56  ? 0.8461 0.6448 1.1340 0.3672  0.0421  0.2359  56  PRO B CA    
2964 C C     . PRO B 56  ? 0.7883 0.5682 1.0529 0.3537  -0.0016 0.1526  56  PRO B C     
2965 O O     . PRO B 56  ? 0.7662 0.5729 1.0273 0.3738  -0.0068 0.0958  56  PRO B O     
2966 C CB    . PRO B 56  ? 0.8058 0.6773 1.2233 0.3597  0.1177  0.2529  56  PRO B CB    
2967 C CG    . PRO B 56  ? 0.8044 0.7580 1.2435 0.4071  0.1813  0.2053  56  PRO B CG    
2968 C CD    . PRO B 56  ? 0.8807 0.8172 1.2029 0.4591  0.1638  0.2288  56  PRO B CD    
2976 N N     . LEU B 57  ? 0.9916 0.7340 1.2390 0.3147  -0.0256 0.1514  57  LEU B N     
2977 C CA    . LEU B 57  ? 0.9583 0.6892 1.1852 0.3086  -0.0368 0.1089  57  LEU B CA    
2978 C C     . LEU B 57  ? 0.8785 0.6822 1.1764 0.3082  0.0042  0.0698  57  LEU B C     
2979 O O     . LEU B 57  ? 0.8496 0.6515 1.1233 0.3049  -0.0006 0.0365  57  LEU B O     
2980 C CB    . LEU B 57  ? 0.9769 0.6661 1.1977 0.2642  -0.0441 0.1473  57  LEU B CB    
2981 C CG    . LEU B 57  ? 0.9625 0.6366 1.1596 0.2506  -0.0493 0.1177  57  LEU B CG    
2982 C CD1   . LEU B 57  ? 1.0025 0.6472 1.0942 0.2834  -0.0488 0.0898  57  LEU B CD1   
2983 C CD2   . LEU B 57  ? 0.9633 0.6193 1.1897 0.1983  -0.0625 0.1532  57  LEU B CD2   
2995 N N     . GLY B 58  ? 0.6524 0.5179 1.0306 0.3083  0.0488  0.0762  58  GLY B N     
2996 C CA    . GLY B 58  ? 0.6122 0.5400 1.0542 0.2992  0.0881  0.0399  58  GLY B CA    
2997 C C     . GLY B 58  ? 0.6025 0.5838 1.1432 0.2870  0.1411  0.0597  58  GLY B C     
2998 O O     . GLY B 58  ? 0.6332 0.6201 1.1993 0.3005  0.1634  0.0978  58  GLY B O     
3002 N N     . PHE B 59  ? 0.6128 0.4607 0.5769 0.0455  0.1129  -0.0645 59  PHE B N     
3003 C CA    . PHE B 59  ? 0.6000 0.4523 0.5720 0.0422  0.1095  -0.0543 59  PHE B CA    
3004 C C     . PHE B 59  ? 0.5959 0.4306 0.5483 0.0352  0.1025  -0.0597 59  PHE B C     
3005 O O     . PHE B 59  ? 0.5965 0.4204 0.5250 0.0348  0.1043  -0.0691 59  PHE B O     
3006 C CB    . PHE B 59  ? 0.5903 0.4647 0.5594 0.0473  0.1153  -0.0521 59  PHE B CB    
3007 C CG    . PHE B 59  ? 0.5934 0.4667 0.5483 0.0389  0.1165  -0.0625 59  PHE B CG    
3008 C CD1   . PHE B 59  ? 0.6050 0.4654 0.5470 0.0324  0.1120  -0.0630 59  PHE B CD1   
3009 C CD2   . PHE B 59  ? 0.6044 0.4911 0.5656 0.0377  0.1229  -0.0682 59  PHE B CD2   
3010 C CE1   . PHE B 59  ? 0.6335 0.4903 0.5741 0.0228  0.1138  -0.0668 59  PHE B CE1   
3011 C CE2   . PHE B 59  ? 0.6343 0.5243 0.5994 0.0273  0.1253  -0.0705 59  PHE B CE2   
3012 C CZ    . PHE B 59  ? 0.6514 0.5244 0.6088 0.0187  0.1208  -0.0687 59  PHE B CZ    
3022 N N     . LYS B 60  ? 0.6009 0.4366 0.5625 0.0344  0.0965  -0.0504 60  LYS B N     
3023 C CA    . LYS B 60  ? 0.6125 0.4337 0.5561 0.0310  0.0885  -0.0542 60  LYS B CA    
3024 C C     . LYS B 60  ? 0.6065 0.4351 0.5370 0.0331  0.0925  -0.0483 60  LYS B C     
3025 O O     . LYS B 60  ? 0.6026 0.4491 0.5465 0.0418  0.0944  -0.0368 60  LYS B O     
3026 C CB    . LYS B 60  ? 0.6345 0.4510 0.6064 0.0298  0.0731  -0.0496 60  LYS B CB    
3027 C CG    . LYS B 60  ? 0.6590 0.4616 0.6116 0.0301  0.0605  -0.0572 60  LYS B CG    
3028 C CD    . LYS B 60  ? 0.6900 0.4906 0.6850 0.0272  0.0390  -0.0555 60  LYS B CD    
3029 C CE    . LYS B 60  ? 0.7226 0.5110 0.6963 0.0316  0.0219  -0.0678 60  LYS B CE    
3030 N NZ    . LYS B 60  ? 0.7557 0.5429 0.7822 0.0273  -0.0065 -0.0701 60  LYS B NZ    
3044 N N     . GLU B 61  ? 0.6567 0.4703 0.5593 0.0296  0.0939  -0.0546 61  GLU B N     
3045 C CA    . GLU B 61  ? 0.6645 0.4746 0.5536 0.0320  0.0929  -0.0525 61  GLU B CA    
3046 C C     . GLU B 61  ? 0.6888 0.4795 0.5533 0.0323  0.0893  -0.0521 61  GLU B C     
3047 O O     . GLU B 61  ? 0.7028 0.4825 0.5538 0.0314  0.0901  -0.0556 61  GLU B O     
3048 C CB    . GLU B 61  ? 0.6682 0.4763 0.5584 0.0264  0.0970  -0.0581 61  GLU B CB    
3049 C CG    . GLU B 61  ? 0.6860 0.4853 0.5724 0.0164  0.1072  -0.0573 61  GLU B CG    
3050 C CD    . GLU B 61  ? 0.7039 0.5056 0.6107 0.0069  0.1094  -0.0575 61  GLU B CD    
3051 O OE1   . GLU B 61  ? 0.6964 0.5013 0.6148 0.0097  0.0969  -0.0655 61  GLU B OE1   
3052 O OE2   . GLU B 61  ? 0.7360 0.5383 0.6502 -0.0006 0.1224  -0.0488 61  GLU B OE2   
3059 N N     . SER B 62  ? 0.7192 0.5057 0.5720 0.0395  0.0843  -0.0486 62  SER B N     
3060 C CA    . SER B 62  ? 0.7451 0.5157 0.5735 0.0440  0.0801  -0.0467 62  SER B CA    
3061 C C     . SER B 62  ? 0.7550 0.5063 0.5632 0.0491  0.0776  -0.0470 62  SER B C     
3062 O O     . SER B 62  ? 0.7421 0.4993 0.5544 0.0577  0.0720  -0.0497 62  SER B O     
3063 C CB    . SER B 62  ? 0.7565 0.5454 0.5982 0.0525  0.0717  -0.0398 62  SER B CB    
3064 O OG    . SER B 62  ? 0.7915 0.5694 0.6085 0.0608  0.0661  -0.0385 62  SER B OG    
3070 N N     . TRP B 63  ? 0.6099 0.3360 0.3942 0.0480  0.0802  -0.0448 63  TRP B N     
3071 C CA    . TRP B 63  ? 0.6323 0.3307 0.3979 0.0534  0.0750  -0.0441 63  TRP B CA    
3072 C C     . TRP B 63  ? 0.6575 0.3470 0.3923 0.0671  0.0724  -0.0391 63  TRP B C     
3073 O O     . TRP B 63  ? 0.6774 0.3649 0.3989 0.0676  0.0784  -0.0356 63  TRP B O     
3074 C CB    . TRP B 63  ? 0.6605 0.3337 0.4351 0.0387  0.0830  -0.0393 63  TRP B CB    
3075 C CG    . TRP B 63  ? 0.6467 0.3150 0.4506 0.0303  0.0730  -0.0481 63  TRP B CG    
3076 C CD1   . TRP B 63  ? 0.6368 0.3184 0.4767 0.0147  0.0783  -0.0484 63  TRP B CD1   
3077 C CD2   . TRP B 63  ? 0.6489 0.2982 0.4475 0.0419  0.0515  -0.0610 63  TRP B CD2   
3078 N NE1   . TRP B 63  ? 0.6339 0.3067 0.4965 0.0133  0.0590  -0.0622 63  TRP B NE1   
3079 C CE2   . TRP B 63  ? 0.6447 0.2949 0.4793 0.0318  0.0407  -0.0720 63  TRP B CE2   
3080 C CE3   . TRP B 63  ? 0.6651 0.2974 0.4296 0.0644  0.0382  -0.0660 63  TRP B CE3   
3081 C CZ2   . TRP B 63  ? 0.6614 0.2918 0.4968 0.0450  0.0125  -0.0922 63  TRP B CZ2   
3082 C CZ3   . TRP B 63  ? 0.6771 0.2897 0.4373 0.0799  0.0137  -0.0837 63  TRP B CZ3   
3083 C CH2   . TRP B 63  ? 0.6778 0.2875 0.4723 0.0709  -0.0012 -0.0987 63  TRP B CH2   
3094 N N     . GLY B 64  ? 0.6498 0.3357 0.3692 0.0836  0.0623  -0.0401 64  GLY B N     
3095 C CA    . GLY B 64  ? 0.6814 0.3623 0.3720 0.0996  0.0589  -0.0350 64  GLY B CA    
3096 C C     . GLY B 64  ? 0.7209 0.3645 0.3812 0.1129  0.0520  -0.0361 64  GLY B C     
3097 O O     . GLY B 64  ? 0.7202 0.3566 0.3792 0.1234  0.0411  -0.0439 64  GLY B O     
3101 N N     . PHE B 65  ? 0.7545 0.3712 0.3873 0.1171  0.0562  -0.0294 65  PHE B N     
3102 C CA    . PHE B 65  ? 0.7948 0.3703 0.3964 0.1323  0.0487  -0.0286 65  PHE B CA    
3103 C C     . PHE B 65  ? 0.8151 0.4037 0.3840 0.1557  0.0471  -0.0235 65  PHE B C     
3104 O O     . PHE B 65  ? 0.8427 0.4239 0.3929 0.1580  0.0553  -0.0159 65  PHE B O     
3105 C CB    . PHE B 65  ? 0.8332 0.3631 0.4374 0.1175  0.0579  -0.0187 65  PHE B CB    
3106 C CG    . PHE B 65  ? 0.8120 0.3436 0.4612 0.0908  0.0635  -0.0187 65  PHE B CG    
3107 C CD1   . PHE B 65  ? 0.7932 0.3158 0.4682 0.0847  0.0463  -0.0335 65  PHE B CD1   
3108 C CD2   . PHE B 65  ? 0.8188 0.3636 0.4817 0.0772  0.0845  -0.0047 65  PHE B CD2   
3109 C CE1   . PHE B 65  ? 0.7763 0.3055 0.4977 0.0607  0.0495  -0.0339 65  PHE B CE1   
3110 C CE2   . PHE B 65  ? 0.7992 0.3519 0.5059 0.0550  0.0914  -0.0019 65  PHE B CE2   
3111 C CZ    . PHE B 65  ? 0.7755 0.3214 0.5152 0.0443  0.0737  -0.0162 65  PHE B CZ    
3121 N N     . GLY B 66  ? 0.8741 0.4868 0.4357 0.1777  0.0369  -0.0261 66  GLY B N     
3122 C CA    . GLY B 66  ? 0.8871 0.5285 0.4334 0.1981  0.0349  -0.0192 66  GLY B CA    
3123 C C     . GLY B 66  ? 0.8699 0.5570 0.4529 0.1841  0.0371  -0.0170 66  GLY B C     
3124 O O     . GLY B 66  ? 0.8268 0.5406 0.4499 0.1688  0.0389  -0.0177 66  GLY B O     
3128 N N     . LYS B 67  ? 0.8522 0.5454 0.4212 0.1920  0.0338  -0.0161 67  LYS B N     
3129 C CA    . LYS B 67  ? 0.8524 0.5796 0.4547 0.1821  0.0268  -0.0206 67  LYS B CA    
3130 C C     . LYS B 67  ? 0.8559 0.5587 0.4490 0.1682  0.0333  -0.0284 67  LYS B C     
3131 O O     . LYS B 67  ? 0.8614 0.5786 0.4618 0.1700  0.0229  -0.0378 67  LYS B O     
3132 C CB    . LYS B 67  ? 0.8951 0.6444 0.4885 0.2029  0.0132  -0.0206 67  LYS B CB    
3133 C CG    . LYS B 67  ? 0.9456 0.6564 0.4769 0.2219  0.0163  -0.0228 67  LYS B CG    
3134 C CD    . LYS B 67  ? 0.9847 0.7219 0.5061 0.2469  0.0001  -0.0245 67  LYS B CD    
3135 C CE    . LYS B 67  ? 1.0068 0.7306 0.4887 0.2718  0.0048  -0.0135 67  LYS B CE    
3136 N NZ    . LYS B 67  ? 1.0256 0.7682 0.4851 0.3003  -0.0086 -0.0152 67  LYS B NZ    
3150 N N     . VAL B 68  ? 0.8498 0.5178 0.4298 0.1576  0.0482  -0.0247 68  VAL B N     
3151 C CA    . VAL B 68  ? 0.8568 0.5075 0.4299 0.1483  0.0606  -0.0244 68  VAL B CA    
3152 C C     . VAL B 68  ? 0.8064 0.4690 0.4212 0.1245  0.0646  -0.0278 68  VAL B C     
3153 O O     . VAL B 68  ? 0.8038 0.4511 0.4298 0.1136  0.0702  -0.0242 68  VAL B O     
3154 C CB    . VAL B 68  ? 0.9084 0.5153 0.4475 0.1539  0.0773  -0.0096 68  VAL B CB    
3155 C CG1   . VAL B 68  ? 0.9268 0.5268 0.4606 0.1511  0.0956  -0.0008 68  VAL B CG1   
3156 C CG2   . VAL B 68  ? 0.9452 0.5385 0.4394 0.1813  0.0735  -0.0049 68  VAL B CG2   
3166 N N     . VAL B 69  ? 0.7937 0.4812 0.4321 0.1186  0.0583  -0.0370 69  VAL B N     
3167 C CA    . VAL B 69  ? 0.7359 0.4400 0.4155 0.0996  0.0600  -0.0404 69  VAL B CA    
3168 C C     . VAL B 69  ? 0.7327 0.4303 0.4079 0.0951  0.0696  -0.0437 69  VAL B C     
3169 O O     . VAL B 69  ? 0.7464 0.4441 0.4009 0.1096  0.0633  -0.0517 69  VAL B O     
3170 C CB    . VAL B 69  ? 0.7095 0.4490 0.4306 0.0974  0.0441  -0.0443 69  VAL B CB    
3171 C CG1   . VAL B 69  ? 0.6668 0.4212 0.4278 0.0812  0.0484  -0.0443 69  VAL B CG1   
3172 C CG2   . VAL B 69  ? 0.7123 0.4674 0.4371 0.1086  0.0393  -0.0346 69  VAL B CG2   
3182 N N     . PHE B 70  ? 0.7175 0.4119 0.4110 0.0797  0.0827  -0.0389 70  PHE B N     
3183 C CA    . PHE B 70  ? 0.7164 0.4140 0.4137 0.0761  0.0942  -0.0390 70  PHE B CA    
3184 C C     . PHE B 70  ? 0.6652 0.3841 0.4016 0.0629  0.0881  -0.0479 70  PHE B C     
3185 O O     . PHE B 70  ? 0.6274 0.3552 0.3890 0.0535  0.0846  -0.0469 70  PHE B O     
3186 C CB    . PHE B 70  ? 0.7505 0.4330 0.4491 0.0683  0.1157  -0.0217 70  PHE B CB    
3187 C CG    . PHE B 70  ? 0.8106 0.4687 0.4762 0.0814  0.1263  -0.0054 70  PHE B CG    
3188 C CD1   . PHE B 70  ? 0.8366 0.4730 0.4977 0.0797  0.1196  -0.0020 70  PHE B CD1   
3189 C CD2   . PHE B 70  ? 0.8350 0.4914 0.4705 0.1007  0.1442  0.0083  70  PHE B CD2   
3190 C CE1   . PHE B 70  ? 0.8989 0.5086 0.5304 0.0927  0.1300  0.0152  70  PHE B CE1   
3191 C CE2   . PHE B 70  ? 0.8843 0.5191 0.4893 0.1165  0.1578  0.0288  70  PHE B CE2   
3192 C CZ    . PHE B 70  ? 0.9167 0.5262 0.5220 0.1102  0.1507  0.0326  70  PHE B CZ    
3202 N N     . LYS B 71  ? 0.7891 0.5148 0.5258 0.0676  0.0866  -0.0565 71  LYS B N     
3203 C CA    . LYS B 71  ? 0.7538 0.4955 0.5264 0.0577  0.0803  -0.0640 71  LYS B CA    
3204 C C     . LYS B 71  ? 0.7505 0.4945 0.5185 0.0600  0.0936  -0.0648 71  LYS B C     
3205 O O     . LYS B 71  ? 0.7839 0.5207 0.5181 0.0762  0.1036  -0.0618 71  LYS B O     
3206 C CB    . LYS B 71  ? 0.7612 0.5077 0.5507 0.0626  0.0560  -0.0767 71  LYS B CB    
3207 C CG    . LYS B 71  ? 0.7614 0.5209 0.5766 0.0581  0.0458  -0.0692 71  LYS B CG    
3208 C CD    . LYS B 71  ? 0.7931 0.5578 0.6332 0.0624  0.0191  -0.0791 71  LYS B CD    
3209 C CE    . LYS B 71  ? 0.8070 0.5953 0.6825 0.0593  0.0132  -0.0641 71  LYS B CE    
3210 N NZ    . LYS B 71  ? 0.7824 0.5936 0.6995 0.0499  0.0256  -0.0455 71  LYS B NZ    
3224 N N     . ARG B 72  ? 0.7076 0.4653 0.5079 0.0487  0.0954  -0.0662 72  ARG B N     
3225 C CA    . ARG B 72  ? 0.7058 0.4716 0.5068 0.0515  0.1081  -0.0662 72  ARG B CA    
3226 C C     . ARG B 72  ? 0.6705 0.4467 0.5028 0.0460  0.0996  -0.0742 72  ARG B C     
3227 O O     . ARG B 72  ? 0.6391 0.4244 0.4998 0.0356  0.0952  -0.0703 72  ARG B O     
3228 C CB    . ARG B 72  ? 0.7144 0.4890 0.5278 0.0405  0.1286  -0.0505 72  ARG B CB    
3229 C CG    . ARG B 72  ? 0.7653 0.5310 0.5551 0.0480  0.1449  -0.0342 72  ARG B CG    
3230 C CD    . ARG B 72  ? 0.7930 0.5640 0.5504 0.0734  0.1568  -0.0311 72  ARG B CD    
3231 N NE    . ARG B 72  ? 0.8423 0.6120 0.5815 0.0847  0.1805  -0.0055 72  ARG B NE    
3232 C CZ    . ARG B 72  ? 0.8733 0.6243 0.5789 0.0976  0.1797  -0.0002 72  ARG B CZ    
3233 N NH1   . ARG B 72  ? 0.8616 0.5967 0.5508 0.0995  0.1541  -0.0211 72  ARG B NH1   
3234 N NH2   . ARG B 72  ? 0.9157 0.6670 0.6087 0.1100  0.2059  0.0299  72  ARG B NH2   
3248 N N     . TYR B 73  ? 0.6921 0.4666 0.5152 0.0584  0.0983  -0.0834 73  TYR B N     
3249 C CA    . TYR B 73  ? 0.6711 0.4531 0.5216 0.0555  0.0947  -0.0882 73  TYR B CA    
3250 C C     . TYR B 73  ? 0.6753 0.4734 0.5186 0.0614  0.1147  -0.0835 73  TYR B C     
3251 O O     . TYR B 73  ? 0.7054 0.5009 0.5160 0.0812  0.1214  -0.0857 73  TYR B O     
3252 C CB    . TYR B 73  ? 0.6878 0.4494 0.5405 0.0666  0.0699  -0.1055 73  TYR B CB    
3253 C CG    . TYR B 73  ? 0.6738 0.4376 0.5620 0.0622  0.0657  -0.1061 73  TYR B CG    
3254 C CD1   . TYR B 73  ? 0.6805 0.4471 0.5559 0.0745  0.0745  -0.1113 73  TYR B CD1   
3255 C CD2   . TYR B 73  ? 0.6593 0.4254 0.5950 0.0491  0.0558  -0.0968 73  TYR B CD2   
3256 C CE1   . TYR B 73  ? 0.6721 0.4382 0.5772 0.0731  0.0713  -0.1106 73  TYR B CE1   
3257 C CE2   . TYR B 73  ? 0.6522 0.4196 0.6219 0.0477  0.0554  -0.0914 73  TYR B CE2   
3258 C CZ    . TYR B 73  ? 0.6582 0.4229 0.6105 0.0594  0.0621  -0.1000 73  TYR B CZ    
3259 O OH    . TYR B 73  ? 0.6577 0.4211 0.6412 0.0605  0.0621  -0.0937 73  TYR B OH    
3269 N N     . LEU B 74  ? 0.6276 0.4461 0.5005 0.0490  0.1240  -0.0762 74  LEU B N     
3270 C CA    . LEU B 74  ? 0.6329 0.4745 0.5124 0.0520  0.1412  -0.0703 74  LEU B CA    
3271 C C     . LEU B 74  ? 0.6078 0.4583 0.5050 0.0561  0.1376  -0.0768 74  LEU B C     
3272 O O     . LEU B 74  ? 0.5820 0.4295 0.4991 0.0502  0.1277  -0.0778 74  LEU B O     
3273 C CB    . LEU B 74  ? 0.6455 0.5049 0.5506 0.0352  0.1512  -0.0582 74  LEU B CB    
3274 C CG    . LEU B 74  ? 0.6843 0.5315 0.5787 0.0295  0.1564  -0.0473 74  LEU B CG    
3275 C CD1   . LEU B 74  ? 0.7088 0.5689 0.6415 0.0116  0.1607  -0.0373 74  LEU B CD1   
3276 C CD2   . LEU B 74  ? 0.7228 0.5686 0.5847 0.0486  0.1715  -0.0379 74  LEU B CD2   
3288 N N     . ARG B 75  ? 0.6316 0.4955 0.5206 0.0703  0.1482  -0.0773 75  ARG B N     
3289 C CA    . ARG B 75  ? 0.6330 0.5036 0.5334 0.0787  0.1461  -0.0831 75  ARG B CA    
3290 C C     . ARG B 75  ? 0.6428 0.5491 0.5750 0.0695  0.1565  -0.0755 75  ARG B C     
3291 O O     . ARG B 75  ? 0.6608 0.5928 0.6052 0.0646  0.1695  -0.0663 75  ARG B O     
3292 C CB    . ARG B 75  ? 0.6503 0.5159 0.5195 0.1057  0.1492  -0.0906 75  ARG B CB    
3293 C CG    . ARG B 75  ? 0.6740 0.5030 0.5065 0.1213  0.1324  -0.1043 75  ARG B CG    
3294 C CD    . ARG B 75  ? 0.7101 0.5218 0.5073 0.1556  0.1235  -0.1208 75  ARG B CD    
3295 N NE    . ARG B 75  ? 0.7643 0.5361 0.5291 0.1727  0.0970  -0.1412 75  ARG B NE    
3296 C CZ    . ARG B 75  ? 0.8268 0.5751 0.5636 0.2014  0.0740  -0.1617 75  ARG B CZ    
3297 N NH1   . ARG B 75  ? 0.8471 0.6059 0.5801 0.2168  0.0777  -0.1622 75  ARG B NH1   
3298 N NH2   . ARG B 75  ? 0.8659 0.5872 0.5866 0.2104  0.0433  -0.1787 75  ARG B NH2   
3312 N N     . TYR B 76  ? 0.6886 0.5981 0.6386 0.0693  0.1497  -0.0776 76  TYR B N     
3313 C CA    . TYR B 76  ? 0.6985 0.6397 0.6744 0.0664  0.1521  -0.0758 76  TYR B CA    
3314 C C     . TYR B 76  ? 0.7141 0.6657 0.6933 0.0836  0.1542  -0.0778 76  TYR B C     
3315 O O     . TYR B 76  ? 0.6932 0.6282 0.6729 0.0905  0.1490  -0.0749 76  TYR B O     
3316 C CB    . TYR B 76  ? 0.6878 0.6249 0.6724 0.0590  0.1417  -0.0749 76  TYR B CB    
3317 C CG    . TYR B 76  ? 0.6897 0.6551 0.6927 0.0654  0.1365  -0.0794 76  TYR B CG    
3318 C CD1   . TYR B 76  ? 0.7081 0.7000 0.7346 0.0593  0.1357  -0.0846 76  TYR B CD1   
3319 C CD2   . TYR B 76  ? 0.6815 0.6498 0.6817 0.0812  0.1311  -0.0769 76  TYR B CD2   
3320 C CE1   . TYR B 76  ? 0.7209 0.7373 0.7660 0.0681  0.1229  -0.0950 76  TYR B CE1   
3321 C CE2   . TYR B 76  ? 0.6880 0.6820 0.6955 0.0965  0.1227  -0.0849 76  TYR B CE2   
3322 C CZ    . TYR B 76  ? 0.7081 0.7240 0.7372 0.0896  0.1151  -0.0978 76  TYR B CZ    
3323 O OH    . TYR B 76  ? 0.7368 0.7771 0.7750 0.1075  0.0990  -0.1118 76  TYR B OH    
3333 N N     . ASP B 77  ? 1.2645 1.2458 1.2510 0.0913  0.1634  -0.0787 77  ASP B N     
3334 C CA    . ASP B 77  ? 1.2734 1.2649 1.2578 0.1115  0.1669  -0.0807 77  ASP B CA    
3335 C C     . ASP B 77  ? 1.2699 1.2871 1.2732 0.1188  0.1627  -0.0815 77  ASP B C     
3336 O O     . ASP B 77  ? 1.2738 1.3088 1.2776 0.1375  0.1671  -0.0825 77  ASP B O     
3337 C CB    . ASP B 77  ? 1.2898 1.3084 1.2715 0.1226  0.1800  -0.0797 77  ASP B CB    
3338 C CG    . ASP B 77  ? 1.3001 1.2964 1.2510 0.1289  0.1853  -0.0788 77  ASP B CG    
3339 O OD1   . ASP B 77  ? 1.3078 1.2597 1.2348 0.1319  0.1735  -0.0861 77  ASP B OD1   
3340 O OD2   . ASP B 77  ? 1.3063 1.3323 1.2595 0.1337  0.2005  -0.0693 77  ASP B OD2   
3345 N N     . ARG B 78  ? 0.9210 0.9406 0.9339 0.1106  0.1532  -0.0823 78  ARG B N     
3346 C CA    . ARG B 78  ? 0.9327 0.9755 0.9528 0.1274  0.1458  -0.0858 78  ARG B CA    
3347 C C     . ARG B 78  ? 0.9357 1.0211 0.9791 0.1323  0.1406  -0.0972 78  ARG B C     
3348 O O     . ARG B 78  ? 0.9405 1.0493 0.9846 0.1556  0.1341  -0.1032 78  ARG B O     
3349 C CB    . ARG B 78  ? 0.9403 0.9737 0.9482 0.1512  0.1530  -0.0742 78  ARG B CB    
3350 C CG    . ARG B 78  ? 0.9399 0.9354 0.9432 0.1449  0.1557  -0.0590 78  ARG B CG    
3351 C CD    . ARG B 78  ? 0.9333 0.9251 0.9363 0.1364  0.1486  -0.0562 78  ARG B CD    
3352 N NE    . ARG B 78  ? 0.9388 0.9599 0.9378 0.1551  0.1411  -0.0630 78  ARG B NE    
3353 C CZ    . ARG B 78  ? 0.9431 0.9792 0.9355 0.1821  0.1417  -0.0502 78  ARG B CZ    
3354 N NH1   . ARG B 78  ? 0.9476 0.9732 0.9458 0.1891  0.1529  -0.0242 78  ARG B NH1   
3355 N NH2   . ARG B 78  ? 0.9524 1.0111 0.9351 0.1983  0.1257  -0.0616 78  ARG B NH2   
3369 N N     . THR B 79  ? 0.7520 0.8520 0.8185 0.1134  0.1436  -0.0979 79  THR B N     
3370 C CA    . THR B 79  ? 0.7606 0.9070 0.8671 0.1130  0.1380  -0.1046 79  THR B CA    
3371 C C     . THR B 79  ? 0.7907 0.9436 0.9379 0.0889  0.1205  -0.1109 79  THR B C     
3372 O O     . THR B 79  ? 0.7930 0.9155 0.9336 0.0706  0.1211  -0.1052 79  THR B O     
3373 C CB    . THR B 79  ? 0.7413 0.9094 0.8557 0.1139  0.1586  -0.0927 79  THR B CB    
3374 O OG1   . THR B 79  ? 0.7348 0.8848 0.8458 0.0959  0.1709  -0.0796 79  THR B OG1   
3375 C CG2   . THR B 79  ? 0.7179 0.8715 0.7916 0.1404  0.1705  -0.0906 79  THR B CG2   
3383 N N     . GLU B 80  ? 0.7801 0.9714 0.9733 0.0901  0.1017  -0.1238 80  GLU B N     
3384 C CA    . GLU B 80  ? 0.8166 1.0122 1.0640 0.0654  0.0789  -0.1313 80  GLU B CA    
3385 C C     . GLU B 80  ? 0.8055 0.9995 1.0839 0.0357  0.0999  -0.1055 80  GLU B C     
3386 O O     . GLU B 80  ? 0.8229 0.9907 1.1176 0.0142  0.0913  -0.1028 80  GLU B O     
3387 C CB    . GLU B 80  ? 0.8513 1.0934 1.1565 0.0710  0.0521  -0.1497 80  GLU B CB    
3388 C CG    . GLU B 80  ? 0.8816 1.1332 1.2693 0.0396  0.0265  -0.1540 80  GLU B CG    
3389 C CD    . GLU B 80  ? 0.8674 1.1583 1.3240 0.0135  0.0510  -0.1224 80  GLU B CD    
3390 O OE1   . GLU B 80  ? 0.8489 1.1597 1.2785 0.0251  0.0868  -0.1010 80  GLU B OE1   
3391 O OE2   . GLU B 80  ? 0.8707 1.1725 1.4108 -0.0159 0.0343  -0.1168 80  GLU B OE2   
3398 N N     . ALA B 81  ? 0.5690 0.7909 0.8513 0.0396  0.1288  -0.0847 81  ALA B N     
3399 C CA    . ALA B 81  ? 0.5706 0.7985 0.8756 0.0220  0.1542  -0.0547 81  ALA B CA    
3400 C C     . ALA B 81  ? 0.5684 0.7429 0.8150 0.0196  0.1649  -0.0486 81  ALA B C     
3401 O O     . ALA B 81  ? 0.5816 0.7427 0.8483 0.0000  0.1698  -0.0330 81  ALA B O     
3402 C CB    . ALA B 81  ? 0.5465 0.8168 0.8514 0.0400  0.1837  -0.0350 81  ALA B CB    
3408 N N     . SER B 82  ? 0.7539 0.8979 0.9332 0.0397  0.1677  -0.0593 82  SER B N     
3409 C CA    . SER B 82  ? 0.7341 0.8303 0.8644 0.0380  0.1723  -0.0567 82  SER B CA    
3410 C C     . SER B 82  ? 0.7470 0.8140 0.8810 0.0231  0.1505  -0.0676 82  SER B C     
3411 O O     . SER B 82  ? 0.7476 0.7838 0.8623 0.0139  0.1539  -0.0605 82  SER B O     
3412 C CB    . SER B 82  ? 0.6956 0.7672 0.7708 0.0604  0.1753  -0.0649 82  SER B CB    
3413 O OG    . SER B 82  ? 0.6843 0.7533 0.7560 0.0694  0.1595  -0.0794 82  SER B OG    
3419 N N     . LEU B 83  ? 0.6384 0.7147 0.7912 0.0264  0.1269  -0.0861 83  LEU B N     
3420 C CA    . LEU B 83  ? 0.6551 0.7050 0.8076 0.0198  0.1030  -0.0990 83  LEU B CA    
3421 C C     . LEU B 83  ? 0.7045 0.7489 0.9038 -0.0072 0.0980  -0.0902 83  LEU B C     
3422 O O     . LEU B 83  ? 0.7043 0.7136 0.8858 -0.0164 0.0969  -0.0857 83  LEU B O     
3423 C CB    . LEU B 83  ? 0.6722 0.7372 0.8313 0.0388  0.0760  -0.1231 83  LEU B CB    
3424 C CG    . LEU B 83  ? 0.6905 0.7296 0.8420 0.0434  0.0461  -0.1417 83  LEU B CG    
3425 C CD1   . LEU B 83  ? 0.6539 0.6597 0.7491 0.0537  0.0556  -0.1342 83  LEU B CD1   
3426 C CD2   . LEU B 83  ? 0.7064 0.7663 0.8614 0.0716  0.0165  -0.1684 83  LEU B CD2   
3438 N N     . HIS B 84  ? 0.9248 1.0052 1.1908 -0.0203 0.0951  -0.0847 84  HIS B N     
3439 C CA    . HIS B 84  ? 0.9322 1.0104 1.2605 -0.0487 0.0933  -0.0677 84  HIS B CA    
3440 C C     . HIS B 84  ? 0.9156 0.9761 1.2168 -0.0546 0.1270  -0.0367 84  HIS B C     
3441 O O     . HIS B 84  ? 0.9167 0.9532 1.2408 -0.0727 0.1256  -0.0234 84  HIS B O     
3442 C CB    . HIS B 84  ? 0.9146 1.0462 1.3295 -0.0613 0.0928  -0.0568 84  HIS B CB    
3443 C CG    . HIS B 84  ? 0.8951 1.0294 1.3960 -0.0934 0.0908  -0.0327 84  HIS B CG    
3444 N ND1   . HIS B 84  ? 0.8847 1.0232 1.3952 -0.1030 0.1296  0.0108  84  HIS B ND1   
3445 C CD2   . HIS B 84  ? 0.8963 1.0283 1.4817 -0.1160 0.0534  -0.0443 84  HIS B CD2   
3446 C CE1   . HIS B 84  ? 0.8823 1.0227 1.4842 -0.1325 0.1211  0.0310  84  HIS B CE1   
3447 N NE2   . HIS B 84  ? 0.8873 1.0211 1.5403 -0.1436 0.0723  -0.0035 84  HIS B NE2   
3455 N N     . ARG B 85  ? 0.9994 1.0684 1.2493 -0.0355 0.1547  -0.0265 85  ARG B N     
3456 C CA    . ARG B 85  ? 0.9754 1.0289 1.1899 -0.0313 0.1829  -0.0016 85  ARG B CA    
3457 C C     . ARG B 85  ? 0.9813 0.9830 1.1417 -0.0302 0.1723  -0.0133 85  ARG B C     
3458 O O     . ARG B 85  ? 0.9823 0.9638 1.1363 -0.0365 0.1829  0.0045  85  ARG B O     
3459 C CB    . ARG B 85  ? 0.9601 1.0326 1.1310 -0.0046 0.2067  0.0046  85  ARG B CB    
3460 C CG    . ARG B 85  ? 0.9708 1.0389 1.1075 0.0099  0.2358  0.0310  85  ARG B CG    
3461 C CD    . ARG B 85  ? 0.9638 1.0443 1.0497 0.0439  0.2512  0.0290  85  ARG B CD    
3462 N NE    . ARG B 85  ? 0.9866 1.0819 1.0495 0.0673  0.2820  0.0589  85  ARG B NE    
3463 C CZ    . ARG B 85  ? 0.9995 1.1023 1.0086 0.1061  0.2955  0.0586  85  ARG B CZ    
3464 N NH1   . ARG B 85  ? 0.9890 1.0814 0.9685 0.1205  0.2800  0.0302  85  ARG B NH1   
3465 N NH2   . ARG B 85  ? 1.0230 1.1423 1.0056 0.1353  0.3242  0.0875  85  ARG B NH2   
3479 N N     . VAL B 86  ? 0.7549 0.7386 0.8787 -0.0198 0.1535  -0.0392 86  VAL B N     
3480 C CA    . VAL B 86  ? 0.7292 0.6724 0.8062 -0.0161 0.1453  -0.0469 86  VAL B CA    
3481 C C     . VAL B 86  ? 0.7542 0.6748 0.8488 -0.0280 0.1221  -0.0562 86  VAL B C     
3482 O O     . VAL B 86  ? 0.7409 0.6298 0.8049 -0.0276 0.1193  -0.0553 86  VAL B O     
3483 C CB    . VAL B 86  ? 0.6581 0.5954 0.6967 0.0019  0.1390  -0.0620 86  VAL B CB    
3484 C CG1   . VAL B 86  ? 0.6348 0.5827 0.6532 0.0156  0.1560  -0.0569 86  VAL B CG1   
3485 C CG2   . VAL B 86  ? 0.6468 0.6004 0.7030 0.0089  0.1208  -0.0784 86  VAL B CG2   
3495 N N     . LEU B 87  ? 0.7745 0.7092 0.9168 -0.0353 0.1017  -0.0680 87  LEU B N     
3496 C CA    . LEU B 87  ? 0.7835 0.6899 0.9418 -0.0423 0.0729  -0.0819 87  LEU B CA    
3497 C C     . LEU B 87  ? 0.7974 0.6815 0.9832 -0.0639 0.0812  -0.0597 87  LEU B C     
3498 O O     . LEU B 87  ? 0.7981 0.6441 0.9736 -0.0659 0.0636  -0.0671 87  LEU B O     
3499 C CB    . LEU B 87  ? 0.8146 0.7396 1.0224 -0.0424 0.0420  -0.1044 87  LEU B CB    
3500 C CG    . LEU B 87  ? 0.8186 0.7618 0.9944 -0.0130 0.0286  -0.1282 87  LEU B CG    
3501 C CD1   . LEU B 87  ? 0.8466 0.8101 1.0738 -0.0102 -0.0058 -0.1528 87  LEU B CD1   
3502 C CD2   . LEU B 87  ? 0.7965 0.7119 0.9098 0.0116  0.0190  -0.1397 87  LEU B CD2   
3514 N N     . GLY B 88  ? 0.7442 0.6522 0.9629 -0.0756 0.1096  -0.0297 88  GLY B N     
3515 C CA    . GLY B 88  ? 0.7510 0.6431 0.9962 -0.0913 0.1257  0.0011  88  GLY B CA    
3516 C C     . GLY B 88  ? 0.7580 0.6281 0.9350 -0.0771 0.1497  0.0161  88  GLY B C     
3517 O O     . GLY B 88  ? 0.7688 0.6322 0.9585 -0.0824 0.1714  0.0481  88  GLY B O     
3521 N N     . SER B 89  ? 0.7878 0.6481 0.8969 -0.0576 0.1458  -0.0042 89  SER B N     
3522 C CA    . SER B 89  ? 0.7826 0.6226 0.8313 -0.0430 0.1609  0.0045  89  SER B CA    
3523 C C     . SER B 89  ? 0.7641 0.5650 0.8059 -0.0493 0.1535  0.0106  89  SER B C     
3524 O O     . SER B 89  ? 0.7720 0.5594 0.7798 -0.0395 0.1710  0.0283  89  SER B O     
3525 C CB    . SER B 89  ? 0.7674 0.6043 0.7653 -0.0259 0.1512  -0.0186 89  SER B CB    
3526 O OG    . SER B 89  ? 0.7317 0.5521 0.7245 -0.0259 0.1260  -0.0389 89  SER B OG    
3532 N N     . TRP B 90  ? 0.7661 0.5465 0.8345 -0.0603 0.1254  -0.0058 90  TRP B N     
3533 C CA    . TRP B 90  ? 0.7724 0.5108 0.8408 -0.0660 0.1148  -0.0010 90  TRP B CA    
3534 C C     . TRP B 90  ? 0.7706 0.4944 0.8984 -0.0818 0.0823  -0.0166 90  TRP B C     
3535 O O     . TRP B 90  ? 0.7477 0.4948 0.9026 -0.0827 0.0650  -0.0368 90  TRP B O     
3536 C CB    . TRP B 90  ? 0.7579 0.4717 0.7585 -0.0466 0.1046  -0.0172 90  TRP B CB    
3537 C CG    . TRP B 90  ? 0.7281 0.4487 0.7122 -0.0339 0.0800  -0.0474 90  TRP B CG    
3538 C CD1   . TRP B 90  ? 0.6974 0.4450 0.6565 -0.0206 0.0847  -0.0559 90  TRP B CD1   
3539 C CD2   . TRP B 90  ? 0.7304 0.4302 0.7207 -0.0277 0.0472  -0.0706 90  TRP B CD2   
3540 N NE1   . TRP B 90  ? 0.6743 0.4247 0.6249 -0.0058 0.0626  -0.0767 90  TRP B NE1   
3541 C CE2   . TRP B 90  ? 0.6983 0.4204 0.6617 -0.0063 0.0383  -0.0885 90  TRP B CE2   
3542 C CE3   . TRP B 90  ? 0.7622 0.4243 0.7784 -0.0346 0.0225  -0.0780 90  TRP B CE3   
3543 C CZ2   . TRP B 90  ? 0.7016 0.4148 0.6537 0.0148  0.0084  -0.1130 90  TRP B CZ2   
3544 C CZ3   . TRP B 90  ? 0.7663 0.4130 0.7712 -0.0153 -0.0139 -0.1092 90  TRP B CZ3   
3545 C CH2   . TRP B 90  ? 0.7384 0.4132 0.7068 0.0123  -0.0194 -0.1262 90  TRP B CH2   
3556 N N     . THR B 91  ? 0.8481 0.5301 0.9961 -0.0916 0.0708  -0.0089 91  THR B N     
3557 C CA    . THR B 91  ? 0.8580 0.5146 1.0658 -0.1054 0.0311  -0.0280 91  THR B CA    
3558 C C     . THR B 91  ? 0.8847 0.4813 1.0676 -0.0992 0.0107  -0.0349 91  THR B C     
3559 O O     . THR B 91  ? 0.8932 0.4741 1.0185 -0.0867 0.0314  -0.0202 91  THR B O     
3560 C CB    . THR B 91  ? 0.8573 0.5319 1.1679 -0.1364 0.0384  -0.0001 91  THR B CB    
3561 O OG1   . THR B 91  ? 0.8684 0.5113 1.2456 -0.1510 -0.0097 -0.0238 91  THR B OG1   
3562 C CG2   . THR B 91  ? 0.8675 0.5341 1.1940 -0.1467 0.0781  0.0515  91  THR B CG2   
3570 N N     . GLY B 92  ? 0.8361 0.3975 1.0626 -0.1051 -0.0344 -0.0603 92  GLY B N     
3571 C CA    . GLY B 92  ? 0.8705 0.3683 1.0730 -0.0955 -0.0602 -0.0716 92  GLY B CA    
3572 C C     . GLY B 92  ? 0.8919 0.3625 1.1065 -0.1102 -0.0293 -0.0272 92  GLY B C     
3573 O O     . GLY B 92  ? 0.9105 0.3494 1.0599 -0.0911 -0.0241 -0.0252 92  GLY B O     
3577 N N     . ASP B 93  ? 1.2493 0.7367 1.5480 -0.1408 -0.0059 0.0128  93  ASP B N     
3578 C CA    . ASP B 93  ? 1.2743 0.7455 1.5808 -0.1485 0.0265  0.0615  93  ASP B CA    
3579 C C     . ASP B 93  ? 1.2830 0.7733 1.5097 -0.1262 0.0744  0.0851  93  ASP B C     
3580 O O     . ASP B 93  ? 1.3270 0.7839 1.5099 -0.1130 0.0882  0.1031  93  ASP B O     
3581 C CB    . ASP B 93  ? 1.2978 0.8077 1.7010 -0.1768 0.0428  0.1018  93  ASP B CB    
3582 C CG    . ASP B 93  ? 1.2587 0.8350 1.6849 -0.1804 0.0799  0.1230  93  ASP B CG    
3583 O OD1   . ASP B 93  ? 1.2617 0.8591 1.6469 -0.1661 0.1293  0.1584  93  ASP B OD1   
3584 O OD2   . ASP B 93  ? 1.2454 0.8536 1.7254 -0.1930 0.0591  0.1031  93  ASP B OD2   
3589 N N     . SER B 94  ? 0.8340 0.3817 1.0328 -0.1173 0.0958  0.0819  94  SER B N     
3590 C CA    . SER B 94  ? 0.8390 0.4101 0.9607 -0.0928 0.1335  0.0989  94  SER B CA    
3591 C C     . SER B 94  ? 0.8529 0.3974 0.8867 -0.0674 0.1176  0.0701  94  SER B C     
3592 O O     . SER B 94  ? 0.8689 0.4058 0.8481 -0.0485 0.1389  0.0870  94  SER B O     
3593 C CB    . SER B 94  ? 0.8070 0.4376 0.9215 -0.0878 0.1515  0.0955  94  SER B CB    
3594 O OG    . SER B 94  ? 0.7745 0.4157 0.8731 -0.0844 0.1213  0.0515  94  SER B OG    
3600 N N     . VAL B 95  ? 0.9440 0.4784 0.9634 -0.0622 0.0806  0.0285  95  VAL B N     
3601 C CA    . VAL B 95  ? 0.9488 0.4673 0.8927 -0.0356 0.0676  0.0063  95  VAL B CA    
3602 C C     . VAL B 95  ? 0.9833 0.4450 0.9132 -0.0298 0.0581  0.0142  95  VAL B C     
3603 O O     . VAL B 95  ? 1.0010 0.4542 0.8756 -0.0113 0.0733  0.0256  95  VAL B O     
3604 C CB    . VAL B 95  ? 0.9324 0.4615 0.8643 -0.0238 0.0355  -0.0334 95  VAL B CB    
3605 C CG1   . VAL B 95  ? 0.9344 0.4556 0.7960 0.0065  0.0265  -0.0481 95  VAL B CG1   
3606 C CG2   . VAL B 95  ? 0.8953 0.4779 0.8398 -0.0278 0.0471  -0.0379 95  VAL B CG2   
3616 N N     . ASN B 96  ? 0.9679 0.3876 0.9496 -0.0439 0.0291  0.0062  96  ASN B N     
3617 C CA    . ASN B 96  ? 1.0093 0.3661 0.9826 -0.0383 0.0162  0.0129  96  ASN B CA    
3618 C C     . ASN B 96  ? 1.0336 0.3843 1.0067 -0.0422 0.0581  0.0623  96  ASN B C     
3619 O O     . ASN B 96  ? 1.0596 0.3807 0.9778 -0.0213 0.0639  0.0701  96  ASN B O     
3620 C CB    . ASN B 96  ? 1.0224 0.3320 1.0706 -0.0578 -0.0248 -0.0019 96  ASN B CB    
3621 C CG    . ASN B 96  ? 1.0082 0.3243 1.0338 -0.0381 -0.0687 -0.0550 96  ASN B CG    
3622 O OD1   . ASN B 96  ? 0.9942 0.3252 0.9465 -0.0072 -0.0725 -0.0763 96  ASN B OD1   
3623 N ND2   . ASN B 96  ? 1.0413 0.3572 1.1258 -0.0520 -0.0999 -0.0730 96  ASN B ND2   
3630 N N     . TYR B 97  ? 1.0849 0.4670 1.1159 -0.0633 0.0890  0.0980  97  TYR B N     
3631 C CA    . TYR B 97  ? 1.1168 0.5021 1.1412 -0.0574 0.1341  0.1499  97  TYR B CA    
3632 C C     . TYR B 97  ? 1.1247 0.5319 1.0487 -0.0222 0.1535  0.1452  97  TYR B C     
3633 O O     . TYR B 97  ? 1.1638 0.5442 1.0433 -0.0018 0.1670  0.1643  97  TYR B O     
3634 C CB    . TYR B 97  ? 1.1012 0.5331 1.1960 -0.0766 0.1672  0.1885  97  TYR B CB    
3635 C CG    . TYR B 97  ? 1.1230 0.5779 1.2109 -0.0623 0.2110  0.2429  97  TYR B CG    
3636 C CD1   . TYR B 97  ? 1.1758 0.6049 1.2966 -0.0683 0.2091  0.2714  97  TYR B CD1   
3637 C CD2   . TYR B 97  ? 1.1172 0.6205 1.1610 -0.0380 0.2518  0.2631  97  TYR B CD2   
3638 C CE1   . TYR B 97  ? 1.2143 0.6697 1.3275 -0.0494 0.2506  0.3207  97  TYR B CE1   
3639 C CE2   . TYR B 97  ? 1.1367 0.6674 1.1672 -0.0146 0.2890  0.3079  97  TYR B CE2   
3640 C CZ    . TYR B 97  ? 1.1952 0.7038 1.2622 -0.0201 0.2903  0.3377  97  TYR B CZ    
3641 O OH    . TYR B 97  ? 1.2418 0.7797 1.2955 0.0082  0.3295  0.3826  97  TYR B OH    
3651 N N     . ALA B 98  ? 0.9371 0.3915 0.8285 -0.0141 0.1522  0.1192  98  ALA B N     
3652 C CA    . ALA B 98  ? 0.9343 0.4085 0.7435 0.0165  0.1605  0.1086  98  ALA B CA    
3653 C C     . ALA B 98  ? 0.9419 0.3828 0.7025 0.0334  0.1343  0.0843  98  ALA B C     
3654 O O     . ALA B 98  ? 0.9695 0.4016 0.6750 0.0580  0.1436  0.0928  98  ALA B O     
3655 C CB    . ALA B 98  ? 0.9018 0.4264 0.7019 0.0174  0.1579  0.0846  98  ALA B CB    
3661 N N     . ALA B 99  ? 1.0268 0.4517 0.8041 0.0257  0.1006  0.0539  99  ALA B N     
3662 C CA    . ALA B 99  ? 1.0361 0.4357 0.7642 0.0486  0.0763  0.0315  99  ALA B CA    
3663 C C     . ALA B 99  ? 1.0860 0.4301 0.7982 0.0580  0.0787  0.0513  99  ALA B C     
3664 O O     . ALA B 99  ? 1.1003 0.4351 0.7535 0.0851  0.0763  0.0474  99  ALA B O     
3665 C CB    . ALA B 99  ? 1.0163 0.4068 0.7629 0.0469  0.0401  -0.0025 99  ALA B CB    
3671 N N     . SER B 100 ? 0.9761 0.2840 0.7462 0.0360  0.0836  0.0756  100 SER B N     
3672 C CA    . SER B 100 ? 1.0433 0.2941 0.8066 0.0436  0.0891  0.1016  100 SER B CA    
3673 C C     . SER B 100 ? 1.0525 0.3207 0.7567 0.0695  0.1250  0.1302  100 SER B C     
3674 O O     . SER B 100 ? 1.0993 0.3367 0.7753 0.0872  0.1264  0.1436  100 SER B O     
3675 C CB    . SER B 100 ? 1.0786 0.3091 0.9379 0.0107  0.0916  0.1319  100 SER B CB    
3676 O OG    . SER B 100 ? 1.0630 0.3376 0.9510 0.0006  0.1344  0.1721  100 SER B OG    
3682 N N     . ARG B 101 ? 1.1755 0.5019 0.8629 0.0746  0.1485  0.1351  101 ARG B N     
3683 C CA    . ARG B 101 ? 1.1920 0.5390 0.8196 0.1055  0.1766  0.1555  101 ARG B CA    
3684 C C     . ARG B 101 ? 1.1859 0.5520 0.7443 0.1333  0.1586  0.1232  101 ARG B C     
3685 O O     . ARG B 101 ? 1.1996 0.5846 0.7063 0.1622  0.1733  0.1314  101 ARG B O     
3686 C CB    . ARG B 101 ? 1.1769 0.5747 0.8181 0.1038  0.2056  0.1729  101 ARG B CB    
3687 C CG    . ARG B 101 ? 1.1782 0.5726 0.8976 0.0775  0.2284  0.2117  101 ARG B CG    
3688 C CD    . ARG B 101 ? 1.2167 0.5936 0.9466 0.0881  0.2513  0.2556  101 ARG B CD    
3689 N NE    . ARG B 101 ? 1.2129 0.6101 1.0343 0.0623  0.2688  0.2939  101 ARG B NE    
3690 C CZ    . ARG B 101 ? 1.2318 0.6799 1.0636 0.0769  0.3064  0.3296  101 ARG B CZ    
3691 N NH1   . ARG B 101 ? 1.2303 0.7102 0.9833 0.1193  0.3267  0.3273  101 ARG B NH1   
3692 N NH2   . ARG B 101 ? 1.2572 0.7261 1.1789 0.0528  0.3199  0.3650  101 ARG B NH2   
3706 N N     . PHE B 102 ? 0.9305 0.5545 0.6014 -0.0790 0.0348  0.1255  102 PHE B N     
3707 C CA    . PHE B 102 ? 0.9233 0.5876 0.6124 -0.0451 0.0360  0.1225  102 PHE B CA    
3708 C C     . PHE B 102 ? 0.9550 0.5641 0.6424 -0.0106 0.0409  0.1128  102 PHE B C     
3709 O O     . PHE B 102 ? 0.9534 0.5999 0.6588 0.0183  0.0442  0.1096  102 PHE B O     
3710 C CB    . PHE B 102 ? 0.8575 0.5927 0.5672 -0.0562 0.0389  0.0962  102 PHE B CB    
3711 C CG    . PHE B 102 ? 0.8133 0.6007 0.5230 -0.0884 0.0336  0.0957  102 PHE B CG    
3712 C CD1   . PHE B 102 ? 0.8047 0.6521 0.5202 -0.0869 0.0254  0.1149  102 PHE B CD1   
3713 C CD2   . PHE B 102 ? 0.7858 0.5677 0.4886 -0.1169 0.0360  0.0741  102 PHE B CD2   
3714 C CE1   . PHE B 102 ? 0.7704 0.6706 0.4834 -0.1127 0.0204  0.1111  102 PHE B CE1   
3715 C CE2   . PHE B 102 ? 0.7574 0.5916 0.4599 -0.1425 0.0314  0.0713  102 PHE B CE2   
3716 C CZ    . PHE B 102 ? 0.7482 0.6414 0.4551 -0.1401 0.0239  0.0891  102 PHE B CZ    
3726 N N     . LEU B 103 ? 0.9205 0.4467 0.5890 -0.0124 0.0411  0.1065  103 LEU B N     
3727 C CA    . LEU B 103 ? 0.9641 0.4348 0.6269 0.0233  0.0443  0.0926  103 LEU B CA    
3728 C C     . LEU B 103 ? 1.0519 0.4470 0.7009 0.0413  0.0371  0.1180  103 LEU B C     
3729 O O     . LEU B 103 ? 1.0778 0.4671 0.7219 0.0260  0.0311  0.1511  103 LEU B O     
3730 C CB    . LEU B 103 ? 0.9622 0.3963 0.6140 0.0113  0.0483  0.0557  103 LEU B CB    
3731 C CG    . LEU B 103 ? 0.8870 0.3856 0.5498 0.0024  0.0566  0.0314  103 LEU B CG    
3732 C CD1   . LEU B 103 ? 0.8960 0.3563 0.5424 -0.0073 0.0583  -0.0021 103 LEU B CD1   
3733 C CD2   . LEU B 103 ? 0.8605 0.4083 0.5414 0.0378  0.0655  0.0307  103 LEU B CD2   
3745 N N     . GLY B 104 ? 1.6300 0.9663 1.2714 0.0761  0.0379  0.1028  104 GLY B N     
3746 C CA    . GLY B 104 ? 1.6932 0.9492 1.3227 0.1023  0.0304  0.1229  104 GLY B CA    
3747 C C     . GLY B 104 ? 1.7067 0.9855 1.3447 0.1585  0.0320  0.1298  104 GLY B C     
3748 O O     . GLY B 104 ? 1.6692 1.0363 1.3268 0.1717  0.0386  0.1268  104 GLY B O     
3752 N N     . ALA B 105 ? 1.5121 0.7081 1.1375 0.1918  0.0252  0.1386  105 ALA B N     
3753 C CA    . ALA B 105 ? 1.5397 0.7473 1.1711 0.2519  0.0254  0.1443  105 ALA B CA    
3754 C C     . ALA B 105 ? 1.5075 0.7600 1.1474 0.2758  0.0371  0.1045  105 ALA B C     
3755 O O     . ALA B 105 ? 1.5334 0.7329 1.1584 0.2738  0.0389  0.0699  105 ALA B O     
3756 C CB    . ALA B 105 ? 1.5081 0.7920 1.1542 0.2599  0.0222  0.1840  105 ALA B CB    
3762 N N     . ASN B 106 ? 1.4275 0.7781 1.0915 0.2976  0.0453  0.1078  106 ASN B N     
3763 C CA    . ASN B 106 ? 1.4110 0.8086 1.0846 0.3212  0.0593  0.0765  106 ASN B CA    
3764 C C     . ASN B 106 ? 1.3641 0.7966 1.0398 0.2764  0.0681  0.0553  106 ASN B C     
3765 O O     . ASN B 106 ? 1.3453 0.8210 1.0324 0.2345  0.0664  0.0684  106 ASN B O     
3766 C CB    . ASN B 106 ? 1.3890 0.8852 1.0945 0.3543  0.0657  0.0904  106 ASN B CB    
3767 C CG    . ASN B 106 ? 1.4621 0.9306 1.1653 0.4097  0.0578  0.1071  106 ASN B CG    
3768 O OD1   . ASN B 106 ? 1.5526 0.9309 1.2312 0.4396  0.0531  0.0948  106 ASN B OD1   
3769 N ND2   . ASN B 106 ? 1.4429 0.9888 1.1723 0.4255  0.0547  0.1332  106 ASN B ND2   
3776 N N     . GLN B 107 ? 1.1328 0.5480 0.7954 0.2889  0.0769  0.0216  107 GLN B N     
3777 C CA    . GLN B 107 ? 1.0724 0.5193 0.7340 0.2541  0.0856  0.0016  107 GLN B CA    
3778 C C     . GLN B 107 ? 0.9913 0.5450 0.6860 0.2468  0.0983  0.0123  107 GLN B C     
3779 O O     . GLN B 107 ? 0.9860 0.5945 0.7033 0.2801  0.1058  0.0220  107 GLN B O     
3780 C CB    . GLN B 107 ? 1.1076 0.5182 0.7446 0.2775  0.0919  -0.0358 107 GLN B CB    
3781 C CG    . GLN B 107 ? 1.0501 0.5005 0.6838 0.2507  0.1022  -0.0546 107 GLN B CG    
3782 C CD    . GLN B 107 ? 1.0954 0.4979 0.6963 0.2675  0.1028  -0.0933 107 GLN B CD    
3783 O OE1   . GLN B 107 ? 1.0747 0.4708 0.6621 0.2378  0.1014  -0.1108 107 GLN B OE1   
3784 N NE2   . GLN B 107 ? 1.1605 0.5329 0.7478 0.3179  0.1037  -0.1090 107 GLN B NE2   
3793 N N     . VAL B 108 ? 0.9314 0.5148 0.6319 0.2024  0.1000  0.0096  108 VAL B N     
3794 C CA    . VAL B 108 ? 0.8647 0.5381 0.5985 0.1874  0.1099  0.0175  108 VAL B CA    
3795 C C     . VAL B 108 ? 0.8251 0.5072 0.5503 0.1669  0.1201  -0.0030 108 VAL B C     
3796 O O     . VAL B 108 ? 0.8552 0.4813 0.5485 0.1662  0.1185  -0.0243 108 VAL B O     
3797 C CB    . VAL B 108 ? 0.8696 0.5786 0.6235 0.1545  0.0984  0.0388  108 VAL B CB    
3798 C CG1   . VAL B 108 ? 0.9158 0.6250 0.6767 0.1796  0.0884  0.0625  108 VAL B CG1   
3799 C CG2   . VAL B 108 ? 0.8703 0.5357 0.6020 0.1132  0.0884  0.0337  108 VAL B CG2   
3809 N N     . GLY B 109 ? 0.8280 0.5803 0.5830 0.1503  0.1294  0.0034  109 GLY B N     
3810 C CA    . GLY B 109 ? 0.7866 0.5515 0.5360 0.1338  0.1400  -0.0103 109 GLY B CA    
3811 C C     . GLY B 109 ? 0.7594 0.5141 0.5043 0.0893  0.1289  -0.0143 109 GLY B C     
3812 O O     . GLY B 109 ? 0.7492 0.5339 0.5168 0.0667  0.1199  -0.0017 109 GLY B O     
3816 N N     . CYS B 110 ? 0.8595 0.5772 0.5745 0.0799  0.1288  -0.0339 110 CYS B N     
3817 C CA    . CYS B 110 ? 0.8359 0.5481 0.5451 0.0416  0.1194  -0.0411 110 CYS B CA    
3818 C C     . CYS B 110 ? 0.8006 0.5363 0.5082 0.0366  0.1305  -0.0507 110 CYS B C     
3819 O O     . CYS B 110 ? 0.8009 0.5343 0.4938 0.0623  0.1433  -0.0578 110 CYS B O     
3820 C CB    . CYS B 110 ? 0.8661 0.5147 0.5432 0.0310  0.1065  -0.0555 110 CYS B CB    
3821 S SG    . CYS B 110 ? 0.9246 0.5325 0.6007 0.0352  0.0937  -0.0382 110 CYS B SG    
3827 N N     . THR B 111 ? 0.8455 0.6047 0.5665 0.0061  0.1254  -0.0503 111 THR B N     
3828 C CA    . THR B 111 ? 0.8282 0.6075 0.5509 0.0012  0.1349  -0.0550 111 THR B CA    
3829 C C     . THR B 111 ? 0.7968 0.5710 0.5120 -0.0286 0.1225  -0.0672 111 THR B C     
3830 O O     . THR B 111 ? 0.7839 0.5674 0.5114 -0.0506 0.1099  -0.0650 111 THR B O     
3831 C CB    . THR B 111 ? 0.8351 0.6659 0.5997 0.0004  0.1463  -0.0367 111 THR B CB    
3832 O OG1   . THR B 111 ? 0.8308 0.6873 0.6258 -0.0223 0.1336  -0.0304 111 THR B OG1   
3833 C CG2   . THR B 111 ? 0.8615 0.7105 0.6365 0.0321  0.1618  -0.0242 111 THR B CG2   
3841 N N     . TYR B 112 ? 0.7794 0.5441 0.4730 -0.0261 0.1262  -0.0802 112 TYR B N     
3842 C CA    . TYR B 112 ? 0.7545 0.5269 0.4467 -0.0485 0.1178  -0.0905 112 TYR B CA    
3843 C C     . TYR B 112 ? 0.7472 0.5386 0.4489 -0.0411 0.1306  -0.0831 112 TYR B C     
3844 O O     . TYR B 112 ? 0.7682 0.5549 0.4531 -0.0172 0.1445  -0.0796 112 TYR B O     
3845 C CB    . TYR B 112 ? 0.7532 0.5106 0.4295 -0.0506 0.1021  -0.1062 112 TYR B CB    
3846 C CG    . TYR B 112 ? 0.7193 0.5075 0.4184 -0.0616 0.0885  -0.1077 112 TYR B CG    
3847 C CD1   . TYR B 112 ? 0.7007 0.5082 0.4191 -0.0838 0.0775  -0.1071 112 TYR B CD1   
3848 C CD2   . TYR B 112 ? 0.7148 0.5152 0.4140 -0.0454 0.0874  -0.1095 112 TYR B CD2   
3849 C CE1   . TYR B 112 ? 0.6769 0.5124 0.4161 -0.0862 0.0663  -0.1089 112 TYR B CE1   
3850 C CE2   . TYR B 112 ? 0.6977 0.5215 0.4136 -0.0498 0.0758  -0.1116 112 TYR B CE2   
3851 C CZ    . TYR B 112 ? 0.6771 0.5171 0.4139 -0.0688 0.0655  -0.1116 112 TYR B CZ    
3852 O OH    . TYR B 112 ? 0.6626 0.5250 0.4149 -0.0671 0.0547  -0.1146 112 TYR B OH    
3862 N N     . SER B 113 ? 0.6736 0.4858 0.4015 -0.0605 0.1258  -0.0803 113 SER B N     
3863 C CA    . SER B 113 ? 0.6717 0.4947 0.4142 -0.0575 0.1368  -0.0701 113 SER B CA    
3864 C C     . SER B 113 ? 0.6552 0.4759 0.3951 -0.0727 0.1244  -0.0846 113 SER B C     
3865 O O     . SER B 113 ? 0.6309 0.4592 0.3762 -0.0911 0.1083  -0.0982 113 SER B O     
3866 C CB    . SER B 113 ? 0.6749 0.5263 0.4655 -0.0645 0.1446  -0.0505 113 SER B CB    
3867 O OG    . SER B 113 ? 0.7004 0.5564 0.5067 -0.0619 0.1585  -0.0357 113 SER B OG    
3873 N N     . ILE B 114 ? 0.6917 0.5045 0.4217 -0.0621 0.1325  -0.0802 114 ILE B N     
3874 C CA    . ILE B 114 ? 0.6877 0.4961 0.4137 -0.0695 0.1213  -0.0935 114 ILE B CA    
3875 C C     . ILE B 114 ? 0.7232 0.5245 0.4628 -0.0616 0.1342  -0.0742 114 ILE B C     
3876 O O     . ILE B 114 ? 0.7474 0.5444 0.4730 -0.0420 0.1522  -0.0552 114 ILE B O     
3877 C CB    . ILE B 114 ? 0.6719 0.4913 0.3887 -0.0549 0.1006  -0.1018 114 ILE B CB    
3878 C CG1   . ILE B 114 ? 0.6680 0.4970 0.3939 -0.0547 0.0865  -0.1096 114 ILE B CG1   
3879 C CG2   . ILE B 114 ? 0.6963 0.5103 0.3889 -0.0291 0.1101  -0.0948 114 ILE B CG2   
3880 C CD1   . ILE B 114 ? 0.6533 0.5107 0.3878 -0.0406 0.0642  -0.1170 114 ILE B CD1   
3892 N N     . ARG B 115 ? 0.7305 0.5303 0.4972 -0.0761 0.1248  -0.0787 115 ARG B N     
3893 C CA    . ARG B 115 ? 0.7870 0.5717 0.5741 -0.0737 0.1348  -0.0591 115 ARG B CA    
3894 C C     . ARG B 115 ? 0.7880 0.5549 0.5601 -0.0688 0.1214  -0.0753 115 ARG B C     
3895 O O     . ARG B 115 ? 0.7510 0.5265 0.5287 -0.0806 0.1019  -0.1021 115 ARG B O     
3896 C CB    . ARG B 115 ? 0.8031 0.5982 0.6482 -0.0966 0.1352  -0.0498 115 ARG B CB    
3897 C CG    . ARG B 115 ? 0.8594 0.6356 0.7341 -0.0989 0.1486  -0.0237 115 ARG B CG    
3898 C CD    . ARG B 115 ? 0.8463 0.6315 0.7835 -0.1271 0.1411  -0.0258 115 ARG B CD    
3899 N NE    . ARG B 115 ? 0.8816 0.6518 0.8565 -0.1344 0.1583  0.0058  115 ARG B NE    
3900 C CZ    . ARG B 115 ? 0.8986 0.6294 0.8830 -0.1360 0.1566  0.0120  115 ARG B CZ    
3901 N NH1   . ARG B 115 ? 0.8935 0.5999 0.8515 -0.1271 0.1375  -0.0144 115 ARG B NH1   
3902 N NH2   . ARG B 115 ? 0.9190 0.6354 0.9412 -0.1461 0.1745  0.0462  115 ARG B NH2   
3916 N N     . PHE B 116 ? 0.8227 0.5685 0.5746 -0.0486 0.1321  -0.0581 116 PHE B N     
3917 C CA    . PHE B 116 ? 0.8323 0.5608 0.5656 -0.0368 0.1197  -0.0716 116 PHE B CA    
3918 C C     . PHE B 116 ? 0.9042 0.6051 0.6293 -0.0172 0.1360  -0.0391 116 PHE B C     
3919 O O     . PHE B 116 ? 0.9149 0.6208 0.6122 0.0016  0.1540  -0.0171 116 PHE B O     
3920 C CB    . PHE B 116 ? 0.7918 0.5369 0.4791 -0.0232 0.1079  -0.0982 116 PHE B CB    
3921 C CG    . PHE B 116 ? 0.7972 0.5357 0.4661 -0.0085 0.0934  -0.1154 116 PHE B CG    
3922 C CD1   . PHE B 116 ? 0.7749 0.5137 0.4685 -0.0205 0.0761  -0.1370 116 PHE B CD1   
3923 C CD2   . PHE B 116 ? 0.8245 0.5613 0.4502 0.0207  0.0960  -0.1125 116 PHE B CD2   
3924 C CE1   . PHE B 116 ? 0.7855 0.5234 0.4648 -0.0026 0.0619  -0.1538 116 PHE B CE1   
3925 C CE2   . PHE B 116 ? 0.8339 0.5749 0.4505 0.0371  0.0801  -0.1267 116 PHE B CE2   
3926 C CZ    . PHE B 116 ? 0.8151 0.5570 0.4600 0.0260  0.0636  -0.1467 116 PHE B CZ    
3936 N N     . ARG B 117 ? 1.0166 0.6880 0.7649 -0.0202 0.1296  -0.0357 117 ARG B N     
3937 C CA    . ARG B 117 ? 1.0909 0.7281 0.8331 -0.0023 0.1440  -0.0008 117 ARG B CA    
3938 C C     . ARG B 117 ? 1.1232 0.7588 0.8938 -0.0123 0.1709  0.0422  117 ARG B C     
3939 O O     . ARG B 117 ? 1.1553 0.7798 0.9053 0.0077  0.1912  0.0790  117 ARG B O     
3940 C CB    . ARG B 117 ? 1.1028 0.7444 0.7831 0.0346  0.1464  0.0018  117 ARG B CB    
3941 C CG    . ARG B 117 ? 1.0750 0.7288 0.7282 0.0457  0.1210  -0.0399 117 ARG B CG    
3942 C CD    . ARG B 117 ? 1.1270 0.7468 0.7806 0.0618  0.1099  -0.0403 117 ARG B CD    
3943 N NE    . ARG B 117 ? 1.1962 0.7939 0.8179 0.0936  0.1249  -0.0033 117 ARG B NE    
3944 C CZ    . ARG B 117 ? 1.1998 0.8188 0.7672 0.1267  0.1238  -0.0063 117 ARG B CZ    
3945 N NH1   . ARG B 117 ? 1.1500 0.8105 0.6937 0.1285  0.1083  -0.0457 117 ARG B NH1   
3946 N NH2   . ARG B 117 ? 1.2545 0.8556 0.7922 0.1574  0.1381  0.0311  117 ARG B NH2   
3960 N N     . GLY B 118 ? 0.8207 0.4735 0.6386 -0.0419 0.1718  0.0390  118 GLY B N     
3961 C CA    . GLY B 118 ? 0.8153 0.4794 0.6653 -0.0528 0.1972  0.0773  118 GLY B CA    
3962 C C     . GLY B 118 ? 0.8038 0.5032 0.6182 -0.0332 0.2165  0.0912  118 GLY B C     
3963 O O     . GLY B 118 ? 0.7984 0.5129 0.6310 -0.0341 0.2418  0.1274  118 GLY B O     
3967 N N     . VAL B 119 ? 0.8216 0.5306 0.6159 -0.0684 0.1556  0.1422  119 VAL B N     
3968 C CA    . VAL B 119 ? 0.7897 0.5512 0.6068 -0.0585 0.1400  0.1375  119 VAL B CA    
3969 C C     . VAL B 119 ? 0.7721 0.5669 0.6297 -0.0696 0.1312  0.1236  119 VAL B C     
3970 O O     . VAL B 119 ? 0.7787 0.5665 0.6589 -0.0656 0.1309  0.1170  119 VAL B O     
3971 C CB    . VAL B 119 ? 0.7926 0.5657 0.6168 -0.0215 0.1223  0.1361  119 VAL B CB    
3972 C CG1   . VAL B 119 ? 0.7964 0.6162 0.6360 -0.0128 0.1030  0.1245  119 VAL B CG1   
3973 C CG2   . VAL B 119 ? 0.8257 0.5554 0.5972 -0.0046 0.1295  0.1540  119 VAL B CG2   
3983 N N     . SER B 120 ? 0.7757 0.6052 0.6413 -0.0811 0.1267  0.1207  120 SER B N     
3984 C CA    . SER B 120 ? 0.7655 0.6193 0.6596 -0.0865 0.1168  0.1108  120 SER B CA    
3985 C C     . SER B 120 ? 0.7651 0.6491 0.6785 -0.0643 0.1014  0.1006  120 SER B C     
3986 O O     . SER B 120 ? 0.7736 0.6743 0.6739 -0.0517 0.1003  0.1012  120 SER B O     
3987 C CB    . SER B 120 ? 0.7554 0.6283 0.6473 -0.1106 0.1191  0.1144  120 SER B CB    
3988 O OG    . SER B 120 ? 0.7514 0.6446 0.6639 -0.1076 0.1064  0.1078  120 SER B OG    
3994 N N     . VAL B 121 ? 0.6355 0.5183 0.5726 -0.0610 0.0924  0.0907  121 VAL B N     
3995 C CA    . VAL B 121 ? 0.6512 0.5477 0.6017 -0.0449 0.0774  0.0776  121 VAL B CA    
3996 C C     . VAL B 121 ? 0.6481 0.5396 0.6081 -0.0505 0.0750  0.0747  121 VAL B C     
3997 O O     . VAL B 121 ? 0.6390 0.5087 0.6037 -0.0641 0.0809  0.0779  121 VAL B O     
3998 C CB    . VAL B 121 ? 0.6852 0.5767 0.6555 -0.0364 0.0661  0.0673  121 VAL B CB    
3999 C CG1   . VAL B 121 ? 0.7353 0.6314 0.7114 -0.0257 0.0482  0.0497  121 VAL B CG1   
4000 C CG2   . VAL B 121 ? 0.7002 0.5930 0.6553 -0.0242 0.0648  0.0739  121 VAL B CG2   
4010 N N     . THR B 122 ? 0.7658 0.6727 0.7224 -0.0363 0.0686  0.0699  122 THR B N     
4011 C CA    . THR B 122 ? 0.7699 0.6678 0.7287 -0.0330 0.0642  0.0700  122 THR B CA    
4012 C C     . THR B 122 ? 0.8322 0.7162 0.7880 -0.0117 0.0549  0.0551  122 THR B C     
4013 O O     . THR B 122 ? 0.8488 0.7502 0.7953 0.0062  0.0537  0.0471  122 THR B O     
4014 C CB    . THR B 122 ? 0.7383 0.6714 0.6971 -0.0327 0.0657  0.0809  122 THR B CB    
4015 O OG1   . THR B 122 ? 0.7120 0.6509 0.6663 -0.0577 0.0734  0.0910  122 THR B OG1   
4016 C CG2   . THR B 122 ? 0.7522 0.6728 0.7084 -0.0253 0.0564  0.0848  122 THR B CG2   
4024 N N     . ILE B 123 ? 0.7239 0.5677 0.6798 -0.0148 0.0511  0.0510  123 ILE B N     
4025 C CA    . ILE B 123 ? 0.7956 0.6067 0.7405 0.0018  0.0432  0.0360  123 ILE B CA    
4026 C C     . ILE B 123 ? 0.7814 0.5744 0.7120 0.0183  0.0430  0.0457  123 ILE B C     
4027 O O     . ILE B 123 ? 0.7461 0.5144 0.6711 0.0056  0.0456  0.0586  123 ILE B O     
4028 C CB    . ILE B 123 ? 0.8088 0.5802 0.7646 -0.0182 0.0395  0.0236  123 ILE B CB    
4029 C CG1   . ILE B 123 ? 0.8240 0.6218 0.7954 -0.0238 0.0304  0.0106  123 ILE B CG1   
4030 C CG2   . ILE B 123 ? 0.8455 0.5610 0.7814 -0.0088 0.0336  0.0098  123 ILE B CG2   
4031 C CD1   . ILE B 123 ? 0.7961 0.6258 0.7892 -0.0373 0.0381  0.0233  123 ILE B CD1   
4043 N N     . SER B 124 ? 0.7253 0.5294 0.6459 0.0506  0.0407  0.0403  124 SER B N     
4044 C CA    . SER B 124 ? 0.7241 0.5248 0.6369 0.0771  0.0378  0.0511  124 SER B CA    
4045 C C     . SER B 124 ? 0.7835 0.5296 0.6698 0.1086  0.0362  0.0364  124 SER B C     
4046 O O     . SER B 124 ? 0.8008 0.5402 0.6764 0.1181  0.0382  0.0163  124 SER B O     
4047 C CB    . SER B 124 ? 0.6777 0.5597 0.6144 0.0921  0.0400  0.0613  124 SER B CB    
4048 O OG    . SER B 124 ? 0.6061 0.5282 0.5599 0.0593  0.0435  0.0702  124 SER B OG    
4054 N N     . GLY B 125 ? 0.7245 0.4227 0.5905 0.1264  0.0320  0.0463  125 GLY B N     
4055 C CA    . GLY B 125 ? 0.8037 0.4338 0.6357 0.1604  0.0322  0.0341  125 GLY B CA    
4056 C C     . GLY B 125 ? 0.8627 0.4387 0.6679 0.1810  0.0270  0.0535  125 GLY B C     
4057 O O     . GLY B 125 ? 0.8414 0.4397 0.6526 0.1699  0.0209  0.0758  125 GLY B O     
4061 N N     . GLY B 126 ? 0.9513 0.4458 0.7166 0.2132  0.0288  0.0444  126 GLY B N     
4062 C CA    . GLY B 126 ? 1.0295 0.4552 0.7565 0.2411  0.0239  0.0646  126 GLY B CA    
4063 C C     . GLY B 126 ? 1.0774 0.4039 0.7675 0.1997  0.0295  0.0715  126 GLY B C     
4064 O O     . GLY B 126 ? 1.0643 0.3657 0.7619 0.1535  0.0376  0.0546  126 GLY B O     
4068 N N     . SER B 127 ? 1.2436 0.5162 0.8938 0.2176  0.0252  0.0983  127 SER B N     
4069 C CA    . SER B 127 ? 1.2788 0.4505 0.8853 0.1799  0.0370  0.1104  127 SER B CA    
4070 C C     . SER B 127 ? 1.3270 0.4259 0.9236 0.1522  0.0494  0.0846  127 SER B C     
4071 O O     . SER B 127 ? 1.3228 0.4045 0.9319 0.0965  0.0617  0.0807  127 SER B O     
4072 C CB    . SER B 127 ? 1.3431 0.4793 0.9045 0.2098  0.0281  0.1391  127 SER B CB    
4073 O OG    . SER B 127 ? 1.2999 0.5070 0.8696 0.2352  0.0091  0.1618  127 SER B OG    
4079 N N     . ARG B 128 ? 1.3136 0.3821 0.8943 0.1893  0.0461  0.0656  128 ARG B N     
4080 C CA    . ARG B 128 ? 1.3815 0.3806 0.9482 0.1615  0.0533  0.0392  128 ARG B CA    
4081 C C     . ARG B 128 ? 1.3245 0.3509 0.9267 0.1194  0.0530  0.0086  128 ARG B C     
4082 O O     . ARG B 128 ? 1.3708 0.3529 0.9741 0.0807  0.0551  -0.0130 128 ARG B O     
4083 C CB    . ARG B 128 ? 1.4705 0.4233 0.9998 0.2164  0.0507  0.0274  128 ARG B CB    
4084 C CG    . ARG B 128 ? 1.5355 0.4667 1.0321 0.2660  0.0471  0.0571  128 ARG B CG    
4085 C CD    . ARG B 128 ? 1.6375 0.5169 1.0983 0.3177  0.0484  0.0444  128 ARG B CD    
4086 N NE    . ARG B 128 ? 1.6951 0.5714 1.1332 0.3740  0.0411  0.0729  128 ARG B NE    
4087 C CZ    . ARG B 128 ? 1.7892 0.5895 1.1817 0.3710  0.0426  0.0940  128 ARG B CZ    
4088 N NH1   . ARG B 128 ? 1.8337 0.5588 1.2034 0.3123  0.0552  0.0906  128 ARG B NH1   
4089 N NH2   . ARG B 128 ? 1.8435 0.6489 1.2163 0.4276  0.0313  0.1190  128 ARG B NH2   
4103 N N     . THR B 129 ? 1.4810 0.5850 1.1146 0.1256  0.0482  0.0065  129 THR B N     
4104 C CA    . THR B 129 ? 1.4374 0.6001 1.1151 0.0847  0.0430  -0.0192 129 THR B CA    
4105 C C     . THR B 129 ? 1.3801 0.5949 1.1057 0.0325  0.0484  -0.0059 129 THR B C     
4106 O O     . THR B 129 ? 1.3320 0.6133 1.1023 0.0049  0.0421  -0.0214 129 THR B O     
4107 C CB    . THR B 129 ? 1.3915 0.6512 1.0917 0.1183  0.0349  -0.0297 129 THR B CB    
4108 O OG1   . THR B 129 ? 1.3298 0.6803 1.0627 0.1320  0.0356  -0.0021 129 THR B OG1   
4109 C CG2   . THR B 129 ? 1.4596 0.6720 1.1134 0.1745  0.0361  -0.0449 129 THR B CG2   
4117 N N     . LEU B 130 ? 1.2226 0.4045 0.9336 0.0225  0.0607  0.0229  130 LEU B N     
4118 C CA    . LEU B 130 ? 1.1562 0.3828 0.9057 -0.0217 0.0721  0.0358  130 LEU B CA    
4119 C C     . LEU B 130 ? 1.1486 0.3840 0.9443 -0.0739 0.0754  0.0132  130 LEU B C     
4120 O O     . LEU B 130 ? 1.0878 0.3874 0.9327 -0.1022 0.0804  0.0126  130 LEU B O     
4121 C CB    . LEU B 130 ? 1.1557 0.3580 0.8794 -0.0232 0.0829  0.0655  130 LEU B CB    
4122 C CG    . LEU B 130 ? 1.0911 0.3454 0.8469 -0.0601 0.0973  0.0788  130 LEU B CG    
4123 C CD1   . LEU B 130 ? 1.0129 0.3333 0.7849 -0.0525 0.0941  0.0859  130 LEU B CD1   
4124 C CD2   . LEU B 130 ? 1.1580 0.3740 0.8717 -0.0577 0.1070  0.1031  130 LEU B CD2   
4136 N N     . GLN B 131 ? 1.3227 0.5023 1.1085 -0.0857 0.0710  -0.0056 131 GLN B N     
4137 C CA    . GLN B 131 ? 1.3173 0.5148 1.1540 -0.1346 0.0662  -0.0300 131 GLN B CA    
4138 C C     . GLN B 131 ? 1.2663 0.5139 1.1287 -0.1388 0.0502  -0.0552 131 GLN B C     
4139 O O     . GLN B 131 ? 1.2044 0.5178 1.1306 -0.1746 0.0476  -0.0630 131 GLN B O     
4140 C CB    . GLN B 131 ? 1.4238 0.5441 1.2364 -0.1438 0.0600  -0.0493 131 GLN B CB    
4141 C CG    . GLN B 131 ? 1.4822 0.5454 1.2331 -0.0977 0.0476  -0.0674 131 GLN B CG    
4142 C CD    . GLN B 131 ? 1.5954 0.5841 1.3251 -0.1128 0.0409  -0.0933 131 GLN B CD    
4143 O OE1   . GLN B 131 ? 1.6220 0.6106 1.3930 -0.1642 0.0392  -0.1043 131 GLN B OE1   
4144 N NE2   . GLN B 131 ? 1.6682 0.5955 1.3354 -0.0669 0.0376  -0.1030 131 GLN B NE2   
4153 N N     . HIS B 132 ? 1.1660 0.4281 0.9962 -0.0919 0.0340  -0.0645 132 HIS B N     
4154 C CA    . HIS B 132 ? 1.1281 0.4717 0.9847 -0.0842 0.0126  -0.0844 132 HIS B CA    
4155 C C     . HIS B 132 ? 1.0503 0.4939 0.9456 -0.0751 0.0168  -0.0623 132 HIS B C     
4156 O O     . HIS B 132 ? 1.0128 0.5247 0.9442 -0.0845 0.0035  -0.0723 132 HIS B O     
4157 C CB    . HIS B 132 ? 1.1707 0.4863 0.9713 -0.0381 0.0015  -0.1024 132 HIS B CB    
4158 C CG    . HIS B 132 ? 1.2342 0.4418 0.9863 -0.0455 -0.0049 -0.1311 132 HIS B CG    
4159 N ND1   . HIS B 132 ? 1.3065 0.4128 1.0026 -0.0212 0.0092  -0.1238 132 HIS B ND1   
4160 C CD2   . HIS B 132 ? 1.2733 0.4521 1.0197 -0.0749 -0.0259 -0.1681 132 HIS B CD2   
4161 C CE1   . HIS B 132 ? 1.3997 0.4310 1.0652 -0.0355 0.0010  -0.1533 132 HIS B CE1   
4162 N NE2   . HIS B 132 ? 1.3893 0.4489 1.0767 -0.0715 -0.0215 -0.1838 132 HIS B NE2   
4170 N N     . LEU B 133 ? 1.0569 0.5054 0.9402 -0.0565 0.0328  -0.0328 133 LEU B N     
4171 C CA    . LEU B 133 ? 0.9835 0.5134 0.8970 -0.0541 0.0377  -0.0138 133 LEU B CA    
4172 C C     . LEU B 133 ? 0.9280 0.4871 0.8919 -0.0948 0.0467  -0.0110 133 LEU B C     
4173 O O     . LEU B 133 ? 0.8834 0.5102 0.8824 -0.0979 0.0411  -0.0130 133 LEU B O     
4174 C CB    . LEU B 133 ? 0.9770 0.4997 0.8636 -0.0317 0.0483  0.0141  133 LEU B CB    
4175 C CG    . LEU B 133 ? 1.0230 0.5255 0.8706 0.0145  0.0416  0.0156  133 LEU B CG    
4176 C CD1   . LEU B 133 ? 1.0033 0.5267 0.8398 0.0334  0.0442  0.0436  133 LEU B CD1   
4177 C CD2   . LEU B 133 ? 1.0297 0.5830 0.8823 0.0391  0.0319  -0.0020 133 LEU B CD2   
4189 N N     . CYS B 134 ? 0.9551 0.4614 0.9220 -0.1243 0.0639  -0.0051 134 CYS B N     
4190 C CA    . CYS B 134 ? 0.9180 0.4568 0.9397 -0.1617 0.0801  -0.0017 134 CYS B CA    
4191 C C     . CYS B 134 ? 0.9071 0.5034 0.9871 -0.1782 0.0598  -0.0271 134 CYS B C     
4192 O O     . CYS B 134 ? 0.8589 0.5265 0.9848 -0.1798 0.0600  -0.0240 134 CYS B O     
4193 C CB    . CYS B 134 ? 0.9537 0.4346 0.9671 -0.1886 0.1000  0.0075  134 CYS B CB    
4194 S SG    . CYS B 134 ? 0.9784 0.4215 0.9263 -0.1632 0.1145  0.0411  134 CYS B SG    
4200 N N     . GLU B 135 ? 1.2042 0.7660 1.2780 -0.1887 0.0398  -0.0530 135 GLU B N     
4201 C CA    . GLU B 135 ? 1.1913 0.8074 1.3167 -0.2064 0.0126  -0.0796 135 GLU B CA    
4202 C C     . GLU B 135 ? 1.1890 0.8724 1.3104 -0.1714 -0.0091 -0.0811 135 GLU B C     
4203 O O     . GLU B 135 ? 1.1685 0.9168 1.3387 -0.1786 -0.0289 -0.0921 135 GLU B O     
4204 C CB    . GLU B 135 ? 1.2348 0.7868 1.3354 -0.2237 -0.0085 -0.1106 135 GLU B CB    
4205 C CG    . GLU B 135 ? 1.2680 0.7463 1.3755 -0.2677 0.0141  -0.1103 135 GLU B CG    
4206 C CD    . GLU B 135 ? 1.3635 0.7727 1.4469 -0.2918 -0.0087 -0.1448 135 GLU B CD    
4207 O OE1   . GLU B 135 ? 1.3844 0.7882 1.4276 -0.2662 -0.0395 -0.1688 135 GLU B OE1   
4208 O OE2   . GLU B 135 ? 1.4202 0.8020 1.5180 -0.3216 -0.0037 -0.1383 135 GLU B OE2   
4215 N N     . MET B 136 ? 0.8577 0.5284 0.9231 -0.1331 -0.0054 -0.0688 136 MET B N     
4216 C CA    . MET B 136 ? 0.8516 0.5789 0.9079 -0.1036 -0.0170 -0.0646 136 MET B CA    
4217 C C     . MET B 136 ? 0.8016 0.5731 0.8823 -0.1006 0.0033  -0.0379 136 MET B C     
4218 O O     . MET B 136 ? 0.7891 0.6106 0.8835 -0.0891 -0.0053 -0.0348 136 MET B O     
4219 C CB    . MET B 136 ? 0.8877 0.5886 0.8796 -0.0672 -0.0185 -0.0653 136 MET B CB    
4220 C CG    . MET B 136 ? 0.9228 0.6069 0.8789 -0.0549 -0.0442 -0.0947 136 MET B CG    
4221 S SD    . MET B 136 ? 0.9106 0.6624 0.8785 -0.0489 -0.0711 -0.1029 136 MET B SD    
4222 C CE    . MET B 136 ? 0.8869 0.6757 0.8296 -0.0161 -0.0487 -0.0729 136 MET B CE    
4232 N N     . ALA B 137 ? 0.7723 0.5168 0.8486 -0.1092 0.0295  -0.0186 137 ALA B N     
4233 C CA    . ALA B 137 ? 0.7275 0.5013 0.8166 -0.1091 0.0495  0.0031  137 ALA B CA    
4234 C C     . ALA B 137 ? 0.6939 0.5109 0.8451 -0.1266 0.0543  0.0003  137 ALA B C     
4235 O O     . ALA B 137 ? 0.6651 0.5165 0.8270 -0.1161 0.0616  0.0112  137 ALA B O     
4236 C CB    . ALA B 137 ? 0.7171 0.4449 0.7777 -0.1158 0.0734  0.0216  137 ALA B CB    
4242 N N     . ILE B 138 ? 0.9121 0.7287 1.1076 -0.1531 0.0509  -0.0147 138 ILE B N     
4243 C CA    . ILE B 138 ? 0.8740 0.7467 1.1452 -0.1692 0.0572  -0.0173 138 ILE B CA    
4244 C C     . ILE B 138 ? 0.8780 0.8121 1.1741 -0.1484 0.0242  -0.0280 138 ILE B C     
4245 O O     . ILE B 138 ? 0.8410 0.8237 1.1749 -0.1365 0.0306  -0.0191 138 ILE B O     
4246 C CB    . ILE B 138 ? 0.8842 0.7461 1.2047 -0.2102 0.0637  -0.0307 138 ILE B CB    
4247 C CG1   . ILE B 138 ? 0.8418 0.7801 1.2586 -0.2268 0.0732  -0.0332 138 ILE B CG1   
4248 C CG2   . ILE B 138 ? 0.9365 0.7769 1.2451 -0.2194 0.0272  -0.0578 138 ILE B CG2   
4249 C CD1   . ILE B 138 ? 0.8062 0.7539 1.2321 -0.2200 0.1173  -0.0097 138 ILE B CD1   
4261 N N     . ARG B 139 ? 0.8398 0.7661 1.1068 -0.1399 -0.0107 -0.0467 139 ARG B N     
4262 C CA    . ARG B 139 ? 0.8594 0.8350 1.1335 -0.1178 -0.0451 -0.0557 139 ARG B CA    
4263 C C     . ARG B 139 ? 0.8590 0.8367 1.0860 -0.0832 -0.0362 -0.0343 139 ARG B C     
4264 O O     . ARG B 139 ? 0.8472 0.8662 1.0950 -0.0647 -0.0439 -0.0267 139 ARG B O     
4265 C CB    . ARG B 139 ? 0.9282 0.8815 1.1647 -0.1177 -0.0822 -0.0826 139 ARG B CB    
4266 C CG    . ARG B 139 ? 0.9424 0.8830 1.2198 -0.1581 -0.0943 -0.1076 139 ARG B CG    
4267 C CD    . ARG B 139 ? 0.9947 0.8590 1.2004 -0.1594 -0.1051 -0.1271 139 ARG B CD    
4268 N NE    . ARG B 139 ? 0.9917 0.8152 1.2240 -0.2032 -0.1028 -0.1451 139 ARG B NE    
4269 C CZ    . ARG B 139 ? 1.0150 0.8426 1.2715 -0.2325 -0.1376 -0.1778 139 ARG B CZ    
4270 N NH1   . ARG B 139 ? 1.0304 0.9044 1.2842 -0.2187 -0.1823 -0.1967 139 ARG B NH1   
4271 N NH2   . ARG B 139 ? 1.0358 0.8155 1.3137 -0.2780 -0.1287 -0.1916 139 ARG B NH2   
4285 N N     . SER B 140 ? 0.8374 0.7704 1.0023 -0.0741 -0.0203 -0.0241 140 SER B N     
4286 C CA    . SER B 140 ? 0.8525 0.7857 0.9769 -0.0512 -0.0077 -0.0039 140 SER B CA    
4287 C C     . SER B 140 ? 0.7905 0.7390 0.9457 -0.0531 0.0161  0.0137  140 SER B C     
4288 O O     . SER B 140 ? 0.7873 0.7518 0.9357 -0.0336 0.0145  0.0240  140 SER B O     
4289 C CB    . SER B 140 ? 0.8748 0.7711 0.9488 -0.0483 0.0078  0.0038  140 SER B CB    
4290 O OG    . SER B 140 ? 0.9321 0.8111 0.9726 -0.0385 -0.0095 -0.0128 140 SER B OG    
4296 N N     . LYS B 141 ? 0.8641 0.7985 1.0447 -0.0744 0.0411  0.0179  141 LYS B N     
4297 C CA    . LYS B 141 ? 0.8218 0.7629 1.0244 -0.0750 0.0691  0.0319  141 LYS B CA    
4298 C C     . LYS B 141 ? 0.8239 0.8184 1.0875 -0.0625 0.0587  0.0276  141 LYS B C     
4299 O O     . LYS B 141 ? 0.8215 0.8225 1.0808 -0.0411 0.0683  0.0396  141 LYS B O     
4300 C CB    . LYS B 141 ? 0.7875 0.7017 1.0018 -0.1006 0.0985  0.0353  141 LYS B CB    
4301 C CG    . LYS B 141 ? 0.7536 0.6711 0.9884 -0.1014 0.1330  0.0464  141 LYS B CG    
4302 C CD    . LYS B 141 ? 0.7469 0.6283 0.9763 -0.1268 0.1652  0.0513  141 LYS B CD    
4303 C CE    . LYS B 141 ? 0.7433 0.6246 0.9865 -0.1252 0.2051  0.0603  141 LYS B CE    
4304 N NZ    . LYS B 141 ? 0.7621 0.6059 0.9719 -0.1415 0.2291  0.0639  141 LYS B NZ    
4318 N N     . GLN B 142 ? 0.8105 0.8432 1.1322 -0.0753 0.0376  0.0099  142 GLN B N     
4319 C CA    . GLN B 142 ? 0.7896 0.8898 1.1838 -0.0628 0.0219  0.0047  142 GLN B CA    
4320 C C     . GLN B 142 ? 0.8234 0.9352 1.1825 -0.0244 -0.0066 0.0103  142 GLN B C     
4321 O O     . GLN B 142 ? 0.8076 0.9556 1.2006 0.0018  -0.0076 0.0188  142 GLN B O     
4322 C CB    . GLN B 142 ? 0.7841 0.9257 1.2441 -0.0897 -0.0047 -0.0191 142 GLN B CB    
4323 C CG    . GLN B 142 ? 0.7548 0.9854 1.3082 -0.0795 -0.0264 -0.0264 142 GLN B CG    
4324 C CD    . GLN B 142 ? 0.7596 1.0351 1.3837 -0.1157 -0.0557 -0.0531 142 GLN B CD    
4325 O OE1   . GLN B 142 ? 0.7859 1.0120 1.3784 -0.1474 -0.0589 -0.0667 142 GLN B OE1   
4326 N NE2   . GLN B 142 ? 0.7367 1.1059 1.4586 -0.1110 -0.0783 -0.0614 142 GLN B NE2   
4335 N N     . GLU B 143 ? 0.8779 0.9559 1.1654 -0.0177 -0.0271 0.0073  143 GLU B N     
4336 C CA    . GLU B 143 ? 0.9129 0.9921 1.1536 0.0167  -0.0513 0.0146  143 GLU B CA    
4337 C C     . GLU B 143 ? 0.8921 0.9326 1.0844 0.0348  -0.0206 0.0399  143 GLU B C     
4338 O O     . GLU B 143 ? 0.8854 0.9333 1.0731 0.0652  -0.0260 0.0524  143 GLU B O     
4339 C CB    . GLU B 143 ? 0.9850 1.0379 1.1604 0.0171  -0.0756 0.0025  143 GLU B CB    
4340 C CG    . GLU B 143 ? 1.0226 1.0784 1.1468 0.0506  -0.1056 0.0066  143 GLU B CG    
4341 C CD    . GLU B 143 ? 1.0362 1.1510 1.2143 0.0631  -0.1493 -0.0063 143 GLU B CD    
4342 O OE1   . GLU B 143 ? 1.0224 1.1773 1.2761 0.0370  -0.1615 -0.0263 143 GLU B OE1   
4343 O OE2   . GLU B 143 ? 1.0556 1.1773 1.2010 0.0982  -0.1724 0.0044  143 GLU B OE2   
4350 N N     . LEU B 144 ? 0.7398 0.7357 0.8935 0.0165  0.0097  0.0474  144 LEU B N     
4351 C CA    . LEU B 144 ? 0.7262 0.6807 0.8323 0.0241  0.0376  0.0678  144 LEU B CA    
4352 C C     . LEU B 144 ? 0.7123 0.6720 0.8518 0.0401  0.0553  0.0771  144 LEU B C     
4353 O O     . LEU B 144 ? 0.7409 0.6679 0.8401 0.0609  0.0654  0.0927  144 LEU B O     
4354 C CB    . LEU B 144 ? 0.7060 0.6264 0.7855 -0.0033 0.0627  0.0705  144 LEU B CB    
4355 C CG    . LEU B 144 ? 0.7009 0.5769 0.7285 -0.0064 0.0880  0.0871  144 LEU B CG    
4356 C CD1   . LEU B 144 ? 0.7235 0.5859 0.6970 0.0022  0.0802  0.0957  144 LEU B CD1   
4357 C CD2   . LEU B 144 ? 0.6873 0.5416 0.7036 -0.0338 0.1067  0.0870  144 LEU B CD2   
4369 N N     . LEU B 145 ? 0.5680 0.5646 0.7797 0.0313  0.0632  0.0679  145 LEU B N     
4370 C CA    . LEU B 145 ? 0.5492 0.5561 0.8002 0.0489  0.0878  0.0751  145 LEU B CA    
4371 C C     . LEU B 145 ? 0.5565 0.6198 0.8591 0.0862  0.0608  0.0753  145 LEU B C     
4372 O O     . LEU B 145 ? 0.5775 0.6485 0.9083 0.1133  0.0805  0.0839  145 LEU B O     
4373 C CB    . LEU B 145 ? 0.5198 0.5446 0.8272 0.0221  0.1164  0.0671  145 LEU B CB    
4374 C CG    . LEU B 145 ? 0.5137 0.4823 0.7687 -0.0108 0.1409  0.0686  145 LEU B CG    
4375 C CD1   . LEU B 145 ? 0.5107 0.4926 0.8151 -0.0356 0.1688  0.0630  145 LEU B CD1   
4376 C CD2   . LEU B 145 ? 0.5443 0.4475 0.7251 -0.0049 0.1658  0.0819  145 LEU B CD2   
4388 N N     . GLN B 146 ? 0.6812 0.7826 0.9931 0.0915  0.0149  0.0654  146 GLN B N     
4389 C CA    . GLN B 146 ? 0.8546 1.0160 1.2131 0.1283  -0.0212 0.0648  146 GLN B CA    
4390 C C     . GLN B 146 ? 0.9871 1.1146 1.2618 0.1595  -0.0521 0.0761  146 GLN B C     
4391 O O     . GLN B 146 ? 1.0536 1.2276 1.3484 0.1881  -0.0961 0.0731  146 GLN B O     
4392 C CB    . GLN B 146 ? 0.9107 1.1539 1.3577 0.1070  -0.0552 0.0406  146 GLN B CB    
4393 C CG    . GLN B 146 ? 0.7457 1.0329 1.2884 0.0792  -0.0224 0.0324  146 GLN B CG    
4394 C CD    . GLN B 146 ? 0.7377 1.1201 1.3867 0.0615  -0.0576 0.0102  146 GLN B CD    
4395 O OE1   . GLN B 146 ? 0.6852 1.0699 1.3570 0.0153  -0.0584 -0.0073 146 GLN B OE1   
4396 N NE2   . GLN B 146 ? 0.7407 1.2010 1.4554 0.0980  -0.0885 0.0110  146 GLN B NE2   
4405 N N     . LEU B 147 ? 1.1930 1.2423 1.3735 0.1534  -0.0304 0.0895  147 LEU B N     
4406 C CA    . LEU B 147 ? 1.2645 1.2706 1.3564 0.1798  -0.0479 0.1045  147 LEU B CA    
4407 C C     . LEU B 147 ? 1.1946 1.1472 1.2469 0.2133  -0.0238 0.1301  147 LEU B C     
4408 O O     . LEU B 147 ? 1.1027 1.0197 1.1580 0.2022  0.0174  0.1358  147 LEU B O     
4409 C CB    . LEU B 147 ? 1.2626 1.2198 1.2793 0.1508  -0.0354 0.1042  147 LEU B CB    
4410 C CG    . LEU B 147 ? 1.3955 1.3810 1.4158 0.1293  -0.0613 0.0813  147 LEU B CG    
4411 C CD1   . LEU B 147 ? 1.3536 1.2908 1.2911 0.1174  -0.0457 0.0874  147 LEU B CD1   
4412 C CD2   . LEU B 147 ? 1.4765 1.5074 1.5104 0.1524  -0.1137 0.0684  147 LEU B CD2   
4424 N N     . THR B 148 ? 1.5852 1.5229 1.5905 0.2557  -0.0503 0.1454  148 THR B N     
4425 C CA    . THR B 148 ? 1.5411 1.4098 1.4915 0.2924  -0.0293 0.1724  148 THR B CA    
4426 C C     . THR B 148 ? 1.6203 1.4321 1.4644 0.3168  -0.0478 0.1926  148 THR B C     
4427 O O     . THR B 148 ? 1.6323 1.4776 1.4596 0.3204  -0.0871 0.1843  148 THR B O     
4428 C CB    . THR B 148 ? 1.5724 1.4887 1.5978 0.3406  -0.0397 0.1759  148 THR B CB    
4429 O OG1   . THR B 148 ? 1.5958 1.5903 1.6606 0.3701  -0.0983 0.1690  148 THR B OG1   
4430 C CG2   . THR B 148 ? 1.5085 1.4749 1.6331 0.3168  -0.0107 0.1586  148 THR B CG2   
4438 O OP3   . U   C 1   ? 1.1429 0.5479 0.8401 -0.0147 -0.0238 0.0857  1   U   C OP3   
4439 P P     . U   C 1   ? 1.1267 0.5328 0.8183 -0.0126 0.0185  0.0692  1   U   C P     
4440 O OP1   . U   C 1   ? 1.1319 0.5167 0.8287 -0.0022 0.0351  0.0671  1   U   C OP1   
4441 O OP2   . U   C 1   ? 1.1610 0.5258 0.7855 -0.0248 0.0287  0.0675  1   U   C OP2   
4442 O "O5'" . U   C 1   ? 1.0646 0.5443 0.8244 -0.0100 0.0332  0.0540  1   U   C "O5'" 
4443 C "C5'" . U   C 1   ? 1.0514 0.5676 0.8376 -0.0182 0.0157  0.0553  1   U   C "C5'" 
4444 C "C4'" . U   C 1   ? 1.0086 0.5822 0.8506 -0.0176 0.0355  0.0398  1   U   C "C4'" 
4445 O "O4'" . U   C 1   ? 0.9812 0.5781 0.8763 -0.0061 0.0481  0.0329  1   U   C "O4'" 
4446 C "C3'" . U   C 1   ? 1.0127 0.5883 0.8318 -0.0182 0.0602  0.0285  1   U   C "C3'" 
4447 O "O3'" . U   C 1   ? 1.0398 0.6017 0.8197 -0.0278 0.0547  0.0315  1   U   C "O3'" 
4448 C "C2'" . U   C 1   ? 0.9696 0.5948 0.8445 -0.0168 0.0779  0.0140  1   U   C "C2'" 
4449 O "O2'" . U   C 1   ? 0.9513 0.6061 0.8490 -0.0286 0.0738  0.0108  1   U   C "O2'" 
4450 C "C1'" . U   C 1   ? 0.9593 0.5871 0.8743 -0.0074 0.0764  0.0159  1   U   C "C1'" 
4451 N N1    . U   C 1   ? 0.9777 0.5882 0.8838 0.0003  0.0975  0.0090  1   U   C N1    
4452 C C2    . U   C 1   ? 0.9526 0.5963 0.8898 -0.0011 0.1227  -0.0088 1   U   C C2    
4453 O O2    . U   C 1   ? 0.9282 0.6087 0.8930 -0.0083 0.1284  -0.0178 1   U   C O2    
4454 N N3    . U   C 1   ? 0.9624 0.5907 0.8916 0.0022  0.1430  -0.0176 1   U   C N3    
4455 C C4    . U   C 1   ? 1.0004 0.5798 0.8917 0.0059  0.1444  -0.0110 1   U   C C4    
4456 O O4    . U   C 1   ? 1.0034 0.5734 0.8923 0.0045  0.1688  -0.0236 1   U   C O4    
4457 C C5    . U   C 1   ? 1.0377 0.5780 0.8902 0.0070  0.1181  0.0088  1   U   C C5    
4458 C C6    . U   C 1   ? 1.0247 0.5840 0.8873 0.0044  0.0943  0.0179  1   U   C C6    
4469 P P     . C   C 2   ? 0.9637 0.4982 0.6973 -0.0226 0.0696  0.0279  2   C   C P     
4470 O OP1   . C   C 2   ? 1.0033 0.5122 0.6937 -0.0325 0.0609  0.0344  2   C   C OP1   
4471 O OP2   . C   C 2   ? 0.9848 0.4864 0.6980 -0.0156 0.0793  0.0274  2   C   C OP2   
4472 O "O5'" . C   C 2   ? 0.9323 0.5096 0.6989 -0.0167 0.0858  0.0141  2   C   C "O5'" 
4473 C "C5'" . C   C 2   ? 0.9151 0.5176 0.6926 -0.0258 0.0843  0.0111  2   C   C "C5'" 
4474 C "C4'" . C   C 2   ? 0.8901 0.5262 0.6901 -0.0224 0.0982  -0.0021 2   C   C "C4'" 
4475 O "O4'" . C   C 2   ? 0.8384 0.5012 0.6858 -0.0210 0.1093  -0.0111 2   C   C "O4'" 
4476 C "C3'" . C   C 2   ? 0.9154 0.5471 0.6984 -0.0088 0.1029  -0.0071 2   C   C "C3'" 
4477 O "O3'" . C   C 2   ? 0.9712 0.5814 0.7134 -0.0053 0.0946  -0.0010 2   C   C "O3'" 
4478 C "C2'" . C   C 2   ? 0.8740 0.5468 0.6930 -0.0101 0.1147  -0.0225 2   C   C "C2'" 
4479 O "O2'" . C   C 2   ? 0.8796 0.5655 0.6878 -0.0201 0.1127  -0.0255 2   C   C "O2'" 
4480 C "C1'" . C   C 2   ? 0.8268 0.5089 0.6830 -0.0159 0.1225  -0.0243 2   C   C "C1'" 
4481 N N1    . C   C 2   ? 0.8127 0.4852 0.6799 -0.0077 0.1322  -0.0281 2   C   C N1    
4482 C C2    . C   C 2   ? 0.7981 0.4959 0.6889 -0.0077 0.1494  -0.0452 2   C   C C2    
4483 O O2    . C   C 2   ? 0.7883 0.5163 0.6883 -0.0140 0.1522  -0.0554 2   C   C O2    
4484 N N3    . C   C 2   ? 0.8029 0.4874 0.7000 -0.0043 0.1636  -0.0514 2   C   C N3    
4485 C C4    . C   C 2   ? 0.8269 0.4684 0.7002 -0.0006 0.1599  -0.0393 2   C   C C4    
4486 N N4    . C   C 2   ? 0.8428 0.4622 0.7125 -0.0009 0.1781  -0.0466 2   C   C N4    
4487 C C5    . C   C 2   ? 0.8440 0.4591 0.6897 -0.0002 0.1385  -0.0206 2   C   C C5    
4488 C C6    . C   C 2   ? 0.8335 0.4682 0.6809 -0.0040 0.1258  -0.0165 2   C   C C6    
4500 P P     . G   C 3   ? 1.0362 0.6162 0.7529 0.0119  0.0942  0.0017  3   G   C P     
4501 O OP1   . G   C 3   ? 1.0913 0.6362 0.7604 0.0135  0.0848  0.0122  3   G   C OP1   
4502 O OP2   . G   C 3   ? 1.0314 0.5887 0.7477 0.0108  0.1011  0.0032  3   G   C OP2   
4503 O "O5'" . G   C 3   ? 1.0321 0.6501 0.7808 0.0258  0.0989  -0.0127 3   G   C "O5'" 
4504 C "C5'" . G   C 3   ? 1.0352 0.6775 0.7829 0.0263  0.0895  -0.0161 3   G   C "C5'" 
4505 C "C4'" . G   C 3   ? 1.0079 0.6961 0.7962 0.0335  0.0928  -0.0333 3   G   C "C4'" 
4506 O "O4'" . G   C 3   ? 0.9544 0.6662 0.7777 0.0201  0.1100  -0.0446 3   G   C "O4'" 
4507 C "C3'" . G   C 3   ? 1.0227 0.7165 0.8336 0.0527  0.0968  -0.0417 3   G   C "C3'" 
4508 O "O3'" . G   C 3   ? 1.0820 0.7686 0.8785 0.0730  0.0788  -0.0364 3   G   C "O3'" 
4509 C "C2'" . G   C 3   ? 0.9755 0.7194 0.8355 0.0469  0.1084  -0.0631 3   G   C "C2'" 
4510 O "O2'" . G   C 3   ? 0.9776 0.7595 0.8466 0.0492  0.0911  -0.0705 3   G   C "O2'" 
4511 C "C1'" . G   C 3   ? 0.9372 0.6767 0.7969 0.0263  0.1209  -0.0616 3   G   C "C1'" 
4512 N N9    . G   C 3   ? 0.9240 0.6410 0.7917 0.0231  0.1400  -0.0628 3   G   C N9    
4513 C C8    . G   C 3   ? 0.9325 0.6048 0.7717 0.0207  0.1394  -0.0472 3   G   C C8    
4514 N N7    . G   C 3   ? 0.9287 0.5806 0.7709 0.0172  0.1554  -0.0508 3   G   C N7    
4515 C C5    . G   C 3   ? 0.9130 0.5990 0.7909 0.0159  0.1722  -0.0718 3   G   C C5    
4516 C C6    . G   C 3   ? 0.9086 0.5853 0.7988 0.0092  0.1978  -0.0858 3   G   C C6    
4517 O O6    . G   C 3   ? 0.9208 0.5499 0.7854 0.0043  0.2090  -0.0797 3   G   C O6    
4518 N N1    . G   C 3   ? 0.8946 0.6195 0.8253 0.0055  0.2099  -0.1095 3   G   C N1    
4519 C C2    . G   C 3   ? 0.8898 0.6652 0.8429 0.0091  0.1937  -0.1168 3   G   C C2    
4520 N N2    . G   C 3   ? 0.8772 0.6981 0.8688 0.0018  0.2050  -0.1417 3   G   C N2    
4521 N N3    . G   C 3   ? 0.9005 0.6773 0.8338 0.0168  0.1679  -0.1013 3   G   C N3    
4522 C C4    . G   C 3   ? 0.9097 0.6407 0.8071 0.0194  0.1611  -0.0801 3   G   C C4    
4534 P P     . A   C 4   ? 1.1460 0.8161 0.9562 0.0959  0.0856  -0.0399 4   A   C P     
4535 O OP1   . A   C 4   ? 1.1890 0.8462 0.9804 0.1194  0.0621  -0.0301 4   A   C OP1   
4536 O OP2   . A   C 4   ? 1.1557 0.7778 0.9401 0.0856  0.1049  -0.0335 4   A   C OP2   
4537 O "O5'" . A   C 4   ? 1.1311 0.8587 1.0091 0.0994  0.0982  -0.0658 4   A   C "O5'" 
4538 C "C5'" . A   C 4   ? 1.1404 0.9244 1.0536 0.1066  0.0792  -0.0774 4   A   C "C5'" 
4539 C "C4'" . A   C 4   ? 1.1236 0.9608 1.1021 0.1013  0.0980  -0.1057 4   A   C "C4'" 
4540 O "O4'" . A   C 4   ? 1.0816 0.9157 1.0562 0.0742  0.1217  -0.1117 4   A   C "O4'" 
4541 C "C3'" . A   C 4   ? 1.1446 0.9771 1.1594 0.1128  0.1230  -0.1203 4   A   C "C3'" 
4542 O "O3'" . A   C 4   ? 1.1735 1.0312 1.2267 0.1424  0.1063  -0.1260 4   A   C "O3'" 
4543 C "C2'" . A   C 4   ? 1.1149 0.9831 1.1719 0.0912  0.1514  -0.1465 4   A   C "C2'" 
4544 O "O2'" . A   C 4   ? 1.1099 1.0522 1.2266 0.0943  0.1381  -0.1686 4   A   C "O2'" 
4545 C "C1'" . A   C 4   ? 1.0702 0.9165 1.0844 0.0680  0.1525  -0.1337 4   A   C "C1'" 
4546 N N9    . A   C 4   ? 1.0451 0.8312 1.0216 0.0565  0.1762  -0.1236 4   A   C N9    
4547 C C8    . A   C 4   ? 1.0476 0.7780 0.9697 0.0569  0.1683  -0.0986 4   A   C C8    
4548 N N7    . A   C 4   ? 1.0333 0.7184 0.9298 0.0446  0.1883  -0.0950 4   A   C N7    
4549 C C5    . A   C 4   ? 1.0134 0.7189 0.9446 0.0353  0.2151  -0.1188 4   A   C C5    
4550 C C6    . A   C 4   ? 1.0014 0.6688 0.9174 0.0195  0.2453  -0.1263 4   A   C C6    
4551 N N6    . A   C 4   ? 1.0150 0.6159 0.8753 0.0122  0.2478  -0.1081 4   A   C N6    
4552 N N1    . A   C 4   ? 0.9863 0.6829 0.9418 0.0092  0.2721  -0.1538 4   A   C N1    
4553 C C2    . A   C 4   ? 0.9735 0.7418 0.9870 0.0149  0.2646  -0.1731 4   A   C C2    
4554 N N3    . A   C 4   ? 0.9859 0.7966 1.0178 0.0314  0.2314  -0.1666 4   A   C N3    
4555 C C4    . A   C 4   ? 1.0132 0.7847 0.9980 0.0413  0.2094  -0.1382 4   A   C C4    
4567 P P     . A   C 5   ? 1.2005 1.0333 1.2791 0.1596  0.1332  -0.1360 5   A   C P     
4568 O OP1   . A   C 5   ? 1.2322 1.0975 1.3573 0.1961  0.1071  -0.1391 5   A   C OP1   
4569 O OP2   . A   C 5   ? 1.2145 0.9647 1.2205 0.1494  0.1501  -0.1160 5   A   C OP2   
4570 O "O5'" . A   C 5   ? 1.1646 1.0349 1.3013 0.1405  0.1721  -0.1699 5   A   C "O5'" 
4571 C "C5'" . A   C 5   ? 1.1345 1.0891 1.3506 0.1422  0.1655  -0.1975 5   A   C "C5'" 
4572 C "C4'" . A   C 5   ? 1.1108 1.0823 1.3667 0.1169  0.2123  -0.2298 5   A   C "C4'" 
4573 O "O4'" . A   C 5   ? 1.0862 1.0224 1.2876 0.0852  0.2282  -0.2222 5   A   C "O4'" 
4574 C "C3'" . A   C 5   ? 1.1422 1.0672 1.4002 0.1166  0.2569  -0.2418 5   A   C "C3'" 
4575 O "O3'" . A   C 5   ? 1.1709 1.1404 1.5097 0.1425  0.2606  -0.2641 5   A   C "O3'" 
4576 C "C2'" . A   C 5   ? 1.1118 1.0242 1.3625 0.0794  0.3005  -0.2624 5   A   C "C2'" 
4577 O "O2'" . A   C 5   ? 1.0881 1.0799 1.4262 0.0710  0.3148  -0.3009 5   A   C "O2'" 
4578 C "C1'" . A   C 5   ? 1.0831 0.9799 1.2763 0.0645  0.2773  -0.2383 5   A   C "C1'" 
4579 N N9    . A   C 5   ? 1.0928 0.9010 1.1979 0.0559  0.2833  -0.2095 5   A   C N9    
4580 C C8    . A   C 5   ? 1.1129 0.8818 1.1634 0.0686  0.2536  -0.1766 5   A   C C8    
4581 N N7    . A   C 5   ? 1.1157 0.8130 1.0986 0.0545  0.2644  -0.1588 5   A   C N7    
4582 C C5    . A   C 5   ? 1.0977 0.7776 1.0826 0.0327  0.3031  -0.1787 5   A   C C5    
4583 C C6    . A   C 5   ? 1.0987 0.7044 1.0210 0.0114  0.3264  -0.1715 5   A   C C6    
4584 N N6    . A   C 5   ? 1.1124 0.6559 0.9651 0.0091  0.3099  -0.1423 5   A   C N6    
4585 N N1    . A   C 5   ? 1.0957 0.6907 1.0264 -0.0092 0.3662  -0.1959 5   A   C N1    
4586 C C2    . A   C 5   ? 1.0777 0.7419 1.0847 -0.0102 0.3828  -0.2286 5   A   C C2    
4587 N N3    . A   C 5   ? 1.0672 0.8141 1.1464 0.0092  0.3598  -0.2394 5   A   C N3    
4588 C C4    . A   C 5   ? 1.0839 0.8305 1.1435 0.0316  0.3187  -0.2113 5   A   C C4    
4600 P P     . G   C 6   ? 1.1561 1.1406 1.0563 0.1130  -0.1204 -0.2503 6   G   C P     
4601 O OP1   . G   C 6   ? 1.1744 1.2119 1.1274 0.1247  -0.1550 -0.2626 6   G   C OP1   
4602 O OP2   . G   C 6   ? 1.1487 1.0955 1.0140 0.1305  -0.1030 -0.2200 6   G   C OP2   
4603 O "O5'" . G   C 6   ? 1.0991 1.0913 1.0378 0.0842  -0.0885 -0.2663 6   G   C "O5'" 
4604 C "C5'" . G   C 6   ? 1.0934 1.1193 1.0721 0.0592  -0.0938 -0.2965 6   G   C "C5'" 
4605 C "C4'" . G   C 6   ? 1.0396 1.0445 1.0213 0.0298  -0.0574 -0.3051 6   G   C "C4'" 
4606 O "O4'" . G   C 6   ? 1.0314 0.9749 0.9445 0.0288  -0.0402 -0.2902 6   G   C "O4'" 
4607 C "C3'" . G   C 6   ? 0.9854 0.9950 1.0012 0.0273  -0.0293 -0.2982 6   G   C "C3'" 
4608 O "O3'" . G   C 6   ? 0.9664 1.0323 1.0563 0.0177  -0.0304 -0.3197 6   G   C "O3'" 
4609 C "C2'" . G   C 6   ? 0.9610 0.9197 0.9386 0.0046  0.0025  -0.2958 6   G   C "C2'" 
4610 O "O2'" . G   C 6   ? 0.9665 0.9371 0.9686 -0.0285 0.0129  -0.3223 6   G   C "O2'" 
4611 C "C1'" . G   C 6   ? 0.9794 0.8958 0.8920 0.0148  -0.0067 -0.2844 6   G   C "C1'" 
4612 N N9    . G   C 6   ? 0.9476 0.8265 0.8229 0.0354  0.0045  -0.2551 6   G   C N9    
4613 C C8    . G   C 6   ? 0.9633 0.8371 0.8152 0.0625  -0.0092 -0.2353 6   G   C C8    
4614 N N7    . G   C 6   ? 0.9433 0.7848 0.7718 0.0723  0.0076  -0.2128 6   G   C N7    
4615 C C5    . G   C 6   ? 0.9050 0.7269 0.7380 0.0527  0.0304  -0.2172 6   G   C C5    
4616 C C6    . G   C 6   ? 0.8788 0.6643 0.6941 0.0531  0.0503  -0.1999 6   G   C C6    
4617 O O6    . G   C 6   ? 0.8765 0.6455 0.6761 0.0703  0.0528  -0.1781 6   G   C O6    
4618 N N1    . G   C 6   ? 0.8596 0.6272 0.6771 0.0295  0.0673  -0.2103 6   G   C N1    
4619 C C2    . G   C 6   ? 0.8610 0.6451 0.6984 0.0056  0.0695  -0.2352 6   G   C C2    
4620 N N2    . G   C 6   ? 0.8489 0.6043 0.6786 -0.0177 0.0902  -0.2407 6   G   C N2    
4621 N N3    . G   C 6   ? 0.8800 0.7049 0.7430 0.0036  0.0515  -0.2533 6   G   C N3    
4622 C C4    . G   C 6   ? 0.9060 0.7471 0.7639 0.0291  0.0307  -0.2425 6   G   C C4    
4634 P P     . U   C 7   ? 0.9077 0.9935 1.0411 0.0298  -0.0146 -0.3129 7   U   C P     
4635 O OP1   . U   C 7   ? 0.9060 1.0597 1.1227 0.0233  -0.0219 -0.3402 7   U   C OP1   
4636 O OP2   . U   C 7   ? 0.9147 0.9784 1.0163 0.0628  -0.0268 -0.2847 7   U   C OP2   
4637 O "O5'" . U   C 7   ? 0.8608 0.9043 0.9708 0.0052  0.0274  -0.3093 7   U   C "O5'" 
4638 C "C5'" . U   C 7   ? 0.8452 0.8908 0.9703 -0.0308 0.0489  -0.3315 7   U   C "C5'" 
4639 C "C4'" . U   C 7   ? 0.8155 0.8010 0.8927 -0.0483 0.0827  -0.3196 7   U   C "C4'" 
4640 O "O4'" . U   C 7   ? 0.8285 0.7598 0.8382 -0.0377 0.0763  -0.2982 7   U   C "O4'" 
4641 C "C3'" . U   C 7   ? 0.7821 0.7544 0.8589 -0.0395 0.1020  -0.3055 7   U   C "C3'" 
4642 O "O3'" . U   C 7   ? 0.7473 0.7521 0.8752 -0.0572 0.1248  -0.3259 7   U   C "O3'" 
4643 C "C2'" . U   C 7   ? 0.7913 0.6924 0.7986 -0.0476 0.1186  -0.2857 7   U   C "C2'" 
4644 O "O2'" . U   C 7   ? 0.7994 0.6751 0.7951 -0.0825 0.1458  -0.2989 7   U   C "O2'" 
4645 C "C1'" . U   C 7   ? 0.8107 0.6946 0.7833 -0.0357 0.0964  -0.2773 7   U   C "C1'" 
4646 N N1    . U   C 7   ? 0.8066 0.6788 0.7556 -0.0037 0.0806  -0.2517 7   U   C N1    
4647 C C2    . U   C 7   ? 0.7938 0.6159 0.6988 0.0006  0.0916  -0.2297 7   U   C C2    
4648 O O2    . U   C 7   ? 0.7874 0.5716 0.6678 -0.0183 0.1107  -0.2292 7   U   C O2    
4649 N N3    . U   C 7   ? 0.7934 0.6101 0.6841 0.0273  0.0784  -0.2079 7   U   C N3    
4650 C C4    . U   C 7   ? 0.8037 0.6518 0.7107 0.0493  0.0573  -0.2044 7   U   C C4    
4651 O O4    . U   C 7   ? 0.8054 0.6398 0.6935 0.0690  0.0509  -0.1834 7   U   C O4    
4652 C C5    . U   C 7   ? 0.8188 0.7128 0.7650 0.0460  0.0438  -0.2264 7   U   C C5    
4653 C C6    . U   C 7   ? 0.8185 0.7266 0.7884 0.0202  0.0550  -0.2496 7   U   C C6    
4664 P P     . A   C 8   ? 0.8078 0.8326 0.9675 -0.0384 0.1329  -0.3221 8   A   C P     
4665 O OP1   . A   C 8   ? 0.7926 0.8595 1.0139 -0.0603 0.1586  -0.3506 8   A   C OP1   
4666 O OP2   . A   C 8   ? 0.8206 0.8685 0.9928 -0.0009 0.0987  -0.3093 8   A   C OP2   
4667 O "O5'" . A   C 8   ? 0.8025 0.7579 0.8945 -0.0418 0.1538  -0.2987 8   A   C "O5'" 
4668 C "C5'" . A   C 8   ? 0.8065 0.7204 0.8656 -0.0743 0.1860  -0.3033 8   A   C "C5'" 
4669 C "C4'" . A   C 8   ? 0.8182 0.6648 0.8075 -0.0707 0.1921  -0.2768 8   A   C "C4'" 
4670 O "O4'" . A   C 8   ? 0.8336 0.6539 0.7849 -0.0547 0.1681  -0.2564 8   A   C "O4'" 
4671 C "C3'" . A   C 8   ? 0.8166 0.6600 0.8050 -0.0500 0.1910  -0.2644 8   A   C "C3'" 
4672 O "O3'" . A   C 8   ? 0.8106 0.6532 0.8099 -0.0665 0.2217  -0.2788 8   A   C "O3'" 
4673 C "C2'" . A   C 8   ? 0.8355 0.6202 0.7587 -0.0418 0.1809  -0.2356 8   A   C "C2'" 
4674 O "O2'" . A   C 8   ? 0.8537 0.5827 0.7258 -0.0658 0.2031  -0.2317 8   A   C "O2'" 
4675 C "C1'" . A   C 8   ? 0.8441 0.6292 0.7586 -0.0375 0.1622  -0.2313 8   A   C "C1'" 
4676 N N9    . A   C 8   ? 0.8505 0.6565 0.7753 -0.0068 0.1343  -0.2176 8   A   C N9    
4677 C C8    . A   C 8   ? 0.8464 0.7019 0.8128 0.0092  0.1155  -0.2264 8   A   C C8    
4678 N N7    . A   C 8   ? 0.8467 0.7002 0.8009 0.0341  0.0948  -0.2081 8   A   C N7    
4679 C C5    . A   C 8   ? 0.8519 0.6585 0.7628 0.0343  0.1009  -0.1873 8   A   C C5    
4680 C C6    . A   C 8   ? 0.8552 0.6413 0.7416 0.0528  0.0893  -0.1634 8   A   C C6    
4681 N N6    . A   C 8   ? 0.8600 0.6642 0.7532 0.0741  0.0718  -0.1548 8   A   C N6    
4682 N N1    . A   C 8   ? 0.8544 0.5995 0.7081 0.0477  0.0963  -0.1483 8   A   C N1    
4683 C C2    . A   C 8   ? 0.8564 0.5752 0.6930 0.0261  0.1127  -0.1551 8   A   C C2    
4684 N N3    . A   C 8   ? 0.8569 0.5847 0.7057 0.0056  0.1284  -0.1761 8   A   C N3    
4685 C C4    . A   C 8   ? 0.8549 0.6313 0.7463 0.0107  0.1222  -0.1925 8   A   C C4    
4697 P P     . U   C 9   ? 0.8329 0.6862 0.8505 -0.0462 0.2243  -0.2770 9   U   C P     
4698 O OP1   . U   C 9   ? 0.8475 0.6566 0.8257 -0.0689 0.2582  -0.2808 9   U   C OP1   
4699 O OP2   . U   C 9   ? 0.8166 0.7405 0.9137 -0.0285 0.2148  -0.2955 9   U   C OP2   
4700 O "O5'" . U   C 9   ? 0.8338 0.6582 0.8131 -0.0198 0.1946  -0.2466 9   U   C "O5'" 
4701 C "C5'" . U   C 9   ? 0.8352 0.6324 0.7915 -0.0085 0.1952  -0.2341 9   U   C "C5'" 
4702 C "C4'" . U   C 9   ? 0.8512 0.5933 0.7442 -0.0089 0.1835  -0.2076 9   U   C "C4'" 
4703 O "O4'" . U   C 9   ? 0.8492 0.5963 0.7381 -0.0020 0.1634  -0.1968 9   U   C "O4'" 
4704 C "C3'" . U   C 9   ? 0.8640 0.5900 0.7436 0.0111  0.1677  -0.1892 9   U   C "C3'" 
4705 O "O3'" . U   C 9   ? 0.8881 0.5832 0.7432 0.0015  0.1850  -0.1932 9   U   C "O3'" 
4706 C "C2'" . U   C 9   ? 0.8661 0.5626 0.7083 0.0147  0.1485  -0.1651 9   U   C "C2'" 
4707 O "O2'" . U   C 9   ? 0.8841 0.5287 0.6733 -0.0046 0.1572  -0.1581 9   U   C "O2'" 
4708 C "C1'" . U   C 9   ? 0.8566 0.5795 0.7181 0.0141  0.1437  -0.1717 9   U   C "C1'" 
4709 N N1    . U   C 9   ? 0.8548 0.6140 0.7472 0.0385  0.1222  -0.1664 9   U   C N1    
4710 C C2    . U   C 9   ? 0.8632 0.6069 0.7367 0.0537  0.1053  -0.1436 9   U   C C2    
4711 O O2    . U   C 9   ? 0.8700 0.5777 0.7109 0.0491  0.1046  -0.1286 9   U   C O2    
4712 N N3    . U   C 9   ? 0.8664 0.6385 0.7610 0.0738  0.0888  -0.1393 9   U   C N3    
4713 C C4    . U   C 9   ? 0.8706 0.6830 0.8007 0.0821  0.0824  -0.1543 9   U   C C4    
4714 O O4    . U   C 9   ? 0.8897 0.7167 0.8253 0.1006  0.0649  -0.1463 9   U   C O4    
4715 C C5    . U   C 9   ? 0.8589 0.6921 0.8165 0.0669  0.0974  -0.1785 9   U   C C5    
4716 C C6    . U   C 9   ? 0.8506 0.6570 0.7889 0.0451  0.1190  -0.1838 9   U   C C6    
4727 P P     . U   C 10  ? 0.8236 0.5262 0.6985 0.0210  0.1812  -0.1937 10  U   C P     
4728 O OP1   . U   C 10  ? 0.8473 0.5178 0.6953 0.0042  0.2083  -0.2067 10  U   C OP1   
4729 O OP2   . U   C 10  ? 0.8107 0.5694 0.7489 0.0430  0.1714  -0.2032 10  U   C OP2   
4730 O "O5'" . U   C 10  ? 0.8253 0.4986 0.6682 0.0324  0.1548  -0.1655 10  U   C "O5'" 
4731 C "C5'" . U   C 10  ? 0.8369 0.4617 0.6246 0.0174  0.1511  -0.1509 10  U   C "C5'" 
4732 C "C4'" . U   C 10  ? 0.8224 0.4413 0.6039 0.0310  0.1240  -0.1261 10  U   C "C4'" 
4733 O "O4'" . U   C 10  ? 0.8051 0.4543 0.6104 0.0412  0.1140  -0.1211 10  U   C "O4'" 
4734 C "C3'" . U   C 10  ? 0.8057 0.4327 0.6063 0.0487  0.1123  -0.1189 10  U   C "C3'" 
4735 O "O3'" . U   C 10  ? 0.8168 0.4054 0.5863 0.0403  0.1135  -0.1169 10  U   C "O3'" 
4736 C "C2'" . U   C 10  ? 0.7889 0.4279 0.5984 0.0614  0.0915  -0.0982 10  U   C "C2'" 
4737 O "O2'" . U   C 10  ? 0.7899 0.3982 0.5692 0.0529  0.0803  -0.0818 10  U   C "O2'" 
4738 C "C1'" . U   C 10  ? 0.7859 0.4486 0.6074 0.0605  0.0955  -0.1051 10  U   C "C1'" 
4739 N N1    . U   C 10  ? 0.7744 0.4786 0.6350 0.0767  0.0928  -0.1135 10  U   C N1    
4740 C C2    . U   C 10  ? 0.7673 0.4835 0.6374 0.0943  0.0769  -0.0984 10  U   C C2    
4741 O O2    . U   C 10  ? 0.7608 0.4599 0.6160 0.0960  0.0684  -0.0800 10  U   C O2    
4742 N N3    . U   C 10  ? 0.7674 0.5164 0.6655 0.1092  0.0711  -0.1059 10  U   C N3    
4743 C C4    . U   C 10  ? 0.7721 0.5497 0.6990 0.1090  0.0775  -0.1276 10  U   C C4    
4744 O O4    . U   C 10  ? 0.7855 0.5924 0.7371 0.1248  0.0655  -0.1316 10  U   C O4    
4745 C C5    . U   C 10  ? 0.7668 0.5357 0.6905 0.0889  0.0978  -0.1439 10  U   C C5    
4746 C C6    . U   C 10  ? 0.7717 0.5012 0.6578 0.0735  0.1054  -0.1358 10  U   C C6    
4757 P P     . C   C 11  ? 0.8590 0.4470 0.6448 0.0518  0.1179  -0.1249 11  C   C P     
4758 O OP1   . C   C 11  ? 0.8847 0.4235 0.6248 0.0362  0.1217  -0.1262 11  C   C OP1   
4759 O OP2   . C   C 11  ? 0.8517 0.4763 0.6792 0.0616  0.1341  -0.1458 11  C   C OP2   
4760 O "O5'" . C   C 11  ? 0.8468 0.4473 0.6528 0.0701  0.0952  -0.1047 11  C   C "O5'" 
4761 C "C5'" . C   C 11  ? 0.8503 0.4307 0.6358 0.0642  0.0779  -0.0842 11  C   C "C5'" 
4762 C "C4'" . C   C 11  ? 0.8383 0.4389 0.6491 0.0805  0.0637  -0.0673 11  C   C "C4'" 
4763 O "O4'" . C   C 11  ? 0.8249 0.4596 0.6561 0.0904  0.0632  -0.0664 11  C   C "O4'" 
4764 C "C3'" . C   C 11  ? 0.8435 0.4456 0.6721 0.0963  0.0637  -0.0689 11  C   C "C3'" 
4765 O "O3'" . C   C 11  ? 0.8560 0.4228 0.6669 0.0894  0.0604  -0.0650 11  C   C "O3'" 
4766 C "C2'" . C   C 11  ? 0.8283 0.4548 0.6758 0.1114  0.0534  -0.0535 11  C   C "C2'" 
4767 O "O2'" . C   C 11  ? 0.8232 0.4373 0.6634 0.1053  0.0436  -0.0337 11  C   C "O2'" 
4768 C "C1'" . C   C 11  ? 0.8162 0.4683 0.6684 0.1090  0.0564  -0.0587 11  C   C "C1'" 
4769 N N1    . C   C 11  ? 0.8171 0.4985 0.6923 0.1214  0.0608  -0.0740 11  C   C N1    
4770 C C2    . C   C 11  ? 0.8089 0.5096 0.6978 0.1396  0.0505  -0.0663 11  C   C C2    
4771 O O2    . C   C 11  ? 0.7982 0.4886 0.6771 0.1434  0.0430  -0.0471 11  C   C O2    
4772 N N3    . C   C 11  ? 0.8144 0.5442 0.7266 0.1517  0.0487  -0.0801 11  C   C N3    
4773 C C4    . C   C 11  ? 0.8186 0.5632 0.7481 0.1451  0.0602  -0.1020 11  C   C C4    
4774 N N4    . C   C 11  ? 0.8307 0.6105 0.7922 0.1568  0.0560  -0.1165 11  C   C N4    
4775 C C5    . C   C 11  ? 0.8220 0.5450 0.7355 0.1250  0.0764  -0.1104 11  C   C C5    
4776 C C6    . C   C 11  ? 0.8243 0.5137 0.7071 0.1143  0.0743  -0.0953 11  C   C C6    
4788 P P     . C   C 12  ? 0.8787 0.4297 0.6968 0.1021  0.0669  -0.0749 12  C   C P     
4789 O OP1   . C   C 12  ? 0.9038 0.4096 0.6913 0.0866  0.0656  -0.0751 12  C   C OP1   
4790 O OP2   . C   C 12  ? 0.8822 0.4559 0.7207 0.1121  0.0821  -0.0965 12  C   C OP2   
4791 O "O5'" . C   C 12  ? 0.8655 0.4271 0.7025 0.1205  0.0550  -0.0571 12  C   C "O5'" 
4792 C "C5'" . C   C 12  ? 0.8542 0.4066 0.6841 0.1126  0.0438  -0.0356 12  C   C "C5'" 
4793 C "C4'" . C   C 12  ? 0.8446 0.4074 0.6868 0.1299  0.0381  -0.0204 12  C   C "C4'" 
4794 O "O4'" . C   C 12  ? 0.8294 0.4295 0.6842 0.1399  0.0374  -0.0209 12  C   C "O4'" 
4795 C "C3'" . C   C 12  ? 0.8621 0.4096 0.7087 0.1500  0.0381  -0.0242 12  C   C "C3'" 
4796 O "O3'" . C   C 12  ? 0.8774 0.3818 0.7092 0.1441  0.0374  -0.0183 12  C   C "O3'" 
4797 C "C2'" . C   C 12  ? 0.8616 0.4292 0.7146 0.1674  0.0307  -0.0109 12  C   C "C2'" 
4798 O "O2'" . C   C 12  ? 0.8671 0.4166 0.7067 0.1608  0.0278  0.0114  12  C   C "O2'" 
4799 C "C1'" . C   C 12  ? 0.8418 0.4479 0.7034 0.1617  0.0324  -0.0168 12  C   C "C1'" 
4800 N N1    . C   C 12  ? 0.8508 0.4848 0.7318 0.1743  0.0337  -0.0365 12  C   C N1    
4801 C C2    . C   C 12  ? 0.8580 0.5117 0.7483 0.1950  0.0235  -0.0344 12  C   C C2    
4802 O O2    . C   C 12  ? 0.8632 0.5046 0.7369 0.2018  0.0159  -0.0153 12  C   C O2    
4803 N N3    . C   C 12  ? 0.8642 0.5494 0.7806 0.2055  0.0221  -0.0537 12  C   C N3    
4804 C C4    . C   C 12  ? 0.8657 0.5614 0.7978 0.1949  0.0355  -0.0744 12  C   C C4    
4805 N N4    . C   C 12  ? 0.8738 0.6053 0.8389 0.2035  0.0362  -0.0944 12  C   C N4    
4806 C C5    . C   C 12  ? 0.8619 0.5309 0.7754 0.1737  0.0486  -0.0760 12  C   C C5    
4807 C C6    . C   C 12  ? 0.8570 0.4963 0.7456 0.1648  0.0446  -0.0567 12  C   C C6    
4819 P P     . G   C 13  ? 0.8821 0.3571 0.7144 0.1621  0.0410  -0.0299 13  G   C P     
4820 O OP1   . G   C 13  ? 0.9076 0.3319 0.7177 0.1487  0.0406  -0.0232 13  G   C OP1   
4821 O OP2   . G   C 13  ? 0.8845 0.3781 0.7309 0.1671  0.0518  -0.0554 13  G   C OP2   
4822 O "O5'" . G   C 13  ? 0.8829 0.3669 0.7246 0.1894  0.0316  -0.0176 13  G   C "O5'" 
4823 C "C5'" . G   C 13  ? 0.8867 0.3519 0.7116 0.1879  0.0250  0.0073  13  G   C "C5'" 
4824 C "C4'" . G   C 13  ? 0.8952 0.3683 0.7204 0.2148  0.0146  0.0166  13  G   C "C4'" 
4825 O "O4'" . G   C 13  ? 0.8716 0.3953 0.7121 0.2193  0.0113  0.0103  13  G   C "O4'" 
4826 C "C3'" . G   C 13  ? 0.9215 0.3808 0.7577 0.2438  0.0083  0.0061  13  G   C "C3'" 
4827 O "O3'" . G   C 13  ? 0.9667 0.3681 0.7814 0.2489  0.0073  0.0171  13  G   C "O3'" 
4828 C "C2'" . G   C 13  ? 0.9181 0.4090 0.7613 0.2664  -0.0066 0.0107  13  G   C "C2'" 
4829 O "O2'" . G   C 13  ? 0.9469 0.4058 0.7557 0.2725  -0.0155 0.0367  13  G   C "O2'" 
4830 C "C1'" . G   C 13  ? 0.8847 0.4221 0.7367 0.2478  -0.0011 0.0054  13  G   C "C1'" 
4831 N N9    . G   C 13  ? 0.8715 0.4515 0.7587 0.2514  0.0021  -0.0208 13  G   C N9    
4832 C C8    . G   C 13  ? 0.8594 0.4492 0.7586 0.2330  0.0176  -0.0386 13  G   C C8    
4833 N N7    . G   C 13  ? 0.8546 0.4829 0.7850 0.2390  0.0207  -0.0602 13  G   C N7    
4834 C C5    . G   C 13  ? 0.8615 0.5108 0.8063 0.2637  0.0027  -0.0572 13  G   C C5    
4835 C C6    . G   C 13  ? 0.8606 0.5571 0.8451 0.2786  -0.0050 -0.0756 13  G   C C6    
4836 O O6    . G   C 13  ? 0.8524 0.5827 0.8699 0.2713  0.0073  -0.0992 13  G   C O6    
4837 N N1    . G   C 13  ? 0.8744 0.5757 0.8568 0.3028  -0.0298 -0.0644 13  G   C N1    
4838 C C2    . G   C 13  ? 0.8963 0.5564 0.8367 0.3107  -0.0419 -0.0377 13  G   C C2    
4839 N N2    . G   C 13  ? 0.9254 0.5901 0.8600 0.3345  -0.0673 -0.0293 13  G   C N2    
4840 N N3    . G   C 13  ? 0.8920 0.5084 0.7974 0.2950  -0.0302 -0.0206 13  G   C N3    
4841 C C4    . G   C 13  ? 0.8744 0.4908 0.7877 0.2723  -0.0098 -0.0322 13  G   C C4    
4853 P P     . C   C 14  ? 1.0366 0.4084 0.8634 0.2670  0.0106  -0.0014 14  C   C P     
4854 O OP1   . C   C 14  ? 1.0877 0.4055 0.8900 0.2575  0.0111  0.0128  14  C   C OP1   
4855 O OP2   . C   C 14  ? 1.0055 0.4041 0.8532 0.2535  0.0251  -0.0278 14  C   C OP2   
4856 O "O5'" . C   C 14  ? 1.0454 0.4448 0.8987 0.3031  -0.0055 -0.0046 14  C   C "O5'" 
4857 C "C5'" . C   C 14  ? 1.0834 0.4644 0.9174 0.3169  -0.0224 0.0187  14  C   C "C5'" 
4858 C "C4'" . C   C 14  ? 1.0965 0.5174 0.9559 0.3473  -0.0423 0.0143  14  C   C "C4'" 
4859 O "O4'" . C   C 14  ? 1.0583 0.5265 0.9300 0.3449  -0.0428 0.0043  14  C   C "O4'" 
4860 C "C3'" . C   C 14  ? 1.0887 0.5318 0.9984 0.3715  -0.0449 -0.0084 14  C   C "C3'" 
4861 O "O3'" . C   C 14  ? 1.1477 0.5525 1.0528 0.3862  -0.0524 0.0014  14  C   C "O3'" 
4862 C "C2'" . C   C 14  ? 1.0784 0.5792 1.0184 0.3914  -0.0633 -0.0168 14  C   C "C2'" 
4863 O "O2'" . C   C 14  ? 1.1037 0.5944 1.0235 0.4102  -0.0900 0.0041  14  C   C "O2'" 
4864 C "C1'" . C   C 14  ? 1.0385 0.5547 0.9563 0.3697  -0.0555 -0.0150 14  C   C "C1'" 
4865 N N1    . C   C 14  ? 0.9855 0.5474 0.9420 0.3543  -0.0366 -0.0428 14  C   C N1    
4866 C C2    . C   C 14  ? 0.9648 0.5879 0.9700 0.3672  -0.0448 -0.0630 14  C   C C2    
4867 O O2    . C   C 14  ? 0.9759 0.6131 0.9909 0.3936  -0.0715 -0.0576 14  C   C O2    
4868 N N3    . C   C 14  ? 0.9430 0.6060 0.9812 0.3492  -0.0242 -0.0879 14  C   C N3    
4869 C C4    . C   C 14  ? 0.9383 0.5788 0.9566 0.3216  0.0007  -0.0918 14  C   C C4    
4870 N N4    . C   C 14  ? 0.9272 0.6008 0.9699 0.3038  0.0209  -0.1150 14  C   C N4    
4871 C C5    . C   C 14  ? 0.9499 0.5312 0.9206 0.3092  0.0051  -0.0720 14  C   C C5    
4872 C C6    . C   C 14  ? 0.9682 0.5137 0.9126 0.3253  -0.0125 -0.0486 14  C   C C6    
4884 P P     . G   C 15  ? 1.1380 0.5350 1.0826 0.3976  -0.0392 -0.0211 15  G   C P     
4885 O OP1   . G   C 15  ? 1.2071 0.5536 1.1339 0.4109  -0.0490 -0.0042 15  G   C OP1   
4886 O OP2   . G   C 15  ? 1.1105 0.5005 1.0521 0.3710  -0.0127 -0.0390 15  G   C OP2   
4887 O "O5'" . G   C 15  ? 1.1158 0.5780 1.1244 0.4255  -0.0475 -0.0428 15  G   C "O5'" 
4888 C "C5'" . G   C 15  ? 1.1435 0.6233 1.1660 0.4543  -0.0765 -0.0318 15  G   C "C5'" 
4889 C "C4'" . G   C 15  ? 1.1451 0.6970 1.2352 0.4738  -0.0826 -0.0563 15  G   C "C4'" 
4890 O "O4'" . G   C 15  ? 1.0803 0.6754 1.1724 0.4572  -0.0801 -0.0659 15  G   C "O4'" 
4891 C "C3'" . G   C 15  ? 1.1344 0.7078 1.2821 0.4799  -0.0562 -0.0865 15  G   C "C3'" 
4892 O "O3'" . G   C 15  ? 1.1946 0.7471 1.3654 0.5060  -0.0598 -0.0851 15  G   C "O3'" 
4893 C "C2'" . G   C 15  ? 1.0828 0.7355 1.2858 0.4842  -0.0587 -0.1095 15  G   C "C2'" 
4894 O "O2'" . G   C 15  ? 1.0807 0.7719 1.3234 0.5141  -0.0900 -0.1074 15  G   C "O2'" 
4895 C "C1'" . G   C 15  ? 1.0660 0.7209 1.2242 0.4616  -0.0667 -0.0981 15  G   C "C1'" 
4896 N N9    . G   C 15  ? 1.0030 0.6568 1.1508 0.4321  -0.0352 -0.1141 15  G   C N9    
4897 C C8    . G   C 15  ? 0.9910 0.5915 1.0824 0.4067  -0.0196 -0.1027 15  G   C C8    
4898 N N7    . G   C 15  ? 0.9581 0.5692 1.0497 0.3844  0.0049  -0.1216 15  G   C N7    
4899 C C5    . G   C 15  ? 0.9426 0.6186 1.0960 0.3937  0.0088  -0.1480 15  G   C C5    
4900 C C6    . G   C 15  ? 0.9278 0.6422 1.1065 0.3720  0.0350  -0.1746 15  G   C C6    
4901 O O6    . G   C 15  ? 0.9186 0.6147 1.0631 0.3388  0.0585  -0.1772 15  G   C O6    
4902 N N1    . G   C 15  ? 0.9095 0.6909 1.1596 0.3879  0.0319  -0.1975 15  G   C N1    
4903 C C2    . G   C 15  ? 0.9093 0.7206 1.1989 0.4180  0.0040  -0.1916 15  G   C C2    
4904 N N2    . G   C 15  ? 0.8881 0.7706 1.2492 0.4246  0.0041  -0.2151 15  G   C N2    
4905 N N3    . G   C 15  ? 0.9288 0.7019 1.1888 0.4377  -0.0224 -0.1644 15  G   C N3    
4906 C C4    . G   C 15  ? 0.9554 0.6615 1.1477 0.4230  -0.0163 -0.1439 15  G   C C4    
4918 P P     . U   C 16  ? 1.2117 1.1364 1.4468 0.2580  0.5633  0.0610  16  U   C P     
4919 O OP1   . U   C 16  ? 1.2458 1.1389 1.4567 0.3352  0.6793  0.1604  16  U   C OP1   
4920 O OP2   . U   C 16  ? 1.2837 1.0220 1.5331 0.1997  0.5015  -0.0408 16  U   C OP2   
4921 O "O5'" . U   C 16  ? 1.1798 1.2120 1.3367 0.2649  0.5196  0.0761  16  U   C "O5'" 
4922 C "C5'" . U   C 16  ? 1.0683 1.3228 1.2034 0.3080  0.5581  0.1570  16  U   C "C5'" 
4923 C "C4'" . U   C 16  ? 1.0188 1.3575 1.0855 0.2921  0.5059  0.1426  16  U   C "C4'" 
4924 O "O4'" . U   C 16  ? 1.0035 1.3750 1.1100 0.2131  0.4208  0.0492  16  U   C "O4'" 
4925 C "C3'" . U   C 16  ? 1.1170 1.2796 1.0964 0.3042  0.4888  0.1319  16  U   C "C3'" 
4926 O "O3'" . U   C 16  ? 1.0926 1.2434 1.0087 0.3785  0.5603  0.2241  16  U   C "O3'" 
4927 C "C2'" . U   C 16  ? 1.0910 1.3367 1.0358 0.2567  0.4149  0.0818  16  U   C "C2'" 
4928 O "O2'" . U   C 16  ? 0.9624 1.4137 0.8659 0.2819  0.4392  0.1423  16  U   C "O2'" 
4929 C "C1'" . U   C 16  ? 1.0537 1.3643 1.0894 0.1913  0.3675  0.0117  16  U   C "C1'" 
4930 N N1    . U   C 16  ? 1.1757 1.2996 1.2334 0.1422  0.2989  -0.0777 16  U   C N1    
4931 C C2    . U   C 16  ? 1.1926 1.2836 1.2082 0.1058  0.2357  -0.1300 16  U   C C2    
4932 O O2    . U   C 16  ? 1.1516 1.3507 1.1145 0.1049  0.2362  -0.1126 16  U   C O2    
4933 N N3    . U   C 16  ? 1.2215 1.1566 1.2587 0.0716  0.1762  -0.2028 16  U   C N3    
4934 C C4    . U   C 16  ? 1.2067 1.0300 1.3030 0.0635  0.1709  -0.2352 16  U   C C4    
4935 O O4    . U   C 16  ? 1.1477 0.8622 1.2566 0.0339  0.1126  -0.3005 16  U   C O4    
4936 C C5    . U   C 16  ? 1.2347 1.0898 1.3722 0.0934  0.2406  -0.1857 16  U   C C5    
4937 C C6    . U   C 16  ? 1.2325 1.2284 1.3490 0.1345  0.3022  -0.1064 16  U   C C6    
4948 P P     . A   C 17  ? 1.2156 1.1189 1.0682 0.4074  0.5923  0.2234  17  A   C P     
4949 O OP1   . A   C 17  ? 1.3028 1.2049 1.1214 0.4713  0.6474  0.3256  17  A   C OP1   
4950 O OP2   . A   C 17  ? 1.2946 1.0122 1.2022 0.3553  0.5636  0.1389  17  A   C OP2   
4951 O "O5'" . A   C 17  ? 1.2164 1.1056 0.9901 0.3815  0.5195  0.1842  17  A   C "O5'" 
4952 C "C5'" . A   C 17  ? 1.1555 1.2195 0.8742 0.4064  0.5192  0.2372  17  A   C "C5'" 
4953 C "C4'" . A   C 17  ? 1.1287 1.1760 0.7904 0.3621  0.4456  0.1758  17  A   C "C4'" 
4954 O "O4'" . A   C 17  ? 1.1269 1.2047 0.8508 0.2870  0.3735  0.0911  17  A   C "O4'" 
4955 C "C3'" . A   C 17  ? 1.2811 1.0972 0.8866 0.3552  0.4163  0.1349  17  A   C "C3'" 
4956 O "O3'" . A   C 17  ? 1.3012 1.0781 0.8237 0.4168  0.4698  0.2016  17  A   C "O3'" 
4957 C "C2'" . A   C 17  ? 1.2811 1.1024 0.8727 0.2914  0.3250  0.0574  17  A   C "C2'" 
4958 O "O2'" . A   C 17  ? 1.1923 1.1362 0.7135 0.3009  0.3229  0.0867  17  A   C "O2'" 
4959 C "C1'" . A   C 17  ? 1.2204 1.1595 0.9058 0.2462  0.3026  0.0210  17  A   C "C1'" 
4960 N N9    . A   C 17  ? 1.2961 1.0924 1.0458 0.2070  0.2609  -0.0503 17  A   C N9    
4961 C C8    . A   C 17  ? 1.3081 1.0516 1.1285 0.2110  0.2913  -0.0526 17  A   C C8    
4962 N N7    . A   C 17  ? 1.2964 0.9280 1.1619 0.1672  0.2383  -0.1291 17  A   C N7    
4963 C C5    . A   C 17  ? 1.2847 0.8903 1.1052 0.1394  0.1703  -0.1732 17  A   C C5    
4964 C C6    . A   C 17  ? 1.2193 0.7327 1.0531 0.0996  0.0968  -0.2487 17  A   C C6    
4965 N N6    . A   C 17  ? 1.1612 0.6012 1.0617 0.0754  0.0731  -0.3011 17  A   C N6    
4966 N N1    . A   C 17  ? 1.2142 0.7207 0.9891 0.0881  0.0516  -0.2663 17  A   C N1    
4967 C C2    . A   C 17  ? 1.2634 0.8514 0.9717 0.1069  0.0768  -0.2194 17  A   C C2    
4968 N N3    . A   C 17  ? 1.2936 0.9878 0.9834 0.1419  0.1401  -0.1511 17  A   C N3    
4969 C C4    . A   C 17  ? 1.3067 1.0039 1.0554 0.1606  0.1853  -0.1273 17  A   C C4    
4981 P P     . C   C 18  ? 1.6116 1.1379 1.0928 0.4317  0.4913  0.1850  18  C   C P     
4982 O OP1   . C   C 18  ? 1.6103 1.1391 1.0195 0.5095  0.5735  0.2770  18  C   C OP1   
4983 O OP2   . C   C 18  ? 1.6538 1.0599 1.2123 0.4053  0.5037  0.1404  18  C   C OP2   
4984 O "O5'" . C   C 18  ? 1.6554 1.0971 1.0875 0.3793  0.3965  0.1058  18  C   C "O5'" 
4985 C "C5'" . C   C 18  ? 1.5891 1.1385 0.9575 0.3776  0.3623  0.1178  18  C   C "C5'" 
4986 C "C4'" . C   C 18  ? 1.6131 1.0826 0.9615 0.3201  0.2709  0.0348  18  C   C "C4'" 
4987 O "O4'" . C   C 18  ? 1.5741 1.0863 1.0044 0.2664  0.2214  -0.0242 18  C   C "O4'" 
4988 C "C3'" . C   C 18  ? 1.6890 0.9508 1.0106 0.3102  0.2468  -0.0137 18  C   C "C3'" 
4989 O "O3'" . C   C 18  ? 1.7431 0.9377 0.9717 0.3455  0.2697  0.0184  18  C   C "O3'" 
4990 C "C2'" . C   C 18  ? 1.6393 0.8773 0.9822 0.2526  0.1558  -0.0932 18  C   C "C2'" 
4991 O "O2'" . C   C 18  ? 1.6254 0.8939 0.8959 0.2461  0.1183  -0.0944 18  C   C "O2'" 
4992 C "C1'" . C   C 18  ? 1.5816 0.9543 1.0125 0.2281  0.1535  -0.0989 18  C   C "C1'" 
4993 N N1    . C   C 18  ? 1.5509 0.8603 1.0681 0.2068  0.1488  -0.1404 18  C   C N1    
4994 C C2    . C   C 18  ? 1.5126 0.7496 1.0600 0.1646  0.0776  -0.2159 18  C   C C2    
4995 O O2    . C   C 18  ? 1.4970 0.7166 0.9968 0.1511  0.0250  -0.2401 18  C   C O2    
4996 N N3    . C   C 18  ? 1.4821 0.6758 1.1088 0.1426  0.0714  -0.2579 18  C   C N3    
4997 C C4    . C   C 18  ? 1.5000 0.7054 1.1747 0.1580  0.1363  -0.2287 18  C   C C4    
4998 N N4    . C   C 18  ? 1.4537 0.6376 1.2171 0.1281  0.1247  -0.2720 18  C   C N4    
4999 C C5    . C   C 18  ? 1.5488 0.8174 1.1934 0.2061  0.2145  -0.1457 18  C   C C5    
5000 C C6    . C   C 18  ? 1.5687 0.8945 1.1353 0.2306  0.2161  -0.1035 18  C   C C6    
5012 P P     . G   C 19  ? 1.8786 0.8726 1.0779 0.3525  0.2920  -0.0077 19  G   C P     
5013 O OP1   . G   C 19  ? 1.9375 0.9088 1.0496 0.4034  0.3448  0.0539  19  G   C OP1   
5014 O OP2   . G   C 19  ? 1.8594 0.8324 1.1575 0.3305  0.3244  -0.0204 19  G   C OP2   
5015 O "O5'" . G   C 19  ? 1.8150 0.7880 1.0291 0.2844  0.1858  -0.0828 19  G   C "O5'" 
5016 C "C5'" . G   C 19  ? 1.7720 0.7174 1.0658 0.2345  0.1545  -0.1316 19  G   C "C5'" 
5017 C "C4'" . G   C 19  ? 1.6943 0.6878 1.0382 0.1879  0.0657  -0.1855 19  G   C "C4'" 
5018 O "O4'" . G   C 19  ? 1.6291 0.6811 1.0355 0.1715  0.0416  -0.2057 19  G   C "O4'" 
5019 C "C3'" . G   C 19  ? 1.6894 0.6838 1.1176 0.1488  0.0409  -0.2374 19  G   C "C3'" 
5020 O "O3'" . G   C 19  ? 1.7350 0.6943 1.1082 0.1505  0.0342  -0.2368 19  G   C "O3'" 
5021 C "C2'" . G   C 19  ? 1.6122 0.6820 1.1151 0.1163  -0.0155 -0.2743 19  G   C "C2'" 
5022 O "O2'" . G   C 19  ? 1.5899 0.6808 1.0431 0.1158  -0.0614 -0.2668 19  G   C "O2'" 
5023 C "C1'" . G   C 19  ? 1.5767 0.6731 1.0858 0.1277  -0.0044 -0.2561 19  G   C "C1'" 
5024 N N9    . G   C 19  ? 1.5675 0.6731 1.1691 0.1146  0.0200  -0.2789 19  G   C N9    
5025 C C8    . G   C 19  ? 1.6075 0.6736 1.1934 0.1425  0.0800  -0.2486 19  G   C C8    
5026 N N7    . G   C 19  ? 1.5911 0.6723 1.2679 0.1245  0.0857  -0.2757 19  G   C N7    
5027 C C5    . G   C 19  ? 1.5314 0.6732 1.2954 0.0820  0.0313  -0.3310 19  G   C C5    
5028 C C6    . G   C 19  ? 1.4930 0.6864 1.3656 0.0462  0.0250  -0.3732 19  G   C C6    
5029 O O6    . G   C 19  ? 1.5131 0.6931 1.4111 0.0626  0.0055  -0.3734 19  G   C O6    
5030 N N1    . G   C 19  ? 1.4939 0.6999 1.3251 0.0038  0.0184  -0.3884 19  G   C N1    
5031 C C2    . G   C 19  ? 1.4911 0.7019 1.2675 0.0142  -0.0228 -0.3811 19  G   C C2    
5032 N N2    . G   C 19  ? 1.4785 0.7123 1.2388 -0.0043 -0.0604 -0.3951 19  G   C N2    
5033 N N3    . G   C 19  ? 1.4991 0.6903 1.2194 0.0476  -0.0328 -0.3500 19  G   C N3    
5034 C C4    . G   C 19  ? 1.5231 0.6768 1.2306 0.0764  0.0011  -0.3260 19  G   C C4    
5046 P P     . U   C 20  ? 2.1258 1.0241 1.5142 0.1441  0.0778  -0.2558 20  U   C P     
5047 O OP1   . U   C 20  ? 2.1827 1.0394 1.4766 0.1599  0.0808  -0.2337 20  U   C OP1   
5048 O OP2   . U   C 20  ? 2.1688 1.0293 1.5766 0.1597  0.1464  -0.2328 20  U   C OP2   
5049 O "O5'" . U   C 20  ? 2.1050 1.0491 1.5961 0.0994  0.0368  -0.3307 20  U   C "O5'" 
5050 C "C5'" . U   C 20  ? 2.1155 1.0716 1.5851 0.0836  0.0019  -0.3591 20  U   C "C5'" 
5051 C "C4'" . U   C 20  ? 2.0603 1.0864 1.5830 0.0544  -0.0421 -0.3986 20  U   C "C4'" 
5052 O "O4'" . U   C 20  ? 2.1127 1.1418 1.6529 0.0255  -0.0453 -0.4581 20  U   C "O4'" 
5053 C "C3'" . U   C 20  ? 2.0163 1.0718 1.4773 0.0696  -0.0961 -0.3642 20  U   C "C3'" 
5054 O "O3'" . U   C 20  ? 1.9462 1.0328 1.4189 0.0806  -0.1052 -0.3329 20  U   C "O3'" 
5055 C "C2'" . U   C 20  ? 2.0347 1.1239 1.5124 0.0469  -0.1328 -0.4072 20  U   C "C2'" 
5056 O "O2'" . U   C 20  ? 2.0042 1.1348 1.5484 0.0256  -0.1345 -0.4303 20  U   C "O2'" 
5057 C "C1'" . U   C 20  ? 2.1077 1.1679 1.5986 0.0231  -0.0982 -0.4579 20  U   C "C1'" 
5058 N N1    . U   C 20  ? 2.1531 1.1760 1.5647 0.0402  -0.1082 -0.4428 20  U   C N1    
5059 C C2    . U   C 20  ? 2.1890 1.2301 1.5590 0.0348  -0.1508 -0.4643 20  U   C C2    
5060 O O2    . U   C 20  ? 2.1953 1.2808 1.5832 0.0206  -0.1846 -0.4927 20  U   C O2    
5061 N N3    . U   C 20  ? 2.2260 1.2291 1.5238 0.0508  -0.1540 -0.4478 20  U   C N3    
5062 C C4    . U   C 20  ? 2.2323 1.1779 1.4878 0.0707  -0.1183 -0.4102 20  U   C C4    
5063 O O4    . U   C 20  ? 2.2681 1.1822 1.4540 0.0823  -0.1240 -0.3979 20  U   C O4    
5064 C C5    . U   C 20  ? 2.2107 1.1369 1.5004 0.0791  -0.0761 -0.3857 20  U   C C5    
5065 C C6    . U   C 20  ? 2.1685 1.1352 1.5373 0.0642  -0.0744 -0.4038 20  U   C C6    
5066 P P     . U   C 21  ? 2.3424 2.3690 3.4211 -0.9300 -0.1298 1.2316  21  U   C P     
5067 O OP1   . U   C 21  ? 2.3164 2.3857 3.4377 -0.9381 -0.1332 1.2248  21  U   C OP1   
5068 O OP2   . U   C 21  ? 2.3596 2.3669 3.4089 -0.9205 -0.1335 1.2477  21  U   C OP2   
5069 O "O5'" . U   C 21  ? 2.3123 2.3563 3.4005 -0.9184 -0.1527 1.2352  21  U   C "O5'" 
5070 C "C5'" . U   C 21  ? 2.2706 2.3585 3.3935 -0.9155 -0.1738 1.2336  21  U   C "C5'" 
5071 C "C4'" . U   C 21  ? 2.2487 2.3492 3.3775 -0.9018 -0.1897 1.2420  21  U   C "C4'" 
5072 O "O4'" . U   C 21  ? 2.2218 2.3413 3.3631 -0.8930 -0.2087 1.2450  21  U   C "O4'" 
5073 C "C3'" . U   C 21  ? 2.2637 2.3435 3.3635 -0.8971 -0.1908 1.2492  21  U   C "C3'" 
5074 O "O3'" . U   C 21  ? 2.2915 2.3544 3.3762 -0.9054 -0.1741 1.2496  21  U   C "O3'" 
5075 C "C2'" . U   C 21  ? 2.2415 2.3375 3.3500 -0.8914 -0.2049 1.2497  21  U   C "C2'" 
5076 O "O2'" . U   C 21  ? 2.2457 2.3413 3.3644 -0.8943 -0.1934 1.2461  21  U   C "O2'" 
5077 C "C1'" . U   C 21  ? 2.2179 2.3296 3.3455 -0.8854 -0.2161 1.2479  21  U   C "C1'" 
5078 N N1    . U   C 21  ? 2.2141 2.3224 3.3312 -0.8815 -0.2261 1.2502  21  U   C N1    
5079 C C2    . U   C 21  ? 2.1999 2.3171 3.3274 -0.8800 -0.2331 1.2463  21  U   C C2    
5080 O O2    . U   C 21  ? 2.1908 2.3257 3.3364 -0.8831 -0.2352 1.2458  21  U   C O2    
5081 N N3    . U   C 21  ? 2.2012 2.3110 3.3206 -0.8767 -0.2373 1.2482  21  U   C N3    
5082 C C4    . U   C 21  ? 2.2136 2.3183 3.3239 -0.8729 -0.2389 1.2615  21  U   C C4    
5083 O O4    . U   C 21  ? 2.2156 2.3190 3.3281 -0.8687 -0.2418 1.2682  21  U   C O4    
5084 C C5    . U   C 21  ? 2.2278 2.3334 3.3293 -0.8760 -0.2366 1.2711  21  U   C C5    
5085 C C6    . U   C 21  ? 2.2282 2.3308 3.3298 -0.8810 -0.2286 1.2613  21  U   C C6    
5086 O OP3   . C   D 1   ? 1.0383 0.5384 0.8844 0.2977  0.2423  0.1374  1   C   D OP3   
5087 P P     . C   D 1   ? 1.0088 0.5209 0.9414 0.2671  0.2332  0.1304  1   C   D P     
5088 O OP1   . C   D 1   ? 1.0101 0.5188 1.0236 0.2612  0.2332  0.1513  1   C   D OP1   
5089 O OP2   . C   D 1   ? 0.9896 0.5335 0.9577 0.2846  0.2495  0.1479  1   C   D OP2   
5090 O "O5'" . C   D 1   ? 1.0121 0.5071 0.8983 0.2234  0.2017  0.0766  1   C   D "O5'" 
5091 C "C5'" . C   D 1   ? 1.0228 0.5010 0.9196 0.1952  0.1815  0.0567  1   C   D "C5'" 
5092 C "C4'" . C   D 1   ? 1.0262 0.5057 0.8889 0.1628  0.1582  0.0154  1   C   D "C4'" 
5093 O "O4'" . C   D 1   ? 1.0072 0.5102 0.9245 0.1580  0.1559  0.0058  1   C   D "O4'" 
5094 C "C3'" . C   D 1   ? 1.0473 0.5212 0.8267 0.1578  0.1536  -0.0006 1   C   D "C3'" 
5095 O "O3'" . C   D 1   ? 1.0744 0.5192 0.7963 0.1512  0.1448  -0.0063 1   C   D "O3'" 
5096 C "C2'" . C   D 1   ? 1.0388 0.5345 0.8232 0.1335  0.1393  -0.0276 1   C   D "C2'" 
5097 O "O2'" . C   D 1   ? 1.0440 0.5368 0.8182 0.1102  0.1214  -0.0462 1   C   D "O2'" 
5098 C "C1'" . C   D 1   ? 1.0135 0.5279 0.8801 0.1439  0.1471  -0.0195 1   C   D "C1'" 
5099 N N1    . C   D 1   ? 1.0079 0.5414 0.8823 0.1628  0.1636  -0.0054 1   C   D N1    
5100 C C2    . C   D 1   ? 1.0107 0.5646 0.8587 0.1521  0.1571  -0.0254 1   C   D C2    
5101 O O2    . C   D 1   ? 1.0118 0.5692 0.8329 0.1285  0.1394  -0.0513 1   C   D O2    
5102 N N3    . C   D 1   ? 1.0176 0.5931 0.8715 0.1709  0.1719  -0.0116 1   C   D N3    
5103 C C4    . C   D 1   ? 1.0102 0.5898 0.8938 0.2019  0.1941  0.0231  1   C   D C4    
5104 N N4    . C   D 1   ? 1.0089 0.6166 0.8960 0.2238  0.2095  0.0390  1   C   D N4    
5105 C C5    . C   D 1   ? 1.0023 0.5643 0.9152 0.2153  0.2034  0.0479  1   C   D C5    
5106 C C6    . C   D 1   ? 1.0049 0.5428 0.9126 0.1936  0.1868  0.0313  1   C   D C6    
5118 P P     . G   D 2   ? 0.9973 0.4231 0.6439 0.1598  0.1410  -0.0141 2   G   D P     
5119 O OP1   . G   D 2   ? 1.0253 0.4139 0.6325 0.1515  0.1300  -0.0193 2   G   D OP1   
5120 O OP2   . G   D 2   ? 1.0110 0.4482 0.6551 0.1993  0.1601  0.0052  2   G   D OP2   
5121 O "O5'" . G   D 2   ? 0.9879 0.4339 0.6200 0.1323  0.1257  -0.0374 2   G   D "O5'" 
5122 C "C5'" . G   D 2   ? 0.9776 0.4282 0.6098 0.0996  0.1103  -0.0512 2   G   D "C5'" 
5123 C "C4'" . G   D 2   ? 0.9866 0.4646 0.6077 0.0812  0.1006  -0.0645 2   G   D "C4'" 
5124 O "O4'" . G   D 2   ? 0.9641 0.4771 0.6227 0.0897  0.1103  -0.0651 2   G   D "O4'" 
5125 C "C3'" . G   D 2   ? 1.0209 0.4896 0.6025 0.0849  0.0924  -0.0703 2   G   D "C3'" 
5126 O "O3'" . G   D 2   ? 1.0583 0.4945 0.6091 0.0683  0.0747  -0.0764 2   G   D "O3'" 
5127 C "C2'" . G   D 2   ? 1.0277 0.5404 0.6229 0.0740  0.0904  -0.0764 2   G   D "C2'" 
5128 O "O2'" . G   D 2   ? 1.0503 0.5796 0.6473 0.0432  0.0778  -0.0802 2   G   D "O2'" 
5129 C "C1'" . G   D 2   ? 0.9836 0.5186 0.6248 0.0878  0.1075  -0.0703 2   G   D "C1'" 
5130 N N9    . G   D 2   ? 0.9746 0.5186 0.6285 0.1183  0.1237  -0.0587 2   G   D N9    
5131 C C8    . G   D 2   ? 0.9610 0.4919 0.6355 0.1467  0.1406  -0.0393 2   G   D C8    
5132 N N7    . G   D 2   ? 0.9605 0.5131 0.6459 0.1743  0.1562  -0.0244 2   G   D N7    
5133 C C5    . G   D 2   ? 0.9736 0.5527 0.6417 0.1620  0.1468  -0.0388 2   G   D C5    
5134 C C6    . G   D 2   ? 0.9791 0.5928 0.6481 0.1817  0.1560  -0.0313 2   G   D C6    
5135 O O6    . G   D 2   ? 0.9729 0.6024 0.6580 0.2173  0.1764  -0.0074 2   G   D O6    
5136 N N1    . G   D 2   ? 0.9986 0.6356 0.6510 0.1586  0.1405  -0.0490 2   G   D N1    
5137 C C2    . G   D 2   ? 1.0231 0.6543 0.6638 0.1227  0.1214  -0.0665 2   G   D C2    
5138 N N2    . G   D 2   ? 1.0519 0.7162 0.6861 0.1062  0.1109  -0.0742 2   G   D N2    
5139 N N3    . G   D 2   ? 1.0147 0.6157 0.6539 0.1064  0.1146  -0.0708 2   G   D N3    
5140 C C4    . G   D 2   ? 0.9835 0.5582 0.6346 0.1268  0.1269  -0.0589 2   G   D C4    
5152 P P     . U   D 3   ? 1.1989 0.5987 0.7052 0.0858  0.0618  -0.0877 3   U   D P     
5153 O OP1   . U   D 3   ? 1.2264 0.5843 0.7184 0.0653  0.0428  -0.0928 3   U   D OP1   
5154 O OP2   . U   D 3   ? 1.1848 0.5787 0.6804 0.1291  0.0809  -0.0785 3   U   D OP2   
5155 O "O5'" . U   D 3   ? 1.2346 0.6657 0.7368 0.0779  0.0485  -0.1001 3   U   D "O5'" 
5156 C "C5'" . U   D 3   ? 1.2584 0.7104 0.7796 0.0401  0.0328  -0.1020 3   U   D "C5'" 
5157 C "C4'" . U   D 3   ? 1.2905 0.7819 0.8143 0.0388  0.0246  -0.1095 3   U   D "C4'" 
5158 O "O4'" . U   D 3   ? 1.2562 0.7888 0.7975 0.0575  0.0490  -0.1003 3   U   D "O4'" 
5159 C "C3'" . U   D 3   ? 1.3334 0.8081 0.8210 0.0619  0.0066  -0.1290 3   U   D "C3'" 
5160 O "O3'" . U   D 3   ? 1.3842 0.8243 0.8644 0.0407  -0.0279 -0.1462 3   U   D "O3'" 
5161 C "C2'" . U   D 3   ? 1.3431 0.8742 0.8411 0.0698  0.0125  -0.1272 3   U   D "C2'" 
5162 O "O2'" . U   D 3   ? 1.3933 0.9535 0.9171 0.0337  -0.0068 -0.1283 3   U   D "O2'" 
5163 C "C1'" . U   D 3   ? 1.2802 0.8373 0.8082 0.0768  0.0459  -0.1067 3   U   D "C1'" 
5164 N N1    . U   D 3   ? 1.2529 0.8095 0.7730 0.1200  0.0691  -0.0971 3   U   D N1    
5165 C C2    . U   D 3   ? 1.2557 0.8508 0.7730 0.1457  0.0770  -0.0933 3   U   D C2    
5166 O O2    . U   D 3   ? 1.2783 0.9059 0.7968 0.1330  0.0638  -0.1010 3   U   D O2    
5167 N N3    . U   D 3   ? 1.2355 0.8352 0.7539 0.1883  0.1023  -0.0748 3   U   D N3    
5168 C C4    . U   D 3   ? 1.2158 0.7869 0.7417 0.2058  0.1193  -0.0597 3   U   D C4    
5169 O O4    . U   D 3   ? 1.1977 0.7841 0.7344 0.2460  0.1440  -0.0353 3   U   D O4    
5170 C C5    . U   D 3   ? 1.2149 0.7455 0.7404 0.1760  0.1074  -0.0690 3   U   D C5    
5171 C C6    . U   D 3   ? 1.2308 0.7557 0.7518 0.1360  0.0839  -0.0868 3   U   D C6    
5182 P P     . A   D 4   ? 1.4334 0.8251 0.8639 0.0725  -0.0522 -0.1758 4   A   D P     
5183 O OP1   . A   D 4   ? 1.4673 0.8144 0.9110 0.0405  -0.0901 -0.1921 4   A   D OP1   
5184 O OP2   . A   D 4   ? 1.4041 0.7746 0.8033 0.1145  -0.0253 -0.1677 4   A   D OP2   
5185 O "O5'" . A   D 4   ? 1.4690 0.9034 0.8819 0.0948  -0.0630 -0.1912 4   A   D "O5'" 
5186 C "C5'" . A   D 4   ? 1.5104 0.9745 0.9526 0.0625  -0.0908 -0.1997 4   A   D "C5'" 
5187 C "C4'" . A   D 4   ? 1.5277 1.0402 0.9491 0.0924  -0.0944 -0.2102 4   A   D "C4'" 
5188 O "O4'" . A   D 4   ? 1.4775 1.0403 0.9118 0.1079  -0.0515 -0.1806 4   A   D "O4'" 
5189 C "C3'" . A   D 4   ? 1.5442 1.0384 0.9011 0.1490  -0.1050 -0.2365 4   A   D "C3'" 
5190 O "O3'" . A   D 4   ? 1.5969 1.0512 0.9342 0.1463  -0.1568 -0.2785 4   A   D "O3'" 
5191 C "C2'" . A   D 4   ? 1.5284 1.0916 0.8775 0.1802  -0.0858 -0.2245 4   A   D "C2'" 
5192 O "O2'" . A   D 4   ? 1.5717 1.1699 0.9359 0.1609  -0.1202 -0.2424 4   A   D "O2'" 
5193 C "C1'" . A   D 4   ? 1.4686 1.0605 0.8665 0.1584  -0.0431 -0.1845 4   A   D "C1'" 
5194 N N9    . A   D 4   ? 1.4132 0.9997 0.8005 0.1964  -0.0023 -0.1606 4   A   D N9    
5195 C C8    . A   D 4   ? 1.3797 0.9258 0.7749 0.1923  0.0155  -0.1479 4   A   D C8    
5196 N N7    . A   D 4   ? 1.3319 0.8886 0.7273 0.2314  0.0503  -0.1229 4   A   D N7    
5197 C C5    . A   D 4   ? 1.3315 0.9388 0.7163 0.2656  0.0584  -0.1163 4   A   D C5    
5198 C C6    . A   D 4   ? 1.2922 0.9373 0.6811 0.3160  0.0935  -0.0848 4   A   D C6    
5199 N N6    . A   D 4   ? 1.2502 0.8865 0.6623 0.3386  0.1265  -0.0529 4   A   D N6    
5200 N N1    . A   D 4   ? 1.2987 0.9963 0.6747 0.3434  0.0939  -0.0823 4   A   D N1    
5201 C C2    . A   D 4   ? 1.3413 1.0517 0.7017 0.3194  0.0582  -0.1131 4   A   D C2    
5202 N N3    . A   D 4   ? 1.3850 1.0633 0.7481 0.2696  0.0218  -0.1432 4   A   D N3    
5203 C C4    . A   D 4   ? 1.3804 1.0069 0.7558 0.2454  0.0255  -0.1417 4   A   D C4    
5215 P P     . C   D 5   ? 1.6911 1.0867 0.9602 0.1973  -0.1714 -0.3102 5   C   D P     
5216 O OP1   . C   D 5   ? 1.7424 1.0857 1.0159 0.1761  -0.2323 -0.3558 5   C   D OP1   
5217 O OP2   . C   D 5   ? 1.6468 1.0157 0.9110 0.2082  -0.1294 -0.2804 5   C   D OP2   
5218 O "O5'" . C   D 5   ? 1.7124 1.1575 0.9215 0.2659  -0.1637 -0.3193 5   C   D "O5'" 
5219 C "C5'" . C   D 5   ? 1.7697 1.2365 0.9563 0.2803  -0.2100 -0.3595 5   C   D "C5'" 
5220 C "C4'" . C   D 5   ? 1.7535 1.3028 0.9240 0.3182  -0.1853 -0.3401 5   C   D "C4'" 
5221 O "O4'" . C   D 5   ? 1.6932 1.2782 0.9087 0.3017  -0.1281 -0.2843 5   C   D "O4'" 
5222 C "C3'" . C   D 5   ? 1.7631 1.3348 0.8532 0.4056  -0.1718 -0.3461 5   C   D "C3'" 
5223 O "O3'" . C   D 5   ? 1.8301 1.3962 0.8668 0.4402  -0.2273 -0.4029 5   C   D "O3'" 
5224 C "C2'" . C   D 5   ? 1.7119 1.3651 0.8216 0.4247  -0.1243 -0.2978 5   C   D "C2'" 
5225 O "O2'" . C   D 5   ? 1.7322 1.4389 0.8505 0.4169  -0.1529 -0.3142 5   C   D "O2'" 
5226 C "C1'" . C   D 5   ? 1.6580 1.2992 0.8443 0.3619  -0.0908 -0.2580 5   C   D "C1'" 
5227 N N1    . C   D 5   ? 1.6086 1.2330 0.7974 0.3848  -0.0415 -0.2198 5   C   D N1    
5228 C C2    . C   D 5   ? 1.5671 1.2459 0.7565 0.4343  0.0055  -0.1767 5   C   D C2    
5229 O O2    . C   D 5   ? 1.5714 1.3107 0.7528 0.4597  0.0064  -0.1719 5   C   D O2    
5230 N N3    . C   D 5   ? 1.5259 1.1927 0.7322 0.4533  0.0481  -0.1381 5   C   D N3    
5231 C C4    . C   D 5   ? 1.5260 1.1314 0.7399 0.4263  0.0449  -0.1441 5   C   D C4    
5232 N N4    . C   D 5   ? 1.4852 1.0850 0.7221 0.4454  0.0852  -0.1044 5   C   D N4    
5233 C C5    . C   D 5   ? 1.5636 1.1132 0.7703 0.3787  0.0000  -0.1870 5   C   D C5    
5234 C C6    . C   D 5   ? 1.6020 1.1622 0.8002 0.3587  -0.0419 -0.2224 5   C   D C6    
5246 P P     . G   D 6   ? 1.1798 1.1169 1.2480 0.2531  -0.0206 -0.3060 6   G   D P     
5247 O OP1   . G   D 6   ? 1.1904 1.1888 1.2763 0.2312  -0.0238 -0.2905 6   G   D OP1   
5248 O OP2   . G   D 6   ? 1.1726 1.0529 1.1992 0.2376  -0.0234 -0.3207 6   G   D OP2   
5249 O "O5'" . G   D 6   ? 1.1810 1.0943 1.2760 0.2732  -0.0347 -0.2934 6   G   D "O5'" 
5250 C "C5'" . G   D 6   ? 1.1918 1.1484 1.3300 0.2965  -0.0336 -0.2768 6   G   D "C5'" 
5251 C "C4'" . G   D 6   ? 1.1706 1.0963 1.3345 0.3130  -0.0465 -0.2603 6   G   D "C4'" 
5252 O "O4'" . G   D 6   ? 1.1540 1.0149 1.3185 0.3347  -0.0463 -0.2787 6   G   D "O4'" 
5253 C "C3'" . G   D 6   ? 1.1494 1.0492 1.2994 0.2923  -0.0603 -0.2459 6   G   D "C3'" 
5254 O "O3'" . G   D 6   ? 1.1623 1.1146 1.3124 0.2804  -0.0663 -0.2251 6   G   D "O3'" 
5255 C "C2'" . G   D 6   ? 1.1451 0.9968 1.3274 0.3137  -0.0685 -0.2340 6   G   D "C2'" 
5256 O "O2'" . G   D 6   ? 1.1660 1.0559 1.3915 0.3351  -0.0703 -0.2046 6   G   D "O2'" 
5257 C "C1'" . G   D 6   ? 1.1402 0.9523 1.3190 0.3322  -0.0626 -0.2653 6   G   D "C1'" 
5258 N N9    . G   D 6   ? 1.1146 0.8626 1.2605 0.3178  -0.0704 -0.2887 6   G   D N9    
5259 C C8    . G   D 6   ? 1.1016 0.8417 1.2004 0.3052  -0.0634 -0.3159 6   G   D C8    
5260 N N7    . G   D 6   ? 1.0943 0.7756 1.1733 0.2947  -0.0768 -0.3295 6   G   D N7    
5261 C C5    . G   D 6   ? 1.0964 0.7444 1.2181 0.2988  -0.0935 -0.3093 6   G   D C5    
5262 C C6    . G   D 6   ? 1.1089 0.6948 1.2442 0.2894  -0.1152 -0.3079 6   G   D C6    
5263 O O6    . G   D 6   ? 1.1199 0.6781 1.2233 0.2680  -0.1226 -0.3186 6   G   D O6    
5264 N N1    . G   D 6   ? 1.1064 0.6813 1.3006 0.2978  -0.1249 -0.2760 6   G   D N1    
5265 C C2    . G   D 6   ? 1.0948 0.7134 1.3234 0.3153  -0.1147 -0.2492 6   G   D C2    
5266 N N2    . G   D 6   ? 1.0961 0.6988 1.3830 0.3232  -0.1243 -0.2142 6   G   D N2    
5267 N N3    . G   D 6   ? 1.1049 0.7824 1.3176 0.3243  -0.0973 -0.2523 6   G   D N3    
5268 C C4    . G   D 6   ? 1.1033 0.7916 1.2653 0.3143  -0.0879 -0.2829 6   G   D C4    
5280 P P     . C   D 7   ? 1.0174 0.9581 1.1265 0.2517  -0.0722 -0.2228 7   C   D P     
5281 O OP1   . C   D 7   ? 1.0519 1.0518 1.1550 0.2432  -0.0804 -0.2117 7   C   D OP1   
5282 O OP2   . C   D 7   ? 0.9906 0.8956 1.0675 0.2319  -0.0650 -0.2485 7   C   D OP2   
5283 O "O5'" . C   D 7   ? 1.0253 0.9255 1.1465 0.2628  -0.0777 -0.1985 7   C   D "O5'" 
5284 C "C5'" . C   D 7   ? 1.0544 0.9739 1.2150 0.2877  -0.0821 -0.1680 7   C   D "C5'" 
5285 C "C4'" . C   D 7   ? 1.0441 0.9152 1.2288 0.2964  -0.0848 -0.1446 7   C   D "C4'" 
5286 O "O4'" . C   D 7   ? 1.0114 0.8257 1.2176 0.3009  -0.0872 -0.1644 7   C   D "O4'" 
5287 C "C3'" . C   D 7   ? 1.0428 0.8895 1.1967 0.2785  -0.0834 -0.1363 7   C   D "C3'" 
5288 O "O3'" . C   D 7   ? 1.0803 0.9657 1.2133 0.2825  -0.0817 -0.1098 7   C   D "O3'" 
5289 C "C2'" . C   D 7   ? 1.0192 0.8099 1.2158 0.2846  -0.0881 -0.1212 7   C   D "C2'" 
5290 O "O2'" . C   D 7   ? 1.0380 0.8409 1.2806 0.3059  -0.0888 -0.0764 7   C   D "O2'" 
5291 C "C1'" . C   D 7   ? 0.9915 0.7550 1.2056 0.2914  -0.0931 -0.1535 7   C   D "C1'" 
5292 N N1    . C   D 7   ? 0.9532 0.6770 1.1337 0.2722  -0.0951 -0.1895 7   C   D N1    
5293 C C2    . C   D 7   ? 0.9341 0.6014 1.1314 0.2639  -0.1068 -0.1865 7   C   D C2    
5294 O O2    . C   D 7   ? 0.9388 0.5909 1.1849 0.2716  -0.1135 -0.1521 7   C   D O2    
5295 N N3    . C   D 7   ? 0.9130 0.5474 1.0777 0.2476  -0.1114 -0.2171 7   C   D N3    
5296 C C4    . C   D 7   ? 0.9026 0.5585 1.0203 0.2411  -0.1010 -0.2470 7   C   D C4    
5297 N N4    . C   D 7   ? 0.8989 0.5247 0.9839 0.2276  -0.1049 -0.2721 7   C   D N4    
5298 C C5    . C   D 7   ? 0.9145 0.6277 1.0219 0.2480  -0.0875 -0.2484 7   C   D C5    
5299 C C6    . C   D 7   ? 0.9395 0.6848 1.0784 0.2627  -0.0870 -0.2208 7   C   D C6    
5311 P P     . G   D 8   ? 1.1364 1.0138 1.2131 0.2642  -0.0758 -0.1143 8   G   D P     
5312 O OP1   . G   D 8   ? 1.1851 1.1084 1.2318 0.2759  -0.0767 -0.0939 8   G   D OP1   
5313 O OP2   . G   D 8   ? 1.1012 0.9631 1.1472 0.2388  -0.0748 -0.1553 8   G   D OP2   
5314 O "O5'" . G   D 8   ? 1.1208 0.9513 1.2232 0.2670  -0.0703 -0.0876 8   G   D "O5'" 
5315 C "C5'" . G   D 8   ? 1.1287 0.9629 1.2789 0.2895  -0.0691 -0.0414 8   G   D "C5'" 
5316 C "C4'" . G   D 8   ? 1.0979 0.8853 1.2859 0.2848  -0.0675 -0.0195 8   G   D "C4'" 
5317 O "O4'" . G   D 8   ? 1.0571 0.7989 1.2789 0.2740  -0.0813 -0.0465 8   G   D "O4'" 
5318 C "C3'" . G   D 8   ? 1.0973 0.8676 1.2449 0.2689  -0.0575 -0.0237 8   G   D "C3'" 
5319 O "O3'" . G   D 8   ? 1.1301 0.9280 1.2515 0.2845  -0.0414 0.0111  8   G   D "O3'" 
5320 C "C2'" . G   D 8   ? 1.0567 0.7772 1.2574 0.2580  -0.0663 -0.0156 8   G   D "C2'" 
5321 O "O2'" . G   D 8   ? 1.0574 0.7777 1.3186 0.2728  -0.0626 0.0403  8   G   D "O2'" 
5322 C "C1'" . G   D 8   ? 1.0269 0.7274 1.2537 0.2564  -0.0840 -0.0474 8   G   D "C1'" 
5323 N N9    . G   D 8   ? 0.9871 0.6671 1.1726 0.2367  -0.0893 -0.0981 8   G   D N9    
5324 C C8    . G   D 8   ? 0.9803 0.6866 1.1169 0.2318  -0.0841 -0.1331 8   G   D C8    
5325 N N7    . G   D 8   ? 0.9460 0.6287 1.0576 0.2157  -0.0875 -0.1678 8   G   D N7    
5326 C C5    . G   D 8   ? 0.9268 0.5639 1.0678 0.2092  -0.0990 -0.1586 8   G   D C5    
5327 C C6    . G   D 8   ? 0.8948 0.4935 1.0231 0.1938  -0.1100 -0.1836 8   G   D C6    
5328 O O6    . G   D 8   ? 0.8735 0.4719 0.9591 0.1849  -0.1073 -0.2172 8   G   D O6    
5329 N N1    . G   D 8   ? 0.8954 0.4569 1.0702 0.1892  -0.1263 -0.1617 8   G   D N1    
5330 C C2    . G   D 8   ? 0.9080 0.4704 1.1415 0.1985  -0.1281 -0.1169 8   G   D C2    
5331 N N2    . G   D 8   ? 0.8982 0.4245 1.1837 0.1891  -0.1471 -0.0971 8   G   D N2    
5332 N N3    . G   D 8   ? 0.9299 0.5294 1.1734 0.2159  -0.1135 -0.0902 8   G   D N3    
5333 C C4    . G   D 8   ? 0.9472 0.5819 1.1392 0.2203  -0.1010 -0.1152 8   G   D C4    
5345 P P     . G   D 9   ? 1.1608 0.9492 1.2206 0.2750  -0.0264 0.0009  9   G   D P     
5346 O OP1   . G   D 9   ? 1.2061 1.0272 1.2314 0.3014  -0.0094 0.0354  9   G   D OP1   
5347 O OP2   . G   D 9   ? 1.1365 0.9171 1.1493 0.2514  -0.0337 -0.0543 9   G   D OP2   
5348 O "O5'" . G   D 9   ? 1.1226 0.8700 1.2316 0.2648  -0.0240 0.0222  9   G   D "O5'" 
5349 C "C5'" . G   D 9   ? 1.1084 0.8297 1.1875 0.2468  -0.0176 0.0033  9   G   D "C5'" 
5350 C "C4'" . G   D 9   ? 1.0597 0.7450 1.2002 0.2328  -0.0280 0.0172  9   G   D "C4'" 
5351 O "O4'" . G   D 9   ? 1.0187 0.6839 1.1879 0.2207  -0.0528 -0.0129 9   G   D "O4'" 
5352 C "C3'" . G   D 9   ? 1.0430 0.7029 1.1604 0.2140  -0.0234 0.0022  9   G   D "C3'" 
5353 O "O3'" . G   D 9   ? 1.0622 0.7287 1.1752 0.2267  0.0006  0.0407  9   G   D "O3'" 
5354 C "C2'" . G   D 9   ? 0.9920 0.6185 1.1658 0.1962  -0.0489 -0.0031 9   G   D "C2'" 
5355 O "O2'" . G   D 9   ? 0.9761 0.5968 1.2252 0.2015  -0.0522 0.0487  9   G   D "O2'" 
5356 C "C1'" . G   D 9   ? 0.9773 0.6055 1.1587 0.1993  -0.0662 -0.0302 9   G   D "C1'" 
5357 N N9    . G   D 9   ? 0.9470 0.5695 1.0773 0.1857  -0.0722 -0.0844 9   G   D N9    
5358 C C8    . G   D 9   ? 0.9514 0.6019 1.0351 0.1890  -0.0646 -0.1117 9   G   D C8    
5359 N N7    . G   D 9   ? 0.9213 0.5639 0.9756 0.1751  -0.0696 -0.1514 9   G   D N7    
5360 C C5    . G   D 9   ? 0.8987 0.5045 0.9724 0.1636  -0.0821 -0.1535 9   G   D C5    
5361 C C6    . G   D 9   ? 0.8786 0.4638 0.9296 0.1500  -0.0914 -0.1863 9   G   D C6    
5362 O O6    . G   D 9   ? 0.8668 0.4642 0.8798 0.1459  -0.0862 -0.2176 9   G   D O6    
5363 N N1    . G   D 9   ? 0.8779 0.4290 0.9577 0.1415  -0.1089 -0.1763 9   G   D N1    
5364 C C2    . G   D 9   ? 0.8854 0.4253 1.0205 0.1435  -0.1161 -0.1362 9   G   D C2    
5365 N N2    . G   D 9   ? 0.8830 0.3921 1.0473 0.1310  -0.1384 -0.1308 9   G   D N2    
5366 N N3    . G   D 9   ? 0.8967 0.4579 1.0586 0.1574  -0.1029 -0.1007 9   G   D N3    
5367 C C4    . G   D 9   ? 0.9107 0.5033 1.0343 0.1679  -0.0865 -0.1133 9   G   D C4    
5379 P P     . A   D 10  ? 1.0154 0.6703 1.0647 0.2202  0.0191  0.0202  10  A   D P     
5380 O OP1   . A   D 10  ? 1.0448 0.7141 1.0809 0.2471  0.0493  0.0625  10  A   D OP1   
5381 O OP2   . A   D 10  ? 1.0168 0.6733 1.0038 0.2082  0.0127  -0.0344 10  A   D OP2   
5382 O "O5'" . A   D 10  ? 0.9742 0.5988 1.0630 0.1968  0.0066  0.0200  10  A   D "O5'" 
5383 C "C5'" . A   D 10  ? 0.9465 0.5661 1.1134 0.1974  0.0002  0.0670  10  A   D "C5'" 
5384 C "C4'" . A   D 10  ? 0.9095 0.5004 1.1075 0.1705  -0.0276 0.0496  10  A   D "C4'" 
5385 O "O4'" . A   D 10  ? 0.8973 0.4763 1.0857 0.1595  -0.0538 0.0051  10  A   D "O4'" 
5386 C "C3'" . A   D 10  ? 0.9054 0.4826 1.0586 0.1566  -0.0200 0.0269  10  A   D "C3'" 
5387 O "O3'" . A   D 10  ? 0.8878 0.4673 1.0676 0.1623  -0.0020 0.0702  10  A   D "O3'" 
5388 C "C2'" . A   D 10  ? 0.8796 0.4341 1.0422 0.1334  -0.0541 -0.0072 10  A   D "C2'" 
5389 O "O2'" . A   D 10  ? 0.8537 0.3951 1.0867 0.1234  -0.0778 0.0226  10  A   D "O2'" 
5390 C "C1'" . A   D 10  ? 0.8787 0.4365 1.0398 0.1390  -0.0680 -0.0317 10  A   D "C1'" 
5391 N N9    . A   D 10  ? 0.8745 0.4408 0.9679 0.1374  -0.0600 -0.0778 10  A   D N9    
5392 C C8    . A   D 10  ? 0.8880 0.4787 0.9452 0.1500  -0.0429 -0.0860 10  A   D C8    
5393 N N7    . A   D 10  ? 0.8709 0.4675 0.8824 0.1418  -0.0426 -0.1265 10  A   D N7    
5394 C C5    . A   D 10  ? 0.8453 0.4207 0.8577 0.1259  -0.0565 -0.1450 10  A   D C5    
5395 C C6    . A   D 10  ? 0.8209 0.3955 0.7978 0.1143  -0.0594 -0.1816 10  A   D C6    
5396 N N6    . A   D 10  ? 0.8111 0.4079 0.7545 0.1135  -0.0491 -0.2054 10  A   D N6    
5397 N N1    . A   D 10  ? 0.8195 0.3731 0.7991 0.1041  -0.0742 -0.1898 10  A   D N1    
5398 C C2    . A   D 10  ? 0.8244 0.3580 0.8448 0.1018  -0.0899 -0.1649 10  A   D C2    
5399 N N3    . A   D 10  ? 0.8346 0.3678 0.9020 0.1090  -0.0897 -0.1272 10  A   D N3    
5400 C C4    . A   D 10  ? 0.8495 0.4049 0.9081 0.1228  -0.0698 -0.1180 10  A   D C4    
5412 P P     . A   D 11  ? 0.8998 0.4747 1.0190 0.1676  0.0294  0.0618  11  A   D P     
5413 O OP1   . A   D 11  ? 0.8864 0.4694 1.0481 0.1826  0.0515  0.1187  11  A   D OP1   
5414 O OP2   . A   D 11  ? 0.9291 0.5097 0.9750 0.1788  0.0452  0.0281  11  A   D OP2   
5415 O "O5'" . A   D 11  ? 0.8822 0.4361 0.9864 0.1402  0.0096  0.0272  11  A   D "O5'" 
5416 C "C5'" . A   D 11  ? 0.8579 0.4039 1.0183 0.1245  -0.0151 0.0466  11  A   D "C5'" 
5417 C "C4'" . A   D 11  ? 0.8578 0.3883 0.9852 0.1030  -0.0344 0.0065  11  A   D "C4'" 
5418 O "O4'" . A   D 11  ? 0.8514 0.3781 0.9535 0.0973  -0.0545 -0.0372 11  A   D "O4'" 
5419 C "C3'" . A   D 11  ? 0.8648 0.3902 0.9320 0.1016  -0.0086 -0.0137 11  A   D "C3'" 
5420 O "O3'" . A   D 11  ? 0.8724 0.3948 0.9573 0.1041  0.0079  0.0202  11  A   D "O3'" 
5421 C "C2'" . A   D 11  ? 0.8542 0.3729 0.8893 0.0840  -0.0302 -0.0569 11  A   D "C2'" 
5422 O "O2'" . A   D 11  ? 0.8593 0.3712 0.9185 0.0709  -0.0541 -0.0471 11  A   D "O2'" 
5423 C "C1'" . A   D 11  ? 0.8485 0.3710 0.8935 0.0872  -0.0507 -0.0757 11  A   D "C1'" 
5424 N N9    . A   D 11  ? 0.8467 0.3803 0.8484 0.0943  -0.0346 -0.1037 11  A   D N9    
5425 C C8    . A   D 11  ? 0.8551 0.4015 0.8526 0.1102  -0.0182 -0.0939 11  A   D C8    
5426 N N7    . A   D 11  ? 0.8497 0.4071 0.8065 0.1106  -0.0123 -0.1253 11  A   D N7    
5427 C C5    . A   D 11  ? 0.8338 0.3868 0.7711 0.0947  -0.0215 -0.1546 11  A   D C5    
5428 C C6    . A   D 11  ? 0.8211 0.3863 0.7250 0.0873  -0.0197 -0.1887 11  A   D C6    
5429 N N6    . A   D 11  ? 0.8183 0.4020 0.7040 0.0918  -0.0129 -0.2026 11  A   D N6    
5430 N N1    . A   D 11  ? 0.8187 0.3809 0.7111 0.0758  -0.0259 -0.2048 11  A   D N1    
5431 C C2    . A   D 11  ? 0.8305 0.3762 0.7373 0.0715  -0.0374 -0.1915 11  A   D C2    
5432 N N3    . A   D 11  ? 0.8392 0.3720 0.7809 0.0743  -0.0451 -0.1615 11  A   D N3    
5433 C C4    . A   D 11  ? 0.8376 0.3754 0.7963 0.0863  -0.0345 -0.1425 11  A   D C4    
5445 P P     . U   D 12  ? 0.8896 0.4015 0.9242 0.1138  0.0465  0.0144  12  U   D P     
5446 O OP1   . U   D 12  ? 0.8871 0.3986 0.9585 0.1232  0.0639  0.0614  12  U   D OP1   
5447 O OP2   . U   D 12  ? 0.9107 0.4241 0.9031 0.1294  0.0645  -0.0048 12  U   D OP2   
5448 O "O5'" . U   D 12  ? 0.8835 0.3852 0.8789 0.0930  0.0372  -0.0240 12  U   D "O5'" 
5449 C "C5'" . U   D 12  ? 0.8762 0.3789 0.8931 0.0775  0.0144  -0.0169 12  U   D "C5'" 
5450 C "C4'" . U   D 12  ? 0.8734 0.3738 0.8465 0.0627  0.0081  -0.0543 12  U   D "C4'" 
5451 O "O4'" . U   D 12  ? 0.8678 0.3755 0.8213 0.0604  -0.0076 -0.0899 12  U   D "O4'" 
5452 C "C3'" . U   D 12  ? 0.8725 0.3619 0.8067 0.0620  0.0383  -0.0683 12  U   D "C3'" 
5453 O "O3'" . U   D 12  ? 0.8852 0.3642 0.8297 0.0622  0.0545  -0.0412 12  U   D "O3'" 
5454 C "C2'" . U   D 12  ? 0.8732 0.3718 0.7758 0.0489  0.0270  -0.1052 12  U   D "C2'" 
5455 O "O2'" . U   D 12  ? 0.8956 0.3999 0.7980 0.0395  0.0136  -0.0995 12  U   D "O2'" 
5456 C "C1'" . U   D 12  ? 0.8642 0.3742 0.7749 0.0531  0.0041  -0.1205 12  U   D "C1'" 
5457 N N1    . U   D 12  ? 0.8492 0.3640 0.7417 0.0594  0.0151  -0.1409 12  U   D N1    
5458 C C2    . U   D 12  ? 0.8422 0.3680 0.7069 0.0511  0.0171  -0.1720 12  U   D C2    
5459 O O2    . U   D 12  ? 0.8510 0.3829 0.7046 0.0414  0.0146  -0.1810 12  U   D O2    
5460 N N3    . U   D 12  ? 0.8363 0.3702 0.6885 0.0559  0.0223  -0.1885 12  U   D N3    
5461 C C4    . U   D 12  ? 0.8965 0.4285 0.7526 0.0706  0.0269  -0.1779 12  U   D C4    
5462 O O4    . U   D 12  ? 0.8817 0.4249 0.7203 0.0742  0.0281  -0.1952 12  U   D O4    
5463 C C5    . U   D 12  ? 0.8488 0.3700 0.7324 0.0814  0.0294  -0.1431 12  U   D C5    
5464 C C6    . U   D 12  ? 0.8501 0.3637 0.7549 0.0741  0.0227  -0.1258 12  U   D C6    
5475 P P     . A   D 13  ? 0.9068 0.3606 0.8282 0.0706  0.0918  -0.0416 13  A   D P     
5476 O OP1   . A   D 13  ? 0.9175 0.3629 0.8650 0.0754  0.1060  -0.0034 13  A   D OP1   
5477 O OP2   . A   D 13  ? 0.9079 0.3551 0.8141 0.0875  0.1048  -0.0500 13  A   D OP2   
5478 O "O5'" . A   D 13  ? 0.9092 0.3596 0.7962 0.0533  0.0931  -0.0773 13  A   D "O5'" 
5479 C "C5'" . A   D 13  ? 0.9201 0.3804 0.8093 0.0394  0.0854  -0.0725 13  A   D "C5'" 
5480 C "C4'" . A   D 13  ? 0.9245 0.3922 0.7887 0.0253  0.0864  -0.1038 13  A   D "C4'" 
5481 O "O4'" . A   D 13  ? 0.9073 0.3952 0.7606 0.0250  0.0677  -0.1309 13  A   D "O4'" 
5482 C "C3'" . A   D 13  ? 0.9305 0.3732 0.7812 0.0212  0.1082  -0.1205 13  A   D "C3'" 
5483 O "O3'" . A   D 13  ? 0.9596 0.3795 0.8194 0.0175  0.1285  -0.1017 13  A   D "O3'" 
5484 C "C2'" . A   D 13  ? 0.9235 0.3890 0.7617 0.0077  0.0982  -0.1511 13  A   D "C2'" 
5485 O "O2'" . A   D 13  ? 0.9498 0.4321 0.7928 -0.0043 0.1009  -0.1432 13  A   D "O2'" 
5486 C "C1'" . A   D 13  ? 0.9018 0.3925 0.7388 0.0160  0.0754  -0.1582 13  A   D "C1'" 
5487 N N9    . A   D 13  ? 0.8814 0.3700 0.7104 0.0244  0.0720  -0.1756 13  A   D N9    
5488 C C8    . A   D 13  ? 0.8746 0.3544 0.7087 0.0410  0.0717  -0.1632 13  A   D C8    
5489 N N7    . A   D 13  ? 0.8770 0.3618 0.6973 0.0477  0.0690  -0.1810 13  A   D N7    
5490 C C5    . A   D 13  ? 0.8800 0.3777 0.6891 0.0323  0.0648  -0.2082 13  A   D C5    
5491 C C6    . A   D 13  ? 0.8857 0.3983 0.6821 0.0294  0.0573  -0.2341 13  A   D C6    
5492 N N6    . A   D 13  ? 0.8922 0.4077 0.6760 0.0442  0.0530  -0.2385 13  A   D N6    
5493 N N1    . A   D 13  ? 0.8871 0.4168 0.6878 0.0113  0.0543  -0.2510 13  A   D N1    
5494 C C2    . A   D 13  ? 0.8847 0.4159 0.6972 -0.0004 0.0616  -0.2412 13  A   D C2    
5495 N N3    . A   D 13  ? 0.8859 0.4036 0.7037 0.0026  0.0688  -0.2183 13  A   D N3    
5496 C C4    . A   D 13  ? 0.8789 0.3797 0.6959 0.0182  0.0684  -0.2036 13  A   D C4    
5508 P P     . C   D 14  ? 1.0098 0.3817 0.8622 0.0258  0.1534  -0.1056 14  C   D P     
5509 O OP1   . C   D 14  ? 1.0315 0.3821 0.9039 0.0261  0.1730  -0.0757 14  C   D OP1   
5510 O OP2   . C   D 14  ? 1.0030 0.3682 0.8444 0.0471  0.1545  -0.1063 14  C   D OP2   
5511 O "O5'" . C   D 14  ? 1.0245 0.3873 0.8613 0.0081  0.1511  -0.1438 14  C   D "O5'" 
5512 C "C5'" . C   D 14  ? 1.0401 0.4142 0.8931 -0.0132 0.1521  -0.1430 14  C   D "C5'" 
5513 C "C4'" . C   D 14  ? 1.0414 0.4258 0.8898 -0.0305 0.1409  -0.1768 14  C   D "C4'" 
5514 O "O4'" . C   D 14  ? 1.0072 0.4305 0.8430 -0.0252 0.1214  -0.1917 14  C   D "O4'" 
5515 C "C3'" . C   D 14  ? 1.0616 0.4021 0.8931 -0.0320 0.1423  -0.2067 14  C   D "C3'" 
5516 O "O3'" . C   D 14  ? 1.1000 0.3968 0.9477 -0.0441 0.1563  -0.2050 14  C   D "O3'" 
5517 C "C2'" . C   D 14  ? 1.0518 0.4262 0.8795 -0.0448 0.1206  -0.2358 14  C   D "C2'" 
5518 O "O2'" . C   D 14  ? 1.0671 0.4608 0.9279 -0.0704 0.1187  -0.2351 14  C   D "O2'" 
5519 C "C1'" . C   D 14  ? 1.0124 0.4334 0.8367 -0.0319 0.1110  -0.2242 14  C   D "C1'" 
5520 N N1    . C   D 14  ? 1.0025 0.4198 0.8009 -0.0110 0.1040  -0.2331 14  C   D N1    
5521 C C2    . C   D 14  ? 1.0079 0.4413 0.7918 -0.0123 0.0878  -0.2605 14  C   D C2    
5522 O O2    . C   D 14  ? 1.0198 0.4711 0.8173 -0.0325 0.0781  -0.2769 14  C   D O2    
5523 N N3    . C   D 14  ? 1.0041 0.4380 0.7647 0.0090  0.0833  -0.2636 14  C   D N3    
5524 C C4    . C   D 14  ? 0.9847 0.4045 0.7420 0.0300  0.0955  -0.2391 14  C   D C4    
5525 N N4    . C   D 14  ? 0.9870 0.4123 0.7270 0.0519  0.0936  -0.2364 14  C   D N4    
5526 C C5    . C   D 14  ? 0.9817 0.3859 0.7586 0.0301  0.1104  -0.2112 14  C   D C5    
5527 C C6    . C   D 14  ? 0.9947 0.3976 0.7884 0.0099  0.1136  -0.2102 14  C   D C6    
5539 P P     . U   D 15  ? 1.2218 0.4695 1.0486 -0.0301 0.1598  -0.2205 15  U   D P     
5540 O OP1   . U   D 15  ? 1.2614 0.4709 1.1173 -0.0429 0.1725  -0.2106 15  U   D OP1   
5541 O OP2   . U   D 15  ? 1.2126 0.4627 1.0158 0.0021  0.1685  -0.2054 15  U   D OP2   
5542 O "O5'" . U   D 15  ? 1.2453 0.5037 1.0528 -0.0390 0.1315  -0.2620 15  U   D "O5'" 
5543 C "C5'" . U   D 15  ? 1.2661 0.5249 1.1002 -0.0714 0.1180  -0.2800 15  U   D "C5'" 
5544 C "C4'" . U   D 15  ? 1.2890 0.5622 1.1020 -0.0758 0.0874  -0.3165 15  U   D "C4'" 
5545 O "O4'" . U   D 15  ? 1.2417 0.5628 1.0389 -0.0666 0.0806  -0.3177 15  U   D "O4'" 
5546 C "C3'" . U   D 15  ? 1.3430 0.5885 1.1142 -0.0519 0.0756  -0.3394 15  U   D "C3'" 
5547 O "O3'" . U   D 15  ? 1.4088 0.6041 1.1886 -0.0616 0.0689  -0.3547 15  U   D "O3'" 
5548 C "C2'" . U   D 15  ? 1.3421 0.6223 1.0903 -0.0521 0.0484  -0.3663 15  U   D "C2'" 
5549 O "O2'" . U   D 15  ? 1.3780 0.6535 1.1464 -0.0842 0.0216  -0.3908 15  U   D "O2'" 
5550 C "C1'" . U   D 15  ? 1.2682 0.5961 1.0298 -0.0531 0.0583  -0.3442 15  U   D "C1'" 
5551 N N1    . U   D 15  ? 1.2424 0.5858 0.9741 -0.0200 0.0682  -0.3310 15  U   D N1    
5552 C C2    . U   D 15  ? 1.2468 0.6132 0.9488 -0.0071 0.0519  -0.3497 15  U   D C2    
5553 O O2    . U   D 15  ? 1.2707 0.6466 0.9676 -0.0213 0.0275  -0.3776 15  U   D O2    
5554 N N3    . U   D 15  ? 1.2256 0.6016 0.9056 0.0219  0.0654  -0.3322 15  U   D N3    
5555 C C4    . U   D 15  ? 1.2024 0.5669 0.8900 0.0378  0.0897  -0.2992 15  U   D C4    
5556 O O4    . U   D 15  ? 1.1670 0.5370 0.8370 0.0628  0.0991  -0.2835 15  U   D O4    
5557 C C5    . U   D 15  ? 1.1985 0.5422 0.9158 0.0232  0.1023  -0.2837 15  U   D C5    
5558 C C6    . U   D 15  ? 1.2182 0.5522 0.9544 -0.0037 0.0930  -0.2993 15  U   D C6    
5569 P P     . U   D 16  ? 1.2587 0.8584 0.8657 0.2650  -0.1000 -0.3930 16  U   D P     
5570 O OP1   . U   D 16  ? 1.3704 0.8543 0.8185 0.2646  -0.0620 -0.3780 16  U   D OP1   
5571 O OP2   . U   D 16  ? 1.2277 0.8883 0.9036 0.3159  -0.1156 -0.4038 16  U   D OP2   
5572 O "O5'" . U   D 16  ? 1.2439 0.8567 0.9037 0.1995  -0.1062 -0.3714 16  U   D "O5'" 
5573 C "C5'" . U   D 16  ? 1.2925 0.8865 0.9182 0.1325  -0.1017 -0.3455 16  U   D "C5'" 
5574 C "C4'" . U   D 16  ? 1.2732 0.9296 0.9955 0.0738  -0.1194 -0.3161 16  U   D "C4'" 
5575 O "O4'" . U   D 16  ? 1.1627 0.9268 1.0547 0.0987  -0.1419 -0.3265 16  U   D "O4'" 
5576 C "C3'" . U   D 16  ? 1.2849 0.9105 0.9880 0.0573  -0.1144 -0.3096 16  U   D "C3'" 
5577 O "O3'" . U   D 16  ? 1.3964 0.9084 0.9377 0.0017  -0.0833 -0.2913 16  U   D "O3'" 
5578 C "C2'" . U   D 16  ? 1.2132 0.9487 1.0734 0.0211  -0.1440 -0.2862 16  U   D "C2'" 
5579 O "O2'" . U   D 16  ? 1.2778 1.0332 1.1256 -0.0648 -0.1487 -0.2354 16  U   D "O2'" 
5580 C "C1'" . U   D 16  ? 1.1190 0.9334 1.1021 0.0725  -0.1566 -0.3085 16  U   D "C1'" 
5581 N N1    . U   D 16  ? 1.0265 0.8779 1.0870 0.1297  -0.1683 -0.3456 16  U   D N1    
5582 C C2    . U   D 16  ? 0.9561 0.8788 1.1455 0.1157  -0.1847 -0.3358 16  U   D C2    
5583 O O2    . U   D 16  ? 0.9561 0.9179 1.2035 0.0622  -0.1900 -0.2935 16  U   D O2    
5584 N N3    . U   D 16  ? 0.8949 0.8506 1.1436 0.1619  -0.1964 -0.3704 16  U   D N3    
5585 C C4    . U   D 16  ? 0.9080 0.8478 1.1051 0.2148  -0.1969 -0.4049 16  U   D C4    
5586 O O4    . U   D 16  ? 0.8664 0.8549 1.1260 0.2410  -0.2127 -0.4260 16  U   D O4    
5587 C C5    . U   D 16  ? 0.9805 0.8538 1.0523 0.2292  -0.1798 -0.4065 16  U   D C5    
5588 C C6    . U   D 16  ? 1.0295 0.8548 1.0367 0.1889  -0.1646 -0.3813 16  U   D C6    
5599 P P     . C   D 17  ? 1.4005 0.8068 0.8440 0.0197  -0.0448 -0.3008 17  C   D P     
5600 O OP1   . C   D 17  ? 1.5482 0.8045 0.7906 -0.0406 0.0040  -0.2890 17  C   D OP1   
5601 O OP2   . C   D 17  ? 1.3597 0.7879 0.8536 0.1228  -0.0424 -0.3262 17  C   D OP2   
5602 O "O5'" . C   D 17  ? 1.3680 0.8374 0.9056 -0.0280 -0.0674 -0.2843 17  C   D "O5'" 
5603 C "C5'" . C   D 17  ? 1.3983 0.8864 0.9199 -0.1354 -0.0806 -0.2465 17  C   D "C5'" 
5604 C "C4'" . C   D 17  ? 1.3243 0.9159 0.9889 -0.1598 -0.1138 -0.2291 17  C   D "C4'" 
5605 O "O4'" . C   D 17  ? 1.2039 0.9259 1.0586 -0.0972 -0.1494 -0.2383 17  C   D "O4'" 
5606 C "C3'" . C   D 17  ? 1.3309 0.8740 0.9814 -0.1341 -0.0945 -0.2478 17  C   D "C3'" 
5607 O "O3'" . C   D 17  ? 1.4220 0.8407 0.9069 -0.2127 -0.0542 -0.2363 17  C   D "O3'" 
5608 C "C2'" . C   D 17  ? 1.2052 0.8945 1.0542 -0.1303 -0.1415 -0.2362 17  C   D "C2'" 
5609 O "O2'" . C   D 17  ? 1.1762 0.9179 1.0480 -0.2339 -0.1622 -0.1873 17  C   D "O2'" 
5610 C "C1'" . C   D 17  ? 1.1126 0.8935 1.0794 -0.0787 -0.1664 -0.2441 17  C   D "C1'" 
5611 N N1    . C   D 17  ? 1.0393 0.8419 1.0697 0.0193  -0.1695 -0.2880 17  C   D N1    
5612 C C2    . C   D 17  ? 0.9303 0.8173 1.1012 0.0448  -0.1935 -0.2972 17  C   D C2    
5613 O O2    . C   D 17  ? 0.8763 0.8128 1.1178 -0.0076 -0.2088 -0.2686 17  C   D O2    
5614 N N3    . C   D 17  ? 0.8760 0.7930 1.0972 0.1180  -0.2006 -0.3327 17  C   D N3    
5615 C C4    . C   D 17  ? 0.9107 0.7859 1.0541 0.1660  -0.1868 -0.3531 17  C   D C4    
5616 N N4    . C   D 17  ? 0.8698 0.7926 1.0623 0.2241  -0.1997 -0.3791 17  C   D N4    
5617 C C5    . C   D 17  ? 1.0045 0.7928 1.0133 0.1500  -0.1606 -0.3440 17  C   D C5    
5618 C C6    . C   D 17  ? 1.0709 0.8212 1.0246 0.0759  -0.1519 -0.3140 17  C   D C6    
5630 P P     . G   D 18  ? 1.5813 0.8686 0.9681 -0.1671 0.0057  -0.2607 18  G   D P     
5631 O OP1   . G   D 18  ? 1.7067 0.8306 0.8804 -0.2665 0.0629  -0.2518 18  G   D OP1   
5632 O OP2   . G   D 18  ? 1.5677 0.8393 0.9719 -0.0464 0.0250  -0.2848 18  G   D OP2   
5633 O "O5'" . G   D 18  ? 1.5135 0.9043 1.0535 -0.1583 -0.0281 -0.2574 18  G   D "O5'" 
5634 C "C5'" . G   D 18  ? 1.4854 0.9344 1.0594 -0.2620 -0.0585 -0.2268 18  G   D "C5'" 
5635 C "C4'" . G   D 18  ? 1.3939 0.9602 1.1445 -0.2289 -0.0959 -0.2270 18  G   D "C4'" 
5636 O "O4'" . G   D 18  ? 1.2681 0.9717 1.2004 -0.1556 -0.1423 -0.2352 18  G   D "O4'" 
5637 C "C3'" . G   D 18  ? 1.4461 0.9480 1.1803 -0.1568 -0.0582 -0.2531 18  G   D "C3'" 
5638 O "O3'" . G   D 18  ? 1.5321 0.9092 1.1249 -0.2245 -0.0083 -0.2475 18  G   D "O3'" 
5639 C "C2'" . G   D 18  ? 1.2943 0.9538 1.2414 -0.1066 -0.1134 -0.2567 18  G   D "C2'" 
5640 O "O2'" . G   D 18  ? 1.2194 0.9407 1.2299 -0.1848 -0.1412 -0.2313 18  G   D "O2'" 
5641 C "C1'" . G   D 18  ? 1.1883 0.9453 1.2328 -0.0847 -0.1537 -0.2565 18  G   D "C1'" 
5642 N N9    . G   D 18  ? 1.1743 0.9335 1.2362 0.0163  -0.1478 -0.2874 18  G   D N9    
5643 C C8    . G   D 18  ? 1.2384 0.9311 1.2011 0.0469  -0.1237 -0.2974 18  G   D C8    
5644 N N7    . G   D 18  ? 1.1719 0.8996 1.1797 0.1320  -0.1286 -0.3180 18  G   D N7    
5645 C C5    . G   D 18  ? 1.0713 0.8910 1.2105 0.1560  -0.1574 -0.3239 18  G   D C5    
5646 C C6    . G   D 18  ? 0.9702 0.8694 1.1984 0.2262  -0.1780 -0.3400 18  G   D C6    
5647 O O6    . G   D 18  ? 0.9566 0.8681 1.1671 0.2811  -0.1769 -0.3488 18  G   D O6    
5648 N N1    . G   D 18  ? 0.8834 0.8598 1.2273 0.2198  -0.2046 -0.3409 18  G   D N1    
5649 C C2    . G   D 18  ? 0.9048 0.8834 1.2802 0.1584  -0.2102 -0.3263 18  G   D C2    
5650 N N2    . G   D 18  ? 0.8018 0.8599 1.2938 0.1631  -0.2364 -0.3291 18  G   D N2    
5651 N N3    . G   D 18  ? 0.9829 0.8969 1.2775 0.0889  -0.1938 -0.3064 18  G   D N3    
5652 C C4    . G   D 18  ? 1.0722 0.9079 1.2483 0.0900  -0.1678 -0.3071 18  G   D C4    
5664 P P     . A   D 19  ? 1.5985 0.8082 1.0576 -0.1592 0.0805  -0.2664 19  A   D P     
5665 O OP1   . A   D 19  ? 1.7160 0.7676 0.9897 -0.2631 0.1425  -0.2617 19  A   D OP1   
5666 O OP2   . A   D 19  ? 1.6331 0.7958 1.0442 -0.0800 0.1066  -0.2764 19  A   D OP2   
5667 O "O5'" . A   D 19  ? 1.5209 0.8341 1.1489 -0.0702 0.0583  -0.2712 19  A   D "O5'" 
5668 C "C5'" . A   D 19  ? 1.4598 0.8636 1.1913 -0.1202 0.0162  -0.2628 19  A   D "C5'" 
5669 C "C4'" . A   D 19  ? 1.3832 0.9028 1.2861 -0.0273 -0.0136 -0.2692 19  A   D "C4'" 
5670 O "O4'" . A   D 19  ? 1.2206 0.8815 1.2700 0.0251  -0.0764 -0.2777 19  A   D "O4'" 
5671 C "C3'" . A   D 19  ? 1.4208 0.8702 1.2875 0.0724  0.0477  -0.2696 19  A   D "C3'" 
5672 O "O3'" . A   D 19  ? 1.5136 0.8442 1.2857 0.0481  0.1146  -0.2624 19  A   D "O3'" 
5673 C "C2'" . A   D 19  ? 1.2272 0.8489 1.2892 0.1521  -0.0141 -0.2726 19  A   D "C2'" 
5674 O "O2'" . A   D 19  ? 1.1734 0.8649 1.3349 0.1331  -0.0398 -0.2698 19  A   D "O2'" 
5675 C "C1'" . A   D 19  ? 1.1138 0.8360 1.2533 0.1243  -0.0811 -0.2851 19  A   D "C1'" 
5676 N N9    . A   D 19  ? 1.0753 0.8061 1.2008 0.1891  -0.0806 -0.2924 19  A   D N9    
5677 C C8    . A   D 19  ? 1.1576 0.8080 1.1693 0.1775  -0.0568 -0.2944 19  A   D C8    
5678 N N7    . A   D 19  ? 1.1083 0.7982 1.1420 0.2463  -0.0654 -0.2997 19  A   D N7    
5679 C C5    . A   D 19  ? 0.9927 0.7991 1.1579 0.2999  -0.0984 -0.2997 19  A   D C5    
5680 C C6    . A   D 19  ? 0.9371 0.8415 1.1752 0.3674  -0.1253 -0.2998 19  A   D C6    
5681 N N6    . A   D 19  ? 0.9707 0.8700 1.1623 0.3998  -0.1223 -0.3007 19  A   D N6    
5682 N N1    . A   D 19  ? 0.8607 0.8745 1.2164 0.3923  -0.1578 -0.2962 19  A   D N1    
5683 C C2    . A   D 19  ? 0.8263 0.8461 1.2296 0.3604  -0.1611 -0.2949 19  A   D C2    
5684 N N3    . A   D 19  ? 0.8611 0.7957 1.2081 0.2993  -0.1377 -0.2947 19  A   D N3    
5685 C C4    . A   D 19  ? 0.9572 0.7879 1.1815 0.2680  -0.1073 -0.2963 19  A   D C4    
5697 P P     . U   D 20  ? 1.9509 1.0884 1.5571 0.1020  0.2321  -0.2522 20  U   D P     
5698 O OP1   . U   D 20  ? 2.0738 1.0210 1.4646 -0.0100 0.2980  -0.2604 20  U   D OP1   
5699 O OP2   . U   D 20  ? 1.9107 1.0823 1.5472 0.2011  0.2331  -0.2437 20  U   D OP2   
5700 O "O5'" . U   D 20  ? 1.9493 1.0972 1.6245 0.1647  0.2689  -0.2348 20  U   D "O5'" 
5701 C "C5'" . U   D 20  ? 1.8607 1.1722 1.7098 0.1637  0.1936  -0.2360 20  U   D "C5'" 
5702 C "C4'" . U   D 20  ? 1.9284 1.1724 1.7184 0.0683  0.2138  -0.2416 20  U   D "C4'" 
5703 O "O4'" . U   D 20  ? 1.8390 1.2138 1.7920 0.1042  0.1726  -0.2339 20  U   D "O4'" 
5704 C "C3'" . U   D 20  ? 2.0880 1.0987 1.6731 0.0470  0.3414  -0.2370 20  U   D "C3'" 
5705 O "O3'" . U   D 20  ? 2.1656 1.0953 1.6333 -0.0964 0.3458  -0.2513 20  U   D "O3'" 
5706 C "C2'" . U   D 20  ? 2.0483 1.0911 1.7292 0.1381  0.3771  -0.2142 20  U   D "C2'" 
5707 O "O2'" . U   D 20  ? 2.2049 1.0573 1.7394 0.1112  0.4904  -0.2098 20  U   D "O2'" 
5708 C "C1'" . U   D 20  ? 1.9125 1.1613 1.7824 0.1096  0.2613  -0.2223 20  U   D "C1'" 
5709 N N1    . U   D 20  ? 1.7991 1.1732 1.8329 0.2016  0.2432  -0.2009 20  U   D N1    
5710 C C2    . U   D 20  ? 1.6507 1.1955 1.8424 0.2882  0.1778  -0.1892 20  U   D C2    
5711 O O2    . U   D 20  ? 1.6235 1.2146 1.8266 0.3000  0.1380  -0.1984 20  U   D O2    
5712 N N3    . U   D 20  ? 1.5221 1.1813 1.8506 0.3547  0.1627  -0.1645 20  U   D N3    
5713 C C4    . U   D 20  ? 1.5388 1.1614 1.8725 0.3519  0.2061  -0.1506 20  U   D C4    
5714 O O4    . U   D 20  ? 1.4298 1.1798 1.9007 0.4158  0.1824  -0.1238 20  U   D O4    
5715 C C5    . U   D 20  ? 1.7108 1.1457 1.8757 0.2630  0.2765  -0.1685 20  U   D C5    
5716 C C6    . U   D 20  ? 1.8241 1.1456 1.8445 0.1879  0.2904  -0.1924 20  U   D C6    
5727 P P     . U   D 21  ? 4.1443 1.3708 1.6603 -0.0493 1.1099  0.0260  21  U   D P     
5728 O OP1   . U   D 21  ? 4.1005 1.3871 1.6619 -0.0568 1.1009  0.0380  21  U   D OP1   
5729 O OP2   . U   D 21  ? 4.1934 1.3877 1.6981 0.0075  1.1395  0.0401  21  U   D OP2   
5730 O "O5'" . U   D 21  ? 4.0168 1.3396 1.6025 -0.0837 1.0866  0.0145  21  U   D "O5'" 
5731 C "C5'" . U   D 21  ? 3.9381 1.3094 1.5512 -0.1359 1.0609  0.0026  21  U   D "C5'" 
5732 C "C4'" . U   D 21  ? 3.8024 1.3011 1.5235 -0.1380 1.0523  0.0113  21  U   D "C4'" 
5733 O "O4'" . U   D 21  ? 3.6794 1.2443 1.4486 -0.1794 1.0337  -0.0011 21  U   D "O4'" 
5734 C "C3'" . U   D 21  ? 3.6923 1.2543 1.4767 -0.0940 1.0658  0.0269  21  U   D "C3'" 
5735 O "O3'" . U   D 21  ? 3.7206 1.2673 1.4983 -0.0535 1.0827  0.0467  21  U   D "O3'" 
5736 C "C2'" . U   D 21  ? 3.5712 1.2520 1.4534 -0.1182 1.0508  0.0245  21  U   D "C2'" 
5737 O "O2'" . U   D 21  ? 3.5526 1.2757 1.4661 -0.1291 1.0453  0.0306  21  U   D "O2'" 
5738 C "C1'" . U   D 21  ? 3.5764 1.2441 1.4394 -0.1659 1.0349  0.0058  21  U   D "C1'" 
5739 N N1    . U   D 21  ? 3.5692 1.2432 1.4361 -0.1654 1.0350  0.0015  21  U   D N1    
5740 C C2    . U   D 21  ? 3.4881 1.2449 1.4323 -0.1445 1.0394  0.0097  21  U   D C2    
5741 O O2    . U   D 21  ? 3.4234 1.2464 1.4317 -0.1267 1.0432  0.0196  21  U   D O2    
5742 N N3    . U   D 21  ? 3.5471 1.3062 1.4870 -0.1476 1.0385  0.0069  21  U   D N3    
5743 C C4    . U   D 21  ? 3.6229 1.3125 1.4883 -0.1720 1.0328  -0.0032 21  U   D C4    
5744 O O4    . U   D 21  ? 3.6168 1.3232 1.4862 -0.1751 1.0315  -0.0027 21  U   D O4    
5745 C C5    . U   D 21  ? 3.7069 1.3098 1.4928 -0.1945 1.0278  -0.0125 21  U   D C5    
5746 C C6    . U   D 21  ? 3.6469 1.2456 1.4379 -0.1892 1.0295  -0.0097 21  U   D C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASN 15  15  15  ASN ASN A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  TRP 19  19  19  TRP TRP A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  TRP 90  90  90  TRP TRP A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 CYS 134 134 134 CYS CYS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 VAL 150 150 ?   ?   ?   A . n 
A 1 151 GLU 151 151 ?   ?   ?   A . n 
A 1 152 VAL 152 152 ?   ?   ?   A . n 
A 1 153 GLU 153 153 ?   ?   ?   A . n 
A 1 154 SER 154 154 ?   ?   ?   A . n 
A 1 155 ASN 155 155 ?   ?   ?   A . n 
A 1 156 VAL 156 156 ?   ?   ?   A . n 
A 1 157 SER 157 157 ?   ?   ?   A . n 
A 1 158 ARG 158 158 ?   ?   ?   A . n 
A 1 159 GLY 159 159 ?   ?   ?   A . n 
A 1 160 CYS 160 160 ?   ?   ?   A . n 
A 1 161 PRO 161 161 ?   ?   ?   A . n 
A 1 162 GLU 162 162 ?   ?   ?   A . n 
A 1 163 GLY 163 163 ?   ?   ?   A . n 
A 1 164 ILE 164 164 ?   ?   ?   A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
A 1 166 THR 166 166 ?   ?   ?   A . n 
A 1 167 PHE 167 167 ?   ?   ?   A . n 
A 1 168 LYS 168 168 ?   ?   ?   A . n 
A 1 169 LYS 169 169 ?   ?   ?   A . n 
A 1 170 GLU 170 170 ?   ?   ?   A . n 
A 1 171 SER 171 171 ?   ?   ?   A . n 
A 1 172 GLU 172 172 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLU 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   3   ARG ARG B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  GLU 12  12  12  GLU GLU B . n 
B 1 13  GLN 13  13  13  GLN GLN B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  ASN 15  15  15  ASN ASN B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  TRP 19  19  19  TRP TRP B . n 
B 1 20  ASP 20  20  20  ASP ASP B . n 
B 1 21  GLY 21  21  21  GLY GLY B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  THR 27  27  27  THR THR B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  PHE 30  30  30  PHE PHE B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  PRO 33  33  33  PRO PRO B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  GLU 35  35  35  GLU GLU B . n 
B 1 36  SER 36  36  36  SER SER B . n 
B 1 37  PRO 37  37  37  PRO PRO B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  THR 40  40  40  THR THR B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  TRP 42  42  42  TRP TRP B . n 
B 1 43  ARG 43  43  43  ARG ARG B . n 
B 1 44  LEU 44  44  44  LEU LEU B . n 
B 1 45  TYR 45  45  45  TYR TYR B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  ASP 47  47  47  ASP ASP B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  ASN 52  52  52  ASN ASN B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  ASP 54  54  54  ASP ASP B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  TRP 63  63  63  TRP TRP B . n 
B 1 64  GLY 64  64  64  GLY GLY B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  VAL 69  69  69  VAL VAL B . n 
B 1 70  PHE 70  70  70  PHE PHE B . n 
B 1 71  LYS 71  71  71  LYS LYS B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  TYR 73  73  73  TYR TYR B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  ARG 75  75  75  ARG ARG B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  THR 79  79  79  THR THR B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  HIS 84  84  84  HIS HIS B . n 
B 1 85  ARG 85  85  85  ARG ARG B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  TRP 90  90  90  TRP TRP B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  GLY 92  92  92  GLY GLY B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  TYR 97  97  97  TYR TYR B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ALA 105 105 105 ALA ALA B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 VAL 108 108 108 VAL VAL B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 THR 111 111 111 THR THR B . n 
B 1 112 TYR 112 112 112 TYR TYR B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 ILE 114 114 114 ILE ILE B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 PHE 116 116 116 PHE PHE B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 SER 127 127 127 SER SER B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 THR 129 129 129 THR THR B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 CYS 134 134 134 CYS CYS B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 MET 136 136 136 MET MET B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 GLU 143 143 143 GLU GLU B . n 
B 1 144 LEU 144 144 144 LEU LEU B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 GLN 146 146 146 GLN GLN B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 PRO 149 149 ?   ?   ?   B . n 
B 1 150 VAL 150 150 ?   ?   ?   B . n 
B 1 151 GLU 151 151 ?   ?   ?   B . n 
B 1 152 VAL 152 152 ?   ?   ?   B . n 
B 1 153 GLU 153 153 ?   ?   ?   B . n 
B 1 154 SER 154 154 ?   ?   ?   B . n 
B 1 155 ASN 155 155 ?   ?   ?   B . n 
B 1 156 VAL 156 156 ?   ?   ?   B . n 
B 1 157 SER 157 157 ?   ?   ?   B . n 
B 1 158 ARG 158 158 ?   ?   ?   B . n 
B 1 159 GLY 159 159 ?   ?   ?   B . n 
B 1 160 CYS 160 160 ?   ?   ?   B . n 
B 1 161 PRO 161 161 ?   ?   ?   B . n 
B 1 162 GLU 162 162 ?   ?   ?   B . n 
B 1 163 GLY 163 163 ?   ?   ?   B . n 
B 1 164 ILE 164 164 ?   ?   ?   B . n 
B 1 165 GLU 165 165 ?   ?   ?   B . n 
B 1 166 THR 166 166 ?   ?   ?   B . n 
B 1 167 PHE 167 167 ?   ?   ?   B . n 
B 1 168 LYS 168 168 ?   ?   ?   B . n 
B 1 169 LYS 169 169 ?   ?   ?   B . n 
B 1 170 GLU 170 170 ?   ?   ?   B . n 
B 1 171 SER 171 171 ?   ?   ?   B . n 
B 1 172 GLU 172 172 ?   ?   ?   B . n 
C 2 1   U   1   1   1   U   U   C . n 
C 2 2   C   2   2   2   C   C   C . n 
C 2 3   G   3   3   3   G   G   C . n 
C 2 4   A   4   4   4   A   A   C . n 
C 2 5   A   5   5   5   A   A   C . n 
C 2 6   G   6   6   6   G   G   C . n 
C 2 7   U   7   7   7   U   U   C . n 
C 2 8   A   8   8   8   A   A   C . n 
C 2 9   U   9   9   9   U   U   C . n 
C 2 10  U   10  10  10  U   U   C . n 
C 2 11  C   11  11  11  C   C   C . n 
C 2 12  C   12  12  12  C   C   C . n 
C 2 13  G   13  13  13  G   G   C . n 
C 2 14  C   14  14  14  C   C   C . n 
C 2 15  G   15  15  15  G   G   C . n 
C 2 16  U   16  16  16  U   U   C . n 
C 2 17  A   17  17  17  A   A   C . n 
C 2 18  C   18  18  18  C   C   C . n 
C 2 19  G   19  19  19  G   G   C . n 
C 2 20  U   20  20  20  U   U   C . n 
C 2 21  U   21  21  21  U   U   C . n 
D 3 1   C   1   1   1   C   C   D . n 
D 3 2   G   2   2   2   G   G   D . n 
D 3 3   U   3   3   3   U   U   D . n 
D 3 4   A   4   4   4   A   A   D . n 
D 3 5   C   5   5   5   C   C   D . n 
D 3 6   G   6   6   6   G   G   D . n 
D 3 7   C   7   7   7   C   C   D . n 
D 3 8   G   8   8   8   G   G   D . n 
D 3 9   G   9   9   9   G   G   D . n 
D 3 10  A   10  10  10  A   A   D . n 
D 3 11  A   11  11  11  A   A   D . n 
D 3 12  U   12  12  12  U   U   D . n 
D 3 13  A   13  13  13  A   A   D . n 
D 3 14  C   14  14  14  C   C   D . n 
D 3 15  U   15  15  15  U   U   D . n 
D 3 16  U   16  16  16  U   U   D . n 
D 3 17  C   17  17  17  C   C   D . n 
D 3 18  G   18  18  18  G   G   D . n 
D 3 19  A   19  19  19  A   A   D . n 
D 3 20  U   20  20  20  U   U   D . n 
D 3 21  U   21  21  21  U   U   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1  201 165 HOH HOH A . 
E 4 HOH 2  202 1   HOH HOH A . 
E 4 HOH 3  203 37  HOH HOH A . 
E 4 HOH 4  204 136 HOH HOH A . 
E 4 HOH 5  205 29  HOH HOH A . 
E 4 HOH 6  206 3   HOH HOH A . 
E 4 HOH 7  207 78  HOH HOH A . 
E 4 HOH 8  208 2   HOH HOH A . 
E 4 HOH 9  209 83  HOH HOH A . 
E 4 HOH 10 210 60  HOH HOH A . 
E 4 HOH 11 211 135 HOH HOH A . 
E 4 HOH 12 212 148 HOH HOH A . 
E 4 HOH 13 213 137 HOH HOH A . 
E 4 HOH 14 214 147 HOH HOH A . 
E 4 HOH 15 215 32  HOH HOH A . 
E 4 HOH 16 216 145 HOH HOH A . 
E 4 HOH 17 217 80  HOH HOH A . 
E 4 HOH 18 218 146 HOH HOH A . 
E 4 HOH 19 219 154 HOH HOH A . 
E 4 HOH 20 220 85  HOH HOH A . 
F 4 HOH 1  201 103 HOH HOH B . 
F 4 HOH 2  202 157 HOH HOH B . 
F 4 HOH 3  203 142 HOH HOH B . 
F 4 HOH 4  204 172 HOH HOH B . 
F 4 HOH 5  205 130 HOH HOH B . 
F 4 HOH 6  206 48  HOH HOH B . 
F 4 HOH 7  207 141 HOH HOH B . 
F 4 HOH 8  208 51  HOH HOH B . 
F 4 HOH 9  209 64  HOH HOH B . 
F 4 HOH 10 210 129 HOH HOH B . 
F 4 HOH 11 211 143 HOH HOH B . 
F 4 HOH 12 212 13  HOH HOH B . 
F 4 HOH 13 213 114 HOH HOH B . 
F 4 HOH 14 214 98  HOH HOH B . 
F 4 HOH 15 215 74  HOH HOH B . 
F 4 HOH 16 216 170 HOH HOH B . 
F 4 HOH 17 217 25  HOH HOH B . 
F 4 HOH 18 218 169 HOH HOH B . 
F 4 HOH 19 219 153 HOH HOH B . 
G 4 HOH 1  101 7   HOH HOH C . 
G 4 HOH 2  102 12  HOH HOH C . 
G 4 HOH 3  103 58  HOH HOH C . 
G 4 HOH 4  104 149 HOH HOH C . 
G 4 HOH 5  105 162 HOH HOH C . 
G 4 HOH 6  106 56  HOH HOH C . 
G 4 HOH 7  107 140 HOH HOH C . 
G 4 HOH 8  108 100 HOH HOH C . 
G 4 HOH 9  109 84  HOH HOH C . 
G 4 HOH 10 110 35  HOH HOH C . 
G 4 HOH 11 111 173 HOH HOH C . 
G 4 HOH 12 112 77  HOH HOH C . 
G 4 HOH 13 113 150 HOH HOH C . 
G 4 HOH 14 114 6   HOH HOH C . 
G 4 HOH 15 115 171 HOH HOH C . 
G 4 HOH 16 116 113 HOH HOH C . 
H 4 HOH 1  101 69  HOH HOH D . 
H 4 HOH 2  102 20  HOH HOH D . 
H 4 HOH 3  103 168 HOH HOH D . 
H 4 HOH 4  104 95  HOH HOH D . 
H 4 HOH 5  105 133 HOH HOH D . 
H 4 HOH 6  106 164 HOH HOH D . 
H 4 HOH 7  107 151 HOH HOH D . 
H 4 HOH 8  108 134 HOH HOH D . 
H 4 HOH 9  109 76  HOH HOH D . 
H 4 HOH 10 110 163 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7370  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  20180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-01-16 
2 'Structure model' 1 1 2019-07-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined -3.7021  40.9418 72.3532 0.8286 0.3329 0.6438 0.0501  0.1296  -0.0698 7.3017 6.3253 4.0312 
-6.7805 -0.4278 0.5234  0.6808  -0.0040 0.1883  0.3706  -0.5721 1.8480  1.9804  -0.1916 -1.4617 
'X-RAY DIFFRACTION' 2  ? refined 0.1754   46.0422 80.8602 1.2693 0.5025 0.6015 0.0407  0.2954  0.0959  9.6276 4.6907 7.7969 
-5.5415 7.3518  -2.4159 -1.9546 0.3682  0.1927  -1.2512 0.1076  0.7864  4.2336  0.1139  -0.5558 
'X-RAY DIFFRACTION' 3  ? refined 5.3632   63.3940 76.3801 0.9597 0.4059 0.5537 0.1097  0.0473  0.0122  4.4043 8.2706 1.6506 
-4.9678 -1.1899 0.1872  0.0474  0.1288  -0.1472 -0.0200 1.1063  -0.8354 0.5898  -1.0672 -0.2161 
'X-RAY DIFFRACTION' 4  ? refined 12.7208  71.5258 69.6209 2.2408 0.8104 0.4611 0.2712  0.3580  0.1441  6.5936 0.4401 0.0632 1.7012 
0.4349  0.1207  0.8836  0.0015  -0.6676 2.0289  1.6300  -0.1828 -0.6101 -1.7890 0.3662  
'X-RAY DIFFRACTION' 5  ? refined 12.6889  49.9827 75.6906 0.7143 0.3967 0.3366 0.0370  -0.0060 0.0137  6.0349 8.0638 5.7837 1.0200 
-0.5148 0.9523  0.3233  -0.3653 0.0939  -0.2230 -0.1911 -0.3396 1.7571  0.3124  0.4403  
'X-RAY DIFFRACTION' 6  ? refined 15.3385  45.0361 66.7680 0.5824 0.4149 0.3189 0.1255  -0.0153 -0.0095 8.2718 9.8659 5.0448 2.7106 
-0.9906 0.0245  -0.2092 0.2184  0.0234  -0.1097 -0.5831 -0.6570 0.0742  -0.0115 0.1860  
'X-RAY DIFFRACTION' 7  ? refined 23.9566  62.0159 68.4269 1.2762 0.6318 1.0227 -0.2822 -0.0236 0.1753  9.2499 4.8435 5.3428 5.6418 
-6.4374 -5.0217 0.6098  0.0780  -0.2480 0.0214  2.1943  -0.3256 -0.1954 -3.0901 1.5108  
'X-RAY DIFFRACTION' 8  ? refined 11.7923  55.2674 38.3013 0.9252 0.4175 0.5377 0.0750  0.1063  -0.0035 5.3416 8.2213 6.9529 
-5.3068 0.6218  0.6848  -0.5423 0.4145  -0.4306 -0.6342 1.0788  -0.1572 -1.0270 -1.8271 -0.3039 
'X-RAY DIFFRACTION' 9  ? refined 22.5468  51.2078 36.0600 0.4939 0.7155 0.9983 0.0354  -0.0092 -0.0831 1.4675 3.7434 9.6759 
-0.1000 -1.0303 5.8009  0.5032  0.6053  -0.4951 1.4831  -0.1560 -1.3579 -1.2417 -1.4595 0.5283  
'X-RAY DIFFRACTION' 10 ? refined 24.3527  37.1872 43.2258 0.7806 0.2500 0.5252 0.0599  0.2220  -0.0701 4.8011 1.7213 2.7587 
-0.6724 1.0060  -0.3112 0.0606  0.1616  -0.2701 0.6696  -1.1836 -1.6989 1.5374  0.8574  0.0469  
'X-RAY DIFFRACTION' 11 ? refined 24.9990  28.8412 53.7752 1.1317 0.6727 1.1784 0.4348  -0.0866 0.5711  6.1496 5.5453 0.1245 5.8233 
-0.9549 -0.8549 0.6973  0.9399  -0.6096 -2.8105 0.1648  1.2140  1.0488  1.6353  -0.2843 
'X-RAY DIFFRACTION' 12 ? refined 25.6022  50.5224 48.6708 0.5051 0.2815 0.4291 -0.0124 0.1231  -0.0367 6.1753 4.9834 3.8830 
-5.4347 1.5727  -1.5537 -0.0456 -0.1112 0.1725  0.2579  0.6892  -0.8022 -0.3424 -0.4713 0.3577  
'X-RAY DIFFRACTION' 13 ? refined 16.2270  53.8416 52.1970 0.5521 0.3433 0.2832 -0.0415 0.1184  -0.0633 5.8647 2.2106 4.9044 
-1.7410 0.5963  0.3561  -0.3500 0.5311  -0.0346 -0.0798 0.2282  0.5232  0.4152  -0.6551 -0.4751 
'X-RAY DIFFRACTION' 14 ? refined 22.5729  53.6736 58.9189 0.5322 0.3346 0.5981 -0.0816 0.0272  -0.0048 3.7656 7.8312 8.4660 
-0.7403 -1.0175 0.1152  -0.2762 0.3268  0.0297  -0.5528 0.6888  -1.0058 0.1444  -0.8874 0.3394  
'X-RAY DIFFRACTION' 15 ? refined 10.1785  37.3954 42.9316 0.8523 0.4973 0.6867 0.0264  0.1558  -0.0534 2.1506 7.2811 4.9213 2.1842 
-1.5790 1.8504  -0.1832 -0.2583 0.4268  0.4590  -0.1948 0.4656  0.5034  -0.3546 -0.3955 
'X-RAY DIFFRACTION' 16 ? refined 2.0839   50.4894 56.4241 0.6360 0.4586 0.6302 0.1622  0.0508  -0.1335 2.0644 5.7124 3.8400 0.6322 
-0.2493 0.8680  0.1415  -0.5362 0.4254  0.2792  0.3717  0.8750  0.0655  -0.2425 -0.7454 
'X-RAY DIFFRACTION' 17 ? refined -8.3378  66.3486 67.0055 1.3863 0.5154 0.9309 0.2116  0.1850  -0.1676 8.8430 0.2416 9.0634 
-0.0501 -7.9142 0.6944  1.1375  0.8089  -1.5229 1.2461  1.5612  -1.5133 1.2982  -1.6398 -1.2357 
'X-RAY DIFFRACTION' 18 ? refined -10.5298 61.3527 79.1232 2.1587 2.2190 3.5618 -1.1779 -0.2179 1.6013  5.7566 3.9129 9.4236 0.8951 
-6.6546 1.5277  0.1758  0.0869  -0.2025 0.1330  0.1637  -0.4349 -0.5497 -0.4770 0.1990  
'X-RAY DIFFRACTION' 19 ? refined -3.7175  58.8147 66.5368 1.0897 0.6004 0.5754 0.1783  0.0891  -0.0848 8.2991 3.8411 3.0449 
-4.5005 1.0554  -2.2645 0.9374  -0.7943 0.0118  0.8800  -0.0455 -0.0787 -0.7580 0.8558  -0.5319 
'X-RAY DIFFRACTION' 20 ? refined 4.4126   46.2090 52.8425 0.8127 0.4190 0.7084 0.1073  -0.0194 -0.2026 6.4348 5.3999 3.5359 
-2.2701 0.3876  -2.9979 -0.0296 -0.5465 0.5573  0.3483  0.5398  -0.3502 -0.1301 0.1273  -0.4742 
'X-RAY DIFFRACTION' 21 ? refined 9.1640   29.0282 39.3925 1.1324 0.7358 1.0211 0.0808  -0.0760 -0.2987 5.5433 5.9937 9.5199 5.7465 
-6.3913 -7.2010 -1.7780 1.0360  0.9500  -0.1476 0.5865  -0.5971 -0.7472 3.0434  -0.0311 
'X-RAY DIFFRACTION' 22 ? refined 16.5017  22.7888 28.9123 3.9080 1.2303 1.2836 -0.1545 1.2422  0.0707  3.5585 3.1477 3.1880 2.0570 
-0.8943 -2.9281 -0.1841 0.3959  -0.5781 -0.0670 0.3747  0.3473  0.8515  -2.3487 -0.1677 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 2   A 18  
;chain 'A' and (resid 2 through 18 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 19  A 28  
;chain 'A' and (resid 19 through 28 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 29  A 47  
;chain 'A' and (resid 29 through 47 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 48  A 57  
;chain 'A' and (resid 48 through 57 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 58  A 101 
;chain 'A' and (resid 58 through 101 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 102 A 144 
;chain 'A' and (resid 102 through 144 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 145 A 149 
;chain 'A' and (resid 145 through 149 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 3   B 18  
;chain 'B' and (resid 3 through 18 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 19  B 28  
;chain 'B' and (resid 19 through 28 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 29  B 45  
;chain 'B' and (resid 29 through 45 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 B 46  B 58  
;chain 'B' and (resid 46 through 58 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 B 59  B 101 
;chain 'B' and (resid 59 through 101 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 B 102 B 118 
;chain 'B' and (resid 102 through 118 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 B 119 B 148 
;chain 'B' and (resid 119 through 148 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 C 1   C 5   
;chain 'C' and (resid 1 through 5 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 C 6   C 15  
;chain 'C' and (resid 6 through 15 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 C 16  C 20  
;chain 'C' and (resid 16 through 20 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 C 21  C 21  
;chain 'C' and (resid 21 through 21 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 19 19 D 1   D 5   
;chain 'D' and (resid 1 through 5 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 20 20 D 6   D 15  
;chain 'D' and (resid 6 through 15 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 21 21 D 16  D 20  
;chain 'D' and (resid 16 through 20 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 22 22 D 21  D 21  
;chain 'D' and (resid 21 through 21 )
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? '(1.10.1_2155)' 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .               2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22            3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .               4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .               5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    41 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    201 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HH11 A ARG 101 ? ? 1_555 O     B GLY 24 ? ? 1_556 1.52 
2 1 OE2  A GLU 12  ? ? 1_555 "O2'" D U   21 ? ? 1_566 2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P C U 1 ? ? OP3 C U 1 ? ? 1.482 1.607 -0.125 0.012 N 
2 1 P D C 1 ? ? OP3 D C 1 ? ? 1.482 1.607 -0.125 0.012 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 23  ? ? 167.75  -47.26  
2  1 ASN A 46  ? ? -86.11  30.91   
3  1 THR A 49  ? ? -108.40 71.54   
4  1 ASN A 50  ? ? -35.40  115.64  
5  1 SER A 51  ? ? -166.69 -166.63 
6  1 ASP A 54  ? ? -160.49 118.81  
7  1 SER B 23  ? ? -172.79 121.26  
8  1 LEU B 44  ? ? -63.17  9.27    
9  1 TYR B 45  ? ? -102.13 45.83   
10 1 GLU B 48  ? ? 79.66   -0.87   
11 1 ASN B 52  ? ? -144.47 -27.07  
12 1 ASP B 54  ? ? -78.38  -75.64  
13 1 ALA B 105 ? ? 60.54   -121.86 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A VAL 150 ? A VAL 150 
3  1 Y 1 A GLU 151 ? A GLU 151 
4  1 Y 1 A VAL 152 ? A VAL 152 
5  1 Y 1 A GLU 153 ? A GLU 153 
6  1 Y 1 A SER 154 ? A SER 154 
7  1 Y 1 A ASN 155 ? A ASN 155 
8  1 Y 1 A VAL 156 ? A VAL 156 
9  1 Y 1 A SER 157 ? A SER 157 
10 1 Y 1 A ARG 158 ? A ARG 158 
11 1 Y 1 A GLY 159 ? A GLY 159 
12 1 Y 1 A CYS 160 ? A CYS 160 
13 1 Y 1 A PRO 161 ? A PRO 161 
14 1 Y 1 A GLU 162 ? A GLU 162 
15 1 Y 1 A GLY 163 ? A GLY 163 
16 1 Y 1 A ILE 164 ? A ILE 164 
17 1 Y 1 A GLU 165 ? A GLU 165 
18 1 Y 1 A THR 166 ? A THR 166 
19 1 Y 1 A PHE 167 ? A PHE 167 
20 1 Y 1 A LYS 168 ? A LYS 168 
21 1 Y 1 A LYS 169 ? A LYS 169 
22 1 Y 1 A GLU 170 ? A GLU 170 
23 1 Y 1 A SER 171 ? A SER 171 
24 1 Y 1 A GLU 172 ? A GLU 172 
25 1 Y 1 B MET 1   ? B MET 1   
26 1 Y 1 B GLU 2   ? B GLU 2   
27 1 Y 1 B PRO 149 ? B PRO 149 
28 1 Y 1 B VAL 150 ? B VAL 150 
29 1 Y 1 B GLU 151 ? B GLU 151 
30 1 Y 1 B VAL 152 ? B VAL 152 
31 1 Y 1 B GLU 153 ? B GLU 153 
32 1 Y 1 B SER 154 ? B SER 154 
33 1 Y 1 B ASN 155 ? B ASN 155 
34 1 Y 1 B VAL 156 ? B VAL 156 
35 1 Y 1 B SER 157 ? B SER 157 
36 1 Y 1 B ARG 158 ? B ARG 158 
37 1 Y 1 B GLY 159 ? B GLY 159 
38 1 Y 1 B CYS 160 ? B CYS 160 
39 1 Y 1 B PRO 161 ? B PRO 161 
40 1 Y 1 B GLU 162 ? B GLU 162 
41 1 Y 1 B GLY 163 ? B GLY 163 
42 1 Y 1 B ILE 164 ? B ILE 164 
43 1 Y 1 B GLU 165 ? B GLU 165 
44 1 Y 1 B THR 166 ? B THR 166 
45 1 Y 1 B PHE 167 ? B PHE 167 
46 1 Y 1 B LYS 168 ? B LYS 168 
47 1 Y 1 B LYS 169 ? B LYS 169 
48 1 Y 1 B GLU 170 ? B GLU 170 
49 1 Y 1 B SER 171 ? B SER 171 
50 1 Y 1 B GLU 172 ? B GLU 172 
# 
_ndb_struct_conf_na.entry_id   6BJV 
_ndb_struct_conf_na.feature    'a-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C U 1  1_555 D A 19 1_555 -0.048 0.089  -0.465 13.588  -11.226 -4.092 1  C_U1:A19_D  C 1  ? D 19 ? 20 1 
1 C C 2  1_555 D G 18 1_555 -0.414 -0.016 -0.271 9.689   -16.334 4.642  2  C_C2:G18_D  C 2  ? D 18 ? 19 1 
1 C G 3  1_555 D C 17 1_555 0.027  0.363  -0.275 -3.181  -6.457  10.877 3  C_G3:C17_D  C 3  ? D 17 ? 19 1 
1 C A 4  1_555 D U 16 1_555 0.293  0.341  0.046  -5.466  -10.860 9.719  4  C_A4:U16_D  C 4  ? D 16 ? 20 1 
1 C A 5  1_555 D U 15 1_555 0.302  -0.067 -0.006 -3.605  -7.680  6.425  5  C_A5:U15_D  C 5  ? D 15 ? 20 1 
1 C G 6  1_555 D C 14 1_555 0.051  0.103  0.100  -8.445  -12.239 4.818  6  C_G6:C14_D  C 6  ? D 14 ? 19 1 
1 C U 7  1_555 D A 13 1_555 0.468  -0.273 0.125  -0.671  -20.384 2.623  7  C_U7:A13_D  C 7  ? D 13 ? 20 1 
1 C A 8  1_555 D U 12 1_555 -0.248 -0.112 0.314  -1.845  -14.942 1.343  8  C_A8:U12_D  C 8  ? D 12 ? 20 1 
1 C U 9  1_555 D A 11 1_555 -0.596 -0.227 0.096  3.049   -14.624 1.310  9  C_U9:A11_D  C 9  ? D 11 ? 20 1 
1 C U 10 1_555 D A 10 1_555 -0.155 -0.166 0.422  -1.925  -19.874 4.074  10 C_U10:A10_D C 10 ? D 10 ? 20 1 
1 C C 11 1_555 D G 9  1_555 0.262  -0.206 0.067  -1.782  -9.324  2.957  11 C_C11:G9_D  C 11 ? D 9  ? 19 1 
1 C C 12 1_555 D G 8  1_555 0.058  0.059  0.233  4.420   -14.986 3.451  12 C_C12:G8_D  C 12 ? D 8  ? 19 1 
1 C G 13 1_555 D C 7  1_555 -0.525 -0.260 0.366  6.205   -11.747 2.851  13 C_G13:C7_D  C 13 ? D 7  ? 19 1 
1 C C 14 1_555 D G 6  1_555 -0.036 -0.135 -0.037 9.483   -12.211 1.656  14 C_C14:G6_D  C 14 ? D 6  ? 19 1 
1 C G 15 1_555 D C 5  1_555 1.040  0.471  -0.167 -13.491 -9.346  2.154  15 C_G15:C5_D  C 15 ? D 5  ? 19 1 
1 C U 16 1_555 D A 4  1_555 0.352  0.048  -0.165 3.576   -3.803  4.790  16 C_U16:A4_D  C 16 ? D 4  ? 20 1 
1 C A 17 1_555 D U 3  1_555 0.098  0.075  0.243  5.309   -9.783  7.038  17 C_A17:U3_D  C 17 ? D 3  ? 20 1 
1 C C 18 1_555 D G 2  1_555 0.265  -0.099 0.010  4.954   -15.179 5.746  18 C_C18:G2_D  C 18 ? D 2  ? 19 1 
1 C G 19 1_555 D C 1  1_555 0.039  -0.222 0.006  -2.647  -13.996 2.458  19 C_G19:C1_D  C 19 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C U 1  1_555 D A 19 1_555 C C 2  1_555 D G 18 1_555 0.302  -1.861 3.204 -1.465 12.721 29.293 -5.383 -0.779 2.208 23.773 2.738  
31.913 1  CC_U1C2:G18A19_DD  C 1  ? D 19 ? C 2  ? D 18 ? 
1 C C 2  1_555 D G 18 1_555 C G 3  1_555 D C 17 1_555 0.509  -1.565 3.683 1.301  11.866 32.147 -4.620 -0.649 2.955 20.564 -2.255 
34.237 2  CC_C2G3:C17G18_DD  C 2  ? D 18 ? C 3  ? D 17 ? 
1 C G 3  1_555 D C 17 1_555 C A 4  1_555 D U 16 1_555 -0.047 -1.531 3.236 -0.134 11.103 29.522 -4.702 0.063  2.511 20.880 0.252  
31.498 3  CC_G3A4:U16C17_DD  C 3  ? D 17 ? C 4  ? D 16 ? 
1 C A 4  1_555 D U 16 1_555 C A 5  1_555 D U 15 1_555 -0.373 -1.553 3.098 -1.101 8.236  29.661 -4.354 0.511  2.595 15.704 2.099  
30.778 4  CC_A4A5:U15U16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C A 5  1_555 D U 15 1_555 C G 6  1_555 D C 14 1_555 0.072  -1.820 3.275 -0.769 12.938 27.104 -5.865 -0.278 2.193 25.817 1.534  
29.991 5  CC_A5G6:C14U15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C G 6  1_555 D C 14 1_555 C U 7  1_555 D A 13 1_555 -0.291 -1.275 3.095 0.931  2.179  35.001 -2.420 0.613  3.004 3.618  -1.545 
35.079 6  CC_G6U7:A13C14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C U 7  1_555 D A 13 1_555 C A 8  1_555 D U 12 1_555 0.057  -1.441 3.074 1.573  13.548 29.237 -4.650 0.136  2.207 25.184 -2.924 
32.199 7  CC_U7A8:U12A13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C A 8  1_555 D U 12 1_555 C U 9  1_555 D A 11 1_555 0.650  -1.867 3.183 2.201  5.892  23.274 -6.195 -0.914 2.685 14.273 -5.331 
24.098 8  CC_A8U9:A11U12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C U 9  1_555 D A 11 1_555 C U 10 1_555 D A 10 1_555 0.145  -1.455 3.357 -2.664 5.152  36.803 -2.958 -0.579 3.114 8.098  4.187  
37.242 9  CC_U9U10:A10A11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C U 10 1_555 D A 10 1_555 C C 11 1_555 D G 9  1_555 0.025  -1.511 3.245 1.513  2.478  34.301 -2.930 0.187  3.130 4.193  -2.560 
34.420 10 CC_U10C11:G9A10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C C 11 1_555 D G 9  1_555 C C 12 1_555 D G 8  1_555 -0.747 -1.705 3.133 -1.349 7.097  25.907 -5.302 1.297  2.616 15.451 2.937  
26.879 11 CC_C11C12:G8G9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C C 12 1_555 D G 8  1_555 C G 13 1_555 D C 7  1_555 0.037  -1.505 3.020 -4.000 9.063  29.123 -4.363 -0.742 2.427 17.400 7.679  
30.727 12 CC_C12G13:C7G8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C G 13 1_555 D C 7  1_555 C C 14 1_555 D G 6  1_555 -0.007 -1.459 3.108 1.914  6.511  33.280 -3.447 0.291  2.777 11.223 -3.300 
33.946 13 CC_G13C14:G6C7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C C 14 1_555 D G 6  1_555 C G 15 1_555 D C 5  1_555 0.129  -1.937 3.832 3.453  15.462 37.066 -4.689 0.230  2.835 23.074 -5.152 
40.200 14 CC_C14G15:C5G6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C G 15 1_555 D C 5  1_555 C U 16 1_555 D A 4  1_555 -0.278 -1.644 2.923 -1.945 0.577  22.906 -4.304 0.087  2.895 1.450  4.886  
22.995 15 CC_G15U16:A4C5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C U 16 1_555 D A 4  1_555 C A 17 1_555 D U 3  1_555 0.269  -1.492 3.019 -0.530 14.181 29.041 -4.760 -0.562 2.079 26.385 0.986  
32.256 16 CC_U16A17:U3A4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C A 17 1_555 D U 3  1_555 C C 18 1_555 D G 2  1_555 -0.057 -1.600 3.249 1.168  6.428  31.171 -4.027 0.305  2.866 11.800 -2.145 
31.832 17 CC_A17C18:G2U3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C C 18 1_555 D G 2  1_555 C G 19 1_555 D C 1  1_555 0.118  -2.122 3.364 3.742  11.143 29.654 -5.733 0.413  2.425 20.773 -6.976 
31.850 18 CC_C18G19:C1G2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#