data_6BM4
# 
_entry.id   6BM4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6BM4         
WWPDB D_1000231091 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6BM4 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wang, W.' 1 ? 
'Wang, D.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            115 
_citation.language                  ? 
_citation.page_first                E2538 
_citation.page_last                 E2545 
_citation.title                     
'Structural basis of transcriptional stalling and bypass of abasic DNA lesion by RNA polymerase II.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1722050115 
_citation.pdbx_database_id_PubMed   29487211 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, W.'    1 ? 
primary 'Walmacq, C.' 2 ? 
primary 'Chong, J.'   3 ? 
primary 'Kashlev, M.' 4 ? 
primary 'Wang, D.'    5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.97 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6BM4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     168.720 
_cell.length_a_esd                 ? 
_cell.length_b                     220.430 
_cell.length_b_esd                 ? 
_cell.length_c                     193.150 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6BM4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase II subunit RPB1'                                     191821.578 1 2.7.7.6 ? ? ? 
2  polymer     man 'DNA-directed RNA polymerase II subunit RPB2'                                     138937.297 1 2.7.7.6 ? ? ? 
3  polymer     man 'DNA-directed RNA polymerase II subunit RPB3'                                     35330.457  1 ?       ? ? ? 
4  polymer     man 'DNA-directed RNA polymerases I, II, and III subunit RPABC1'                      25117.094  1 ?       ? ? ? 
5  polymer     man 'DNA-directed RNA polymerases I, II, and III subunit RPABC2'                      17931.834  1 ?       ? ? ? 
6  polymer     man 'DNA-directed RNA polymerases I, II, and III subunit RPABC3'                      16525.363  1 ?       ? ? ? 
7  polymer     man 'DNA-directed RNA polymerase II subunit RPB9'                                     14308.161  1 ?       ? ? ? 
8  polymer     man 'DNA-directed RNA polymerases I, II, and III subunit RPABC5'                      8290.732   1 ?       ? ? ? 
9  polymer     man 'DNA-directed RNA polymerase II subunit RPB11'                                    13633.493  1 ?       ? ? ? 
10 polymer     man 'DNA-directed RNA polymerases I, II, and III subunit RPABC4'                      7729.969   1 ?       ? ? ? 
11 polymer     syn 
;DNA (5'-D(P*CP*AP*(3DR)P*CP*TP*CP*TP*TP*GP*AP*TP*G)-3')
;
8779.650   1 ?       ? ? ? 
12 polymer     syn 
;RNA (5'-R(*AP*UP*CP*AP*AP*GP*AP*GP*A)-3')
;
2918.831   1 ?       ? ? ? 
13 non-polymer syn 'ZINC ION'                                                                        65.409     8 ?       ? ? ? 
14 non-polymer syn 'MAGNESIUM ION'                                                                   24.305     2 ?       ? ? ? 
15 non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" 483.156    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit 1, RNA polymerase II subunit B1, DNA-directed RNA polymerase III largest subunit, RNA polymerase II subunit B220
;
2  'RNA polymerase II subunit 2, B150, DNA-directed RNA polymerase II 140 kDa polypeptide' 
3  'RNA polymerase II subunit 3, RNA polymerase II subunit B3, B44.5, DNA-directed RNA polymerase II 45 kDa polypeptide' 
4  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
5  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
6  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
7  
'RNA polymerase II subunit B9, B12.6, DNA-directed RNA polymerase II 14.2 kDa polypeptide, DNA-directed RNA polymerase II subunit 9' 
8  'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
9  'RNA polymerase II subunit B11,B13.6,DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
10 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
5  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
6  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
7  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
8  'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
9  'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
10 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
11 polydeoxyribonucleotide no yes 
;(DC)(DT)(DA)(DC)(DC)(DG)(DA)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DA)(DG)(DG)(DC)(DA)
(3DR)(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CTACCGATAAGCAGAGGCANCTCTCGATG T ? 
12 polyribonucleotide      no no  AUCGAGAGA AUCGAGAGA R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASP n 
4  3    GLN n 
4  4    GLU n 
4  5    ASN n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ILE n 
4  10   SER n 
4  11   ARG n 
4  12   LEU n 
4  13   TRP n 
4  14   ARG n 
4  15   ALA n 
4  16   PHE n 
4  17   ARG n 
4  18   THR n 
4  19   VAL n 
4  20   LYS n 
4  21   GLU n 
4  22   MET n 
4  23   VAL n 
4  24   LYS n 
4  25   ASP n 
4  26   ARG n 
4  27   GLY n 
4  28   TYR n 
4  29   PHE n 
4  30   ILE n 
4  31   THR n 
4  32   GLN n 
4  33   GLU n 
4  34   GLU n 
4  35   VAL n 
4  36   GLU n 
4  37   LEU n 
4  38   PRO n 
4  39   LEU n 
4  40   GLU n 
4  41   ASP n 
4  42   PHE n 
4  43   LYS n 
4  44   ALA n 
4  45   LYS n 
4  46   TYR n 
4  47   CYS n 
4  48   ASP n 
4  49   SER n 
4  50   MET n 
4  51   GLY n 
4  52   ARG n 
4  53   PRO n 
4  54   GLN n 
4  55   ARG n 
4  56   LYS n 
4  57   MET n 
4  58   MET n 
4  59   SER n 
4  60   PHE n 
4  61   GLN n 
4  62   ALA n 
4  63   ASN n 
4  64   PRO n 
4  65   THR n 
4  66   GLU n 
4  67   GLU n 
4  68   SER n 
4  69   ILE n 
4  70   SER n 
4  71   LYS n 
4  72   PHE n 
4  73   PRO n 
4  74   ASP n 
4  75   MET n 
4  76   GLY n 
4  77   SER n 
4  78   LEU n 
4  79   TRP n 
4  80   VAL n 
4  81   GLU n 
4  82   PHE n 
4  83   CYS n 
4  84   ASP n 
4  85   GLU n 
4  86   PRO n 
4  87   SER n 
4  88   VAL n 
4  89   GLY n 
4  90   VAL n 
4  91   LYS n 
4  92   THR n 
4  93   MET n 
4  94   LYS n 
4  95   THR n 
4  96   PHE n 
4  97   VAL n 
4  98   ILE n 
4  99   HIS n 
4  100  ILE n 
4  101  GLN n 
4  102  GLU n 
4  103  LYS n 
4  104  ASN n 
4  105  PHE n 
4  106  GLN n 
4  107  THR n 
4  108  GLY n 
4  109  ILE n 
4  110  PHE n 
4  111  VAL n 
4  112  TYR n 
4  113  GLN n 
4  114  ASN n 
4  115  ASN n 
4  116  ILE n 
4  117  THR n 
4  118  PRO n 
4  119  SER n 
4  120  ALA n 
4  121  MET n 
4  122  LYS n 
4  123  LEU n 
4  124  VAL n 
4  125  PRO n 
4  126  SER n 
4  127  ILE n 
4  128  PRO n 
4  129  PRO n 
4  130  ALA n 
4  131  THR n 
4  132  ILE n 
4  133  GLU n 
4  134  THR n 
4  135  PHE n 
4  136  ASN n 
4  137  GLU n 
4  138  ALA n 
4  139  ALA n 
4  140  LEU n 
4  141  VAL n 
4  142  VAL n 
4  143  ASN n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  HIS n 
4  148  GLU n 
4  149  LEU n 
4  150  VAL n 
4  151  PRO n 
4  152  LYS n 
4  153  HIS n 
4  154  ILE n 
4  155  ARG n 
4  156  LEU n 
4  157  SER n 
4  158  SER n 
4  159  ASP n 
4  160  GLU n 
4  161  LYS n 
4  162  ARG n 
4  163  GLU n 
4  164  LEU n 
4  165  LEU n 
4  166  LYS n 
4  167  ARG n 
4  168  TYR n 
4  169  ARG n 
4  170  LEU n 
4  171  LYS n 
4  172  GLU n 
4  173  SER n 
4  174  GLN n 
4  175  LEU n 
4  176  PRO n 
4  177  ARG n 
4  178  ILE n 
4  179  GLN n 
4  180  ARG n 
4  181  ALA n 
4  182  ASP n 
4  183  PRO n 
4  184  VAL n 
4  185  ALA n 
4  186  LEU n 
4  187  TYR n 
4  188  LEU n 
4  189  GLY n 
4  190  LEU n 
4  191  LYS n 
4  192  ARG n 
4  193  GLY n 
4  194  GLU n 
4  195  VAL n 
4  196  VAL n 
4  197  LYS n 
4  198  ILE n 
4  199  ILE n 
4  200  ARG n 
4  201  LYS n 
4  202  SER n 
4  203  GLU n 
4  204  THR n 
4  205  SER n 
4  206  GLY n 
4  207  ARG n 
4  208  TYR n 
4  209  ALA n 
4  210  SER n 
4  211  TYR n 
4  212  ARG n 
4  213  ILE n 
4  214  CYS n 
4  215  MET n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    TYR n 
5  5    GLU n 
5  6    GLU n 
5  7    ALA n 
5  8    PHE n 
5  9    ASN n 
5  10   ASP n 
5  11   GLY n 
5  12   ASN n 
5  13   GLU n 
5  14   ASN n 
5  15   PHE n 
5  16   GLU n 
5  17   ASP n 
5  18   PHE n 
5  19   ASP n 
5  20   VAL n 
5  21   GLU n 
5  22   HIS n 
5  23   PHE n 
5  24   SER n 
5  25   ASP n 
5  26   GLU n 
5  27   GLU n 
5  28   THR n 
5  29   TYR n 
5  30   GLU n 
5  31   GLU n 
5  32   LYS n 
5  33   PRO n 
5  34   GLN n 
5  35   PHE n 
5  36   LYS n 
5  37   ASP n 
5  38   GLY n 
5  39   GLU n 
5  40   THR n 
5  41   THR n 
5  42   ASP n 
5  43   ALA n 
5  44   ASN n 
5  45   GLY n 
5  46   LYS n 
5  47   THR n 
5  48   ILE n 
5  49   VAL n 
5  50   THR n 
5  51   GLY n 
5  52   GLY n 
5  53   ASN n 
5  54   GLY n 
5  55   PRO n 
5  56   GLU n 
5  57   ASP n 
5  58   PHE n 
5  59   GLN n 
5  60   GLN n 
5  61   HIS n 
5  62   GLU n 
5  63   GLN n 
5  64   ILE n 
5  65   ARG n 
5  66   ARG n 
5  67   LYS n 
5  68   THR n 
5  69   LEU n 
5  70   LYS n 
5  71   GLU n 
5  72   LYS n 
5  73   ALA n 
5  74   ILE n 
5  75   PRO n 
5  76   LYS n 
5  77   ASP n 
5  78   GLN n 
5  79   ARG n 
5  80   ALA n 
5  81   THR n 
5  82   THR n 
5  83   PRO n 
5  84   TYR n 
5  85   MET n 
5  86   THR n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ARG n 
5  91   ALA n 
5  92   ARG n 
5  93   ILE n 
5  94   LEU n 
5  95   GLY n 
5  96   THR n 
5  97   ARG n 
5  98   ALA n 
5  99   LEU n 
5  100  GLN n 
5  101  ILE n 
5  102  SER n 
5  103  MET n 
5  104  ASN n 
5  105  ALA n 
5  106  PRO n 
5  107  VAL n 
5  108  PHE n 
5  109  VAL n 
5  110  ASP n 
5  111  LEU n 
5  112  GLU n 
5  113  GLY n 
5  114  GLU n 
5  115  THR n 
5  116  ASP n 
5  117  PRO n 
5  118  LEU n 
5  119  ARG n 
5  120  ILE n 
5  121  ALA n 
5  122  MET n 
5  123  LYS n 
5  124  GLU n 
5  125  LEU n 
5  126  ALA n 
5  127  GLU n 
5  128  LYS n 
5  129  LYS n 
5  130  ILE n 
5  131  PRO n 
5  132  LEU n 
5  133  VAL n 
5  134  ILE n 
5  135  ARG n 
5  136  ARG n 
5  137  TYR n 
5  138  LEU n 
5  139  PRO n 
5  140  ASP n 
5  141  GLY n 
5  142  SER n 
5  143  PHE n 
5  144  GLU n 
5  145  ASP n 
5  146  TRP n 
5  147  SER n 
5  148  VAL n 
5  149  GLU n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  VAL n 
5  154  ASP n 
5  155  LEU n 
6  1    MET n 
6  2    SER n 
6  3    ASN n 
6  4    THR n 
6  5    LEU n 
6  6    PHE n 
6  7    ASP n 
6  8    ASP n 
6  9    ILE n 
6  10   PHE n 
6  11   GLN n 
6  12   VAL n 
6  13   SER n 
6  14   GLU n 
6  15   VAL n 
6  16   ASP n 
6  17   PRO n 
6  18   GLY n 
6  19   ARG n 
6  20   TYR n 
6  21   ASN n 
6  22   LYS n 
6  23   VAL n 
6  24   CYS n 
6  25   ARG n 
6  26   ILE n 
6  27   GLU n 
6  28   ALA n 
6  29   ALA n 
6  30   SER n 
6  31   THR n 
6  32   THR n 
6  33   GLN n 
6  34   ASP n 
6  35   GLN n 
6  36   CYS n 
6  37   LYS n 
6  38   LEU n 
6  39   THR n 
6  40   LEU n 
6  41   ASP n 
6  42   ILE n 
6  43   ASN n 
6  44   VAL n 
6  45   GLU n 
6  46   LEU n 
6  47   PHE n 
6  48   PRO n 
6  49   VAL n 
6  50   ALA n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   SER n 
6  55   LEU n 
6  56   THR n 
6  57   VAL n 
6  58   THR n 
6  59   ILE n 
6  60   ALA n 
6  61   SER n 
6  62   SER n 
6  63   LEU n 
6  64   ASN n 
6  65   LEU n 
6  66   GLU n 
6  67   ASP n 
6  68   THR n 
6  69   PRO n 
6  70   ALA n 
6  71   ASN n 
6  72   ASP n 
6  73   SER n 
6  74   SER n 
6  75   ALA n 
6  76   THR n 
6  77   ARG n 
6  78   SER n 
6  79   TRP n 
6  80   ARG n 
6  81   PRO n 
6  82   PRO n 
6  83   GLN n 
6  84   ALA n 
6  85   GLY n 
6  86   ASP n 
6  87   ARG n 
6  88   SER n 
6  89   LEU n 
6  90   ALA n 
6  91   ASP n 
6  92   ASP n 
6  93   TYR n 
6  94   ASP n 
6  95   TYR n 
6  96   VAL n 
6  97   MET n 
6  98   TYR n 
6  99   GLY n 
6  100  THR n 
6  101  ALA n 
6  102  TYR n 
6  103  LYS n 
6  104  PHE n 
6  105  GLU n 
6  106  GLU n 
6  107  VAL n 
6  108  SER n 
6  109  LYS n 
6  110  ASP n 
6  111  LEU n 
6  112  ILE n 
6  113  ALA n 
6  114  VAL n 
6  115  TYR n 
6  116  TYR n 
6  117  SER n 
6  118  PHE n 
6  119  GLY n 
6  120  GLY n 
6  121  LEU n 
6  122  LEU n 
6  123  MET n 
6  124  ARG n 
6  125  LEU n 
6  126  GLU n 
6  127  GLY n 
6  128  ASN n 
6  129  TYR n 
6  130  ARG n 
6  131  ASN n 
6  132  LEU n 
6  133  ASN n 
6  134  ASN n 
6  135  LEU n 
6  136  LYS n 
6  137  GLN n 
6  138  GLU n 
6  139  ASN n 
6  140  ALA n 
6  141  TYR n 
6  142  LEU n 
6  143  LEU n 
6  144  ILE n 
6  145  ARG n 
6  146  ARG n 
7  1    MET n 
7  2    THR n 
7  3    THR n 
7  4    PHE n 
7  5    ARG n 
7  6    PHE n 
7  7    CYS n 
7  8    ARG n 
7  9    ASP n 
7  10   CYS n 
7  11   ASN n 
7  12   ASN n 
7  13   MET n 
7  14   LEU n 
7  15   TYR n 
7  16   PRO n 
7  17   ARG n 
7  18   GLU n 
7  19   ASP n 
7  20   LYS n 
7  21   GLU n 
7  22   ASN n 
7  23   ASN n 
7  24   ARG n 
7  25   LEU n 
7  26   LEU n 
7  27   PHE n 
7  28   GLU n 
7  29   CYS n 
7  30   ARG n 
7  31   THR n 
7  32   CYS n 
7  33   SER n 
7  34   TYR n 
7  35   VAL n 
7  36   GLU n 
7  37   GLU n 
7  38   ALA n 
7  39   GLY n 
7  40   SER n 
7  41   PRO n 
7  42   LEU n 
7  43   VAL n 
7  44   TYR n 
7  45   ARG n 
7  46   HIS n 
7  47   GLU n 
7  48   LEU n 
7  49   ILE n 
7  50   THR n 
7  51   ASN n 
7  52   ILE n 
7  53   GLY n 
7  54   GLU n 
7  55   THR n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   VAL n 
7  60   GLN n 
7  61   ASP n 
7  62   ILE n 
7  63   GLY n 
7  64   SER n 
7  65   ASP n 
7  66   PRO n 
7  67   THR n 
7  68   LEU n 
7  69   PRO n 
7  70   ARG n 
7  71   SER n 
7  72   ASP n 
7  73   ARG n 
7  74   GLU n 
7  75   CYS n 
7  76   PRO n 
7  77   LYS n 
7  78   CYS n 
7  79   HIS n 
7  80   SER n 
7  81   ARG n 
7  82   GLU n 
7  83   ASN n 
7  84   VAL n 
7  85   PHE n 
7  86   PHE n 
7  87   GLN n 
7  88   SER n 
7  89   GLN n 
7  90   GLN n 
7  91   ARG n 
7  92   ARG n 
7  93   LYS n 
7  94   ASP n 
7  95   THR n 
7  96   SER n 
7  97   MET n 
7  98   VAL n 
7  99   LEU n 
7  100  PHE n 
7  101  PHE n 
7  102  VAL n 
7  103  CYS n 
7  104  LEU n 
7  105  SER n 
7  106  CYS n 
7  107  SER n 
7  108  HIS n 
7  109  ILE n 
7  110  PHE n 
7  111  THR n 
7  112  SER n 
7  113  ASP n 
7  114  GLN n 
7  115  LYS n 
7  116  ASN n 
7  117  LYS n 
7  118  ARG n 
7  119  THR n 
7  120  GLN n 
7  121  PHE n 
7  122  SER n 
8  1    MET n 
8  2    ILE n 
8  3    VAL n 
8  4    PRO n 
8  5    VAL n 
8  6    ARG n 
8  7    CYS n 
8  8    PHE n 
8  9    SER n 
8  10   CYS n 
8  11   GLY n 
8  12   LYS n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   ASP n 
8  17   LYS n 
8  18   TRP n 
8  19   GLU n 
8  20   SER n 
8  21   TYR n 
8  22   LEU n 
8  23   ASN n 
8  24   LEU n 
8  25   LEU n 
8  26   GLN n 
8  27   GLU n 
8  28   ASP n 
8  29   GLU n 
8  30   LEU n 
8  31   ASP n 
8  32   GLU n 
8  33   GLY n 
8  34   THR n 
8  35   ALA n 
8  36   LEU n 
8  37   SER n 
8  38   ARG n 
8  39   LEU n 
8  40   GLY n 
8  41   LEU n 
8  42   LYS n 
8  43   ARG n 
8  44   TYR n 
8  45   CYS n 
8  46   CYS n 
8  47   ARG n 
8  48   ARG n 
8  49   MET n 
8  50   ILE n 
8  51   LEU n 
8  52   THR n 
8  53   HIS n 
8  54   VAL n 
8  55   ASP n 
8  56   LEU n 
8  57   ILE n 
8  58   GLU n 
8  59   LYS n 
8  60   PHE n 
8  61   LEU n 
8  62   ARG n 
8  63   TYR n 
8  64   ASN n 
8  65   PRO n 
8  66   LEU n 
8  67   GLU n 
8  68   LYS n 
8  69   ARG n 
8  70   ASP n 
9  1    MET n 
9  2    ASN n 
9  3    ALA n 
9  4    PRO n 
9  5    ASP n 
9  6    ARG n 
9  7    PHE n 
9  8    GLU n 
9  9    LEU n 
9  10   PHE n 
9  11   LEU n 
9  12   LEU n 
9  13   GLY n 
9  14   GLU n 
9  15   GLY n 
9  16   GLU n 
9  17   SER n 
9  18   LYS n 
9  19   LEU n 
9  20   LYS n 
9  21   ILE n 
9  22   ASP n 
9  23   PRO n 
9  24   ASP n 
9  25   THR n 
9  26   LYS n 
9  27   ALA n 
9  28   PRO n 
9  29   ASN n 
9  30   ALA n 
9  31   VAL n 
9  32   VAL n 
9  33   ILE n 
9  34   THR n 
9  35   PHE n 
9  36   GLU n 
9  37   LYS n 
9  38   GLU n 
9  39   ASP n 
9  40   HIS n 
9  41   THR n 
9  42   LEU n 
9  43   GLY n 
9  44   ASN n 
9  45   LEU n 
9  46   ILE n 
9  47   ARG n 
9  48   ALA n 
9  49   GLU n 
9  50   LEU n 
9  51   LEU n 
9  52   ASN n 
9  53   ASP n 
9  54   ARG n 
9  55   LYS n 
9  56   VAL n 
9  57   LEU n 
9  58   PHE n 
9  59   ALA n 
9  60   ALA n 
9  61   TYR n 
9  62   LYS n 
9  63   VAL n 
9  64   GLU n 
9  65   HIS n 
9  66   PRO n 
9  67   PHE n 
9  68   PHE n 
9  69   ALA n 
9  70   ARG n 
9  71   PHE n 
9  72   LYS n 
9  73   LEU n 
9  74   ARG n 
9  75   ILE n 
9  76   GLN n 
9  77   THR n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TYR n 
9  82   ASP n 
9  83   PRO n 
9  84   LYS n 
9  85   ASP n 
9  86   ALA n 
9  87   LEU n 
9  88   LYS n 
9  89   ASN n 
9  90   ALA n 
9  91   CYS n 
9  92   ASN n 
9  93   SER n 
9  94   ILE n 
9  95   ILE n 
9  96   ASN n 
9  97   LYS n 
9  98   LEU n 
9  99   GLY n 
9  100  ALA n 
9  101  LEU n 
9  102  LYS n 
9  103  THR n 
9  104  ASN n 
9  105  PHE n 
9  106  GLU n 
9  107  THR n 
9  108  GLU n 
9  109  TRP n 
9  110  ASN n 
9  111  LEU n 
9  112  GLN n 
9  113  THR n 
9  114  LEU n 
9  115  ALA n 
9  116  ALA n 
9  117  ASP n 
9  118  ASP n 
9  119  ALA n 
9  120  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ARG n 
10 4    GLU n 
10 5    GLY n 
10 6    PHE n 
10 7    GLN n 
10 8    ILE n 
10 9    PRO n 
10 10   THR n 
10 11   ASN n 
10 12   LEU n 
10 13   ASP n 
10 14   ALA n 
10 15   ALA n 
10 16   ALA n 
10 17   ALA n 
10 18   GLY n 
10 19   THR n 
10 20   SER n 
10 21   GLN n 
10 22   ALA n 
10 23   ARG n 
10 24   THR n 
10 25   ALA n 
10 26   THR n 
10 27   LEU n 
10 28   LYS n 
10 29   TYR n 
10 30   ILE n 
10 31   CYS n 
10 32   ALA n 
10 33   GLU n 
10 34   CYS n 
10 35   SER n 
10 36   SER n 
10 37   LYS n 
10 38   LEU n 
10 39   SER n 
10 40   LEU n 
10 41   SER n 
10 42   ARG n 
10 43   THR n 
10 44   ASP n 
10 45   ALA n 
10 46   VAL n 
10 47   ARG n 
10 48   CYS n 
10 49   LYS n 
10 50   ASP n 
10 51   CYS n 
10 52   GLY n 
10 53   HIS n 
10 54   ARG n 
10 55   ILE n 
10 56   LEU n 
10 57   LEU n 
10 58   LYS n 
10 59   ALA n 
10 60   ARG n 
10 61   THR n 
10 62   LYS n 
10 63   ARG n 
10 64   LEU n 
10 65   VAL n 
10 66   GLN n 
10 67   PHE n 
10 68   GLU n 
10 69   ALA n 
10 70   ARG n 
11 1    DC  n 
11 2    DT  n 
11 3    DA  n 
11 4    DC  n 
11 5    DC  n 
11 6    DG  n 
11 7    DA  n 
11 8    DT  n 
11 9    DA  n 
11 10   DA  n 
11 11   DG  n 
11 12   DC  n 
11 13   DA  n 
11 14   DG  n 
11 15   DA  n 
11 16   DG  n 
11 17   DG  n 
11 18   DC  n 
11 19   DA  n 
11 20   3DR n 
11 21   DC  n 
11 22   DT  n 
11 23   DC  n 
11 24   DT  n 
11 25   DC  n 
11 26   DG  n 
11 27   DA  n 
11 28   DT  n 
11 29   DG  n 
12 1    A   n 
12 2    U   n 
12 3    C   n 
12 4    G   n 
12 5    A   n 
12 6    G   n 
12 7    A   n 
12 8    G   n 
12 9    A   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample 'Biological sequence' 1 1733 
;Baker's yeast
;
? RPO21                                ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 'Biological sequence' 1 1224 
;Baker's yeast
;
? RPB2                                 ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 'Biological sequence' 1 318  
;Baker's yeast
;
? RPB3                                 ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 'Biological sequence' 1 215  
;Baker's yeast
;
? 'RPB5, RPA7, RPC9, YBR154C, YBR1204' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 'Biological sequence' 1 155  
;Baker's yeast
;
? 'RPO26, RPB6, YPR187W, P9677.8'      ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 'Biological sequence' 1 146  
;Baker's yeast
;
? 'RPB8, YOR224C, YOR50-14'            ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 'Biological sequence' 1 122  
;Baker's yeast
;
? RPB9                                 ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 'Biological sequence' 1 70   
;Baker's yeast
;
? 'RPB10, YOR210W'                     ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 'Biological sequence' 1 120  
;Baker's yeast
;
? 'RPB11, YOL005C'                     ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 'Biological sequence' 1 70   
;Baker's yeast
;
? RPC10                                ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
11 1 sample 1 29 'synthetic construct' ? 32630 ? 
12 1 sample 1 9  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPB1_YEAST  P04050 ? 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 
2  UNP RPB2_YEAST  P08518 ? 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 
3  UNP RPB3_YEAST  P16370 ? 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 
4  UNP RPAB1_YEAST P20434 ? 4  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
5  UNP RPAB2_YEAST P20435 ? 5  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
6  UNP RPAB3_YEAST P20436 ? 6  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
7  UNP RPB9_YEAST  P27999 ? 7  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 
8  UNP RPAB5_YEAST P22139 ? 8  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
9  UNP RPB11_YEAST P38902 ? 9  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 
10 UNP RPAB4_YEAST P40422 ? 10 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
11 PDB 6BM4        6BM4   ? 11 ? 1 
12 PDB 6BM4        6BM4   ? 12 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6BM4 A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  6BM4 B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  6BM4 C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  6BM4 E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  6BM4 F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  6BM4 H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  6BM4 I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  6BM4 J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  6BM4 K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 6BM4 L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 6BM4 T 1 ? 29   ? 6BM4   1 ? 29   ? 1 29   
12 12 6BM4 R 1 ? 9    ? 6BM4   1 ? 9    ? 1 9    
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2KH non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine" ?                      
'C9 H16 N3 O14 P3' 483.156 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE"                                          'ABASIC DIDEOXYRIBOSE' 
'C5 H11 O6 P'      198.111 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                      ?                      
'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                                                                           ?                      
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                          ?                      
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                        ?                      
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                   ?                      
'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                       ?                      
'C9 H14 N3 O8 P'   323.197 
CYS 'L-peptide linking' y CYSTEINE                                                                          ?                      
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                              ?                      
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                               ?                      
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                              ?                      
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                      ?                      
'C10 H15 N2 O8 P'  322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                      ?                      
'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                                                                         ?                      
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                   ?                      
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                           ?                      
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                         ?                      
'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                        ?                      
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                           ?                      
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                            ?                      
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                        ?                      
'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                   ?                      
'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                     ?                      
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                           ?                      
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                            ?                      
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                         ?                      
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                        ?                      
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                          ?                      
'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                        ?                      
'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                                                                            ?                      
'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION'                                                                        ?                      
'Zn 2'             65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6BM4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.00 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         69.22 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '390mM (NH4)2HPO4/NaH2PO4, pH 6.5, 50mM dioxane, 10mM DTT, 9-12% PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6BM4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.95 
_reflns.d_resolution_low                 95.3 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       126240 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.95 
_reflns_shell.d_res_low                   3.11 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6BM4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.951 
_refine.ls_d_res_low                             55.607 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     126204 
_refine.ls_number_reflns_R_free                  6424 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    86.96 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2356 
_refine.ls_R_factor_R_free                       0.2601 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2343 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.13 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27808 
_refine_hist.pdbx_number_atoms_nucleic_acid   427 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28274 
_refine_hist.d_res_high                       2.951 
_refine_hist.d_res_low                        55.607 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 28826 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.568  ? 39019 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.402 ? 11000 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.022  ? 4387  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 4971  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9510 2.9845  . . 14  299  7.00  . . . 0.4808 . 0.3842 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9845 3.0196  . . 50  951  21.00 . . . 0.4974 . 0.3708 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0196 3.0564  . . 120 1866 42.00 . . . 0.3774 . 0.3578 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0564 3.0951  . . 124 2663 58.00 . . . 0.3561 . 0.3520 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0951 3.1358  . . 173 3314 72.00 . . . 0.4000 . 0.3512 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1358 3.1788  . . 203 3955 86.00 . . . 0.3454 . 0.3339 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1788 3.2242  . . 224 4475 97.00 . . . 0.3375 . 0.3238 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2242 3.2723  . . 232 4435 98.00 . . . 0.3400 . 0.3194 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2723 3.3235  . . 252 4503 98.00 . . . 0.3262 . 0.3144 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3235 3.3779  . . 214 4498 97.00 . . . 0.3473 . 0.3057 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3779 3.4362  . . 259 4410 97.00 . . . 0.3379 . 0.2951 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4362 3.4986  . . 233 4492 97.00 . . . 0.3305 . 0.2857 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4986 3.5659  . . 244 4434 97.00 . . . 0.3269 . 0.2798 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5659 3.6387  . . 248 4460 98.00 . . . 0.3011 . 0.2656 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6387 3.7178  . . 239 4436 97.00 . . . 0.2787 . 0.2593 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7178 3.8043  . . 247 4480 97.00 . . . 0.2748 . 0.2525 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8043 3.8994  . . 227 4462 97.00 . . . 0.2641 . 0.2459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8994 4.0048  . . 225 4382 95.00 . . . 0.2533 . 0.2326 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0048 4.1226  . . 258 4157 91.00 . . . 0.2485 . 0.2138 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1226 4.2556  . . 251 4471 98.00 . . . 0.2208 . 0.2053 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2556 4.4076  . . 226 4525 99.00 . . . 0.2133 . 0.1874 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4076 4.5840  . . 232 4570 99.00 . . . 0.2302 . 0.1832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5840 4.7926  . . 250 4512 98.00 . . . 0.1971 . 0.1764 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7926 5.0451  . . 254 4463 98.00 . . . 0.2137 . 0.1863 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0451 5.3609  . . 247 4510 98.00 . . . 0.2028 . 0.2009 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3609 5.7745  . . 216 4365 94.00 . . . 0.2166 . 0.2103 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7745 6.3548  . . 223 4172 91.00 . . . 0.2527 . 0.2206 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3548 7.2726  . . 246 4545 98.00 . . . 0.2682 . 0.2159 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.2726 9.1561  . . 241 4539 98.00 . . . 0.1949 . 0.1726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 9.1561 55.6172 . . 252 4436 95.00 . . . 0.2231 . 0.1979 . . . . . . . . . . 
# 
_struct.entry_id                     6BM4 
_struct.title                        'Pol II elongation complex with an abasic lesion at i-1 position,soaking UMPNPP' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6BM4 
_struct_keywords.text            'Complex, DNA BINDING PROTEIN, DNA-RNA HYBRID, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 13 ? 
O N N 14 ? 
P N N 14 ? 
Q N N 13 ? 
R N N 15 ? 
S N N 13 ? 
T N N 13 ? 
U N N 13 ? 
V N N 13 ? 
W N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   AA2 HIS A 92   ? GLY A 94   ? HIS A 92   GLY A 94   5 ? 3  
HELX_P HELX_P3   AA3 PHE A 95   ? CYS A 103  ? PHE A 95   CYS A 103  1 ? 9  
HELX_P HELX_P4   AA4 LEU A 121  ? LEU A 126  ? LEU A 121  LEU A 126  1 ? 6  
HELX_P HELX_P5   AA5 ASP A 130  ? LEU A 141  ? ASP A 130  LEU A 141  1 ? 12 
HELX_P HELX_P6   AA6 SER A 203  ? LYS A 212  ? SER A 203  LYS A 212  1 ? 10 
HELX_P HELX_P7   AA7 PHE A 219  ? GLY A 223  ? PHE A 219  GLY A 223  5 ? 5  
HELX_P HELX_P8   AA8 ARG A 230  ? MET A 234  ? ARG A 230  MET A 234  5 ? 5  
HELX_P HELX_P9   AA9 ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  AB1 ALA A 288  ? ASP A 305  ? ALA A 288  ASP A 305  1 ? 18 
HELX_P HELX_P11  AB2 SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  AB3 GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  AB4 LYS A 368  ? LEU A 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P14  AB5 ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  AB6 HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  AB7 VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  AB8 SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P18  AB9 VAL A 507  ? GLN A 510  ? VAL A 507  GLN A 510  5 ? 4  
HELX_P HELX_P19  AC1 VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P20  AC2 GLU A 542  ? VAL A 553  ? GLU A 542  VAL A 553  1 ? 12 
HELX_P HELX_P21  AC3 GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P22  AC4 GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  AC5 GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P24  AC6 GLY A 638  ? HIS A 659  ? GLY A 638  HIS A 659  1 ? 22 
HELX_P HELX_P25  AC7 GLY A 665  ? ILE A 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P26  AC8 ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  AC9 THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  AD1 ASN A 741  ? ALA A 749  ? ASN A 741  ALA A 749  1 ? 9  
HELX_P HELX_P29  AD2 SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  AD3 THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P31  AD4 ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P32  AD5 ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P33  AD6 SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P34  AD7 ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P35  AD8 ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P36  AD9 THR A 982  ? GLN A 994  ? THR A 982  GLN A 994  1 ? 13 
HELX_P HELX_P37  AE1 ASN A 1004 ? VAL A 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P38  AE2 VAL A 1015 ? LEU A 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P39  AE3 ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P40  AE4 THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P41  AE5 MET A 1063 ? GLU A 1074 ? MET A 1063 GLU A 1074 1 ? 12 
HELX_P HELX_P42  AE6 GLY A 1097 ? VAL A 1107 ? GLY A 1097 VAL A 1107 1 ? 11 
HELX_P HELX_P43  AE7 ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  AE8 ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P45  AE9 ALA A 1200 ? LYS A 1205 ? ALA A 1200 LYS A 1205 1 ? 6  
HELX_P HELX_P46  AF1 THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P47  AF2 GLU A 1256 ? GLU A 1269 ? GLU A 1256 GLU A 1269 1 ? 14 
HELX_P HELX_P48  AF3 ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P49  AF4 SER A 1331 ? LEU A 1339 ? SER A 1331 LEU A 1339 1 ? 9  
HELX_P HELX_P50  AF5 GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P51  AF6 ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P52  AF7 GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P53  AF8 GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P54  AF9 THR A 1405 ? ALA A 1416 ? THR A 1405 ALA A 1416 1 ? 12 
HELX_P HELX_P55  AG1 GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P56  AG2 ILE A 1436 ? GLY A 1439 ? ILE A 1436 GLY A 1439 5 ? 4  
HELX_P HELX_P57  AG3 ASP B 29   ? GLU B 40   ? ASP B 29   GLU B 40   1 ? 12 
HELX_P HELX_P58  AG4 VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P59  AG5 TYR B 57   ? GLU B 65   ? TYR B 57   GLU B 65   1 ? 9  
HELX_P HELX_P60  AG6 TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P61  AG7 THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P62  AG8 ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P63  AG9 GLY B 295  ? CYS B 302  ? GLY B 295  CYS B 302  1 ? 8  
HELX_P HELX_P64  AH1 ASP B 307  ? GLY B 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P65  AH2 ASP B 326  ? GLY B 338  ? ASP B 326  GLY B 338  1 ? 13 
HELX_P HELX_P66  AH3 GLU B 346  ? GLU B 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P67  AH4 GLU B 371  ? LEU B 390  ? GLU B 371  LEU B 390  1 ? 20 
HELX_P HELX_P68  AH5 HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P69  AH6 LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P70  AH7 ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P71  AH8 THR B 487  ? ARG B 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P72  AH9 HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P73  AI1 PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P74  AI2 PRO B 565  ? TYR B 569  ? PRO B 565  TYR B 569  5 ? 5  
HELX_P HELX_P75  AI3 VAL B 570  ? SER B 574  ? VAL B 570  SER B 574  5 ? 5  
HELX_P HELX_P76  AI4 ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P77  AI5 ARG B 654  ? ASP B 668  ? ARG B 654  ASP B 668  1 ? 15 
HELX_P HELX_P78  AI6 THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P79  AI7 ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P80  AI8 GLN B 706  ? GLU B 711  ? GLN B 706  GLU B 711  5 ? 6  
HELX_P HELX_P81  AI9 HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P82  AJ1 PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P83  AJ2 GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P84  AJ3 LYS B 775  ? ALA B 777  ? LYS B 775  ALA B 777  5 ? 3  
HELX_P HELX_P85  AJ4 LEU B 782  ? ARG B 788  ? LEU B 782  ARG B 788  5 ? 7  
HELX_P HELX_P86  AJ5 ALA B 808  ? LEU B 812  ? ALA B 808  LEU B 812  5 ? 5  
HELX_P HELX_P87  AJ6 GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P88  AJ7 ASN B 1013 ? ILE B 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P89  AJ8 THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P90  AJ9 THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P91  AK1 MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P92  AK2 GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P93  AK3 ALA B 1143 ? LEU B 1151 ? ALA B 1143 LEU B 1151 1 ? 9  
HELX_P HELX_P94  AK4 TYR B 1198 ? ALA B 1209 ? TYR B 1198 ALA B 1209 1 ? 12 
HELX_P HELX_P95  AK5 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P96  AK6 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P97  AK7 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P98  AK8 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P99  AK9 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P100 AL1 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P101 AL2 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P102 AL3 PRO C 239  ? MET C 265  ? PRO C 239  MET C 265  1 ? 27 
HELX_P HELX_P103 AL4 GLU D 4    ? GLY D 27   ? GLU E 4    GLY E 27   1 ? 24 
HELX_P HELX_P104 AL5 THR D 31   ? GLU D 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P105 AL6 PRO D 38   ? CYS D 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P106 AL7 GLN D 54   ? MET D 58   ? GLN E 54   MET E 58   5 ? 5  
HELX_P HELX_P107 AL8 THR D 65   ? PHE D 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P108 AL9 GLY D 89   ? ASN D 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P109 AM1 ALA D 138  ? LEU D 140  ? ALA E 138  LEU E 140  5 ? 3  
HELX_P HELX_P110 AM2 ASN D 143  ? HIS D 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P111 AM3 SER D 157  ? TYR D 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P112 AM4 LYS D 171  ? LEU D 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P113 AM5 ASP D 182  ? GLY D 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P114 AM6 THR E 86   ? SER E 102  ? THR F 86   SER F 102  1 ? 17 
HELX_P HELX_P115 AM7 ASP E 116  ? GLU E 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P116 AM8 VAL G 59   ? ASP G 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P117 AM9 LYS H 17   ? GLU H 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P118 AN1 ASP H 31   ? LEU H 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P119 AN2 ARG H 43   ? THR H 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P120 AN3 LEU H 56   ? LEU H 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P121 AN4 ASP I 5    ? PHE I 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P122 AN5 ASP I 39   ? LEU I 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P123 AN6 ASP I 82   ? ASN I 110  ? ASP K 82   ASN K 110  1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A CYS 67   SG    ? ? ? 1_555 N ZN  .  ZN    ? ? A CYS 67   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.892 
? 
metalc2  metalc ?    ? A CYS 77   SG    ? ? ? 1_555 N ZN  .  ZN    ? ? A CYS 77   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.407 
? 
metalc3  metalc ?    ? A HIS 80   NE2   ? ? ? 1_555 N ZN  .  ZN    ? ? A HIS 80   A ZN  1802 1_555 ? ? ? ? ? ? ?            2.075 
? 
metalc4  metalc ?    ? A CYS 107  SG    ? ? ? 1_555 M ZN  .  ZN    ? ? A CYS 107  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.761 
? 
metalc5  metalc ?    ? A CYS 110  SG    ? ? ? 1_555 M ZN  .  ZN    ? ? A CYS 110  A ZN  1801 1_555 ? ? ? ? ? ? ?            2.775 
? 
metalc6  metalc ?    ? A ASP 481  OD1   ? ? ? 1_555 O MG  .  MG    ? ? A ASP 481  A MG  1803 1_555 ? ? ? ? ? ? ?            1.979 
? 
metalc7  metalc ?    ? A ASP 481  OD2   ? ? ? 1_555 P MG  .  MG    ? ? A ASP 481  A MG  1804 1_555 ? ? ? ? ? ? ?            2.979 
? 
metalc8  metalc ?    ? A ASP 483  OD1   ? ? ? 1_555 O MG  .  MG    ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?            2.346 
? 
metalc9  metalc ?    ? A ASP 485  OD1   ? ? ? 1_555 O MG  .  MG    ? ? A ASP 485  A MG  1803 1_555 ? ? ? ? ? ? ?            2.171 
? 
metalc10 metalc ?    ? B CYS 1163 SG    ? ? ? 1_555 Q ZN  .  ZN    ? ? B CYS 1163 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.457 
? 
metalc11 metalc ?    ? B CYS 1166 SG    ? ? ? 1_555 Q ZN  .  ZN    ? ? B CYS 1166 B ZN  1301 1_555 ? ? ? ? ? ? ?            2.394 
? 
metalc12 metalc ?    ? C CYS 86   SG    ? ? ? 1_555 S ZN  .  ZN    ? ? C CYS 86   C ZN  401  1_555 ? ? ? ? ? ? ?            2.391 
? 
metalc13 metalc ?    ? C CYS 88   SG    ? ? ? 1_555 S ZN  .  ZN    ? ? C CYS 88   C ZN  401  1_555 ? ? ? ? ? ? ?            2.296 
? 
metalc14 metalc ?    ? C CYS 92   SG    ? ? ? 1_555 S ZN  .  ZN    ? ? C CYS 92   C ZN  401  1_555 ? ? ? ? ? ? ?            2.398 
? 
metalc15 metalc ?    ? C CYS 95   SG    ? ? ? 1_555 S ZN  .  ZN    ? ? C CYS 95   C ZN  401  1_555 ? ? ? ? ? ? ?            2.436 
? 
metalc16 metalc ?    ? G CYS 7    SG    ? ? ? 1_555 T ZN  .  ZN    ? ? I CYS 7    I ZN  201  1_555 ? ? ? ? ? ? ?            2.448 
? 
metalc17 metalc ?    ? G CYS 10   SG    ? ? ? 1_555 T ZN  .  ZN    ? ? I CYS 10   I ZN  201  1_555 ? ? ? ? ? ? ?            2.579 
? 
metalc18 metalc ?    ? G CYS 29   SG    ? ? ? 1_555 T ZN  .  ZN    ? ? I CYS 29   I ZN  201  1_555 ? ? ? ? ? ? ?            2.403 
? 
metalc19 metalc ?    ? G CYS 32   SG    ? ? ? 1_555 T ZN  .  ZN    ? ? I CYS 32   I ZN  201  1_555 ? ? ? ? ? ? ?            2.465 
? 
metalc20 metalc ?    ? G CYS 75   SG    ? ? ? 1_555 U ZN  .  ZN    ? ? I CYS 75   I ZN  202  1_555 ? ? ? ? ? ? ?            2.466 
? 
metalc21 metalc ?    ? G CYS 78   SG    ? ? ? 1_555 U ZN  .  ZN    ? ? I CYS 78   I ZN  202  1_555 ? ? ? ? ? ? ?            2.322 
? 
metalc22 metalc ?    ? G CYS 103  SG    ? ? ? 1_555 U ZN  .  ZN    ? ? I CYS 103  I ZN  202  1_555 ? ? ? ? ? ? ?            2.381 
? 
metalc23 metalc ?    ? G CYS 106  SG    ? ? ? 1_555 U ZN  .  ZN    ? ? I CYS 106  I ZN  202  1_555 ? ? ? ? ? ? ?            2.359 
? 
metalc24 metalc ?    ? H CYS 7    SG    ? ? ? 1_555 V ZN  .  ZN    ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?            2.381 
? 
metalc25 metalc ?    ? H CYS 10   SG    ? ? ? 1_555 V ZN  .  ZN    ? ? J CYS 10   J ZN  101  1_555 ? ? ? ? ? ? ?            2.386 
? 
metalc26 metalc ?    ? H CYS 45   SG    ? ? ? 1_555 V ZN  .  ZN    ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?            2.334 
? 
metalc27 metalc ?    ? H CYS 46   SG    ? ? ? 1_555 V ZN  .  ZN    ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?            2.398 
? 
metalc28 metalc ?    ? J CYS 31   SG    ? ? ? 1_555 W ZN  .  ZN    ? ? L CYS 31   L ZN  101  1_555 ? ? ? ? ? ? ?            2.741 
? 
metalc29 metalc ?    ? J CYS 34   SG    ? ? ? 1_555 W ZN  .  ZN    ? ? L CYS 34   L ZN  101  1_555 ? ? ? ? ? ? ?            2.392 
? 
metalc30 metalc ?    ? J CYS 48   SG    ? ? ? 1_555 W ZN  .  ZN    ? ? L CYS 48   L ZN  101  1_555 ? ? ? ? ? ? ?            2.485 
? 
metalc31 metalc ?    ? J CYS 51   SG    ? ? ? 1_555 W ZN  .  ZN    ? ? L CYS 51   L ZN  101  1_555 ? ? ? ? ? ? ?            2.508 
? 
covale1  covale both ? K DA  19   "O3'" ? ? ? 1_555 K 3DR 20 P     ? ? T DA  19   T 3DR 20   1_555 ? ? ? ? ? ? ?            1.607 
? 
covale2  covale both ? K 3DR 20   "O3'" ? ? ? 1_555 K DC  21 P     ? ? T 3DR 20   T DC  21   1_555 ? ? ? ? ? ? ?            1.609 
? 
metalc32 metalc ?    ? L A   9    "O3'" ? ? ? 1_555 O MG  .  MG    ? ? R A   9    A MG  1803 1_555 ? ? ? ? ? ? ?            2.256 
? 
metalc33 metalc ?    ? P MG  .    MG    ? ? ? 1_555 R 2KH .  "O2'" ? ? A MG  1804 B 2KH 1302 1_555 ? ? ? ? ? ? ?            2.300 
? 
hydrog1  hydrog ?    ? K DC  21   N3    ? ? ? 1_555 L G   8  N1    ? ? T DC  21   R G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog2  hydrog ?    ? K DC  21   N4    ? ? ? 1_555 L G   8  O6    ? ? T DC  21   R G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog3  hydrog ?    ? K DC  21   O2    ? ? ? 1_555 L G   8  N2    ? ? T DC  21   R G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4  hydrog ?    ? K DT  22   N3    ? ? ? 1_555 L A   7  N1    ? ? T DT  22   R A   7    1_555 ? ? ? ? ? ? 'DT-A PAIR'  ?     
? 
hydrog5  hydrog ?    ? K DC  23   N3    ? ? ? 1_555 L G   6  N1    ? ? T DC  23   R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6  hydrog ?    ? K DC  23   N4    ? ? ? 1_555 L G   6  O6    ? ? T DC  23   R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7  hydrog ?    ? K DC  23   O2    ? ? ? 1_555 L G   6  N2    ? ? T DC  23   R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8  hydrog ?    ? K DT  24   N3    ? ? ? 1_555 L A   5  N1    ? ? T DT  24   R A   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9  hydrog ?    ? K DT  24   O4    ? ? ? 1_555 L A   5  N6    ? ? T DT  24   R A   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10 hydrog ?    ? K DC  25   N4    ? ? ? 1_555 L G   4  O6    ? ? T DC  25   R G   4    1_555 ? ? ? ? ? ? 'DC-G PAIR'  ?     
? 
hydrog11 hydrog ?    ? K DG  26   O6    ? ? ? 1_555 L C   3  N4    ? ? T DG  26   R C   3    1_555 ? ? ? ? ? ? 'DG-C PAIR'  ?     
? 
hydrog12 hydrog ?    ? K DT  28   O4    ? ? ? 1_555 L A   1  N6    ? ? T DT  28   R A   1    1_555 ? ? ? ? ? ? 'DT-A PAIR'  ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 331 A . ? GLY 331 A LYS 332 A ? LYS 332 A 1 1.44  
2 HIS 399 A . ? HIS 399 A PRO 400 A ? PRO 400 A 1 0.65  
3 GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 0.12  
4 LYS 567 A . ? LYS 567 A PRO 568 A ? PRO 568 A 1 1.73  
5 PRO 128 D . ? PRO 128 E PRO 129 D ? PRO 129 E 1 -3.72 
6 GLN 83  F . ? GLN 83  H ALA 84  F ? ALA 84  H 1 0.14  
7 ALA 84  F . ? ALA 84  H GLY 85  F ? GLY 85  H 1 -1.55 
8 GLY 85  F . ? GLY 85  H ASP 86  F ? ASP 86  H 1 0.50  
9 VAL 46  J . ? VAL 46  L ARG 47  J ? ARG 47  L 1 2.95  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 2  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 8  ? 
AA6 ? 4  ? 
AA7 ? 2  ? 
AA8 ? 2  ? 
AA9 ? 10 ? 
AB1 ? 3  ? 
AB2 ? 2  ? 
AB3 ? 2  ? 
AB4 ? 3  ? 
AB5 ? 2  ? 
AB6 ? 4  ? 
AB7 ? 2  ? 
AB8 ? 5  ? 
AB9 ? 2  ? 
AC1 ? 3  ? 
AC2 ? 4  ? 
AC3 ? 2  ? 
AC4 ? 3  ? 
AC5 ? 4  ? 
AC6 ? 5  ? 
AC7 ? 3  ? 
AC8 ? 4  ? 
AC9 ? 4  ? 
AD1 ? 5  ? 
AD2 ? 6  ? 
AD3 ? 2  ? 
AD4 ? 8  ? 
AD5 ? 4  ? 
AD6 ? 2  ? 
AD7 ? 2  ? 
AD8 ? 2  ? 
AD9 ? 2  ? 
AE1 ? 4  ? 
AE2 ? 5  ? 
AE3 ? 2  ? 
AE4 ? 4  ? 
AE5 ? 2  ? 
AE6 ? 4  ? 
AE7 ? 3  ? 
AE8 ? 3  ? 
AE9 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? anti-parallel 
AA5 2 3  ? anti-parallel 
AA5 3 4  ? anti-parallel 
AA5 4 5  ? anti-parallel 
AA5 5 6  ? parallel      
AA5 6 7  ? anti-parallel 
AA5 7 8  ? parallel      
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA7 1 2  ? anti-parallel 
AA8 1 2  ? anti-parallel 
AA9 1 2  ? anti-parallel 
AA9 2 3  ? anti-parallel 
AA9 3 4  ? anti-parallel 
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? anti-parallel 
AA9 7 8  ? anti-parallel 
AA9 8 9  ? anti-parallel 
AA9 9 10 ? anti-parallel 
AB1 1 2  ? anti-parallel 
AB1 2 3  ? anti-parallel 
AB2 1 2  ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB4 1 2  ? anti-parallel 
AB4 2 3  ? anti-parallel 
AB5 1 2  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB6 2 3  ? anti-parallel 
AB6 3 4  ? anti-parallel 
AB7 1 2  ? anti-parallel 
AB8 1 2  ? anti-parallel 
AB8 2 3  ? anti-parallel 
AB8 3 4  ? anti-parallel 
AB8 4 5  ? anti-parallel 
AB9 1 2  ? anti-parallel 
AC1 1 2  ? anti-parallel 
AC1 2 3  ? anti-parallel 
AC2 1 2  ? anti-parallel 
AC2 2 3  ? anti-parallel 
AC2 3 4  ? anti-parallel 
AC3 1 2  ? anti-parallel 
AC4 1 2  ? anti-parallel 
AC4 2 3  ? anti-parallel 
AC5 1 2  ? anti-parallel 
AC5 2 3  ? parallel      
AC5 3 4  ? anti-parallel 
AC6 1 2  ? anti-parallel 
AC6 2 3  ? anti-parallel 
AC6 3 4  ? anti-parallel 
AC6 4 5  ? anti-parallel 
AC7 1 2  ? anti-parallel 
AC7 2 3  ? anti-parallel 
AC8 1 2  ? anti-parallel 
AC8 2 3  ? anti-parallel 
AC8 3 4  ? parallel      
AC9 1 2  ? anti-parallel 
AC9 2 3  ? parallel      
AC9 3 4  ? anti-parallel 
AD1 1 2  ? anti-parallel 
AD1 2 3  ? anti-parallel 
AD1 3 4  ? anti-parallel 
AD1 4 5  ? anti-parallel 
AD2 1 2  ? anti-parallel 
AD2 2 3  ? anti-parallel 
AD2 3 4  ? anti-parallel 
AD2 4 5  ? anti-parallel 
AD2 5 6  ? anti-parallel 
AD3 1 2  ? parallel      
AD4 1 2  ? anti-parallel 
AD4 2 3  ? anti-parallel 
AD4 3 4  ? anti-parallel 
AD4 4 5  ? parallel      
AD4 5 6  ? anti-parallel 
AD4 6 7  ? parallel      
AD4 7 8  ? anti-parallel 
AD5 1 2  ? anti-parallel 
AD5 2 3  ? anti-parallel 
AD5 3 4  ? parallel      
AD6 1 2  ? anti-parallel 
AD7 1 2  ? anti-parallel 
AD8 1 2  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AE1 1 2  ? anti-parallel 
AE1 2 3  ? anti-parallel 
AE1 3 4  ? anti-parallel 
AE2 1 2  ? anti-parallel 
AE2 2 3  ? anti-parallel 
AE2 3 4  ? anti-parallel 
AE2 4 5  ? anti-parallel 
AE3 1 2  ? anti-parallel 
AE4 1 2  ? anti-parallel 
AE4 2 3  ? parallel      
AE4 3 4  ? parallel      
AE5 1 2  ? parallel      
AE6 1 2  ? anti-parallel 
AE6 2 3  ? anti-parallel 
AE6 3 4  ? parallel      
AE7 1 2  ? anti-parallel 
AE7 2 3  ? anti-parallel 
AE8 1 2  ? anti-parallel 
AE8 2 3  ? anti-parallel 
AE9 1 2  ? anti-parallel 
AE9 2 3  ? anti-parallel 
AE9 3 4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA1 2  GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
AA1 3  ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
AA2 1  GLY A 82   ? VAL A 90   ? GLY A 82   VAL A 90   
AA2 2  LEU A 236  ? VAL A 241  ? LEU A 236  VAL A 241  
AA3 1  LYS A 176  ? ASP A 177  ? LYS A 176  ASP A 177  
AA3 2  LYS A 180  ? LEU A 181  ? LYS A 180  LEU A 181  
AA4 1  LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AA4 2  LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AA5 1  HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AA5 2  SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AA5 3  GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AA5 4  PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AA5 5  MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AA5 6  GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AA5 7  PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AA5 8  SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AA6 1  THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AA6 2  LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AA6 3  ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AA6 4  ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AA7 1  VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AA7 2  LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AA8 1  PHE A 540  ? ILE A 541  ? PHE A 540  ILE A 541  
AA8 2  TRP A 572  ? SER A 573  ? TRP A 572  SER A 573  
AA9 1  ILE A 565  ? LYS A 567  ? ILE A 565  LYS A 567  
AA9 2  TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
AA9 3  TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
AA9 4  SER F 54   ? ALA F 60   ? SER H 54   ALA H 60   
AA9 5  THR F 4    ? ASP F 16   ? THR H 4    ASP H 16   
AA9 6  VAL F 23   ? SER F 30   ? VAL H 23   SER H 30   
AA9 7  LYS F 37   ? ASN F 43   ? LYS H 37   ASN H 43   
AA9 8  LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
AA9 9  ILE F 112  ? PHE F 118  ? ILE H 112  PHE H 118  
AA9 10 THR F 100  ? GLU F 106  ? THR H 100  GLU H 106  
AB1 1  LEU A 588  ? ARG A 590  ? LEU A 588  ARG A 590  
AB1 2  MET A 605  ? ILE A 608  ? MET A 605  ILE A 608  
AB1 3  GLN A 611  ? PHE A 614  ? GLN A 611  PHE A 614  
AB2 1  GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AB2 2  PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AB3 1  SER A 769  ? VAL A 770  ? SER A 769  VAL A 770  
AB3 2  LYS A 773  ? ARG A 774  ? LYS A 773  ARG A 774  
AB4 1  MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AB4 2  THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AB4 3  VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AB5 1  ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
AB5 2  ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
AB6 1  ARG A 1281 ? TYR A 1287 ? ARG A 1281 TYR A 1287 
AB6 2  GLU A 1303 ? ASP A 1309 ? GLU A 1303 ASP A 1309 
AB6 3  LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AB6 4  TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AB7 1  THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
AB7 2  THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
AB8 1  LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AB8 2  ILE A 1237 ? VAL A 1242 ? ILE A 1237 VAL A 1242 
AB8 3  TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AB8 4  THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AB8 5  TYR G 44   ? GLU G 47   ? TYR I 44   GLU I 47   
AB9 1  LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AB9 2  TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
AC1 1  PHE A 1441 ? ILE A 1445 ? PHE A 1441 ILE A 1445 
AC1 2  LEU E 132  ? TYR E 137  ? LEU F 132  TYR F 137  
AC1 3  PHE E 143  ? SER E 147  ? PHE F 143  SER F 147  
AC2 1  THR B 68   ? LEU B 69   ? THR B 68   LEU B 69   
AC2 2  ILE B 90   ? VAL B 97   ? ILE B 90   VAL B 97   
AC2 3  SER B 125  ? VAL B 132  ? SER B 125  VAL B 132  
AC2 4  VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
AC3 1  MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
AC3 2  THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
AC4 1  PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
AC4 2  SER B 208  ? LEU B 212  ? SER B 208  LEU B 212  
AC4 3  SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
AC5 1  LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
AC5 2  ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
AC5 3  ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
AC5 4  LYS B 537  ? ASN B 538  ? LYS B 537  ASN B 538  
AC6 1  VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
AC6 2  ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
AC6 3  SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
AC6 4  ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
AC6 5  ILE B 280  ? PRO B 281  ? ILE B 280  PRO B 281  
AC7 1  CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
AC7 2  VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
AC7 3  VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
AC8 1  GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
AC8 2  VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
AC8 3  HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
AC8 4  ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
AC9 1  VAL B 585  ? HIS B 590  ? VAL B 585  HIS B 590  
AC9 2  THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
AC9 3  GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
AC9 4  SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
AD1 1  MET B 792  ? LEU B 796  ? MET B 792  LEU B 796  
AD1 2  SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AD1 3  LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
AD1 4  ASN B 946  ? THR B 956  ? ASN B 946  THR B 956  
AD1 5  ARG B 904  ? SER B 906  ? ARG B 904  SER B 906  
AD2 1  MET B 792  ? LEU B 796  ? MET B 792  LEU B 796  
AD2 2  SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AD2 3  LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
AD2 4  ASN B 946  ? THR B 956  ? ASN B 946  THR B 956  
AD2 5  LEU J 56   ? LYS J 58   ? LEU L 56   LYS L 58   
AD2 6  TYR J 29   ? CYS J 31   ? TYR L 29   CYS L 31   
AD3 1  GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
AD3 2  GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
AD4 1  PHE B 1069 ? GLU B 1070 ? PHE B 1069 GLU B 1070 
AD4 2  ILE B 1085 ? ARG B 1094 ? ILE B 1085 ARG B 1094 
AD4 3  LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
AD4 4  LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
AD4 5  SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
AD4 6  LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
AD4 7  GLN B 821  ? ILE B 827  ? GLN B 821  ILE B 827  
AD4 8  ILE B 1085 ? ARG B 1094 ? ILE B 1085 ARG B 1094 
AD5 1  THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
AD5 2  LYS B 914  ? THR B 916  ? LYS B 914  THR B 916  
AD5 3  LYS B 934  ? ASP B 936  ? LYS B 934  ASP B 936  
AD5 4  THR B 882  ? LEU B 883  ? THR B 882  LEU B 883  
AD6 1  VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
AD6 2  THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
AD7 1  PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
AD7 2  MET B 1072 ? TYR B 1073 ? MET B 1072 TYR B 1073 
AD8 1  ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
AD8 2  ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
AD9 1  ILE B 1172 ? LYS B 1174 ? ILE B 1172 LYS B 1174 
AD9 2  GLN B 1179 ? GLU B 1181 ? GLN B 1179 GLU B 1181 
AE1 1  GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
AE1 2  ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
AE1 3  PHE C 228  ? SER C 234  ? PHE C 228  SER C 234  
AE1 4  ALA C 173  ? TYR C 180  ? ALA C 173  TYR C 180  
AE2 1  VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AE2 2  SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
AE2 3  GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
AE2 4  THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
AE2 5  VAL J 65   ? GLU J 68   ? VAL L 65   GLU L 68   
AE3 1  THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
AE3 2  LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
AE4 1  GLN D 61   ? ALA D 62   ? GLN E 61   ALA E 62   
AE4 2  LEU D 78   ? PHE D 82   ? LEU E 78   PHE E 82   
AE4 3  THR D 107  ? TYR D 112  ? THR E 107  TYR E 112  
AE4 4  THR D 131  ? ASN D 136  ? THR E 131  ASN E 136  
AE5 1  SER D 87   ? VAL D 88   ? SER E 87   VAL E 88   
AE5 2  ASN D 115  ? ILE D 116  ? ASN E 115  ILE E 116  
AE6 1  LYS D 152  ? ARG D 155  ? LYS E 152  ARG E 155  
AE6 2  VAL D 195  ? SER D 202  ? VAL E 195  SER E 202  
AE6 3  GLY D 206  ? CYS D 214  ? GLY E 206  CYS E 214  
AE6 4  ARG D 177  ? ILE D 178  ? ARG E 177  ILE E 178  
AE7 1  TYR G 15   ? ASP G 19   ? TYR I 15   ASP I 19   
AE7 2  ARG G 24   ? GLU G 28   ? ARG I 24   GLU I 28   
AE7 3  VAL G 35   ? GLU G 37   ? VAL I 35   GLU I 37   
AE8 1  ASN G 83   ? GLN G 87   ? ASN I 83   GLN I 87   
AE8 2  LEU G 99   ? CYS G 103  ? LEU I 99   CYS I 103  
AE8 3  ILE G 109  ? THR G 111  ? ILE I 109  THR I 111  
AE9 1  LEU I 19   ? PRO I 23   ? LEU K 19   PRO K 23   
AE9 2  ALA I 30   ? GLU I 36   ? ALA K 30   GLU K 36   
AE9 3  ARG I 70   ? THR I 77   ? ARG K 70   THR K 77   
AE9 4  VAL I 56   ? LYS I 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O ASP A 1419 ? O ASP A 1419 N VAL A 17   ? N VAL A 17   
AA1 2 3  N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AA2 1 2  N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AA3 1 2  N ASP A 177  ? N ASP A 177  O LYS A 180  ? O LYS A 180  
AA4 1 2  N LYS A 343  ? N LYS A 343  O PHE B 1130 ? O PHE B 1130 
AA5 1 2  O HIS B 1104 ? O HIS B 1104 N ARG A 350  ? N ARG A 350  
AA5 2 3  N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AA5 3 4  O HIS A 490  ? O HIS A 490  N LEU A 443  ? N LEU A 443  
AA5 4 5  N VAL A 442  ? N VAL A 442  O HIS A 458  ? O HIS A 458  
AA5 5 6  O ILE A 463  ? O ILE A 463  N VAL A 366  ? N VAL A 366  
AA5 6 7  N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AA5 7 8  O LEU A 470  ? O LEU A 470  N SER A 354  ? N SER A 354  
AA6 1 2  N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AA6 2 3  O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AA6 3 4  N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AA7 1 2  N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AA8 1 2  N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AA9 1 2  N ILE A 566  ? N ILE A 566  O VAL F 96   ? O VAL H 96   
AA9 2 3  N MET F 97   ? N MET H 97   O LEU F 142  ? O LEU H 142  
AA9 3 4  O LEU F 143  ? O LEU H 143  N THR F 58   ? N THR H 58   
AA9 4 5  O ILE F 59   ? O ILE H 59   N LEU F 5    ? N LEU H 5    
AA9 5 6  N SER F 13   ? N SER H 13   O GLU F 27   ? O GLU H 27   
AA9 6 7  N ILE F 26   ? N ILE H 26   O LEU F 40   ? O LEU H 40   
AA9 7 8  N LYS F 37   ? N LYS H 37   O GLU F 126  ? O GLU H 126  
AA9 8 9  O GLY F 127  ? O GLY H 127  N ILE F 112  ? N ILE H 112  
AA9 9 10 O ALA F 113  ? O ALA H 113  N GLU F 105  ? N GLU H 105  
AB1 1 2  N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
AB1 2 3  N ILE A 608  ? N ILE A 608  O GLN A 611  ? O GLN A 611  
AB2 1 2  N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AB3 1 2  N VAL A 770  ? N VAL A 770  O LYS A 773  ? O LYS A 773  
AB4 1 2  N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AB4 2 3  N THR A 856  ? N THR A 856  O ILE A 864  ? O ILE A 864  
AB5 1 2  N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AB6 1 2  N MET A 1285 ? N MET A 1285 O VAL A 1305 ? O VAL A 1305 
AB6 2 3  O LEU A 1306 ? O LEU A 1306 N VAL A 1118 ? N VAL A 1118 
AB6 3 4  N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AB7 1 2  N THR A 1141 ? N THR A 1141 O LEU A 1273 ? O LEU A 1273 
AB8 1 2  N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AB8 2 3  O CYS A 1240 ? O CYS A 1240 N LEU A 1193 ? N LEU A 1193 
AB8 3 4  O GLU A 1196 ? O GLU A 1196 N ALA A 1149 ? N ALA A 1149 
AB8 4 5  N SER A 1150 ? N SER A 1150 O HIS G 46   ? O HIS I 46   
AB9 1 2  N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
AC1 1 2  N ASP A 1442 ? N ASP A 1442 O ARG E 135  ? O ARG F 135  
AC1 2 3  N ARG E 136  ? N ARG F 136  O GLU E 144  ? O GLU F 144  
AC2 1 2  N LEU B 69   ? N LEU B 69   O ILE B 90   ? O ILE B 90   
AC2 2 3  N GLY B 93   ? N GLY B 93   O ASP B 131  ? O ASP B 131  
AC2 3 4  N LEU B 128  ? N LEU B 128  O GLY B 168  ? O GLY B 168  
AC3 1 2  N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
AC4 1 2  N PHE B 203  ? N PHE B 203  O LYS B 210  ? O LYS B 210  
AC4 2 3  N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
AC5 1 2  O ASP B 407  ? O ASP B 407  N GLN B 215  ? N GLN B 215  
AC5 2 3  N GLU B 216  ? N GLU B 216  O ASN B 499  ? O ASN B 499  
AC5 3 4  N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
AC6 1 2  N GLN B 224  ? N GLN B 224  O GLU B 239  ? O GLU B 239  
AC6 2 3  N SER B 235  ? N SER B 235  O LEU B 258  ? O LEU B 258  
AC6 3 4  N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
AC6 4 5  N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
AC7 1 2  N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
AC7 2 3  N ARG B 635  ? N ARG B 635  O ILE B 693  ? O ILE B 693  
AC8 1 2  O GLU B 650  ? O GLU B 650  N GLU B 641  ? N GLU B 641  
AC8 2 3  N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
AC8 3 4  O HIS B 740  ? O HIS B 740  N ALA B 704  ? N ALA B 704  
AC9 1 2  O GLY B 588  ? O GLY B 588  N VAL B 580  ? N VAL B 580  
AC9 2 3  N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
AC9 3 4  O LYS B 625  ? O LYS B 625  N ILE B 616  ? N ILE B 616  
AD1 1 2  N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AD1 2 3  N ARG B 857  ? N ARG B 857  O VAL B 968  ? O VAL B 968  
AD1 3 4  O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AD1 4 5  O GLY B 947  ? O GLY B 947  N VAL B 905  ? N VAL B 905  
AD2 1 2  N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AD2 2 3  N ARG B 857  ? N ARG B 857  O VAL B 968  ? O VAL B 968  
AD2 3 4  O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AD2 4 5  N VAL B 954  ? N VAL B 954  O LEU J 56   ? O LEU L 56   
AD2 5 6  O LEU J 57   ? O LEU L 57   N ILE J 30   ? N ILE L 30   
AD3 1 2  N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
AD4 1 2  N GLU B 1070 ? N GLU B 1070 O ILE B 1085 ? O ILE B 1085 
AD4 2 3  O GLN B 1093 ? O GLN B 1093 N ALA B 981  ? N ALA B 981  
AD4 3 4  N PHE B 980  ? N PHE B 980  O GLY B 988  ? O GLY B 988  
AD4 4 5  O GLY B 991  ? O GLY B 991  N MET B 839  ? N MET B 839  
AD4 5 6  N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
AD4 6 7  O ILE B 1012 ? O ILE B 1012 N ALA B 826  ? N ALA B 826  
AD4 7 8  N VAL B 825  ? N VAL B 825  O GLY B 1088 ? O GLY B 1088 
AD5 1 2  N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
AD5 2 3  N THR B 916  ? N THR B 916  O ARG B 935  ? O ARG B 935  
AD5 3 4  O LYS B 934  ? O LYS B 934  N LEU B 883  ? N LEU B 883  
AD6 1 2  N ILE B 912  ? N ILE B 912  O THR B 939  ? O THR B 939  
AD7 1 2  N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
AD8 1 2  N VAL B 1160 ? N VAL B 1160 O ILE B 1194 ? O ILE B 1194 
AD9 1 2  N LYS B 1174 ? N LYS B 1174 O GLN B 1179 ? O GLN B 1179 
AE1 1 2  N GLN C 7    ? N GLN C 7    O SER C 23   ? O SER C 23   
AE1 2 3  N PHE C 20   ? N PHE C 20   O MET C 230  ? O MET C 230  
AE1 3 4  O GLU C 233  ? O GLU C 233  N ALA C 174  ? N ALA C 174  
AE2 1 2  O VAL C 119  ? O VAL C 119  N THR C 100  ? N THR C 100  
AE2 2 3  N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
AE2 3 4  O LYS C 154  ? O LYS C 154  N THR C 53   ? N THR C 53   
AE2 4 5  N VAL C 49   ? N VAL C 49   O PHE J 67   ? O PHE L 67   
AE3 1 2  N VAL C 113  ? N VAL C 113  O CYS C 145  ? O CYS C 145  
AE4 1 2  N ALA D 62   ? N ALA E 62   O LEU D 78   ? O LEU E 78   
AE4 2 3  N GLU D 81   ? N GLU E 81   O VAL D 111  ? O VAL E 111  
AE4 3 4  N PHE D 110  ? N PHE E 110  O GLU D 133  ? O GLU E 133  
AE5 1 2  O VAL D 88   ? O VAL E 88   N ASN D 115  ? N ASN E 115  
AE6 1 2  N LYS D 152  ? N LYS E 152  O ILE D 199  ? O ILE E 199  
AE6 2 3  N ILE D 198  ? N ILE E 198  O SER D 210  ? O SER E 210  
AE6 3 4  O ILE D 213  ? O ILE E 213  N ILE D 178  ? N ILE E 178  
AE7 1 2  N ASP G 19   ? N ASP I 19   O ARG G 24   ? O ARG I 24   
AE7 2 3  N PHE G 27   ? N PHE I 27   O GLU G 36   ? O GLU I 36   
AE8 1 2  N PHE G 86   ? N PHE I 86   O PHE G 100  ? O PHE I 100  
AE8 2 3  N PHE G 101  ? N PHE I 101  O PHE G 110  ? O PHE I 110  
AE9 1 2  N ASP I 22   ? N ASP K 22   O VAL I 32   ? O VAL K 32   
AE9 2 3  N PHE I 35   ? N PHE K 35   O PHE I 71   ? O PHE K 71   
AE9 3 4  O ARG I 74   ? O ARG K 74   N ALA I 60   ? N ALA K 60   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  1801 ? 5 'binding site for residue ZN A 1801'  
AC2 Software A ZN  1802 ? 4 'binding site for residue ZN A 1802'  
AC3 Software A MG  1803 ? 4 'binding site for residue MG A 1803'  
AC4 Software A MG  1804 ? 2 'binding site for residue MG A 1804'  
AC5 Software B ZN  1301 ? 4 'binding site for residue ZN B 1301'  
AC6 Software B 2KH 1302 ? 5 'binding site for residue 2KH B 1302' 
AC7 Software C ZN  401  ? 4 'binding site for residue ZN C 401'   
AC8 Software I ZN  201  ? 4 'binding site for residue ZN I 201'   
AC9 Software I ZN  202  ? 4 'binding site for residue ZN I 202'   
AD1 Software J ZN  101  ? 4 'binding site for residue ZN J 101'   
AD2 Software L ZN  101  ? 4 'binding site for residue ZN L 101'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 5 MET A 108  ? MET A 108  . ? 1_555 ? 
3  AC1 5 CYS A 110  ? CYS A 110  . ? 1_555 ? 
4  AC1 5 CYS A 148  ? CYS A 148  . ? 1_555 ? 
5  AC1 5 CYS A 167  ? CYS A 167  . ? 1_555 ? 
6  AC2 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
7  AC2 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
8  AC2 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
9  AC2 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
10 AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
11 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
12 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
13 AC3 4 A   L 9    ? A   R 9    . ? 1_555 ? 
14 AC4 2 ASP A 481  ? ASP A 481  . ? 1_555 ? 
15 AC4 2 2KH R .    ? 2KH B 1302 . ? 1_555 ? 
16 AC5 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
17 AC5 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
18 AC5 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
19 AC5 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
20 AC6 5 LYS A 752  ? LYS A 752  . ? 1_555 ? 
21 AC6 5 MG  P .    ? MG  A 1804 . ? 1_555 ? 
22 AC6 5 ARG B 766  ? ARG B 766  . ? 1_555 ? 
23 AC6 5 SER B 1019 ? SER B 1019 . ? 1_555 ? 
24 AC6 5 ARG B 1020 ? ARG B 1020 . ? 1_555 ? 
25 AC7 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
26 AC7 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
27 AC7 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
28 AC7 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
29 AC8 4 CYS G 7    ? CYS I 7    . ? 1_555 ? 
30 AC8 4 CYS G 10   ? CYS I 10   . ? 1_555 ? 
31 AC8 4 CYS G 29   ? CYS I 29   . ? 1_555 ? 
32 AC8 4 CYS G 32   ? CYS I 32   . ? 1_555 ? 
33 AC9 4 CYS G 75   ? CYS I 75   . ? 1_555 ? 
34 AC9 4 CYS G 78   ? CYS I 78   . ? 1_555 ? 
35 AC9 4 CYS G 103  ? CYS I 103  . ? 1_555 ? 
36 AC9 4 CYS G 106  ? CYS I 106  . ? 1_555 ? 
37 AD1 4 CYS H 7    ? CYS J 7    . ? 1_555 ? 
38 AD1 4 CYS H 10   ? CYS J 10   . ? 1_555 ? 
39 AD1 4 CYS H 45   ? CYS J 45   . ? 1_555 ? 
40 AD1 4 CYS H 46   ? CYS J 46   . ? 1_555 ? 
41 AD2 4 CYS J 31   ? CYS L 31   . ? 1_555 ? 
42 AD2 4 CYS J 34   ? CYS L 34   . ? 1_555 ? 
43 AD2 4 CYS J 48   ? CYS L 48   . ? 1_555 ? 
44 AD2 4 CYS J 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6BM4 
_atom_sites.fract_transf_matrix[1][1]   0.005927 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001149 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005274 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 431.743 -14.823 647.612 1.00 96.51  ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 430.844 -14.380 646.563 1.00 98.14  ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 429.975 -13.213 646.992 1.00 101.46 ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 430.473 -12.112 647.231 1.00 95.35  ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 428.671 -13.455 647.088 1.00 106.50 ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 427.726 -12.420 647.490 1.00 107.44 ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 426.866 -12.884 648.664 1.00 111.51 ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 427.257 -12.730 649.822 1.00 112.98 ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 426.845 -12.012 646.306 1.00 105.75 ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 427.626 -11.400 645.148 1.00 107.79 ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 426.745 -11.021 643.972 1.00 108.53 ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 425.526 -11.178 644.019 1.00 110.62 ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 427.361 -10.519 642.907 1.00 106.44 ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 425.702 -13.454 648.367 1.00 115.60 ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 424.808 -13.936 649.416 1.00 116.27 ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 423.810 -14.966 648.886 1.00 115.23 ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 423.487 -14.979 647.698 1.00 114.81 ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 424.063 -12.762 650.058 1.00 116.24 ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 423.507 -13.056 651.443 1.00 121.16 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 422.853 -11.844 652.078 1.00 125.25 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 422.729 -10.792 651.451 1.00 125.77 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 422.432 -11.985 653.330 1.00 127.52 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 423.330 -15.828 649.778 1.00 110.51 ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 422.373 -16.872 649.425 1.00 111.39 ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 421.033 -16.270 649.008 1.00 113.34 ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 420.474 -15.429 649.712 1.00 115.62 ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 422.183 -17.832 650.607 1.00 114.41 ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 421.736 -19.236 650.241 1.00 116.98 ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 420.708 -19.454 649.331 1.00 116.35 ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 422.346 -20.346 650.813 1.00 119.19 ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 420.302 -20.734 649.001 1.00 117.39 ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 421.947 -21.630 650.489 1.00 120.06 ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 420.925 -21.818 649.582 1.00 120.39 ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 420.524 -23.094 649.256 1.00 117.66 ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 420.527 -16.703 647.858 1.00 101.49 ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 419.214 -16.277 647.387 1.00 103.86 ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 418.267 -17.469 647.289 1.00 106.18 ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 418.670 -18.560 646.884 1.00 105.51 ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 419.328 -15.578 646.030 1.00 100.46 ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 418.055 -15.174 645.555 1.00 103.65 ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 417.009 -17.256 647.662 1.00 144.81 ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 416.010 -18.320 647.637 1.00 147.53 ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 415.609 -18.675 646.208 1.00 147.00 ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 415.009 -19.722 645.963 1.00 148.95 ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 414.774 -17.914 648.443 1.00 152.73 ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 413.808 -18.951 648.458 1.00 155.51 ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 415.946 -17.797 645.268 1.00 86.86  ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 415.625 -18.012 643.862 1.00 86.40  ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 416.551 -19.047 643.233 1.00 85.04  ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 417.757 -19.032 643.473 1.00 83.75  ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 415.703 -16.700 643.097 1.00 86.02  ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 415.982 -19.956 642.427 1.00 131.55 ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 416.767 -20.971 641.716 1.00 128.47 ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 417.702 -20.350 640.684 1.00 124.31 ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 417.333 -19.374 640.030 1.00 124.12 ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 415.698 -21.832 641.032 1.00 130.86 ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 414.437 -21.560 641.790 1.00 133.02 ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 414.536 -20.131 642.214 1.00 132.20 ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 418.900 -20.909 640.545 1.00 85.37  ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 419.857 -20.426 639.556 1.00 82.08  ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 419.553 -21.011 638.181 1.00 78.95  ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 419.652 -22.220 637.976 1.00 75.98  ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 421.288 -20.775 639.972 1.00 78.79  ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 422.390 -20.420 638.970 1.00 73.62  ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 422.471 -18.916 638.764 1.00 71.80  ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 423.731 -20.976 639.422 1.00 72.42  ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 419.182 -20.146 637.244 1.00 74.07  ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 418.847 -20.584 635.894 1.00 73.88  ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 419.749 -19.933 634.851 1.00 72.22  ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 420.366 -18.898 635.105 1.00 71.68  ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 417.379 -20.282 635.583 1.00 76.20  ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 416.496 -21.518 635.505 1.00 77.31  ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 416.517 -22.303 636.808 1.00 80.45  ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 415.816 -23.579 636.690 1.00 83.95  ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 414.524 -23.751 636.947 1.00 85.71  ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 413.781 -22.726 637.343 1.00 82.52  ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 413.972 -24.949 636.810 1.00 89.39  ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 419.816 -20.551 633.677 1.00 99.75  ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 420.648 -20.059 632.585 1.00 96.22  ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 419.798 -19.349 631.536 1.00 98.30  ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 418.700 -19.801 631.209 1.00 101.90 ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 421.429 -21.209 631.916 1.00 93.27  ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 422.077 -21.999 632.920 1.00 93.58  ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 422.470 -20.666 630.951 1.00 91.60  ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 420.304 -18.235 631.015 1.00 55.10  ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 419.600 -17.494 629.974 1.00 56.25  ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 419.577 -18.288 628.671 1.00 55.80  ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 420.622 -18.556 628.077 1.00 54.01  ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 420.244 -16.120 629.719 1.00 55.76  ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 419.462 -15.361 628.658 1.00 57.15  ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 420.312 -15.320 631.009 1.00 56.26  ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 418.379 -18.662 628.233 1.00 76.26  ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 418.222 -19.485 627.040 1.00 75.21  ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 417.836 -18.655 625.820 1.00 76.88  ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 418.319 -18.900 624.716 1.00 76.50  ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 417.171 -20.573 627.276 1.00 79.18  ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 417.473 -21.504 628.441 1.00 77.00  ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 418.812 -22.202 628.274 1.00 75.01  ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 418.969 -23.330 629.283 1.00 74.96  ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 418.708 -22.876 630.678 1.00 74.40  ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 416.956 -17.679 626.021 1.00 71.87  ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 416.481 -16.842 624.924 1.00 73.09  ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 416.542 -15.362 625.281 1.00 75.15  ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 416.451 -14.991 626.451 1.00 76.17  ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 415.047 -17.219 624.540 1.00 78.57  ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 414.872 -18.652 624.063 1.00 81.72  ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 413.428 -18.981 623.731 1.00 85.50  ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 412.595 -18.051 623.707 1.00 83.72  ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 413.127 -20.170 623.497 1.00 89.30  ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 416.698 -14.522 624.263 1.00 65.74  ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 416.644 -13.076 624.445 1.00 66.54  ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 415.605 -12.465 623.511 1.00 68.65  ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 415.796 -12.421 622.295 1.00 68.49  ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 418.011 -12.410 624.193 1.00 64.69  ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 417.879 -10.896 624.245 1.00 65.76  ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 419.031 -12.891 625.210 1.00 62.77  ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 414.501 -12.002 624.089 1.00 85.17  ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 413.425 -11.397 623.313 1.00 88.20  ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 413.549 -9.880  623.274 1.00 88.96  ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 413.189 -9.196  624.231 1.00 90.26  ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 412.061 -11.793 623.884 1.00 91.06  ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 411.337 -12.862 623.082 1.00 91.66  ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 410.903 -12.371 621.715 1.00 93.57  ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 410.750 -11.170 621.491 1.00 94.45  ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 410.702 -13.302 620.789 1.00 94.18  ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 414.063 -9.360  622.165 1.00 79.30  ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 414.162 -7.919  621.979 1.00 80.56  ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 412.786 -7.317  621.733 1.00 84.81  ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 411.855 -8.015  621.330 1.00 86.48  ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 415.101 -7.584  620.819 1.00 80.18  ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 416.550 -7.830  621.122 1.00 78.30  ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 417.303 -6.876  621.786 1.00 76.69  ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 417.160 -9.014  620.744 1.00 75.36  ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 418.637 -7.097  622.068 1.00 72.48  ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 418.494 -9.242  621.024 1.00 72.79  ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 419.234 -8.282  621.687 1.00 72.82  ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 412.661 -6.018  621.980 1.00 83.34  ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 411.397 -5.332  621.804 1.00 86.11  ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 411.478 -3.871  622.193 1.00 87.06  ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 412.565 -3.328  622.390 1.00 86.38  ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 410.319 -3.232  622.306 1.00 124.79 ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 410.256 -1.822  622.659 1.00 126.82 ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 409.698 -1.632  624.063 1.00 126.88 ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 409.126 -2.555  624.645 1.00 125.24 ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 409.407 -1.056  621.646 1.00 130.49 ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 409.890 -1.147  620.198 1.00 128.70 ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 408.963 -0.378  619.273 1.00 132.54 ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 411.317 -0.637  620.083 1.00 125.13 ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 409.868 -0.431  624.602 1.00 102.77 ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 409.392 -0.124  625.943 1.00 105.11 ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 408.102 0.687   625.896 1.00 108.90 ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 408.124 1.897   625.673 1.00 108.82 ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 410.463 0.633   626.731 1.00 103.31 ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 410.851 -0.034  628.020 1.00 100.64 ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 409.947 -0.833  628.701 1.00 102.75 ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 412.121 0.133   628.547 1.00 98.32  ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 410.302 -1.450  629.886 1.00 100.57 ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 412.482 -0.481  629.731 1.00 98.00  ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 411.572 -1.273  630.402 1.00 97.24  ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 406.977 0.009   626.100 1.00 123.07 ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 405.685 0.679   626.152 1.00 125.43 ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 405.610 1.575   627.382 1.00 126.37 ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 405.941 1.141   628.485 1.00 125.26 ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 404.545 -0.341  626.166 1.00 125.90 ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 404.659 -1.220  627.271 1.00 124.70 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 405.179 2.833   627.190 1.00 98.06  ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 405.063 3.842   628.250 1.00 99.39  ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 404.335 3.320   629.486 1.00 100.42 ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 404.715 3.652   630.611 1.00 100.19 ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 404.264 4.960   627.578 1.00 102.09 ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 404.608 4.837   626.137 1.00 101.24 ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 404.758 3.364   625.881 1.00 99.40  ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 403.303 2.510   629.267 1.00 137.12 ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 402.572 1.869   630.353 1.00 141.01 ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 403.516 1.018   631.199 1.00 138.14 ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 403.584 1.170   632.421 1.00 138.80 ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 401.437 1.006   629.798 1.00 142.93 ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 400.525 1.729   628.820 1.00 144.83 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 399.564 0.789   628.116 1.00 147.69 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 399.676 -0.439  628.318 1.00 145.62 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 398.699 1.277   627.359 1.00 150.04 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 404.249 0.130   630.534 1.00 124.66 ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 405.219 -0.728  631.203 1.00 120.63 ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 406.364 0.095   631.784 1.00 120.00 ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 406.945 -0.274  632.802 1.00 117.89 ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 405.764 -1.782  630.236 1.00 118.09 ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 406.717 -2.784  630.875 1.00 116.06 ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 407.312 -3.750  629.869 1.00 111.30 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 407.087 -3.561  628.655 1.00 109.55 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 408.005 -4.699  630.293 1.00 107.44 ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 406.683 1.210   631.134 1.00 115.23 ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 407.746 2.091   631.604 1.00 113.01 ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 407.404 2.693   632.965 1.00 115.34 ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 408.206 2.629   633.898 1.00 111.89 ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 408.026 3.230   630.602 1.00 113.50 ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 408.929 4.283   631.227 1.00 113.26 ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 408.646 2.677   629.329 1.00 110.52 ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 406.211 3.269   633.078 1.00 98.90  ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 405.792 3.886   634.331 1.00 100.73 ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 405.419 2.835   635.376 1.00 100.74 ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 405.490 3.095   636.577 1.00 101.35 ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 404.618 4.844   634.099 1.00 103.93 ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 403.372 4.199   633.514 1.00 105.52 ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 402.249 5.216   633.366 1.00 108.81 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 402.638 6.347   632.528 1.00 109.04 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 402.391 6.434   631.224 1.00 110.04 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 401.750 5.454   630.601 1.00 110.18 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 402.784 7.502   630.543 1.00 109.63 ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 405.027 1.648   634.920 1.00 115.47 ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 404.694 0.561   635.837 1.00 116.06 ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 405.954 -0.053  636.446 1.00 114.01 ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 405.937 -0.536  637.578 1.00 115.06 ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 403.875 -0.505  635.125 1.00 116.99 ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 407.043 -0.029  635.684 1.00 99.82  ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 408.317 -0.591  636.121 1.00 97.10  ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 409.044 0.357   637.071 1.00 97.05  ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 409.674 -0.076  638.039 1.00 95.96  ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 409.220 -0.921  634.905 1.00 94.67  ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 408.921 -2.332  634.395 1.00 93.81  ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 410.698 -0.779  635.245 1.00 92.26  ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 409.746 -2.738  633.197 1.00 91.58  ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 408.931 1.653   636.794 1.00 101.56 ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 409.601 2.685   637.580 1.00 101.73 ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 409.274 2.618   639.068 1.00 103.00 ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 408.187 2.194   639.461 1.00 104.78 ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 409.236 4.068   637.044 1.00 103.58 ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 409.737 5.090   637.889 1.00 104.18 ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 410.229 3.046   639.887 1.00 92.44  ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 410.059 3.053   641.333 1.00 93.61  ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 410.159 4.469   641.884 1.00 95.28  ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 410.029 4.686   643.089 1.00 96.55  ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 411.109 2.168   642.031 1.00 91.31  ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 410.979 0.725   641.571 1.00 89.83  ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 412.509 2.695   641.759 1.00 89.24  ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 410.389 5.431   640.995 1.00 92.95  ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 410.543 6.822   641.404 1.00 94.51  ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 410.207 7.790   640.275 1.00 95.55  ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 410.737 7.678   639.170 1.00 93.87  ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 411.960 7.068   641.901 1.00 92.66  ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 409.322 8.739   640.562 1.00 112.71 ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 408.996 9.795   639.611 1.00 114.77 ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 410.080 10.868  639.652 1.00 115.96 ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 410.638 11.160  640.711 1.00 117.28 ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 407.619 10.403  639.907 1.00 121.61 ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 407.527 11.222  641.194 1.00 126.19 ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 407.332 10.344  642.422 1.00 125.74 ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 407.304 11.173  643.696 1.00 126.35 ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 407.142 10.321  644.906 1.00 124.58 ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 410.383 11.448  638.496 1.00 112.31 ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 411.477 12.408  638.394 1.00 113.57 ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 410.968 13.807  638.060 1.00 115.71 ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 410.844 14.170  636.890 1.00 113.92 ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 412.501 11.973  637.329 1.00 109.31 ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 412.766 10.469  637.427 1.00 106.74 ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 413.793 12.755  637.480 1.00 107.41 ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 413.419 10.040  638.724 1.00 103.67 ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 410.680 14.590  639.096 1.00 133.77 ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 410.133 15.931  638.920 1.00 136.22 ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 411.215 17.007  638.965 1.00 135.49 ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 411.310 17.838  638.062 1.00 136.45 ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 409.070 16.212  639.984 1.00 140.40 ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 407.763 15.463  639.764 1.00 140.26 ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 406.825 15.593  640.956 1.00 142.23 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 407.266 14.790  642.094 1.00 142.53 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 407.926 15.273  643.142 1.00 142.47 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 408.222 16.563  643.206 1.00 144.25 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 408.287 14.465  644.130 1.00 137.63 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 412.028 16.990  640.017 1.00 143.33 ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 413.079 17.990  640.185 1.00 144.24 ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 414.336 17.640  639.393 1.00 140.23 ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 414.810 16.505  639.441 1.00 136.18 ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 413.426 18.156  641.667 1.00 144.88 ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 412.384 18.896  642.456 1.00 149.66 ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 411.349 18.215  643.075 1.00 149.95 ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 412.441 20.275  642.580 1.00 153.09 ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 410.390 18.896  643.802 1.00 153.16 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 411.485 20.961  643.306 1.00 155.90 ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 410.458 20.271  643.918 1.00 156.64 ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 414.879 18.624  638.657 1.00 111.67 ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 416.104 18.459  637.867 1.00 109.10 ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 417.370 18.551  638.713 1.00 107.73 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 418.460 18.284  638.207 1.00 105.43 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 416.032 19.617  636.873 1.00 110.59 ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 415.290 20.675  637.609 1.00 113.79 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 414.276 19.955  638.461 1.00 114.64 ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 417.224 18.931  639.979 1.00 171.17 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 418.362 19.011  640.889 1.00 171.55 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 418.988 17.634  641.086 1.00 167.84 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 418.283 16.629  641.177 1.00 167.27 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 417.942 19.600  642.239 1.00 176.19 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 417.708 21.106  642.229 1.00 177.83 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 416.396 21.497  641.576 1.00 180.15 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 415.529 20.616  641.403 1.00 178.66 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 416.232 22.688  641.236 1.00 182.22 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 420.314 17.596  641.149 1.00 151.31 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 421.038 16.335  641.252 1.00 148.11 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 420.909 15.721  642.644 1.00 149.02 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 420.051 14.869  642.876 1.00 148.67 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 422.531 16.517  640.917 1.00 146.56 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 422.663 17.264  639.701 1.00 143.64 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 423.210 15.166  640.753 1.00 143.41 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 421.759 16.157  643.567 1.00 156.56 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 421.781 15.587  644.910 1.00 157.86 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 421.537 16.643  645.982 1.00 162.47 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 420.524 16.609  646.681 1.00 164.60 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 423.118 14.888  645.167 1.00 154.81 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 423.471 13.828  644.137 1.00 151.91 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 425.107 13.115  644.394 1.00 150.48 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 425.262 12.091  642.933 1.00 141.32 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 422.475 17.578  646.105 1.00 166.75 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 422.419 18.606  647.139 1.00 172.56 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 421.201 19.511  646.970 1.00 174.74 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 420.912 19.986  645.872 1.00 173.95 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 423.702 19.443  647.124 1.00 171.65 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 423.938 20.184  648.431 1.00 169.90 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 422.956 20.496  649.137 1.00 175.02 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 425.115 20.455  648.753 1.00 163.27 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 420.490 19.740  648.070 1.00 137.47 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 419.334 20.626  648.068 1.00 141.94 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 419.415 21.588  649.249 1.00 148.52 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 419.211 21.190  650.397 1.00 147.45 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 418.034 19.818  648.116 1.00 140.42 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 416.791 20.591  647.691 1.00 144.95 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 416.217 21.454  648.799 1.00 149.14 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 416.415 21.113  649.984 1.00 147.86 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 415.566 22.472  648.484 1.00 150.86 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 419.720 22.849  648.950 1.00 234.30 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 419.880 23.897  649.959 1.00 239.43 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 420.908 23.496  651.018 1.00 237.60 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 420.579 23.359  652.198 1.00 240.68 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 418.536 24.238  650.643 1.00 245.56 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 417.482 24.216  649.673 1.00 248.08 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 418.595 25.618  651.290 1.00 250.08 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 422.150 23.304  650.576 1.00 148.94 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 423.264 22.938  651.451 1.00 144.43 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 422.966 21.698  652.291 1.00 141.98 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 423.040 21.738  653.520 1.00 142.05 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 423.633 24.110  652.367 1.00 146.77 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 424.112 25.351  651.628 1.00 144.01 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 424.468 26.490  652.566 1.00 139.86 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 424.330 26.374  653.783 1.00 141.45 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 424.931 27.599  652.000 1.00 136.64 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 422.628 20.599  651.624 1.00 181.07 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 422.321 19.352  652.315 1.00 178.48 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 422.853 18.147  651.548 1.00 172.71 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 422.439 17.886  650.418 1.00 172.68 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 420.804 19.182  652.527 1.00 179.82 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 420.308 20.259  653.332 1.00 184.93 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 420.507 17.860  653.218 1.00 175.55 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 423.772 17.413  652.169 1.00 171.21 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 424.351 16.225  651.553 1.00 167.39 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 423.352 15.071  651.532 1.00 167.88 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 423.507 14.090  652.260 1.00 164.11 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 425.623 15.804  652.291 1.00 165.64 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 426.742 16.833  652.241 1.00 165.05 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 427.933 16.392  653.077 1.00 164.45 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 428.447 15.091  652.657 1.00 162.49 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 429.471 14.470  653.233 1.00 159.33 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 430.097 15.031  654.259 1.00 158.18 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 429.871 13.288  652.785 1.00 154.52 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 422.329 15.197  650.693 1.00 175.99 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 421.298 14.172  650.580 1.00 173.63 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 420.794 14.062  649.145 1.00 174.32 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 421.520 14.364  648.197 1.00 174.00 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 420.146 14.471  651.527 1.00 174.35 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 419.548 13.625  648.991 1.00 176.13 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 418.946 13.475  647.672 1.00 175.83 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 417.532 14.046  647.643 1.00 180.03 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 416.657 13.597  648.385 1.00 182.14 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 418.919 12.003  647.248 1.00 172.73 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 420.289 11.352  647.097 1.00 172.39 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 420.741 10.682  648.386 1.00 172.54 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 422.091 10.006  648.213 1.00 168.02 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 422.539 9.335   649.464 1.00 166.69 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 417.314 15.038  646.786 1.00 166.71 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 415.991 15.627  646.619 1.00 169.62 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 415.074 14.626  645.916 1.00 165.69 ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 415.546 13.729  645.218 1.00 161.56 ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 416.055 16.950  645.815 1.00 170.75 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 414.768 17.763  645.991 1.00 173.34 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 416.349 16.678  644.345 1.00 167.90 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 414.716 19.018  645.149 1.00 173.84 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 413.767 14.773  646.109 1.00 125.61 ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 412.799 13.875  645.503 1.00 121.23 ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 412.581 14.125  644.022 1.00 122.79 ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 411.445 14.163  643.551 1.00 125.14 ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 413.676 14.294  643.287 1.00 139.19 ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 413.614 14.512  641.854 1.00 138.34 ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 414.536 13.564  641.113 1.00 137.88 ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 414.145 12.449  640.771 1.00 140.26 ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 415.764 14.007  640.867 1.00 102.93 ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 416.760 13.170  640.205 1.00 98.95  ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 417.654 12.505  641.249 1.00 97.29  ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 417.882 13.066  642.323 1.00 99.07  ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 417.589 14.001  639.219 1.00 98.30  ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 418.474 13.265  638.208 1.00 95.41  ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 418.457 13.982  636.869 1.00 95.81  ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 419.897 13.149  638.718 1.00 93.41  ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 418.146 11.310  640.928 1.00 111.68 ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 418.977 10.519  641.839 1.00 111.19 ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 418.327 10.276  643.198 1.00 114.40 ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 418.911 10.585  644.236 1.00 116.55 ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 420.340 11.186  642.042 1.00 111.24 ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 421.294 10.924  640.895 1.00 110.26 ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 421.136 9.956   640.151 1.00 110.58 ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 422.295 11.784  640.750 1.00 109.78 ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 417.120 9.721   643.188 1.00 103.28 ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 416.430 9.374   644.425 1.00 105.05 ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 417.123 8.203   645.113 1.00 103.90 ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 417.764 7.387   644.451 1.00 103.37 ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 414.963 9.028   644.149 1.00 105.46 ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 414.150 10.231  643.714 1.00 110.79 ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 414.525 11.367  644.073 1.00 112.98 ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 413.131 10.040  643.017 1.00 112.38 ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 417.000 8.116   646.448 1.00 139.13 ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 417.522 6.949   647.169 1.00 139.17 ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 416.779 5.674   646.777 1.00 137.55 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 417.245 4.570   647.058 1.00 136.91 ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 417.279 7.304   648.641 1.00 141.56 ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 416.184 8.318   648.614 1.00 144.16 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 416.408 9.108   647.361 1.00 145.20 ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 415.627 5.840   646.134 1.00 115.90 ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 414.861 4.718   645.612 1.00 114.32 ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 415.534 4.140   644.371 1.00 110.70 ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 415.448 2.940   644.108 1.00 108.01 ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 413.428 5.149   645.291 1.00 116.40 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 412.627 5.583   646.510 1.00 119.44 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 411.243 6.079   646.122 1.00 120.24 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 411.299 7.318   645.352 1.00 119.27 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 410.229 7.983   644.927 1.00 123.65 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 409.013 7.527   645.196 1.00 126.17 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 410.374 9.103   644.233 1.00 125.81 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 416.205 5.002   643.613 1.00 85.71  ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 416.935 4.574   642.424 1.00 83.25  ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 418.222 3.851   642.808 1.00 80.74  ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 418.751 3.052   642.035 1.00 78.56  ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 417.256 5.769   641.525 1.00 83.50  ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 416.080 6.594   640.999 1.00 85.97  ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 416.578 7.704   640.085 1.00 85.96  ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 415.077 5.710   640.277 1.00 86.13  ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 418.721 4.144   644.005 1.00 123.76 ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 419.943 3.535   644.496 1.00 121.70 ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 420.782 4.498   645.314 1.00 120.85 ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 421.226 5.529   644.810 1.00 121.33 ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 420.996 4.161   646.583 1.00 156.81 ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 421.803 4.991   647.470 1.00 155.33 ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 423.262 4.993   647.026 1.00 150.32 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 423.755 4.004   646.482 1.00 146.65 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 421.688 4.507   648.917 1.00 154.40 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 422.139 3.170   649.049 1.00 151.77 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 423.947 6.107   647.259 1.00 111.14 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 425.325 6.267   646.808 1.00 109.57 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 426.184 7.000   647.836 1.00 110.26 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 426.612 8.133   647.610 1.00 111.41 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 425.383 7.024   645.468 1.00 109.37 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 424.307 8.111   645.428 1.00 106.62 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 425.194 6.062   644.305 1.00 107.32 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 424.213 8.828   644.102 1.00 109.08 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 426.439 6.343   648.963 1.00 138.98 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 427.251 6.928   650.023 1.00 140.69 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 427.839 5.834   650.911 1.00 137.50 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 428.148 6.070   652.081 1.00 139.04 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 426.419 7.908   650.857 1.00 145.46 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 427.276 8.886   651.641 1.00 146.23 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 427.753 9.873   651.041 1.00 146.00 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 427.466 8.675   652.858 1.00 143.66 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 427.989 4.640   650.340 1.00 125.82 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 428.518 3.482   651.058 1.00 127.67 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 427.698 3.177   652.310 1.00 131.99 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 428.251 2.923   653.380 1.00 131.37 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 429.987 3.704   651.430 1.00 127.88 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 430.920 3.831   650.235 1.00 124.03 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 432.259 4.452   650.622 1.00 125.79 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 432.936 3.719   651.690 1.00 126.96 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 432.976 4.112   652.960 1.00 127.53 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 432.374 5.236   653.328 1.00 127.58 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 433.616 3.382   653.863 1.00 126.26 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 426.377 3.208   652.166 1.00 147.33 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 425.474 2.947   653.281 1.00 149.76 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 425.113 1.471   653.403 1.00 151.04 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 425.624 0.631   652.662 1.00 149.50 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 424.196 3.776   653.136 1.00 146.61 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 424.448 5.263   653.269 1.00 148.32 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 425.590 5.716   653.230 1.00 149.15 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 423.377 6.032   653.427 1.00 148.48 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 424.229 1.166   654.346 1.00 178.67 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 423.738 -0.193  654.531 1.00 178.14 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 422.288 -0.294  654.073 1.00 178.55 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 421.693 -1.372  654.089 1.00 177.31 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 423.865 -0.620  655.995 1.00 180.72 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 425.273 -0.607  656.593 1.00 177.57 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 425.240 -1.024  658.056 1.00 175.45 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 426.205 -1.507  655.796 1.00 172.42 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 421.726 0.839   653.664 1.00 139.60 ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 420.335 0.898   653.232 1.00 141.68 ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 420.223 1.379   651.787 1.00 137.35 ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 421.031 2.188   651.328 1.00 133.64 ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 419.528 1.815   654.155 1.00 145.15 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 419.699 1.520   655.638 1.00 143.16 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 419.283 0.098   655.979 1.00 143.35 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 419.481 -0.195  657.458 1.00 143.17 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 419.096 -1.591  657.809 1.00 140.03 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 419.216 0.876   651.080 1.00 159.83 ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 418.982 1.251   649.689 1.00 158.19 ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 417.566 0.889   649.254 1.00 161.41 ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 417.326 -0.216  648.769 1.00 161.99 ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 420.001 0.574   648.770 1.00 156.04 ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 419.757 0.907   647.010 1.00 158.92 ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 416.639 1.828   649.433 1.00 134.11 ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 415.236 1.640   649.064 1.00 135.80 ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 414.633 0.399   649.723 1.00 139.41 ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 414.380 -0.606  649.055 1.00 134.25 ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 415.087 1.545   647.542 1.00 132.68 ? 68   GLN A CB    1 
ATOM   514   C  CG    . GLN A 1  68   ? 413.649 1.603   647.045 1.00 134.20 ? 68   GLN A CG    1 
ATOM   515   C  CD    . GLN A 1  68   ? 413.461 0.867   645.736 1.00 130.70 ? 68   GLN A CD    1 
ATOM   516   O  OE1   . GLN A 1  68   ? 414.271 0.016   645.368 1.00 125.19 ? 68   GLN A OE1   1 
ATOM   517   N  NE2   . GLN A 1  68   ? 412.389 1.191   645.023 1.00 132.84 ? 68   GLN A NE2   1 
ATOM   518   N  N     . THR A 1  69   ? 414.433 0.470   651.038 1.00 179.28 ? 69   THR A N     1 
ATOM   519   C  CA    . THR A 1  69   ? 413.781 -0.592  651.813 1.00 182.14 ? 69   THR A CA    1 
ATOM   520   C  C     . THR A 1  69   ? 414.472 -1.959  651.718 1.00 176.88 ? 69   THR A C     1 
ATOM   521   O  O     . THR A 1  69   ? 414.730 -2.599  652.738 1.00 177.11 ? 69   THR A O     1 
ATOM   522   C  CB    . THR A 1  69   ? 412.305 -0.761  651.391 1.00 185.37 ? 69   THR A CB    1 
ATOM   523   O  OG1   . THR A 1  69   ? 411.628 0.498   651.494 1.00 188.87 ? 69   THR A OG1   1 
ATOM   524   C  CG2   . THR A 1  69   ? 411.608 -1.779  652.280 1.00 186.83 ? 69   THR A CG2   1 
ATOM   525   N  N     . CYS A 1  70   ? 414.764 -2.402  650.497 1.00 182.58 ? 70   CYS A N     1 
ATOM   526   C  CA    . CYS A 1  70   ? 415.367 -3.713  650.266 1.00 177.41 ? 70   CYS A CA    1 
ATOM   527   C  C     . CYS A 1  70   ? 416.783 -3.814  650.828 1.00 173.74 ? 70   CYS A C     1 
ATOM   528   O  O     . CYS A 1  70   ? 417.304 -4.915  651.005 1.00 171.72 ? 70   CYS A O     1 
ATOM   529   C  CB    . CYS A 1  70   ? 415.384 -4.036  648.769 1.00 171.38 ? 70   CYS A CB    1 
ATOM   530   S  SG    . CYS A 1  70   ? 416.577 -3.086  647.799 1.00 161.61 ? 70   CYS A SG    1 
ATOM   531   N  N     . GLN A 1  71   ? 417.395 -2.661  651.096 1.00 150.88 ? 71   GLN A N     1 
ATOM   532   C  CA    . GLN A 1  71   ? 418.741 -2.588  651.665 1.00 149.54 ? 71   GLN A CA    1 
ATOM   533   C  C     . GLN A 1  71   ? 419.779 -3.263  650.770 1.00 145.53 ? 71   GLN A C     1 
ATOM   534   O  O     . GLN A 1  71   ? 419.967 -2.870  649.618 1.00 141.60 ? 71   GLN A O     1 
ATOM   535   C  CB    . GLN A 1  71   ? 418.768 -3.214  653.064 1.00 151.19 ? 71   GLN A CB    1 
ATOM   536   C  CG    . GLN A 1  71   ? 417.733 -2.647  654.024 1.00 157.00 ? 71   GLN A CG    1 
ATOM   537   C  CD    . GLN A 1  71   ? 417.644 -3.433  655.318 1.00 158.23 ? 71   GLN A CD    1 
ATOM   538   O  OE1   . GLN A 1  71   ? 418.334 -4.437  655.497 1.00 156.30 ? 71   GLN A OE1   1 
ATOM   539   N  NE2   . GLN A 1  71   ? 416.790 -2.980  656.228 1.00 159.44 ? 71   GLN A NE2   1 
ATOM   540   N  N     . GLU A 1  72   ? 420.448 -4.274  651.320 1.00 174.45 ? 72   GLU A N     1 
ATOM   541   C  CA    . GLU A 1  72   ? 421.460 -5.058  650.608 1.00 168.90 ? 72   GLU A CA    1 
ATOM   542   C  C     . GLU A 1  72   ? 422.616 -4.209  650.084 1.00 166.45 ? 72   GLU A C     1 
ATOM   543   O  O     . GLU A 1  72   ? 423.244 -4.557  649.084 1.00 162.33 ? 72   GLU A O     1 
ATOM   544   C  CB    . GLU A 1  72   ? 420.822 -5.833  649.450 1.00 163.19 ? 72   GLU A CB    1 
ATOM   545   C  CG    . GLU A 1  72   ? 419.652 -6.712  649.860 1.00 166.94 ? 72   GLU A CG    1 
ATOM   546   C  CD    . GLU A 1  72   ? 420.005 -7.680  650.972 1.00 169.09 ? 72   GLU A CD    1 
ATOM   547   O  OE1   . GLU A 1  72   ? 421.127 -8.229  650.955 1.00 164.79 ? 72   GLU A OE1   1 
ATOM   548   O  OE2   . GLU A 1  72   ? 419.157 -7.894  651.865 1.00 172.71 ? 72   GLU A OE2   1 
ATOM   549   N  N     . GLY A 1  73   ? 422.897 -3.102  650.766 1.00 156.44 ? 73   GLY A N     1 
ATOM   550   C  CA    . GLY A 1  73   ? 424.009 -2.239  650.407 1.00 156.07 ? 73   GLY A CA    1 
ATOM   551   C  C     . GLY A 1  73   ? 423.912 -1.666  649.006 1.00 151.73 ? 73   GLY A C     1 
ATOM   552   O  O     . GLY A 1  73   ? 422.817 -1.500  648.469 1.00 152.24 ? 73   GLY A O     1 
ATOM   553   N  N     . MET A 1  74   ? 425.064 -1.365  648.413 1.00 112.80 ? 74   MET A N     1 
ATOM   554   C  CA    . MET A 1  74   ? 425.109 -0.817  647.061 1.00 113.39 ? 74   MET A CA    1 
ATOM   555   C  C     . MET A 1  74   ? 425.982 -1.667  646.144 1.00 108.26 ? 74   MET A C     1 
ATOM   556   O  O     . MET A 1  74   ? 426.205 -1.315  644.986 1.00 108.63 ? 74   MET A O     1 
ATOM   557   C  CB    . MET A 1  74   ? 425.619 0.625   647.080 1.00 115.26 ? 74   MET A CB    1 
ATOM   558   C  CG    . MET A 1  74   ? 427.054 0.772   647.556 1.00 113.05 ? 74   MET A CG    1 
ATOM   559   S  SD    . MET A 1  74   ? 427.685 2.443   647.312 1.00 122.43 ? 74   MET A SD    1 
ATOM   560   C  CE    . MET A 1  74   ? 427.566 2.591   645.530 1.00 108.33 ? 74   MET A CE    1 
ATOM   561   N  N     . ASN A 1  75   ? 426.480 -2.781  646.669 1.00 80.23  ? 75   ASN A N     1 
ATOM   562   C  CA    . ASN A 1  75   ? 427.266 -3.714  645.871 1.00 78.74  ? 75   ASN A CA    1 
ATOM   563   C  C     . ASN A 1  75   ? 426.395 -4.843  645.336 1.00 77.03  ? 75   ASN A C     1 
ATOM   564   O  O     . ASN A 1  75   ? 426.584 -5.310  644.214 1.00 72.98  ? 75   ASN A O     1 
ATOM   565   C  CB    . ASN A 1  75   ? 428.423 -4.284  646.693 1.00 78.72  ? 75   ASN A CB    1 
ATOM   566   C  CG    . ASN A 1  75   ? 429.251 -5.288  645.914 1.00 75.57  ? 75   ASN A CG    1 
ATOM   567   O  OD1   . ASN A 1  75   ? 428.990 -6.490  645.955 1.00 72.37  ? 75   ASN A OD1   1 
ATOM   568   N  ND2   . ASN A 1  75   ? 430.255 -4.797  645.196 1.00 72.55  ? 75   ASN A ND2   1 
ATOM   569   N  N     . GLU A 1  76   ? 425.439 -5.274  646.153 1.00 96.17  ? 76   GLU A N     1 
ATOM   570   C  CA    . GLU A 1  76   ? 424.497 -6.316  645.763 1.00 91.98  ? 76   GLU A CA    1 
ATOM   571   C  C     . GLU A 1  76   ? 423.393 -5.749  644.878 1.00 93.95  ? 76   GLU A C     1 
ATOM   572   O  O     . GLU A 1  76   ? 423.004 -6.362  643.883 1.00 92.55  ? 76   GLU A O     1 
ATOM   573   C  CB    . GLU A 1  76   ? 423.893 -6.978  647.004 1.00 94.29  ? 76   GLU A CB    1 
ATOM   574   C  CG    . GLU A 1  76   ? 422.748 -7.934  646.711 1.00 95.79  ? 76   GLU A CG    1 
ATOM   575   C  CD    . GLU A 1  76   ? 423.189 -9.149  645.922 1.00 92.17  ? 76   GLU A CD    1 
ATOM   576   O  OE1   . GLU A 1  76   ? 424.370 -9.539  646.037 1.00 90.82  ? 76   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A 1  76   ? 422.354 -9.713  645.183 1.00 90.75  ? 76   GLU A OE2   1 
ATOM   578   N  N     . CYS A 1  77   ? 422.895 -4.573  645.248 1.00 95.07  ? 77   CYS A N     1 
ATOM   579   C  CA    . CYS A 1  77   ? 421.830 -3.910  644.503 1.00 97.19  ? 77   CYS A CA    1 
ATOM   580   C  C     . CYS A 1  77   ? 422.266 -3.545  643.090 1.00 93.49  ? 77   CYS A C     1 
ATOM   581   O  O     . CYS A 1  77   ? 423.239 -2.814  642.907 1.00 94.13  ? 77   CYS A O     1 
ATOM   582   C  CB    . CYS A 1  77   ? 421.366 -2.652  645.241 1.00 103.56 ? 77   CYS A CB    1 
ATOM   583   S  SG    . CYS A 1  77   ? 420.293 -1.569  644.266 1.00 101.50 ? 77   CYS A SG    1 
ATOM   584   N  N     . PRO A 1  78   ? 421.544 -4.062  642.084 1.00 92.85  ? 78   PRO A N     1 
ATOM   585   C  CA    . PRO A 1  78   ? 421.806 -3.751  640.675 1.00 92.03  ? 78   PRO A CA    1 
ATOM   586   C  C     . PRO A 1  78   ? 421.476 -2.300  640.343 1.00 94.62  ? 78   PRO A C     1 
ATOM   587   O  O     . PRO A 1  78   ? 422.236 -1.394  640.683 1.00 96.26  ? 78   PRO A O     1 
ATOM   588   C  CB    . PRO A 1  78   ? 420.873 -4.707  639.919 1.00 91.53  ? 78   PRO A CB    1 
ATOM   589   C  CG    . PRO A 1  78   ? 420.495 -5.761  640.914 1.00 93.07  ? 78   PRO A CG    1 
ATOM   590   C  CD    . PRO A 1  78   ? 420.475 -5.063  642.233 1.00 95.76  ? 78   PRO A CD    1 
ATOM   591   N  N     . GLY A 1  79   ? 420.342 -2.090  639.684 1.00 77.77  ? 79   GLY A N     1 
ATOM   592   C  CA    . GLY A 1  79   ? 419.903 -0.755  639.330 1.00 82.07  ? 79   GLY A CA    1 
ATOM   593   C  C     . GLY A 1  79   ? 418.394 -0.670  639.216 1.00 88.39  ? 79   GLY A C     1 
ATOM   594   O  O     . GLY A 1  79   ? 417.771 -1.452  638.498 1.00 90.64  ? 79   GLY A O     1 
ATOM   595   N  N     . HIS A 1  80   ? 417.804 0.284   639.927 1.00 84.76  ? 80   HIS A N     1 
ATOM   596   C  CA    . HIS A 1  80   ? 416.358 0.460   639.915 1.00 85.55  ? 80   HIS A CA    1 
ATOM   597   C  C     . HIS A 1  80   ? 415.969 1.656   639.055 1.00 87.49  ? 80   HIS A C     1 
ATOM   598   O  O     . HIS A 1  80   ? 416.287 2.800   639.380 1.00 88.36  ? 80   HIS A O     1 
ATOM   599   C  CB    . HIS A 1  80   ? 415.833 0.624   641.341 1.00 87.90  ? 80   HIS A CB    1 
ATOM   600   C  CG    . HIS A 1  80   ? 416.319 -0.435  642.282 1.00 84.67  ? 80   HIS A CG    1 
ATOM   601   N  ND1   . HIS A 1  80   ? 415.959 -1.760  642.160 1.00 83.46  ? 80   HIS A ND1   1 
ATOM   602   C  CD2   . HIS A 1  80   ? 417.145 -0.366  643.353 1.00 85.21  ? 80   HIS A CD2   1 
ATOM   603   C  CE1   . HIS A 1  80   ? 416.538 -2.461  643.119 1.00 82.57  ? 80   HIS A CE1   1 
ATOM   604   N  NE2   . HIS A 1  80   ? 417.263 -1.639  643.856 1.00 83.33  ? 80   HIS A NE2   1 
ATOM   605   N  N     . PHE A 1  81   ? 415.284 1.378   637.951 1.00 85.48  ? 81   PHE A N     1 
ATOM   606   C  CA    . PHE A 1  81   ? 414.940 2.406   636.976 1.00 86.62  ? 81   PHE A CA    1 
ATOM   607   C  C     . PHE A 1  81   ? 413.866 3.367   637.467 1.00 90.86  ? 81   PHE A C     1 
ATOM   608   O  O     . PHE A 1  81   ? 413.019 3.012   638.287 1.00 93.68  ? 81   PHE A O     1 
ATOM   609   C  CB    . PHE A 1  81   ? 414.478 1.760   635.668 1.00 86.51  ? 81   PHE A CB    1 
ATOM   610   C  CG    . PHE A 1  81   ? 415.593 1.469   634.709 1.00 85.27  ? 81   PHE A CG    1 
ATOM   611   C  CD1   . PHE A 1  81   ? 415.926 2.381   633.721 1.00 85.28  ? 81   PHE A CD1   1 
ATOM   612   C  CD2   . PHE A 1  81   ? 416.310 0.288   634.794 1.00 82.98  ? 81   PHE A CD2   1 
ATOM   613   C  CE1   . PHE A 1  81   ? 416.951 2.120   632.835 1.00 81.75  ? 81   PHE A CE1   1 
ATOM   614   C  CE2   . PHE A 1  81   ? 417.338 0.020   633.911 1.00 81.25  ? 81   PHE A CE2   1 
ATOM   615   C  CZ    . PHE A 1  81   ? 417.659 0.939   632.930 1.00 82.08  ? 81   PHE A CZ    1 
ATOM   616   N  N     . GLY A 1  82   ? 413.914 4.590   636.950 1.00 83.85  ? 82   GLY A N     1 
ATOM   617   C  CA    . GLY A 1  82   ? 412.877 5.573   637.198 1.00 86.79  ? 82   GLY A CA    1 
ATOM   618   C  C     . GLY A 1  82   ? 412.141 5.870   635.907 1.00 87.82  ? 82   GLY A C     1 
ATOM   619   O  O     . GLY A 1  82   ? 412.297 5.151   634.921 1.00 86.37  ? 82   GLY A O     1 
ATOM   620   N  N     . HIS A 1  83   ? 411.338 6.927   635.908 1.00 113.91 ? 83   HIS A N     1 
ATOM   621   C  CA    . HIS A 1  83   ? 410.629 7.334   634.702 1.00 115.02 ? 83   HIS A CA    1 
ATOM   622   C  C     . HIS A 1  83   ? 410.344 8.827   634.713 1.00 118.22 ? 83   HIS A C     1 
ATOM   623   O  O     . HIS A 1  83   ? 410.141 9.424   635.771 1.00 118.88 ? 83   HIS A O     1 
ATOM   624   C  CB    . HIS A 1  83   ? 409.319 6.557   634.551 1.00 117.32 ? 83   HIS A CB    1 
ATOM   625   C  CG    . HIS A 1  83   ? 408.204 7.078   635.406 1.00 120.85 ? 83   HIS A CG    1 
ATOM   626   N  ND1   . HIS A 1  83   ? 408.311 7.209   636.774 1.00 120.31 ? 83   HIS A ND1   1 
ATOM   627   C  CD2   . HIS A 1  83   ? 406.958 7.501   635.084 1.00 123.77 ? 83   HIS A CD2   1 
ATOM   628   C  CE1   . HIS A 1  83   ? 407.180 7.690   637.258 1.00 124.57 ? 83   HIS A CE1   1 
ATOM   629   N  NE2   . HIS A 1  83   ? 406.343 7.876   636.254 1.00 127.26 ? 83   HIS A NE2   1 
ATOM   630   N  N     . ILE A 1  84   ? 410.335 9.429   633.530 1.00 110.19 ? 84   ILE A N     1 
ATOM   631   C  CA    . ILE A 1  84   ? 409.961 10.829  633.401 1.00 112.35 ? 84   ILE A CA    1 
ATOM   632   C  C     . ILE A 1  84   ? 408.938 11.006  632.283 1.00 115.06 ? 84   ILE A C     1 
ATOM   633   O  O     . ILE A 1  84   ? 409.135 10.545  631.152 1.00 113.14 ? 84   ILE A O     1 
ATOM   634   C  CB    . ILE A 1  84   ? 411.193 11.729  633.149 1.00 111.35 ? 84   ILE A CB    1 
ATOM   635   C  CG1   . ILE A 1  84   ? 410.756 13.134  632.729 1.00 115.39 ? 84   ILE A CG1   1 
ATOM   636   C  CG2   . ILE A 1  84   ? 412.106 11.120  632.102 1.00 109.07 ? 84   ILE A CG2   1 
ATOM   637   C  CD1   . ILE A 1  84   ? 411.909 14.065  632.428 1.00 114.26 ? 84   ILE A CD1   1 
ATOM   638   N  N     . ASP A 1  85   ? 407.830 11.658  632.626 1.00 103.34 ? 85   ASP A N     1 
ATOM   639   C  CA    . ASP A 1  85   ? 406.764 11.944  631.676 1.00 104.48 ? 85   ASP A CA    1 
ATOM   640   C  C     . ASP A 1  85   ? 407.070 13.223  630.908 1.00 106.11 ? 85   ASP A C     1 
ATOM   641   O  O     . ASP A 1  85   ? 407.390 14.253  631.503 1.00 106.42 ? 85   ASP A O     1 
ATOM   642   C  CB    . ASP A 1  85   ? 405.418 12.071  632.396 1.00 107.35 ? 85   ASP A CB    1 
ATOM   643   C  CG    . ASP A 1  85   ? 405.061 10.831  633.197 1.00 106.64 ? 85   ASP A CG    1 
ATOM   644   O  OD1   . ASP A 1  85   ? 405.246 9.710   632.680 1.00 105.97 ? 85   ASP A OD1   1 
ATOM   645   O  OD2   . ASP A 1  85   ? 404.596 10.980  634.346 1.00 108.08 ? 85   ASP A OD2   1 
ATOM   646   N  N     . LEU A 1  86   ? 406.974 13.154  629.585 1.00 122.71 ? 86   LEU A N     1 
ATOM   647   C  CA    . LEU A 1  86   ? 407.229 14.314  628.744 1.00 125.48 ? 86   LEU A CA    1 
ATOM   648   C  C     . LEU A 1  86   ? 405.949 15.113  628.532 1.00 129.03 ? 86   LEU A C     1 
ATOM   649   O  O     . LEU A 1  86   ? 404.866 14.539  628.414 1.00 129.78 ? 86   LEU A O     1 
ATOM   650   C  CB    . LEU A 1  86   ? 407.820 13.882  627.402 1.00 126.78 ? 86   LEU A CB    1 
ATOM   651   C  CG    . LEU A 1  86   ? 409.097 13.042  627.488 1.00 121.18 ? 86   LEU A CG    1 
ATOM   652   C  CD1   . LEU A 1  86   ? 409.546 12.594  626.106 1.00 116.53 ? 86   LEU A CD1   1 
ATOM   653   C  CD2   . LEU A 1  86   ? 410.205 13.813  628.191 1.00 118.52 ? 86   LEU A CD2   1 
ATOM   654   N  N     . ALA A 1  87   ? 406.078 16.437  628.493 1.00 179.53 ? 87   ALA A N     1 
ATOM   655   C  CA    . ALA A 1  87   ? 404.932 17.318  628.292 1.00 185.64 ? 87   ALA A CA    1 
ATOM   656   C  C     . ALA A 1  87   ? 404.266 17.032  626.952 1.00 186.54 ? 87   ALA A C     1 
ATOM   657   O  O     . ALA A 1  87   ? 403.041 17.059  626.834 1.00 192.29 ? 87   ALA A O     1 
ATOM   658   C  CB    . ALA A 1  87   ? 405.357 18.775  628.378 1.00 187.27 ? 87   ALA A CB    1 
ATOM   659   N  N     . LYS A 1  88   ? 405.089 16.761  625.944 1.00 139.94 ? 88   LYS A N     1 
ATOM   660   C  CA    . LYS A 1  88   ? 404.601 16.336  624.638 1.00 139.00 ? 88   LYS A CA    1 
ATOM   661   C  C     . LYS A 1  88   ? 405.503 15.242  624.077 1.00 133.49 ? 88   LYS A C     1 
ATOM   662   O  O     . LYS A 1  88   ? 406.717 15.276  624.276 1.00 132.67 ? 88   LYS A O     1 
ATOM   663   C  CB    . LYS A 1  88   ? 404.524 17.519  623.670 1.00 140.49 ? 88   LYS A CB    1 
ATOM   664   C  CG    . LYS A 1  88   ? 403.317 18.418  623.890 1.00 146.16 ? 88   LYS A CG    1 
ATOM   665   C  CD    . LYS A 1  88   ? 403.044 19.284  622.673 1.00 148.24 ? 88   LYS A CD    1 
ATOM   666   C  CE    . LYS A 1  88   ? 401.772 20.098  622.850 1.00 150.74 ? 88   LYS A CE    1 
ATOM   667   N  NZ    . LYS A 1  88   ? 401.451 20.895  621.635 1.00 155.98 ? 88   LYS A NZ    1 
ATOM   668   N  N     . PRO A 1  89   ? 404.906 14.262  623.380 1.00 118.28 ? 89   PRO A N     1 
ATOM   669   C  CA    . PRO A 1  89   ? 405.654 13.126  622.828 1.00 116.70 ? 89   PRO A CA    1 
ATOM   670   C  C     . PRO A 1  89   ? 406.739 13.556  621.847 1.00 115.84 ? 89   PRO A C     1 
ATOM   671   O  O     . PRO A 1  89   ? 406.577 14.552  621.143 1.00 115.22 ? 89   PRO A O     1 
ATOM   672   C  CB    . PRO A 1  89   ? 404.571 12.302  622.119 1.00 116.06 ? 89   PRO A CB    1 
ATOM   673   C  CG    . PRO A 1  89   ? 403.454 13.261  621.874 1.00 121.17 ? 89   PRO A CG    1 
ATOM   674   C  CD    . PRO A 1  89   ? 403.474 14.189  623.045 1.00 122.69 ? 89   PRO A CD    1 
ATOM   675   N  N     . VAL A 1  90   ? 407.838 12.810  621.816 1.00 140.39 ? 90   VAL A N     1 
ATOM   676   C  CA    . VAL A 1  90   ? 408.947 13.114  620.921 1.00 138.49 ? 90   VAL A CA    1 
ATOM   677   C  C     . VAL A 1  90   ? 409.347 11.886  620.110 1.00 136.95 ? 90   VAL A C     1 
ATOM   678   O  O     . VAL A 1  90   ? 408.818 10.794  620.317 1.00 135.01 ? 90   VAL A O     1 
ATOM   679   C  CB    . VAL A 1  90   ? 410.178 13.628  621.694 1.00 135.89 ? 90   VAL A CB    1 
ATOM   680   C  CG1   . VAL A 1  90   ? 409.837 14.898  622.460 1.00 137.18 ? 90   VAL A CG1   1 
ATOM   681   C  CG2   . VAL A 1  90   ? 410.700 12.553  622.633 1.00 134.00 ? 90   VAL A CG2   1 
ATOM   682   N  N     . PHE A 1  91   ? 410.287 12.074  619.190 1.00 146.64 ? 91   PHE A N     1 
ATOM   683   C  CA    . PHE A 1  91   ? 410.755 10.988  618.337 1.00 144.90 ? 91   PHE A CA    1 
ATOM   684   C  C     . PHE A 1  91   ? 411.973 10.284  618.919 1.00 141.65 ? 91   PHE A C     1 
ATOM   685   O  O     . PHE A 1  91   ? 412.818 10.908  619.560 1.00 141.77 ? 91   PHE A O     1 
ATOM   686   C  CB    . PHE A 1  91   ? 411.096 11.511  616.939 1.00 145.56 ? 91   PHE A CB    1 
ATOM   687   C  CG    . PHE A 1  91   ? 409.896 11.835  616.099 1.00 150.38 ? 91   PHE A CG    1 
ATOM   688   C  CD1   . PHE A 1  91   ? 408.667 11.257  616.367 1.00 152.77 ? 91   PHE A CD1   1 
ATOM   689   C  CD2   . PHE A 1  91   ? 410.000 12.715  615.035 1.00 151.98 ? 91   PHE A CD2   1 
ATOM   690   C  CE1   . PHE A 1  91   ? 407.563 11.553  615.591 1.00 155.83 ? 91   PHE A CE1   1 
ATOM   691   C  CE2   . PHE A 1  91   ? 408.900 13.016  614.257 1.00 155.04 ? 91   PHE A CE2   1 
ATOM   692   C  CZ    . PHE A 1  91   ? 407.680 12.435  614.535 1.00 158.47 ? 91   PHE A CZ    1 
ATOM   693   N  N     . HIS A 1  92   ? 412.052 8.977   618.692 1.00 108.42 ? 92   HIS A N     1 
ATOM   694   C  CA    . HIS A 1  92   ? 413.256 8.219   619.001 1.00 102.60 ? 92   HIS A CA    1 
ATOM   695   C  C     . HIS A 1  92   ? 414.183 8.289   617.793 1.00 100.08 ? 92   HIS A C     1 
ATOM   696   O  O     . HIS A 1  92   ? 413.801 7.892   616.693 1.00 100.71 ? 92   HIS A O     1 
ATOM   697   C  CB    . HIS A 1  92   ? 412.916 6.767   619.348 1.00 102.20 ? 92   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1  92   ? 414.073 5.988   619.893 1.00 98.59  ? 92   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1  92   ? 415.127 5.572   619.109 1.00 93.47  ? 92   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1  92   ? 414.336 5.543   621.145 1.00 96.63  ? 92   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1  92   ? 415.993 4.908   619.855 1.00 91.44  ? 92   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1  92   ? 415.536 4.876   621.094 1.00 90.50  ? 92   HIS A NE2   1 
ATOM   703   N  N     . VAL A 1  93   ? 415.392 8.803   618.000 1.00 85.21  ? 93   VAL A N     1 
ATOM   704   C  CA    . VAL A 1  93   ? 416.323 9.060   616.903 1.00 84.42  ? 93   VAL A CA    1 
ATOM   705   C  C     . VAL A 1  93   ? 416.632 7.806   616.082 1.00 82.69  ? 93   VAL A C     1 
ATOM   706   O  O     . VAL A 1  93   ? 416.517 7.816   614.854 1.00 83.41  ? 93   VAL A O     1 
ATOM   707   C  CB    . VAL A 1  93   ? 417.646 9.674   617.428 1.00 82.94  ? 93   VAL A CB    1 
ATOM   708   C  CG1   . VAL A 1  93   ? 418.102 8.980   618.706 1.00 80.94  ? 93   VAL A CG1   1 
ATOM   709   C  CG2   . VAL A 1  93   ? 418.727 9.629   616.356 1.00 81.63  ? 93   VAL A CG2   1 
ATOM   710   N  N     . GLY A 1  94   ? 416.986 6.719   616.762 1.00 104.10 ? 94   GLY A N     1 
ATOM   711   C  CA    . GLY A 1  94   ? 417.364 5.486   616.094 1.00 103.93 ? 94   GLY A CA    1 
ATOM   712   C  C     . GLY A 1  94   ? 416.259 4.850   615.270 1.00 106.38 ? 94   GLY A C     1 
ATOM   713   O  O     . GLY A 1  94   ? 416.497 3.889   614.539 1.00 105.30 ? 94   GLY A O     1 
ATOM   714   N  N     . PHE A 1  95   ? 415.049 5.385   615.386 1.00 102.46 ? 95   PHE A N     1 
ATOM   715   C  CA    . PHE A 1  95   ? 413.909 4.860   614.648 1.00 101.98 ? 95   PHE A CA    1 
ATOM   716   C  C     . PHE A 1  95   ? 413.365 5.867   613.640 1.00 106.38 ? 95   PHE A C     1 
ATOM   717   O  O     . PHE A 1  95   ? 412.378 5.584   612.955 1.00 106.80 ? 95   PHE A O     1 
ATOM   718   C  CB    . PHE A 1  95   ? 412.798 4.445   615.613 1.00 102.62 ? 95   PHE A CB    1 
ATOM   719   C  CG    . PHE A 1  95   ? 413.169 3.300   616.510 1.00 98.90  ? 95   PHE A CG    1 
ATOM   720   C  CD1   . PHE A 1  95   ? 414.080 2.343   616.093 1.00 95.04  ? 95   PHE A CD1   1 
ATOM   721   C  CD2   . PHE A 1  95   ? 412.610 3.182   617.771 1.00 102.90 ? 95   PHE A CD2   1 
ATOM   722   C  CE1   . PHE A 1  95   ? 414.425 1.289   616.918 1.00 94.97  ? 95   PHE A CE1   1 
ATOM   723   C  CE2   . PHE A 1  95   ? 412.951 2.132   618.601 1.00 101.80 ? 95   PHE A CE2   1 
ATOM   724   C  CZ    . PHE A 1  95   ? 413.859 1.183   618.174 1.00 98.85  ? 95   PHE A CZ    1 
ATOM   725   N  N     . ILE A 1  96   ? 414.011 7.031   613.553 1.00 87.18  ? 96   ILE A N     1 
ATOM   726   C  CA    . ILE A 1  96   ? 413.568 8.111   612.665 1.00 89.69  ? 96   ILE A CA    1 
ATOM   727   C  C     . ILE A 1  96   ? 413.283 7.609   611.252 1.00 90.37  ? 96   ILE A C     1 
ATOM   728   O  O     . ILE A 1  96   ? 412.280 7.982   610.642 1.00 92.91  ? 96   ILE A O     1 
ATOM   729   C  CB    . ILE A 1  96   ? 414.611 9.251   612.600 1.00 89.41  ? 96   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1  96   ? 414.539 10.111  613.862 1.00 89.97  ? 96   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1  96   ? 414.381 10.131  611.381 1.00 91.61  ? 96   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1  96   ? 413.222 10.833  614.033 1.00 93.01  ? 96   ILE A CD1   1 
ATOM   733   N  N     . ALA A 1  97   ? 414.157 6.745   610.748 1.00 88.18  ? 97   ALA A N     1 
ATOM   734   C  CA    . ALA A 1  97   ? 413.951 6.130   609.444 1.00 88.65  ? 97   ALA A CA    1 
ATOM   735   C  C     . ALA A 1  97   ? 412.722 5.223   609.456 1.00 89.69  ? 97   ALA A C     1 
ATOM   736   O  O     . ALA A 1  97   ? 411.799 5.410   608.660 1.00 92.05  ? 97   ALA A O     1 
ATOM   737   C  CB    . ALA A 1  97   ? 415.185 5.347   609.026 1.00 85.99  ? 97   ALA A CB    1 
ATOM   738   N  N     . LYS A 1  98   ? 412.713 4.256   610.372 1.00 151.48 ? 98   LYS A N     1 
ATOM   739   C  CA    . LYS A 1  98   ? 411.652 3.252   610.437 1.00 153.86 ? 98   LYS A CA    1 
ATOM   740   C  C     . LYS A 1  98   ? 410.265 3.877   610.527 1.00 159.74 ? 98   LYS A C     1 
ATOM   741   O  O     . LYS A 1  98   ? 409.373 3.531   609.751 1.00 164.20 ? 98   LYS A O     1 
ATOM   742   C  CB    . LYS A 1  98   ? 411.875 2.311   611.623 1.00 151.46 ? 98   LYS A CB    1 
ATOM   743   C  CG    . LYS A 1  98   ? 412.722 1.091   611.296 1.00 148.18 ? 98   LYS A CG    1 
ATOM   744   C  CD    . LYS A 1  98   ? 412.053 0.229   610.235 1.00 146.03 ? 98   LYS A CD    1 
ATOM   745   C  CE    . LYS A 1  98   ? 412.861 -1.026  609.944 1.00 143.17 ? 98   LYS A CE    1 
ATOM   746   N  NZ    . LYS A 1  98   ? 412.995 -1.896  611.145 1.00 141.10 ? 98   LYS A NZ    1 
ATOM   747   N  N     . ILE A 1  99   ? 410.093 4.800   611.469 1.00 133.84 ? 99   ILE A N     1 
ATOM   748   C  CA    . ILE A 1  99   ? 408.839 5.533   611.606 1.00 135.42 ? 99   ILE A CA    1 
ATOM   749   C  C     . ILE A 1  99   ? 408.468 6.202   610.286 1.00 138.79 ? 99   ILE A C     1 
ATOM   750   O  O     . ILE A 1  99   ? 407.327 6.105   609.827 1.00 142.19 ? 99   ILE A O     1 
ATOM   751   C  CB    . ILE A 1  99   ? 408.923 6.601   612.715 1.00 131.76 ? 99   ILE A CB    1 
ATOM   752   C  CG1   . ILE A 1  99   ? 409.223 5.947   614.066 1.00 130.92 ? 99   ILE A CG1   1 
ATOM   753   C  CG2   . ILE A 1  99   ? 407.632 7.402   612.787 1.00 135.29 ? 99   ILE A CG2   1 
ATOM   754   C  CD1   . ILE A 1  99   ? 409.289 6.926   615.219 1.00 132.84 ? 99   ILE A CD1   1 
ATOM   755   N  N     . LYS A 1  100  ? 409.454 6.846   609.664 1.00 97.18  ? 100  LYS A N     1 
ATOM   756   C  CA    . LYS A 1  100  ? 409.245 7.558   608.407 1.00 99.28  ? 100  LYS A CA    1 
ATOM   757   C  C     . LYS A 1  100  ? 408.792 6.604   607.305 1.00 99.80  ? 100  LYS A C     1 
ATOM   758   O  O     . LYS A 1  100  ? 408.162 7.018   606.332 1.00 102.22 ? 100  LYS A O     1 
ATOM   759   C  CB    . LYS A 1  100  ? 410.526 8.290   607.992 1.00 98.16  ? 100  LYS A CB    1 
ATOM   760   C  CG    . LYS A 1  100  ? 410.342 9.337   606.903 1.00 100.62 ? 100  LYS A CG    1 
ATOM   761   C  CD    . LYS A 1  100  ? 410.780 8.816   605.543 1.00 100.30 ? 100  LYS A CD    1 
ATOM   762   C  CE    . LYS A 1  100  ? 410.746 9.918   604.497 1.00 102.64 ? 100  LYS A CE    1 
ATOM   763   N  NZ    . LYS A 1  100  ? 411.181 9.431   603.160 1.00 102.47 ? 100  LYS A NZ    1 
ATOM   764   N  N     . LYS A 1  101  ? 409.111 5.324   607.467 1.00 119.18 ? 101  LYS A N     1 
ATOM   765   C  CA    . LYS A 1  101  ? 408.664 4.307   606.525 1.00 119.67 ? 101  LYS A CA    1 
ATOM   766   C  C     . LYS A 1  101  ? 407.236 3.868   606.841 1.00 122.66 ? 101  LYS A C     1 
ATOM   767   O  O     . LYS A 1  101  ? 406.434 3.645   605.933 1.00 125.24 ? 101  LYS A O     1 
ATOM   768   C  CB    . LYS A 1  101  ? 409.606 3.103   606.543 1.00 116.45 ? 101  LYS A CB    1 
ATOM   769   C  CG    . LYS A 1  101  ? 411.030 3.420   606.109 1.00 115.18 ? 101  LYS A CG    1 
ATOM   770   C  CD    . LYS A 1  101  ? 411.903 2.173   606.120 1.00 113.82 ? 101  LYS A CD    1 
ATOM   771   C  CE    . LYS A 1  101  ? 413.332 2.491   605.703 1.00 109.70 ? 101  LYS A CE    1 
ATOM   772   N  NZ    . LYS A 1  101  ? 413.400 3.073   604.334 1.00 110.23 ? 101  LYS A NZ    1 
ATOM   773   N  N     . VAL A 1  102  ? 406.920 3.754   608.130 1.00 122.75 ? 102  VAL A N     1 
ATOM   774   C  CA    . VAL A 1  102  ? 405.598 3.300   608.555 1.00 124.41 ? 102  VAL A CA    1 
ATOM   775   C  C     . VAL A 1  102  ? 404.533 4.308   608.135 1.00 128.98 ? 102  VAL A C     1 
ATOM   776   O  O     . VAL A 1  102  ? 403.409 3.938   607.791 1.00 133.58 ? 102  VAL A O     1 
ATOM   777   C  CB    . VAL A 1  102  ? 405.536 3.079   610.082 1.00 123.70 ? 102  VAL A CB    1 
ATOM   778   C  CG1   . VAL A 1  102  ? 404.163 2.570   610.497 1.00 123.89 ? 102  VAL A CG1   1 
ATOM   779   C  CG2   . VAL A 1  102  ? 406.610 2.097   610.517 1.00 120.15 ? 102  VAL A CG2   1 
ATOM   780   N  N     . CYS A 1  103  ? 404.903 5.584   608.144 1.00 128.23 ? 103  CYS A N     1 
ATOM   781   C  CA    . CYS A 1  103  ? 404.002 6.648   607.716 1.00 133.58 ? 103  CYS A CA    1 
ATOM   782   C  C     . CYS A 1  103  ? 403.740 6.586   606.213 1.00 136.11 ? 103  CYS A C     1 
ATOM   783   O  O     . CYS A 1  103  ? 402.794 7.194   605.712 1.00 142.88 ? 103  CYS A O     1 
ATOM   784   C  CB    . CYS A 1  103  ? 404.575 8.015   608.094 1.00 132.83 ? 103  CYS A CB    1 
ATOM   785   S  SG    . CYS A 1  103  ? 404.860 8.248   609.864 1.00 131.52 ? 103  CYS A SG    1 
ATOM   786   N  N     . GLU A 1  104  ? 404.584 5.846   605.499 1.00 121.31 ? 104  GLU A N     1 
ATOM   787   C  CA    . GLU A 1  104  ? 404.444 5.701   604.055 1.00 122.12 ? 104  GLU A CA    1 
ATOM   788   C  C     . GLU A 1  104  ? 403.785 4.375   603.682 1.00 123.44 ? 104  GLU A C     1 
ATOM   789   O  O     . GLU A 1  104  ? 403.490 4.126   602.515 1.00 124.38 ? 104  GLU A O     1 
ATOM   790   C  CB    . GLU A 1  104  ? 405.809 5.823   603.375 1.00 120.15 ? 104  GLU A CB    1 
ATOM   791   C  CG    . GLU A 1  104  ? 406.462 7.187   603.546 1.00 121.29 ? 104  GLU A CG    1 
ATOM   792   C  CD    . GLU A 1  104  ? 407.873 7.238   602.991 1.00 119.51 ? 104  GLU A CD    1 
ATOM   793   O  OE1   . GLU A 1  104  ? 408.465 6.162   602.764 1.00 118.61 ? 104  GLU A OE1   1 
ATOM   794   O  OE2   . GLU A 1  104  ? 408.390 8.355   602.781 1.00 118.62 ? 104  GLU A OE2   1 
ATOM   795   N  N     . CYS A 1  105  ? 403.558 3.527   604.679 1.00 168.02 ? 105  CYS A N     1 
ATOM   796   C  CA    . CYS A 1  105  ? 402.901 2.244   604.454 1.00 169.38 ? 105  CYS A CA    1 
ATOM   797   C  C     . CYS A 1  105  ? 401.418 2.324   604.798 1.00 175.33 ? 105  CYS A C     1 
ATOM   798   O  O     . CYS A 1  105  ? 400.617 1.511   604.335 1.00 177.90 ? 105  CYS A O     1 
ATOM   799   C  CB    . CYS A 1  105  ? 403.573 1.139   605.275 1.00 165.32 ? 105  CYS A CB    1 
ATOM   800   S  SG    . CYS A 1  105  ? 405.283 0.789   604.804 1.00 159.96 ? 105  CYS A SG    1 
ATOM   801   N  N     . VAL A 1  106  ? 401.060 3.308   605.616 1.00 185.93 ? 106  VAL A N     1 
ATOM   802   C  CA    . VAL A 1  106  ? 399.674 3.508   606.020 1.00 190.71 ? 106  VAL A CA    1 
ATOM   803   C  C     . VAL A 1  106  ? 399.263 4.964   605.822 1.00 196.42 ? 106  VAL A C     1 
ATOM   804   O  O     . VAL A 1  106  ? 399.981 5.879   606.226 1.00 195.68 ? 106  VAL A O     1 
ATOM   805   C  CB    . VAL A 1  106  ? 399.450 3.109   607.494 1.00 187.90 ? 106  VAL A CB    1 
ATOM   806   C  CG1   . VAL A 1  106  ? 398.030 3.432   607.923 1.00 193.96 ? 106  VAL A CG1   1 
ATOM   807   C  CG2   . VAL A 1  106  ? 399.749 1.631   607.700 1.00 183.14 ? 106  VAL A CG2   1 
ATOM   808   N  N     . CYS A 1  107  ? 398.108 5.173   605.198 1.00 148.83 ? 107  CYS A N     1 
ATOM   809   C  CA    . CYS A 1  107  ? 397.596 6.519   604.964 1.00 154.16 ? 107  CYS A CA    1 
ATOM   810   C  C     . CYS A 1  107  ? 397.253 7.220   606.276 1.00 156.14 ? 107  CYS A C     1 
ATOM   811   O  O     . CYS A 1  107  ? 397.227 6.596   607.338 1.00 152.80 ? 107  CYS A O     1 
ATOM   812   C  CB    . CYS A 1  107  ? 396.365 6.475   604.056 1.00 160.68 ? 107  CYS A CB    1 
ATOM   813   S  SG    . CYS A 1  107  ? 395.667 8.098   603.662 1.00 172.23 ? 107  CYS A SG    1 
ATOM   814   N  N     . MET A 1  108  ? 396.987 8.519   606.194 1.00 203.59 ? 108  MET A N     1 
ATOM   815   C  CA    . MET A 1  108  ? 396.709 9.319   607.380 1.00 203.26 ? 108  MET A CA    1 
ATOM   816   C  C     . MET A 1  108  ? 395.250 9.211   607.814 1.00 206.56 ? 108  MET A C     1 
ATOM   817   O  O     . MET A 1  108  ? 394.429 8.607   607.123 1.00 209.40 ? 108  MET A O     1 
ATOM   818   C  CB    . MET A 1  108  ? 397.071 10.784  607.127 1.00 205.19 ? 108  MET A CB    1 
ATOM   819   C  CG    . MET A 1  108  ? 398.501 10.995  606.654 1.00 201.86 ? 108  MET A CG    1 
ATOM   820   S  SD    . MET A 1  108  ? 399.724 10.342  607.808 1.00 194.14 ? 108  MET A SD    1 
ATOM   821   C  CE    . MET A 1  108  ? 399.369 11.321  609.265 1.00 193.38 ? 108  MET A CE    1 
ATOM   822   N  N     . HIS A 1  109  ? 394.952 9.797   608.972 1.00 179.57 ? 109  HIS A N     1 
ATOM   823   C  CA    . HIS A 1  109  ? 393.605 9.833   609.546 1.00 183.99 ? 109  HIS A CA    1 
ATOM   824   C  C     . HIS A 1  109  ? 393.032 8.446   609.845 1.00 183.33 ? 109  HIS A C     1 
ATOM   825   O  O     . HIS A 1  109  ? 392.743 8.129   610.999 1.00 182.22 ? 109  HIS A O     1 
ATOM   826   C  CB    . HIS A 1  109  ? 392.649 10.599  608.627 1.00 189.09 ? 109  HIS A CB    1 
ATOM   827   C  CG    . HIS A 1  109  ? 391.311 10.870  609.242 1.00 193.00 ? 109  HIS A CG    1 
ATOM   828   N  ND1   . HIS A 1  109  ? 390.226 10.041  609.060 1.00 196.53 ? 109  HIS A ND1   1 
ATOM   829   C  CD2   . HIS A 1  109  ? 390.887 11.875  610.044 1.00 192.63 ? 109  HIS A CD2   1 
ATOM   830   C  CE1   . HIS A 1  109  ? 389.189 10.525  609.719 1.00 198.11 ? 109  HIS A CE1   1 
ATOM   831   N  NE2   . HIS A 1  109  ? 389.563 11.638  610.325 1.00 196.20 ? 109  HIS A NE2   1 
ATOM   832   N  N     . CYS A 1  110  ? 392.862 7.627   608.810 1.00 174.58 ? 110  CYS A N     1 
ATOM   833   C  CA    . CYS A 1  110  ? 392.271 6.301   608.973 1.00 173.09 ? 110  CYS A CA    1 
ATOM   834   C  C     . CYS A 1  110  ? 393.173 5.366   609.776 1.00 169.31 ? 110  CYS A C     1 
ATOM   835   O  O     . CYS A 1  110  ? 393.097 5.321   611.005 1.00 166.28 ? 110  CYS A O     1 
ATOM   836   C  CB    . CYS A 1  110  ? 391.960 5.683   607.607 1.00 172.78 ? 110  CYS A CB    1 
ATOM   837   S  SG    . CYS A 1  110  ? 393.391 5.482   606.522 1.00 174.20 ? 110  CYS A SG    1 
ATOM   838   N  N     . GLY A 1  111  ? 394.020 4.617   609.079 1.00 223.00 ? 111  GLY A N     1 
ATOM   839   C  CA    . GLY A 1  111  ? 394.919 3.681   609.729 1.00 216.56 ? 111  GLY A CA    1 
ATOM   840   C  C     . GLY A 1  111  ? 394.854 2.295   609.119 1.00 213.58 ? 111  GLY A C     1 
ATOM   841   O  O     . GLY A 1  111  ? 394.804 1.293   609.832 1.00 210.54 ? 111  GLY A O     1 
ATOM   842   N  N     . LYS A 1  112  ? 394.858 2.239   607.791 1.00 151.61 ? 112  LYS A N     1 
ATOM   843   C  CA    . LYS A 1  112  ? 394.758 0.973   607.074 1.00 150.62 ? 112  LYS A CA    1 
ATOM   844   C  C     . LYS A 1  112  ? 395.842 0.865   606.003 1.00 147.27 ? 112  LYS A C     1 
ATOM   845   O  O     . LYS A 1  112  ? 396.337 1.877   605.505 1.00 145.50 ? 112  LYS A O     1 
ATOM   846   C  CB    . LYS A 1  112  ? 393.369 0.829   606.440 1.00 154.37 ? 112  LYS A CB    1 
ATOM   847   C  CG    . LYS A 1  112  ? 393.066 -0.558  605.886 1.00 152.30 ? 112  LYS A CG    1 
ATOM   848   C  CD    . LYS A 1  112  ? 391.849 -0.544  604.976 1.00 151.26 ? 112  LYS A CD    1 
ATOM   849   C  CE    . LYS A 1  112  ? 391.640 -1.903  604.328 1.00 149.24 ? 112  LYS A CE    1 
ATOM   850   N  NZ    . LYS A 1  112  ? 390.556 -1.879  603.308 1.00 153.36 ? 112  LYS A NZ    1 
ATOM   851   N  N     . LEU A 1  113  ? 396.213 -0.365  605.661 1.00 160.22 ? 113  LEU A N     1 
ATOM   852   C  CA    . LEU A 1  113  ? 397.150 -0.614  604.572 1.00 159.07 ? 113  LEU A CA    1 
ATOM   853   C  C     . LEU A 1  113  ? 396.544 -0.175  603.243 1.00 162.79 ? 113  LEU A C     1 
ATOM   854   O  O     . LEU A 1  113  ? 395.326 -0.213  603.065 1.00 165.68 ? 113  LEU A O     1 
ATOM   855   C  CB    . LEU A 1  113  ? 397.533 -2.094  604.518 1.00 154.50 ? 113  LEU A CB    1 
ATOM   856   C  CG    . LEU A 1  113  ? 398.125 -2.692  605.796 1.00 149.86 ? 113  LEU A CG    1 
ATOM   857   C  CD1   . LEU A 1  113  ? 398.403 -4.175  605.614 1.00 147.58 ? 113  LEU A CD1   1 
ATOM   858   C  CD2   . LEU A 1  113  ? 399.390 -1.951  606.201 1.00 145.50 ? 113  LEU A CD2   1 
ATOM   859   N  N     . LEU A 1  114  ? 397.396 0.241   602.311 1.00 148.59 ? 114  LEU A N     1 
ATOM   860   C  CA    . LEU A 1  114  ? 396.931 0.743   601.022 1.00 151.45 ? 114  LEU A CA    1 
ATOM   861   C  C     . LEU A 1  114  ? 396.394 -0.376  600.133 1.00 155.23 ? 114  LEU A C     1 
ATOM   862   O  O     . LEU A 1  114  ? 395.267 -0.301  599.640 1.00 160.89 ? 114  LEU A O     1 
ATOM   863   C  CB    . LEU A 1  114  ? 398.055 1.490   600.300 1.00 149.72 ? 114  LEU A CB    1 
ATOM   864   C  CG    . LEU A 1  114  ? 398.235 2.973   600.644 1.00 151.90 ? 114  LEU A CG    1 
ATOM   865   C  CD1   . LEU A 1  114  ? 396.940 3.737   600.404 1.00 159.57 ? 114  LEU A CD1   1 
ATOM   866   C  CD2   . LEU A 1  114  ? 398.726 3.173   602.072 1.00 148.96 ? 114  LEU A CD2   1 
ATOM   867   N  N     . LEU A 1  115  ? 397.202 -1.411  599.931 1.00 184.15 ? 115  LEU A N     1 
ATOM   868   C  CA    . LEU A 1  115  ? 396.800 -2.539  599.098 1.00 185.99 ? 115  LEU A CA    1 
ATOM   869   C  C     . LEU A 1  115  ? 396.503 -3.773  599.942 1.00 183.59 ? 115  LEU A C     1 
ATOM   870   O  O     . LEU A 1  115  ? 397.176 -4.032  600.939 1.00 180.51 ? 115  LEU A O     1 
ATOM   871   C  CB    . LEU A 1  115  ? 397.883 -2.854  598.065 1.00 184.14 ? 115  LEU A CB    1 
ATOM   872   C  CG    . LEU A 1  115  ? 398.210 -1.735  597.075 1.00 185.78 ? 115  LEU A CG    1 
ATOM   873   C  CD1   . LEU A 1  115  ? 399.309 -2.168  596.117 1.00 183.27 ? 115  LEU A CD1   1 
ATOM   874   C  CD2   . LEU A 1  115  ? 396.963 -1.316  596.312 1.00 191.32 ? 115  LEU A CD2   1 
ATOM   875   N  N     . ASP A 1  116  ? 395.490 -4.531  599.536 1.00 150.42 ? 116  ASP A N     1 
ATOM   876   C  CA    . ASP A 1  116  ? 395.091 -5.732  600.260 1.00 149.86 ? 116  ASP A CA    1 
ATOM   877   C  C     . ASP A 1  116  ? 395.229 -6.975  599.388 1.00 150.05 ? 116  ASP A C     1 
ATOM   878   O  O     . ASP A 1  116  ? 396.056 -7.018  598.476 1.00 148.49 ? 116  ASP A O     1 
ATOM   879   C  CB    . ASP A 1  116  ? 393.651 -5.603  600.762 1.00 151.64 ? 116  ASP A CB    1 
ATOM   880   C  CG    . ASP A 1  116  ? 393.475 -4.459  601.740 1.00 150.06 ? 116  ASP A CG    1 
ATOM   881   O  OD1   . ASP A 1  116  ? 394.390 -4.231  602.560 1.00 147.46 ? 116  ASP A OD1   1 
ATOM   882   O  OD2   . ASP A 1  116  ? 392.424 -3.787  601.688 1.00 151.66 ? 116  ASP A OD2   1 
ATOM   883   N  N     . GLU A 1  117  ? 394.411 -7.983  599.674 1.00 189.63 ? 117  GLU A N     1 
ATOM   884   C  CA    . GLU A 1  117  ? 394.411 -9.217  598.898 1.00 190.62 ? 117  GLU A CA    1 
ATOM   885   C  C     . GLU A 1  117  ? 393.714 -9.015  597.556 1.00 194.86 ? 117  GLU A C     1 
ATOM   886   O  O     . GLU A 1  117  ? 393.760 -9.883  596.685 1.00 195.01 ? 117  GLU A O     1 
ATOM   887   C  CB    . GLU A 1  117  ? 393.735 -10.349 599.678 1.00 189.46 ? 117  GLU A CB    1 
ATOM   888   C  CG    . GLU A 1  117  ? 394.538 -10.870 600.864 1.00 184.18 ? 117  GLU A CG    1 
ATOM   889   C  CD    . GLU A 1  117  ? 394.518 -9.930  602.054 1.00 183.56 ? 117  GLU A CD    1 
ATOM   890   O  OE1   . GLU A 1  117  ? 393.673 -9.011  602.076 1.00 186.04 ? 117  GLU A OE1   1 
ATOM   891   O  OE2   . GLU A 1  117  ? 395.350 -10.111 602.968 1.00 179.83 ? 117  GLU A OE2   1 
ATOM   892   N  N     . HIS A 1  118  ? 393.065 -7.866  597.399 1.00 147.04 ? 118  HIS A N     1 
ATOM   893   C  CA    . HIS A 1  118  ? 392.420 -7.517  596.140 1.00 149.10 ? 118  HIS A CA    1 
ATOM   894   C  C     . HIS A 1  118  ? 393.472 -7.218  595.079 1.00 148.24 ? 118  HIS A C     1 
ATOM   895   O  O     . HIS A 1  118  ? 393.262 -7.467  593.892 1.00 152.22 ? 118  HIS A O     1 
ATOM   896   C  CB    . HIS A 1  118  ? 391.490 -6.315  596.323 1.00 150.51 ? 118  HIS A CB    1 
ATOM   897   C  CG    . HIS A 1  118  ? 390.456 -6.508  597.388 1.00 151.43 ? 118  HIS A CG    1 
ATOM   898   N  ND1   . HIS A 1  118  ? 390.753 -6.456  598.733 1.00 149.30 ? 118  HIS A ND1   1 
ATOM   899   C  CD2   . HIS A 1  118  ? 389.127 -6.754  597.306 1.00 153.37 ? 118  HIS A CD2   1 
ATOM   900   C  CE1   . HIS A 1  118  ? 389.652 -6.661  599.433 1.00 149.73 ? 118  HIS A CE1   1 
ATOM   901   N  NE2   . HIS A 1  118  ? 388.651 -6.845  598.592 1.00 153.15 ? 118  HIS A NE2   1 
ATOM   902   N  N     . ASN A 1  119  ? 394.605 -6.681  595.520 1.00 155.56 ? 119  ASN A N     1 
ATOM   903   C  CA    . ASN A 1  119  ? 395.726 -6.406  594.631 1.00 153.06 ? 119  ASN A CA    1 
ATOM   904   C  C     . ASN A 1  119  ? 396.467 -7.694  594.286 1.00 152.31 ? 119  ASN A C     1 
ATOM   905   O  O     . ASN A 1  119  ? 396.335 -8.698  594.985 1.00 149.77 ? 119  ASN A O     1 
ATOM   906   C  CB    . ASN A 1  119  ? 396.679 -5.395  595.273 1.00 147.68 ? 119  ASN A CB    1 
ATOM   907   C  CG    . ASN A 1  119  ? 397.697 -4.846  594.292 1.00 145.62 ? 119  ASN A CG    1 
ATOM   908   O  OD1   . ASN A 1  119  ? 398.770 -5.421  594.105 1.00 141.63 ? 119  ASN A OD1   1 
ATOM   909   N  ND2   . ASN A 1  119  ? 397.365 -3.727  593.659 1.00 147.12 ? 119  ASN A ND2   1 
ATOM   910   N  N     . GLU A 1  120  ? 397.243 -7.667  593.207 1.00 175.56 ? 120  GLU A N     1 
ATOM   911   C  CA    . GLU A 1  120  ? 397.962 -8.854  592.757 1.00 173.99 ? 120  GLU A CA    1 
ATOM   912   C  C     . GLU A 1  120  ? 399.371 -8.929  593.341 1.00 168.79 ? 120  GLU A C     1 
ATOM   913   O  O     . GLU A 1  120  ? 399.834 -10.003 593.727 1.00 166.65 ? 120  GLU A O     1 
ATOM   914   C  CB    . GLU A 1  120  ? 398.030 -8.886  591.228 1.00 177.63 ? 120  GLU A CB    1 
ATOM   915   C  CG    . GLU A 1  120  ? 398.773 -10.088 590.663 1.00 176.88 ? 120  GLU A CG    1 
ATOM   916   C  CD    . GLU A 1  120  ? 398.095 -11.405 590.993 1.00 178.43 ? 120  GLU A CD    1 
ATOM   917   O  OE1   . GLU A 1  120  ? 396.855 -11.420 591.138 1.00 182.41 ? 120  GLU A OE1   1 
ATOM   918   O  OE2   . GLU A 1  120  ? 398.805 -12.427 591.109 1.00 174.77 ? 120  GLU A OE2   1 
ATOM   919   N  N     . LEU A 1  121  ? 400.049 -7.787  593.405 1.00 152.57 ? 121  LEU A N     1 
ATOM   920   C  CA    . LEU A 1  121  ? 401.426 -7.745  593.886 1.00 145.73 ? 121  LEU A CA    1 
ATOM   921   C  C     . LEU A 1  121  ? 401.509 -7.770  595.410 1.00 142.08 ? 121  LEU A C     1 
ATOM   922   O  O     . LEU A 1  121  ? 402.515 -8.199  595.976 1.00 138.89 ? 121  LEU A O     1 
ATOM   923   C  CB    . LEU A 1  121  ? 402.140 -6.502  593.349 1.00 143.53 ? 121  LEU A CB    1 
ATOM   924   C  CG    . LEU A 1  121  ? 402.339 -6.440  591.833 1.00 146.14 ? 121  LEU A CG    1 
ATOM   925   C  CD1   . LEU A 1  121  ? 403.093 -5.179  591.445 1.00 141.23 ? 121  LEU A CD1   1 
ATOM   926   C  CD2   . LEU A 1  121  ? 403.067 -7.680  591.336 1.00 142.54 ? 121  LEU A CD2   1 
ATOM   927   N  N     . MET A 1  122  ? 400.452 -7.308  596.070 1.00 188.91 ? 122  MET A N     1 
ATOM   928   C  CA    . MET A 1  122  ? 400.428 -7.274  597.528 1.00 187.02 ? 122  MET A CA    1 
ATOM   929   C  C     . MET A 1  122  ? 400.251 -8.679  598.097 1.00 186.56 ? 122  MET A C     1 
ATOM   930   O  O     . MET A 1  122  ? 400.702 -8.972  599.205 1.00 182.57 ? 122  MET A O     1 
ATOM   931   C  CB    . MET A 1  122  ? 399.316 -6.349  598.028 1.00 191.28 ? 122  MET A CB    1 
ATOM   932   C  CG    . MET A 1  122  ? 399.334 -6.112  599.531 1.00 190.37 ? 122  MET A CG    1 
ATOM   933   S  SD    . MET A 1  122  ? 400.944 -5.562  600.134 1.00 183.76 ? 122  MET A SD    1 
ATOM   934   C  CE    . MET A 1  122  ? 401.158 -4.041  599.212 1.00 185.52 ? 122  MET A CE    1 
ATOM   935   N  N     . ARG A 1  123  ? 399.597 -9.545  597.330 1.00 177.91 ? 123  ARG A N     1 
ATOM   936   C  CA    . ARG A 1  123  ? 399.447 -10.945 597.711 1.00 177.74 ? 123  ARG A CA    1 
ATOM   937   C  C     . ARG A 1  123  ? 400.800 -11.648 597.707 1.00 173.15 ? 123  ARG A C     1 
ATOM   938   O  O     . ARG A 1  123  ? 401.004 -12.632 598.417 1.00 170.30 ? 123  ARG A O     1 
ATOM   939   C  CB    . ARG A 1  123  ? 398.481 -11.664 596.767 1.00 182.57 ? 123  ARG A CB    1 
ATOM   940   C  CG    . ARG A 1  123  ? 397.033 -11.226 596.895 1.00 184.90 ? 123  ARG A CG    1 
ATOM   941   C  CD    . ARG A 1  123  ? 396.152 -11.885 595.840 1.00 188.18 ? 123  ARG A CD    1 
ATOM   942   N  NE    . ARG A 1  123  ? 396.149 -13.343 595.942 1.00 188.29 ? 123  ARG A NE    1 
ATOM   943   C  CZ    . ARG A 1  123  ? 396.830 -14.151 595.135 1.00 188.11 ? 123  ARG A CZ    1 
ATOM   944   N  NH1   . ARG A 1  123  ? 397.572 -13.646 594.159 1.00 189.39 ? 123  ARG A NH1   1 
ATOM   945   N  NH2   . ARG A 1  123  ? 396.767 -15.465 595.302 1.00 183.29 ? 123  ARG A NH2   1 
ATOM   946   N  N     . GLN A 1  124  ? 401.720 -11.130 596.900 1.00 150.30 ? 124  GLN A N     1 
ATOM   947   C  CA    . GLN A 1  124  ? 403.053 -11.705 596.779 1.00 146.50 ? 124  GLN A CA    1 
ATOM   948   C  C     . GLN A 1  124  ? 404.015 -11.080 597.784 1.00 143.69 ? 124  GLN A C     1 
ATOM   949   O  O     . GLN A 1  124  ? 405.008 -11.695 598.171 1.00 140.72 ? 124  GLN A O     1 
ATOM   950   C  CB    . GLN A 1  124  ? 403.583 -11.520 595.357 1.00 145.05 ? 124  GLN A CB    1 
ATOM   951   C  CG    . GLN A 1  124  ? 402.656 -12.060 594.280 1.00 148.51 ? 124  GLN A CG    1 
ATOM   952   C  CD    . GLN A 1  124  ? 403.127 -11.721 592.880 1.00 151.90 ? 124  GLN A CD    1 
ATOM   953   O  OE1   . GLN A 1  124  ? 404.166 -11.086 592.699 1.00 150.08 ? 124  GLN A OE1   1 
ATOM   954   N  NE2   . GLN A 1  124  ? 402.363 -12.144 591.880 1.00 156.49 ? 124  GLN A NE2   1 
ATOM   955   N  N     . ALA A 1  125  ? 403.712 -9.856  598.203 1.00 120.68 ? 125  ALA A N     1 
ATOM   956   C  CA    . ALA A 1  125  ? 404.564 -9.135  599.141 1.00 115.56 ? 125  ALA A CA    1 
ATOM   957   C  C     . ALA A 1  125  ? 404.293 -9.558  600.582 1.00 113.95 ? 125  ALA A C     1 
ATOM   958   O  O     . ALA A 1  125  ? 405.211 -9.641  601.398 1.00 111.79 ? 125  ALA A O     1 
ATOM   959   C  CB    . ALA A 1  125  ? 404.368 -7.634  598.985 1.00 116.22 ? 125  ALA A CB    1 
ATOM   960   N  N     . LEU A 1  126  ? 403.028 -9.827  600.888 1.00 148.14 ? 126  LEU A N     1 
ATOM   961   C  CA    . LEU A 1  126  ? 402.627 -10.202 602.240 1.00 147.71 ? 126  LEU A CA    1 
ATOM   962   C  C     . LEU A 1  126  ? 402.798 -11.699 602.486 1.00 146.32 ? 126  LEU A C     1 
ATOM   963   O  O     . LEU A 1  126  ? 402.513 -12.194 603.576 1.00 145.32 ? 126  LEU A O     1 
ATOM   964   C  CB    . LEU A 1  126  ? 401.175 -9.792  602.496 1.00 150.00 ? 126  LEU A CB    1 
ATOM   965   C  CG    . LEU A 1  126  ? 400.926 -8.834  603.663 1.00 149.49 ? 126  LEU A CG    1 
ATOM   966   C  CD1   . LEU A 1  126  ? 399.455 -8.453  603.740 1.00 152.72 ? 126  LEU A CD1   1 
ATOM   967   C  CD2   . LEU A 1  126  ? 401.393 -9.447  604.974 1.00 144.99 ? 126  LEU A CD2   1 
ATOM   968   N  N     . ALA A 1  127  ? 403.267 -12.414 601.468 1.00 125.05 ? 127  ALA A N     1 
ATOM   969   C  CA    . ALA A 1  127  ? 403.441 -13.859 601.564 1.00 123.48 ? 127  ALA A CA    1 
ATOM   970   C  C     . ALA A 1  127  ? 404.754 -14.224 602.250 1.00 121.65 ? 127  ALA A C     1 
ATOM   971   O  O     . ALA A 1  127  ? 404.945 -15.364 602.676 1.00 120.44 ? 127  ALA A O     1 
ATOM   972   C  CB    . ALA A 1  127  ? 403.374 -14.490 600.181 1.00 124.03 ? 127  ALA A CB    1 
ATOM   973   N  N     . ILE A 1  128  ? 405.654 -13.252 602.355 1.00 148.73 ? 128  ILE A N     1 
ATOM   974   C  CA    . ILE A 1  128  ? 406.956 -13.474 602.974 1.00 144.64 ? 128  ILE A CA    1 
ATOM   975   C  C     . ILE A 1  128  ? 406.827 -13.625 604.488 1.00 143.57 ? 128  ILE A C     1 
ATOM   976   O  O     . ILE A 1  128  ? 406.176 -12.814 605.146 1.00 145.27 ? 128  ILE A O     1 
ATOM   977   C  CB    . ILE A 1  128  ? 407.930 -12.323 602.660 1.00 141.26 ? 128  ILE A CB    1 
ATOM   978   C  CG1   . ILE A 1  128  ? 407.914 -12.006 601.163 1.00 140.22 ? 128  ILE A CG1   1 
ATOM   979   C  CG2   . ILE A 1  128  ? 409.336 -12.669 603.129 1.00 138.74 ? 128  ILE A CG2   1 
ATOM   980   C  CD1   . ILE A 1  128  ? 408.797 -10.843 600.776 1.00 136.95 ? 128  ILE A CD1   1 
ATOM   981   N  N     . LYS A 1  129  ? 407.450 -14.665 605.034 1.00 145.86 ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A 1  129  ? 407.377 -14.933 606.467 1.00 146.69 ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A 1  129  ? 408.407 -14.123 607.251 1.00 144.17 ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A 1  129  ? 408.191 -13.800 608.420 1.00 143.70 ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A 1  129  ? 407.564 -16.427 606.745 1.00 146.49 ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A 1  129  ? 406.471 -17.312 606.163 1.00 151.36 ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A 1  129  ? 406.538 -18.723 606.728 1.00 150.78 ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A 1  129  ? 407.878 -19.380 606.436 1.00 143.78 ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A 1  129  ? 408.116 -19.533 604.975 1.00 143.74 ? 129  LYS A NZ    1 
ATOM   990   N  N     . ASP A 1  130  ? 409.525 -13.800 606.609 1.00 133.02 ? 130  ASP A N     1 
ATOM   991   C  CA    . ASP A 1  130  ? 410.570 -13.011 607.252 1.00 130.05 ? 130  ASP A CA    1 
ATOM   992   C  C     . ASP A 1  130  ? 410.131 -11.557 607.390 1.00 130.39 ? 130  ASP A C     1 
ATOM   993   O  O     . ASP A 1  130  ? 409.770 -10.916 606.405 1.00 132.54 ? 130  ASP A O     1 
ATOM   994   C  CB    . ASP A 1  130  ? 411.878 -13.098 606.463 1.00 127.99 ? 130  ASP A CB    1 
ATOM   995   C  CG    . ASP A 1  130  ? 413.041 -12.452 607.190 1.00 126.15 ? 130  ASP A CG    1 
ATOM   996   O  OD1   . ASP A 1  130  ? 413.021 -12.421 608.438 1.00 125.31 ? 130  ASP A OD1   1 
ATOM   997   O  OD2   . ASP A 1  130  ? 413.977 -11.976 606.514 1.00 125.71 ? 130  ASP A OD2   1 
ATOM   998   N  N     . SER A 1  131  ? 410.169 -11.045 608.617 1.00 116.99 ? 131  SER A N     1 
ATOM   999   C  CA    . SER A 1  131  ? 409.669 -9.706  608.924 1.00 118.44 ? 131  SER A CA    1 
ATOM   1000  C  C     . SER A 1  131  ? 410.382 -8.603  608.142 1.00 119.12 ? 131  SER A C     1 
ATOM   1001  O  O     . SER A 1  131  ? 409.736 -7.731  607.558 1.00 122.52 ? 131  SER A O     1 
ATOM   1002  C  CB    . SER A 1  131  ? 409.791 -9.432  610.425 1.00 116.77 ? 131  SER A CB    1 
ATOM   1003  O  OG    . SER A 1  131  ? 408.999 -10.336 611.176 1.00 116.12 ? 131  SER A OG    1 
ATOM   1004  N  N     . LYS A 1  132  ? 411.711 -8.645  608.135 1.00 107.93 ? 132  LYS A N     1 
ATOM   1005  C  CA    . LYS A 1  132  ? 412.509 -7.623  607.463 1.00 108.37 ? 132  LYS A CA    1 
ATOM   1006  C  C     . LYS A 1  132  ? 412.273 -7.614  605.954 1.00 109.79 ? 132  LYS A C     1 
ATOM   1007  O  O     . LYS A 1  132  ? 412.087 -6.554  605.353 1.00 110.20 ? 132  LYS A O     1 
ATOM   1008  C  CB    . LYS A 1  132  ? 413.999 -7.826  607.757 1.00 105.93 ? 132  LYS A CB    1 
ATOM   1009  C  CG    . LYS A 1  132  ? 414.507 -7.092  608.996 1.00 102.81 ? 132  LYS A CG    1 
ATOM   1010  C  CD    . LYS A 1  132  ? 413.870 -7.595  610.289 1.00 101.53 ? 132  LYS A CD    1 
ATOM   1011  C  CE    . LYS A 1  132  ? 414.493 -8.902  610.769 1.00 97.90  ? 132  LYS A CE    1 
ATOM   1012  N  NZ    . LYS A 1  132  ? 414.032 -10.095 610.003 1.00 100.20 ? 132  LYS A NZ    1 
ATOM   1013  N  N     . LYS A 1  133  ? 412.281 -8.797  605.347 1.00 108.01 ? 133  LYS A N     1 
ATOM   1014  C  CA    . LYS A 1  133  ? 412.056 -8.924  603.911 1.00 108.69 ? 133  LYS A CA    1 
ATOM   1015  C  C     . LYS A 1  133  ? 410.627 -8.541  603.536 1.00 111.59 ? 133  LYS A C     1 
ATOM   1016  O  O     . LYS A 1  133  ? 410.392 -7.941  602.488 1.00 111.93 ? 133  LYS A O     1 
ATOM   1017  C  CB    . LYS A 1  133  ? 412.357 -10.350 603.442 1.00 106.84 ? 133  LYS A CB    1 
ATOM   1018  C  CG    . LYS A 1  133  ? 413.762 -10.547 602.885 1.00 104.71 ? 133  LYS A CG    1 
ATOM   1019  C  CD    . LYS A 1  133  ? 414.831 -10.237 603.921 1.00 104.44 ? 133  LYS A CD    1 
ATOM   1020  C  CE    . LYS A 1  133  ? 416.225 -10.463 603.359 1.00 102.32 ? 133  LYS A CE    1 
ATOM   1021  N  NZ    . LYS A 1  133  ? 416.422 -11.869 602.911 1.00 93.31  ? 133  LYS A NZ    1 
ATOM   1022  N  N     . ARG A 1  134  ? 409.679 -8.896  604.398 1.00 144.71 ? 134  ARG A N     1 
ATOM   1023  C  CA    . ARG A 1  134  ? 408.277 -8.552  604.192 1.00 145.66 ? 134  ARG A CA    1 
ATOM   1024  C  C     . ARG A 1  134  ? 408.088 -7.040  604.201 1.00 146.75 ? 134  ARG A C     1 
ATOM   1025  O  O     . ARG A 1  134  ? 407.453 -6.475  603.309 1.00 150.41 ? 134  ARG A O     1 
ATOM   1026  C  CB    . ARG A 1  134  ? 407.405 -9.199  605.269 1.00 145.64 ? 134  ARG A CB    1 
ATOM   1027  C  CG    . ARG A 1  134  ? 405.920 -8.909  605.147 1.00 148.38 ? 134  ARG A CG    1 
ATOM   1028  C  CD    . ARG A 1  134  ? 405.190 -9.360  606.401 1.00 150.33 ? 134  ARG A CD    1 
ATOM   1029  N  NE    . ARG A 1  134  ? 405.443 -10.765 606.706 1.00 149.22 ? 134  ARG A NE    1 
ATOM   1030  C  CZ    . ARG A 1  134  ? 405.223 -11.325 607.891 1.00 149.55 ? 134  ARG A CZ    1 
ATOM   1031  N  NH1   . ARG A 1  134  ? 404.749 -10.596 608.892 1.00 149.80 ? 134  ARG A NH1   1 
ATOM   1032  N  NH2   . ARG A 1  134  ? 405.482 -12.611 608.078 1.00 148.39 ? 134  ARG A NH2   1 
ATOM   1033  N  N     . PHE A 1  135  ? 408.651 -6.392  605.217 1.00 113.10 ? 135  PHE A N     1 
ATOM   1034  C  CA    . PHE A 1  135  ? 408.568 -4.943  605.353 1.00 113.22 ? 135  PHE A CA    1 
ATOM   1035  C  C     . PHE A 1  135  ? 409.258 -4.240  604.189 1.00 114.83 ? 135  PHE A C     1 
ATOM   1036  O  O     . PHE A 1  135  ? 408.751 -3.250  603.662 1.00 117.32 ? 135  PHE A O     1 
ATOM   1037  C  CB    . PHE A 1  135  ? 409.185 -4.497  606.681 1.00 109.98 ? 135  PHE A CB    1 
ATOM   1038  C  CG    . PHE A 1  135  ? 409.050 -3.025  606.950 1.00 112.81 ? 135  PHE A CG    1 
ATOM   1039  C  CD1   . PHE A 1  135  ? 410.084 -2.152  606.651 1.00 113.24 ? 135  PHE A CD1   1 
ATOM   1040  C  CD2   . PHE A 1  135  ? 407.889 -2.514  607.506 1.00 116.32 ? 135  PHE A CD2   1 
ATOM   1041  C  CE1   . PHE A 1  135  ? 409.962 -0.798  606.899 1.00 114.50 ? 135  PHE A CE1   1 
ATOM   1042  C  CE2   . PHE A 1  135  ? 407.760 -1.161  607.756 1.00 118.37 ? 135  PHE A CE2   1 
ATOM   1043  C  CZ    . PHE A 1  135  ? 408.798 -0.302  607.452 1.00 116.91 ? 135  PHE A CZ    1 
ATOM   1044  N  N     . ALA A 1  136  ? 410.414 -4.762  603.789 1.00 91.94  ? 136  ALA A N     1 
ATOM   1045  C  CA    . ALA A 1  136  ? 411.176 -4.184  602.688 1.00 92.05  ? 136  ALA A CA    1 
ATOM   1046  C  C     . ALA A 1  136  ? 410.428 -4.320  601.366 1.00 94.58  ? 136  ALA A C     1 
ATOM   1047  O  O     . ALA A 1  136  ? 410.495 -3.436  600.512 1.00 96.05  ? 136  ALA A O     1 
ATOM   1048  C  CB    . ALA A 1  136  ? 412.545 -4.838  602.591 1.00 89.17  ? 136  ALA A CB    1 
ATOM   1049  N  N     . ALA A 1  137  ? 409.715 -5.430  601.205 1.00 142.29 ? 137  ALA A N     1 
ATOM   1050  C  CA    . ALA A 1  137  ? 408.973 -5.693  599.978 1.00 144.78 ? 137  ALA A CA    1 
ATOM   1051  C  C     . ALA A 1  137  ? 407.702 -4.853  599.904 1.00 148.77 ? 137  ALA A C     1 
ATOM   1052  O  O     . ALA A 1  137  ? 407.341 -4.353  598.839 1.00 153.35 ? 137  ALA A O     1 
ATOM   1053  C  CB    . ALA A 1  137  ? 408.635 -7.172  599.870 1.00 143.73 ? 137  ALA A CB    1 
ATOM   1054  N  N     . ILE A 1  138  ? 407.026 -4.702  601.039 1.00 149.76 ? 138  ILE A N     1 
ATOM   1055  C  CA    . ILE A 1  138  ? 405.780 -3.946  601.084 1.00 152.83 ? 138  ILE A CA    1 
ATOM   1056  C  C     . ILE A 1  138  ? 406.035 -2.442  600.986 1.00 154.91 ? 138  ILE A C     1 
ATOM   1057  O  O     . ILE A 1  138  ? 405.291 -1.725  600.315 1.00 159.79 ? 138  ILE A O     1 
ATOM   1058  C  CB    . ILE A 1  138  ? 404.983 -4.257  602.370 1.00 152.18 ? 138  ILE A CB    1 
ATOM   1059  C  CG1   . ILE A 1  138  ? 404.494 -5.707  602.344 1.00 151.87 ? 138  ILE A CG1   1 
ATOM   1060  C  CG2   . ILE A 1  138  ? 403.798 -3.315  602.520 1.00 155.92 ? 138  ILE A CG2   1 
ATOM   1061  C  CD1   . ILE A 1  138  ? 403.567 -6.062  603.481 1.00 149.15 ? 138  ILE A CD1   1 
ATOM   1062  N  N     . TRP A 1  139  ? 407.096 -1.974  601.637 1.00 134.91 ? 139  TRP A N     1 
ATOM   1063  C  CA    . TRP A 1  139  ? 407.428 -0.550  601.648 1.00 138.50 ? 139  TRP A CA    1 
ATOM   1064  C  C     . TRP A 1  139  ? 407.630 0.015   600.244 1.00 141.19 ? 139  TRP A C     1 
ATOM   1065  O  O     . TRP A 1  139  ? 407.256 1.154   599.966 1.00 144.04 ? 139  TRP A O     1 
ATOM   1066  C  CB    . TRP A 1  139  ? 408.683 -0.300  602.487 1.00 136.83 ? 139  TRP A CB    1 
ATOM   1067  C  CG    . TRP A 1  139  ? 409.092 1.142   602.547 1.00 138.60 ? 139  TRP A CG    1 
ATOM   1068  C  CD1   . TRP A 1  139  ? 408.583 2.105   603.368 1.00 138.50 ? 139  TRP A CD1   1 
ATOM   1069  C  CD2   . TRP A 1  139  ? 410.101 1.782   601.755 1.00 137.69 ? 139  TRP A CD2   1 
ATOM   1070  N  NE1   . TRP A 1  139  ? 409.210 3.306   603.136 1.00 137.74 ? 139  TRP A NE1   1 
ATOM   1071  C  CE2   . TRP A 1  139  ? 410.146 3.134   602.150 1.00 137.76 ? 139  TRP A CE2   1 
ATOM   1072  C  CE3   . TRP A 1  139  ? 410.969 1.344   600.750 1.00 135.48 ? 139  TRP A CE3   1 
ATOM   1073  C  CZ2   . TRP A 1  139  ? 411.024 4.051   601.576 1.00 136.88 ? 139  TRP A CZ2   1 
ATOM   1074  C  CZ3   . TRP A 1  139  ? 411.841 2.257   600.181 1.00 134.70 ? 139  TRP A CZ3   1 
ATOM   1075  C  CH2   . TRP A 1  139  ? 411.861 3.594   600.596 1.00 136.12 ? 139  TRP A CH2   1 
ATOM   1076  N  N     . THR A 1  140  ? 408.221 -0.785  599.362 1.00 129.33 ? 140  THR A N     1 
ATOM   1077  C  CA    . THR A 1  140  ? 408.475 -0.353  597.992 1.00 131.68 ? 140  THR A CA    1 
ATOM   1078  C  C     . THR A 1  140  ? 407.199 -0.369  597.154 1.00 134.43 ? 140  THR A C     1 
ATOM   1079  O  O     . THR A 1  140  ? 407.061 0.400   596.202 1.00 136.81 ? 140  THR A O     1 
ATOM   1080  C  CB    . THR A 1  140  ? 409.536 -1.237  597.310 1.00 131.02 ? 140  THR A CB    1 
ATOM   1081  O  OG1   . THR A 1  140  ? 409.101 -2.602  597.314 1.00 129.39 ? 140  THR A OG1   1 
ATOM   1082  C  CG2   . THR A 1  140  ? 410.867 -1.132  598.039 1.00 127.05 ? 140  THR A CG2   1 
ATOM   1083  N  N     . LEU A 1  141  ? 406.268 -1.247  597.514 1.00 169.64 ? 141  LEU A N     1 
ATOM   1084  C  CA    . LEU A 1  141  ? 405.013 -1.374  596.782 1.00 173.79 ? 141  LEU A CA    1 
ATOM   1085  C  C     . LEU A 1  141  ? 403.843 -0.793  597.569 1.00 176.44 ? 141  LEU A C     1 
ATOM   1086  O  O     . LEU A 1  141  ? 402.774 -1.398  597.642 1.00 178.39 ? 141  LEU A O     1 
ATOM   1087  C  CB    . LEU A 1  141  ? 404.736 -2.841  596.445 1.00 174.30 ? 141  LEU A CB    1 
ATOM   1088  C  CG    . LEU A 1  141  ? 405.765 -3.554  595.566 1.00 173.66 ? 141  LEU A CG    1 
ATOM   1089  C  CD1   . LEU A 1  141  ? 405.366 -5.005  595.343 1.00 171.72 ? 141  LEU A CD1   1 
ATOM   1090  C  CD2   . LEU A 1  141  ? 405.932 -2.830  594.239 1.00 173.63 ? 141  LEU A CD2   1 
ATOM   1091  N  N     . CYS A 1  142  ? 404.050 0.383   598.154 1.00 228.89 ? 142  CYS A N     1 
ATOM   1092  C  CA    . CYS A 1  142  ? 403.010 1.034   598.944 1.00 230.65 ? 142  CYS A CA    1 
ATOM   1093  C  C     . CYS A 1  142  ? 403.278 2.528   599.099 1.00 229.89 ? 142  CYS A C     1 
ATOM   1094  O  O     . CYS A 1  142  ? 402.376 3.298   599.430 1.00 233.92 ? 142  CYS A O     1 
ATOM   1095  C  CB    . CYS A 1  142  ? 402.897 0.374   600.320 1.00 226.99 ? 142  CYS A CB    1 
ATOM   1096  S  SG    . CYS A 1  142  ? 401.471 0.899   601.297 1.00 232.80 ? 142  CYS A SG    1 
ATOM   1097  N  N     . LYS A 1  143  ? 404.520 2.935   598.854 1.00 115.58 ? 143  LYS A N     1 
ATOM   1098  C  CA    . LYS A 1  143  ? 404.909 4.332   599.013 1.00 116.10 ? 143  LYS A CA    1 
ATOM   1099  C  C     . LYS A 1  143  ? 404.579 5.158   597.773 1.00 119.06 ? 143  LYS A C     1 
ATOM   1100  O  O     . LYS A 1  143  ? 404.766 6.375   597.760 1.00 120.07 ? 143  LYS A O     1 
ATOM   1101  C  CB    . LYS A 1  143  ? 406.403 4.438   599.328 1.00 112.96 ? 143  LYS A CB    1 
ATOM   1102  C  CG    . LYS A 1  143  ? 407.313 3.950   598.214 1.00 111.94 ? 143  LYS A CG    1 
ATOM   1103  C  CD    . LYS A 1  143  ? 408.775 4.034   598.627 1.00 108.82 ? 143  LYS A CD    1 
ATOM   1104  C  CE    . LYS A 1  143  ? 409.698 3.581   597.506 1.00 107.92 ? 143  LYS A CE    1 
ATOM   1105  N  NZ    . LYS A 1  143  ? 409.573 4.448   596.301 1.00 110.52 ? 143  LYS A NZ    1 
ATOM   1106  N  N     . THR A 1  144  ? 404.088 4.491   596.734 1.00 181.79 ? 144  THR A N     1 
ATOM   1107  C  CA    . THR A 1  144  ? 403.719 5.168   595.496 1.00 186.28 ? 144  THR A CA    1 
ATOM   1108  C  C     . THR A 1  144  ? 402.227 5.482   595.462 1.00 191.41 ? 144  THR A C     1 
ATOM   1109  O  O     . THR A 1  144  ? 401.754 6.204   594.585 1.00 195.02 ? 144  THR A O     1 
ATOM   1110  C  CB    . THR A 1  144  ? 404.084 4.325   594.260 1.00 185.71 ? 144  THR A CB    1 
ATOM   1111  O  OG1   . THR A 1  144  ? 403.704 5.027   593.070 1.00 188.74 ? 144  THR A OG1   1 
ATOM   1112  C  CG2   . THR A 1  144  ? 403.370 2.983   594.301 1.00 183.35 ? 144  THR A CG2   1 
ATOM   1113  N  N     . LYS A 1  145  ? 401.490 4.936   596.424 1.00 142.76 ? 145  LYS A N     1 
ATOM   1114  C  CA    . LYS A 1  145  ? 400.049 5.144   596.500 1.00 146.34 ? 145  LYS A CA    1 
ATOM   1115  C  C     . LYS A 1  145  ? 399.720 6.525   597.058 1.00 149.92 ? 145  LYS A C     1 
ATOM   1116  O  O     . LYS A 1  145  ? 400.310 6.963   598.046 1.00 148.59 ? 145  LYS A O     1 
ATOM   1117  C  CB    . LYS A 1  145  ? 399.396 4.059   597.360 1.00 143.44 ? 145  LYS A CB    1 
ATOM   1118  C  CG    . LYS A 1  145  ? 399.679 2.637   596.897 1.00 141.38 ? 145  LYS A CG    1 
ATOM   1119  C  CD    . LYS A 1  145  ? 399.067 2.358   595.532 1.00 145.06 ? 145  LYS A CD    1 
ATOM   1120  C  CE    . LYS A 1  145  ? 397.549 2.432   595.579 1.00 147.50 ? 145  LYS A CE    1 
ATOM   1121  N  NZ    . LYS A 1  145  ? 396.936 2.098   594.263 1.00 147.73 ? 145  LYS A NZ    1 
ATOM   1122  N  N     . MET A 1  146  ? 398.775 7.207   596.419 1.00 165.18 ? 146  MET A N     1 
ATOM   1123  C  CA    . MET A 1  146  ? 398.363 8.537   596.850 1.00 166.24 ? 146  MET A CA    1 
ATOM   1124  C  C     . MET A 1  146  ? 396.959 8.512   597.445 1.00 170.12 ? 146  MET A C     1 
ATOM   1125  O  O     . MET A 1  146  ? 396.712 9.084   598.507 1.00 169.46 ? 146  MET A O     1 
ATOM   1126  C  CB    . MET A 1  146  ? 398.417 9.521   595.680 1.00 166.48 ? 146  MET A CB    1 
ATOM   1127  C  CG    . MET A 1  146  ? 399.784 9.638   595.028 1.00 164.45 ? 146  MET A CG    1 
ATOM   1128  S  SD    . MET A 1  146  ? 399.773 10.748  593.608 1.00 175.07 ? 146  MET A SD    1 
ATOM   1129  C  CE    . MET A 1  146  ? 398.572 9.939   592.554 1.00 169.23 ? 146  MET A CE    1 
ATOM   1130  N  N     . VAL A 1  147  ? 396.042 7.847   596.750 1.00 204.71 ? 147  VAL A N     1 
ATOM   1131  C  CA    . VAL A 1  147  ? 394.658 7.753   597.197 1.00 208.40 ? 147  VAL A CA    1 
ATOM   1132  C  C     . VAL A 1  147  ? 394.367 6.340   597.708 1.00 204.96 ? 147  VAL A C     1 
ATOM   1133  O  O     . VAL A 1  147  ? 395.007 5.375   597.287 1.00 201.75 ? 147  VAL A O     1 
ATOM   1134  C  CB    . VAL A 1  147  ? 393.674 8.128   596.060 1.00 215.96 ? 147  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A 1  147  ? 393.642 7.045   594.990 1.00 215.14 ? 147  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A 1  147  ? 392.276 8.392   596.609 1.00 217.01 ? 147  VAL A CG2   1 
ATOM   1137  N  N     . CYS A 1  148  ? 393.418 6.227   598.632 1.00 165.73 ? 148  CYS A N     1 
ATOM   1138  C  CA    . CYS A 1  148  ? 393.038 4.932   599.184 1.00 162.35 ? 148  CYS A CA    1 
ATOM   1139  C  C     . CYS A 1  148  ? 392.038 4.219   598.279 1.00 165.38 ? 148  CYS A C     1 
ATOM   1140  O  O     . CYS A 1  148  ? 390.843 4.514   598.305 1.00 167.95 ? 148  CYS A O     1 
ATOM   1141  C  CB    . CYS A 1  148  ? 392.451 5.100   600.586 1.00 161.39 ? 148  CYS A CB    1 
ATOM   1142  S  SG    . CYS A 1  148  ? 393.581 5.851   601.780 1.00 160.68 ? 148  CYS A SG    1 
ATOM   1143  N  N     . GLY A 1  165  ? 387.567 -1.292  603.506 1.00 141.38 ? 165  GLY A N     1 
ATOM   1144  C  CA    . GLY A 1  165  ? 387.958 -0.032  604.110 1.00 140.92 ? 165  GLY A CA    1 
ATOM   1145  C  C     . GLY A 1  165  ? 387.906 1.120   603.126 1.00 142.99 ? 165  GLY A C     1 
ATOM   1146  O  O     . GLY A 1  165  ? 388.266 0.968   601.958 1.00 143.10 ? 165  GLY A O     1 
ATOM   1147  N  N     . GLY A 1  166  ? 387.457 2.277   603.601 1.00 144.75 ? 166  GLY A N     1 
ATOM   1148  C  CA    . GLY A 1  166  ? 387.334 3.451   602.757 1.00 147.86 ? 166  GLY A CA    1 
ATOM   1149  C  C     . GLY A 1  166  ? 388.298 4.557   603.138 1.00 150.93 ? 166  GLY A C     1 
ATOM   1150  O  O     . GLY A 1  166  ? 389.513 4.358   603.133 1.00 146.78 ? 166  GLY A O     1 
ATOM   1151  N  N     . CYS A 1  167  ? 387.743 5.722   603.470 1.00 236.76 ? 167  CYS A N     1 
ATOM   1152  C  CA    . CYS A 1  167  ? 388.525 6.906   603.825 1.00 237.78 ? 167  CYS A CA    1 
ATOM   1153  C  C     . CYS A 1  167  ? 389.532 7.252   602.731 1.00 237.43 ? 167  CYS A C     1 
ATOM   1154  O  O     . CYS A 1  167  ? 390.739 7.084   602.907 1.00 234.95 ? 167  CYS A O     1 
ATOM   1155  C  CB    . CYS A 1  167  ? 389.241 6.701   605.163 1.00 234.67 ? 167  CYS A CB    1 
ATOM   1156  S  SG    . CYS A 1  167  ? 390.047 8.183   605.817 1.00 234.52 ? 167  CYS A SG    1 
ATOM   1157  N  N     . GLY A 1  168  ? 389.025 7.733   601.601 1.00 148.51 ? 168  GLY A N     1 
ATOM   1158  C  CA    . GLY A 1  168  ? 389.865 8.062   600.464 1.00 148.02 ? 168  GLY A CA    1 
ATOM   1159  C  C     . GLY A 1  168  ? 390.555 9.405   600.600 1.00 147.80 ? 168  GLY A C     1 
ATOM   1160  O  O     . GLY A 1  168  ? 390.214 10.362  599.905 1.00 150.52 ? 168  GLY A O     1 
ATOM   1161  N  N     . ASN A 1  169  ? 391.532 9.475   601.498 1.00 167.38 ? 169  ASN A N     1 
ATOM   1162  C  CA    . ASN A 1  169  ? 392.296 10.698  601.704 1.00 167.69 ? 169  ASN A CA    1 
ATOM   1163  C  C     . ASN A 1  169  ? 393.598 10.667  600.910 1.00 166.71 ? 169  ASN A C     1 
ATOM   1164  O  O     . ASN A 1  169  ? 394.290 9.650   600.877 1.00 164.14 ? 169  ASN A O     1 
ATOM   1165  C  CB    . ASN A 1  169  ? 392.588 10.902  603.192 1.00 166.67 ? 169  ASN A CB    1 
ATOM   1166  C  CG    . ASN A 1  169  ? 392.972 12.333  603.525 1.00 167.27 ? 169  ASN A CG    1 
ATOM   1167  O  OD1   . ASN A 1  169  ? 393.337 13.113  602.645 1.00 168.47 ? 169  ASN A OD1   1 
ATOM   1168  N  ND2   . ASN A 1  169  ? 392.895 12.682  604.804 1.00 166.44 ? 169  ASN A ND2   1 
ATOM   1169  N  N     . THR A 1  170  ? 393.925 11.785  600.269 1.00 162.88 ? 170  THR A N     1 
ATOM   1170  C  CA    . THR A 1  170  ? 395.148 11.886  599.481 1.00 160.52 ? 170  THR A CA    1 
ATOM   1171  C  C     . THR A 1  170  ? 396.381 11.848  600.379 1.00 157.00 ? 170  THR A C     1 
ATOM   1172  O  O     . THR A 1  170  ? 396.702 12.829  601.050 1.00 156.87 ? 170  THR A O     1 
ATOM   1173  C  CB    . THR A 1  170  ? 395.173 13.176  598.640 1.00 160.96 ? 170  THR A CB    1 
ATOM   1174  O  OG1   . THR A 1  170  ? 395.058 14.315  599.501 1.00 162.39 ? 170  THR A OG1   1 
ATOM   1175  C  CG2   . THR A 1  170  ? 394.023 13.183  597.643 1.00 159.65 ? 170  THR A CG2   1 
ATOM   1176  N  N     . GLN A 1  171  ? 397.067 10.708  600.386 1.00 169.70 ? 171  GLN A N     1 
ATOM   1177  C  CA    . GLN A 1  171  ? 398.245 10.522  601.226 1.00 163.58 ? 171  GLN A CA    1 
ATOM   1178  C  C     . GLN A 1  171  ? 399.394 11.416  600.767 1.00 162.93 ? 171  GLN A C     1 
ATOM   1179  O  O     . GLN A 1  171  ? 399.863 11.301  599.635 1.00 164.41 ? 171  GLN A O     1 
ATOM   1180  C  CB    . GLN A 1  171  ? 398.679 9.055   601.220 1.00 160.41 ? 171  GLN A CB    1 
ATOM   1181  C  CG    . GLN A 1  171  ? 399.764 8.723   602.232 1.00 157.03 ? 171  GLN A CG    1 
ATOM   1182  C  CD    . GLN A 1  171  ? 400.094 7.243   602.267 1.00 153.96 ? 171  GLN A CD    1 
ATOM   1183  O  OE1   . GLN A 1  171  ? 399.620 6.469   601.436 1.00 154.42 ? 171  GLN A OE1   1 
ATOM   1184  N  NE2   . GLN A 1  171  ? 400.910 6.842   603.236 1.00 150.25 ? 171  GLN A NE2   1 
ATOM   1185  N  N     . PRO A 1  172  ? 399.850 12.312  601.655 1.00 164.73 ? 172  PRO A N     1 
ATOM   1186  C  CA    . PRO A 1  172  ? 400.877 13.312  601.343 1.00 163.45 ? 172  PRO A CA    1 
ATOM   1187  C  C     . PRO A 1  172  ? 402.279 12.724  601.202 1.00 157.67 ? 172  PRO A C     1 
ATOM   1188  O  O     . PRO A 1  172  ? 402.532 11.606  601.650 1.00 152.47 ? 172  PRO A O     1 
ATOM   1189  C  CB    . PRO A 1  172  ? 400.813 14.259  602.542 1.00 163.54 ? 172  PRO A CB    1 
ATOM   1190  C  CG    . PRO A 1  172  ? 400.352 13.395  603.662 1.00 162.07 ? 172  PRO A CG    1 
ATOM   1191  C  CD    . PRO A 1  172  ? 399.384 12.420  603.049 1.00 163.59 ? 172  PRO A CD    1 
ATOM   1192  N  N     . THR A 1  173  ? 403.175 13.486  600.583 1.00 139.59 ? 173  THR A N     1 
ATOM   1193  C  CA    . THR A 1  173  ? 404.567 13.079  600.434 1.00 136.94 ? 173  THR A CA    1 
ATOM   1194  C  C     . THR A 1  173  ? 405.384 13.530  601.640 1.00 136.17 ? 173  THR A C     1 
ATOM   1195  O  O     . THR A 1  173  ? 405.609 14.724  601.838 1.00 136.17 ? 173  THR A O     1 
ATOM   1196  C  CB    . THR A 1  173  ? 405.193 13.655  599.149 1.00 136.88 ? 173  THR A CB    1 
ATOM   1197  O  OG1   . THR A 1  173  ? 404.453 13.202  598.009 1.00 139.85 ? 173  THR A OG1   1 
ATOM   1198  C  CG2   . THR A 1  173  ? 406.642 13.214  599.016 1.00 133.19 ? 173  THR A CG2   1 
ATOM   1199  N  N     . ILE A 1  174  ? 405.826 12.567  602.442 1.00 182.15 ? 174  ILE A N     1 
ATOM   1200  C  CA    . ILE A 1  174  ? 406.542 12.863  603.678 1.00 176.47 ? 174  ILE A CA    1 
ATOM   1201  C  C     . ILE A 1  174  ? 408.055 12.781  603.494 1.00 171.36 ? 174  ILE A C     1 
ATOM   1202  O  O     . ILE A 1  174  ? 408.573 11.795  602.971 1.00 167.52 ? 174  ILE A O     1 
ATOM   1203  C  CB    . ILE A 1  174  ? 406.118 11.905  604.808 1.00 172.33 ? 174  ILE A CB    1 
ATOM   1204  C  CG1   . ILE A 1  174  ? 404.599 11.941  604.991 1.00 176.52 ? 174  ILE A CG1   1 
ATOM   1205  C  CG2   . ILE A 1  174  ? 406.826 12.260  606.107 1.00 172.00 ? 174  ILE A CG2   1 
ATOM   1206  C  CD1   . ILE A 1  174  ? 404.091 11.027  606.082 1.00 174.00 ? 174  ILE A CD1   1 
ATOM   1207  N  N     . ARG A 1  175  ? 408.755 13.826  603.925 1.00 164.79 ? 175  ARG A N     1 
ATOM   1208  C  CA    . ARG A 1  175  ? 410.212 13.864  603.850 1.00 160.27 ? 175  ARG A CA    1 
ATOM   1209  C  C     . ARG A 1  175  ? 410.818 14.217  605.206 1.00 159.21 ? 175  ARG A C     1 
ATOM   1210  O  O     . ARG A 1  175  ? 410.132 14.737  606.085 1.00 162.50 ? 175  ARG A O     1 
ATOM   1211  C  CB    . ARG A 1  175  ? 410.670 14.865  602.788 1.00 162.84 ? 175  ARG A CB    1 
ATOM   1212  C  CG    . ARG A 1  175  ? 410.193 14.533  601.383 1.00 169.43 ? 175  ARG A CG    1 
ATOM   1213  C  CD    . ARG A 1  175  ? 410.721 15.529  600.364 1.00 173.67 ? 175  ARG A CD    1 
ATOM   1214  N  NE    . ARG A 1  175  ? 410.260 15.219  599.014 1.00 177.34 ? 175  ARG A NE    1 
ATOM   1215  C  CZ    . ARG A 1  175  ? 410.888 14.397  598.180 1.00 174.92 ? 175  ARG A CZ    1 
ATOM   1216  N  NH1   . ARG A 1  175  ? 412.010 13.797  598.557 1.00 173.62 ? 175  ARG A NH1   1 
ATOM   1217  N  NH2   . ARG A 1  175  ? 410.396 14.172  596.970 1.00 175.15 ? 175  ARG A NH2   1 
ATOM   1218  N  N     . LYS A 1  176  ? 412.107 13.933  605.366 1.00 105.47 ? 176  LYS A N     1 
ATOM   1219  C  CA    . LYS A 1  176  ? 412.792 14.160  606.635 1.00 103.58 ? 176  LYS A CA    1 
ATOM   1220  C  C     . LYS A 1  176  ? 413.408 15.555  606.716 1.00 104.51 ? 176  LYS A C     1 
ATOM   1221  O  O     . LYS A 1  176  ? 413.979 16.050  605.744 1.00 105.09 ? 176  LYS A O     1 
ATOM   1222  C  CB    . LYS A 1  176  ? 413.877 13.099  606.851 1.00 100.10 ? 176  LYS A CB    1 
ATOM   1223  C  CG    . LYS A 1  176  ? 414.666 13.270  608.142 1.00 98.06  ? 176  LYS A CG    1 
ATOM   1224  C  CD    . LYS A 1  176  ? 415.729 12.195  608.300 1.00 94.74  ? 176  LYS A CD    1 
ATOM   1225  C  CE    . LYS A 1  176  ? 416.563 12.430  609.549 1.00 92.86  ? 176  LYS A CE    1 
ATOM   1226  N  NZ    . LYS A 1  176  ? 417.588 11.369  609.746 1.00 89.68  ? 176  LYS A NZ    1 
ATOM   1227  N  N     . ASP A 1  177  ? 413.285 16.180  607.883 1.00 163.47 ? 177  ASP A N     1 
ATOM   1228  C  CA    . ASP A 1  177  ? 413.879 17.490  608.122 1.00 164.29 ? 177  ASP A CA    1 
ATOM   1229  C  C     . ASP A 1  177  ? 414.218 17.658  609.601 1.00 164.77 ? 177  ASP A C     1 
ATOM   1230  O  O     . ASP A 1  177  ? 413.346 17.957  610.417 1.00 166.43 ? 177  ASP A O     1 
ATOM   1231  C  CB    . ASP A 1  177  ? 412.935 18.603  607.662 1.00 170.03 ? 177  ASP A CB    1 
ATOM   1232  C  CG    . ASP A 1  177  ? 413.647 19.931  607.462 1.00 170.02 ? 177  ASP A CG    1 
ATOM   1233  O  OD1   . ASP A 1  177  ? 414.761 20.104  608.000 1.00 168.84 ? 177  ASP A OD1   1 
ATOM   1234  O  OD2   . ASP A 1  177  ? 413.088 20.804  606.766 1.00 173.53 ? 177  ASP A OD2   1 
ATOM   1235  N  N     . GLY A 1  178  ? 415.489 17.462  609.939 1.00 101.13 ? 178  GLY A N     1 
ATOM   1236  C  CA    . GLY A 1  178  ? 415.949 17.609  611.308 1.00 99.76  ? 178  GLY A CA    1 
ATOM   1237  C  C     . GLY A 1  178  ? 415.436 16.518  612.228 1.00 98.37  ? 178  GLY A C     1 
ATOM   1238  O  O     . GLY A 1  178  ? 415.991 15.421  612.276 1.00 95.82  ? 178  GLY A O     1 
ATOM   1239  N  N     . LEU A 1  179  ? 414.372 16.824  612.963 1.00 200.40 ? 179  LEU A N     1 
ATOM   1240  C  CA    . LEU A 1  179  ? 413.781 15.867  613.890 1.00 201.68 ? 179  LEU A CA    1 
ATOM   1241  C  C     . LEU A 1  179  ? 412.256 15.902  613.833 1.00 206.55 ? 179  LEU A C     1 
ATOM   1242  O  O     . LEU A 1  179  ? 411.580 15.382  614.720 1.00 206.07 ? 179  LEU A O     1 
ATOM   1243  C  CB    . LEU A 1  179  ? 414.270 16.135  615.317 1.00 202.96 ? 179  LEU A CB    1 
ATOM   1244  C  CG    . LEU A 1  179  ? 414.692 17.565  615.669 1.00 204.70 ? 179  LEU A CG    1 
ATOM   1245  C  CD1   . LEU A 1  179  ? 413.498 18.507  615.729 1.00 208.88 ? 179  LEU A CD1   1 
ATOM   1246  C  CD2   . LEU A 1  179  ? 415.462 17.587  616.980 1.00 199.12 ? 179  LEU A CD2   1 
ATOM   1247  N  N     . LYS A 1  180  ? 411.725 16.521  612.784 1.00 143.94 ? 180  LYS A N     1 
ATOM   1248  C  CA    . LYS A 1  180  ? 410.284 16.557  612.552 1.00 146.71 ? 180  LYS A CA    1 
ATOM   1249  C  C     . LYS A 1  180  ? 409.949 15.983  611.179 1.00 144.78 ? 180  LYS A C     1 
ATOM   1250  O  O     . LYS A 1  180  ? 410.845 15.664  610.395 1.00 139.60 ? 180  LYS A O     1 
ATOM   1251  C  CB    . LYS A 1  180  ? 409.748 17.987  612.672 1.00 149.00 ? 180  LYS A CB    1 
ATOM   1252  C  CG    . LYS A 1  180  ? 409.014 18.282  613.975 1.00 150.63 ? 180  LYS A CG    1 
ATOM   1253  C  CD    . LYS A 1  180  ? 409.940 18.195  615.175 1.00 148.59 ? 180  LYS A CD    1 
ATOM   1254  C  CE    . LYS A 1  180  ? 409.204 18.509  616.469 1.00 146.27 ? 180  LYS A CE    1 
ATOM   1255  N  NZ    . LYS A 1  180  ? 408.629 19.883  616.465 1.00 149.69 ? 180  LYS A NZ    1 
ATOM   1256  N  N     . LEU A 1  181  ? 408.658 15.851  610.892 1.00 171.27 ? 181  LEU A N     1 
ATOM   1257  C  CA    . LEU A 1  181  ? 408.209 15.333  609.604 1.00 170.87 ? 181  LEU A CA    1 
ATOM   1258  C  C     . LEU A 1  181  ? 407.231 16.294  608.935 1.00 173.92 ? 181  LEU A C     1 
ATOM   1259  O  O     . LEU A 1  181  ? 406.388 16.900  609.598 1.00 175.03 ? 181  LEU A O     1 
ATOM   1260  C  CB    . LEU A 1  181  ? 407.565 13.955  609.775 1.00 168.69 ? 181  LEU A CB    1 
ATOM   1261  C  CG    . LEU A 1  181  ? 408.478 12.840  610.293 1.00 162.22 ? 181  LEU A CG    1 
ATOM   1262  C  CD1   . LEU A 1  181  ? 407.729 11.518  610.363 1.00 160.61 ? 181  LEU A CD1   1 
ATOM   1263  C  CD2   . LEU A 1  181  ? 409.718 12.711  609.422 1.00 158.26 ? 181  LEU A CD2   1 
ATOM   1264  N  N     . VAL A 1  182  ? 407.350 16.428  607.618 1.00 175.38 ? 182  VAL A N     1 
ATOM   1265  C  CA    . VAL A 1  182  ? 406.508 17.347  606.859 1.00 179.61 ? 182  VAL A CA    1 
ATOM   1266  C  C     . VAL A 1  182  ? 405.447 16.606  606.050 1.00 183.74 ? 182  VAL A C     1 
ATOM   1267  O  O     . VAL A 1  182  ? 405.329 15.384  606.135 1.00 181.66 ? 182  VAL A O     1 
ATOM   1268  C  CB    . VAL A 1  182  ? 407.348 18.215  605.903 1.00 178.79 ? 182  VAL A CB    1 
ATOM   1269  C  CG1   . VAL A 1  182  ? 408.325 19.074  606.689 1.00 176.46 ? 182  VAL A CG1   1 
ATOM   1270  C  CG2   . VAL A 1  182  ? 408.085 17.339  604.901 1.00 175.47 ? 182  VAL A CG2   1 
ATOM   1271  N  N     . GLY A 1  183  ? 404.678 17.356  605.267 1.00 194.64 ? 183  GLY A N     1 
ATOM   1272  C  CA    . GLY A 1  183  ? 403.635 16.781  604.438 1.00 197.85 ? 183  GLY A CA    1 
ATOM   1273  C  C     . GLY A 1  183  ? 403.337 17.636  603.222 1.00 201.17 ? 183  GLY A C     1 
ATOM   1274  O  O     . GLY A 1  183  ? 403.309 18.864  603.307 1.00 204.23 ? 183  GLY A O     1 
ATOM   1275  N  N     . SER A 1  184  ? 403.111 16.985  602.085 1.00 158.68 ? 184  SER A N     1 
ATOM   1276  C  CA    . SER A 1  184  ? 402.844 17.695  600.839 1.00 160.18 ? 184  SER A CA    1 
ATOM   1277  C  C     . SER A 1  184  ? 401.632 17.121  600.112 1.00 163.21 ? 184  SER A C     1 
ATOM   1278  O  O     . SER A 1  184  ? 401.671 15.998  599.610 1.00 160.67 ? 184  SER A O     1 
ATOM   1279  C  CB    . SER A 1  184  ? 404.072 17.647  599.927 1.00 155.06 ? 184  SER A CB    1 
ATOM   1280  O  OG    . SER A 1  184  ? 403.823 18.315  598.702 1.00 154.70 ? 184  SER A OG    1 
ATOM   1281  N  N     . TRP A 1  185  ? 400.557 17.901  600.056 1.00 181.33 ? 185  TRP A N     1 
ATOM   1282  C  CA    . TRP A 1  185  ? 399.337 17.478  599.379 1.00 183.32 ? 185  TRP A CA    1 
ATOM   1283  C  C     . TRP A 1  185  ? 399.205 18.139  598.010 1.00 183.82 ? 185  TRP A C     1 
ATOM   1284  O  O     . TRP A 1  185  ? 399.581 19.297  597.829 1.00 185.32 ? 185  TRP A O     1 
ATOM   1285  C  CB    . TRP A 1  185  ? 398.110 17.797  600.236 1.00 187.41 ? 185  TRP A CB    1 
ATOM   1286  C  CG    . TRP A 1  185  ? 398.033 16.996  601.502 1.00 184.76 ? 185  TRP A CG    1 
ATOM   1287  C  CD1   . TRP A 1  185  ? 397.432 15.782  601.668 1.00 182.81 ? 185  TRP A CD1   1 
ATOM   1288  C  CD2   . TRP A 1  185  ? 398.574 17.353  602.780 1.00 183.06 ? 185  TRP A CD2   1 
ATOM   1289  N  NE1   . TRP A 1  185  ? 397.566 15.361  602.969 1.00 179.77 ? 185  TRP A NE1   1 
ATOM   1290  C  CE2   . TRP A 1  185  ? 398.262 16.308  603.672 1.00 179.75 ? 185  TRP A CE2   1 
ATOM   1291  C  CE3   . TRP A 1  185  ? 399.291 18.455  603.257 1.00 182.31 ? 185  TRP A CE3   1 
ATOM   1292  C  CZ2   . TRP A 1  185  ? 398.644 16.331  605.012 1.00 175.40 ? 185  TRP A CZ2   1 
ATOM   1293  C  CZ3   . TRP A 1  185  ? 399.669 18.476  604.588 1.00 179.40 ? 185  TRP A CZ3   1 
ATOM   1294  C  CH2   . TRP A 1  185  ? 399.344 17.421  605.450 1.00 175.77 ? 185  TRP A CH2   1 
ATOM   1295  N  N     . VAL A 1  201  ? 403.485 20.219  608.069 1.00 159.18 ? 201  VAL A N     1 
ATOM   1296  C  CA    . VAL A 1  201  ? 404.288 19.669  609.155 1.00 158.39 ? 201  VAL A CA    1 
ATOM   1297  C  C     . VAL A 1  201  ? 403.463 18.724  610.023 1.00 158.21 ? 201  VAL A C     1 
ATOM   1298  O  O     . VAL A 1  201  ? 402.404 19.096  610.529 1.00 161.43 ? 201  VAL A O     1 
ATOM   1299  C  CB    . VAL A 1  201  ? 404.880 20.783  610.039 1.00 156.80 ? 201  VAL A CB    1 
ATOM   1300  C  CG1   . VAL A 1  201  ? 405.694 20.186  611.177 1.00 148.81 ? 201  VAL A CG1   1 
ATOM   1301  C  CG2   . VAL A 1  201  ? 405.734 21.725  609.204 1.00 156.44 ? 201  VAL A CG2   1 
ATOM   1302  N  N     . LEU A 1  202  ? 403.953 17.500  610.190 1.00 184.93 ? 202  LEU A N     1 
ATOM   1303  C  CA    . LEU A 1  202  ? 403.258 16.499  610.993 1.00 182.42 ? 202  LEU A CA    1 
ATOM   1304  C  C     . LEU A 1  202  ? 403.715 16.532  612.447 1.00 180.58 ? 202  LEU A C     1 
ATOM   1305  O  O     . LEU A 1  202  ? 404.905 16.405  612.738 1.00 179.11 ? 202  LEU A O     1 
ATOM   1306  C  CB    . LEU A 1  202  ? 403.469 15.098  610.411 1.00 177.74 ? 202  LEU A CB    1 
ATOM   1307  C  CG    . LEU A 1  202  ? 402.494 14.618  609.331 1.00 179.98 ? 202  LEU A CG    1 
ATOM   1308  C  CD1   . LEU A 1  202  ? 402.599 15.456  608.065 1.00 184.71 ? 202  LEU A CD1   1 
ATOM   1309  C  CD2   . LEU A 1  202  ? 402.723 13.145  609.022 1.00 178.06 ? 202  LEU A CD2   1 
ATOM   1310  N  N     . SER A 1  203  ? 402.761 16.704  613.356 1.00 173.02 ? 203  SER A N     1 
ATOM   1311  C  CA    . SER A 1  203  ? 403.055 16.717  614.783 1.00 173.28 ? 203  SER A CA    1 
ATOM   1312  C  C     . SER A 1  203  ? 403.319 15.306  615.296 1.00 171.09 ? 203  SER A C     1 
ATOM   1313  O  O     . SER A 1  203  ? 402.863 14.328  614.706 1.00 170.57 ? 203  SER A O     1 
ATOM   1314  C  CB    . SER A 1  203  ? 401.903 17.354  615.563 1.00 177.80 ? 203  SER A CB    1 
ATOM   1315  O  OG    . SER A 1  203  ? 402.147 17.313  616.958 1.00 176.27 ? 203  SER A OG    1 
ATOM   1316  N  N     . THR A 1  204  ? 404.057 15.209  616.397 1.00 130.70 ? 204  THR A N     1 
ATOM   1317  C  CA    . THR A 1  204  ? 404.365 13.918  617.000 1.00 129.19 ? 204  THR A CA    1 
ATOM   1318  C  C     . THR A 1  204  ? 403.110 13.294  617.606 1.00 130.20 ? 204  THR A C     1 
ATOM   1319  O  O     . THR A 1  204  ? 402.915 12.078  617.542 1.00 127.50 ? 204  THR A O     1 
ATOM   1320  C  CB    . THR A 1  204  ? 405.449 14.047  618.087 1.00 127.22 ? 204  THR A CB    1 
ATOM   1321  O  OG1   . THR A 1  204  ? 406.576 14.759  617.561 1.00 126.31 ? 204  THR A OG1   1 
ATOM   1322  C  CG2   . THR A 1  204  ? 405.898 12.673  618.563 1.00 123.36 ? 204  THR A CG2   1 
ATOM   1323  N  N     . GLU A 1  205  ? 402.262 14.137  618.189 1.00 176.80 ? 205  GLU A N     1 
ATOM   1324  C  CA    . GLU A 1  205  ? 401.002 13.689  618.773 1.00 179.26 ? 205  GLU A CA    1 
ATOM   1325  C  C     . GLU A 1  205  ? 400.088 13.109  617.699 1.00 180.24 ? 205  GLU A C     1 
ATOM   1326  O  O     . GLU A 1  205  ? 399.378 12.128  617.934 1.00 180.00 ? 205  GLU A O     1 
ATOM   1327  C  CB    . GLU A 1  205  ? 400.305 14.846  619.495 1.00 182.94 ? 205  GLU A CB    1 
ATOM   1328  C  CG    . GLU A 1  205  ? 398.960 14.486  620.111 1.00 187.80 ? 205  GLU A CG    1 
ATOM   1329  C  CD    . GLU A 1  205  ? 399.085 13.537  621.288 1.00 185.15 ? 205  GLU A CD    1 
ATOM   1330  O  OE1   . GLU A 1  205  ? 398.101 12.829  621.588 1.00 185.77 ? 205  GLU A OE1   1 
ATOM   1331  O  OE2   . GLU A 1  205  ? 400.164 13.502  621.917 1.00 181.43 ? 205  GLU A OE2   1 
ATOM   1332  N  N     . GLU A 1  206  ? 400.115 13.722  616.520 1.00 150.41 ? 206  GLU A N     1 
ATOM   1333  C  CA    . GLU A 1  206  ? 399.329 13.248  615.388 1.00 152.61 ? 206  GLU A CA    1 
ATOM   1334  C  C     . GLU A 1  206  ? 399.763 11.848  614.972 1.00 147.95 ? 206  GLU A C     1 
ATOM   1335  O  O     . GLU A 1  206  ? 398.930 10.969  614.762 1.00 149.47 ? 206  GLU A O     1 
ATOM   1336  C  CB    . GLU A 1  206  ? 399.454 14.208  614.204 1.00 150.87 ? 206  GLU A CB    1 
ATOM   1337  C  CG    . GLU A 1  206  ? 398.707 13.754  612.961 1.00 151.45 ? 206  GLU A CG    1 
ATOM   1338  C  CD    . GLU A 1  206  ? 398.913 14.684  611.783 1.00 154.18 ? 206  GLU A CD    1 
ATOM   1339  O  OE1   . GLU A 1  206  ? 398.316 14.433  610.715 1.00 156.35 ? 206  GLU A OE1   1 
ATOM   1340  O  OE2   . GLU A 1  206  ? 399.673 15.666  611.924 1.00 154.61 ? 206  GLU A OE2   1 
ATOM   1341  N  N     . ILE A 1  207  ? 401.073 11.651  614.863 1.00 120.68 ? 207  ILE A N     1 
ATOM   1342  C  CA    . ILE A 1  207  ? 401.632 10.358  614.483 1.00 115.72 ? 207  ILE A CA    1 
ATOM   1343  C  C     . ILE A 1  207  ? 401.365 9.313   615.567 1.00 114.19 ? 207  ILE A C     1 
ATOM   1344  O  O     . ILE A 1  207  ? 401.190 8.130   615.273 1.00 111.79 ? 207  ILE A O     1 
ATOM   1345  C  CB    . ILE A 1  207  ? 403.147 10.467  614.209 1.00 111.46 ? 207  ILE A CB    1 
ATOM   1346  C  CG1   . ILE A 1  207  ? 403.408 11.532  613.142 1.00 112.59 ? 207  ILE A CG1   1 
ATOM   1347  C  CG2   . ILE A 1  207  ? 403.717 9.132   613.765 1.00 108.62 ? 207  ILE A CG2   1 
ATOM   1348  C  CD1   . ILE A 1  207  ? 404.839 11.592  612.669 1.00 110.12 ? 207  ILE A CD1   1 
ATOM   1349  N  N     . LEU A 1  208  ? 401.325 9.760   616.819 1.00 151.69 ? 208  LEU A N     1 
ATOM   1350  C  CA    . LEU A 1  208  ? 400.933 8.896   617.928 1.00 151.43 ? 208  LEU A CA    1 
ATOM   1351  C  C     . LEU A 1  208  ? 399.495 8.423   617.723 1.00 157.61 ? 208  LEU A C     1 
ATOM   1352  O  O     . LEU A 1  208  ? 399.200 7.231   617.834 1.00 154.88 ? 208  LEU A O     1 
ATOM   1353  C  CB    . LEU A 1  208  ? 401.086 9.633   619.266 1.00 151.81 ? 208  LEU A CB    1 
ATOM   1354  C  CG    . LEU A 1  208  ? 400.680 8.979   620.595 1.00 150.68 ? 208  LEU A CG    1 
ATOM   1355  C  CD1   . LEU A 1  208  ? 399.214 9.242   620.936 1.00 154.22 ? 208  LEU A CD1   1 
ATOM   1356  C  CD2   . LEU A 1  208  ? 400.974 7.483   620.606 1.00 144.40 ? 208  LEU A CD2   1 
ATOM   1357  N  N     . ASN A 1  209  ? 398.609 9.367   617.417 1.00 160.58 ? 209  ASN A N     1 
ATOM   1358  C  CA    . ASN A 1  209  ? 397.204 9.056   617.179 1.00 165.64 ? 209  ASN A CA    1 
ATOM   1359  C  C     . ASN A 1  209  ? 397.017 8.150   615.964 1.00 164.99 ? 209  ASN A C     1 
ATOM   1360  O  O     . ASN A 1  209  ? 396.073 7.361   615.907 1.00 167.46 ? 209  ASN A O     1 
ATOM   1361  C  CB    . ASN A 1  209  ? 396.398 10.345  617.000 1.00 173.01 ? 209  ASN A CB    1 
ATOM   1362  C  CG    . ASN A 1  209  ? 394.906 10.092  616.894 1.00 179.21 ? 209  ASN A CG    1 
ATOM   1363  O  OD1   . ASN A 1  209  ? 394.204 10.021  617.902 1.00 180.86 ? 209  ASN A OD1   1 
ATOM   1364  N  ND2   . ASN A 1  209  ? 394.414 9.956   615.668 1.00 180.20 ? 209  ASN A ND2   1 
ATOM   1365  N  N     . ILE A 1  210  ? 397.921 8.267   614.996 1.00 118.74 ? 210  ILE A N     1 
ATOM   1366  C  CA    . ILE A 1  210  ? 397.885 7.421   613.809 1.00 118.41 ? 210  ILE A CA    1 
ATOM   1367  C  C     . ILE A 1  210  ? 398.301 5.997   614.151 1.00 115.74 ? 210  ILE A C     1 
ATOM   1368  O  O     . ILE A 1  210  ? 397.593 5.041   613.838 1.00 116.39 ? 210  ILE A O     1 
ATOM   1369  C  CB    . ILE A 1  210  ? 398.803 7.960   612.693 1.00 117.66 ? 210  ILE A CB    1 
ATOM   1370  C  CG1   . ILE A 1  210  ? 398.289 9.306   612.181 1.00 120.65 ? 210  ILE A CG1   1 
ATOM   1371  C  CG2   . ILE A 1  210  ? 398.893 6.964   611.548 1.00 116.98 ? 210  ILE A CG2   1 
ATOM   1372  C  CD1   . ILE A 1  210  ? 396.867 9.263   611.668 1.00 123.99 ? 210  ILE A CD1   1 
ATOM   1373  N  N     . PHE A 1  211  ? 399.448 5.864   614.808 1.00 139.93 ? 211  PHE A N     1 
ATOM   1374  C  CA    . PHE A 1  211  ? 399.981 4.554   615.163 1.00 136.09 ? 211  PHE A CA    1 
ATOM   1375  C  C     . PHE A 1  211  ? 399.130 3.871   616.229 1.00 137.13 ? 211  PHE A C     1 
ATOM   1376  O  O     . PHE A 1  211  ? 399.258 2.668   616.460 1.00 136.09 ? 211  PHE A O     1 
ATOM   1377  C  CB    . PHE A 1  211  ? 401.429 4.674   615.643 1.00 133.28 ? 211  PHE A CB    1 
ATOM   1378  C  CG    . PHE A 1  211  ? 402.401 5.039   614.555 1.00 130.58 ? 211  PHE A CG    1 
ATOM   1379  C  CD1   . PHE A 1  211  ? 402.012 5.030   613.225 1.00 130.39 ? 211  PHE A CD1   1 
ATOM   1380  C  CD2   . PHE A 1  211  ? 403.707 5.381   614.863 1.00 129.61 ? 211  PHE A CD2   1 
ATOM   1381  C  CE1   . PHE A 1  211  ? 402.903 5.363   612.225 1.00 128.31 ? 211  PHE A CE1   1 
ATOM   1382  C  CE2   . PHE A 1  211  ? 404.605 5.712   613.866 1.00 126.82 ? 211  PHE A CE2   1 
ATOM   1383  C  CZ    . PHE A 1  211  ? 404.202 5.704   612.545 1.00 126.24 ? 211  PHE A CZ    1 
ATOM   1384  N  N     . LYS A 1  212  ? 398.262 4.642   616.874 1.00 151.62 ? 212  LYS A N     1 
ATOM   1385  C  CA    . LYS A 1  212  ? 397.362 4.097   617.882 1.00 152.16 ? 212  LYS A CA    1 
ATOM   1386  C  C     . LYS A 1  212  ? 396.140 3.446   617.235 1.00 157.79 ? 212  LYS A C     1 
ATOM   1387  O  O     . LYS A 1  212  ? 395.354 2.779   617.908 1.00 157.65 ? 212  LYS A O     1 
ATOM   1388  C  CB    . LYS A 1  212  ? 396.920 5.194   618.853 1.00 152.56 ? 212  LYS A CB    1 
ATOM   1389  C  CG    . LYS A 1  212  ? 396.810 4.748   620.302 1.00 149.34 ? 212  LYS A CG    1 
ATOM   1390  C  CD    . LYS A 1  212  ? 398.184 4.528   620.915 1.00 146.64 ? 212  LYS A CD    1 
ATOM   1391  C  CE    . LYS A 1  212  ? 398.086 4.226   622.402 1.00 144.43 ? 212  LYS A CE    1 
ATOM   1392  N  NZ    . LYS A 1  212  ? 399.428 4.081   623.030 1.00 138.04 ? 212  LYS A NZ    1 
ATOM   1393  N  N     . HIS A 1  213  ? 395.987 3.642   615.927 1.00 142.39 ? 213  HIS A N     1 
ATOM   1394  C  CA    . HIS A 1  213  ? 394.810 3.154   615.211 1.00 145.55 ? 213  HIS A CA    1 
ATOM   1395  C  C     . HIS A 1  213  ? 395.158 2.230   614.043 1.00 142.64 ? 213  HIS A C     1 
ATOM   1396  O  O     . HIS A 1  213  ? 394.335 2.009   613.155 1.00 146.31 ? 213  HIS A O     1 
ATOM   1397  C  CB    . HIS A 1  213  ? 393.978 4.333   614.695 1.00 150.57 ? 213  HIS A CB    1 
ATOM   1398  C  CG    . HIS A 1  213  ? 393.357 5.157   615.780 1.00 154.03 ? 213  HIS A CG    1 
ATOM   1399  N  ND1   . HIS A 1  213  ? 393.227 4.707   617.076 1.00 154.91 ? 213  HIS A ND1   1 
ATOM   1400  C  CD2   . HIS A 1  213  ? 392.829 6.404   615.760 1.00 158.92 ? 213  HIS A CD2   1 
ATOM   1401  C  CE1   . HIS A 1  213  ? 392.646 5.642   617.808 1.00 157.88 ? 213  HIS A CE1   1 
ATOM   1402  N  NE2   . HIS A 1  213  ? 392.395 6.681   617.034 1.00 161.06 ? 213  HIS A NE2   1 
ATOM   1403  N  N     . ILE A 1  214  ? 396.374 1.692   614.045 1.00 135.35 ? 214  ILE A N     1 
ATOM   1404  C  CA    . ILE A 1  214  ? 396.795 0.761   613.003 1.00 134.30 ? 214  ILE A CA    1 
ATOM   1405  C  C     . ILE A 1  214  ? 396.300 -0.647  613.339 1.00 134.75 ? 214  ILE A C     1 
ATOM   1406  O  O     . ILE A 1  214  ? 396.274 -1.533  612.483 1.00 132.61 ? 214  ILE A O     1 
ATOM   1407  C  CB    . ILE A 1  214  ? 398.331 0.763   612.831 1.00 128.72 ? 214  ILE A CB    1 
ATOM   1408  C  CG1   . ILE A 1  214  ? 398.854 2.196   612.752 1.00 128.45 ? 214  ILE A CG1   1 
ATOM   1409  C  CG2   . ILE A 1  214  ? 398.748 0.008   611.579 1.00 122.24 ? 214  ILE A CG2   1 
ATOM   1410  C  CD1   . ILE A 1  214  ? 398.378 2.948   611.532 1.00 130.38 ? 214  ILE A CD1   1 
ATOM   1411  N  N     . SER A 1  215  ? 395.901 -0.830  614.596 1.00 162.00 ? 215  SER A N     1 
ATOM   1412  C  CA    . SER A 1  215  ? 395.344 -2.091  615.094 1.00 162.97 ? 215  SER A CA    1 
ATOM   1413  C  C     . SER A 1  215  ? 396.344 -3.246  615.027 1.00 159.13 ? 215  SER A C     1 
ATOM   1414  O  O     . SER A 1  215  ? 397.504 -3.063  614.660 1.00 156.17 ? 215  SER A O     1 
ATOM   1415  C  CB    . SER A 1  215  ? 394.068 -2.458  614.328 1.00 166.71 ? 215  SER A CB    1 
ATOM   1416  O  OG    . SER A 1  215  ? 393.491 -3.649  614.835 1.00 167.72 ? 215  SER A OG    1 
ATOM   1417  N  N     . VAL A 1  216  ? 395.876 -4.438  615.386 1.00 158.28 ? 216  VAL A N     1 
ATOM   1418  C  CA    . VAL A 1  216  ? 396.740 -5.607  615.522 1.00 151.52 ? 216  VAL A CA    1 
ATOM   1419  C  C     . VAL A 1  216  ? 397.057 -6.280  614.188 1.00 148.73 ? 216  VAL A C     1 
ATOM   1420  O  O     . VAL A 1  216  ? 398.212 -6.605  613.908 1.00 146.68 ? 216  VAL A O     1 
ATOM   1421  C  CB    . VAL A 1  216  ? 396.103 -6.655  616.460 1.00 150.11 ? 216  VAL A CB    1 
ATOM   1422  C  CG1   . VAL A 1  216  ? 396.970 -7.902  616.538 1.00 144.96 ? 216  VAL A CG1   1 
ATOM   1423  C  CG2   . VAL A 1  216  ? 395.878 -6.063  617.843 1.00 151.49 ? 216  VAL A CG2   1 
ATOM   1424  N  N     . LYS A 1  217  ? 396.027 -6.487  613.373 1.00 147.35 ? 217  LYS A N     1 
ATOM   1425  C  CA    . LYS A 1  217  ? 396.159 -7.234  612.125 1.00 147.44 ? 217  LYS A CA    1 
ATOM   1426  C  C     . LYS A 1  217  ? 397.178 -6.611  611.171 1.00 145.52 ? 217  LYS A C     1 
ATOM   1427  O  O     . LYS A 1  217  ? 397.849 -7.319  610.420 1.00 143.02 ? 217  LYS A O     1 
ATOM   1428  C  CB    . LYS A 1  217  ? 394.799 -7.346  611.431 1.00 151.94 ? 217  LYS A CB    1 
ATOM   1429  C  CG    . LYS A 1  217  ? 394.776 -8.304  610.251 1.00 148.26 ? 217  LYS A CG    1 
ATOM   1430  C  CD    . LYS A 1  217  ? 395.176 -9.708  610.676 1.00 144.35 ? 217  LYS A CD    1 
ATOM   1431  C  CE    . LYS A 1  217  ? 395.107 -10.680 609.510 1.00 145.91 ? 217  LYS A CE    1 
ATOM   1432  N  NZ    . LYS A 1  217  ? 393.729 -10.781 608.955 1.00 149.77 ? 217  LYS A NZ    1 
ATOM   1433  N  N     . ASP A 1  218  ? 397.296 -5.289  611.210 1.00 131.65 ? 218  ASP A N     1 
ATOM   1434  C  CA    . ASP A 1  218  ? 398.214 -4.584  610.323 1.00 132.01 ? 218  ASP A CA    1 
ATOM   1435  C  C     . ASP A 1  218  ? 399.649 -4.614  610.844 1.00 127.78 ? 218  ASP A C     1 
ATOM   1436  O  O     . ASP A 1  218  ? 400.589 -4.377  610.088 1.00 124.29 ? 218  ASP A O     1 
ATOM   1437  C  CB    . ASP A 1  218  ? 397.761 -3.136  610.128 1.00 134.43 ? 218  ASP A CB    1 
ATOM   1438  C  CG    . ASP A 1  218  ? 396.426 -3.032  609.415 1.00 137.25 ? 218  ASP A CG    1 
ATOM   1439  O  OD1   . ASP A 1  218  ? 396.144 -3.888  608.550 1.00 136.51 ? 218  ASP A OD1   1 
ATOM   1440  O  OD2   . ASP A 1  218  ? 395.659 -2.093  609.719 1.00 139.51 ? 218  ASP A OD2   1 
ATOM   1441  N  N     . PHE A 1  219  ? 399.813 -4.906  612.132 1.00 155.61 ? 219  PHE A N     1 
ATOM   1442  C  CA    . PHE A 1  219  ? 401.142 -4.977  612.738 1.00 148.93 ? 219  PHE A CA    1 
ATOM   1443  C  C     . PHE A 1  219  ? 401.924 -6.186  612.238 1.00 146.12 ? 219  PHE A C     1 
ATOM   1444  O  O     . PHE A 1  219  ? 403.117 -6.090  611.951 1.00 142.75 ? 219  PHE A O     1 
ATOM   1445  C  CB    . PHE A 1  219  ? 401.041 -5.027  614.264 1.00 148.00 ? 219  PHE A CB    1 
ATOM   1446  C  CG    . PHE A 1  219  ? 400.644 -3.722  614.891 1.00 150.36 ? 219  PHE A CG    1 
ATOM   1447  C  CD1   . PHE A 1  219  ? 400.721 -2.541  614.174 1.00 152.04 ? 219  PHE A CD1   1 
ATOM   1448  C  CD2   . PHE A 1  219  ? 400.199 -3.677  616.202 1.00 152.34 ? 219  PHE A CD2   1 
ATOM   1449  C  CE1   . PHE A 1  219  ? 400.357 -1.340  614.751 1.00 157.10 ? 219  PHE A CE1   1 
ATOM   1450  C  CE2   . PHE A 1  219  ? 399.834 -2.479  616.784 1.00 157.47 ? 219  PHE A CE2   1 
ATOM   1451  C  CZ    . PHE A 1  219  ? 399.913 -1.309  616.057 1.00 158.49 ? 219  PHE A CZ    1 
ATOM   1452  N  N     . THR A 1  220  ? 401.243 -7.323  612.140 1.00 166.57 ? 220  THR A N     1 
ATOM   1453  C  CA    . THR A 1  220  ? 401.868 -8.563  611.697 1.00 165.69 ? 220  THR A CA    1 
ATOM   1454  C  C     . THR A 1  220  ? 402.281 -8.470  610.229 1.00 166.59 ? 220  THR A C     1 
ATOM   1455  O  O     . THR A 1  220  ? 403.150 -9.209  609.767 1.00 164.13 ? 220  THR A O     1 
ATOM   1456  C  CB    . THR A 1  220  ? 400.921 -9.767  611.891 1.00 165.18 ? 220  THR A CB    1 
ATOM   1457  O  OG1   . THR A 1  220  ? 400.270 -9.667  613.164 1.00 164.12 ? 220  THR A OG1   1 
ATOM   1458  C  CG2   . THR A 1  220  ? 401.689 -11.081 611.819 1.00 158.54 ? 220  THR A CG2   1 
ATOM   1459  N  N     . SER A 1  221  ? 401.661 -7.545  609.504 1.00 176.92 ? 221  SER A N     1 
ATOM   1460  C  CA    . SER A 1  221  ? 401.913 -7.391  608.077 1.00 176.28 ? 221  SER A CA    1 
ATOM   1461  C  C     . SER A 1  221  ? 403.196 -6.616  607.782 1.00 172.45 ? 221  SER A C     1 
ATOM   1462  O  O     . SER A 1  221  ? 403.627 -6.544  606.633 1.00 172.23 ? 221  SER A O     1 
ATOM   1463  C  CB    . SER A 1  221  ? 400.726 -6.698  607.404 1.00 185.49 ? 221  SER A CB    1 
ATOM   1464  O  OG    . SER A 1  221  ? 400.511 -5.408  607.948 1.00 188.08 ? 221  SER A OG    1 
ATOM   1465  N  N     . LEU A 1  222  ? 403.809 -6.038  608.811 1.00 96.43  ? 222  LEU A N     1 
ATOM   1466  C  CA    . LEU A 1  222  ? 405.026 -5.257  608.607 1.00 94.71  ? 222  LEU A CA    1 
ATOM   1467  C  C     . LEU A 1  222  ? 406.026 -5.355  609.761 1.00 91.87  ? 222  LEU A C     1 
ATOM   1468  O  O     . LEU A 1  222  ? 406.577 -4.346  610.204 1.00 91.28  ? 222  LEU A O     1 
ATOM   1469  C  CB    . LEU A 1  222  ? 404.673 -3.787  608.347 1.00 96.74  ? 222  LEU A CB    1 
ATOM   1470  C  CG    . LEU A 1  222  ? 403.398 -3.207  608.965 1.00 99.33  ? 222  LEU A CG    1 
ATOM   1471  C  CD1   . LEU A 1  222  ? 403.497 -3.125  610.479 1.00 98.19  ? 222  LEU A CD1   1 
ATOM   1472  C  CD2   . LEU A 1  222  ? 403.095 -1.839  608.373 1.00 101.52 ? 222  LEU A CD2   1 
ATOM   1473  N  N     . GLY A 1  223  ? 406.256 -6.574  610.242 1.00 120.06 ? 223  GLY A N     1 
ATOM   1474  C  CA    . GLY A 1  223  ? 407.344 -6.836  611.168 1.00 115.32 ? 223  GLY A CA    1 
ATOM   1475  C  C     . GLY A 1  223  ? 407.032 -6.767  612.651 1.00 112.94 ? 223  GLY A C     1 
ATOM   1476  O  O     . GLY A 1  223  ? 407.521 -7.590  613.426 1.00 112.16 ? 223  GLY A O     1 
ATOM   1477  N  N     . PHE A 1  224  ? 406.227 -5.787  613.051 1.00 106.80 ? 224  PHE A N     1 
ATOM   1478  C  CA    . PHE A 1  224  ? 405.966 -5.535  614.468 1.00 105.18 ? 224  PHE A CA    1 
ATOM   1479  C  C     . PHE A 1  224  ? 405.262 -6.696  615.168 1.00 105.72 ? 224  PHE A C     1 
ATOM   1480  O  O     . PHE A 1  224  ? 404.657 -7.553  614.524 1.00 107.70 ? 224  PHE A O     1 
ATOM   1481  C  CB    . PHE A 1  224  ? 405.143 -4.258  614.632 1.00 106.97 ? 224  PHE A CB    1 
ATOM   1482  C  CG    . PHE A 1  224  ? 405.888 -3.010  614.260 1.00 107.24 ? 224  PHE A CG    1 
ATOM   1483  C  CD1   . PHE A 1  224  ? 406.647 -2.335  615.199 1.00 107.50 ? 224  PHE A CD1   1 
ATOM   1484  C  CD2   . PHE A 1  224  ? 405.836 -2.517  612.968 1.00 108.07 ? 224  PHE A CD2   1 
ATOM   1485  C  CE1   . PHE A 1  224  ? 407.335 -1.187  614.858 1.00 108.02 ? 224  PHE A CE1   1 
ATOM   1486  C  CE2   . PHE A 1  224  ? 406.520 -1.370  612.619 1.00 109.87 ? 224  PHE A CE2   1 
ATOM   1487  C  CZ    . PHE A 1  224  ? 407.271 -0.705  613.565 1.00 108.60 ? 224  PHE A CZ    1 
ATOM   1488  N  N     . ASN A 1  225  ? 405.348 -6.709  616.495 1.00 113.39 ? 225  ASN A N     1 
ATOM   1489  C  CA    . ASN A 1  225  ? 404.801 -7.796  617.298 1.00 112.94 ? 225  ASN A CA    1 
ATOM   1490  C  C     . ASN A 1  225  ? 403.573 -7.359  618.097 1.00 118.47 ? 225  ASN A C     1 
ATOM   1491  O  O     . ASN A 1  225  ? 403.247 -6.173  618.153 1.00 122.11 ? 225  ASN A O     1 
ATOM   1492  C  CB    . ASN A 1  225  ? 405.878 -8.343  618.241 1.00 110.10 ? 225  ASN A CB    1 
ATOM   1493  C  CG    . ASN A 1  225  ? 405.551 -9.728  618.764 1.00 110.99 ? 225  ASN A CG    1 
ATOM   1494  O  OD1   . ASN A 1  225  ? 404.872 -9.876  619.780 1.00 113.40 ? 225  ASN A OD1   1 
ATOM   1495  N  ND2   . ASN A 1  225  ? 406.036 -10.752 618.071 1.00 106.25 ? 225  ASN A ND2   1 
ATOM   1496  N  N     . GLU A 1  226  ? 402.897 -8.326  618.709 1.00 129.29 ? 226  GLU A N     1 
ATOM   1497  C  CA    . GLU A 1  226  ? 401.690 -8.063  619.483 1.00 134.08 ? 226  GLU A CA    1 
ATOM   1498  C  C     . GLU A 1  226  ? 401.983 -7.260  620.747 1.00 132.72 ? 226  GLU A C     1 
ATOM   1499  O  O     . GLU A 1  226  ? 401.726 -6.057  620.803 1.00 134.09 ? 226  GLU A O     1 
ATOM   1500  C  CB    . GLU A 1  226  ? 401.002 -9.380  619.852 1.00 135.82 ? 226  GLU A CB    1 
ATOM   1501  C  CG    . GLU A 1  226  ? 399.677 -9.219  620.584 1.00 139.57 ? 226  GLU A CG    1 
ATOM   1502  C  CD    . GLU A 1  226  ? 398.560 -8.742  619.677 1.00 141.69 ? 226  GLU A CD    1 
ATOM   1503  O  OE1   . GLU A 1  226  ? 398.436 -7.516  619.475 1.00 146.40 ? 226  GLU A OE1   1 
ATOM   1504  O  OE2   . GLU A 1  226  ? 397.806 -9.596  619.166 1.00 138.59 ? 226  GLU A OE2   1 
ATOM   1505  N  N     . VAL A 1  227  ? 402.526 -7.932  621.758 1.00 130.26 ? 227  VAL A N     1 
ATOM   1506  C  CA    . VAL A 1  227  ? 402.756 -7.311  623.058 1.00 132.38 ? 227  VAL A CA    1 
ATOM   1507  C  C     . VAL A 1  227  ? 404.229 -6.995  623.303 1.00 128.70 ? 227  VAL A C     1 
ATOM   1508  O  O     . VAL A 1  227  ? 404.625 -6.697  624.431 1.00 127.46 ? 227  VAL A O     1 
ATOM   1509  C  CB    . VAL A 1  227  ? 402.248 -8.211  624.202 1.00 129.99 ? 227  VAL A CB    1 
ATOM   1510  C  CG1   . VAL A 1  227  ? 400.734 -8.351  624.138 1.00 133.93 ? 227  VAL A CG1   1 
ATOM   1511  C  CG2   . VAL A 1  227  ? 402.921 -9.575  624.144 1.00 121.83 ? 227  VAL A CG2   1 
ATOM   1512  N  N     . PHE A 1  228  ? 405.037 -7.056  622.249 1.00 111.20 ? 228  PHE A N     1 
ATOM   1513  C  CA    . PHE A 1  228  ? 406.469 -6.798  622.374 1.00 105.17 ? 228  PHE A CA    1 
ATOM   1514  C  C     . PHE A 1  228  ? 406.868 -5.452  621.779 1.00 106.88 ? 228  PHE A C     1 
ATOM   1515  O  O     . PHE A 1  228  ? 407.444 -4.609  622.466 1.00 108.65 ? 228  PHE A O     1 
ATOM   1516  C  CB    . PHE A 1  228  ? 407.274 -7.917  621.709 1.00 101.24 ? 228  PHE A CB    1 
ATOM   1517  C  CG    . PHE A 1  228  ? 407.440 -9.137  622.568 1.00 98.74  ? 228  PHE A CG    1 
ATOM   1518  C  CD1   . PHE A 1  228  ? 407.411 -9.037  623.949 1.00 99.42  ? 228  PHE A CD1   1 
ATOM   1519  C  CD2   . PHE A 1  228  ? 407.626 -10.384 621.995 1.00 96.40  ? 228  PHE A CD2   1 
ATOM   1520  C  CE1   . PHE A 1  228  ? 407.564 -10.157 624.743 1.00 97.14  ? 228  PHE A CE1   1 
ATOM   1521  C  CE2   . PHE A 1  228  ? 407.780 -11.508 622.784 1.00 95.31  ? 228  PHE A CE2   1 
ATOM   1522  C  CZ    . PHE A 1  228  ? 407.749 -11.394 624.160 1.00 95.54  ? 228  PHE A CZ    1 
ATOM   1523  N  N     . SER A 1  229  ? 406.564 -5.255  620.500 1.00 103.87 ? 229  SER A N     1 
ATOM   1524  C  CA    . SER A 1  229  ? 406.942 -4.024  619.816 1.00 105.28 ? 229  SER A CA    1 
ATOM   1525  C  C     . SER A 1  229  ? 405.829 -3.507  618.910 1.00 110.44 ? 229  SER A C     1 
ATOM   1526  O  O     . SER A 1  229  ? 405.418 -4.177  617.963 1.00 109.58 ? 229  SER A O     1 
ATOM   1527  C  CB    . SER A 1  229  ? 408.218 -4.239  619.000 1.00 102.00 ? 229  SER A CB    1 
ATOM   1528  O  OG    . SER A 1  229  ? 408.035 -5.247  618.022 1.00 104.61 ? 229  SER A OG    1 
ATOM   1529  N  N     . ARG A 1  230  ? 405.346 -2.306  619.214 1.00 126.68 ? 230  ARG A N     1 
ATOM   1530  C  CA    . ARG A 1  230  ? 404.335 -1.647  618.398 1.00 128.74 ? 230  ARG A CA    1 
ATOM   1531  C  C     . ARG A 1  230  ? 404.838 -0.284  617.935 1.00 127.88 ? 230  ARG A C     1 
ATOM   1532  O  O     . ARG A 1  230  ? 405.629 0.355   618.631 1.00 128.17 ? 230  ARG A O     1 
ATOM   1533  C  CB    . ARG A 1  230  ? 403.027 -1.488  619.178 1.00 133.78 ? 230  ARG A CB    1 
ATOM   1534  C  CG    . ARG A 1  230  ? 402.294 -2.788  619.466 1.00 135.49 ? 230  ARG A CG    1 
ATOM   1535  C  CD    . ARG A 1  230  ? 400.974 -2.516  620.173 1.00 140.04 ? 230  ARG A CD    1 
ATOM   1536  N  NE    . ARG A 1  230  ? 400.172 -3.724  620.336 1.00 140.91 ? 230  ARG A NE    1 
ATOM   1537  C  CZ    . ARG A 1  230  ? 398.949 -3.742  620.857 1.00 146.06 ? 230  ARG A CZ    1 
ATOM   1538  N  NH1   . ARG A 1  230  ? 398.384 -2.614  621.266 1.00 149.27 ? 230  ARG A NH1   1 
ATOM   1539  N  NH2   . ARG A 1  230  ? 398.289 -4.887  620.969 1.00 148.25 ? 230  ARG A NH2   1 
ATOM   1540  N  N     . PRO A 1  231  ? 404.388 0.164   616.752 1.00 96.15  ? 231  PRO A N     1 
ATOM   1541  C  CA    . PRO A 1  231  ? 404.720 1.502   616.249 1.00 96.96  ? 231  PRO A CA    1 
ATOM   1542  C  C     . PRO A 1  231  ? 404.278 2.601   617.213 1.00 98.55  ? 231  PRO A C     1 
ATOM   1543  O  O     . PRO A 1  231  ? 404.887 3.669   617.257 1.00 98.43  ? 231  PRO A O     1 
ATOM   1544  C  CB    . PRO A 1  231  ? 403.943 1.585   614.931 1.00 99.15  ? 231  PRO A CB    1 
ATOM   1545  C  CG    . PRO A 1  231  ? 403.788 0.169   614.501 1.00 98.31  ? 231  PRO A CG    1 
ATOM   1546  C  CD    . PRO A 1  231  ? 403.617 -0.616  615.769 1.00 97.37  ? 231  PRO A CD    1 
ATOM   1547  N  N     . GLU A 1  232  ? 403.231 2.323   617.985 1.00 162.50 ? 232  GLU A N     1 
ATOM   1548  C  CA    . GLU A 1  232  ? 402.724 3.263   618.979 1.00 165.01 ? 232  GLU A CA    1 
ATOM   1549  C  C     . GLU A 1  232  ? 403.600 3.280   620.230 1.00 163.47 ? 232  GLU A C     1 
ATOM   1550  O  O     . GLU A 1  232  ? 403.267 3.930   621.222 1.00 165.27 ? 232  GLU A O     1 
ATOM   1551  C  CB    . GLU A 1  232  ? 401.283 2.914   619.355 1.00 169.63 ? 232  GLU A CB    1 
ATOM   1552  C  CG    . GLU A 1  232  ? 401.138 1.572   620.056 1.00 168.45 ? 232  GLU A CG    1 
ATOM   1553  C  CD    . GLU A 1  232  ? 399.694 1.211   620.338 1.00 172.80 ? 232  GLU A CD    1 
ATOM   1554  O  OE1   . GLU A 1  232  ? 398.934 0.990   619.372 1.00 175.05 ? 232  GLU A OE1   1 
ATOM   1555  O  OE2   . GLU A 1  232  ? 399.317 1.149   621.528 1.00 173.49 ? 232  GLU A OE2   1 
ATOM   1556  N  N     . TRP A 1  233  ? 404.713 2.555   620.179 1.00 143.04 ? 233  TRP A N     1 
ATOM   1557  C  CA    . TRP A 1  233  ? 405.655 2.503   621.290 1.00 139.77 ? 233  TRP A CA    1 
ATOM   1558  C  C     . TRP A 1  233  ? 407.033 2.995   620.855 1.00 135.92 ? 233  TRP A C     1 
ATOM   1559  O  O     . TRP A 1  233  ? 407.928 3.168   621.682 1.00 135.05 ? 233  TRP A O     1 
ATOM   1560  C  CB    . TRP A 1  233  ? 405.751 1.081   621.849 1.00 136.31 ? 233  TRP A CB    1 
ATOM   1561  C  CG    . TRP A 1  233  ? 404.472 0.585   622.456 1.00 139.25 ? 233  TRP A CG    1 
ATOM   1562  C  CD1   . TRP A 1  233  ? 403.422 1.342   622.887 1.00 144.99 ? 233  TRP A CD1   1 
ATOM   1563  C  CD2   . TRP A 1  233  ? 404.105 -0.780  622.690 1.00 139.12 ? 233  TRP A CD2   1 
ATOM   1564  N  NE1   . TRP A 1  233  ? 402.425 0.534   623.379 1.00 147.65 ? 233  TRP A NE1   1 
ATOM   1565  C  CE2   . TRP A 1  233  ? 402.819 -0.773  623.268 1.00 144.63 ? 233  TRP A CE2   1 
ATOM   1566  C  CE3   . TRP A 1  233  ? 404.738 -2.007  622.469 1.00 136.63 ? 233  TRP A CE3   1 
ATOM   1567  C  CZ2   . TRP A 1  233  ? 402.156 -1.945  623.629 1.00 146.93 ? 233  TRP A CZ2   1 
ATOM   1568  C  CZ3   . TRP A 1  233  ? 404.078 -3.169  622.827 1.00 135.94 ? 233  TRP A CZ3   1 
ATOM   1569  C  CH2   . TRP A 1  233  ? 402.801 -3.130  623.401 1.00 141.51 ? 233  TRP A CH2   1 
ATOM   1570  N  N     . MET A 1  234  ? 407.197 3.216   619.554 1.00 136.50 ? 234  MET A N     1 
ATOM   1571  C  CA    . MET A 1  234  ? 408.446 3.747   619.018 1.00 133.36 ? 234  MET A CA    1 
ATOM   1572  C  C     . MET A 1  234  ? 408.646 5.183   619.481 1.00 138.35 ? 234  MET A C     1 
ATOM   1573  O  O     . MET A 1  234  ? 409.724 5.552   619.947 1.00 136.92 ? 234  MET A O     1 
ATOM   1574  C  CB    . MET A 1  234  ? 408.459 3.681   617.490 1.00 132.23 ? 234  MET A CB    1 
ATOM   1575  C  CG    . MET A 1  234  ? 408.200 2.298   616.925 1.00 133.34 ? 234  MET A CG    1 
ATOM   1576  S  SD    . MET A 1  234  ? 408.225 2.261   615.122 1.00 137.02 ? 234  MET A SD    1 
ATOM   1577  C  CE    . MET A 1  234  ? 409.980 2.402   614.802 1.00 129.33 ? 234  MET A CE    1 
ATOM   1578  N  N     . ILE A 1  235  ? 407.599 5.991   619.345 1.00 142.25 ? 235  ILE A N     1 
ATOM   1579  C  CA    . ILE A 1  235  ? 407.621 7.359   619.842 1.00 144.00 ? 235  ILE A CA    1 
ATOM   1580  C  C     . ILE A 1  235  ? 407.702 7.353   621.366 1.00 142.50 ? 235  ILE A C     1 
ATOM   1581  O  O     . ILE A 1  235  ? 407.221 6.427   622.019 1.00 139.49 ? 235  ILE A O     1 
ATOM   1582  C  CB    . ILE A 1  235  ? 406.384 8.156   619.376 1.00 146.34 ? 235  ILE A CB    1 
ATOM   1583  C  CG1   . ILE A 1  235  ? 405.195 7.222   619.135 1.00 147.41 ? 235  ILE A CG1   1 
ATOM   1584  C  CG2   . ILE A 1  235  ? 406.693 8.910   618.098 1.00 144.71 ? 235  ILE A CG2   1 
ATOM   1585  C  CD1   . ILE A 1  235  ? 404.498 6.765   620.392 1.00 147.35 ? 235  ILE A CD1   1 
ATOM   1586  N  N     . LEU A 1  236  ? 408.319 8.386   621.929 1.00 97.41  ? 236  LEU A N     1 
ATOM   1587  C  CA    . LEU A 1  236  ? 408.586 8.414   623.361 1.00 96.75  ? 236  LEU A CA    1 
ATOM   1588  C  C     . LEU A 1  236  ? 407.603 9.293   624.128 1.00 99.56  ? 236  LEU A C     1 
ATOM   1589  O  O     . LEU A 1  236  ? 407.787 10.505  624.229 1.00 100.74 ? 236  LEU A O     1 
ATOM   1590  C  CB    . LEU A 1  236  ? 410.017 8.889   623.617 1.00 94.72  ? 236  LEU A CB    1 
ATOM   1591  C  CG    . LEU A 1  236  ? 411.117 8.046   622.967 1.00 91.83  ? 236  LEU A CG    1 
ATOM   1592  C  CD1   . LEU A 1  236  ? 412.493 8.602   623.298 1.00 90.10  ? 236  LEU A CD1   1 
ATOM   1593  C  CD2   . LEU A 1  236  ? 411.007 6.591   623.398 1.00 90.25  ? 236  LEU A CD2   1 
ATOM   1594  N  N     . THR A 1  237  ? 406.558 8.671   624.665 1.00 120.54 ? 237  THR A N     1 
ATOM   1595  C  CA    . THR A 1  237  ? 405.620 9.367   625.535 1.00 122.99 ? 237  THR A CA    1 
ATOM   1596  C  C     . THR A 1  237  ? 406.327 9.737   626.832 1.00 122.17 ? 237  THR A C     1 
ATOM   1597  O  O     . THR A 1  237  ? 406.565 10.911  627.112 1.00 123.53 ? 237  THR A O     1 
ATOM   1598  C  CB    . THR A 1  237  ? 404.379 8.510   625.844 1.00 122.85 ? 237  THR A CB    1 
ATOM   1599  O  OG1   . THR A 1  237  ? 403.767 8.088   624.619 1.00 125.81 ? 237  THR A OG1   1 
ATOM   1600  C  CG2   . THR A 1  237  ? 403.372 9.301   626.667 1.00 124.49 ? 237  THR A CG2   1 
ATOM   1601  N  N     . CYS A 1  238  ? 406.661 8.720   627.619 1.00 158.05 ? 238  CYS A N     1 
ATOM   1602  C  CA    . CYS A 1  238  ? 407.471 8.899   628.817 1.00 158.83 ? 238  CYS A CA    1 
ATOM   1603  C  C     . CYS A 1  238  ? 408.710 8.021   628.711 1.00 154.43 ? 238  CYS A C     1 
ATOM   1604  O  O     . CYS A 1  238  ? 408.625 6.878   628.262 1.00 151.14 ? 238  CYS A O     1 
ATOM   1605  C  CB    . CYS A 1  238  ? 406.673 8.558   630.076 1.00 161.87 ? 238  CYS A CB    1 
ATOM   1606  S  SG    . CYS A 1  238  ? 406.085 6.851   630.162 1.00 164.22 ? 238  CYS A SG    1 
ATOM   1607  N  N     . LEU A 1  239  ? 409.862 8.547   629.116 1.00 119.50 ? 239  LEU A N     1 
ATOM   1608  C  CA    . LEU A 1  239  ? 411.103 7.796   628.945 1.00 113.29 ? 239  LEU A CA    1 
ATOM   1609  C  C     . LEU A 1  239  ? 411.691 7.354   630.283 1.00 112.29 ? 239  LEU A C     1 
ATOM   1610  O  O     . LEU A 1  239  ? 411.589 8.069   631.281 1.00 114.23 ? 239  LEU A O     1 
ATOM   1611  C  CB    . LEU A 1  239  ? 412.126 8.622   628.150 1.00 110.52 ? 239  LEU A CB    1 
ATOM   1612  C  CG    . LEU A 1  239  ? 412.739 9.887   628.753 1.00 113.48 ? 239  LEU A CG    1 
ATOM   1613  C  CD1   . LEU A 1  239  ? 414.083 9.588   629.404 1.00 108.69 ? 239  LEU A CD1   1 
ATOM   1614  C  CD2   . LEU A 1  239  ? 412.885 10.964  627.691 1.00 115.59 ? 239  LEU A CD2   1 
ATOM   1615  N  N     . PRO A 1  240  ? 412.301 6.158   630.305 1.00 118.03 ? 240  PRO A N     1 
ATOM   1616  C  CA    . PRO A 1  240  ? 412.891 5.593   631.523 1.00 118.02 ? 240  PRO A CA    1 
ATOM   1617  C  C     . PRO A 1  240  ? 414.129 6.352   631.983 1.00 117.35 ? 240  PRO A C     1 
ATOM   1618  O  O     . PRO A 1  240  ? 414.847 6.923   631.163 1.00 115.02 ? 240  PRO A O     1 
ATOM   1619  C  CB    . PRO A 1  240  ? 413.254 4.165   631.105 1.00 110.17 ? 240  PRO A CB    1 
ATOM   1620  C  CG    . PRO A 1  240  ? 413.455 4.251   629.634 1.00 110.42 ? 240  PRO A CG    1 
ATOM   1621  C  CD    . PRO A 1  240  ? 412.445 5.249   629.154 1.00 114.05 ? 240  PRO A CD    1 
ATOM   1622  N  N     . VAL A 1  241  ? 414.370 6.351   633.290 1.00 115.57 ? 241  VAL A N     1 
ATOM   1623  C  CA    . VAL A 1  241  ? 415.534 7.020   633.857 1.00 113.31 ? 241  VAL A CA    1 
ATOM   1624  C  C     . VAL A 1  241  ? 416.535 6.000   634.387 1.00 110.03 ? 241  VAL A C     1 
ATOM   1625  O  O     . VAL A 1  241  ? 416.241 5.269   635.336 1.00 108.05 ? 241  VAL A O     1 
ATOM   1626  C  CB    . VAL A 1  241  ? 415.134 7.984   634.987 1.00 114.35 ? 241  VAL A CB    1 
ATOM   1627  C  CG1   . VAL A 1  241  ? 416.370 8.602   635.620 1.00 113.58 ? 241  VAL A CG1   1 
ATOM   1628  C  CG2   . VAL A 1  241  ? 414.206 9.061   634.452 1.00 119.61 ? 241  VAL A CG2   1 
ATOM   1629  N  N     . PRO A 1  242  ? 417.726 5.948   633.769 1.00 78.04  ? 242  PRO A N     1 
ATOM   1630  C  CA    . PRO A 1  242  ? 418.785 4.994   634.119 1.00 75.45  ? 242  PRO A CA    1 
ATOM   1631  C  C     . PRO A 1  242  ? 419.360 5.227   635.514 1.00 75.36  ? 242  PRO A C     1 
ATOM   1632  O  O     . PRO A 1  242  ? 419.656 6.367   635.874 1.00 76.38  ? 242  PRO A O     1 
ATOM   1633  C  CB    . PRO A 1  242  ? 419.848 5.242   633.045 1.00 73.80  ? 242  PRO A CB    1 
ATOM   1634  C  CG    . PRO A 1  242  ? 419.616 6.644   632.605 1.00 75.65  ? 242  PRO A CG    1 
ATOM   1635  C  CD    . PRO A 1  242  ? 418.132 6.841   632.669 1.00 78.13  ? 242  PRO A CD    1 
ATOM   1636  N  N     . PRO A 1  243  ? 419.515 4.146   636.291 1.00 89.07  ? 243  PRO A N     1 
ATOM   1637  C  CA    . PRO A 1  243  ? 420.031 4.165   637.665 1.00 90.66  ? 243  PRO A CA    1 
ATOM   1638  C  C     . PRO A 1  243  ? 421.459 4.702   637.759 1.00 90.05  ? 243  PRO A C     1 
ATOM   1639  O  O     . PRO A 1  243  ? 422.179 4.687   636.761 1.00 90.76  ? 243  PRO A O     1 
ATOM   1640  C  CB    . PRO A 1  243  ? 419.979 2.688   638.077 1.00 89.11  ? 243  PRO A CB    1 
ATOM   1641  C  CG    . PRO A 1  243  ? 418.966 2.074   637.172 1.00 91.36  ? 243  PRO A CG    1 
ATOM   1642  C  CD    . PRO A 1  243  ? 419.125 2.789   635.872 1.00 89.64  ? 243  PRO A CD    1 
ATOM   1643  N  N     . PRO A 1  244  ? 421.860 5.177   638.950 1.00 73.27  ? 244  PRO A N     1 
ATOM   1644  C  CA    . PRO A 1  244  ? 423.219 5.665   639.226 1.00 72.08  ? 244  PRO A CA    1 
ATOM   1645  C  C     . PRO A 1  244  ? 424.374 4.713   638.851 1.00 69.23  ? 244  PRO A C     1 
ATOM   1646  O  O     . PRO A 1  244  ? 425.428 5.218   638.467 1.00 68.21  ? 244  PRO A O     1 
ATOM   1647  C  CB    . PRO A 1  244  ? 423.194 5.905   640.739 1.00 73.27  ? 244  PRO A CB    1 
ATOM   1648  C  CG    . PRO A 1  244  ? 421.781 6.251   641.025 1.00 75.82  ? 244  PRO A CG    1 
ATOM   1649  C  CD    . PRO A 1  244  ? 420.960 5.396   640.098 1.00 75.44  ? 244  PRO A CD    1 
ATOM   1650  N  N     . PRO A 1  245  ? 424.204 3.379   638.972 1.00 82.31  ? 245  PRO A N     1 
ATOM   1651  C  CA    . PRO A 1  245  ? 425.314 2.538   638.501 1.00 80.84  ? 245  PRO A CA    1 
ATOM   1652  C  C     . PRO A 1  245  ? 425.635 2.687   637.010 1.00 80.24  ? 245  PRO A C     1 
ATOM   1653  O  O     . PRO A 1  245  ? 426.724 2.303   636.584 1.00 78.03  ? 245  PRO A O     1 
ATOM   1654  C  CB    . PRO A 1  245  ? 424.824 1.121   638.804 1.00 78.72  ? 245  PRO A CB    1 
ATOM   1655  C  CG    . PRO A 1  245  ? 423.940 1.288   639.977 1.00 78.82  ? 245  PRO A CG    1 
ATOM   1656  C  CD    . PRO A 1  245  ? 423.229 2.590   639.750 1.00 84.91  ? 245  PRO A CD    1 
ATOM   1657  N  N     . VAL A 1  246  ? 424.703 3.231   636.233 1.00 65.89  ? 246  VAL A N     1 
ATOM   1658  C  CA    . VAL A 1  246  ? 424.946 3.486   634.817 1.00 65.28  ? 246  VAL A CA    1 
ATOM   1659  C  C     . VAL A 1  246  ? 425.679 4.814   634.642 1.00 65.73  ? 246  VAL A C     1 
ATOM   1660  O  O     . VAL A 1  246  ? 426.509 4.967   633.745 1.00 64.53  ? 246  VAL A O     1 
ATOM   1661  C  CB    . VAL A 1  246  ? 423.632 3.511   634.010 1.00 66.79  ? 246  VAL A CB    1 
ATOM   1662  C  CG1   . VAL A 1  246  ? 423.916 3.680   632.525 1.00 66.13  ? 246  VAL A CG1   1 
ATOM   1663  C  CG2   . VAL A 1  246  ? 422.836 2.240   634.255 1.00 66.62  ? 246  VAL A CG2   1 
ATOM   1664  N  N     . ARG A 1  247  ? 425.374 5.768   635.516 1.00 75.51  ? 247  ARG A N     1 
ATOM   1665  C  CA    . ARG A 1  247  ? 425.993 7.089   635.469 1.00 79.36  ? 247  ARG A CA    1 
ATOM   1666  C  C     . ARG A 1  247  ? 426.584 7.482   636.825 1.00 80.01  ? 247  ARG A C     1 
ATOM   1667  O  O     . ARG A 1  247  ? 426.038 8.338   637.522 1.00 81.83  ? 247  ARG A O     1 
ATOM   1668  C  CB    . ARG A 1  247  ? 424.969 8.132   635.014 1.00 82.01  ? 247  ARG A CB    1 
ATOM   1669  C  CG    . ARG A 1  247  ? 423.578 7.917   635.595 1.00 83.52  ? 247  ARG A CG    1 
ATOM   1670  C  CD    . ARG A 1  247  ? 422.599 8.979   635.130 1.00 86.07  ? 247  ARG A CD    1 
ATOM   1671  N  NE    . ARG A 1  247  ? 421.272 8.767   635.698 1.00 86.69  ? 247  ARG A NE    1 
ATOM   1672  C  CZ    . ARG A 1  247  ? 420.890 9.218   636.888 1.00 89.66  ? 247  ARG A CZ    1 
ATOM   1673  N  NH1   . ARG A 1  247  ? 421.736 9.909   637.639 1.00 91.06  ? 247  ARG A NH1   1 
ATOM   1674  N  NH2   . ARG A 1  247  ? 419.662 8.978   637.329 1.00 93.41  ? 247  ARG A NH2   1 
ATOM   1675  N  N     . PRO A 1  248  ? 427.714 6.858   637.199 1.00 74.86  ? 248  PRO A N     1 
ATOM   1676  C  CA    . PRO A 1  248  ? 428.339 7.057   638.513 1.00 74.99  ? 248  PRO A CA    1 
ATOM   1677  C  C     . PRO A 1  248  ? 428.812 8.489   638.744 1.00 76.33  ? 248  PRO A C     1 
ATOM   1678  O  O     . PRO A 1  248  ? 428.831 9.295   637.815 1.00 76.86  ? 248  PRO A O     1 
ATOM   1679  C  CB    . PRO A 1  248  ? 429.535 6.095   638.485 1.00 72.39  ? 248  PRO A CB    1 
ATOM   1680  C  CG    . PRO A 1  248  ? 429.226 5.117   637.398 1.00 71.06  ? 248  PRO A CG    1 
ATOM   1681  C  CD    . PRO A 1  248  ? 428.473 5.902   636.376 1.00 72.42  ? 248  PRO A CD    1 
ATOM   1682  N  N     . SER A 1  249  ? 429.192 8.794   639.981 1.00 97.68  ? 249  SER A N     1 
ATOM   1683  C  CA    . SER A 1  249  ? 429.680 10.123  640.328 1.00 101.44 ? 249  SER A CA    1 
ATOM   1684  C  C     . SER A 1  249  ? 431.056 10.044  640.980 1.00 104.41 ? 249  SER A C     1 
ATOM   1685  O  O     . SER A 1  249  ? 431.264 9.273   641.917 1.00 105.14 ? 249  SER A O     1 
ATOM   1686  C  CB    . SER A 1  249  ? 428.695 10.830  641.260 1.00 105.47 ? 249  SER A CB    1 
ATOM   1687  O  OG    . SER A 1  249  ? 427.419 10.950  640.657 1.00 108.21 ? 249  SER A OG    1 
ATOM   1688  N  N     . ILE A 1  250  ? 431.993 10.843  640.479 1.00 128.71 ? 250  ILE A N     1 
ATOM   1689  C  CA    . ILE A 1  250  ? 433.347 10.870  641.023 1.00 129.59 ? 250  ILE A CA    1 
ATOM   1690  C  C     . ILE A 1  250  ? 433.711 12.259  641.540 1.00 130.26 ? 250  ILE A C     1 
ATOM   1691  O  O     . ILE A 1  250  ? 433.328 13.272  640.954 1.00 132.87 ? 250  ILE A O     1 
ATOM   1692  C  CB    . ILE A 1  250  ? 434.388 10.436  639.972 1.00 126.41 ? 250  ILE A CB    1 
ATOM   1693  C  CG1   . ILE A 1  250  ? 434.062 9.039   639.441 1.00 123.36 ? 250  ILE A CG1   1 
ATOM   1694  C  CG2   . ILE A 1  250  ? 435.789 10.471  640.566 1.00 121.72 ? 250  ILE A CG2   1 
ATOM   1695  C  CD1   . ILE A 1  250  ? 434.059 7.965   640.506 1.00 119.88 ? 250  ILE A CD1   1 
ATOM   1696  N  N     . GLU A 1  259  ? 429.952 14.567  638.487 1.00 118.03 ? 259  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1  259  ? 428.791 13.874  637.943 1.00 116.57 ? 259  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1  259  ? 429.086 13.311  636.557 1.00 116.06 ? 259  GLU A C     1 
ATOM   1699  O  O     . GLU A 1  259  ? 430.041 13.725  635.899 1.00 115.04 ? 259  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1  259  ? 427.585 14.813  637.882 1.00 119.97 ? 259  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1  259  ? 427.188 15.410  639.224 1.00 125.67 ? 259  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1  259  ? 426.623 14.379  640.184 1.00 125.93 ? 259  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1  259  ? 426.152 13.319  639.718 1.00 122.46 ? 259  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1  259  ? 426.649 14.632  641.407 1.00 128.41 ? 259  GLU A OE2   1 
ATOM   1705  N  N     . ASP A 1  260  ? 428.260 12.366  636.119 1.00 109.57 ? 260  ASP A N     1 
ATOM   1706  C  CA    . ASP A 1  260  ? 428.428 11.746  634.810 1.00 106.96 ? 260  ASP A CA    1 
ATOM   1707  C  C     . ASP A 1  260  ? 427.697 12.549  633.736 1.00 109.39 ? 260  ASP A C     1 
ATOM   1708  O  O     . ASP A 1  260  ? 426.846 13.383  634.047 1.00 114.13 ? 260  ASP A O     1 
ATOM   1709  C  CB    . ASP A 1  260  ? 427.924 10.302  634.833 1.00 103.58 ? 260  ASP A CB    1 
ATOM   1710  C  CG    . ASP A 1  260  ? 428.398 9.498   633.639 1.00 104.29 ? 260  ASP A CG    1 
ATOM   1711  O  OD1   . ASP A 1  260  ? 427.734 9.553   632.583 1.00 105.15 ? 260  ASP A OD1   1 
ATOM   1712  O  OD2   . ASP A 1  260  ? 429.436 8.812   633.758 1.00 102.71 ? 260  ASP A OD2   1 
ATOM   1713  N  N     . ASP A 1  261  ? 428.034 12.294  632.475 1.00 104.41 ? 261  ASP A N     1 
ATOM   1714  C  CA    . ASP A 1  261  ? 427.435 13.015  631.356 1.00 108.44 ? 261  ASP A CA    1 
ATOM   1715  C  C     . ASP A 1  261  ? 425.941 12.729  631.225 1.00 108.00 ? 261  ASP A C     1 
ATOM   1716  O  O     . ASP A 1  261  ? 425.162 13.615  630.868 1.00 111.71 ? 261  ASP A O     1 
ATOM   1717  C  CB    . ASP A 1  261  ? 428.151 12.661  630.051 1.00 108.31 ? 261  ASP A CB    1 
ATOM   1718  C  CG    . ASP A 1  261  ? 429.603 13.095  630.048 1.00 109.32 ? 261  ASP A CG    1 
ATOM   1719  O  OD1   . ASP A 1  261  ? 430.209 13.157  631.139 1.00 106.99 ? 261  ASP A OD1   1 
ATOM   1720  O  OD2   . ASP A 1  261  ? 430.139 13.376  628.955 1.00 108.75 ? 261  ASP A OD2   1 
ATOM   1721  N  N     . LEU A 1  262  ? 425.547 11.493  631.517 1.00 94.73  ? 262  LEU A N     1 
ATOM   1722  C  CA    . LEU A 1  262  ? 424.144 11.101  631.441 1.00 95.58  ? 262  LEU A CA    1 
ATOM   1723  C  C     . LEU A 1  262  ? 423.299 11.874  632.446 1.00 99.13  ? 262  LEU A C     1 
ATOM   1724  O  O     . LEU A 1  262  ? 422.140 12.189  632.183 1.00 102.95 ? 262  LEU A O     1 
ATOM   1725  C  CB    . LEU A 1  262  ? 423.988 9.598   631.675 1.00 93.54  ? 262  LEU A CB    1 
ATOM   1726  C  CG    . LEU A 1  262  ? 424.633 8.667   630.647 1.00 92.80  ? 262  LEU A CG    1 
ATOM   1727  C  CD1   . LEU A 1  262  ? 424.233 7.226   630.920 1.00 91.23  ? 262  LEU A CD1   1 
ATOM   1728  C  CD2   . LEU A 1  262  ? 424.256 9.074   629.231 1.00 90.96  ? 262  LEU A CD2   1 
ATOM   1729  N  N     . THR A 1  263  ? 423.889 12.177  633.599 1.00 89.99  ? 263  THR A N     1 
ATOM   1730  C  CA    . THR A 1  263  ? 423.213 12.967  634.621 1.00 93.03  ? 263  THR A CA    1 
ATOM   1731  C  C     . THR A 1  263  ? 422.941 14.377  634.104 1.00 97.03  ? 263  THR A C     1 
ATOM   1732  O  O     . THR A 1  263  ? 421.849 14.922  634.290 1.00 100.81 ? 263  THR A O     1 
ATOM   1733  C  CB    . THR A 1  263  ? 424.044 13.041  635.918 1.00 93.20  ? 263  THR A CB    1 
ATOM   1734  O  OG1   . THR A 1  263  ? 424.337 11.716  636.378 1.00 88.52  ? 263  THR A OG1   1 
ATOM   1735  C  CG2   . THR A 1  263  ? 423.282 13.794  636.999 1.00 96.48  ? 263  THR A CG2   1 
ATOM   1736  N  N     . PHE A 1  264  ? 423.938 14.956  633.443 1.00 105.59 ? 264  PHE A N     1 
ATOM   1737  C  CA    . PHE A 1  264  ? 423.809 16.289  632.865 1.00 106.20 ? 264  PHE A CA    1 
ATOM   1738  C  C     . PHE A 1  264  ? 422.772 16.311  631.749 1.00 109.07 ? 264  PHE A C     1 
ATOM   1739  O  O     . PHE A 1  264  ? 421.978 17.245  631.650 1.00 114.84 ? 264  PHE A O     1 
ATOM   1740  C  CB    . PHE A 1  264  ? 425.158 16.779  632.334 1.00 105.47 ? 264  PHE A CB    1 
ATOM   1741  C  CG    . PHE A 1  264  ? 426.156 17.100  633.412 1.00 107.59 ? 264  PHE A CG    1 
ATOM   1742  C  CD1   . PHE A 1  264  ? 425.740 17.356  634.708 1.00 108.03 ? 264  PHE A CD1   1 
ATOM   1743  C  CD2   . PHE A 1  264  ? 427.511 17.149  633.127 1.00 105.59 ? 264  PHE A CD2   1 
ATOM   1744  C  CE1   . PHE A 1  264  ? 426.657 17.653  635.701 1.00 106.92 ? 264  PHE A CE1   1 
ATOM   1745  C  CE2   . PHE A 1  264  ? 428.433 17.445  634.115 1.00 104.59 ? 264  PHE A CE2   1 
ATOM   1746  C  CZ    . PHE A 1  264  ? 428.005 17.697  635.403 1.00 106.22 ? 264  PHE A CZ    1 
ATOM   1747  N  N     . LYS A 1  265  ? 422.780 15.278  630.912 1.00 101.93 ? 265  LYS A N     1 
ATOM   1748  C  CA    . LYS A 1  265  ? 421.842 15.197  629.798 1.00 103.73 ? 265  LYS A CA    1 
ATOM   1749  C  C     . LYS A 1  265  ? 420.408 15.016  630.284 1.00 106.40 ? 265  LYS A C     1 
ATOM   1750  O  O     . LYS A 1  265  ? 419.483 15.619  629.740 1.00 111.76 ? 265  LYS A O     1 
ATOM   1751  C  CB    . LYS A 1  265  ? 422.225 14.058  628.852 1.00 101.25 ? 265  LYS A CB    1 
ATOM   1752  C  CG    . LYS A 1  265  ? 423.539 14.283  628.122 1.00 103.13 ? 265  LYS A CG    1 
ATOM   1753  C  CD    . LYS A 1  265  ? 423.530 15.597  627.354 1.00 103.61 ? 265  LYS A CD    1 
ATOM   1754  C  CE    . LYS A 1  265  ? 422.481 15.591  626.254 1.00 102.71 ? 265  LYS A CE    1 
ATOM   1755  N  NZ    . LYS A 1  265  ? 422.711 14.484  625.289 1.00 103.93 ? 265  LYS A NZ    1 
ATOM   1756  N  N     . LEU A 1  266  ? 420.227 14.186  631.306 1.00 98.21  ? 266  LEU A N     1 
ATOM   1757  C  CA    . LEU A 1  266  ? 418.911 14.001  631.907 1.00 101.72 ? 266  LEU A CA    1 
ATOM   1758  C  C     . LEU A 1  266  ? 418.451 15.290  632.582 1.00 105.27 ? 266  LEU A C     1 
ATOM   1759  O  O     . LEU A 1  266  ? 417.260 15.613  632.583 1.00 107.86 ? 266  LEU A O     1 
ATOM   1760  C  CB    . LEU A 1  266  ? 418.929 12.848  632.913 1.00 100.37 ? 266  LEU A CB    1 
ATOM   1761  C  CG    . LEU A 1  266  ? 419.047 11.439  632.326 1.00 94.83  ? 266  LEU A CG    1 
ATOM   1762  C  CD1   . LEU A 1  266  ? 419.077 10.396  633.432 1.00 93.28  ? 266  LEU A CD1   1 
ATOM   1763  C  CD2   . LEU A 1  266  ? 417.910 11.161  631.354 1.00 94.15  ? 266  LEU A CD2   1 
ATOM   1764  N  N     . ALA A 1  267  ? 419.403 16.025  633.148 1.00 136.36 ? 267  ALA A N     1 
ATOM   1765  C  CA    . ALA A 1  267  ? 419.111 17.322  633.744 1.00 139.06 ? 267  ALA A CA    1 
ATOM   1766  C  C     . ALA A 1  267  ? 418.659 18.312  632.674 1.00 142.09 ? 267  ALA A C     1 
ATOM   1767  O  O     . ALA A 1  267  ? 417.797 19.156  632.920 1.00 147.86 ? 267  ALA A O     1 
ATOM   1768  C  CB    . ALA A 1  267  ? 420.327 17.856  634.485 1.00 138.24 ? 267  ALA A CB    1 
ATOM   1769  N  N     . ASP A 1  268  ? 419.245 18.199  631.485 1.00 92.71  ? 268  ASP A N     1 
ATOM   1770  C  CA    . ASP A 1  268  ? 418.879 19.052  630.359 1.00 94.37  ? 268  ASP A CA    1 
ATOM   1771  C  C     . ASP A 1  268  ? 417.487 18.709  629.843 1.00 95.82  ? 268  ASP A C     1 
ATOM   1772  O  O     . ASP A 1  268  ? 416.689 19.598  629.541 1.00 98.40  ? 268  ASP A O     1 
ATOM   1773  C  CB    . ASP A 1  268  ? 419.900 18.922  629.228 1.00 92.51  ? 268  ASP A CB    1 
ATOM   1774  C  CG    . ASP A 1  268  ? 421.280 19.401  629.629 1.00 91.38  ? 268  ASP A CG    1 
ATOM   1775  O  OD1   . ASP A 1  268  ? 421.377 20.227  630.562 1.00 92.75  ? 268  ASP A OD1   1 
ATOM   1776  O  OD2   . ASP A 1  268  ? 422.269 18.952  629.011 1.00 89.21  ? 268  ASP A OD2   1 
ATOM   1777  N  N     . ILE A 1  269  ? 417.207 17.414  629.738 1.00 93.72  ? 269  ILE A N     1 
ATOM   1778  C  CA    . ILE A 1  269  ? 415.898 16.942  629.303 1.00 94.96  ? 269  ILE A CA    1 
ATOM   1779  C  C     . ILE A 1  269  ? 414.812 17.400  630.271 1.00 97.53  ? 269  ILE A C     1 
ATOM   1780  O  O     . ILE A 1  269  ? 413.759 17.884  629.853 1.00 100.61 ? 269  ILE A O     1 
ATOM   1781  C  CB    . ILE A 1  269  ? 415.861 15.405  629.179 1.00 92.71  ? 269  ILE A CB    1 
ATOM   1782  C  CG1   . ILE A 1  269  ? 416.802 14.937  628.068 1.00 90.45  ? 269  ILE A CG1   1 
ATOM   1783  C  CG2   . ILE A 1  269  ? 414.445 14.921  628.905 1.00 94.24  ? 269  ILE A CG2   1 
ATOM   1784  C  CD1   . ILE A 1  269  ? 416.797 13.440  627.855 1.00 88.30  ? 269  ILE A CD1   1 
ATOM   1785  N  N     . LEU A 1  270  ? 415.077 17.255  631.566 1.00 152.48 ? 270  LEU A N     1 
ATOM   1786  C  CA    . LEU A 1  270  ? 414.128 17.689  632.583 1.00 153.68 ? 270  LEU A CA    1 
ATOM   1787  C  C     . LEU A 1  270  ? 413.983 19.208  632.570 1.00 158.06 ? 270  LEU A C     1 
ATOM   1788  O  O     . LEU A 1  270  ? 412.905 19.738  632.836 1.00 161.45 ? 270  LEU A O     1 
ATOM   1789  C  CB    . LEU A 1  270  ? 414.560 17.207  633.969 1.00 151.77 ? 270  LEU A CB    1 
ATOM   1790  C  CG    . LEU A 1  270  ? 413.487 16.484  634.788 1.00 154.09 ? 270  LEU A CG    1 
ATOM   1791  C  CD1   . LEU A 1  270  ? 414.033 16.071  636.141 1.00 152.14 ? 270  LEU A CD1   1 
ATOM   1792  C  CD2   . LEU A 1  270  ? 412.243 17.345  634.952 1.00 158.50 ? 270  LEU A CD2   1 
ATOM   1793  N  N     . LYS A 1  271  ? 415.073 19.903  632.254 1.00 126.05 ? 271  LYS A N     1 
ATOM   1794  C  CA    . LYS A 1  271  ? 415.050 21.358  632.151 1.00 127.76 ? 271  LYS A CA    1 
ATOM   1795  C  C     . LYS A 1  271  ? 414.122 21.808  631.028 1.00 128.45 ? 271  LYS A C     1 
ATOM   1796  O  O     . LYS A 1  271  ? 413.271 22.678  631.222 1.00 131.51 ? 271  LYS A O     1 
ATOM   1797  C  CB    . LYS A 1  271  ? 416.460 21.905  631.919 1.00 127.26 ? 271  LYS A CB    1 
ATOM   1798  C  CG    . LYS A 1  271  ? 416.523 23.418  631.766 1.00 130.50 ? 271  LYS A CG    1 
ATOM   1799  C  CD    . LYS A 1  271  ? 417.937 23.908  631.465 1.00 127.83 ? 271  LYS A CD    1 
ATOM   1800  C  CE    . LYS A 1  271  ? 418.800 23.998  632.719 1.00 125.49 ? 271  LYS A CE    1 
ATOM   1801  N  NZ    . LYS A 1  271  ? 419.277 22.674  633.207 1.00 121.69 ? 271  LYS A NZ    1 
ATOM   1802  N  N     . ALA A 1  272  ? 414.288 21.203  629.855 1.00 117.99 ? 272  ALA A N     1 
ATOM   1803  C  CA    . ALA A 1  272  ? 413.455 21.518  628.700 1.00 120.38 ? 272  ALA A CA    1 
ATOM   1804  C  C     . ALA A 1  272  ? 412.010 21.088  628.934 1.00 122.45 ? 272  ALA A C     1 
ATOM   1805  O  O     . ALA A 1  272  ? 411.078 21.687  628.397 1.00 125.52 ? 272  ALA A O     1 
ATOM   1806  C  CB    . ALA A 1  272  ? 414.010 20.854  627.450 1.00 117.96 ? 272  ALA A CB    1 
ATOM   1807  N  N     . ASN A 1  273  ? 411.833 20.046  629.741 1.00 124.72 ? 273  ASN A N     1 
ATOM   1808  C  CA    . ASN A 1  273  ? 410.506 19.540  630.067 1.00 125.70 ? 273  ASN A CA    1 
ATOM   1809  C  C     . ASN A 1  273  ? 409.740 20.514  630.960 1.00 130.58 ? 273  ASN A C     1 
ATOM   1810  O  O     . ASN A 1  273  ? 408.602 20.884  630.662 1.00 134.90 ? 273  ASN A O     1 
ATOM   1811  C  CB    . ASN A 1  273  ? 410.613 18.172  630.743 1.00 123.22 ? 273  ASN A CB    1 
ATOM   1812  C  CG    . ASN A 1  273  ? 409.277 17.466  630.845 1.00 124.51 ? 273  ASN A CG    1 
ATOM   1813  O  OD1   . ASN A 1  273  ? 408.829 16.826  629.895 1.00 122.02 ? 273  ASN A OD1   1 
ATOM   1814  N  ND2   . ASN A 1  273  ? 408.635 17.574  632.003 1.00 126.80 ? 273  ASN A ND2   1 
ATOM   1815  N  N     . ILE A 1  274  ? 410.376 20.926  632.054 1.00 179.76 ? 274  ILE A N     1 
ATOM   1816  C  CA    . ILE A 1  274  ? 409.791 21.903  632.965 1.00 182.68 ? 274  ILE A CA    1 
ATOM   1817  C  C     . ILE A 1  274  ? 409.586 23.236  632.248 1.00 185.35 ? 274  ILE A C     1 
ATOM   1818  O  O     . ILE A 1  274  ? 408.611 23.944  632.501 1.00 190.85 ? 274  ILE A O     1 
ATOM   1819  C  CB    . ILE A 1  274  ? 410.673 22.109  634.218 1.00 181.31 ? 274  ILE A CB    1 
ATOM   1820  C  CG1   . ILE A 1  274  ? 410.819 20.795  634.987 1.00 179.42 ? 274  ILE A CG1   1 
ATOM   1821  C  CG2   . ILE A 1  274  ? 410.086 23.178  635.128 1.00 185.94 ? 274  ILE A CG2   1 
ATOM   1822  C  CD1   . ILE A 1  274  ? 409.503 20.208  635.452 1.00 181.81 ? 274  ILE A CD1   1 
ATOM   1823  N  N     . SER A 1  275  ? 410.504 23.565  631.343 1.00 114.45 ? 275  SER A N     1 
ATOM   1824  C  CA    . SER A 1  275  ? 410.379 24.770  630.530 1.00 116.61 ? 275  SER A CA    1 
ATOM   1825  C  C     . SER A 1  275  ? 409.136 24.708  629.648 1.00 118.52 ? 275  SER A C     1 
ATOM   1826  O  O     . SER A 1  275  ? 408.360 25.665  629.577 1.00 121.57 ? 275  SER A O     1 
ATOM   1827  C  CB    . SER A 1  275  ? 411.625 24.968  629.665 1.00 114.72 ? 275  SER A CB    1 
ATOM   1828  O  OG    . SER A 1  275  ? 411.471 26.081  628.801 1.00 116.86 ? 275  SER A OG    1 
ATOM   1829  N  N     . LEU A 1  276  ? 408.952 23.572  628.982 1.00 125.89 ? 276  LEU A N     1 
ATOM   1830  C  CA    . LEU A 1  276  ? 407.808 23.368  628.103 1.00 127.49 ? 276  LEU A CA    1 
ATOM   1831  C  C     . LEU A 1  276  ? 406.496 23.424  628.881 1.00 132.00 ? 276  LEU A C     1 
ATOM   1832  O  O     . LEU A 1  276  ? 405.534 24.054  628.443 1.00 136.83 ? 276  LEU A O     1 
ATOM   1833  C  CB    . LEU A 1  276  ? 407.933 22.032  627.367 1.00 124.98 ? 276  LEU A CB    1 
ATOM   1834  C  CG    . LEU A 1  276  ? 406.837 21.693  626.356 1.00 126.89 ? 276  LEU A CG    1 
ATOM   1835  C  CD1   . LEU A 1  276  ? 406.650 22.833  625.369 1.00 130.87 ? 276  LEU A CD1   1 
ATOM   1836  C  CD2   . LEU A 1  276  ? 407.167 20.401  625.625 1.00 123.69 ? 276  LEU A CD2   1 
ATOM   1837  N  N     . GLU A 1  277  ? 406.467 22.767  630.038 1.00 149.70 ? 277  GLU A N     1 
ATOM   1838  C  CA    . GLU A 1  277  ? 405.286 22.786  630.898 1.00 152.63 ? 277  GLU A CA    1 
ATOM   1839  C  C     . GLU A 1  277  ? 404.971 24.203  631.370 1.00 156.74 ? 277  GLU A C     1 
ATOM   1840  O  O     . GLU A 1  277  ? 403.809 24.607  631.421 1.00 160.38 ? 277  GLU A O     1 
ATOM   1841  C  CB    . GLU A 1  277  ? 405.482 21.865  632.104 1.00 150.41 ? 277  GLU A CB    1 
ATOM   1842  C  CG    . GLU A 1  277  ? 405.571 20.388  631.758 1.00 148.19 ? 277  GLU A CG    1 
ATOM   1843  C  CD    . GLU A 1  277  ? 405.811 19.519  632.978 1.00 146.83 ? 277  GLU A CD    1 
ATOM   1844  O  OE1   . GLU A 1  277  ? 405.809 18.278  632.836 1.00 146.52 ? 277  GLU A OE1   1 
ATOM   1845  O  OE2   . GLU A 1  277  ? 406.004 20.077  634.079 1.00 145.64 ? 277  GLU A OE2   1 
ATOM   1846  N  N     . THR A 1  278  ? 406.016 24.952  631.711 1.00 135.89 ? 278  THR A N     1 
ATOM   1847  C  CA    . THR A 1  278  ? 405.864 26.327  632.173 1.00 138.77 ? 278  THR A CA    1 
ATOM   1848  C  C     . THR A 1  278  ? 405.313 27.217  631.063 1.00 143.08 ? 278  THR A C     1 
ATOM   1849  O  O     . THR A 1  278  ? 404.479 28.090  631.310 1.00 148.71 ? 278  THR A O     1 
ATOM   1850  C  CB    . THR A 1  278  ? 407.204 26.905  632.676 1.00 136.04 ? 278  THR A CB    1 
ATOM   1851  O  OG1   . THR A 1  278  ? 407.749 26.046  633.686 1.00 129.91 ? 278  THR A OG1   1 
ATOM   1852  C  CG2   . THR A 1  278  ? 407.007 28.299  633.256 1.00 138.86 ? 278  THR A CG2   1 
ATOM   1853  N  N     . LEU A 1  279  ? 405.775 26.987  629.838 1.00 134.13 ? 279  LEU A N     1 
ATOM   1854  C  CA    . LEU A 1  279  ? 405.311 27.762  628.693 1.00 136.28 ? 279  LEU A CA    1 
ATOM   1855  C  C     . LEU A 1  279  ? 403.916 27.329  628.244 1.00 138.58 ? 279  LEU A C     1 
ATOM   1856  O  O     . LEU A 1  279  ? 403.226 28.069  627.544 1.00 140.71 ? 279  LEU A O     1 
ATOM   1857  C  CB    . LEU A 1  279  ? 406.296 27.641  627.529 1.00 134.16 ? 279  LEU A CB    1 
ATOM   1858  C  CG    . LEU A 1  279  ? 407.672 28.276  627.739 1.00 132.86 ? 279  LEU A CG    1 
ATOM   1859  C  CD1   . LEU A 1  279  ? 408.520 28.147  626.483 1.00 131.08 ? 279  LEU A CD1   1 
ATOM   1860  C  CD2   . LEU A 1  279  ? 407.533 29.733  628.153 1.00 135.90 ? 279  LEU A CD2   1 
ATOM   1861  N  N     . GLU A 1  280  ? 403.506 26.131  628.648 1.00 165.12 ? 280  GLU A N     1 
ATOM   1862  C  CA    . GLU A 1  280  ? 402.184 25.620  628.295 1.00 167.53 ? 280  GLU A CA    1 
ATOM   1863  C  C     . GLU A 1  280  ? 401.107 26.092  629.269 1.00 171.98 ? 280  GLU A C     1 
ATOM   1864  O  O     . GLU A 1  280  ? 400.096 26.661  628.857 1.00 174.36 ? 280  GLU A O     1 
ATOM   1865  C  CB    . GLU A 1  280  ? 402.197 24.091  628.237 1.00 165.98 ? 280  GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1  280  ? 402.771 23.519  626.950 1.00 164.50 ? 280  GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1  280  ? 402.808 22.003  626.952 1.00 160.77 ? 280  GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1  280  ? 402.626 21.404  628.033 1.00 158.74 ? 280  GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1  280  ? 403.017 21.409  625.874 1.00 158.04 ? 280  GLU A OE2   1 
ATOM   1870  N  N     . HIS A 1  281  ? 401.327 25.851  630.559 1.00 175.57 ? 281  HIS A N     1 
ATOM   1871  C  CA    . HIS A 1  281  ? 400.349 26.208  631.583 1.00 178.27 ? 281  HIS A CA    1 
ATOM   1872  C  C     . HIS A 1  281  ? 400.164 27.718  631.693 1.00 181.52 ? 281  HIS A C     1 
ATOM   1873  O  O     . HIS A 1  281  ? 399.037 28.210  631.729 1.00 185.97 ? 281  HIS A O     1 
ATOM   1874  C  CB    . HIS A 1  281  ? 400.760 25.632  632.940 1.00 175.59 ? 281  HIS A CB    1 
ATOM   1875  C  CG    . HIS A 1  281  ? 400.698 24.137  633.005 1.00 174.04 ? 281  HIS A CG    1 
ATOM   1876  N  ND1   . HIS A 1  281  ? 399.509 23.440  632.981 1.00 173.48 ? 281  HIS A ND1   1 
ATOM   1877  C  CD2   . HIS A 1  281  ? 401.678 23.207  633.098 1.00 169.47 ? 281  HIS A CD2   1 
ATOM   1878  C  CE1   . HIS A 1  281  ? 399.759 22.145  633.053 1.00 168.65 ? 281  HIS A CE1   1 
ATOM   1879  N  NE2   . HIS A 1  281  ? 401.067 21.977  633.125 1.00 167.22 ? 281  HIS A NE2   1 
ATOM   1880  N  N     . ASN A 1  282  ? 401.273 28.450  631.746 1.00 173.76 ? 282  ASN A N     1 
ATOM   1881  C  CA    . ASN A 1  282  ? 401.222 29.905  631.839 1.00 176.42 ? 282  ASN A CA    1 
ATOM   1882  C  C     . ASN A 1  282  ? 400.933 30.547  630.486 1.00 176.51 ? 282  ASN A C     1 
ATOM   1883  O  O     . ASN A 1  282  ? 400.108 30.052  629.717 1.00 175.69 ? 282  ASN A O     1 
ATOM   1884  C  CB    . ASN A 1  282  ? 402.533 30.450  632.407 1.00 175.17 ? 282  ASN A CB    1 
ATOM   1885  C  CG    . ASN A 1  282  ? 402.846 29.897  633.783 1.00 174.37 ? 282  ASN A CG    1 
ATOM   1886  O  OD1   . ASN A 1  282  ? 402.314 28.862  634.184 1.00 174.05 ? 282  ASN A OD1   1 
ATOM   1887  N  ND2   . ASN A 1  282  ? 403.715 30.585  634.514 1.00 171.31 ? 282  ASN A ND2   1 
ATOM   1888  N  N     . GLY A 1  283  ? 401.612 31.654  630.203 1.00 173.97 ? 283  GLY A N     1 
ATOM   1889  C  CA    . GLY A 1  283  ? 401.479 32.319  628.920 1.00 175.01 ? 283  GLY A CA    1 
ATOM   1890  C  C     . GLY A 1  283  ? 401.984 31.429  627.803 1.00 172.23 ? 283  GLY A C     1 
ATOM   1891  O  O     . GLY A 1  283  ? 403.144 31.016  627.807 1.00 169.51 ? 283  GLY A O     1 
ATOM   1892  N  N     . ALA A 1  284  ? 401.112 31.127  626.847 1.00 212.19 ? 284  ALA A N     1 
ATOM   1893  C  CA    . ALA A 1  284  ? 401.454 30.211  625.766 1.00 208.91 ? 284  ALA A CA    1 
ATOM   1894  C  C     . ALA A 1  284  ? 401.359 30.878  624.397 1.00 211.22 ? 284  ALA A C     1 
ATOM   1895  O  O     . ALA A 1  284  ? 400.305 30.850  623.762 1.00 213.16 ? 284  ALA A O     1 
ATOM   1896  C  CB    . ALA A 1  284  ? 400.557 28.982  625.815 1.00 205.07 ? 284  ALA A CB    1 
ATOM   1897  N  N     . PRO A 1  285  ? 402.467 31.483  623.940 1.00 143.33 ? 285  PRO A N     1 
ATOM   1898  C  CA    . PRO A 1  285  ? 402.530 32.069  622.597 1.00 144.55 ? 285  PRO A CA    1 
ATOM   1899  C  C     . PRO A 1  285  ? 402.496 30.994  621.514 1.00 142.70 ? 285  PRO A C     1 
ATOM   1900  O  O     . PRO A 1  285  ? 402.735 29.822  621.807 1.00 139.91 ? 285  PRO A O     1 
ATOM   1901  C  CB    . PRO A 1  285  ? 403.875 32.809  622.593 1.00 143.45 ? 285  PRO A CB    1 
ATOM   1902  C  CG    . PRO A 1  285  ? 404.247 32.958  624.036 1.00 142.86 ? 285  PRO A CG    1 
ATOM   1903  C  CD    . PRO A 1  285  ? 403.692 31.746  624.710 1.00 141.43 ? 285  PRO A CD    1 
ATOM   1904  N  N     . HIS A 1  286  ? 402.204 31.391  620.280 1.00 185.76 ? 286  HIS A N     1 
ATOM   1905  C  CA    . HIS A 1  286  ? 402.104 30.441  619.177 1.00 184.82 ? 286  HIS A CA    1 
ATOM   1906  C  C     . HIS A 1  286  ? 403.477 30.007  618.669 1.00 180.79 ? 286  HIS A C     1 
ATOM   1907  O  O     . HIS A 1  286  ? 403.693 28.833  618.372 1.00 176.33 ? 286  HIS A O     1 
ATOM   1908  C  CB    . HIS A 1  286  ? 401.290 31.042  618.029 1.00 189.18 ? 286  HIS A CB    1 
ATOM   1909  C  CG    . HIS A 1  286  ? 399.857 31.302  618.374 1.00 193.01 ? 286  HIS A CG    1 
ATOM   1910  N  ND1   . HIS A 1  286  ? 398.871 30.350  618.224 1.00 192.91 ? 286  HIS A ND1   1 
ATOM   1911  C  CD2   . HIS A 1  286  ? 399.242 32.406  618.860 1.00 196.78 ? 286  HIS A CD2   1 
ATOM   1912  C  CE1   . HIS A 1  286  ? 397.711 30.856  618.604 1.00 196.53 ? 286  HIS A CE1   1 
ATOM   1913  N  NE2   . HIS A 1  286  ? 397.909 32.102  618.994 1.00 200.30 ? 286  HIS A NE2   1 
ATOM   1914  N  N     . HIS A 1  287  ? 404.401 30.958  618.573 1.00 177.71 ? 287  HIS A N     1 
ATOM   1915  C  CA    . HIS A 1  287  ? 405.725 30.683  618.025 1.00 173.39 ? 287  HIS A CA    1 
ATOM   1916  C  C     . HIS A 1  287  ? 406.799 30.653  619.108 1.00 168.19 ? 287  HIS A C     1 
ATOM   1917  O  O     . HIS A 1  287  ? 407.913 31.133  618.899 1.00 165.21 ? 287  HIS A O     1 
ATOM   1918  C  CB    . HIS A 1  287  ? 406.089 31.727  616.966 1.00 176.39 ? 287  HIS A CB    1 
ATOM   1919  C  CG    . HIS A 1  287  ? 404.929 32.558  616.512 1.00 180.72 ? 287  HIS A CG    1 
ATOM   1920  N  ND1   . HIS A 1  287  ? 404.095 32.176  615.484 1.00 181.22 ? 287  HIS A ND1   1 
ATOM   1921  C  CD2   . HIS A 1  287  ? 404.467 33.755  616.946 1.00 182.09 ? 287  HIS A CD2   1 
ATOM   1922  C  CE1   . HIS A 1  287  ? 403.168 33.100  615.305 1.00 184.11 ? 287  HIS A CE1   1 
ATOM   1923  N  NE2   . HIS A 1  287  ? 403.371 34.069  616.179 1.00 184.91 ? 287  HIS A NE2   1 
ATOM   1924  N  N     . ALA A 1  288  ? 406.464 30.086  620.263 1.00 155.37 ? 288  ALA A N     1 
ATOM   1925  C  CA    . ALA A 1  288  ? 407.403 30.028  621.378 1.00 151.99 ? 288  ALA A CA    1 
ATOM   1926  C  C     . ALA A 1  288  ? 407.458 28.637  622.003 1.00 147.36 ? 288  ALA A C     1 
ATOM   1927  O  O     . ALA A 1  288  ? 408.540 28.100  622.242 1.00 143.09 ? 288  ALA A O     1 
ATOM   1928  C  CB    . ALA A 1  288  ? 407.037 31.063  622.430 1.00 154.30 ? 288  ALA A CB    1 
ATOM   1929  N  N     . ILE A 1  289  ? 406.290 28.059  622.268 1.00 157.32 ? 289  ILE A N     1 
ATOM   1930  C  CA    . ILE A 1  289  ? 406.216 26.733  622.872 1.00 154.30 ? 289  ILE A CA    1 
ATOM   1931  C  C     . ILE A 1  289  ? 406.714 25.662  621.904 1.00 152.70 ? 289  ILE A C     1 
ATOM   1932  O  O     . ILE A 1  289  ? 407.211 24.615  622.323 1.00 150.87 ? 289  ILE A O     1 
ATOM   1933  C  CB    . ILE A 1  289  ? 404.779 26.393  623.323 1.00 155.60 ? 289  ILE A CB    1 
ATOM   1934  C  CG1   . ILE A 1  289  ? 403.805 26.485  622.146 1.00 160.10 ? 289  ILE A CG1   1 
ATOM   1935  C  CG2   . ILE A 1  289  ? 404.339 27.320  624.444 1.00 158.06 ? 289  ILE A CG2   1 
ATOM   1936  C  CD1   . ILE A 1  289  ? 402.374 26.149  622.511 1.00 161.90 ? 289  ILE A CD1   1 
ATOM   1937  N  N     . GLU A 1  290  ? 406.586 25.938  620.610 1.00 167.32 ? 290  GLU A N     1 
ATOM   1938  C  CA    . GLU A 1  290  ? 407.039 25.019  619.573 1.00 165.50 ? 290  GLU A CA    1 
ATOM   1939  C  C     . GLU A 1  290  ? 408.554 24.849  619.627 1.00 160.95 ? 290  GLU A C     1 
ATOM   1940  O  O     . GLU A 1  290  ? 409.077 23.751  619.423 1.00 158.42 ? 290  GLU A O     1 
ATOM   1941  C  CB    . GLU A 1  290  ? 406.606 25.521  618.193 1.00 170.09 ? 290  GLU A CB    1 
ATOM   1942  C  CG    . GLU A 1  290  ? 405.105 25.729  618.056 1.00 176.09 ? 290  GLU A CG    1 
ATOM   1943  C  CD    . GLU A 1  290  ? 404.723 26.424  616.762 1.00 178.66 ? 290  GLU A CD    1 
ATOM   1944  O  OE1   . GLU A 1  290  ? 403.511 26.546  616.487 1.00 178.85 ? 290  GLU A OE1   1 
ATOM   1945  O  OE2   . GLU A 1  290  ? 405.634 26.851  616.023 1.00 177.80 ? 290  GLU A OE2   1 
ATOM   1946  N  N     . GLU A 1  291  ? 409.250 25.945  619.911 1.00 162.23 ? 291  GLU A N     1 
ATOM   1947  C  CA    . GLU A 1  291  ? 410.701 25.926  620.043 1.00 157.55 ? 291  GLU A CA    1 
ATOM   1948  C  C     . GLU A 1  291  ? 411.120 25.100  621.253 1.00 154.95 ? 291  GLU A C     1 
ATOM   1949  O  O     . GLU A 1  291  ? 412.162 24.445  621.239 1.00 153.20 ? 291  GLU A O     1 
ATOM   1950  C  CB    . GLU A 1  291  ? 411.248 27.349  620.157 1.00 158.25 ? 291  GLU A CB    1 
ATOM   1951  C  CG    . GLU A 1  291  ? 410.835 28.264  619.016 1.00 164.29 ? 291  GLU A CG    1 
ATOM   1952  C  CD    . GLU A 1  291  ? 411.360 29.676  619.183 1.00 166.55 ? 291  GLU A CD    1 
ATOM   1953  O  OE1   . GLU A 1  291  ? 412.244 29.885  620.040 1.00 160.01 ? 291  GLU A OE1   1 
ATOM   1954  O  OE2   . GLU A 1  291  ? 410.885 30.577  618.459 1.00 172.07 ? 291  GLU A OE2   1 
ATOM   1955  N  N     . ALA A 1  292  ? 410.302 25.138  622.300 1.00 118.52 ? 292  ALA A N     1 
ATOM   1956  C  CA    . ALA A 1  292  ? 410.554 24.348  623.499 1.00 116.43 ? 292  ALA A CA    1 
ATOM   1957  C  C     . ALA A 1  292  ? 410.312 22.869  623.218 1.00 113.80 ? 292  ALA A C     1 
ATOM   1958  O  O     . ALA A 1  292  ? 411.026 22.006  623.731 1.00 110.67 ? 292  ALA A O     1 
ATOM   1959  C  CB    . ALA A 1  292  ? 409.680 24.824  624.648 1.00 118.42 ? 292  ALA A CB    1 
ATOM   1960  N  N     . GLU A 1  293  ? 409.300 22.584  622.403 1.00 143.41 ? 293  GLU A N     1 
ATOM   1961  C  CA    . GLU A 1  293  ? 409.024 21.216  621.976 1.00 141.24 ? 293  GLU A CA    1 
ATOM   1962  C  C     . GLU A 1  293  ? 410.196 20.663  621.171 1.00 137.60 ? 293  GLU A C     1 
ATOM   1963  O  O     . GLU A 1  293  ? 410.634 19.532  621.388 1.00 135.22 ? 293  GLU A O     1 
ATOM   1964  C  CB    . GLU A 1  293  ? 407.741 21.151  621.144 1.00 145.16 ? 293  GLU A CB    1 
ATOM   1965  C  CG    . GLU A 1  293  ? 406.478 21.522  621.902 1.00 149.13 ? 293  GLU A CG    1 
ATOM   1966  C  CD    . GLU A 1  293  ? 405.238 21.450  621.033 1.00 153.04 ? 293  GLU A CD    1 
ATOM   1967  O  OE1   . GLU A 1  293  ? 405.291 20.795  619.971 1.00 150.35 ? 293  GLU A OE1   1 
ATOM   1968  O  OE2   . GLU A 1  293  ? 404.209 22.051  621.410 1.00 157.29 ? 293  GLU A OE2   1 
ATOM   1969  N  N     . SER A 1  294  ? 410.701 21.473  620.245 1.00 152.28 ? 294  SER A N     1 
ATOM   1970  C  CA    . SER A 1  294  ? 411.836 21.078  619.418 1.00 149.22 ? 294  SER A CA    1 
ATOM   1971  C  C     . SER A 1  294  ? 413.109 20.957  620.250 1.00 144.68 ? 294  SER A C     1 
ATOM   1972  O  O     . SER A 1  294  ? 414.003 20.178  619.921 1.00 140.82 ? 294  SER A O     1 
ATOM   1973  C  CB    . SER A 1  294  ? 412.045 22.080  618.281 1.00 153.22 ? 294  SER A CB    1 
ATOM   1974  O  OG    . SER A 1  294  ? 412.347 23.368  618.787 1.00 155.90 ? 294  SER A OG    1 
ATOM   1975  N  N     . LEU A 1  295  ? 413.184 21.732  621.326 1.00 124.56 ? 295  LEU A N     1 
ATOM   1976  C  CA    . LEU A 1  295  ? 414.329 21.683  622.229 1.00 120.66 ? 295  LEU A CA    1 
ATOM   1977  C  C     . LEU A 1  295  ? 414.331 20.385  623.031 1.00 117.46 ? 295  LEU A C     1 
ATOM   1978  O  O     . LEU A 1  295  ? 415.355 19.705  623.126 1.00 114.41 ? 295  LEU A O     1 
ATOM   1979  C  CB    . LEU A 1  295  ? 414.322 22.887  623.172 1.00 123.67 ? 295  LEU A CB    1 
ATOM   1980  C  CG    . LEU A 1  295  ? 415.448 22.947  624.207 1.00 118.50 ? 295  LEU A CG    1 
ATOM   1981  C  CD1   . LEU A 1  295  ? 416.807 22.957  623.523 1.00 115.35 ? 295  LEU A CD1   1 
ATOM   1982  C  CD2   . LEU A 1  295  ? 415.284 24.164  625.106 1.00 120.61 ? 295  LEU A CD2   1 
ATOM   1983  N  N     . LEU A 1  296  ? 413.179 20.051  623.607 1.00 123.98 ? 296  LEU A N     1 
ATOM   1984  C  CA    . LEU A 1  296  ? 413.021 18.804  624.346 1.00 118.89 ? 296  LEU A CA    1 
ATOM   1985  C  C     . LEU A 1  296  ? 413.281 17.614  623.431 1.00 118.20 ? 296  LEU A C     1 
ATOM   1986  O  O     . LEU A 1  296  ? 413.993 16.678  623.800 1.00 114.82 ? 296  LEU A O     1 
ATOM   1987  C  CB    . LEU A 1  296  ? 411.621 18.712  624.956 1.00 121.26 ? 296  LEU A CB    1 
ATOM   1988  C  CG    . LEU A 1  296  ? 411.296 17.437  625.738 1.00 119.72 ? 296  LEU A CG    1 
ATOM   1989  C  CD1   . LEU A 1  296  ? 412.273 17.248  626.887 1.00 119.43 ? 296  LEU A CD1   1 
ATOM   1990  C  CD2   . LEU A 1  296  ? 409.863 17.470  626.249 1.00 123.77 ? 296  LEU A CD2   1 
ATOM   1991  N  N     . GLN A 1  297  ? 412.703 17.667  622.234 1.00 159.88 ? 297  GLN A N     1 
ATOM   1992  C  CA    . GLN A 1  297  ? 412.931 16.648  621.215 1.00 158.32 ? 297  GLN A CA    1 
ATOM   1993  C  C     . GLN A 1  297  ? 414.417 16.506  620.908 1.00 154.95 ? 297  GLN A C     1 
ATOM   1994  O  O     . GLN A 1  297  ? 414.933 15.394  620.788 1.00 151.32 ? 297  GLN A O     1 
ATOM   1995  C  CB    . GLN A 1  297  ? 412.160 16.989  619.937 1.00 162.90 ? 297  GLN A CB    1 
ATOM   1996  C  CG    . GLN A 1  297  ? 412.525 16.133  618.733 1.00 160.98 ? 297  GLN A CG    1 
ATOM   1997  C  CD    . GLN A 1  297  ? 412.082 14.691  618.879 1.00 157.39 ? 297  GLN A CD    1 
ATOM   1998  O  OE1   . GLN A 1  297  ? 410.943 14.346  618.565 1.00 161.78 ? 297  GLN A OE1   1 
ATOM   1999  N  NE2   . GLN A 1  297  ? 412.983 13.839  619.353 1.00 152.10 ? 297  GLN A NE2   1 
ATOM   2000  N  N     . PHE A 1  298  ? 415.100 17.641  620.795 1.00 97.25  ? 298  PHE A N     1 
ATOM   2001  C  CA    . PHE A 1  298  ? 416.530 17.657  620.508 1.00 95.09  ? 298  PHE A CA    1 
ATOM   2002  C  C     . PHE A 1  298  ? 417.339 16.983  621.610 1.00 92.58  ? 298  PHE A C     1 
ATOM   2003  O  O     . PHE A 1  298  ? 418.170 16.120  621.335 1.00 90.07  ? 298  PHE A O     1 
ATOM   2004  C  CB    . PHE A 1  298  ? 417.022 19.092  620.308 1.00 96.64  ? 298  PHE A CB    1 
ATOM   2005  C  CG    . PHE A 1  298  ? 418.508 19.200  620.098 1.00 94.62  ? 298  PHE A CG    1 
ATOM   2006  C  CD1   . PHE A 1  298  ? 419.063 18.957  618.853 1.00 93.74  ? 298  PHE A CD1   1 
ATOM   2007  C  CD2   . PHE A 1  298  ? 419.348 19.549  621.143 1.00 93.71  ? 298  PHE A CD2   1 
ATOM   2008  C  CE1   . PHE A 1  298  ? 420.428 19.055  618.655 1.00 91.98  ? 298  PHE A CE1   1 
ATOM   2009  C  CE2   . PHE A 1  298  ? 420.713 19.649  620.952 1.00 91.95  ? 298  PHE A CE2   1 
ATOM   2010  C  CZ    . PHE A 1  298  ? 421.253 19.402  619.706 1.00 91.08  ? 298  PHE A CZ    1 
ATOM   2011  N  N     . HIS A 1  299  ? 417.096 17.384  622.855 1.00 115.17 ? 299  HIS A N     1 
ATOM   2012  C  CA    . HIS A 1  299  ? 417.837 16.836  623.987 1.00 113.38 ? 299  HIS A CA    1 
ATOM   2013  C  C     . HIS A 1  299  ? 417.579 15.343  624.170 1.00 109.43 ? 299  HIS A C     1 
ATOM   2014  O  O     . HIS A 1  299  ? 418.503 14.582  624.458 1.00 107.20 ? 299  HIS A O     1 
ATOM   2015  C  CB    . HIS A 1  299  ? 417.491 17.591  625.272 1.00 115.81 ? 299  HIS A CB    1 
ATOM   2016  C  CG    . HIS A 1  299  ? 418.307 18.828  625.482 1.00 116.62 ? 299  HIS A CG    1 
ATOM   2017  N  ND1   . HIS A 1  299  ? 418.009 19.762  626.451 1.00 118.66 ? 299  HIS A ND1   1 
ATOM   2018  C  CD2   . HIS A 1  299  ? 419.416 19.282  624.852 1.00 113.73 ? 299  HIS A CD2   1 
ATOM   2019  C  CE1   . HIS A 1  299  ? 418.896 20.740  626.405 1.00 118.65 ? 299  HIS A CE1   1 
ATOM   2020  N  NE2   . HIS A 1  299  ? 419.762 20.472  625.443 1.00 114.81 ? 299  HIS A NE2   1 
ATOM   2021  N  N     . VAL A 1  300  ? 416.327 14.928  623.999 1.00 92.34  ? 300  VAL A N     1 
ATOM   2022  C  CA    . VAL A 1  300  ? 415.984 13.513  624.108 1.00 90.86  ? 300  VAL A CA    1 
ATOM   2023  C  C     . VAL A 1  300  ? 416.641 12.715  622.982 1.00 88.82  ? 300  VAL A C     1 
ATOM   2024  O  O     . VAL A 1  300  ? 417.103 11.592  623.191 1.00 86.54  ? 300  VAL A O     1 
ATOM   2025  C  CB    . VAL A 1  300  ? 414.454 13.296  624.080 1.00 96.16  ? 300  VAL A CB    1 
ATOM   2026  C  CG1   . VAL A 1  300  ? 414.120 11.814  623.992 1.00 91.53  ? 300  VAL A CG1   1 
ATOM   2027  C  CG2   . VAL A 1  300  ? 413.808 13.912  625.312 1.00 96.78  ? 300  VAL A CG2   1 
ATOM   2028  N  N     . ALA A 1  301  ? 416.701 13.309  621.794 1.00 105.18 ? 301  ALA A N     1 
ATOM   2029  C  CA    . ALA A 1  301  ? 417.298 12.644  620.638 1.00 105.60 ? 301  ALA A CA    1 
ATOM   2030  C  C     . ALA A 1  301  ? 418.813 12.507  620.773 1.00 101.45 ? 301  ALA A C     1 
ATOM   2031  O  O     . ALA A 1  301  ? 419.387 11.492  620.379 1.00 99.16  ? 301  ALA A O     1 
ATOM   2032  C  CB    . ALA A 1  301  ? 416.952 13.394  619.361 1.00 109.78 ? 301  ALA A CB    1 
ATOM   2033  N  N     . THR A 1  302  ? 419.457 13.530  621.328 1.00 84.37  ? 302  THR A N     1 
ATOM   2034  C  CA    . THR A 1  302  ? 420.911 13.531  621.459 1.00 82.23  ? 302  THR A CA    1 
ATOM   2035  C  C     . THR A 1  302  ? 421.365 12.827  622.737 1.00 80.39  ? 302  THR A C     1 
ATOM   2036  O  O     . THR A 1  302  ? 422.550 12.540  622.908 1.00 78.31  ? 302  THR A O     1 
ATOM   2037  C  CB    . THR A 1  302  ? 421.482 14.963  621.444 1.00 83.50  ? 302  THR A CB    1 
ATOM   2038  O  OG1   . THR A 1  302  ? 422.912 14.908  621.391 1.00 81.45  ? 302  THR A OG1   1 
ATOM   2039  C  CG2   . THR A 1  302  ? 421.055 15.726  622.686 1.00 85.04  ? 302  THR A CG2   1 
ATOM   2040  N  N     . TYR A 1  303  ? 420.417 12.553  623.629 1.00 100.32 ? 303  TYR A N     1 
ATOM   2041  C  CA    . TYR A 1  303  ? 420.706 11.819  624.857 1.00 96.32  ? 303  TYR A CA    1 
ATOM   2042  C  C     . TYR A 1  303  ? 421.108 10.381  624.548 1.00 94.70  ? 303  TYR A C     1 
ATOM   2043  O  O     . TYR A 1  303  ? 421.909 9.781   625.265 1.00 94.12  ? 303  TYR A O     1 
ATOM   2044  C  CB    . TYR A 1  303  ? 419.494 11.846  625.792 1.00 98.73  ? 303  TYR A CB    1 
ATOM   2045  C  CG    . TYR A 1  303  ? 419.431 10.700  626.778 1.00 95.73  ? 303  TYR A CG    1 
ATOM   2046  C  CD1   . TYR A 1  303  ? 420.260 10.664  627.891 1.00 94.01  ? 303  TYR A CD1   1 
ATOM   2047  C  CD2   . TYR A 1  303  ? 418.527 9.660   626.602 1.00 96.02  ? 303  TYR A CD2   1 
ATOM   2048  C  CE1   . TYR A 1  303  ? 420.198 9.619   628.794 1.00 91.78  ? 303  TYR A CE1   1 
ATOM   2049  C  CE2   . TYR A 1  303  ? 418.457 8.612   627.498 1.00 93.35  ? 303  TYR A CE2   1 
ATOM   2050  C  CZ    . TYR A 1  303  ? 419.294 8.597   628.592 1.00 92.49  ? 303  TYR A CZ    1 
ATOM   2051  O  OH    . TYR A 1  303  ? 419.224 7.553   629.485 1.00 91.52  ? 303  TYR A OH    1 
ATOM   2052  N  N     . MET A 1  304  ? 420.551 9.838   623.471 1.00 95.75  ? 304  MET A N     1 
ATOM   2053  C  CA    . MET A 1  304  ? 420.838 8.469   623.064 1.00 93.07  ? 304  MET A CA    1 
ATOM   2054  C  C     . MET A 1  304  ? 421.900 8.423   621.968 1.00 92.01  ? 304  MET A C     1 
ATOM   2055  O  O     . MET A 1  304  ? 422.885 7.694   622.078 1.00 90.76  ? 304  MET A O     1 
ATOM   2056  C  CB    . MET A 1  304  ? 419.559 7.778   622.587 1.00 93.79  ? 304  MET A CB    1 
ATOM   2057  C  CG    . MET A 1  304  ? 418.497 7.634   623.665 1.00 95.12  ? 304  MET A CG    1 
ATOM   2058  S  SD    . MET A 1  304  ? 416.948 6.961   623.038 1.00 97.88  ? 304  MET A SD    1 
ATOM   2059  C  CE    . MET A 1  304  ? 416.444 8.265   621.919 1.00 102.34 ? 304  MET A CE    1 
ATOM   2060  N  N     . ASP A 1  305  ? 421.692 9.206   620.915 1.00 80.13  ? 305  ASP A N     1 
ATOM   2061  C  CA    . ASP A 1  305  ? 422.610 9.241   619.782 1.00 77.75  ? 305  ASP A CA    1 
ATOM   2062  C  C     . ASP A 1  305  ? 423.163 10.650  619.593 1.00 80.61  ? 305  ASP A C     1 
ATOM   2063  O  O     . ASP A 1  305  ? 422.409 11.592  619.354 1.00 84.37  ? 305  ASP A O     1 
ATOM   2064  C  CB    . ASP A 1  305  ? 421.901 8.771   618.508 1.00 78.56  ? 305  ASP A CB    1 
ATOM   2065  C  CG    . ASP A 1  305  ? 422.867 8.437   617.384 1.00 78.32  ? 305  ASP A CG    1 
ATOM   2066  O  OD1   . ASP A 1  305  ? 424.059 8.796   617.484 1.00 78.15  ? 305  ASP A OD1   1 
ATOM   2067  O  OD2   . ASP A 1  305  ? 422.428 7.816   616.393 1.00 79.01  ? 305  ASP A OD2   1 
ATOM   2068  N  N     . ASN A 1  306  ? 424.481 10.791  619.693 1.00 100.06 ? 306  ASN A N     1 
ATOM   2069  C  CA    . ASN A 1  306  ? 425.111 12.101  619.578 1.00 100.78 ? 306  ASN A CA    1 
ATOM   2070  C  C     . ASN A 1  306  ? 425.828 12.294  618.245 1.00 100.87 ? 306  ASN A C     1 
ATOM   2071  O  O     . ASN A 1  306  ? 426.312 13.386  617.945 1.00 99.32  ? 306  ASN A O     1 
ATOM   2072  C  CB    . ASN A 1  306  ? 426.094 12.320  620.728 1.00 100.35 ? 306  ASN A CB    1 
ATOM   2073  C  CG    . ASN A 1  306  ? 426.214 13.777  621.118 1.00 103.58 ? 306  ASN A CG    1 
ATOM   2074  O  OD1   . ASN A 1  306  ? 425.249 14.535  621.029 1.00 108.57 ? 306  ASN A OD1   1 
ATOM   2075  N  ND2   . ASN A 1  306  ? 427.402 14.179  621.551 1.00 102.29 ? 306  ASN A ND2   1 
ATOM   2076  N  N     . ASP A 1  307  ? 425.898 11.230  617.452 1.00 109.32 ? 307  ASP A N     1 
ATOM   2077  C  CA    . ASP A 1  307  ? 426.535 11.295  616.141 1.00 107.77 ? 307  ASP A CA    1 
ATOM   2078  C  C     . ASP A 1  307  ? 425.503 11.169  615.025 1.00 110.51 ? 307  ASP A C     1 
ATOM   2079  O  O     . ASP A 1  307  ? 425.382 10.119  614.393 1.00 110.04 ? 307  ASP A O     1 
ATOM   2080  C  CB    . ASP A 1  307  ? 427.598 10.203  616.005 1.00 104.01 ? 307  ASP A CB    1 
ATOM   2081  C  CG    . ASP A 1  307  ? 428.755 10.391  616.967 1.00 103.39 ? 307  ASP A CG    1 
ATOM   2082  O  OD1   . ASP A 1  307  ? 429.732 11.076  616.597 1.00 100.79 ? 307  ASP A OD1   1 
ATOM   2083  O  OD2   . ASP A 1  307  ? 428.687 9.855   618.093 1.00 103.54 ? 307  ASP A OD2   1 
ATOM   2084  N  N     . ILE A 1  308  ? 424.761 12.246  614.790 1.00 95.89  ? 308  ILE A N     1 
ATOM   2085  C  CA    . ILE A 1  308  ? 423.726 12.259  613.764 1.00 97.82  ? 308  ILE A CA    1 
ATOM   2086  C  C     . ILE A 1  308  ? 424.139 13.163  612.605 1.00 100.41 ? 308  ILE A C     1 
ATOM   2087  O  O     . ILE A 1  308  ? 425.144 13.869  612.689 1.00 99.96  ? 308  ILE A O     1 
ATOM   2088  C  CB    . ILE A 1  308  ? 422.372 12.735  614.334 1.00 98.45  ? 308  ILE A CB    1 
ATOM   2089  C  CG1   . ILE A 1  308  ? 422.324 12.528  615.849 1.00 94.90  ? 308  ILE A CG1   1 
ATOM   2090  C  CG2   . ILE A 1  308  ? 421.213 12.015  613.652 1.00 96.60  ? 308  ILE A CG2   1 
ATOM   2091  C  CD1   . ILE A 1  308  ? 421.029 12.982  616.489 1.00 94.57  ? 308  ILE A CD1   1 
ATOM   2092  N  N     . ALA A 1  309  ? 423.361 13.138  611.526 1.00 123.32 ? 309  ALA A N     1 
ATOM   2093  C  CA    . ALA A 1  309  ? 423.620 13.989  610.370 1.00 122.75 ? 309  ALA A CA    1 
ATOM   2094  C  C     . ALA A 1  309  ? 423.443 15.461  610.728 1.00 129.11 ? 309  ALA A C     1 
ATOM   2095  O  O     . ALA A 1  309  ? 424.036 16.340  610.101 1.00 126.27 ? 309  ALA A O     1 
ATOM   2096  C  CB    . ALA A 1  309  ? 422.706 13.609  609.215 1.00 118.56 ? 309  ALA A CB    1 
ATOM   2097  N  N     . GLY A 1  310  ? 422.620 15.722  611.739 1.00 181.22 ? 310  GLY A N     1 
ATOM   2098  C  CA    . GLY A 1  310  ? 422.420 17.070  612.234 1.00 182.25 ? 310  GLY A CA    1 
ATOM   2099  C  C     . GLY A 1  310  ? 423.692 17.622  612.845 1.00 182.37 ? 310  GLY A C     1 
ATOM   2100  O  O     . GLY A 1  310  ? 424.260 17.027  613.761 1.00 181.47 ? 310  GLY A O     1 
ATOM   2101  N  N     . GLN A 1  311  ? 424.140 18.762  612.329 1.00 157.31 ? 311  GLN A N     1 
ATOM   2102  C  CA    . GLN A 1  311  ? 425.383 19.387  612.776 1.00 159.82 ? 311  GLN A CA    1 
ATOM   2103  C  C     . GLN A 1  311  ? 425.458 19.717  614.278 1.00 161.47 ? 311  GLN A C     1 
ATOM   2104  O  O     . GLN A 1  311  ? 426.520 19.549  614.878 1.00 159.52 ? 311  GLN A O     1 
ATOM   2105  C  CB    . GLN A 1  311  ? 425.644 20.657  611.961 1.00 162.67 ? 311  GLN A CB    1 
ATOM   2106  C  CG    . GLN A 1  311  ? 425.932 20.389  610.492 1.00 160.53 ? 311  GLN A CG    1 
ATOM   2107  C  CD    . GLN A 1  311  ? 426.332 21.640  609.736 1.00 162.49 ? 311  GLN A CD    1 
ATOM   2108  O  OE1   . GLN A 1  311  ? 426.277 22.747  610.272 1.00 163.35 ? 311  GLN A OE1   1 
ATOM   2109  N  NE2   . GLN A 1  311  ? 426.739 21.469  608.484 1.00 160.59 ? 311  GLN A NE2   1 
ATOM   2110  N  N     . PRO A 1  312  ? 424.355 20.200  614.891 1.00 222.38 ? 312  PRO A N     1 
ATOM   2111  C  CA    . PRO A 1  312  ? 424.452 20.413  616.342 1.00 219.44 ? 312  PRO A CA    1 
ATOM   2112  C  C     . PRO A 1  312  ? 424.730 19.123  617.112 1.00 214.01 ? 312  PRO A C     1 
ATOM   2113  O  O     . PRO A 1  312  ? 423.845 18.280  617.255 1.00 214.09 ? 312  PRO A O     1 
ATOM   2114  C  CB    . PRO A 1  312  ? 423.075 20.984  616.711 1.00 222.46 ? 312  PRO A CB    1 
ATOM   2115  C  CG    . PRO A 1  312  ? 422.185 20.646  615.559 1.00 224.61 ? 312  PRO A CG    1 
ATOM   2116  C  CD    . PRO A 1  312  ? 423.073 20.698  614.362 1.00 223.74 ? 312  PRO A CD    1 
ATOM   2117  N  N     . GLN A 1  313  ? 425.959 18.985  617.601 1.00 123.98 ? 313  GLN A N     1 
ATOM   2118  C  CA    . GLN A 1  313  ? 426.386 17.776  618.296 1.00 120.73 ? 313  GLN A CA    1 
ATOM   2119  C  C     . GLN A 1  313  ? 426.124 17.875  619.797 1.00 118.79 ? 313  GLN A C     1 
ATOM   2120  O  O     . GLN A 1  313  ? 426.473 16.971  620.556 1.00 116.75 ? 313  GLN A O     1 
ATOM   2121  C  CB    . GLN A 1  313  ? 427.871 17.510  618.032 1.00 119.01 ? 313  GLN A CB    1 
ATOM   2122  C  CG    . GLN A 1  313  ? 428.296 16.059  618.216 1.00 115.39 ? 313  GLN A CG    1 
ATOM   2123  C  CD    . GLN A 1  313  ? 429.783 15.853  618.000 1.00 109.62 ? 313  GLN A CD    1 
ATOM   2124  O  OE1   . GLN A 1  313  ? 430.533 16.811  617.811 1.00 111.01 ? 313  GLN A OE1   1 
ATOM   2125  N  NE2   . GLN A 1  313  ? 430.217 14.599  618.025 1.00 102.51 ? 313  GLN A NE2   1 
ATOM   2126  N  N     . ALA A 1  314  ? 425.508 18.981  620.211 1.00 129.97 ? 314  ALA A N     1 
ATOM   2127  C  CA    . ALA A 1  314  ? 425.157 19.217  621.611 1.00 131.19 ? 314  ALA A CA    1 
ATOM   2128  C  C     . ALA A 1  314  ? 426.358 19.056  622.540 1.00 127.82 ? 314  ALA A C     1 
ATOM   2129  O  O     . ALA A 1  314  ? 426.521 18.019  623.184 1.00 124.90 ? 314  ALA A O     1 
ATOM   2130  C  CB    . ALA A 1  314  ? 424.027 18.285  622.040 1.00 127.30 ? 314  ALA A CB    1 
ATOM   2131  N  N     . LEU A 1  315  ? 427.192 20.087  622.606 1.00 119.41 ? 315  LEU A N     1 
ATOM   2132  C  CA    . LEU A 1  315  ? 428.383 20.057  623.447 1.00 118.23 ? 315  LEU A CA    1 
ATOM   2133  C  C     . LEU A 1  315  ? 428.015 20.202  624.922 1.00 119.00 ? 315  LEU A C     1 
ATOM   2134  O  O     . LEU A 1  315  ? 426.836 20.204  625.278 1.00 118.22 ? 315  LEU A O     1 
ATOM   2135  C  CB    . LEU A 1  315  ? 429.356 21.162  623.031 1.00 119.03 ? 315  LEU A CB    1 
ATOM   2136  C  CG    . LEU A 1  315  ? 429.664 21.267  621.534 1.00 119.64 ? 315  LEU A CG    1 
ATOM   2137  C  CD1   . LEU A 1  315  ? 430.699 22.350  621.271 1.00 120.09 ? 315  LEU A CD1   1 
ATOM   2138  C  CD2   . LEU A 1  315  ? 430.126 19.931  620.974 1.00 117.83 ? 315  LEU A CD2   1 
ATOM   2139  N  N     . GLN A 1  316  ? 429.025 20.325  625.778 1.00 152.67 ? 316  GLN A N     1 
ATOM   2140  C  CA    . GLN A 1  316  ? 428.787 20.470  627.210 1.00 154.63 ? 316  GLN A CA    1 
ATOM   2141  C  C     . GLN A 1  316  ? 429.441 21.736  627.758 1.00 156.06 ? 316  GLN A C     1 
ATOM   2142  O  O     . GLN A 1  316  ? 429.834 22.623  627.000 1.00 156.22 ? 316  GLN A O     1 
ATOM   2143  C  CB    . GLN A 1  316  ? 429.300 19.243  627.968 1.00 151.77 ? 316  GLN A CB    1 
ATOM   2144  C  CG    . GLN A 1  316  ? 428.395 18.798  629.109 1.00 153.21 ? 316  GLN A CG    1 
ATOM   2145  C  CD    . GLN A 1  316  ? 429.068 17.811  630.040 1.00 152.44 ? 316  GLN A CD    1 
ATOM   2146  O  OE1   . GLN A 1  316  ? 428.683 16.643  630.111 1.00 151.77 ? 316  GLN A OE1   1 
ATOM   2147  N  NE2   . GLN A 1  316  ? 430.077 18.277  630.767 1.00 153.20 ? 316  GLN A NE2   1 
ATOM   2148  N  N     . LYS A 1  317  ? 429.552 21.811  629.081 1.00 142.27 ? 317  LYS A N     1 
ATOM   2149  C  CA    . LYS A 1  317  ? 430.127 22.974  629.747 1.00 145.25 ? 317  LYS A CA    1 
ATOM   2150  C  C     . LYS A 1  317  ? 431.635 23.048  629.531 1.00 143.15 ? 317  LYS A C     1 
ATOM   2151  O  O     . LYS A 1  317  ? 432.207 24.135  629.443 1.00 144.64 ? 317  LYS A O     1 
ATOM   2152  C  CB    . LYS A 1  317  ? 429.807 22.937  631.245 1.00 145.25 ? 317  LYS A CB    1 
ATOM   2153  C  CG    . LYS A 1  317  ? 430.239 24.175  632.017 1.00 148.84 ? 317  LYS A CG    1 
ATOM   2154  C  CD    . LYS A 1  317  ? 429.831 24.079  633.480 1.00 147.80 ? 317  LYS A CD    1 
ATOM   2155  C  CE    . LYS A 1  317  ? 430.231 25.325  634.254 1.00 145.71 ? 317  LYS A CE    1 
ATOM   2156  N  NZ    . LYS A 1  317  ? 431.705 25.528  634.265 1.00 144.11 ? 317  LYS A NZ    1 
ATOM   2157  N  N     . SER A 1  318  ? 432.274 21.886  629.439 1.00 139.21 ? 318  SER A N     1 
ATOM   2158  C  CA    . SER A 1  318  ? 433.721 21.818  629.264 1.00 134.58 ? 318  SER A CA    1 
ATOM   2159  C  C     . SER A 1  318  ? 434.113 21.788  627.789 1.00 132.73 ? 318  SER A C     1 
ATOM   2160  O  O     . SER A 1  318  ? 435.280 21.588  627.453 1.00 133.20 ? 318  SER A O     1 
ATOM   2161  C  CB    . SER A 1  318  ? 434.286 20.590  629.979 1.00 133.11 ? 318  SER A CB    1 
ATOM   2162  O  OG    . SER A 1  318  ? 433.717 19.396  629.471 1.00 132.22 ? 318  SER A OG    1 
ATOM   2163  N  N     . GLY A 1  319  ? 433.134 21.988  626.913 1.00 97.80  ? 319  GLY A N     1 
ATOM   2164  C  CA    . GLY A 1  319  ? 433.378 21.970  625.482 1.00 96.04  ? 319  GLY A CA    1 
ATOM   2165  C  C     . GLY A 1  319  ? 433.372 20.565  624.912 1.00 96.81  ? 319  GLY A C     1 
ATOM   2166  O  O     . GLY A 1  319  ? 433.549 20.372  623.708 1.00 94.47  ? 319  GLY A O     1 
ATOM   2167  N  N     . ARG A 1  320  ? 433.167 19.580  625.781 1.00 154.75 ? 320  ARG A N     1 
ATOM   2168  C  CA    . ARG A 1  320  ? 433.129 18.182  625.369 1.00 152.87 ? 320  ARG A CA    1 
ATOM   2169  C  C     . ARG A 1  320  ? 431.876 17.890  624.550 1.00 152.95 ? 320  ARG A C     1 
ATOM   2170  O  O     . ARG A 1  320  ? 430.785 18.338  624.901 1.00 156.92 ? 320  ARG A O     1 
ATOM   2171  C  CB    . ARG A 1  320  ? 433.181 17.259  626.591 1.00 153.09 ? 320  ARG A CB    1 
ATOM   2172  C  CG    . ARG A 1  320  ? 433.378 15.788  626.252 1.00 151.13 ? 320  ARG A CG    1 
ATOM   2173  C  CD    . ARG A 1  320  ? 432.954 14.869  627.391 1.00 150.67 ? 320  ARG A CD    1 
ATOM   2174  N  NE    . ARG A 1  320  ? 433.610 15.196  628.654 1.00 152.64 ? 320  ARG A NE    1 
ATOM   2175  C  CZ    . ARG A 1  320  ? 432.990 15.735  629.699 1.00 153.29 ? 320  ARG A CZ    1 
ATOM   2176  N  NH1   . ARG A 1  320  ? 431.694 16.005  629.635 1.00 155.57 ? 320  ARG A NH1   1 
ATOM   2177  N  NH2   . ARG A 1  320  ? 433.664 16.001  630.810 1.00 151.29 ? 320  ARG A NH2   1 
ATOM   2178  N  N     . PRO A 1  321  ? 432.029 17.131  623.452 1.00 114.79 ? 321  PRO A N     1 
ATOM   2179  C  CA    . PRO A 1  321  ? 430.899 16.701  622.619 1.00 115.29 ? 321  PRO A CA    1 
ATOM   2180  C  C     . PRO A 1  321  ? 429.909 15.794  623.356 1.00 116.71 ? 321  PRO A C     1 
ATOM   2181  O  O     . PRO A 1  321  ? 428.892 15.421  622.771 1.00 118.93 ? 321  PRO A O     1 
ATOM   2182  C  CB    . PRO A 1  321  ? 431.578 15.936  621.477 1.00 111.04 ? 321  PRO A CB    1 
ATOM   2183  C  CG    . PRO A 1  321  ? 432.956 16.490  621.419 1.00 111.91 ? 321  PRO A CG    1 
ATOM   2184  C  CD    . PRO A 1  321  ? 433.324 16.786  622.840 1.00 113.98 ? 321  PRO A CD    1 
ATOM   2185  N  N     . VAL A 1  322  ? 430.224 15.449  624.605 1.00 94.24  ? 322  VAL A N     1 
ATOM   2186  C  CA    . VAL A 1  322  ? 429.388 14.611  625.472 1.00 96.31  ? 322  VAL A CA    1 
ATOM   2187  C  C     . VAL A 1  322  ? 429.320 13.162  624.975 1.00 95.33  ? 322  VAL A C     1 
ATOM   2188  O  O     . VAL A 1  322  ? 429.354 12.892  623.773 1.00 93.41  ? 322  VAL A O     1 
ATOM   2189  C  CB    . VAL A 1  322  ? 427.952 15.203  625.631 1.00 95.36  ? 322  VAL A CB    1 
ATOM   2190  C  CG1   . VAL A 1  322  ? 426.886 14.265  625.075 1.00 92.26  ? 322  VAL A CG1   1 
ATOM   2191  C  CG2   . VAL A 1  322  ? 427.673 15.528  627.091 1.00 95.48  ? 322  VAL A CG2   1 
ATOM   2192  N  N     . LYS A 1  323  ? 429.254 12.232  625.922 1.00 117.25 ? 323  LYS A N     1 
ATOM   2193  C  CA    . LYS A 1  323  ? 429.213 10.810  625.606 1.00 114.81 ? 323  LYS A CA    1 
ATOM   2194  C  C     . LYS A 1  323  ? 427.788 10.272  625.653 1.00 112.22 ? 323  LYS A C     1 
ATOM   2195  O  O     . LYS A 1  323  ? 427.212 10.109  626.728 1.00 111.41 ? 323  LYS A O     1 
ATOM   2196  C  CB    . LYS A 1  323  ? 430.101 10.022  626.572 1.00 115.17 ? 323  LYS A CB    1 
ATOM   2197  C  CG    . LYS A 1  323  ? 431.584 10.331  626.450 1.00 112.87 ? 323  LYS A CG    1 
ATOM   2198  C  CD    . LYS A 1  323  ? 432.161 9.764   625.164 1.00 112.15 ? 323  LYS A CD    1 
ATOM   2199  C  CE    . LYS A 1  323  ? 432.048 8.247   625.134 1.00 108.80 ? 323  LYS A CE    1 
ATOM   2200  N  NZ    . LYS A 1  323  ? 432.641 7.665   623.899 1.00 109.84 ? 323  LYS A NZ    1 
ATOM   2201  N  N     . SER A 1  324  ? 427.225 9.998   624.482 1.00 110.41 ? 324  SER A N     1 
ATOM   2202  C  CA    . SER A 1  324  ? 425.882 9.438   624.397 1.00 110.71 ? 324  SER A CA    1 
ATOM   2203  C  C     . SER A 1  324  ? 425.899 7.946   624.703 1.00 107.28 ? 324  SER A C     1 
ATOM   2204  O  O     . SER A 1  324  ? 426.964 7.337   624.806 1.00 106.43 ? 324  SER A O     1 
ATOM   2205  C  CB    . SER A 1  324  ? 425.284 9.686   623.012 1.00 114.06 ? 324  SER A CB    1 
ATOM   2206  O  OG    . SER A 1  324  ? 426.109 9.143   621.996 1.00 111.24 ? 324  SER A OG    1 
ATOM   2207  N  N     . ILE A 1  325  ? 424.713 7.362   624.848 1.00 73.91  ? 325  ILE A N     1 
ATOM   2208  C  CA    . ILE A 1  325  ? 424.590 5.932   625.097 1.00 69.46  ? 325  ILE A CA    1 
ATOM   2209  C  C     . ILE A 1  325  ? 425.072 5.148   623.880 1.00 68.02  ? 325  ILE A C     1 
ATOM   2210  O  O     . ILE A 1  325  ? 425.627 4.056   624.007 1.00 66.46  ? 325  ILE A O     1 
ATOM   2211  C  CB    . ILE A 1  325  ? 423.135 5.538   625.429 1.00 70.97  ? 325  ILE A CB    1 
ATOM   2212  C  CG1   . ILE A 1  325  ? 422.569 6.453   626.516 1.00 72.84  ? 325  ILE A CG1   1 
ATOM   2213  C  CG2   . ILE A 1  325  ? 423.055 4.080   625.861 1.00 69.42  ? 325  ILE A CG2   1 
ATOM   2214  C  CD1   . ILE A 1  325  ? 421.152 6.111   626.923 1.00 74.46  ? 325  ILE A CD1   1 
ATOM   2215  N  N     . ARG A 1  326  ? 424.867 5.725   622.700 1.00 66.44  ? 326  ARG A N     1 
ATOM   2216  C  CA    . ARG A 1  326  ? 425.271 5.096   621.448 1.00 65.36  ? 326  ARG A CA    1 
ATOM   2217  C  C     . ARG A 1  326  ? 426.787 4.950   621.357 1.00 63.24  ? 326  ARG A C     1 
ATOM   2218  O  O     . ARG A 1  326  ? 427.296 3.908   620.944 1.00 61.49  ? 326  ARG A O     1 
ATOM   2219  C  CB    . ARG A 1  326  ? 424.748 5.903   620.257 1.00 67.24  ? 326  ARG A CB    1 
ATOM   2220  C  CG    . ARG A 1  326  ? 424.980 5.250   618.908 1.00 66.51  ? 326  ARG A CG    1 
ATOM   2221  C  CD    . ARG A 1  326  ? 426.149 5.873   618.160 1.00 65.92  ? 326  ARG A CD    1 
ATOM   2222  N  NE    . ARG A 1  326  ? 426.505 5.100   616.973 1.00 64.95  ? 326  ARG A NE    1 
ATOM   2223  C  CZ    . ARG A 1  326  ? 425.921 5.235   615.787 1.00 66.32  ? 326  ARG A CZ    1 
ATOM   2224  N  NH1   . ARG A 1  326  ? 424.944 6.116   615.624 1.00 68.72  ? 326  ARG A NH1   1 
ATOM   2225  N  NH2   . ARG A 1  326  ? 426.311 4.487   614.765 1.00 65.39  ? 326  ARG A NH2   1 
ATOM   2226  N  N     . ALA A 1  327  ? 427.501 6.001   621.747 1.00 69.00  ? 327  ALA A N     1 
ATOM   2227  C  CA    . ALA A 1  327  ? 428.959 6.008   621.685 1.00 67.22  ? 327  ALA A CA    1 
ATOM   2228  C  C     . ALA A 1  327  ? 429.566 5.020   622.677 1.00 65.19  ? 327  ALA A C     1 
ATOM   2229  O  O     . ALA A 1  327  ? 430.666 4.509   622.462 1.00 63.33  ? 327  ALA A O     1 
ATOM   2230  C  CB    . ALA A 1  327  ? 429.492 7.409   621.943 1.00 68.26  ? 327  ALA A CB    1 
ATOM   2231  N  N     . ARG A 1  328  ? 428.843 4.756   623.761 1.00 74.77  ? 328  ARG A N     1 
ATOM   2232  C  CA    . ARG A 1  328  ? 429.304 3.819   624.780 1.00 73.91  ? 328  ARG A CA    1 
ATOM   2233  C  C     . ARG A 1  328  ? 429.366 2.391   624.250 1.00 69.37  ? 328  ARG A C     1 
ATOM   2234  O  O     . ARG A 1  328  ? 430.167 1.582   624.716 1.00 66.40  ? 328  ARG A O     1 
ATOM   2235  C  CB    . ARG A 1  328  ? 428.394 3.866   626.009 1.00 73.72  ? 328  ARG A CB    1 
ATOM   2236  C  CG    . ARG A 1  328  ? 428.543 5.109   626.869 1.00 72.77  ? 328  ARG A CG    1 
ATOM   2237  C  CD    . ARG A 1  328  ? 427.774 4.947   628.171 1.00 71.81  ? 328  ARG A CD    1 
ATOM   2238  N  NE    . ARG A 1  328  ? 427.966 6.073   629.078 1.00 76.65  ? 328  ARG A NE    1 
ATOM   2239  C  CZ    . ARG A 1  328  ? 427.493 6.117   630.319 1.00 77.14  ? 328  ARG A CZ    1 
ATOM   2240  N  NH1   . ARG A 1  328  ? 426.800 5.094   630.803 1.00 72.79  ? 328  ARG A NH1   1 
ATOM   2241  N  NH2   . ARG A 1  328  ? 427.713 7.182   631.078 1.00 75.79  ? 328  ARG A NH2   1 
ATOM   2242  N  N     . LEU A 1  329  ? 428.516 2.086   623.275 1.00 57.63  ? 329  LEU A N     1 
ATOM   2243  C  CA    . LEU A 1  329  ? 428.391 0.723   622.773 1.00 56.42  ? 329  LEU A CA    1 
ATOM   2244  C  C     . LEU A 1  329  ? 429.211 0.489   621.508 1.00 55.36  ? 329  LEU A C     1 
ATOM   2245  O  O     . LEU A 1  329  ? 429.584 -0.644  621.203 1.00 53.83  ? 329  LEU A O     1 
ATOM   2246  C  CB    . LEU A 1  329  ? 426.921 0.394   622.505 1.00 57.98  ? 329  LEU A CB    1 
ATOM   2247  C  CG    . LEU A 1  329  ? 425.945 0.701   623.643 1.00 59.43  ? 329  LEU A CG    1 
ATOM   2248  C  CD1   . LEU A 1  329  ? 424.550 0.204   623.303 1.00 60.83  ? 329  LEU A CD1   1 
ATOM   2249  C  CD2   . LEU A 1  329  ? 426.431 0.093   624.944 1.00 58.12  ? 329  LEU A CD2   1 
ATOM   2250  N  N     . LYS A 1  330  ? 429.490 1.563   620.776 1.00 67.03  ? 330  LYS A N     1 
ATOM   2251  C  CA    . LYS A 1  330  ? 430.205 1.465   619.508 1.00 65.20  ? 330  LYS A CA    1 
ATOM   2252  C  C     . LYS A 1  330  ? 431.680 1.128   619.723 1.00 65.86  ? 330  LYS A C     1 
ATOM   2253  O  O     . LYS A 1  330  ? 432.419 1.902   620.332 1.00 67.29  ? 330  LYS A O     1 
ATOM   2254  C  CB    . LYS A 1  330  ? 430.067 2.771   618.722 1.00 68.56  ? 330  LYS A CB    1 
ATOM   2255  C  CG    . LYS A 1  330  ? 430.269 2.628   617.224 1.00 70.95  ? 330  LYS A CG    1 
ATOM   2256  C  CD    . LYS A 1  330  ? 429.997 3.943   616.509 1.00 73.30  ? 330  LYS A CD    1 
ATOM   2257  C  CE    . LYS A 1  330  ? 429.974 3.764   614.999 1.00 78.23  ? 330  LYS A CE    1 
ATOM   2258  N  NZ    . LYS A 1  330  ? 431.270 3.256   614.471 1.00 77.56  ? 330  LYS A NZ    1 
ATOM   2259  N  N     . GLY A 1  331  ? 432.100 -0.028  619.214 1.00 88.20  ? 331  GLY A N     1 
ATOM   2260  C  CA    . GLY A 1  331  ? 433.465 -0.499  619.382 1.00 85.78  ? 331  GLY A CA    1 
ATOM   2261  C  C     . GLY A 1  331  ? 434.501 0.361   618.679 1.00 90.50  ? 331  GLY A C     1 
ATOM   2262  O  O     . GLY A 1  331  ? 434.152 1.341   618.021 1.00 95.08  ? 331  GLY A O     1 
ATOM   2263  N  N     . LYS A 1  332  ? 435.776 0.001   618.808 1.00 70.97  ? 332  LYS A N     1 
ATOM   2264  C  CA    . LYS A 1  332  ? 436.200 -1.180  619.557 1.00 65.27  ? 332  LYS A CA    1 
ATOM   2265  C  C     . LYS A 1  332  ? 436.389 -0.880  621.041 1.00 67.20  ? 332  LYS A C     1 
ATOM   2266  O  O     . LYS A 1  332  ? 436.588 -1.790  621.846 1.00 64.32  ? 332  LYS A O     1 
ATOM   2267  C  CB    . LYS A 1  332  ? 437.499 -1.739  618.975 1.00 62.37  ? 332  LYS A CB    1 
ATOM   2268  C  CG    . LYS A 1  332  ? 438.643 -0.740  618.967 1.00 65.84  ? 332  LYS A CG    1 
ATOM   2269  C  CD    . LYS A 1  332  ? 439.929 -1.365  618.454 1.00 64.30  ? 332  LYS A CD    1 
ATOM   2270  C  CE    . LYS A 1  332  ? 441.045 -0.334  618.365 1.00 62.65  ? 332  LYS A CE    1 
ATOM   2271  N  NZ    . LYS A 1  332  ? 441.338 0.295   619.685 1.00 64.08  ? 332  LYS A NZ    1 
ATOM   2272  N  N     . GLU A 1  333  ? 436.332 0.400   621.396 1.00 102.70 ? 333  GLU A N     1 
ATOM   2273  C  CA    . GLU A 1  333  ? 436.406 0.810   622.794 1.00 101.15 ? 333  GLU A CA    1 
ATOM   2274  C  C     . GLU A 1  333  ? 435.027 0.749   623.442 1.00 103.47 ? 333  GLU A C     1 
ATOM   2275  O  O     . GLU A 1  333  ? 434.873 1.053   624.625 1.00 103.38 ? 333  GLU A O     1 
ATOM   2276  C  CB    . GLU A 1  333  ? 436.982 2.224   622.919 1.00 104.94 ? 333  GLU A CB    1 
ATOM   2277  C  CG    . GLU A 1  333  ? 438.410 2.284   623.449 1.00 105.72 ? 333  GLU A CG    1 
ATOM   2278  C  CD    . GLU A 1  333  ? 439.448 1.978   622.388 1.00 103.43 ? 333  GLU A CD    1 
ATOM   2279  O  OE1   . GLU A 1  333  ? 440.626 1.773   622.750 1.00 99.30  ? 333  GLU A OE1   1 
ATOM   2280  O  OE2   . GLU A 1  333  ? 439.090 1.949   621.192 1.00 103.99 ? 333  GLU A OE2   1 
ATOM   2281  N  N     . GLY A 1  334  ? 434.030 0.351   622.658 1.00 92.39  ? 334  GLY A N     1 
ATOM   2282  C  CA    . GLY A 1  334  ? 432.657 0.287   623.126 1.00 92.43  ? 334  GLY A CA    1 
ATOM   2283  C  C     . GLY A 1  334  ? 432.427 -0.769  624.189 1.00 89.85  ? 334  GLY A C     1 
ATOM   2284  O  O     . GLY A 1  334  ? 433.353 -1.466  624.595 1.00 87.19  ? 334  GLY A O     1 
ATOM   2285  N  N     . ARG A 1  335  ? 431.183 -0.887  624.640 1.00 66.99  ? 335  ARG A N     1 
ATOM   2286  C  CA    . ARG A 1  335  ? 430.842 -1.835  625.693 1.00 65.09  ? 335  ARG A CA    1 
ATOM   2287  C  C     . ARG A 1  335  ? 430.915 -3.273  625.192 1.00 61.75  ? 335  ARG A C     1 
ATOM   2288  O  O     . ARG A 1  335  ? 431.415 -4.157  625.886 1.00 60.64  ? 335  ARG A O     1 
ATOM   2289  C  CB    . ARG A 1  335  ? 429.444 -1.542  626.244 1.00 65.50  ? 335  ARG A CB    1 
ATOM   2290  C  CG    . ARG A 1  335  ? 429.058 -2.397  627.441 1.00 62.66  ? 335  ARG A CG    1 
ATOM   2291  C  CD    . ARG A 1  335  ? 428.856 -1.554  628.693 1.00 66.59  ? 335  ARG A CD    1 
ATOM   2292  N  NE    . ARG A 1  335  ? 430.016 -0.719  628.993 1.00 66.17  ? 335  ARG A NE    1 
ATOM   2293  C  CZ    . ARG A 1  335  ? 430.047 0.600   628.839 1.00 68.51  ? 335  ARG A CZ    1 
ATOM   2294  N  NH1   . ARG A 1  335  ? 428.978 1.244   628.392 1.00 71.30  ? 335  ARG A NH1   1 
ATOM   2295  N  NH2   . ARG A 1  335  ? 431.147 1.278   629.135 1.00 68.94  ? 335  ARG A NH2   1 
ATOM   2296  N  N     . ILE A 1  336  ? 430.420 -3.498  623.979 1.00 53.64  ? 336  ILE A N     1 
ATOM   2297  C  CA    . ILE A 1  336  ? 430.340 -4.844  623.423 1.00 52.62  ? 336  ILE A CA    1 
ATOM   2298  C  C     . ILE A 1  336  ? 431.721 -5.418  623.109 1.00 50.54  ? 336  ILE A C     1 
ATOM   2299  O  O     . ILE A 1  336  ? 432.089 -6.480  623.610 1.00 49.22  ? 336  ILE A O     1 
ATOM   2300  C  CB    . ILE A 1  336  ? 429.476 -4.879  622.141 1.00 53.78  ? 336  ILE A CB    1 
ATOM   2301  C  CG1   . ILE A 1  336  ? 427.991 -4.720  622.481 1.00 55.72  ? 336  ILE A CG1   1 
ATOM   2302  C  CG2   . ILE A 1  336  ? 429.682 -6.186  621.395 1.00 52.58  ? 336  ILE A CG2   1 
ATOM   2303  C  CD1   . ILE A 1  336  ? 427.536 -3.287  622.660 1.00 57.50  ? 336  ILE A CD1   1 
ATOM   2304  N  N     . ARG A 1  337  ? 432.487 -4.713  622.285 1.00 46.69  ? 337  ARG A N     1 
ATOM   2305  C  CA    . ARG A 1  337  ? 433.793 -5.209  621.868 1.00 44.88  ? 337  ARG A CA    1 
ATOM   2306  C  C     . ARG A 1  337  ? 434.874 -4.967  622.916 1.00 43.79  ? 337  ARG A C     1 
ATOM   2307  O  O     . ARG A 1  337  ? 435.908 -5.635  622.913 1.00 42.16  ? 337  ARG A O     1 
ATOM   2308  C  CB    . ARG A 1  337  ? 434.208 -4.565  620.546 1.00 45.21  ? 337  ARG A CB    1 
ATOM   2309  C  CG    . ARG A 1  337  ? 433.346 -4.963  619.366 1.00 46.08  ? 337  ARG A CG    1 
ATOM   2310  C  CD    . ARG A 1  337  ? 433.894 -4.367  618.086 1.00 46.34  ? 337  ARG A CD    1 
ATOM   2311  N  NE    . ARG A 1  337  ? 435.309 -4.680  617.912 1.00 44.61  ? 337  ARG A NE    1 
ATOM   2312  C  CZ    . ARG A 1  337  ? 436.052 -4.232  616.907 1.00 44.56  ? 337  ARG A CZ    1 
ATOM   2313  N  NH1   . ARG A 1  337  ? 435.515 -3.450  615.981 1.00 46.16  ? 337  ARG A NH1   1 
ATOM   2314  N  NH2   . ARG A 1  337  ? 437.332 -4.567  616.826 1.00 43.01  ? 337  ARG A NH2   1 
ATOM   2315  N  N     . GLY A 1  338  ? 434.631 -4.020  623.815 1.00 46.37  ? 338  GLY A N     1 
ATOM   2316  C  CA    . GLY A 1  338  ? 435.639 -3.620  624.778 1.00 45.63  ? 338  GLY A CA    1 
ATOM   2317  C  C     . GLY A 1  338  ? 435.437 -4.153  626.183 1.00 45.36  ? 338  GLY A C     1 
ATOM   2318  O  O     . GLY A 1  338  ? 436.373 -4.153  626.982 1.00 44.45  ? 338  GLY A O     1 
ATOM   2319  N  N     . ASN A 1  339  ? 434.226 -4.605  626.492 1.00 44.54  ? 339  ASN A N     1 
ATOM   2320  C  CA    . ASN A 1  339  ? 433.931 -5.093  627.835 1.00 44.53  ? 339  ASN A CA    1 
ATOM   2321  C  C     . ASN A 1  339  ? 433.190 -6.427  627.844 1.00 44.26  ? 339  ASN A C     1 
ATOM   2322  O  O     . ASN A 1  339  ? 432.979 -7.014  628.904 1.00 44.16  ? 339  ASN A O     1 
ATOM   2323  C  CB    . ASN A 1  339  ? 433.115 -4.054  628.608 1.00 46.40  ? 339  ASN A CB    1 
ATOM   2324  C  CG    . ASN A 1  339  ? 433.846 -2.735  628.764 1.00 46.80  ? 339  ASN A CG    1 
ATOM   2325  O  OD1   . ASN A 1  339  ? 433.627 -1.795  627.999 1.00 47.83  ? 339  ASN A OD1   1 
ATOM   2326  N  ND2   . ASN A 1  339  ? 434.719 -2.658  629.761 1.00 46.10  ? 339  ASN A ND2   1 
ATOM   2327  N  N     . LEU A 1  340  ? 432.796 -6.904  626.668 1.00 46.49  ? 340  LEU A N     1 
ATOM   2328  C  CA    . LEU A 1  340  ? 432.037 -8.147  626.575 1.00 46.41  ? 340  LEU A CA    1 
ATOM   2329  C  C     . LEU A 1  340  ? 432.749 -9.201  625.733 1.00 44.82  ? 340  LEU A C     1 
ATOM   2330  O  O     . LEU A 1  340  ? 432.922 -10.339 626.170 1.00 43.86  ? 340  LEU A O     1 
ATOM   2331  C  CB    . LEU A 1  340  ? 430.643 -7.878  626.006 1.00 48.23  ? 340  LEU A CB    1 
ATOM   2332  C  CG    . LEU A 1  340  ? 429.717 -7.055  626.899 1.00 50.00  ? 340  LEU A CG    1 
ATOM   2333  C  CD1   . LEU A 1  340  ? 428.426 -6.743  626.172 1.00 51.81  ? 340  LEU A CD1   1 
ATOM   2334  C  CD2   . LEU A 1  340  ? 429.439 -7.799  628.193 1.00 49.89  ? 340  LEU A CD2   1 
ATOM   2335  N  N     . MET A 1  341  ? 433.155 -8.825  624.525 1.00 61.96  ? 341  MET A N     1 
ATOM   2336  C  CA    . MET A 1  341  ? 433.885 -9.740  623.657 1.00 61.89  ? 341  MET A CA    1 
ATOM   2337  C  C     . MET A 1  341  ? 435.304 -9.931  624.175 1.00 58.63  ? 341  MET A C     1 
ATOM   2338  O  O     . MET A 1  341  ? 435.975 -10.910 623.850 1.00 56.48  ? 341  MET A O     1 
ATOM   2339  C  CB    . MET A 1  341  ? 433.910 -9.223  622.217 1.00 65.16  ? 341  MET A CB    1 
ATOM   2340  C  CG    . MET A 1  341  ? 432.533 -8.987  621.614 1.00 66.27  ? 341  MET A CG    1 
ATOM   2341  S  SD    . MET A 1  341  ? 431.441 -10.415 621.761 1.00 64.75  ? 341  MET A SD    1 
ATOM   2342  C  CE    . MET A 1  341  ? 432.454 -11.688 621.020 1.00 61.80  ? 341  MET A CE    1 
ATOM   2343  N  N     . GLY A 1  342  ? 435.749 -8.978  624.986 1.00 45.03  ? 342  GLY A N     1 
ATOM   2344  C  CA    . GLY A 1  342  ? 437.063 -9.028  625.592 1.00 43.64  ? 342  GLY A CA    1 
ATOM   2345  C  C     . GLY A 1  342  ? 437.149 -8.044  626.740 1.00 44.32  ? 342  GLY A C     1 
ATOM   2346  O  O     . GLY A 1  342  ? 436.528 -6.983  626.700 1.00 45.75  ? 342  GLY A O     1 
ATOM   2347  N  N     . LYS A 1  343  ? 437.915 -8.395  627.767 1.00 44.51  ? 343  LYS A N     1 
ATOM   2348  C  CA    . LYS A 1  343  ? 438.059 -7.539  628.938 1.00 45.16  ? 343  LYS A CA    1 
ATOM   2349  C  C     . LYS A 1  343  ? 439.286 -7.910  629.758 1.00 43.85  ? 343  LYS A C     1 
ATOM   2350  O  O     . LYS A 1  343  ? 439.773 -9.039  629.687 1.00 42.55  ? 343  LYS A O     1 
ATOM   2351  C  CB    . LYS A 1  343  ? 436.804 -7.613  629.809 1.00 48.13  ? 343  LYS A CB    1 
ATOM   2352  C  CG    . LYS A 1  343  ? 436.222 -9.009  629.960 1.00 46.06  ? 343  LYS A CG    1 
ATOM   2353  C  CD    . LYS A 1  343  ? 434.992 -8.984  630.851 1.00 47.54  ? 343  LYS A CD    1 
ATOM   2354  C  CE    . LYS A 1  343  ? 434.201 -10.276 630.762 1.00 47.49  ? 343  LYS A CE    1 
ATOM   2355  N  NZ    . LYS A 1  343  ? 433.530 -10.431 629.444 1.00 47.87  ? 343  LYS A NZ    1 
ATOM   2356  N  N     . ARG A 1  344  ? 439.783 -6.951  630.534 1.00 53.57  ? 344  ARG A N     1 
ATOM   2357  C  CA    . ARG A 1  344  ? 440.942 -7.178  631.389 1.00 52.11  ? 344  ARG A CA    1 
ATOM   2358  C  C     . ARG A 1  344  ? 440.595 -8.173  632.487 1.00 52.35  ? 344  ARG A C     1 
ATOM   2359  O  O     . ARG A 1  344  ? 439.495 -8.142  633.040 1.00 57.06  ? 344  ARG A O     1 
ATOM   2360  C  CB    . ARG A 1  344  ? 441.434 -5.861  631.986 1.00 53.99  ? 344  ARG A CB    1 
ATOM   2361  C  CG    . ARG A 1  344  ? 441.689 -4.801  630.935 1.00 57.24  ? 344  ARG A CG    1 
ATOM   2362  C  CD    . ARG A 1  344  ? 442.245 -3.522  631.525 1.00 58.28  ? 344  ARG A CD    1 
ATOM   2363  N  NE    . ARG A 1  344  ? 442.367 -2.492  630.499 1.00 61.34  ? 344  ARG A NE    1 
ATOM   2364  C  CZ    . ARG A 1  344  ? 443.387 -2.400  629.652 1.00 62.50  ? 344  ARG A CZ    1 
ATOM   2365  N  NH1   . ARG A 1  344  ? 444.382 -3.275  629.710 1.00 56.39  ? 344  ARG A NH1   1 
ATOM   2366  N  NH2   . ARG A 1  344  ? 443.414 -1.432  628.745 1.00 65.47  ? 344  ARG A NH2   1 
ATOM   2367  N  N     . VAL A 1  345  ? 441.533 -9.063  632.793 1.00 35.05  ? 345  VAL A N     1 
ATOM   2368  C  CA    . VAL A 1  345  ? 441.258 -10.163 633.707 1.00 34.80  ? 345  VAL A CA    1 
ATOM   2369  C  C     . VAL A 1  345  ? 442.256 -10.244 634.856 1.00 34.32  ? 345  VAL A C     1 
ATOM   2370  O  O     . VAL A 1  345  ? 443.370 -9.726  634.767 1.00 33.74  ? 345  VAL A O     1 
ATOM   2371  C  CB    . VAL A 1  345  ? 441.258 -11.513 632.964 1.00 33.66  ? 345  VAL A CB    1 
ATOM   2372  C  CG1   . VAL A 1  345  ? 440.203 -11.515 631.873 1.00 34.28  ? 345  VAL A CG1   1 
ATOM   2373  C  CG2   . VAL A 1  345  ? 442.633 -11.795 632.379 1.00 32.13  ? 345  VAL A CG2   1 
ATOM   2374  N  N     . ASP A 1  346  ? 441.842 -10.896 635.939 1.00 37.45  ? 346  ASP A N     1 
ATOM   2375  C  CA    . ASP A 1  346  ? 442.729 -11.166 637.061 1.00 37.05  ? 346  ASP A CA    1 
ATOM   2376  C  C     . ASP A 1  346  ? 443.607 -12.372 636.754 1.00 35.41  ? 346  ASP A C     1 
ATOM   2377  O  O     . ASP A 1  346  ? 443.422 -13.037 635.734 1.00 34.70  ? 346  ASP A O     1 
ATOM   2378  C  CB    . ASP A 1  346  ? 441.930 -11.411 638.343 1.00 38.21  ? 346  ASP A CB    1 
ATOM   2379  C  CG    . ASP A 1  346  ? 441.110 -10.209 638.759 1.00 39.94  ? 346  ASP A CG    1 
ATOM   2380  O  OD1   . ASP A 1  346  ? 441.531 -9.070  638.466 1.00 40.22  ? 346  ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A 1  346  ? 440.045 -10.405 639.385 1.00 41.10  ? 346  ASP A OD2   1 
ATOM   2382  N  N     . PHE A 1  347  ? 444.554 -12.646 637.647 1.00 32.32  ? 347  PHE A N     1 
ATOM   2383  C  CA    . PHE A 1  347  ? 445.465 -13.780 637.512 1.00 30.88  ? 347  PHE A CA    1 
ATOM   2384  C  C     . PHE A 1  347  ? 446.166 -13.769 636.159 1.00 29.73  ? 347  PHE A C     1 
ATOM   2385  O  O     . PHE A 1  347  ? 446.256 -14.790 635.479 1.00 28.78  ? 347  PHE A O     1 
ATOM   2386  C  CB    . PHE A 1  347  ? 444.712 -15.093 637.723 1.00 30.83  ? 347  PHE A CB    1 
ATOM   2387  C  CG    . PHE A 1  347  ? 443.953 -15.143 639.016 1.00 32.10  ? 347  PHE A CG    1 
ATOM   2388  C  CD1   . PHE A 1  347  ? 444.618 -15.336 640.216 1.00 32.19  ? 347  PHE A CD1   1 
ATOM   2389  C  CD2   . PHE A 1  347  ? 442.579 -14.982 639.037 1.00 33.32  ? 347  PHE A CD2   1 
ATOM   2390  C  CE1   . PHE A 1  347  ? 443.924 -15.376 641.411 1.00 33.48  ? 347  PHE A CE1   1 
ATOM   2391  C  CE2   . PHE A 1  347  ? 441.880 -15.023 640.230 1.00 34.60  ? 347  PHE A CE2   1 
ATOM   2392  C  CZ    . PHE A 1  347  ? 442.555 -15.220 641.419 1.00 34.68  ? 347  PHE A CZ    1 
ATOM   2393  N  N     . SER A 1  348  ? 446.655 -12.593 635.782 1.00 32.39  ? 348  SER A N     1 
ATOM   2394  C  CA    . SER A 1  348  ? 447.360 -12.413 634.523 1.00 31.78  ? 348  SER A CA    1 
ATOM   2395  C  C     . SER A 1  348  ? 448.699 -11.730 634.760 1.00 31.11  ? 348  SER A C     1 
ATOM   2396  O  O     . SER A 1  348  ? 448.853 -10.961 635.709 1.00 32.88  ? 348  SER A O     1 
ATOM   2397  C  CB    . SER A 1  348  ? 446.516 -11.596 633.544 1.00 32.60  ? 348  SER A CB    1 
ATOM   2398  O  OG    . SER A 1  348  ? 446.275 -10.292 634.047 1.00 30.41  ? 348  SER A OG    1 
ATOM   2399  N  N     . ALA A 1  349  ? 449.666 -12.015 633.896 1.00 26.60  ? 349  ALA A N     1 
ATOM   2400  C  CA    . ALA A 1  349  ? 450.988 -11.411 634.004 1.00 26.01  ? 349  ALA A CA    1 
ATOM   2401  C  C     . ALA A 1  349  ? 451.530 -11.066 632.623 1.00 25.97  ? 349  ALA A C     1 
ATOM   2402  O  O     . ALA A 1  349  ? 451.064 -11.596 631.622 1.00 27.66  ? 349  ALA A O     1 
ATOM   2403  C  CB    . ALA A 1  349  ? 451.940 -12.341 634.732 1.00 26.69  ? 349  ALA A CB    1 
ATOM   2404  N  N     . ARG A 1  350  ? 452.503 -10.166 632.569 1.00 21.70  ? 350  ARG A N     1 
ATOM   2405  C  CA    . ARG A 1  350  ? 453.085 -9.760  631.295 1.00 20.79  ? 350  ARG A CA    1 
ATOM   2406  C  C     . ARG A 1  350  ? 454.535 -9.355  631.475 1.00 19.93  ? 350  ARG A C     1 
ATOM   2407  O  O     . ARG A 1  350  ? 454.853 -8.576  632.374 1.00 19.45  ? 350  ARG A O     1 
ATOM   2408  C  CB    . ARG A 1  350  ? 452.293 -8.604  630.680 1.00 20.05  ? 350  ARG A CB    1 
ATOM   2409  C  CG    . ARG A 1  350  ? 452.908 -8.040  629.411 1.00 19.11  ? 350  ARG A CG    1 
ATOM   2410  C  CD    . ARG A 1  350  ? 452.093 -6.882  628.873 1.00 18.56  ? 350  ARG A CD    1 
ATOM   2411  N  NE    . ARG A 1  350  ? 452.656 -6.349  627.637 1.00 17.77  ? 350  ARG A NE    1 
ATOM   2412  C  CZ    . ARG A 1  350  ? 452.272 -6.722  626.421 1.00 18.08  ? 350  ARG A CZ    1 
ATOM   2413  N  NH1   . ARG A 1  350  ? 451.319 -7.633  626.274 1.00 19.14  ? 350  ARG A NH1   1 
ATOM   2414  N  NH2   . ARG A 1  350  ? 452.839 -6.181  625.351 1.00 17.40  ? 350  ARG A NH2   1 
ATOM   2415  N  N     . THR A 1  351  ? 455.423 -9.886  630.638 1.00 35.21  ? 351  THR A N     1 
ATOM   2416  C  CA    . THR A 1  351  ? 456.835 -9.514  630.752 1.00 32.37  ? 351  THR A CA    1 
ATOM   2417  C  C     . THR A 1  351  ? 457.623 -9.700  629.462 1.00 33.70  ? 351  THR A C     1 
ATOM   2418  O  O     . THR A 1  351  ? 457.207 -10.432 628.562 1.00 34.58  ? 351  THR A O     1 
ATOM   2419  C  CB    . THR A 1  351  ? 457.557 -10.322 631.856 1.00 34.54  ? 351  THR A CB    1 
ATOM   2420  O  OG1   . THR A 1  351  ? 456.619 -10.741 632.852 1.00 41.16  ? 351  THR A OG1   1 
ATOM   2421  C  CG2   . THR A 1  351  ? 458.638 -9.481  632.513 1.00 32.48  ? 351  THR A CG2   1 
ATOM   2422  N  N     . VAL A 1  352  ? 458.765 -9.020  629.393 1.00 17.40  ? 352  VAL A N     1 
ATOM   2423  C  CA    . VAL A 1  352  ? 459.734 -9.205  628.323 1.00 17.05  ? 352  VAL A CA    1 
ATOM   2424  C  C     . VAL A 1  352  ? 460.203 -10.651 628.279 1.00 17.58  ? 352  VAL A C     1 
ATOM   2425  O  O     . VAL A 1  352  ? 460.630 -11.200 629.292 1.00 18.16  ? 352  VAL A O     1 
ATOM   2426  C  CB    . VAL A 1  352  ? 460.955 -8.288  628.509 1.00 16.76  ? 352  VAL A CB    1 
ATOM   2427  C  CG1   . VAL A 1  352  ? 462.033 -8.620  627.488 1.00 16.80  ? 352  VAL A CG1   1 
ATOM   2428  C  CG2   . VAL A 1  352  ? 460.542 -6.827  628.418 1.00 16.74  ? 352  VAL A CG2   1 
ATOM   2429  N  N     . ILE A 1  353  ? 460.125 -11.267 627.105 1.00 15.36  ? 353  ILE A N     1 
ATOM   2430  C  CA    . ILE A 1  353  ? 460.499 -12.668 626.972 1.00 15.81  ? 353  ILE A CA    1 
ATOM   2431  C  C     . ILE A 1  353  ? 461.940 -12.854 626.525 1.00 15.82  ? 353  ILE A C     1 
ATOM   2432  O  O     . ILE A 1  353  ? 462.537 -11.965 625.918 1.00 15.47  ? 353  ILE A O     1 
ATOM   2433  C  CB    . ILE A 1  353  ? 459.590 -13.400 625.975 1.00 16.03  ? 353  ILE A CB    1 
ATOM   2434  C  CG1   . ILE A 1  353  ? 459.610 -12.691 624.618 1.00 15.69  ? 353  ILE A CG1   1 
ATOM   2435  C  CG2   . ILE A 1  353  ? 458.182 -13.489 626.520 1.00 16.21  ? 353  ILE A CG2   1 
ATOM   2436  C  CD1   . ILE A 1  353  ? 458.852 -13.421 623.536 1.00 15.97  ? 353  ILE A CD1   1 
ATOM   2437  N  N     . SER A 1  354  ? 462.487 -14.026 626.834 1.00 35.71  ? 354  SER A N     1 
ATOM   2438  C  CA    . SER A 1  354  ? 463.825 -14.399 626.395 1.00 34.88  ? 354  SER A CA    1 
ATOM   2439  C  C     . SER A 1  354  ? 463.906 -15.904 626.155 1.00 36.33  ? 354  SER A C     1 
ATOM   2440  O  O     . SER A 1  354  ? 463.140 -16.684 626.731 1.00 36.42  ? 354  SER A O     1 
ATOM   2441  C  CB    . SER A 1  354  ? 464.873 -13.957 627.419 1.00 34.17  ? 354  SER A CB    1 
ATOM   2442  O  OG    . SER A 1  354  ? 464.512 -14.358 628.728 1.00 37.69  ? 354  SER A OG    1 
ATOM   2443  N  N     . GLY A 1  355  ? 464.830 -16.304 625.289 1.00 30.60  ? 355  GLY A N     1 
ATOM   2444  C  CA    . GLY A 1  355  ? 465.003 -17.704 624.949 1.00 30.17  ? 355  GLY A CA    1 
ATOM   2445  C  C     . GLY A 1  355  ? 465.885 -18.430 625.941 1.00 30.80  ? 355  GLY A C     1 
ATOM   2446  O  O     . GLY A 1  355  ? 466.747 -17.826 626.579 1.00 30.62  ? 355  GLY A O     1 
ATOM   2447  N  N     . ASP A 1  356  ? 465.667 -19.734 626.067 1.00 25.88  ? 356  ASP A N     1 
ATOM   2448  C  CA    . ASP A 1  356  ? 466.417 -20.548 627.014 1.00 26.19  ? 356  ASP A CA    1 
ATOM   2449  C  C     . ASP A 1  356  ? 466.583 -21.963 626.477 1.00 27.55  ? 356  ASP A C     1 
ATOM   2450  O  O     . ASP A 1  356  ? 465.629 -22.739 626.452 1.00 29.64  ? 356  ASP A O     1 
ATOM   2451  C  CB    . ASP A 1  356  ? 465.713 -20.570 628.373 1.00 27.60  ? 356  ASP A CB    1 
ATOM   2452  C  CG    . ASP A 1  356  ? 466.628 -21.005 629.504 1.00 29.02  ? 356  ASP A CG    1 
ATOM   2453  O  OD1   . ASP A 1  356  ? 467.509 -21.860 629.273 1.00 29.67  ? 356  ASP A OD1   1 
ATOM   2454  O  OD2   . ASP A 1  356  ? 466.463 -20.488 630.630 1.00 29.38  ? 356  ASP A OD2   1 
ATOM   2455  N  N     . PRO A 1  357  ? 467.806 -22.304 626.048 1.00 31.87  ? 357  PRO A N     1 
ATOM   2456  C  CA    . PRO A 1  357  ? 468.127 -23.613 625.467 1.00 33.22  ? 357  PRO A CA    1 
ATOM   2457  C  C     . PRO A 1  357  ? 467.909 -24.773 626.435 1.00 35.05  ? 357  PRO A C     1 
ATOM   2458  O  O     . PRO A 1  357  ? 467.828 -25.922 625.999 1.00 36.55  ? 357  PRO A O     1 
ATOM   2459  C  CB    . PRO A 1  357  ? 469.614 -23.485 625.113 1.00 33.91  ? 357  PRO A CB    1 
ATOM   2460  C  CG    . PRO A 1  357  ? 469.861 -22.021 625.013 1.00 31.62  ? 357  PRO A CG    1 
ATOM   2461  C  CD    . PRO A 1  357  ? 468.965 -21.397 626.032 1.00 31.03  ? 357  PRO A CD    1 
ATOM   2462  N  N     . ASN A 1  358  ? 467.812 -24.476 627.727 1.00 32.29  ? 358  ASN A N     1 
ATOM   2463  C  CA    . ASN A 1  358  ? 467.697 -25.521 628.738 1.00 33.13  ? 358  ASN A CA    1 
ATOM   2464  C  C     . ASN A 1  358  ? 466.294 -25.651 629.322 1.00 34.76  ? 358  ASN A C     1 
ATOM   2465  O  O     . ASN A 1  358  ? 466.106 -26.258 630.376 1.00 38.08  ? 358  ASN A O     1 
ATOM   2466  C  CB    . ASN A 1  358  ? 468.703 -25.276 629.860 1.00 32.85  ? 358  ASN A CB    1 
ATOM   2467  C  CG    . ASN A 1  358  ? 470.136 -25.359 629.378 1.00 33.48  ? 358  ASN A CG    1 
ATOM   2468  O  OD1   . ASN A 1  358  ? 470.637 -26.441 629.072 1.00 34.66  ? 358  ASN A OD1   1 
ATOM   2469  N  ND2   . ASN A 1  358  ? 470.806 -24.214 629.309 1.00 34.65  ? 358  ASN A ND2   1 
ATOM   2470  N  N     . LEU A 1  359  ? 465.311 -25.077 628.637 1.00 28.15  ? 359  LEU A N     1 
ATOM   2471  C  CA    . LEU A 1  359  ? 463.915 -25.292 628.996 1.00 28.93  ? 359  LEU A CA    1 
ATOM   2472  C  C     . LEU A 1  359  ? 463.259 -26.193 627.962 1.00 30.07  ? 359  LEU A C     1 
ATOM   2473  O  O     . LEU A 1  359  ? 463.590 -26.132 626.779 1.00 30.41  ? 359  LEU A O     1 
ATOM   2474  C  CB    . LEU A 1  359  ? 463.158 -23.968 629.100 1.00 27.44  ? 359  LEU A CB    1 
ATOM   2475  C  CG    . LEU A 1  359  ? 463.648 -22.967 630.147 1.00 26.83  ? 359  LEU A CG    1 
ATOM   2476  C  CD1   . LEU A 1  359  ? 462.632 -21.853 630.325 1.00 27.25  ? 359  LEU A CD1   1 
ATOM   2477  C  CD2   . LEU A 1  359  ? 463.932 -23.658 631.468 1.00 30.57  ? 359  LEU A CD2   1 
ATOM   2478  N  N     . GLU A 1  360  ? 462.334 -27.034 628.409 1.00 57.57  ? 360  GLU A N     1 
ATOM   2479  C  CA    . GLU A 1  360  ? 461.625 -27.918 627.497 1.00 58.86  ? 360  GLU A CA    1 
ATOM   2480  C  C     . GLU A 1  360  ? 460.694 -27.113 626.599 1.00 58.27  ? 360  GLU A C     1 
ATOM   2481  O  O     . GLU A 1  360  ? 460.403 -25.950 626.881 1.00 58.33  ? 360  GLU A O     1 
ATOM   2482  C  CB    . GLU A 1  360  ? 460.845 -28.979 628.273 1.00 60.32  ? 360  GLU A CB    1 
ATOM   2483  C  CG    . GLU A 1  360  ? 461.726 -29.952 629.042 1.00 60.62  ? 360  GLU A CG    1 
ATOM   2484  C  CD    . GLU A 1  360  ? 462.615 -30.783 628.134 1.00 62.69  ? 360  GLU A CD    1 
ATOM   2485  O  OE1   . GLU A 1  360  ? 462.238 -30.999 626.962 1.00 63.18  ? 360  GLU A OE1   1 
ATOM   2486  O  OE2   . GLU A 1  360  ? 463.692 -31.219 628.591 1.00 63.40  ? 360  GLU A OE2   1 
ATOM   2487  N  N     . LEU A 1  361  ? 460.238 -27.734 625.516 1.00 31.48  ? 361  LEU A N     1 
ATOM   2488  C  CA    . LEU A 1  361  ? 459.383 -27.064 624.543 1.00 31.03  ? 361  LEU A CA    1 
ATOM   2489  C  C     . LEU A 1  361  ? 458.109 -26.526 625.181 1.00 32.13  ? 361  LEU A C     1 
ATOM   2490  O  O     . LEU A 1  361  ? 457.701 -25.396 624.914 1.00 31.93  ? 361  LEU A O     1 
ATOM   2491  C  CB    . LEU A 1  361  ? 459.025 -28.018 623.402 1.00 31.73  ? 361  LEU A CB    1 
ATOM   2492  C  CG    . LEU A 1  361  ? 458.150 -27.435 622.290 1.00 31.11  ? 361  LEU A CG    1 
ATOM   2493  C  CD1   . LEU A 1  361  ? 458.925 -26.407 621.481 1.00 30.12  ? 361  LEU A CD1   1 
ATOM   2494  C  CD2   . LEU A 1  361  ? 457.607 -28.533 621.393 1.00 29.78  ? 361  LEU A CD2   1 
ATOM   2495  N  N     . ASP A 1  362  ? 457.489 -27.338 626.031 1.00 30.35  ? 362  ASP A N     1 
ATOM   2496  C  CA    . ASP A 1  362  ? 456.208 -26.982 626.623 1.00 31.15  ? 362  ASP A CA    1 
ATOM   2497  C  C     . ASP A 1  362  ? 456.365 -26.346 627.997 1.00 31.65  ? 362  ASP A C     1 
ATOM   2498  O  O     . ASP A 1  362  ? 455.422 -26.320 628.787 1.00 33.11  ? 362  ASP A O     1 
ATOM   2499  C  CB    . ASP A 1  362  ? 455.311 -28.213 626.724 1.00 33.98  ? 362  ASP A CB    1 
ATOM   2500  C  CG    . ASP A 1  362  ? 455.905 -29.292 627.601 1.00 35.60  ? 362  ASP A CG    1 
ATOM   2501  O  OD1   . ASP A 1  362  ? 457.147 -29.395 627.653 1.00 33.61  ? 362  ASP A OD1   1 
ATOM   2502  O  OD2   . ASP A 1  362  ? 455.130 -30.033 628.240 1.00 38.08  ? 362  ASP A OD2   1 
ATOM   2503  N  N     . GLN A 1  363  ? 457.556 -25.835 628.283 1.00 28.80  ? 363  GLN A N     1 
ATOM   2504  C  CA    . GLN A 1  363  ? 457.782 -25.130 629.537 1.00 28.51  ? 363  GLN A CA    1 
ATOM   2505  C  C     . GLN A 1  363  ? 457.741 -23.620 629.339 1.00 27.59  ? 363  GLN A C     1 
ATOM   2506  O  O     . GLN A 1  363  ? 457.784 -23.127 628.211 1.00 27.17  ? 363  GLN A O     1 
ATOM   2507  C  CB    . GLN A 1  363  ? 459.120 -25.538 630.157 1.00 28.78  ? 363  GLN A CB    1 
ATOM   2508  C  CG    . GLN A 1  363  ? 459.077 -26.860 630.901 1.00 29.73  ? 363  GLN A CG    1 
ATOM   2509  C  CD    . GLN A 1  363  ? 460.270 -27.051 631.815 1.00 29.99  ? 363  GLN A CD    1 
ATOM   2510  O  OE1   . GLN A 1  363  ? 461.407 -26.762 631.441 1.00 29.75  ? 363  GLN A OE1   1 
ATOM   2511  N  NE2   . GLN A 1  363  ? 460.016 -27.529 633.027 1.00 30.53  ? 363  GLN A NE2   1 
ATOM   2512  N  N     . VAL A 1  364  ? 457.643 -22.895 630.447 1.00 17.50  ? 364  VAL A N     1 
ATOM   2513  C  CA    . VAL A 1  364  ? 457.727 -21.442 630.432 1.00 16.70  ? 364  VAL A CA    1 
ATOM   2514  C  C     . VAL A 1  364  ? 458.471 -20.960 631.675 1.00 16.61  ? 364  VAL A C     1 
ATOM   2515  O  O     . VAL A 1  364  ? 458.142 -21.335 632.801 1.00 17.06  ? 364  VAL A O     1 
ATOM   2516  C  CB    . VAL A 1  364  ? 456.329 -20.780 630.358 1.00 16.50  ? 364  VAL A CB    1 
ATOM   2517  C  CG1   . VAL A 1  364  ? 455.423 -21.276 631.479 1.00 17.09  ? 364  VAL A CG1   1 
ATOM   2518  C  CG2   . VAL A 1  364  ? 456.455 -19.269 630.401 1.00 15.75  ? 364  VAL A CG2   1 
ATOM   2519  N  N     . GLY A 1  365  ? 459.501 -20.150 631.464 1.00 18.20  ? 365  GLY A N     1 
ATOM   2520  C  CA    . GLY A 1  365  ? 460.233 -19.575 632.573 1.00 18.10  ? 365  GLY A CA    1 
ATOM   2521  C  C     . GLY A 1  365  ? 459.408 -18.480 633.212 1.00 17.75  ? 365  GLY A C     1 
ATOM   2522  O  O     . GLY A 1  365  ? 459.012 -17.527 632.545 1.00 17.20  ? 365  GLY A O     1 
ATOM   2523  N  N     . VAL A 1  366  ? 459.130 -18.617 634.502 1.00 17.66  ? 366  VAL A N     1 
ATOM   2524  C  CA    . VAL A 1  366  ? 458.353 -17.611 635.212 1.00 17.45  ? 366  VAL A CA    1 
ATOM   2525  C  C     . VAL A 1  366  ? 459.177 -16.982 636.327 1.00 17.42  ? 366  VAL A C     1 
ATOM   2526  O  O     . VAL A 1  366  ? 459.657 -17.682 637.219 1.00 17.96  ? 366  VAL A O     1 
ATOM   2527  C  CB    . VAL A 1  366  ? 457.058 -18.205 635.803 1.00 18.03  ? 366  VAL A CB    1 
ATOM   2528  C  CG1   . VAL A 1  366  ? 456.322 -17.161 636.624 1.00 17.93  ? 366  VAL A CG1   1 
ATOM   2529  C  CG2   . VAL A 1  366  ? 456.168 -18.741 634.695 1.00 18.10  ? 366  VAL A CG2   1 
ATOM   2530  N  N     . PRO A 1  367  ? 459.357 -15.654 636.268 1.00 18.67  ? 367  PRO A N     1 
ATOM   2531  C  CA    . PRO A 1  367  ? 460.067 -14.903 637.306 1.00 18.63  ? 367  PRO A CA    1 
ATOM   2532  C  C     . PRO A 1  367  ? 459.492 -15.165 638.695 1.00 19.24  ? 367  PRO A C     1 
ATOM   2533  O  O     . PRO A 1  367  ? 458.285 -15.360 638.832 1.00 19.48  ? 367  PRO A O     1 
ATOM   2534  C  CB    . PRO A 1  367  ? 459.854 -13.447 636.887 1.00 17.98  ? 367  PRO A CB    1 
ATOM   2535  C  CG    . PRO A 1  367  ? 459.692 -13.513 635.412 1.00 17.59  ? 367  PRO A CG    1 
ATOM   2536  C  CD    . PRO A 1  367  ? 458.939 -14.788 635.152 1.00 18.05  ? 367  PRO A CD    1 
ATOM   2537  N  N     . LYS A 1  368  ? 460.355 -15.171 639.706 1.00 37.79  ? 368  LYS A N     1 
ATOM   2538  C  CA    . LYS A 1  368  ? 459.951 -15.501 641.066 1.00 37.41  ? 368  LYS A CA    1 
ATOM   2539  C  C     . LYS A 1  368  ? 458.892 -14.542 641.600 1.00 37.56  ? 368  LYS A C     1 
ATOM   2540  O  O     . LYS A 1  368  ? 457.969 -14.959 642.295 1.00 39.07  ? 368  LYS A O     1 
ATOM   2541  C  CB    . LYS A 1  368  ? 461.168 -15.502 641.993 1.00 38.93  ? 368  LYS A CB    1 
ATOM   2542  C  CG    . LYS A 1  368  ? 460.913 -16.118 643.358 1.00 40.07  ? 368  LYS A CG    1 
ATOM   2543  C  CD    . LYS A 1  368  ? 461.675 -17.423 643.522 1.00 42.38  ? 368  LYS A CD    1 
ATOM   2544  C  CE    . LYS A 1  368  ? 463.174 -17.208 643.375 1.00 40.58  ? 368  LYS A CE    1 
ATOM   2545  N  NZ    . LYS A 1  368  ? 463.944 -18.469 643.557 1.00 38.40  ? 368  LYS A NZ    1 
ATOM   2546  N  N     . SER A 1  369  ? 459.026 -13.260 641.272 1.00 33.27  ? 369  SER A N     1 
ATOM   2547  C  CA    . SER A 1  369  ? 458.085 -12.247 641.742 1.00 34.48  ? 369  SER A CA    1 
ATOM   2548  C  C     . SER A 1  369  ? 456.681 -12.495 641.196 1.00 36.03  ? 369  SER A C     1 
ATOM   2549  O  O     . SER A 1  369  ? 455.686 -12.375 641.920 1.00 36.79  ? 369  SER A O     1 
ATOM   2550  C  CB    . SER A 1  369  ? 458.563 -10.847 641.349 1.00 34.03  ? 369  SER A CB    1 
ATOM   2551  O  OG    . SER A 1  369  ? 458.703 -10.729 639.943 1.00 33.70  ? 369  SER A OG    1 
ATOM   2552  N  N     . ILE A 1  370  ? 456.609 -12.844 639.916 1.00 21.95  ? 370  ILE A N     1 
ATOM   2553  C  CA    . ILE A 1  370  ? 455.339 -13.168 639.281 1.00 22.06  ? 370  ILE A CA    1 
ATOM   2554  C  C     . ILE A 1  370  ? 454.726 -14.411 639.916 1.00 22.86  ? 370  ILE A C     1 
ATOM   2555  O  O     . ILE A 1  370  ? 453.525 -14.456 640.189 1.00 23.27  ? 370  ILE A O     1 
ATOM   2556  C  CB    . ILE A 1  370  ? 455.508 -13.394 637.770 1.00 21.56  ? 370  ILE A CB    1 
ATOM   2557  C  CG1   . ILE A 1  370  ? 456.001 -12.113 637.096 1.00 20.83  ? 370  ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A 1  370  ? 454.198 -13.850 637.147 1.00 21.79  ? 370  ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A 1  370  ? 456.158 -12.242 635.604 1.00 20.38  ? 370  ILE A CD1   1 
ATOM   2560  N  N     . ALA A 1  371  ? 455.566 -15.411 640.161 1.00 24.11  ? 371  ALA A N     1 
ATOM   2561  C  CA    . ALA A 1  371  ? 455.131 -16.647 640.796 1.00 24.93  ? 371  ALA A CA    1 
ATOM   2562  C  C     . ALA A 1  371  ? 454.590 -16.378 642.196 1.00 25.53  ? 371  ALA A C     1 
ATOM   2563  O  O     . ALA A 1  371  ? 453.669 -17.054 642.653 1.00 26.22  ? 371  ALA A O     1 
ATOM   2564  C  CB    . ALA A 1  371  ? 456.273 -17.646 640.850 1.00 25.15  ? 371  ALA A CB    1 
ATOM   2565  N  N     . LYS A 1  372  ? 455.166 -15.388 642.874 1.00 25.37  ? 372  LYS A N     1 
ATOM   2566  C  CA    . LYS A 1  372  ? 454.669 -14.977 644.183 1.00 25.93  ? 372  LYS A CA    1 
ATOM   2567  C  C     . LYS A 1  372  ? 453.344 -14.239 644.046 1.00 25.95  ? 372  LYS A C     1 
ATOM   2568  O  O     . LYS A 1  372  ? 452.482 -14.324 644.920 1.00 26.65  ? 372  LYS A O     1 
ATOM   2569  C  CB    . LYS A 1  372  ? 455.679 -14.080 644.904 1.00 25.74  ? 372  LYS A CB    1 
ATOM   2570  C  CG    . LYS A 1  372  ? 456.958 -14.759 645.361 1.00 25.96  ? 372  LYS A CG    1 
ATOM   2571  C  CD    . LYS A 1  372  ? 457.605 -13.952 646.482 1.00 26.13  ? 372  LYS A CD    1 
ATOM   2572  C  CE    . LYS A 1  372  ? 459.117 -14.106 646.508 1.00 26.33  ? 372  LYS A CE    1 
ATOM   2573  N  NZ    . LYS A 1  372  ? 459.770 -13.373 645.386 1.00 25.09  ? 372  LYS A NZ    1 
ATOM   2574  N  N     . THR A 1  373  ? 453.189 -13.506 642.948 1.00 16.76  ? 373  THR A N     1 
ATOM   2575  C  CA    . THR A 1  373  ? 451.995 -12.691 642.747 1.00 16.77  ? 373  THR A CA    1 
ATOM   2576  C  C     . THR A 1  373  ? 450.787 -13.529 642.330 1.00 17.23  ? 373  THR A C     1 
ATOM   2577  O  O     . THR A 1  373  ? 449.767 -13.548 643.021 1.00 17.92  ? 373  THR A O     1 
ATOM   2578  C  CB    . THR A 1  373  ? 452.229 -11.601 641.687 1.00 15.90  ? 373  THR A CB    1 
ATOM   2579  O  OG1   . THR A 1  373  ? 453.404 -10.849 642.018 1.00 15.49  ? 373  THR A OG1   1 
ATOM   2580  C  CG2   . THR A 1  373  ? 451.029 -10.670 641.617 1.00 16.01  ? 373  THR A CG2   1 
ATOM   2581  N  N     . LEU A 1  374  ? 450.906 -14.211 641.194 1.00 25.44  ? 374  LEU A N     1 
ATOM   2582  C  CA    . LEU A 1  374  ? 449.822 -15.040 640.678 1.00 25.96  ? 374  LEU A CA    1 
ATOM   2583  C  C     . LEU A 1  374  ? 449.582 -16.237 641.584 1.00 27.10  ? 374  LEU A C     1 
ATOM   2584  O  O     . LEU A 1  374  ? 450.529 -16.865 642.055 1.00 27.56  ? 374  LEU A O     1 
ATOM   2585  C  CB    . LEU A 1  374  ? 450.135 -15.510 639.259 1.00 25.74  ? 374  LEU A CB    1 
ATOM   2586  C  CG    . LEU A 1  374  ? 450.361 -14.400 638.235 1.00 24.63  ? 374  LEU A CG    1 
ATOM   2587  C  CD1   . LEU A 1  374  ? 450.686 -14.998 636.877 1.00 24.58  ? 374  LEU A CD1   1 
ATOM   2588  C  CD2   . LEU A 1  374  ? 449.145 -13.490 638.153 1.00 24.20  ? 374  LEU A CD2   1 
ATOM   2589  N  N     . THR A 1  375  ? 448.315 -16.558 641.821 1.00 30.26  ? 375  THR A N     1 
ATOM   2590  C  CA    . THR A 1  375  ? 447.979 -17.602 642.779 1.00 31.23  ? 375  THR A CA    1 
ATOM   2591  C  C     . THR A 1  375  ? 446.942 -18.586 642.238 1.00 31.82  ? 375  THR A C     1 
ATOM   2592  O  O     . THR A 1  375  ? 446.263 -18.312 641.248 1.00 31.56  ? 375  THR A O     1 
ATOM   2593  C  CB    . THR A 1  375  ? 447.460 -16.987 644.095 1.00 31.84  ? 375  THR A CB    1 
ATOM   2594  O  OG1   . THR A 1  375  ? 447.721 -17.884 645.179 1.00 32.62  ? 375  THR A OG1   1 
ATOM   2595  C  CG2   . THR A 1  375  ? 445.965 -16.698 644.013 1.00 32.36  ? 375  THR A CG2   1 
ATOM   2596  N  N     . TYR A 1  376  ? 446.840 -19.740 642.891 1.00 33.92  ? 376  TYR A N     1 
ATOM   2597  C  CA    . TYR A 1  376  ? 445.842 -20.747 642.548 1.00 33.46  ? 376  TYR A CA    1 
ATOM   2598  C  C     . TYR A 1  376  ? 445.130 -21.253 643.798 1.00 35.39  ? 376  TYR A C     1 
ATOM   2599  O  O     . TYR A 1  376  ? 445.775 -21.586 644.796 1.00 36.04  ? 376  TYR A O     1 
ATOM   2600  C  CB    . TYR A 1  376  ? 446.484 -21.920 641.803 1.00 33.69  ? 376  TYR A CB    1 
ATOM   2601  C  CG    . TYR A 1  376  ? 445.535 -23.073 641.554 1.00 34.39  ? 376  TYR A CG    1 
ATOM   2602  C  CD1   . TYR A 1  376  ? 444.639 -23.045 640.492 1.00 35.86  ? 376  TYR A CD1   1 
ATOM   2603  C  CD2   . TYR A 1  376  ? 445.538 -24.191 642.378 1.00 35.58  ? 376  TYR A CD2   1 
ATOM   2604  C  CE1   . TYR A 1  376  ? 443.769 -24.096 640.262 1.00 35.05  ? 376  TYR A CE1   1 
ATOM   2605  C  CE2   . TYR A 1  376  ? 444.673 -25.246 642.155 1.00 38.03  ? 376  TYR A CE2   1 
ATOM   2606  C  CZ    . TYR A 1  376  ? 443.791 -25.194 641.097 1.00 36.05  ? 376  TYR A CZ    1 
ATOM   2607  O  OH    . TYR A 1  376  ? 442.930 -26.244 640.871 1.00 36.89  ? 376  TYR A OH    1 
ATOM   2608  N  N     . PRO A 1  377  ? 443.790 -21.305 643.747 1.00 28.52  ? 377  PRO A N     1 
ATOM   2609  C  CA    . PRO A 1  377  ? 442.961 -21.810 644.845 1.00 29.74  ? 377  PRO A CA    1 
ATOM   2610  C  C     . PRO A 1  377  ? 442.914 -23.334 644.880 1.00 30.51  ? 377  PRO A C     1 
ATOM   2611  O  O     . PRO A 1  377  ? 442.243 -23.952 644.053 1.00 30.77  ? 377  PRO A O     1 
ATOM   2612  C  CB    . PRO A 1  377  ? 441.581 -21.226 644.536 1.00 30.08  ? 377  PRO A CB    1 
ATOM   2613  C  CG    . PRO A 1  377  ? 441.566 -21.079 643.055 1.00 29.29  ? 377  PRO A CG    1 
ATOM   2614  C  CD    . PRO A 1  377  ? 442.978 -20.755 642.647 1.00 28.17  ? 377  PRO A CD    1 
ATOM   2615  N  N     . GLU A 1  378  ? 443.623 -23.931 645.831 1.00 36.64  ? 378  GLU A N     1 
ATOM   2616  C  CA    . GLU A 1  378  ? 443.647 -25.382 645.954 1.00 36.36  ? 378  GLU A CA    1 
ATOM   2617  C  C     . GLU A 1  378  ? 442.913 -25.831 647.212 1.00 39.68  ? 378  GLU A C     1 
ATOM   2618  O  O     . GLU A 1  378  ? 443.298 -25.477 648.325 1.00 42.33  ? 378  GLU A O     1 
ATOM   2619  C  CB    . GLU A 1  378  ? 445.088 -25.894 645.965 1.00 36.15  ? 378  GLU A CB    1 
ATOM   2620  C  CG    . GLU A 1  378  ? 445.212 -27.407 646.040 1.00 39.14  ? 378  GLU A CG    1 
ATOM   2621  C  CD    . GLU A 1  378  ? 446.639 -27.883 645.850 1.00 38.14  ? 378  GLU A CD    1 
ATOM   2622  O  OE1   . GLU A 1  378  ? 447.458 -27.107 645.316 1.00 34.68  ? 378  GLU A OE1   1 
ATOM   2623  O  OE2   . GLU A 1  378  ? 446.943 -29.031 646.234 1.00 40.51  ? 378  GLU A OE2   1 
ATOM   2624  N  N     . VAL A 1  379  ? 441.852 -26.609 647.027 1.00 29.87  ? 379  VAL A N     1 
ATOM   2625  C  CA    . VAL A 1  379  ? 441.061 -27.103 648.149 1.00 31.24  ? 379  VAL A CA    1 
ATOM   2626  C  C     . VAL A 1  379  ? 441.853 -28.120 648.968 1.00 31.86  ? 379  VAL A C     1 
ATOM   2627  O  O     . VAL A 1  379  ? 442.519 -28.995 648.414 1.00 31.70  ? 379  VAL A O     1 
ATOM   2628  C  CB    . VAL A 1  379  ? 439.740 -27.739 647.670 1.00 32.12  ? 379  VAL A CB    1 
ATOM   2629  C  CG1   . VAL A 1  379  ? 438.937 -28.267 648.849 1.00 33.62  ? 379  VAL A CG1   1 
ATOM   2630  C  CG2   . VAL A 1  379  ? 438.924 -26.728 646.881 1.00 31.61  ? 379  VAL A CG2   1 
ATOM   2631  N  N     . VAL A 1  380  ? 441.782 -27.991 650.290 1.00 57.13  ? 380  VAL A N     1 
ATOM   2632  C  CA    . VAL A 1  380  ? 442.503 -28.879 651.194 1.00 57.40  ? 380  VAL A CA    1 
ATOM   2633  C  C     . VAL A 1  380  ? 441.947 -30.300 651.166 1.00 59.72  ? 380  VAL A C     1 
ATOM   2634  O  O     . VAL A 1  380  ? 440.788 -30.536 651.510 1.00 62.21  ? 380  VAL A O     1 
ATOM   2635  C  CB    . VAL A 1  380  ? 442.462 -28.358 652.640 1.00 57.91  ? 380  VAL A CB    1 
ATOM   2636  C  CG1   . VAL A 1  380  ? 443.183 -29.322 653.570 1.00 61.87  ? 380  VAL A CG1   1 
ATOM   2637  C  CG2   . VAL A 1  380  ? 443.078 -26.971 652.719 1.00 56.08  ? 380  VAL A CG2   1 
ATOM   2638  N  N     . THR A 1  381  ? 442.788 -31.240 650.750 1.00 69.59  ? 381  THR A N     1 
ATOM   2639  C  CA    . THR A 1  381  ? 442.426 -32.651 650.709 1.00 71.05  ? 381  THR A CA    1 
ATOM   2640  C  C     . THR A 1  381  ? 443.437 -33.451 651.522 1.00 71.74  ? 381  THR A C     1 
ATOM   2641  O  O     . THR A 1  381  ? 444.526 -32.953 651.809 1.00 69.79  ? 381  THR A O     1 
ATOM   2642  C  CB    . THR A 1  381  ? 442.381 -33.184 649.261 1.00 71.34  ? 381  THR A CB    1 
ATOM   2643  O  OG1   . THR A 1  381  ? 443.685 -33.093 648.673 1.00 72.81  ? 381  THR A OG1   1 
ATOM   2644  C  CG2   . THR A 1  381  ? 441.395 -32.386 648.428 1.00 69.97  ? 381  THR A CG2   1 
ATOM   2645  N  N     . PRO A 1  382  ? 443.083 -34.689 651.909 1.00 58.36  ? 382  PRO A N     1 
ATOM   2646  C  CA    . PRO A 1  382  ? 444.060 -35.536 652.601 1.00 57.71  ? 382  PRO A CA    1 
ATOM   2647  C  C     . PRO A 1  382  ? 445.327 -35.763 651.779 1.00 57.67  ? 382  PRO A C     1 
ATOM   2648  O  O     . PRO A 1  382  ? 446.386 -36.033 652.348 1.00 57.87  ? 382  PRO A O     1 
ATOM   2649  C  CB    . PRO A 1  382  ? 443.301 -36.849 652.804 1.00 59.83  ? 382  PRO A CB    1 
ATOM   2650  C  CG    . PRO A 1  382  ? 441.873 -36.448 652.847 1.00 58.77  ? 382  PRO A CG    1 
ATOM   2651  C  CD    . PRO A 1  382  ? 441.744 -35.306 651.881 1.00 58.09  ? 382  PRO A CD    1 
ATOM   2652  N  N     . TYR A 1  383  ? 445.218 -35.643 650.459 1.00 67.79  ? 383  TYR A N     1 
ATOM   2653  C  CA    . TYR A 1  383  ? 446.359 -35.850 649.579 1.00 68.03  ? 383  TYR A CA    1 
ATOM   2654  C  C     . TYR A 1  383  ? 447.383 -34.722 649.695 1.00 66.93  ? 383  TYR A C     1 
ATOM   2655  O  O     . TYR A 1  383  ? 448.584 -34.955 649.563 1.00 68.09  ? 383  TYR A O     1 
ATOM   2656  C  CB    . TYR A 1  383  ? 445.907 -35.975 648.120 1.00 68.68  ? 383  TYR A CB    1 
ATOM   2657  C  CG    . TYR A 1  383  ? 444.580 -36.671 647.919 1.00 70.35  ? 383  TYR A CG    1 
ATOM   2658  C  CD1   . TYR A 1  383  ? 444.416 -38.012 648.240 1.00 73.09  ? 383  TYR A CD1   1 
ATOM   2659  C  CD2   . TYR A 1  383  ? 443.494 -35.988 647.384 1.00 70.27  ? 383  TYR A CD2   1 
ATOM   2660  C  CE1   . TYR A 1  383  ? 443.202 -38.649 648.048 1.00 76.23  ? 383  TYR A CE1   1 
ATOM   2661  C  CE2   . TYR A 1  383  ? 442.279 -36.615 647.188 1.00 72.01  ? 383  TYR A CE2   1 
ATOM   2662  C  CZ    . TYR A 1  383  ? 442.138 -37.945 647.521 1.00 75.51  ? 383  TYR A CZ    1 
ATOM   2663  O  OH    . TYR A 1  383  ? 440.928 -38.570 647.325 1.00 74.65  ? 383  TYR A OH    1 
ATOM   2664  N  N     . ASN A 1  384  ? 446.911 -33.503 649.943 1.00 53.02  ? 384  ASN A N     1 
ATOM   2665  C  CA    . ASN A 1  384  ? 447.789 -32.335 649.889 1.00 51.46  ? 384  ASN A CA    1 
ATOM   2666  C  C     . ASN A 1  384  ? 447.784 -31.449 651.134 1.00 50.53  ? 384  ASN A C     1 
ATOM   2667  O  O     . ASN A 1  384  ? 448.317 -30.339 651.103 1.00 47.84  ? 384  ASN A O     1 
ATOM   2668  C  CB    . ASN A 1  384  ? 447.433 -31.478 648.667 1.00 49.01  ? 384  ASN A CB    1 
ATOM   2669  C  CG    . ASN A 1  384  ? 445.988 -30.992 648.679 1.00 49.26  ? 384  ASN A CG    1 
ATOM   2670  O  OD1   . ASN A 1  384  ? 445.392 -30.776 649.735 1.00 48.51  ? 384  ASN A OD1   1 
ATOM   2671  N  ND2   . ASN A 1  384  ? 445.419 -30.817 647.491 1.00 50.22  ? 384  ASN A ND2   1 
ATOM   2672  N  N     . ILE A 1  385  ? 447.189 -31.929 652.221 1.00 46.09  ? 385  ILE A N     1 
ATOM   2673  C  CA    . ILE A 1  385  ? 447.065 -31.116 653.429 1.00 45.03  ? 385  ILE A CA    1 
ATOM   2674  C  C     . ILE A 1  385  ? 448.434 -30.766 654.019 1.00 42.73  ? 385  ILE A C     1 
ATOM   2675  O  O     . ILE A 1  385  ? 448.633 -29.658 654.517 1.00 42.28  ? 385  ILE A O     1 
ATOM   2676  C  CB    . ILE A 1  385  ? 446.194 -31.819 654.500 1.00 46.82  ? 385  ILE A CB    1 
ATOM   2677  C  CG1   . ILE A 1  385  ? 446.084 -30.953 655.759 1.00 45.06  ? 385  ILE A CG1   1 
ATOM   2678  C  CG2   . ILE A 1  385  ? 446.735 -33.204 654.827 1.00 49.50  ? 385  ILE A CG2   1 
ATOM   2679  C  CD1   . ILE A 1  385  ? 445.200 -31.542 656.830 1.00 48.92  ? 385  ILE A CD1   1 
ATOM   2680  N  N     . ASP A 1  386  ? 449.380 -31.697 653.937 1.00 75.00  ? 386  ASP A N     1 
ATOM   2681  C  CA    . ASP A 1  386  ? 450.729 -31.465 654.442 1.00 74.80  ? 386  ASP A CA    1 
ATOM   2682  C  C     . ASP A 1  386  ? 451.439 -30.392 653.623 1.00 71.81  ? 386  ASP A C     1 
ATOM   2683  O  O     . ASP A 1  386  ? 451.985 -29.432 654.173 1.00 71.42  ? 386  ASP A O     1 
ATOM   2684  C  CB    . ASP A 1  386  ? 451.543 -32.761 654.425 1.00 76.84  ? 386  ASP A CB    1 
ATOM   2685  C  CG    . ASP A 1  386  ? 450.928 -33.850 655.284 1.00 78.57  ? 386  ASP A CG    1 
ATOM   2686  O  OD1   . ASP A 1  386  ? 451.330 -33.981 656.460 1.00 76.50  ? 386  ASP A OD1   1 
ATOM   2687  O  OD2   . ASP A 1  386  ? 450.045 -34.577 654.784 1.00 81.12  ? 386  ASP A OD2   1 
ATOM   2688  N  N     . ARG A 1  387  ? 451.421 -30.565 652.304 1.00 54.82  ? 387  ARG A N     1 
ATOM   2689  C  CA    . ARG A 1  387  ? 452.063 -29.630 651.389 1.00 52.55  ? 387  ARG A CA    1 
ATOM   2690  C  C     . ARG A 1  387  ? 451.470 -28.232 651.514 1.00 53.76  ? 387  ARG A C     1 
ATOM   2691  O  O     . ARG A 1  387  ? 452.202 -27.246 651.592 1.00 53.91  ? 387  ARG A O     1 
ATOM   2692  C  CB    . ARG A 1  387  ? 451.944 -30.123 649.945 1.00 54.13  ? 387  ARG A CB    1 
ATOM   2693  C  CG    . ARG A 1  387  ? 452.471 -29.140 648.910 1.00 54.69  ? 387  ARG A CG    1 
ATOM   2694  C  CD    . ARG A 1  387  ? 452.499 -29.751 647.517 1.00 55.52  ? 387  ARG A CD    1 
ATOM   2695  N  NE    . ARG A 1  387  ? 451.199 -30.283 647.115 1.00 55.69  ? 387  ARG A NE    1 
ATOM   2696  C  CZ    . ARG A 1  387  ? 450.252 -29.570 646.512 1.00 53.98  ? 387  ARG A CZ    1 
ATOM   2697  N  NH1   . ARG A 1  387  ? 450.454 -28.287 646.241 1.00 51.97  ? 387  ARG A NH1   1 
ATOM   2698  N  NH2   . ARG A 1  387  ? 449.101 -30.139 646.182 1.00 52.89  ? 387  ARG A NH2   1 
ATOM   2699  N  N     . LEU A 1  388  ? 450.144 -28.150 651.540 1.00 41.80  ? 388  LEU A N     1 
ATOM   2700  C  CA    . LEU A 1  388  ? 449.464 -26.866 651.679 1.00 42.52  ? 388  LEU A CA    1 
ATOM   2701  C  C     . LEU A 1  388  ? 449.752 -26.229 653.036 1.00 43.14  ? 388  LEU A C     1 
ATOM   2702  O  O     . LEU A 1  388  ? 449.882 -25.010 653.138 1.00 42.05  ? 388  LEU A O     1 
ATOM   2703  C  CB    . LEU A 1  388  ? 447.956 -27.028 651.480 1.00 45.06  ? 388  LEU A CB    1 
ATOM   2704  C  CG    . LEU A 1  388  ? 447.496 -27.346 650.056 1.00 44.01  ? 388  LEU A CG    1 
ATOM   2705  C  CD1   . LEU A 1  388  ? 445.980 -27.448 649.988 1.00 45.34  ? 388  LEU A CD1   1 
ATOM   2706  C  CD2   . LEU A 1  388  ? 448.009 -26.300 649.081 1.00 40.78  ? 388  LEU A CD2   1 
ATOM   2707  N  N     . THR A 1  389  ? 449.854 -27.056 654.074 1.00 46.11  ? 389  THR A N     1 
ATOM   2708  C  CA    . THR A 1  389  ? 450.184 -26.562 655.406 1.00 45.58  ? 389  THR A CA    1 
ATOM   2709  C  C     . THR A 1  389  ? 451.578 -25.948 655.409 1.00 45.67  ? 389  THR A C     1 
ATOM   2710  O  O     . THR A 1  389  ? 451.800 -24.891 656.001 1.00 47.19  ? 389  THR A O     1 
ATOM   2711  C  CB    . THR A 1  389  ? 450.117 -27.677 656.467 1.00 46.69  ? 389  THR A CB    1 
ATOM   2712  O  OG1   . THR A 1  389  ? 448.818 -28.280 656.449 1.00 49.98  ? 389  THR A OG1   1 
ATOM   2713  C  CG2   . THR A 1  389  ? 450.385 -27.113 657.853 1.00 48.60  ? 389  THR A CG2   1 
ATOM   2714  N  N     . GLN A 1  390  ? 452.513 -26.613 654.737 1.00 56.57  ? 390  GLN A N     1 
ATOM   2715  C  CA    . GLN A 1  390  ? 453.873 -26.097 654.625 1.00 56.65  ? 390  GLN A CA    1 
ATOM   2716  C  C     . GLN A 1  390  ? 453.901 -24.797 653.824 1.00 55.32  ? 390  GLN A C     1 
ATOM   2717  O  O     . GLN A 1  390  ? 454.609 -23.854 654.181 1.00 54.96  ? 390  GLN A O     1 
ATOM   2718  C  CB    . GLN A 1  390  ? 454.793 -27.137 653.981 1.00 55.13  ? 390  GLN A CB    1 
ATOM   2719  C  CG    . GLN A 1  390  ? 456.220 -26.656 653.765 1.00 56.90  ? 390  GLN A CG    1 
ATOM   2720  C  CD    . GLN A 1  390  ? 456.899 -26.229 655.054 1.00 60.06  ? 390  GLN A CD    1 
ATOM   2721  O  OE1   . GLN A 1  390  ? 457.619 -25.230 655.089 1.00 61.58  ? 390  GLN A OE1   1 
ATOM   2722  N  NE2   . GLN A 1  390  ? 456.680 -26.992 656.121 1.00 62.53  ? 390  GLN A NE2   1 
ATOM   2723  N  N     . LEU A 1  391  ? 453.124 -24.753 652.745 1.00 31.86  ? 391  LEU A N     1 
ATOM   2724  C  CA    . LEU A 1  391  ? 453.042 -23.565 651.900 1.00 30.70  ? 391  LEU A CA    1 
ATOM   2725  C  C     . LEU A 1  391  ? 452.511 -22.367 652.678 1.00 30.74  ? 391  LEU A C     1 
ATOM   2726  O  O     . LEU A 1  391  ? 453.038 -21.260 652.566 1.00 29.98  ? 391  LEU A O     1 
ATOM   2727  C  CB    . LEU A 1  391  ? 452.158 -23.831 650.681 1.00 30.33  ? 391  LEU A CB    1 
ATOM   2728  C  CG    . LEU A 1  391  ? 452.727 -24.780 649.624 1.00 30.06  ? 391  LEU A CG    1 
ATOM   2729  C  CD1   . LEU A 1  391  ? 451.745 -24.967 648.479 1.00 29.78  ? 391  LEU A CD1   1 
ATOM   2730  C  CD2   . LEU A 1  391  ? 454.060 -24.264 649.111 1.00 29.14  ? 391  LEU A CD2   1 
ATOM   2731  N  N     . VAL A 1  392  ? 451.462 -22.597 653.462 1.00 37.90  ? 392  VAL A N     1 
ATOM   2732  C  CA    . VAL A 1  392  ? 450.908 -21.562 654.326 1.00 37.03  ? 392  VAL A CA    1 
ATOM   2733  C  C     . VAL A 1  392  ? 451.941 -21.147 655.368 1.00 37.85  ? 392  VAL A C     1 
ATOM   2734  O  O     . VAL A 1  392  ? 452.078 -19.965 655.689 1.00 37.71  ? 392  VAL A O     1 
ATOM   2735  C  CB    . VAL A 1  392  ? 449.619 -22.039 655.026 1.00 37.81  ? 392  VAL A CB    1 
ATOM   2736  C  CG1   . VAL A 1  392  ? 449.179 -21.045 656.085 1.00 38.45  ? 392  VAL A CG1   1 
ATOM   2737  C  CG2   . VAL A 1  392  ? 448.514 -22.251 654.006 1.00 39.48  ? 392  VAL A CG2   1 
ATOM   2738  N  N     . ARG A 1  393  ? 452.678 -22.129 655.878 1.00 68.90  ? 393  ARG A N     1 
ATOM   2739  C  CA    . ARG A 1  393  ? 453.725 -21.879 656.861 1.00 69.90  ? 393  ARG A CA    1 
ATOM   2740  C  C     . ARG A 1  393  ? 454.795 -20.956 656.285 1.00 69.08  ? 393  ARG A C     1 
ATOM   2741  O  O     . ARG A 1  393  ? 455.371 -20.134 656.999 1.00 70.05  ? 393  ARG A O     1 
ATOM   2742  C  CB    . ARG A 1  393  ? 454.350 -23.196 657.325 1.00 71.55  ? 393  ARG A CB    1 
ATOM   2743  C  CG    . ARG A 1  393  ? 455.161 -23.087 658.605 1.00 75.03  ? 393  ARG A CG    1 
ATOM   2744  C  CD    . ARG A 1  393  ? 454.655 -24.071 659.647 1.00 75.63  ? 393  ARG A CD    1 
ATOM   2745  N  NE    . ARG A 1  393  ? 453.236 -23.872 659.929 1.00 78.77  ? 393  ARG A NE    1 
ATOM   2746  C  CZ    . ARG A 1  393  ? 452.504 -24.678 660.690 1.00 81.53  ? 393  ARG A CZ    1 
ATOM   2747  N  NH1   . ARG A 1  393  ? 453.055 -25.747 661.248 1.00 80.83  ? 393  ARG A NH1   1 
ATOM   2748  N  NH2   . ARG A 1  393  ? 451.219 -24.418 660.891 1.00 81.15  ? 393  ARG A NH2   1 
ATOM   2749  N  N     . ASN A 1  394  ? 455.053 -21.092 654.989 1.00 52.14  ? 394  ASN A N     1 
ATOM   2750  C  CA    . ASN A 1  394  ? 455.981 -20.203 654.300 1.00 49.38  ? 394  ASN A CA    1 
ATOM   2751  C  C     . ASN A 1  394  ? 455.357 -18.837 654.037 1.00 49.03  ? 394  ASN A C     1 
ATOM   2752  O  O     . ASN A 1  394  ? 456.053 -17.822 654.010 1.00 49.28  ? 394  ASN A O     1 
ATOM   2753  C  CB    . ASN A 1  394  ? 456.445 -20.826 652.982 1.00 49.90  ? 394  ASN A CB    1 
ATOM   2754  C  CG    . ASN A 1  394  ? 457.291 -22.066 653.188 1.00 50.94  ? 394  ASN A CG    1 
ATOM   2755  O  OD1   . ASN A 1  394  ? 456.961 -23.146 652.699 1.00 53.67  ? 394  ASN A OD1   1 
ATOM   2756  N  ND2   . ASN A 1  394  ? 458.392 -21.915 653.916 1.00 49.66  ? 394  ASN A ND2   1 
ATOM   2757  N  N     . GLY A 1  395  ? 454.041 -18.821 653.840 1.00 42.76  ? 395  GLY A N     1 
ATOM   2758  C  CA    . GLY A 1  395  ? 453.315 -17.590 653.583 1.00 41.59  ? 395  GLY A CA    1 
ATOM   2759  C  C     . GLY A 1  395  ? 453.759 -16.901 652.308 1.00 40.38  ? 395  GLY A C     1 
ATOM   2760  O  O     . GLY A 1  395  ? 454.443 -17.502 651.480 1.00 41.03  ? 395  GLY A O     1 
ATOM   2761  N  N     . PRO A 1  396  ? 453.370 -15.628 652.138 1.00 37.75  ? 396  PRO A N     1 
ATOM   2762  C  CA    . PRO A 1  396  ? 453.811 -14.838 650.984 1.00 36.45  ? 396  PRO A CA    1 
ATOM   2763  C  C     . PRO A 1  396  ? 455.276 -14.434 651.117 1.00 38.04  ? 396  PRO A C     1 
ATOM   2764  O  O     . PRO A 1  396  ? 455.924 -14.832 652.088 1.00 40.24  ? 396  PRO A O     1 
ATOM   2765  C  CB    . PRO A 1  396  ? 452.893 -13.616 651.027 1.00 34.80  ? 396  PRO A CB    1 
ATOM   2766  C  CG    . PRO A 1  396  ? 452.555 -13.467 652.471 1.00 35.15  ? 396  PRO A CG    1 
ATOM   2767  C  CD    . PRO A 1  396  ? 452.480 -14.861 653.026 1.00 36.48  ? 396  PRO A CD    1 
ATOM   2768  N  N     . ASN A 1  397  ? 455.791 -13.683 650.147 1.00 89.23  ? 397  ASN A N     1 
ATOM   2769  C  CA    . ASN A 1  397  ? 457.172 -13.193 650.164 1.00 89.78  ? 397  ASN A CA    1 
ATOM   2770  C  C     . ASN A 1  397  ? 458.227 -14.305 650.067 1.00 91.04  ? 397  ASN A C     1 
ATOM   2771  O  O     . ASN A 1  397  ? 459.382 -14.041 649.732 1.00 94.49  ? 397  ASN A O     1 
ATOM   2772  C  CB    . ASN A 1  397  ? 457.417 -12.346 651.421 1.00 92.67  ? 397  ASN A CB    1 
ATOM   2773  C  CG    . ASN A 1  397  ? 458.747 -11.618 651.389 1.00 101.61 ? 397  ASN A CG    1 
ATOM   2774  O  OD1   . ASN A 1  397  ? 459.263 -11.287 650.320 1.00 103.12 ? 397  ASN A OD1   1 
ATOM   2775  N  ND2   . ASN A 1  397  ? 459.311 -11.365 652.565 1.00 103.69 ? 397  ASN A ND2   1 
ATOM   2776  N  N     . GLU A 1  398  ? 457.832 -15.542 650.354 1.00 55.87  ? 398  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1  398  ? 458.729 -16.685 650.211 1.00 56.99  ? 398  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1  398  ? 458.099 -17.771 649.346 1.00 57.60  ? 398  GLU A C     1 
ATOM   2779  O  O     . GLU A 1  398  ? 457.050 -18.318 649.685 1.00 59.12  ? 398  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1  398  ? 459.102 -17.262 651.577 1.00 59.86  ? 398  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1  398  ? 460.041 -18.459 651.496 1.00 63.33  ? 398  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1  398  ? 460.380 -19.039 652.857 1.00 65.15  ? 398  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1  398  ? 459.778 -18.602 653.861 1.00 69.70  ? 398  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1  398  ? 461.251 -19.932 652.922 1.00 62.27  ? 398  GLU A OE2   1 
ATOM   2785  N  N     . HIS A 1  399  ? 458.750 -18.079 648.228 1.00 47.70  ? 399  HIS A N     1 
ATOM   2786  C  CA    . HIS A 1  399  ? 458.253 -19.083 647.295 1.00 47.17  ? 399  HIS A CA    1 
ATOM   2787  C  C     . HIS A 1  399  ? 458.958 -20.422 647.508 1.00 48.10  ? 399  HIS A C     1 
ATOM   2788  O  O     . HIS A 1  399  ? 460.175 -20.461 647.686 1.00 48.90  ? 399  HIS A O     1 
ATOM   2789  C  CB    . HIS A 1  399  ? 458.440 -18.607 645.853 1.00 46.67  ? 399  HIS A CB    1 
ATOM   2790  C  CG    . HIS A 1  399  ? 457.837 -19.519 644.831 1.00 45.75  ? 399  HIS A CG    1 
ATOM   2791  N  ND1   . HIS A 1  399  ? 458.490 -20.633 644.349 1.00 45.71  ? 399  HIS A ND1   1 
ATOM   2792  C  CD2   . HIS A 1  399  ? 456.638 -19.485 644.202 1.00 45.28  ? 399  HIS A CD2   1 
ATOM   2793  C  CE1   . HIS A 1  399  ? 457.721 -21.245 643.466 1.00 45.16  ? 399  HIS A CE1   1 
ATOM   2794  N  NE2   . HIS A 1  399  ? 456.592 -20.568 643.359 1.00 44.38  ? 399  HIS A NE2   1 
ATOM   2795  N  N     . PRO A 1  400  ? 458.195 -21.528 647.489 1.00 28.17  ? 400  PRO A N     1 
ATOM   2796  C  CA    . PRO A 1  400  ? 456.746 -21.572 647.269 1.00 28.41  ? 400  PRO A CA    1 
ATOM   2797  C  C     . PRO A 1  400  ? 455.951 -21.341 648.549 1.00 28.79  ? 400  PRO A C     1 
ATOM   2798  O  O     . PRO A 1  400  ? 456.280 -21.910 649.589 1.00 30.86  ? 400  PRO A O     1 
ATOM   2799  C  CB    . PRO A 1  400  ? 456.512 -22.994 646.734 1.00 29.14  ? 400  PRO A CB    1 
ATOM   2800  C  CG    . PRO A 1  400  ? 457.851 -23.715 646.838 1.00 27.86  ? 400  PRO A CG    1 
ATOM   2801  C  CD    . PRO A 1  400  ? 458.744 -22.876 647.689 1.00 27.74  ? 400  PRO A CD    1 
ATOM   2802  N  N     . GLY A 1  401  ? 454.913 -20.515 648.468 1.00 40.48  ? 401  GLY A N     1 
ATOM   2803  C  CA    . GLY A 1  401  ? 454.098 -20.207 649.628 1.00 43.46  ? 401  GLY A CA    1 
ATOM   2804  C  C     . GLY A 1  401  ? 452.629 -20.028 649.301 1.00 42.18  ? 401  GLY A C     1 
ATOM   2805  O  O     . GLY A 1  401  ? 452.099 -20.666 648.391 1.00 41.51  ? 401  GLY A O     1 
ATOM   2806  N  N     . ALA A 1  402  ? 451.968 -19.153 650.052 1.00 35.99  ? 402  ALA A N     1 
ATOM   2807  C  CA    . ALA A 1  402  ? 450.548 -18.895 649.859 1.00 36.05  ? 402  ALA A CA    1 
ATOM   2808  C  C     . ALA A 1  402  ? 450.206 -17.449 650.197 1.00 35.28  ? 402  ALA A C     1 
ATOM   2809  O  O     . ALA A 1  402  ? 450.925 -16.792 650.947 1.00 35.51  ? 402  ALA A O     1 
ATOM   2810  C  CB    . ALA A 1  402  ? 449.716 -19.850 650.702 1.00 38.60  ? 402  ALA A CB    1 
ATOM   2811  N  N     . LYS A 1  403  ? 449.101 -16.962 649.645 1.00 39.64  ? 403  LYS A N     1 
ATOM   2812  C  CA    . LYS A 1  403  ? 448.678 -15.584 649.859 1.00 38.79  ? 403  LYS A CA    1 
ATOM   2813  C  C     . LYS A 1  403  ? 447.470 -15.503 650.789 1.00 40.12  ? 403  LYS A C     1 
ATOM   2814  O  O     . LYS A 1  403  ? 447.446 -14.695 651.717 1.00 41.56  ? 403  LYS A O     1 
ATOM   2815  C  CB    . LYS A 1  403  ? 448.355 -14.914 648.522 1.00 38.56  ? 403  LYS A CB    1 
ATOM   2816  C  CG    . LYS A 1  403  ? 449.522 -14.861 647.550 1.00 36.75  ? 403  LYS A CG    1 
ATOM   2817  C  CD    . LYS A 1  403  ? 450.309 -13.568 647.690 1.00 38.09  ? 403  LYS A CD    1 
ATOM   2818  C  CE    . LYS A 1  403  ? 449.468 -12.371 647.273 1.00 39.02  ? 403  LYS A CE    1 
ATOM   2819  N  NZ    . LYS A 1  403  ? 448.955 -12.512 645.880 1.00 35.12  ? 403  LYS A NZ    1 
ATOM   2820  N  N     . TYR A 1  404  ? 446.470 -16.341 650.536 1.00 37.30  ? 404  TYR A N     1 
ATOM   2821  C  CA    . TYR A 1  404  ? 445.236 -16.301 651.313 1.00 39.21  ? 404  TYR A CA    1 
ATOM   2822  C  C     . TYR A 1  404  ? 444.729 -17.690 651.681 1.00 41.26  ? 404  TYR A C     1 
ATOM   2823  O  O     . TYR A 1  404  ? 445.015 -18.672 650.993 1.00 41.07  ? 404  TYR A O     1 
ATOM   2824  C  CB    . TYR A 1  404  ? 444.145 -15.552 650.545 1.00 38.50  ? 404  TYR A CB    1 
ATOM   2825  C  CG    . TYR A 1  404  ? 444.494 -14.120 650.215 1.00 37.55  ? 404  TYR A CG    1 
ATOM   2826  C  CD1   . TYR A 1  404  ? 445.065 -13.789 648.994 1.00 39.22  ? 404  TYR A CD1   1 
ATOM   2827  C  CD2   . TYR A 1  404  ? 444.252 -13.099 651.124 1.00 39.29  ? 404  TYR A CD2   1 
ATOM   2828  C  CE1   . TYR A 1  404  ? 445.387 -12.481 648.685 1.00 41.26  ? 404  TYR A CE1   1 
ATOM   2829  C  CE2   . TYR A 1  404  ? 444.569 -11.787 650.825 1.00 40.04  ? 404  TYR A CE2   1 
ATOM   2830  C  CZ    . TYR A 1  404  ? 445.137 -11.483 649.605 1.00 40.14  ? 404  TYR A CZ    1 
ATOM   2831  O  OH    . TYR A 1  404  ? 445.456 -10.179 649.301 1.00 38.35  ? 404  TYR A OH    1 
ATOM   2832  N  N     . VAL A 1  405  ? 443.972 -17.761 652.773 1.00 35.46  ? 405  VAL A N     1 
ATOM   2833  C  CA    . VAL A 1  405  ? 443.334 -19.011 653.181 1.00 36.58  ? 405  VAL A CA    1 
ATOM   2834  C  C     . VAL A 1  405  ? 441.839 -18.807 653.413 1.00 37.68  ? 405  VAL A C     1 
ATOM   2835  O  O     . VAL A 1  405  ? 441.439 -18.058 654.301 1.00 40.95  ? 405  VAL A O     1 
ATOM   2836  C  CB    . VAL A 1  405  ? 443.968 -19.588 654.461 1.00 37.37  ? 405  VAL A CB    1 
ATOM   2837  C  CG1   . VAL A 1  405  ? 443.192 -20.809 654.930 1.00 38.65  ? 405  VAL A CG1   1 
ATOM   2838  C  CG2   . VAL A 1  405  ? 445.427 -19.940 654.223 1.00 36.58  ? 405  VAL A CG2   1 
ATOM   2839  N  N     . ILE A 1  406  ? 441.019 -19.478 652.611 1.00 38.06  ? 406  ILE A N     1 
ATOM   2840  C  CA    . ILE A 1  406  ? 439.569 -19.353 652.713 1.00 39.01  ? 406  ILE A CA    1 
ATOM   2841  C  C     . ILE A 1  406  ? 438.967 -20.512 653.507 1.00 41.05  ? 406  ILE A C     1 
ATOM   2842  O  O     . ILE A 1  406  ? 439.252 -21.678 653.234 1.00 40.55  ? 406  ILE A O     1 
ATOM   2843  C  CB    . ILE A 1  406  ? 438.906 -19.292 651.320 1.00 38.48  ? 406  ILE A CB    1 
ATOM   2844  C  CG1   . ILE A 1  406  ? 439.444 -18.105 650.518 1.00 37.14  ? 406  ILE A CG1   1 
ATOM   2845  C  CG2   . ILE A 1  406  ? 437.393 -19.197 651.450 1.00 43.96  ? 406  ILE A CG2   1 
ATOM   2846  C  CD1   . ILE A 1  406  ? 440.599 -18.448 649.601 1.00 35.93  ? 406  ILE A CD1   1 
ATOM   2847  N  N     . ARG A 1  407  ? 438.133 -20.180 654.487 1.00 53.45  ? 407  ARG A N     1 
ATOM   2848  C  CA    . ARG A 1  407  ? 437.535 -21.180 655.366 1.00 55.37  ? 407  ARG A CA    1 
ATOM   2849  C  C     . ARG A 1  407  ? 436.159 -21.623 654.875 1.00 58.18  ? 407  ARG A C     1 
ATOM   2850  O  O     . ARG A 1  407  ? 435.732 -21.256 653.780 1.00 57.14  ? 407  ARG A O     1 
ATOM   2851  C  CB    . ARG A 1  407  ? 437.428 -20.630 656.790 1.00 57.69  ? 407  ARG A CB    1 
ATOM   2852  C  CG    . ARG A 1  407  ? 438.756 -20.184 657.379 1.00 54.08  ? 407  ARG A CG    1 
ATOM   2853  C  CD    . ARG A 1  407  ? 438.570 -19.016 658.331 1.00 55.54  ? 407  ARG A CD    1 
ATOM   2854  N  NE    . ARG A 1  407  ? 437.738 -19.363 659.478 1.00 58.31  ? 407  ARG A NE    1 
ATOM   2855  C  CZ    . ARG A 1  407  ? 437.306 -18.483 660.374 1.00 61.43  ? 407  ARG A CZ    1 
ATOM   2856  N  NH1   . ARG A 1  407  ? 437.623 -17.201 660.250 1.00 58.07  ? 407  ARG A NH1   1 
ATOM   2857  N  NH2   . ARG A 1  407  ? 436.554 -18.882 661.391 1.00 65.60  ? 407  ARG A NH2   1 
ATOM   2858  N  N     . ASP A 1  408  ? 435.473 -22.414 655.696 1.00 75.25  ? 408  ASP A N     1 
ATOM   2859  C  CA    . ASP A 1  408  ? 434.148 -22.923 655.358 1.00 77.64  ? 408  ASP A CA    1 
ATOM   2860  C  C     . ASP A 1  408  ? 433.124 -21.800 655.260 1.00 77.55  ? 408  ASP A C     1 
ATOM   2861  O  O     . ASP A 1  408  ? 432.250 -21.818 654.394 1.00 78.41  ? 408  ASP A O     1 
ATOM   2862  C  CB    . ASP A 1  408  ? 433.689 -23.954 656.392 1.00 80.95  ? 408  ASP A CB    1 
ATOM   2863  C  CG    . ASP A 1  408  ? 434.544 -25.206 656.390 1.00 81.17  ? 408  ASP A CG    1 
ATOM   2864  O  OD1   . ASP A 1  408  ? 435.022 -25.602 655.306 1.00 78.05  ? 408  ASP A OD1   1 
ATOM   2865  O  OD2   . ASP A 1  408  ? 434.737 -25.797 657.474 1.00 83.31  ? 408  ASP A OD2   1 
ATOM   2866  N  N     . SER A 1  409  ? 433.239 -20.823 656.155 1.00 103.10 ? 409  SER A N     1 
ATOM   2867  C  CA    . SER A 1  409  ? 432.307 -19.702 656.195 1.00 105.66 ? 409  SER A CA    1 
ATOM   2868  C  C     . SER A 1  409  ? 432.475 -18.784 654.988 1.00 104.12 ? 409  SER A C     1 
ATOM   2869  O  O     . SER A 1  409  ? 431.570 -18.024 654.644 1.00 104.71 ? 409  SER A O     1 
ATOM   2870  C  CB    . SER A 1  409  ? 432.488 -18.907 657.490 1.00 108.82 ? 409  SER A CB    1 
ATOM   2871  O  OG    . SER A 1  409  ? 433.826 -18.462 657.632 1.00 105.66 ? 409  SER A OG    1 
ATOM   2872  N  N     . GLY A 1  410  ? 433.638 -18.858 654.348 1.00 71.27  ? 410  GLY A N     1 
ATOM   2873  C  CA    . GLY A 1  410  ? 433.914 -18.047 653.178 1.00 69.82  ? 410  GLY A CA    1 
ATOM   2874  C  C     . GLY A 1  410  ? 434.803 -16.859 653.490 1.00 71.03  ? 410  GLY A C     1 
ATOM   2875  O  O     . GLY A 1  410  ? 435.158 -16.088 652.597 1.00 69.71  ? 410  GLY A O     1 
ATOM   2876  N  N     . ASP A 1  411  ? 435.159 -16.710 654.762 1.00 123.37 ? 411  ASP A N     1 
ATOM   2877  C  CA    . ASP A 1  411  ? 436.029 -15.622 655.197 1.00 121.34 ? 411  ASP A CA    1 
ATOM   2878  C  C     . ASP A 1  411  ? 437.437 -15.799 654.639 1.00 117.32 ? 411  ASP A C     1 
ATOM   2879  O  O     . ASP A 1  411  ? 437.933 -16.919 654.526 1.00 117.62 ? 411  ASP A O     1 
ATOM   2880  C  CB    . ASP A 1  411  ? 436.068 -15.543 656.724 1.00 123.73 ? 411  ASP A CB    1 
ATOM   2881  C  CG    . ASP A 1  411  ? 434.696 -15.325 657.330 1.00 127.59 ? 411  ASP A CG    1 
ATOM   2882  O  OD1   . ASP A 1  411  ? 433.825 -14.753 656.641 1.00 127.58 ? 411  ASP A OD1   1 
ATOM   2883  O  OD2   . ASP A 1  411  ? 434.487 -15.725 658.495 1.00 130.53 ? 411  ASP A OD2   1 
ATOM   2884  N  N     . ARG A 1  412  ? 438.077 -14.686 654.295 1.00 77.49  ? 412  ARG A N     1 
ATOM   2885  C  CA    . ARG A 1  412  ? 439.385 -14.727 653.654 1.00 71.45  ? 412  ARG A CA    1 
ATOM   2886  C  C     . ARG A 1  412  ? 440.503 -14.305 654.606 1.00 70.80  ? 412  ARG A C     1 
ATOM   2887  O  O     . ARG A 1  412  ? 440.524 -13.174 655.094 1.00 70.89  ? 412  ARG A O     1 
ATOM   2888  C  CB    . ARG A 1  412  ? 439.387 -13.835 652.411 1.00 71.87  ? 412  ARG A CB    1 
ATOM   2889  C  CG    . ARG A 1  412  ? 440.621 -13.981 651.538 1.00 71.16  ? 412  ARG A CG    1 
ATOM   2890  C  CD    . ARG A 1  412  ? 440.519 -13.109 650.295 1.00 68.68  ? 412  ARG A CD    1 
ATOM   2891  N  NE    . ARG A 1  412  ? 439.337 -13.426 649.499 1.00 71.63  ? 412  ARG A NE    1 
ATOM   2892  C  CZ    . ARG A 1  412  ? 439.321 -14.303 648.500 1.00 70.24  ? 412  ARG A CZ    1 
ATOM   2893  N  NH1   . ARG A 1  412  ? 440.428 -14.953 648.170 1.00 67.86  ? 412  ARG A NH1   1 
ATOM   2894  N  NH2   . ARG A 1  412  ? 438.199 -14.529 647.830 1.00 69.52  ? 412  ARG A NH2   1 
ATOM   2895  N  N     . ILE A 1  413  ? 441.430 -15.223 654.863 1.00 37.33  ? 413  ILE A N     1 
ATOM   2896  C  CA    . ILE A 1  413  ? 442.559 -14.957 655.749 1.00 37.22  ? 413  ILE A CA    1 
ATOM   2897  C  C     . ILE A 1  413  ? 443.772 -14.462 654.969 1.00 35.78  ? 413  ILE A C     1 
ATOM   2898  O  O     . ILE A 1  413  ? 444.317 -15.184 654.132 1.00 35.08  ? 413  ILE A O     1 
ATOM   2899  C  CB    . ILE A 1  413  ? 442.966 -16.213 656.545 1.00 37.98  ? 413  ILE A CB    1 
ATOM   2900  C  CG1   . ILE A 1  413  ? 441.764 -16.798 657.287 1.00 39.49  ? 413  ILE A CG1   1 
ATOM   2901  C  CG2   . ILE A 1  413  ? 444.089 -15.887 657.517 1.00 37.99  ? 413  ILE A CG2   1 
ATOM   2902  C  CD1   . ILE A 1  413  ? 442.075 -18.081 658.021 1.00 40.33  ? 413  ILE A CD1   1 
ATOM   2903  N  N     . ASP A 1  414  ? 444.189 -13.232 655.256 1.00 53.12  ? 414  ASP A N     1 
ATOM   2904  C  CA    . ASP A 1  414  ? 445.341 -12.622 654.599 1.00 51.00  ? 414  ASP A CA    1 
ATOM   2905  C  C     . ASP A 1  414  ? 446.634 -13.029 655.302 1.00 50.61  ? 414  ASP A C     1 
ATOM   2906  O  O     . ASP A 1  414  ? 446.908 -12.585 656.415 1.00 54.78  ? 414  ASP A O     1 
ATOM   2907  C  CB    . ASP A 1  414  ? 445.199 -11.098 654.585 1.00 52.65  ? 414  ASP A CB    1 
ATOM   2908  C  CG    . ASP A 1  414  ? 446.072 -10.438 653.538 1.00 50.09  ? 414  ASP A CG    1 
ATOM   2909  O  OD1   . ASP A 1  414  ? 447.013 -11.093 653.043 1.00 48.93  ? 414  ASP A OD1   1 
ATOM   2910  O  OD2   . ASP A 1  414  ? 445.815 -9.261  653.208 1.00 49.47  ? 414  ASP A OD2   1 
ATOM   2911  N  N     . LEU A 1  415  ? 447.434 -13.860 654.640 1.00 29.27  ? 415  LEU A N     1 
ATOM   2912  C  CA    . LEU A 1  415  ? 448.613 -14.455 655.267 1.00 29.38  ? 415  LEU A CA    1 
ATOM   2913  C  C     . LEU A 1  415  ? 449.801 -13.506 655.428 1.00 28.71  ? 415  LEU A C     1 
ATOM   2914  O  O     . LEU A 1  415  ? 450.897 -13.942 655.778 1.00 28.67  ? 415  LEU A O     1 
ATOM   2915  C  CB    . LEU A 1  415  ? 449.063 -15.681 654.471 1.00 29.01  ? 415  LEU A CB    1 
ATOM   2916  C  CG    . LEU A 1  415  ? 448.079 -16.847 654.442 1.00 29.82  ? 415  LEU A CG    1 
ATOM   2917  C  CD1   . LEU A 1  415  ? 448.713 -18.058 653.778 1.00 29.54  ? 415  LEU A CD1   1 
ATOM   2918  C  CD2   . LEU A 1  415  ? 447.613 -17.179 655.848 1.00 31.18  ? 415  LEU A CD2   1 
ATOM   2919  N  N     . ARG A 1  416  ? 449.596 -12.219 655.179 1.00 48.03  ? 416  ARG A N     1 
ATOM   2920  C  CA    . ARG A 1  416  ? 450.686 -11.264 655.336 1.00 49.25  ? 416  ARG A CA    1 
ATOM   2921  C  C     . ARG A 1  416  ? 450.390 -10.253 656.438 1.00 50.68  ? 416  ARG A C     1 
ATOM   2922  O  O     . ARG A 1  416  ? 451.274 -9.509  656.858 1.00 51.51  ? 416  ARG A O     1 
ATOM   2923  C  CB    . ARG A 1  416  ? 450.968 -10.541 654.016 1.00 46.60  ? 416  ARG A CB    1 
ATOM   2924  C  CG    . ARG A 1  416  ? 449.827 -9.682  653.511 1.00 47.55  ? 416  ARG A CG    1 
ATOM   2925  C  CD    . ARG A 1  416  ? 450.227 -8.924  652.257 1.00 47.10  ? 416  ARG A CD    1 
ATOM   2926  N  NE    . ARG A 1  416  ? 449.159 -8.047  651.786 1.00 48.00  ? 416  ARG A NE    1 
ATOM   2927  C  CZ    . ARG A 1  416  ? 448.295 -8.368  650.829 1.00 48.84  ? 416  ARG A CZ    1 
ATOM   2928  N  NH1   . ARG A 1  416  ? 448.373 -9.550  650.230 1.00 48.16  ? 416  ARG A NH1   1 
ATOM   2929  N  NH2   . ARG A 1  416  ? 447.355 -7.505  650.466 1.00 48.18  ? 416  ARG A NH2   1 
ATOM   2930  N  N     . TYR A 1  417  ? 449.148 -10.238 656.911 1.00 38.24  ? 417  TYR A N     1 
ATOM   2931  C  CA    . TYR A 1  417  ? 448.741 -9.292  657.943 1.00 39.03  ? 417  TYR A CA    1 
ATOM   2932  C  C     . TYR A 1  417  ? 448.109 -9.980  659.149 1.00 40.45  ? 417  TYR A C     1 
ATOM   2933  O  O     . TYR A 1  417  ? 448.103 -9.429  660.247 1.00 43.39  ? 417  TYR A O     1 
ATOM   2934  C  CB    . TYR A 1  417  ? 447.769 -8.262  657.365 1.00 38.84  ? 417  TYR A CB    1 
ATOM   2935  C  CG    . TYR A 1  417  ? 448.391 -7.352  656.331 1.00 37.59  ? 417  TYR A CG    1 
ATOM   2936  C  CD1   . TYR A 1  417  ? 449.688 -6.881  656.487 1.00 37.28  ? 417  TYR A CD1   1 
ATOM   2937  C  CD2   . TYR A 1  417  ? 447.687 -6.972  655.196 1.00 37.01  ? 417  TYR A CD2   1 
ATOM   2938  C  CE1   . TYR A 1  417  ? 450.266 -6.053  655.543 1.00 38.55  ? 417  TYR A CE1   1 
ATOM   2939  C  CE2   . TYR A 1  417  ? 448.256 -6.142  654.247 1.00 35.92  ? 417  TYR A CE2   1 
ATOM   2940  C  CZ    . TYR A 1  417  ? 449.547 -5.687  654.425 1.00 36.73  ? 417  TYR A CZ    1 
ATOM   2941  O  OH    . TYR A 1  417  ? 450.121 -4.862  653.483 1.00 36.23  ? 417  TYR A OH    1 
ATOM   2942  N  N     . SER A 1  418  ? 447.584 -11.184 658.943 1.00 27.41  ? 418  SER A N     1 
ATOM   2943  C  CA    . SER A 1  418  ? 446.905 -11.916 660.009 1.00 28.81  ? 418  SER A CA    1 
ATOM   2944  C  C     . SER A 1  418  ? 447.840 -12.236 661.169 1.00 29.42  ? 418  SER A C     1 
ATOM   2945  O  O     . SER A 1  418  ? 448.989 -12.626 660.963 1.00 28.81  ? 418  SER A O     1 
ATOM   2946  C  CB    . SER A 1  418  ? 446.299 -13.212 659.467 1.00 29.00  ? 418  SER A CB    1 
ATOM   2947  O  OG    . SER A 1  418  ? 445.580 -13.896 660.480 1.00 30.43  ? 418  SER A OG    1 
ATOM   2948  N  N     . LYS A 1  419  ? 447.339 -12.073 662.389 1.00 30.70  ? 419  LYS A N     1 
ATOM   2949  C  CA    . LYS A 1  419  ? 448.123 -12.366 663.581 1.00 31.47  ? 419  LYS A CA    1 
ATOM   2950  C  C     . LYS A 1  419  ? 448.297 -13.869 663.757 1.00 31.96  ? 419  LYS A C     1 
ATOM   2951  O  O     . LYS A 1  419  ? 449.188 -14.321 664.475 1.00 32.34  ? 419  LYS A O     1 
ATOM   2952  C  CB    . LYS A 1  419  ? 447.463 -11.770 664.826 1.00 32.81  ? 419  LYS A CB    1 
ATOM   2953  C  CG    . LYS A 1  419  ? 446.252 -12.549 665.314 1.00 34.09  ? 419  LYS A CG    1 
ATOM   2954  C  CD    . LYS A 1  419  ? 445.775 -12.045 666.661 1.00 35.54  ? 419  LYS A CD    1 
ATOM   2955  C  CE    . LYS A 1  419  ? 445.232 -10.635 666.555 1.00 35.44  ? 419  LYS A CE    1 
ATOM   2956  N  NZ    . LYS A 1  419  ? 444.044 -10.575 665.660 1.00 35.24  ? 419  LYS A NZ    1 
ATOM   2957  N  N     . ARG A 1  420  ? 447.437 -14.640 663.101 1.00 38.87  ? 420  ARG A N     1 
ATOM   2958  C  CA    . ARG A 1  420  ? 447.486 -16.090 663.204 1.00 39.40  ? 420  ARG A CA    1 
ATOM   2959  C  C     . ARG A 1  420  ? 448.015 -16.724 661.926 1.00 38.22  ? 420  ARG A C     1 
ATOM   2960  O  O     . ARG A 1  420  ? 447.648 -17.845 661.586 1.00 38.50  ? 420  ARG A O     1 
ATOM   2961  C  CB    . ARG A 1  420  ? 446.103 -16.653 663.530 1.00 40.58  ? 420  ARG A CB    1 
ATOM   2962  C  CG    . ARG A 1  420  ? 445.617 -16.338 664.932 1.00 42.04  ? 420  ARG A CG    1 
ATOM   2963  C  CD    . ARG A 1  420  ? 444.423 -17.202 665.292 1.00 43.33  ? 420  ARG A CD    1 
ATOM   2964  N  NE    . ARG A 1  420  ? 444.724 -18.621 665.128 1.00 44.13  ? 420  ARG A NE    1 
ATOM   2965  C  CZ    . ARG A 1  420  ? 443.849 -19.600 665.329 1.00 47.53  ? 420  ARG A CZ    1 
ATOM   2966  N  NH1   . ARG A 1  420  ? 442.609 -19.319 665.706 1.00 45.73  ? 420  ARG A NH1   1 
ATOM   2967  N  NH2   . ARG A 1  420  ? 444.215 -20.863 665.153 1.00 49.21  ? 420  ARG A NH2   1 
ATOM   2968  N  N     . ALA A 1  421  ? 448.880 -16.004 661.220 1.00 42.48  ? 421  ALA A N     1 
ATOM   2969  C  CA    . ALA A 1  421  ? 449.477 -16.522 659.995 1.00 41.34  ? 421  ALA A CA    1 
ATOM   2970  C  C     . ALA A 1  421  ? 450.506 -17.604 660.311 1.00 43.75  ? 421  ALA A C     1 
ATOM   2971  O  O     . ALA A 1  421  ? 450.909 -18.366 659.431 1.00 40.90  ? 421  ALA A O     1 
ATOM   2972  C  CB    . ALA A 1  421  ? 450.116 -15.397 659.198 1.00 39.32  ? 421  ALA A CB    1 
ATOM   2973  N  N     . GLY A 1  422  ? 450.924 -17.664 661.572 1.00 50.49  ? 422  GLY A N     1 
ATOM   2974  C  CA    . GLY A 1  422  ? 451.898 -18.642 662.017 1.00 48.39  ? 422  GLY A CA    1 
ATOM   2975  C  C     . GLY A 1  422  ? 451.272 -19.979 662.360 1.00 53.13  ? 422  GLY A C     1 
ATOM   2976  O  O     . GLY A 1  422  ? 451.775 -21.028 661.958 1.00 56.49  ? 422  GLY A O     1 
ATOM   2977  N  N     . ASP A 1  423  ? 450.173 -19.946 663.107 1.00 70.03  ? 423  ASP A N     1 
ATOM   2978  C  CA    . ASP A 1  423  ? 449.475 -21.168 663.491 1.00 73.86  ? 423  ASP A CA    1 
ATOM   2979  C  C     . ASP A 1  423  ? 448.107 -21.269 662.820 1.00 74.08  ? 423  ASP A C     1 
ATOM   2980  O  O     . ASP A 1  423  ? 447.178 -20.538 663.163 1.00 74.57  ? 423  ASP A O     1 
ATOM   2981  C  CB    . ASP A 1  423  ? 449.325 -21.246 665.014 1.00 79.71  ? 423  ASP A CB    1 
ATOM   2982  C  CG    . ASP A 1  423  ? 448.713 -19.991 665.608 1.00 81.75  ? 423  ASP A CG    1 
ATOM   2983  O  OD1   . ASP A 1  423  ? 449.022 -18.887 665.113 1.00 81.90  ? 423  ASP A OD1   1 
ATOM   2984  O  OD2   . ASP A 1  423  ? 447.921 -20.110 666.566 1.00 83.51  ? 423  ASP A OD2   1 
ATOM   2985  N  N     . ILE A 1  424  ? 447.993 -22.177 661.856 1.00 59.76  ? 424  ILE A N     1 
ATOM   2986  C  CA    . ILE A 1  424  ? 446.734 -22.388 661.149 1.00 57.93  ? 424  ILE A CA    1 
ATOM   2987  C  C     . ILE A 1  424  ? 446.384 -23.868 661.048 1.00 60.79  ? 424  ILE A C     1 
ATOM   2988  O  O     . ILE A 1  424  ? 447.133 -24.657 660.472 1.00 61.05  ? 424  ILE A O     1 
ATOM   2989  C  CB    . ILE A 1  424  ? 446.772 -21.790 659.732 1.00 54.70  ? 424  ILE A CB    1 
ATOM   2990  C  CG1   . ILE A 1  424  ? 446.870 -20.267 659.801 1.00 54.67  ? 424  ILE A CG1   1 
ATOM   2991  C  CG2   . ILE A 1  424  ? 445.534 -22.194 658.951 1.00 56.98  ? 424  ILE A CG2   1 
ATOM   2992  C  CD1   . ILE A 1  424  ? 446.795 -19.587 658.460 1.00 51.12  ? 424  ILE A CD1   1 
ATOM   2993  N  N     . GLN A 1  425  ? 445.240 -24.237 661.613 1.00 105.05 ? 425  GLN A N     1 
ATOM   2994  C  CA    . GLN A 1  425  ? 444.756 -25.608 661.534 1.00 108.26 ? 425  GLN A CA    1 
ATOM   2995  C  C     . GLN A 1  425  ? 443.905 -25.793 660.284 1.00 106.24 ? 425  GLN A C     1 
ATOM   2996  O  O     . GLN A 1  425  ? 442.685 -25.631 660.326 1.00 107.76 ? 425  GLN A O     1 
ATOM   2997  C  CB    . GLN A 1  425  ? 443.952 -25.967 662.785 1.00 115.31 ? 425  GLN A CB    1 
ATOM   2998  C  CG    . GLN A 1  425  ? 444.717 -25.785 664.086 1.00 115.19 ? 425  GLN A CG    1 
ATOM   2999  C  CD    . GLN A 1  425  ? 445.909 -26.716 664.197 1.00 116.32 ? 425  GLN A CD    1 
ATOM   3000  O  OE1   . GLN A 1  425  ? 447.041 -26.272 664.392 1.00 115.01 ? 425  GLN A OE1   1 
ATOM   3001  N  NE2   . GLN A 1  425  ? 445.659 -28.015 664.079 1.00 118.59 ? 425  GLN A NE2   1 
ATOM   3002  N  N     . LEU A 1  426  ? 444.556 -26.123 659.172 1.00 40.33  ? 426  LEU A N     1 
ATOM   3003  C  CA    . LEU A 1  426  ? 443.866 -26.296 657.897 1.00 39.77  ? 426  LEU A CA    1 
ATOM   3004  C  C     . LEU A 1  426  ? 442.830 -27.413 657.955 1.00 41.00  ? 426  LEU A C     1 
ATOM   3005  O  O     . LEU A 1  426  ? 443.172 -28.587 658.084 1.00 41.59  ? 426  LEU A O     1 
ATOM   3006  C  CB    . LEU A 1  426  ? 444.867 -26.581 656.775 1.00 38.54  ? 426  LEU A CB    1 
ATOM   3007  C  CG    . LEU A 1  426  ? 445.619 -25.382 656.197 1.00 37.08  ? 426  LEU A CG    1 
ATOM   3008  C  CD1   . LEU A 1  426  ? 446.542 -25.825 655.074 1.00 36.06  ? 426  LEU A CD1   1 
ATOM   3009  C  CD2   . LEU A 1  426  ? 444.643 -24.326 655.703 1.00 36.65  ? 426  LEU A CD2   1 
ATOM   3010  N  N     . GLN A 1  427  ? 441.561 -27.035 657.860 1.00 77.32  ? 427  GLN A N     1 
ATOM   3011  C  CA    . GLN A 1  427  ? 440.476 -28.003 657.843 1.00 80.22  ? 427  GLN A CA    1 
ATOM   3012  C  C     . GLN A 1  427  ? 440.236 -28.479 656.415 1.00 78.93  ? 427  GLN A C     1 
ATOM   3013  O  O     . GLN A 1  427  ? 440.555 -27.773 655.459 1.00 77.50  ? 427  GLN A O     1 
ATOM   3014  C  CB    . GLN A 1  427  ? 439.200 -27.392 658.425 1.00 80.51  ? 427  GLN A CB    1 
ATOM   3015  C  CG    . GLN A 1  427  ? 438.310 -28.379 659.160 1.00 86.92  ? 427  GLN A CG    1 
ATOM   3016  C  CD    . GLN A 1  427  ? 438.863 -28.758 660.521 1.00 90.33  ? 427  GLN A CD    1 
ATOM   3017  O  OE1   . GLN A 1  427  ? 439.759 -28.096 661.046 1.00 87.84  ? 427  GLN A OE1   1 
ATOM   3018  N  NE2   . GLN A 1  427  ? 438.330 -29.829 661.099 1.00 94.81  ? 427  GLN A NE2   1 
ATOM   3019  N  N     . TYR A 1  428  ? 439.683 -29.679 656.269 1.00 63.21  ? 428  TYR A N     1 
ATOM   3020  C  CA    . TYR A 1  428  ? 439.328 -30.182 654.948 1.00 60.68  ? 428  TYR A CA    1 
ATOM   3021  C  C     . TYR A 1  428  ? 438.176 -29.366 654.376 1.00 63.13  ? 428  TYR A C     1 
ATOM   3022  O  O     . TYR A 1  428  ? 437.270 -28.963 655.104 1.00 67.04  ? 428  TYR A O     1 
ATOM   3023  C  CB    . TYR A 1  428  ? 438.952 -31.662 655.006 1.00 64.57  ? 428  TYR A CB    1 
ATOM   3024  C  CG    . TYR A 1  428  ? 440.087 -32.568 655.425 1.00 64.09  ? 428  TYR A CG    1 
ATOM   3025  C  CD1   . TYR A 1  428  ? 441.170 -32.787 654.585 1.00 61.10  ? 428  TYR A CD1   1 
ATOM   3026  C  CD2   . TYR A 1  428  ? 440.070 -33.211 656.656 1.00 69.95  ? 428  TYR A CD2   1 
ATOM   3027  C  CE1   . TYR A 1  428  ? 442.210 -33.614 654.963 1.00 63.27  ? 428  TYR A CE1   1 
ATOM   3028  C  CE2   . TYR A 1  428  ? 441.105 -34.043 657.042 1.00 69.97  ? 428  TYR A CE2   1 
ATOM   3029  C  CZ    . TYR A 1  428  ? 442.173 -34.242 656.191 1.00 66.06  ? 428  TYR A CZ    1 
ATOM   3030  O  OH    . TYR A 1  428  ? 443.207 -35.068 656.568 1.00 65.42  ? 428  TYR A OH    1 
ATOM   3031  N  N     . GLY A 1  429  ? 438.218 -29.119 653.072 1.00 52.38  ? 429  GLY A N     1 
ATOM   3032  C  CA    . GLY A 1  429  ? 437.191 -28.327 652.422 1.00 52.05  ? 429  GLY A CA    1 
ATOM   3033  C  C     . GLY A 1  429  ? 437.596 -26.873 652.283 1.00 48.55  ? 429  GLY A C     1 
ATOM   3034  O  O     . GLY A 1  429  ? 437.039 -26.138 651.469 1.00 47.96  ? 429  GLY A O     1 
ATOM   3035  N  N     . TRP A 1  430  ? 438.569 -26.455 653.087 1.00 46.99  ? 430  TRP A N     1 
ATOM   3036  C  CA    . TRP A 1  430  ? 439.102 -25.102 652.997 1.00 45.28  ? 430  TRP A CA    1 
ATOM   3037  C  C     . TRP A 1  430  ? 439.869 -24.914 651.698 1.00 42.62  ? 430  TRP A C     1 
ATOM   3038  O  O     . TRP A 1  430  ? 440.348 -25.879 651.106 1.00 42.11  ? 430  TRP A O     1 
ATOM   3039  C  CB    . TRP A 1  430  ? 440.019 -24.791 654.183 1.00 45.61  ? 430  TRP A CB    1 
ATOM   3040  C  CG    . TRP A 1  430  ? 439.302 -24.545 655.472 1.00 47.15  ? 430  TRP A CG    1 
ATOM   3041  C  CD1   . TRP A 1  430  ? 437.996 -24.822 655.754 1.00 50.29  ? 430  TRP A CD1   1 
ATOM   3042  C  CD2   . TRP A 1  430  ? 439.853 -23.961 656.659 1.00 46.47  ? 430  TRP A CD2   1 
ATOM   3043  N  NE1   . TRP A 1  430  ? 437.701 -24.451 657.044 1.00 52.17  ? 430  TRP A NE1   1 
ATOM   3044  C  CE2   . TRP A 1  430  ? 438.824 -23.920 657.620 1.00 49.65  ? 430  TRP A CE2   1 
ATOM   3045  C  CE3   . TRP A 1  430  ? 441.117 -23.472 657.001 1.00 44.54  ? 430  TRP A CE3   1 
ATOM   3046  C  CZ2   . TRP A 1  430  ? 439.021 -23.408 658.901 1.00 52.23  ? 430  TRP A CZ2   1 
ATOM   3047  C  CZ3   . TRP A 1  430  ? 441.310 -22.965 658.272 1.00 45.19  ? 430  TRP A CZ3   1 
ATOM   3048  C  CH2   . TRP A 1  430  ? 440.268 -22.937 659.206 1.00 49.28  ? 430  TRP A CH2   1 
ATOM   3049  N  N     . LYS A 1  431  ? 439.982 -23.666 651.259 1.00 53.17  ? 431  LYS A N     1 
ATOM   3050  C  CA    . LYS A 1  431  ? 440.778 -23.345 650.084 1.00 51.39  ? 431  LYS A CA    1 
ATOM   3051  C  C     . LYS A 1  431  ? 442.076 -22.668 650.499 1.00 49.59  ? 431  LYS A C     1 
ATOM   3052  O  O     . LYS A 1  431  ? 442.099 -21.877 651.438 1.00 52.05  ? 431  LYS A O     1 
ATOM   3053  C  CB    . LYS A 1  431  ? 439.997 -22.444 649.125 1.00 53.32  ? 431  LYS A CB    1 
ATOM   3054  C  CG    . LYS A 1  431  ? 438.729 -23.069 648.568 1.00 56.49  ? 431  LYS A CG    1 
ATOM   3055  C  CD    . LYS A 1  431  ? 438.050 -22.135 647.577 1.00 54.91  ? 431  LYS A CD    1 
ATOM   3056  C  CE    . LYS A 1  431  ? 436.770 -22.745 647.027 1.00 58.32  ? 431  LYS A CE    1 
ATOM   3057  N  NZ    . LYS A 1  431  ? 435.767 -23.001 648.101 1.00 61.71  ? 431  LYS A NZ    1 
ATOM   3058  N  N     . VAL A 1  432  ? 443.159 -22.994 649.805 1.00 27.35  ? 432  VAL A N     1 
ATOM   3059  C  CA    . VAL A 1  432  ? 444.433 -22.324 650.025 1.00 26.50  ? 432  VAL A CA    1 
ATOM   3060  C  C     . VAL A 1  432  ? 444.923 -21.730 648.715 1.00 25.18  ? 432  VAL A C     1 
ATOM   3061  O  O     . VAL A 1  432  ? 445.229 -22.460 647.770 1.00 24.83  ? 432  VAL A O     1 
ATOM   3062  C  CB    . VAL A 1  432  ? 445.504 -23.279 650.587 1.00 26.78  ? 432  VAL A CB    1 
ATOM   3063  C  CG1   . VAL A 1  432  ? 446.859 -22.592 650.623 1.00 25.85  ? 432  VAL A CG1   1 
ATOM   3064  C  CG2   . VAL A 1  432  ? 445.112 -23.766 651.972 1.00 28.11  ? 432  VAL A CG2   1 
ATOM   3065  N  N     . GLU A 1  433  ? 444.978 -20.404 648.649 1.00 28.74  ? 433  GLU A N     1 
ATOM   3066  C  CA    . GLU A 1  433  ? 445.480 -19.742 647.453 1.00 27.52  ? 433  GLU A CA    1 
ATOM   3067  C  C     . GLU A 1  433  ? 447.000 -19.718 647.480 1.00 26.82  ? 433  GLU A C     1 
ATOM   3068  O  O     . GLU A 1  433  ? 447.609 -18.783 647.999 1.00 26.46  ? 433  GLU A O     1 
ATOM   3069  C  CB    . GLU A 1  433  ? 444.916 -18.328 647.333 1.00 27.15  ? 433  GLU A CB    1 
ATOM   3070  C  CG    . GLU A 1  433  ? 443.413 -18.293 647.127 1.00 27.80  ? 433  GLU A CG    1 
ATOM   3071  C  CD    . GLU A 1  433  ? 442.912 -16.923 646.727 1.00 27.34  ? 433  GLU A CD    1 
ATOM   3072  O  OE1   . GLU A 1  433  ? 443.751 -16.029 646.485 1.00 26.43  ? 433  GLU A OE1   1 
ATOM   3073  O  OE2   . GLU A 1  433  ? 441.678 -16.742 646.651 1.00 27.95  ? 433  GLU A OE2   1 
ATOM   3074  N  N     . ARG A 1  434  ? 447.604 -20.761 646.920 1.00 31.45  ? 434  ARG A N     1 
ATOM   3075  C  CA    . ARG A 1  434  ? 449.054 -20.912 646.931 1.00 30.95  ? 434  ARG A CA    1 
ATOM   3076  C  C     . ARG A 1  434  ? 449.706 -20.247 645.728 1.00 29.77  ? 434  ARG A C     1 
ATOM   3077  O  O     . ARG A 1  434  ? 449.046 -19.966 644.731 1.00 29.38  ? 434  ARG A O     1 
ATOM   3078  C  CB    . ARG A 1  434  ? 449.431 -22.393 646.966 1.00 31.91  ? 434  ARG A CB    1 
ATOM   3079  C  CG    . ARG A 1  434  ? 448.565 -23.260 646.069 1.00 32.71  ? 434  ARG A CG    1 
ATOM   3080  C  CD    . ARG A 1  434  ? 449.262 -24.560 645.719 1.00 34.60  ? 434  ARG A CD    1 
ATOM   3081  N  NE    . ARG A 1  434  ? 450.081 -24.431 644.517 1.00 32.60  ? 434  ARG A NE    1 
ATOM   3082  C  CZ    . ARG A 1  434  ? 449.688 -24.804 643.303 1.00 33.53  ? 434  ARG A CZ    1 
ATOM   3083  N  NH1   . ARG A 1  434  ? 448.486 -25.337 643.127 1.00 34.05  ? 434  ARG A NH1   1 
ATOM   3084  N  NH2   . ARG A 1  434  ? 450.499 -24.650 642.266 1.00 34.72  ? 434  ARG A NH2   1 
ATOM   3085  N  N     . HIS A 1  435  ? 451.007 -19.999 645.826 1.00 44.21  ? 435  HIS A N     1 
ATOM   3086  C  CA    . HIS A 1  435  ? 451.763 -19.453 644.708 1.00 42.30  ? 435  HIS A CA    1 
ATOM   3087  C  C     . HIS A 1  435  ? 451.752 -20.417 643.529 1.00 42.74  ? 435  HIS A C     1 
ATOM   3088  O  O     . HIS A 1  435  ? 451.565 -21.622 643.703 1.00 44.63  ? 435  HIS A O     1 
ATOM   3089  C  CB    . HIS A 1  435  ? 453.205 -19.156 645.124 1.00 42.13  ? 435  HIS A CB    1 
ATOM   3090  C  CG    . HIS A 1  435  ? 453.333 -18.039 646.111 1.00 42.00  ? 435  HIS A CG    1 
ATOM   3091  N  ND1   . HIS A 1  435  ? 454.390 -17.941 646.991 1.00 42.88  ? 435  HIS A ND1   1 
ATOM   3092  C  CD2   . HIS A 1  435  ? 452.542 -16.968 646.353 1.00 42.62  ? 435  HIS A CD2   1 
ATOM   3093  C  CE1   . HIS A 1  435  ? 454.241 -16.859 647.735 1.00 44.82  ? 435  HIS A CE1   1 
ATOM   3094  N  NE2   . HIS A 1  435  ? 453.128 -16.251 647.367 1.00 43.27  ? 435  HIS A NE2   1 
ATOM   3095  N  N     . ILE A 1  436  ? 451.943 -19.882 642.329 1.00 39.64  ? 436  ILE A N     1 
ATOM   3096  C  CA    . ILE A 1  436  ? 452.097 -20.717 641.147 1.00 39.95  ? 436  ILE A CA    1 
ATOM   3097  C  C     . ILE A 1  436  ? 453.392 -21.510 641.293 1.00 40.85  ? 436  ILE A C     1 
ATOM   3098  O  O     . ILE A 1  436  ? 454.450 -20.945 641.576 1.00 42.37  ? 436  ILE A O     1 
ATOM   3099  C  CB    . ILE A 1  436  ? 452.096 -19.875 639.847 1.00 37.65  ? 436  ILE A CB    1 
ATOM   3100  C  CG1   . ILE A 1  436  ? 450.713 -19.902 639.195 1.00 40.99  ? 436  ILE A CG1   1 
ATOM   3101  C  CG2   . ILE A 1  436  ? 453.105 -20.397 638.850 1.00 39.46  ? 436  ILE A CG2   1 
ATOM   3102  C  CD1   . ILE A 1  436  ? 449.596 -19.448 640.101 1.00 41.04  ? 436  ILE A CD1   1 
ATOM   3103  N  N     . MET A 1  437  ? 453.299 -22.825 641.136 1.00 34.31  ? 437  MET A N     1 
ATOM   3104  C  CA    . MET A 1  437  ? 454.458 -23.690 641.312 1.00 35.22  ? 437  MET A CA    1 
ATOM   3105  C  C     . MET A 1  437  ? 454.823 -24.395 640.015 1.00 36.28  ? 437  MET A C     1 
ATOM   3106  O  O     . MET A 1  437  ? 454.155 -24.222 638.995 1.00 35.35  ? 437  MET A O     1 
ATOM   3107  C  CB    . MET A 1  437  ? 454.198 -24.718 642.414 1.00 37.04  ? 437  MET A CB    1 
ATOM   3108  C  CG    . MET A 1  437  ? 453.846 -24.110 643.761 1.00 38.22  ? 437  MET A CG    1 
ATOM   3109  S  SD    . MET A 1  437  ? 453.868 -25.326 645.092 1.00 40.21  ? 437  MET A SD    1 
ATOM   3110  C  CE    . MET A 1  437  ? 452.749 -26.562 644.434 1.00 42.24  ? 437  MET A CE    1 
ATOM   3111  N  N     . ASP A 1  438  ? 455.885 -25.193 640.062 1.00 32.90  ? 438  ASP A N     1 
ATOM   3112  C  CA    . ASP A 1  438  ? 456.360 -25.903 638.881 1.00 30.46  ? 438  ASP A CA    1 
ATOM   3113  C  C     . ASP A 1  438  ? 455.313 -26.864 638.329 1.00 32.79  ? 438  ASP A C     1 
ATOM   3114  O  O     . ASP A 1  438  ? 454.513 -27.428 639.077 1.00 35.04  ? 438  ASP A O     1 
ATOM   3115  C  CB    . ASP A 1  438  ? 457.650 -26.665 639.193 1.00 29.62  ? 438  ASP A CB    1 
ATOM   3116  C  CG    . ASP A 1  438  ? 458.855 -25.752 639.295 1.00 30.26  ? 438  ASP A CG    1 
ATOM   3117  O  OD1   . ASP A 1  438  ? 458.737 -24.569 638.914 1.00 31.87  ? 438  ASP A OD1   1 
ATOM   3118  O  OD2   . ASP A 1  438  ? 459.922 -26.220 639.744 1.00 31.44  ? 438  ASP A OD2   1 
ATOM   3119  N  N     . ASN A 1  439  ? 455.330 -27.026 637.008 1.00 36.89  ? 439  ASN A N     1 
ATOM   3120  C  CA    . ASN A 1  439  ? 454.428 -27.926 636.295 1.00 37.01  ? 439  ASN A CA    1 
ATOM   3121  C  C     . ASN A 1  439  ? 452.954 -27.560 636.457 1.00 38.99  ? 439  ASN A C     1 
ATOM   3122  O  O     . ASN A 1  439  ? 452.079 -28.421 636.368 1.00 41.99  ? 439  ASN A O     1 
ATOM   3123  C  CB    . ASN A 1  439  ? 454.663 -29.371 636.738 1.00 37.60  ? 439  ASN A CB    1 
ATOM   3124  C  CG    . ASN A 1  439  ? 456.078 -29.834 636.468 1.00 37.47  ? 439  ASN A CG    1 
ATOM   3125  O  OD1   . ASN A 1  439  ? 456.733 -29.357 635.540 1.00 35.92  ? 439  ASN A OD1   1 
ATOM   3126  N  ND2   . ASN A 1  439  ? 456.561 -30.767 637.280 1.00 39.99  ? 439  ASN A ND2   1 
ATOM   3127  N  N     . ASP A 1  440  ? 452.687 -26.279 636.689 1.00 40.02  ? 440  ASP A N     1 
ATOM   3128  C  CA    . ASP A 1  440  ? 451.321 -25.772 636.658 1.00 41.45  ? 440  ASP A CA    1 
ATOM   3129  C  C     . ASP A 1  440  ? 450.959 -25.364 635.237 1.00 39.96  ? 440  ASP A C     1 
ATOM   3130  O  O     . ASP A 1  440  ? 451.770 -24.755 634.539 1.00 39.14  ? 440  ASP A O     1 
ATOM   3131  C  CB    . ASP A 1  440  ? 451.147 -24.584 637.606 1.00 42.50  ? 440  ASP A CB    1 
ATOM   3132  C  CG    . ASP A 1  440  ? 450.906 -25.007 639.038 1.00 43.54  ? 440  ASP A CG    1 
ATOM   3133  O  OD1   . ASP A 1  440  ? 450.410 -26.134 639.255 1.00 44.99  ? 440  ASP A OD1   1 
ATOM   3134  O  OD2   . ASP A 1  440  ? 451.207 -24.207 639.948 1.00 42.88  ? 440  ASP A OD2   1 
ATOM   3135  N  N     . PRO A 1  441  ? 449.739 -25.704 634.799 1.00 19.31  ? 441  PRO A N     1 
ATOM   3136  C  CA    . PRO A 1  441  ? 449.287 -25.312 633.462 1.00 18.88  ? 441  PRO A CA    1 
ATOM   3137  C  C     . PRO A 1  441  ? 449.010 -23.818 633.398 1.00 18.11  ? 441  PRO A C     1 
ATOM   3138  O  O     . PRO A 1  441  ? 448.209 -23.330 634.190 1.00 18.33  ? 441  PRO A O     1 
ATOM   3139  C  CB    . PRO A 1  441  ? 447.990 -26.112 633.272 1.00 19.73  ? 441  PRO A CB    1 
ATOM   3140  C  CG    . PRO A 1  441  ? 447.977 -27.130 634.372 1.00 20.63  ? 441  PRO A CG    1 
ATOM   3141  C  CD    . PRO A 1  441  ? 448.734 -26.514 635.500 1.00 20.31  ? 441  PRO A CD    1 
ATOM   3142  N  N     . VAL A 1  442  ? 449.665 -23.099 632.493 1.00 21.69  ? 442  VAL A N     1 
ATOM   3143  C  CA    . VAL A 1  442  ? 449.361 -21.680 632.322 1.00 21.01  ? 442  VAL A CA    1 
ATOM   3144  C  C     . VAL A 1  442  ? 449.217 -21.327 630.850 1.00 20.57  ? 442  VAL A C     1 
ATOM   3145  O  O     . VAL A 1  442  ? 449.892 -21.895 630.000 1.00 20.49  ? 442  VAL A O     1 
ATOM   3146  C  CB    . VAL A 1  442  ? 450.439 -20.780 632.954 1.00 20.38  ? 442  VAL A CB    1 
ATOM   3147  C  CG1   . VAL A 1  442  ? 450.333 -20.808 634.470 1.00 20.81  ? 442  VAL A CG1   1 
ATOM   3148  C  CG2   . VAL A 1  442  ? 451.826 -21.199 632.490 1.00 20.09  ? 442  VAL A CG2   1 
ATOM   3149  N  N     . LEU A 1  443  ? 448.332 -20.388 630.547 1.00 32.07  ? 443  LEU A N     1 
ATOM   3150  C  CA    . LEU A 1  443  ? 448.115 -19.995 629.166 1.00 30.54  ? 443  LEU A CA    1 
ATOM   3151  C  C     . LEU A 1  443  ? 449.110 -18.928 628.740 1.00 30.38  ? 443  LEU A C     1 
ATOM   3152  O  O     . LEU A 1  443  ? 449.021 -17.777 629.167 1.00 31.03  ? 443  LEU A O     1 
ATOM   3153  C  CB    . LEU A 1  443  ? 446.691 -19.490 628.962 1.00 30.37  ? 443  LEU A CB    1 
ATOM   3154  C  CG    . LEU A 1  443  ? 445.966 -20.072 627.747 1.00 31.48  ? 443  LEU A CG    1 
ATOM   3155  C  CD1   . LEU A 1  443  ? 444.905 -19.110 627.271 1.00 31.35  ? 443  LEU A CD1   1 
ATOM   3156  C  CD2   . LEU A 1  443  ? 446.926 -20.411 626.615 1.00 30.69  ? 443  LEU A CD2   1 
ATOM   3157  N  N     . PHE A 1  444  ? 450.058 -19.321 627.897 1.00 22.79  ? 444  PHE A N     1 
ATOM   3158  C  CA    . PHE A 1  444  ? 451.020 -18.385 627.336 1.00 22.01  ? 444  PHE A CA    1 
ATOM   3159  C  C     . PHE A 1  444  ? 450.451 -17.783 626.061 1.00 21.77  ? 444  PHE A C     1 
ATOM   3160  O  O     . PHE A 1  444  ? 449.908 -18.497 625.215 1.00 22.18  ? 444  PHE A O     1 
ATOM   3161  C  CB    . PHE A 1  444  ? 452.354 -19.072 627.050 1.00 21.95  ? 444  PHE A CB    1 
ATOM   3162  C  CG    . PHE A 1  444  ? 453.547 -18.192 627.275 1.00 21.31  ? 444  PHE A CG    1 
ATOM   3163  C  CD1   . PHE A 1  444  ? 453.421 -16.997 627.963 1.00 20.90  ? 444  PHE A CD1   1 
ATOM   3164  C  CD2   . PHE A 1  444  ? 454.793 -18.555 626.795 1.00 21.19  ? 444  PHE A CD2   1 
ATOM   3165  C  CE1   . PHE A 1  444  ? 454.516 -16.183 628.174 1.00 20.36  ? 444  PHE A CE1   1 
ATOM   3166  C  CE2   . PHE A 1  444  ? 455.893 -17.745 627.001 1.00 20.67  ? 444  PHE A CE2   1 
ATOM   3167  C  CZ    . PHE A 1  444  ? 455.755 -16.557 627.691 1.00 20.25  ? 444  PHE A CZ    1 
ATOM   3168  N  N     . ASN A 1  445  ? 450.581 -16.468 625.928 1.00 24.02  ? 445  ASN A N     1 
ATOM   3169  C  CA    . ASN A 1  445  ? 449.977 -15.755 624.813 1.00 23.72  ? 445  ASN A CA    1 
ATOM   3170  C  C     . ASN A 1  445  ? 450.827 -14.590 624.321 1.00 22.95  ? 445  ASN A C     1 
ATOM   3171  O  O     . ASN A 1  445  ? 451.445 -13.883 625.116 1.00 22.58  ? 445  ASN A O     1 
ATOM   3172  C  CB    . ASN A 1  445  ? 448.586 -15.257 625.216 1.00 25.03  ? 445  ASN A CB    1 
ATOM   3173  C  CG    . ASN A 1  445  ? 448.038 -14.207 624.267 1.00 24.57  ? 445  ASN A CG    1 
ATOM   3174  O  OD1   . ASN A 1  445  ? 447.790 -13.064 624.660 1.00 25.13  ? 445  ASN A OD1   1 
ATOM   3175  N  ND2   . ASN A 1  445  ? 447.853 -14.586 623.009 1.00 24.33  ? 445  ASN A ND2   1 
ATOM   3176  N  N     . ARG A 1  446  ? 450.860 -14.402 623.005 1.00 38.89  ? 446  ARG A N     1 
ATOM   3177  C  CA    . ARG A 1  446  ? 451.473 -13.219 622.417 1.00 38.80  ? 446  ARG A CA    1 
ATOM   3178  C  C     . ARG A 1  446  ? 450.525 -12.547 621.433 1.00 38.90  ? 446  ARG A C     1 
ATOM   3179  O  O     . ARG A 1  446  ? 449.897 -13.211 620.609 1.00 39.43  ? 446  ARG A O     1 
ATOM   3180  C  CB    . ARG A 1  446  ? 452.776 -13.568 621.710 1.00 36.80  ? 446  ARG A CB    1 
ATOM   3181  C  CG    . ARG A 1  446  ? 453.499 -12.348 621.180 1.00 35.83  ? 446  ARG A CG    1 
ATOM   3182  C  CD    . ARG A 1  446  ? 454.448 -12.712 620.065 1.00 36.61  ? 446  ARG A CD    1 
ATOM   3183  N  NE    . ARG A 1  446  ? 455.327 -11.602 619.704 1.00 35.62  ? 446  ARG A NE    1 
ATOM   3184  C  CZ    . ARG A 1  446  ? 455.073 -10.727 618.735 1.00 34.96  ? 446  ARG A CZ    1 
ATOM   3185  N  NH1   . ARG A 1  446  ? 453.960 -10.827 618.021 1.00 37.21  ? 446  ARG A NH1   1 
ATOM   3186  N  NH2   . ARG A 1  446  ? 455.936 -9.753  618.478 1.00 32.98  ? 446  ARG A NH2   1 
ATOM   3187  N  N     . GLN A 1  447  ? 450.429 -11.227 621.522 1.00 33.74  ? 447  GLN A N     1 
ATOM   3188  C  CA    . GLN A 1  447  ? 449.586 -10.460 620.619 1.00 33.08  ? 447  GLN A CA    1 
ATOM   3189  C  C     . GLN A 1  447  ? 450.394 -9.940  619.432 1.00 31.71  ? 447  GLN A C     1 
ATOM   3190  O  O     . GLN A 1  447  ? 451.576 -9.630  619.573 1.00 31.82  ? 447  GLN A O     1 
ATOM   3191  C  CB    . GLN A 1  447  ? 448.922 -9.306  621.370 1.00 33.67  ? 447  GLN A CB    1 
ATOM   3192  C  CG    . GLN A 1  447  ? 447.832 -9.754  622.324 1.00 33.97  ? 447  GLN A CG    1 
ATOM   3193  C  CD    . GLN A 1  447  ? 447.999 -9.180  623.715 1.00 34.74  ? 447  GLN A CD    1 
ATOM   3194  O  OE1   . GLN A 1  447  ? 449.033 -8.594  624.038 1.00 33.16  ? 447  GLN A OE1   1 
ATOM   3195  N  NE2   . GLN A 1  447  ? 446.980 -9.347  624.549 1.00 38.50  ? 447  GLN A NE2   1 
ATOM   3196  N  N     . PRO A 1  448  ? 449.762 -9.850  618.251 1.00 20.77  ? 448  PRO A N     1 
ATOM   3197  C  CA    . PRO A 1  448  ? 448.361 -10.202 617.986 1.00 21.35  ? 448  PRO A CA    1 
ATOM   3198  C  C     . PRO A 1  448  ? 448.128 -11.709 617.901 1.00 22.33  ? 448  PRO A C     1 
ATOM   3199  O  O     . PRO A 1  448  ? 448.885 -12.421 617.240 1.00 23.47  ? 448  PRO A O     1 
ATOM   3200  C  CB    . PRO A 1  448  ? 448.087 -9.535  616.638 1.00 21.37  ? 448  PRO A CB    1 
ATOM   3201  C  CG    . PRO A 1  448  ? 449.409 -9.527  615.964 1.00 20.99  ? 448  PRO A CG    1 
ATOM   3202  C  CD    . PRO A 1  448  ? 450.429 -9.318  617.050 1.00 20.52  ? 448  PRO A CD    1 
ATOM   3203  N  N     . SER A 1  449  ? 447.087 -12.181 618.579 1.00 34.44  ? 449  SER A N     1 
ATOM   3204  C  CA    . SER A 1  449  ? 446.749 -13.599 618.576 1.00 34.59  ? 449  SER A CA    1 
ATOM   3205  C  C     . SER A 1  449  ? 446.037 -13.977 617.283 1.00 35.89  ? 449  SER A C     1 
ATOM   3206  O  O     . SER A 1  449  ? 444.811 -14.073 617.242 1.00 38.57  ? 449  SER A O     1 
ATOM   3207  C  CB    . SER A 1  449  ? 445.878 -13.941 619.784 1.00 35.22  ? 449  SER A CB    1 
ATOM   3208  O  OG    . SER A 1  449  ? 446.524 -13.579 620.992 1.00 35.24  ? 449  SER A OG    1 
ATOM   3209  N  N     . LEU A 1  450  ? 446.817 -14.196 616.230 1.00 29.26  ? 450  LEU A N     1 
ATOM   3210  C  CA    . LEU A 1  450  ? 446.267 -14.412 614.897 1.00 30.20  ? 450  LEU A CA    1 
ATOM   3211  C  C     . LEU A 1  450  ? 445.677 -15.811 614.717 1.00 32.64  ? 450  LEU A C     1 
ATOM   3212  O  O     . LEU A 1  450  ? 444.645 -15.973 614.066 1.00 32.54  ? 450  LEU A O     1 
ATOM   3213  C  CB    . LEU A 1  450  ? 447.344 -14.153 613.842 1.00 28.78  ? 450  LEU A CB    1 
ATOM   3214  C  CG    . LEU A 1  450  ? 447.875 -12.716 613.830 1.00 28.10  ? 450  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A 1  450  ? 449.015 -12.554 612.835 1.00 30.11  ? 450  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A 1  450  ? 446.749 -11.737 613.525 1.00 28.24  ? 450  LEU A CD2   1 
ATOM   3217  N  N     . HIS A 1  451  ? 446.330 -16.817 615.289 1.00 28.35  ? 451  HIS A N     1 
ATOM   3218  C  CA    . HIS A 1  451  ? 445.816 -18.184 615.235 1.00 28.66  ? 451  HIS A CA    1 
ATOM   3219  C  C     . HIS A 1  451  ? 445.894 -18.860 616.602 1.00 28.88  ? 451  HIS A C     1 
ATOM   3220  O  O     . HIS A 1  451  ? 446.470 -18.312 617.540 1.00 26.88  ? 451  HIS A O     1 
ATOM   3221  C  CB    . HIS A 1  451  ? 446.566 -19.010 614.182 1.00 27.87  ? 451  HIS A CB    1 
ATOM   3222  C  CG    . HIS A 1  451  ? 448.056 -18.995 614.336 1.00 26.45  ? 451  HIS A CG    1 
ATOM   3223  N  ND1   . HIS A 1  451  ? 448.901 -19.585 613.420 1.00 27.09  ? 451  HIS A ND1   1 
ATOM   3224  C  CD2   . HIS A 1  451  ? 448.854 -18.467 615.294 1.00 27.06  ? 451  HIS A CD2   1 
ATOM   3225  C  CE1   . HIS A 1  451  ? 450.153 -19.418 613.805 1.00 26.53  ? 451  HIS A CE1   1 
ATOM   3226  N  NE2   . HIS A 1  451  ? 450.153 -18.742 614.940 1.00 26.67  ? 451  HIS A NE2   1 
ATOM   3227  N  N     . LYS A 1  452  ? 445.313 -20.053 616.706 1.00 44.59  ? 452  LYS A N     1 
ATOM   3228  C  CA    . LYS A 1  452  ? 445.182 -20.743 617.987 1.00 43.31  ? 452  LYS A CA    1 
ATOM   3229  C  C     . LYS A 1  452  ? 446.525 -21.058 618.645 1.00 42.84  ? 452  LYS A C     1 
ATOM   3230  O  O     . LYS A 1  452  ? 446.595 -21.243 619.859 1.00 43.40  ? 452  LYS A O     1 
ATOM   3231  C  CB    . LYS A 1  452  ? 444.379 -22.036 617.812 1.00 43.44  ? 452  LYS A CB    1 
ATOM   3232  C  CG    . LYS A 1  452  ? 444.899 -22.953 616.718 1.00 46.17  ? 452  LYS A CG    1 
ATOM   3233  C  CD    . LYS A 1  452  ? 445.123 -24.368 617.233 1.00 46.73  ? 452  LYS A CD    1 
ATOM   3234  C  CE    . LYS A 1  452  ? 443.824 -25.027 617.676 1.00 47.00  ? 452  LYS A CE    1 
ATOM   3235  N  NZ    . LYS A 1  452  ? 442.916 -25.314 616.530 1.00 46.55  ? 452  LYS A NZ    1 
ATOM   3236  N  N     . MET A 1  453  ? 447.589 -21.110 617.849 1.00 33.86  ? 453  MET A N     1 
ATOM   3237  C  CA    . MET A 1  453  ? 448.916 -21.402 618.381 1.00 32.81  ? 453  MET A CA    1 
ATOM   3238  C  C     . MET A 1  453  ? 449.554 -20.174 619.027 1.00 31.29  ? 453  MET A C     1 
ATOM   3239  O  O     . MET A 1  453  ? 450.688 -20.233 619.498 1.00 30.32  ? 453  MET A O     1 
ATOM   3240  C  CB    . MET A 1  453  ? 449.832 -21.947 617.283 1.00 32.22  ? 453  MET A CB    1 
ATOM   3241  C  CG    . MET A 1  453  ? 449.431 -23.317 616.762 1.00 33.32  ? 453  MET A CG    1 
ATOM   3242  S  SD    . MET A 1  453  ? 448.320 -23.234 615.346 1.00 36.64  ? 453  MET A SD    1 
ATOM   3243  C  CE    . MET A 1  453  ? 449.463 -22.786 614.043 1.00 32.45  ? 453  MET A CE    1 
ATOM   3244  N  N     . SER A 1  454  ? 448.825 -19.063 619.042 1.00 37.12  ? 454  SER A N     1 
ATOM   3245  C  CA    . SER A 1  454  ? 449.283 -17.865 619.735 1.00 35.48  ? 454  SER A CA    1 
ATOM   3246  C  C     . SER A 1  454  ? 448.959 -17.966 621.220 1.00 36.26  ? 454  SER A C     1 
ATOM   3247  O  O     . SER A 1  454  ? 449.540 -17.260 622.042 1.00 36.01  ? 454  SER A O     1 
ATOM   3248  C  CB    . SER A 1  454  ? 448.650 -16.610 619.136 1.00 35.64  ? 454  SER A CB    1 
ATOM   3249  O  OG    . SER A 1  454  ? 449.082 -16.407 617.802 1.00 34.70  ? 454  SER A OG    1 
ATOM   3250  N  N     . MET A 1  455  ? 448.020 -18.845 621.557 1.00 27.11  ? 455  MET A N     1 
ATOM   3251  C  CA    . MET A 1  455  ? 447.720 -19.146 622.950 1.00 27.26  ? 455  MET A CA    1 
ATOM   3252  C  C     . MET A 1  455  ? 447.907 -20.629 623.213 1.00 29.32  ? 455  MET A C     1 
ATOM   3253  O  O     . MET A 1  455  ? 447.120 -21.452 622.748 1.00 30.14  ? 455  MET A O     1 
ATOM   3254  C  CB    . MET A 1  455  ? 446.299 -18.728 623.314 1.00 26.95  ? 455  MET A CB    1 
ATOM   3255  C  CG    . MET A 1  455  ? 446.012 -17.262 623.112 1.00 28.55  ? 455  MET A CG    1 
ATOM   3256  S  SD    . MET A 1  455  ? 444.496 -16.766 623.945 1.00 31.65  ? 455  MET A SD    1 
ATOM   3257  C  CE    . MET A 1  455  ? 445.142 -16.084 625.469 1.00 27.97  ? 455  MET A CE    1 
ATOM   3258  N  N     . MET A 1  456  ? 448.953 -20.973 623.957 1.00 24.99  ? 456  MET A N     1 
ATOM   3259  C  CA    . MET A 1  456  ? 449.236 -22.375 624.241 1.00 24.74  ? 456  MET A CA    1 
ATOM   3260  C  C     . MET A 1  456  ? 449.557 -22.598 625.713 1.00 25.73  ? 456  MET A C     1 
ATOM   3261  O  O     . MET A 1  456  ? 450.178 -21.757 626.358 1.00 25.66  ? 456  MET A O     1 
ATOM   3262  C  CB    . MET A 1  456  ? 450.389 -22.876 623.368 1.00 23.63  ? 456  MET A CB    1 
ATOM   3263  C  CG    . MET A 1  456  ? 450.079 -22.871 621.882 1.00 23.91  ? 456  MET A CG    1 
ATOM   3264  S  SD    . MET A 1  456  ? 451.367 -23.632 620.881 1.00 25.16  ? 456  MET A SD    1 
ATOM   3265  C  CE    . MET A 1  456  ? 452.763 -22.583 621.256 1.00 22.49  ? 456  MET A CE    1 
ATOM   3266  N  N     . ALA A 1  457  ? 449.127 -23.740 626.238 1.00 17.54  ? 457  ALA A N     1 
ATOM   3267  C  CA    . ALA A 1  457  ? 449.363 -24.066 627.636 1.00 17.80  ? 457  ALA A CA    1 
ATOM   3268  C  C     . ALA A 1  457  ? 450.789 -24.558 627.849 1.00 17.70  ? 457  ALA A C     1 
ATOM   3269  O  O     . ALA A 1  457  ? 451.228 -25.514 627.212 1.00 18.08  ? 457  ALA A O     1 
ATOM   3270  C  CB    . ALA A 1  457  ? 448.367 -25.106 628.111 1.00 18.77  ? 457  ALA A CB    1 
ATOM   3271  N  N     . HIS A 1  458  ? 451.506 -23.891 628.745 1.00 33.71  ? 458  HIS A N     1 
ATOM   3272  C  CA    . HIS A 1  458  ? 452.855 -24.286 629.114 1.00 33.15  ? 458  HIS A CA    1 
ATOM   3273  C  C     . HIS A 1  458  ? 452.911 -24.765 630.560 1.00 33.82  ? 458  HIS A C     1 
ATOM   3274  O  O     . HIS A 1  458  ? 452.036 -24.443 631.374 1.00 34.09  ? 458  HIS A O     1 
ATOM   3275  C  CB    . HIS A 1  458  ? 453.832 -23.124 628.928 1.00 31.96  ? 458  HIS A CB    1 
ATOM   3276  C  CG    . HIS A 1  458  ? 454.064 -22.742 627.500 1.00 30.28  ? 458  HIS A CG    1 
ATOM   3277  N  ND1   . HIS A 1  458  ? 455.314 -22.765 626.920 1.00 29.75  ? 458  HIS A ND1   1 
ATOM   3278  C  CD2   . HIS A 1  458  ? 453.212 -22.314 626.540 1.00 30.11  ? 458  HIS A CD2   1 
ATOM   3279  C  CE1   . HIS A 1  458  ? 455.221 -22.373 625.662 1.00 29.13  ? 458  HIS A CE1   1 
ATOM   3280  N  NE2   . HIS A 1  458  ? 453.956 -22.092 625.407 1.00 29.53  ? 458  HIS A NE2   1 
ATOM   3281  N  N     . ARG A 1  459  ? 453.951 -25.535 630.863 1.00 21.29  ? 459  ARG A N     1 
ATOM   3282  C  CA    . ARG A 1  459  ? 454.249 -25.961 632.223 1.00 21.76  ? 459  ARG A CA    1 
ATOM   3283  C  C     . ARG A 1  459  ? 455.139 -24.928 632.904 1.00 21.13  ? 459  ARG A C     1 
ATOM   3284  O  O     . ARG A 1  459  ? 456.184 -24.552 632.372 1.00 20.65  ? 459  ARG A O     1 
ATOM   3285  C  CB    . ARG A 1  459  ? 454.929 -27.331 632.219 1.00 22.50  ? 459  ARG A CB    1 
ATOM   3286  C  CG    . ARG A 1  459  ? 454.003 -28.489 631.887 1.00 23.34  ? 459  ARG A CG    1 
ATOM   3287  C  CD    . ARG A 1  459  ? 454.783 -29.720 631.441 1.00 23.97  ? 459  ARG A CD    1 
ATOM   3288  N  NE    . ARG A 1  459  ? 455.987 -29.939 632.238 1.00 24.12  ? 459  ARG A NE    1 
ATOM   3289  C  CZ    . ARG A 1  459  ? 457.212 -30.038 631.729 1.00 23.97  ? 459  ARG A CZ    1 
ATOM   3290  N  NH1   . ARG A 1  459  ? 457.397 -29.945 630.420 1.00 23.68  ? 459  ARG A NH1   1 
ATOM   3291  N  NH2   . ARG A 1  459  ? 458.253 -30.234 632.527 1.00 24.20  ? 459  ARG A NH2   1 
ATOM   3292  N  N     . VAL A 1  460  ? 454.725 -24.468 634.079 1.00 24.05  ? 460  VAL A N     1 
ATOM   3293  C  CA    . VAL A 1  460  ? 455.479 -23.456 634.809 1.00 23.53  ? 460  VAL A CA    1 
ATOM   3294  C  C     . VAL A 1  460  ? 456.823 -23.976 635.305 1.00 23.81  ? 460  VAL A C     1 
ATOM   3295  O  O     . VAL A 1  460  ? 456.908 -25.068 635.864 1.00 27.20  ? 460  VAL A O     1 
ATOM   3296  C  CB    . VAL A 1  460  ? 454.683 -22.932 636.023 1.00 23.72  ? 460  VAL A CB    1 
ATOM   3297  C  CG1   . VAL A 1  460  ? 455.576 -22.099 636.930 1.00 23.39  ? 460  VAL A CG1   1 
ATOM   3298  C  CG2   . VAL A 1  460  ? 453.486 -22.128 635.567 1.00 23.40  ? 460  VAL A CG2   1 
ATOM   3299  N  N     . LYS A 1  461  ? 457.875 -23.195 635.083 1.00 36.23  ? 461  LYS A N     1 
ATOM   3300  C  CA    . LYS A 1  461  ? 459.138 -23.417 635.771 1.00 37.09  ? 461  LYS A CA    1 
ATOM   3301  C  C     . LYS A 1  461  ? 459.620 -22.104 636.369 1.00 35.61  ? 461  LYS A C     1 
ATOM   3302  O  O     . LYS A 1  461  ? 460.113 -21.231 635.655 1.00 36.65  ? 461  LYS A O     1 
ATOM   3303  C  CB    . LYS A 1  461  ? 460.197 -23.995 634.833 1.00 35.08  ? 461  LYS A CB    1 
ATOM   3304  C  CG    . LYS A 1  461  ? 461.521 -24.270 635.529 1.00 36.40  ? 461  LYS A CG    1 
ATOM   3305  C  CD    . LYS A 1  461  ? 462.566 -24.819 634.573 1.00 40.72  ? 461  LYS A CD    1 
ATOM   3306  C  CE    . LYS A 1  461  ? 463.916 -24.981 635.263 1.00 41.78  ? 461  LYS A CE    1 
ATOM   3307  N  NZ    . LYS A 1  461  ? 464.979 -25.441 634.322 1.00 42.48  ? 461  LYS A NZ    1 
ATOM   3308  N  N     . VAL A 1  462  ? 459.461 -21.964 637.681 1.00 30.75  ? 462  VAL A N     1 
ATOM   3309  C  CA    . VAL A 1  462  ? 459.862 -20.746 638.375 1.00 30.31  ? 462  VAL A CA    1 
ATOM   3310  C  C     . VAL A 1  462  ? 461.370 -20.549 638.304 1.00 30.14  ? 462  VAL A C     1 
ATOM   3311  O  O     . VAL A 1  462  ? 462.141 -21.413 638.720 1.00 30.72  ? 462  VAL A O     1 
ATOM   3312  C  CB    . VAL A 1  462  ? 459.422 -20.764 639.847 1.00 30.86  ? 462  VAL A CB    1 
ATOM   3313  C  CG1   . VAL A 1  462  ? 459.854 -19.482 640.540 1.00 30.99  ? 462  VAL A CG1   1 
ATOM   3314  C  CG2   . VAL A 1  462  ? 457.916 -20.943 639.943 1.00 31.12  ? 462  VAL A CG2   1 
ATOM   3315  N  N     . ILE A 1  463  ? 461.783 -19.405 637.769 1.00 21.37  ? 463  ILE A N     1 
ATOM   3316  C  CA    . ILE A 1  463  ? 463.197 -19.107 637.582 1.00 21.19  ? 463  ILE A CA    1 
ATOM   3317  C  C     . ILE A 1  463  ? 463.533 -17.703 638.081 1.00 20.69  ? 463  ILE A C     1 
ATOM   3318  O  O     . ILE A 1  463  ? 462.654 -16.844 638.155 1.00 20.31  ? 463  ILE A O     1 
ATOM   3319  C  CB    . ILE A 1  463  ? 463.603 -19.249 636.094 1.00 20.85  ? 463  ILE A CB    1 
ATOM   3320  C  CG1   . ILE A 1  463  ? 462.506 -18.704 635.177 1.00 20.30  ? 463  ILE A CG1   1 
ATOM   3321  C  CG2   . ILE A 1  463  ? 463.874 -20.705 635.758 1.00 21.52  ? 463  ILE A CG2   1 
ATOM   3322  C  CD1   . ILE A 1  463  ? 462.602 -17.220 634.891 1.00 19.54  ? 463  ILE A CD1   1 
ATOM   3323  N  N     . PRO A 1  464  ? 464.808 -17.468 638.436 1.00 22.41  ? 464  PRO A N     1 
ATOM   3324  C  CA    . PRO A 1  464  ? 465.241 -16.122 638.825 1.00 21.98  ? 464  PRO A CA    1 
ATOM   3325  C  C     . PRO A 1  464  ? 465.206 -15.142 637.653 1.00 21.19  ? 464  PRO A C     1 
ATOM   3326  O  O     . PRO A 1  464  ? 464.910 -15.552 636.530 1.00 21.01  ? 464  PRO A O     1 
ATOM   3327  C  CB    . PRO A 1  464  ? 466.676 -16.343 639.312 1.00 22.37  ? 464  PRO A CB    1 
ATOM   3328  C  CG    . PRO A 1  464  ? 467.118 -17.590 638.629 1.00 22.77  ? 464  PRO A CG    1 
ATOM   3329  C  CD    . PRO A 1  464  ? 465.896 -18.452 638.566 1.00 23.01  ? 464  PRO A CD    1 
ATOM   3330  N  N     . TYR A 1  465  ? 465.501 -13.872 637.928 1.00 26.86  ? 465  TYR A N     1 
ATOM   3331  C  CA    . TYR A 1  465  ? 465.479 -12.795 636.933 1.00 26.44  ? 465  TYR A CA    1 
ATOM   3332  C  C     . TYR A 1  465  ? 464.061 -12.524 636.415 1.00 26.83  ? 465  TYR A C     1 
ATOM   3333  O  O     . TYR A 1  465  ? 463.157 -13.341 636.582 1.00 26.95  ? 465  TYR A O     1 
ATOM   3334  C  CB    . TYR A 1  465  ? 466.431 -13.108 635.776 1.00 26.08  ? 465  TYR A CB    1 
ATOM   3335  C  CG    . TYR A 1  465  ? 467.827 -13.451 636.241 1.00 26.46  ? 465  TYR A CG    1 
ATOM   3336  C  CD1   . TYR A 1  465  ? 468.706 -12.457 636.653 1.00 26.34  ? 465  TYR A CD1   1 
ATOM   3337  C  CD2   . TYR A 1  465  ? 468.265 -14.768 636.276 1.00 27.07  ? 465  TYR A CD2   1 
ATOM   3338  C  CE1   . TYR A 1  465  ? 469.983 -12.765 637.084 1.00 26.81  ? 465  TYR A CE1   1 
ATOM   3339  C  CE2   . TYR A 1  465  ? 469.540 -15.086 636.704 1.00 27.54  ? 465  TYR A CE2   1 
ATOM   3340  C  CZ    . TYR A 1  465  ? 470.395 -14.080 637.107 1.00 27.42  ? 465  TYR A CZ    1 
ATOM   3341  O  OH    . TYR A 1  465  ? 471.666 -14.391 637.533 1.00 27.96  ? 465  TYR A OH    1 
ATOM   3342  N  N     . SER A 1  466  ? 463.871 -11.364 635.794 1.00 39.67  ? 466  SER A N     1 
ATOM   3343  C  CA    . SER A 1  466  ? 462.528 -10.869 635.506 1.00 38.97  ? 466  SER A CA    1 
ATOM   3344  C  C     . SER A 1  466  ? 462.101 -11.016 634.048 1.00 36.95  ? 466  SER A C     1 
ATOM   3345  O  O     . SER A 1  466  ? 461.625 -10.056 633.445 1.00 37.14  ? 466  SER A O     1 
ATOM   3346  C  CB    . SER A 1  466  ? 462.427 -9.395  635.907 1.00 37.22  ? 466  SER A CB    1 
ATOM   3347  O  OG    . SER A 1  466  ? 462.912 -9.187  637.222 1.00 37.96  ? 466  SER A OG    1 
ATOM   3348  N  N     . THR A 1  467  ? 462.260 -12.208 633.482 1.00 27.95  ? 467  THR A N     1 
ATOM   3349  C  CA    . THR A 1  467  ? 461.833 -12.451 632.106 1.00 27.66  ? 467  THR A CA    1 
ATOM   3350  C  C     . THR A 1  467  ? 461.076 -13.764 631.954 1.00 29.20  ? 467  THR A C     1 
ATOM   3351  O  O     . THR A 1  467  ? 461.432 -14.773 632.564 1.00 29.91  ? 467  THR A O     1 
ATOM   3352  C  CB    . THR A 1  467  ? 463.028 -12.472 631.121 1.00 24.95  ? 467  THR A CB    1 
ATOM   3353  O  OG1   . THR A 1  467  ? 464.035 -13.375 631.596 1.00 27.89  ? 467  THR A OG1   1 
ATOM   3354  C  CG2   . THR A 1  467  ? 463.628 -11.089 630.966 1.00 22.94  ? 467  THR A CG2   1 
ATOM   3355  N  N     . PHE A 1  468  ? 460.025 -13.739 631.142 1.00 18.34  ? 468  PHE A N     1 
ATOM   3356  C  CA    . PHE A 1  468  ? 459.370 -14.962 630.705 1.00 18.77  ? 468  PHE A CA    1 
ATOM   3357  C  C     . PHE A 1  468  ? 460.319 -15.729 629.796 1.00 18.89  ? 468  PHE A C     1 
ATOM   3358  O  O     . PHE A 1  468  ? 460.630 -15.281 628.694 1.00 18.54  ? 468  PHE A O     1 
ATOM   3359  C  CB    . PHE A 1  468  ? 458.063 -14.659 629.969 1.00 18.64  ? 468  PHE A CB    1 
ATOM   3360  C  CG    . PHE A 1  468  ? 456.902 -14.375 630.878 1.00 18.83  ? 468  PHE A CG    1 
ATOM   3361  C  CD1   . PHE A 1  468  ? 456.794 -15.005 632.105 1.00 19.33  ? 468  PHE A CD1   1 
ATOM   3362  C  CD2   . PHE A 1  468  ? 455.915 -13.480 630.500 1.00 18.59  ? 468  PHE A CD2   1 
ATOM   3363  C  CE1   . PHE A 1  468  ? 455.723 -14.746 632.939 1.00 19.58  ? 468  PHE A CE1   1 
ATOM   3364  C  CE2   . PHE A 1  468  ? 454.842 -13.215 631.330 1.00 18.85  ? 468  PHE A CE2   1 
ATOM   3365  C  CZ    . PHE A 1  468  ? 454.745 -13.849 632.551 1.00 19.35  ? 468  PHE A CZ    1 
ATOM   3366  N  N     . ARG A 1  469  ? 460.793 -16.878 630.257 1.00 19.23  ? 469  ARG A N     1 
ATOM   3367  C  CA    . ARG A 1  469  ? 461.739 -17.653 629.468 1.00 19.46  ? 469  ARG A CA    1 
ATOM   3368  C  C     . ARG A 1  469  ? 461.026 -18.761 628.711 1.00 19.89  ? 469  ARG A C     1 
ATOM   3369  O  O     . ARG A 1  469  ? 460.260 -19.527 629.293 1.00 20.35  ? 469  ARG A O     1 
ATOM   3370  C  CB    . ARG A 1  469  ? 462.835 -18.233 630.360 1.00 19.89  ? 469  ARG A CB    1 
ATOM   3371  C  CG    . ARG A 1  469  ? 463.513 -17.195 631.231 1.00 19.58  ? 469  ARG A CG    1 
ATOM   3372  C  CD    . ARG A 1  469  ? 464.894 -17.644 631.650 1.00 19.96  ? 469  ARG A CD    1 
ATOM   3373  N  NE    . ARG A 1  469  ? 465.886 -16.615 631.365 1.00 19.54  ? 469  ARG A NE    1 
ATOM   3374  C  CZ    . ARG A 1  469  ? 466.529 -16.504 630.209 1.00 19.40  ? 469  ARG A CZ    1 
ATOM   3375  N  NH1   . ARG A 1  469  ? 466.285 -17.364 629.230 1.00 19.63  ? 469  ARG A NH1   1 
ATOM   3376  N  NH2   . ARG A 1  469  ? 467.416 -15.535 630.031 1.00 19.07  ? 469  ARG A NH2   1 
ATOM   3377  N  N     . LEU A 1  470  ? 461.270 -18.842 627.408 1.00 17.67  ? 470  LEU A N     1 
ATOM   3378  C  CA    . LEU A 1  470  ? 460.624 -19.867 626.597 1.00 18.11  ? 470  LEU A CA    1 
ATOM   3379  C  C     . LEU A 1  470  ? 461.619 -20.597 625.702 1.00 18.45  ? 470  LEU A C     1 
ATOM   3380  O  O     . LEU A 1  470  ? 462.709 -20.096 625.434 1.00 18.22  ? 470  LEU A O     1 
ATOM   3381  C  CB    . LEU A 1  470  ? 459.499 -19.251 625.759 1.00 17.76  ? 470  LEU A CB    1 
ATOM   3382  C  CG    . LEU A 1  470  ? 459.795 -17.998 624.931 1.00 17.11  ? 470  LEU A CG    1 
ATOM   3383  C  CD1   . LEU A 1  470  ? 460.344 -18.358 623.560 1.00 17.23  ? 470  LEU A CD1   1 
ATOM   3384  C  CD2   . LEU A 1  470  ? 458.547 -17.140 624.798 1.00 16.77  ? 470  LEU A CD2   1 
ATOM   3385  N  N     . ASN A 1  471  ? 461.232 -21.785 625.250 1.00 24.63  ? 471  ASN A N     1 
ATOM   3386  C  CA    . ASN A 1  471  ? 462.059 -22.577 624.350 1.00 25.09  ? 471  ASN A CA    1 
ATOM   3387  C  C     . ASN A 1  471  ? 462.128 -21.933 622.971 1.00 24.72  ? 471  ASN A C     1 
ATOM   3388  O  O     . ASN A 1  471  ? 461.161 -21.329 622.517 1.00 25.04  ? 471  ASN A O     1 
ATOM   3389  C  CB    . ASN A 1  471  ? 461.515 -24.004 624.245 1.00 25.90  ? 471  ASN A CB    1 
ATOM   3390  C  CG    . ASN A 1  471  ? 462.378 -24.896 623.377 1.00 26.50  ? 471  ASN A CG    1 
ATOM   3391  O  OD1   . ASN A 1  471  ? 462.270 -24.880 622.152 1.00 27.01  ? 471  ASN A OD1   1 
ATOM   3392  N  ND2   . ASN A 1  471  ? 463.236 -25.689 624.011 1.00 27.07  ? 471  ASN A ND2   1 
ATOM   3393  N  N     . LEU A 1  472  ? 463.271 -22.061 622.309 1.00 37.00  ? 472  LEU A N     1 
ATOM   3394  C  CA    . LEU A 1  472  ? 463.466 -21.441 621.003 1.00 36.22  ? 472  LEU A CA    1 
ATOM   3395  C  C     . LEU A 1  472  ? 462.488 -21.969 619.961 1.00 38.13  ? 472  LEU A C     1 
ATOM   3396  O  O     . LEU A 1  472  ? 461.952 -21.209 619.161 1.00 37.86  ? 472  LEU A O     1 
ATOM   3397  C  CB    . LEU A 1  472  ? 464.897 -21.664 620.525 1.00 38.17  ? 472  LEU A CB    1 
ATOM   3398  C  CG    . LEU A 1  472  ? 465.978 -21.099 621.444 1.00 39.79  ? 472  LEU A CG    1 
ATOM   3399  C  CD1   . LEU A 1  472  ? 467.228 -21.970 621.391 1.00 40.75  ? 472  LEU A CD1   1 
ATOM   3400  C  CD2   . LEU A 1  472  ? 466.288 -19.663 621.058 1.00 36.30  ? 472  LEU A CD2   1 
ATOM   3401  N  N     . SER A 1  473  ? 462.246 -23.274 619.983 1.00 28.93  ? 473  SER A N     1 
ATOM   3402  C  CA    . SER A 1  473  ? 461.415 -23.907 618.967 1.00 28.02  ? 473  SER A CA    1 
ATOM   3403  C  C     . SER A 1  473  ? 459.931 -23.576 619.117 1.00 27.71  ? 473  SER A C     1 
ATOM   3404  O  O     . SER A 1  473  ? 459.108 -24.033 618.325 1.00 28.99  ? 473  SER A O     1 
ATOM   3405  C  CB    . SER A 1  473  ? 461.615 -25.420 618.997 1.00 29.14  ? 473  SER A CB    1 
ATOM   3406  O  OG    . SER A 1  473  ? 462.941 -25.760 618.626 1.00 30.01  ? 473  SER A OG    1 
ATOM   3407  N  N     . VAL A 1  474  ? 459.592 -22.784 620.129 1.00 21.76  ? 474  VAL A N     1 
ATOM   3408  C  CA    . VAL A 1  474  ? 458.214 -22.349 620.318 1.00 21.53  ? 474  VAL A CA    1 
ATOM   3409  C  C     . VAL A 1  474  ? 458.054 -20.925 619.779 1.00 20.79  ? 474  VAL A C     1 
ATOM   3410  O  O     . VAL A 1  474  ? 456.958 -20.361 619.779 1.00 20.57  ? 474  VAL A O     1 
ATOM   3411  C  CB    . VAL A 1  474  ? 457.791 -22.430 621.807 1.00 21.54  ? 474  VAL A CB    1 
ATOM   3412  C  CG1   . VAL A 1  474  ? 458.070 -21.123 622.535 1.00 20.79  ? 474  VAL A CG1   1 
ATOM   3413  C  CG2   . VAL A 1  474  ? 456.326 -22.799 621.920 1.00 21.86  ? 474  VAL A CG2   1 
ATOM   3414  N  N     . THR A 1  475  ? 459.158 -20.364 619.292 1.00 31.84  ? 475  THR A N     1 
ATOM   3415  C  CA    . THR A 1  475  ? 459.168 -19.018 618.722 1.00 29.97  ? 475  THR A CA    1 
ATOM   3416  C  C     . THR A 1  475  ? 458.246 -18.881 617.508 1.00 31.06  ? 475  THR A C     1 
ATOM   3417  O  O     . THR A 1  475  ? 457.479 -17.921 617.410 1.00 30.87  ? 475  THR A O     1 
ATOM   3418  C  CB    . THR A 1  475  ? 460.604 -18.604 618.319 1.00 30.02  ? 475  THR A CB    1 
ATOM   3419  O  OG1   . THR A 1  475  ? 461.270 -18.032 619.452 1.00 28.78  ? 475  THR A OG1   1 
ATOM   3420  C  CG2   . THR A 1  475  ? 460.598 -17.598 617.177 1.00 30.20  ? 475  THR A CG2   1 
ATOM   3421  N  N     . SER A 1  476  ? 458.313 -19.847 616.597 1.00 48.87  ? 476  SER A N     1 
ATOM   3422  C  CA    . SER A 1  476  ? 457.597 -19.760 615.324 1.00 48.13  ? 476  SER A CA    1 
ATOM   3423  C  C     . SER A 1  476  ? 456.070 -19.619 615.446 1.00 47.71  ? 476  SER A C     1 
ATOM   3424  O  O     . SER A 1  476  ? 455.495 -18.732 614.817 1.00 48.19  ? 476  SER A O     1 
ATOM   3425  C  CB    . SER A 1  476  ? 457.933 -20.973 614.450 1.00 50.73  ? 476  SER A CB    1 
ATOM   3426  O  OG    . SER A 1  476  ? 459.327 -21.052 614.207 1.00 51.98  ? 476  SER A OG    1 
ATOM   3427  N  N     . PRO A 1  477  ? 455.403 -20.483 616.241 1.00 19.68  ? 477  PRO A N     1 
ATOM   3428  C  CA    . PRO A 1  477  ? 453.944 -20.319 616.297 1.00 19.79  ? 477  PRO A CA    1 
ATOM   3429  C  C     . PRO A 1  477  ? 453.509 -19.016 616.963 1.00 19.13  ? 477  PRO A C     1 
ATOM   3430  O  O     . PRO A 1  477  ? 452.479 -18.460 616.584 1.00 19.11  ? 477  PRO A O     1 
ATOM   3431  C  CB    . PRO A 1  477  ? 453.485 -21.529 617.116 1.00 20.40  ? 477  PRO A CB    1 
ATOM   3432  C  CG    . PRO A 1  477  ? 454.669 -21.914 617.922 1.00 20.34  ? 477  PRO A CG    1 
ATOM   3433  C  CD    . PRO A 1  477  ? 455.849 -21.637 617.046 1.00 20.14  ? 477  PRO A CD    1 
ATOM   3434  N  N     . TYR A 1  478  ? 454.280 -18.537 617.935 1.00 21.45  ? 478  TYR A N     1 
ATOM   3435  C  CA    . TYR A 1  478  ? 453.985 -17.263 618.582 1.00 20.86  ? 478  TYR A CA    1 
ATOM   3436  C  C     . TYR A 1  478  ? 454.401 -16.085 617.709 1.00 20.35  ? 478  TYR A C     1 
ATOM   3437  O  O     . TYR A 1  478  ? 453.882 -14.980 617.867 1.00 19.98  ? 478  TYR A O     1 
ATOM   3438  C  CB    . TYR A 1  478  ? 454.693 -17.155 619.934 1.00 20.61  ? 478  TYR A CB    1 
ATOM   3439  C  CG    . TYR A 1  478  ? 454.129 -18.032 621.029 1.00 21.05  ? 478  TYR A CG    1 
ATOM   3440  C  CD1   . TYR A 1  478  ? 452.854 -17.815 621.535 1.00 21.19  ? 478  TYR A CD1   1 
ATOM   3441  C  CD2   . TYR A 1  478  ? 454.886 -19.059 621.579 1.00 21.40  ? 478  TYR A CD2   1 
ATOM   3442  C  CE1   . TYR A 1  478  ? 452.340 -18.611 622.544 1.00 21.67  ? 478  TYR A CE1   1 
ATOM   3443  C  CE2   . TYR A 1  478  ? 454.384 -19.857 622.588 1.00 21.86  ? 478  TYR A CE2   1 
ATOM   3444  C  CZ    . TYR A 1  478  ? 453.110 -19.631 623.066 1.00 21.99  ? 478  TYR A CZ    1 
ATOM   3445  O  OH    . TYR A 1  478  ? 452.608 -20.428 624.069 1.00 22.61  ? 478  TYR A OH    1 
ATOM   3446  N  N     . ASN A 1  479  ? 455.335 -16.333 616.792 1.00 41.72  ? 479  ASN A N     1 
ATOM   3447  C  CA    . ASN A 1  479  ? 455.980 -15.277 616.013 1.00 40.16  ? 479  ASN A CA    1 
ATOM   3448  C  C     . ASN A 1  479  ? 456.579 -14.227 616.938 1.00 38.66  ? 479  ASN A C     1 
ATOM   3449  O  O     . ASN A 1  479  ? 456.055 -13.120 617.060 1.00 38.16  ? 479  ASN A O     1 
ATOM   3450  C  CB    . ASN A 1  479  ? 454.994 -14.628 615.036 1.00 40.60  ? 479  ASN A CB    1 
ATOM   3451  C  CG    . ASN A 1  479  ? 455.651 -13.580 614.153 1.00 38.49  ? 479  ASN A CG    1 
ATOM   3452  O  OD1   . ASN A 1  479  ? 456.847 -13.653 613.866 1.00 35.90  ? 479  ASN A OD1   1 
ATOM   3453  N  ND2   . ASN A 1  479  ? 454.871 -12.596 613.723 1.00 41.65  ? 479  ASN A ND2   1 
ATOM   3454  N  N     . ALA A 1  480  ? 457.677 -14.585 617.596 1.00 22.10  ? 480  ALA A N     1 
ATOM   3455  C  CA    . ALA A 1  480  ? 458.279 -13.708 618.591 1.00 20.94  ? 480  ALA A CA    1 
ATOM   3456  C  C     . ALA A 1  480  ? 459.791 -13.840 618.656 1.00 21.22  ? 480  ALA A C     1 
ATOM   3457  O  O     . ALA A 1  480  ? 460.321 -14.936 618.812 1.00 23.73  ? 480  ALA A O     1 
ATOM   3458  C  CB    . ALA A 1  480  ? 457.690 -13.988 619.952 1.00 19.62  ? 480  ALA A CB    1 
ATOM   3459  N  N     . ASP A 1  481  ? 460.482 -12.713 618.542 1.00 37.83  ? 481  ASP A N     1 
ATOM   3460  C  CA    . ASP A 1  481  ? 461.906 -12.669 618.832 1.00 36.23  ? 481  ASP A CA    1 
ATOM   3461  C  C     . ASP A 1  481  ? 462.087 -12.183 620.265 1.00 35.71  ? 481  ASP A C     1 
ATOM   3462  O  O     . ASP A 1  481  ? 461.128 -12.145 621.036 1.00 34.32  ? 481  ASP A O     1 
ATOM   3463  C  CB    . ASP A 1  481  ? 462.641 -11.767 617.840 1.00 37.99  ? 481  ASP A CB    1 
ATOM   3464  C  CG    . ASP A 1  481  ? 461.787 -10.615 617.359 1.00 38.15  ? 481  ASP A CG    1 
ATOM   3465  O  OD1   . ASP A 1  481  ? 460.822 -10.258 618.065 1.00 35.13  ? 481  ASP A OD1   1 
ATOM   3466  O  OD2   . ASP A 1  481  ? 462.080 -10.067 616.274 1.00 38.71  ? 481  ASP A OD2   1 
ATOM   3467  N  N     . PHE A 1  482  ? 463.310 -11.815 620.626 1.00 28.50  ? 482  PHE A N     1 
ATOM   3468  C  CA    . PHE A 1  482  ? 463.584 -11.361 621.984 1.00 26.20  ? 482  PHE A CA    1 
ATOM   3469  C  C     . PHE A 1  482  ? 464.244 -9.989  621.983 1.00 26.63  ? 482  PHE A C     1 
ATOM   3470  O  O     . PHE A 1  482  ? 465.152 -9.724  622.769 1.00 27.52  ? 482  PHE A O     1 
ATOM   3471  C  CB    . PHE A 1  482  ? 464.461 -12.375 622.713 1.00 26.70  ? 482  PHE A CB    1 
ATOM   3472  C  CG    . PHE A 1  482  ? 463.972 -13.787 622.591 1.00 26.69  ? 482  PHE A CG    1 
ATOM   3473  C  CD1   . PHE A 1  482  ? 462.713 -14.136 623.049 1.00 27.15  ? 482  PHE A CD1   1 
ATOM   3474  C  CD2   . PHE A 1  482  ? 464.767 -14.763 622.018 1.00 29.33  ? 482  PHE A CD2   1 
ATOM   3475  C  CE1   . PHE A 1  482  ? 462.256 -15.434 622.938 1.00 28.54  ? 482  PHE A CE1   1 
ATOM   3476  C  CE2   . PHE A 1  482  ? 464.316 -16.063 621.903 1.00 28.70  ? 482  PHE A CE2   1 
ATOM   3477  C  CZ    . PHE A 1  482  ? 463.058 -16.399 622.364 1.00 27.17  ? 482  PHE A CZ    1 
ATOM   3478  N  N     . ASP A 1  483  ? 463.779 -9.118  621.095 1.00 21.02  ? 483  ASP A N     1 
ATOM   3479  C  CA    . ASP A 1  483  ? 464.309 -7.764  621.004 1.00 21.01  ? 483  ASP A CA    1 
ATOM   3480  C  C     . ASP A 1  483  ? 463.378 -6.771  621.687 1.00 20.74  ? 483  ASP A C     1 
ATOM   3481  O  O     . ASP A 1  483  ? 463.214 -5.644  621.226 1.00 20.68  ? 483  ASP A O     1 
ATOM   3482  C  CB    . ASP A 1  483  ? 464.531 -7.367  619.542 1.00 21.11  ? 483  ASP A CB    1 
ATOM   3483  C  CG    . ASP A 1  483  ? 463.255 -7.413  618.721 1.00 20.91  ? 483  ASP A CG    1 
ATOM   3484  O  OD1   . ASP A 1  483  ? 462.288 -8.069  619.158 1.00 21.21  ? 483  ASP A OD1   1 
ATOM   3485  O  OD2   . ASP A 1  483  ? 463.223 -6.799  617.633 1.00 20.93  ? 483  ASP A OD2   1 
ATOM   3486  N  N     . GLY A 1  484  ? 462.767 -7.201  622.785 1.00 23.52  ? 484  GLY A N     1 
ATOM   3487  C  CA    . GLY A 1  484  ? 461.874 -6.346  623.542 1.00 23.81  ? 484  GLY A CA    1 
ATOM   3488  C  C     . GLY A 1  484  ? 460.441 -6.836  623.532 1.00 24.94  ? 484  GLY A C     1 
ATOM   3489  O  O     . GLY A 1  484  ? 459.553 -6.185  624.084 1.00 28.58  ? 484  GLY A O     1 
ATOM   3490  N  N     . ASP A 1  485  ? 460.214 -7.983  622.899 1.00 24.10  ? 485  ASP A N     1 
ATOM   3491  C  CA    . ASP A 1  485  ? 458.884 -8.578  622.845 1.00 23.33  ? 485  ASP A CA    1 
ATOM   3492  C  C     . ASP A 1  485  ? 458.379 -8.909  624.242 1.00 24.79  ? 485  ASP A C     1 
ATOM   3493  O  O     . ASP A 1  485  ? 459.139 -9.368  625.095 1.00 25.64  ? 485  ASP A O     1 
ATOM   3494  C  CB    . ASP A 1  485  ? 458.887 -9.842  621.981 1.00 24.73  ? 485  ASP A CB    1 
ATOM   3495  C  CG    . ASP A 1  485  ? 459.065 -9.542  620.505 1.00 24.48  ? 485  ASP A CG    1 
ATOM   3496  O  OD1   . ASP A 1  485  ? 459.795 -8.584  620.177 1.00 25.71  ? 485  ASP A OD1   1 
ATOM   3497  O  OD2   . ASP A 1  485  ? 458.471 -10.259 619.670 1.00 24.32  ? 485  ASP A OD2   1 
ATOM   3498  N  N     . GLU A 1  486  ? 457.095 -8.667  624.473 1.00 28.67  ? 486  GLU A N     1 
ATOM   3499  C  CA    . GLU A 1  486  ? 456.476 -8.999  625.747 1.00 29.18  ? 486  GLU A CA    1 
ATOM   3500  C  C     . GLU A 1  486  ? 455.357 -10.008 625.543 1.00 30.49  ? 486  GLU A C     1 
ATOM   3501  O  O     . GLU A 1  486  ? 454.642 -9.961  624.542 1.00 30.46  ? 486  GLU A O     1 
ATOM   3502  C  CB    . GLU A 1  486  ? 455.934 -7.746  626.434 1.00 29.16  ? 486  GLU A CB    1 
ATOM   3503  C  CG    . GLU A 1  486  ? 456.995 -6.716  626.778 1.00 30.41  ? 486  GLU A CG    1 
ATOM   3504  C  CD    . GLU A 1  486  ? 456.411 -5.475  627.421 1.00 32.30  ? 486  GLU A CD    1 
ATOM   3505  O  OE1   . GLU A 1  486  ? 457.009 -4.389  627.262 1.00 33.50  ? 486  GLU A OE1   1 
ATOM   3506  O  OE2   . GLU A 1  486  ? 455.358 -5.587  628.085 1.00 31.30  ? 486  GLU A OE2   1 
ATOM   3507  N  N     . MET A 1  487  ? 455.208 -10.923 626.494 1.00 20.57  ? 487  MET A N     1 
ATOM   3508  C  CA    . MET A 1  487  ? 454.131 -11.898 626.424 1.00 21.08  ? 487  MET A CA    1 
ATOM   3509  C  C     . MET A 1  487  ? 453.304 -11.930 627.696 1.00 21.42  ? 487  MET A C     1 
ATOM   3510  O  O     . MET A 1  487  ? 453.762 -11.514 628.772 1.00 21.72  ? 487  MET A O     1 
ATOM   3511  C  CB    . MET A 1  487  ? 454.677 -13.294 626.142 1.00 21.41  ? 487  MET A CB    1 
ATOM   3512  C  CG    . MET A 1  487  ? 455.039 -13.543 624.694 1.00 21.32  ? 487  MET A CG    1 
ATOM   3513  S  SD    . MET A 1  487  ? 455.434 -15.278 624.435 1.00 21.90  ? 487  MET A SD    1 
ATOM   3514  C  CE    . MET A 1  487  ? 455.851 -15.267 622.702 1.00 21.78  ? 487  MET A CE    1 
ATOM   3515  N  N     . ASN A 1  488  ? 452.083 -12.436 627.547 1.00 27.14  ? 488  ASN A N     1 
ATOM   3516  C  CA    . ASN A 1  488  ? 451.121 -12.530 628.633 1.00 27.92  ? 488  ASN A CA    1 
ATOM   3517  C  C     . ASN A 1  488  ? 450.913 -13.967 629.096 1.00 28.73  ? 488  ASN A C     1 
ATOM   3518  O  O     . ASN A 1  488  ? 451.087 -14.914 628.328 1.00 29.22  ? 488  ASN A O     1 
ATOM   3519  C  CB    . ASN A 1  488  ? 449.783 -11.925 628.206 1.00 28.66  ? 488  ASN A CB    1 
ATOM   3520  C  CG    . ASN A 1  488  ? 449.892 -10.456 627.849 1.00 29.74  ? 488  ASN A CG    1 
ATOM   3521  O  OD1   . ASN A 1  488  ? 450.990 -9.924  627.691 1.00 29.38  ? 488  ASN A OD1   1 
ATOM   3522  N  ND2   . ASN A 1  488  ? 448.749 -9.792  627.715 1.00 30.60  ? 488  ASN A ND2   1 
ATOM   3523  N  N     . LEU A 1  489  ? 450.526 -14.114 630.358 1.00 24.36  ? 489  LEU A N     1 
ATOM   3524  C  CA    . LEU A 1  489  ? 450.335 -15.416 630.980 1.00 25.01  ? 489  LEU A CA    1 
ATOM   3525  C  C     . LEU A 1  489  ? 449.060 -15.401 631.816 1.00 26.16  ? 489  LEU A C     1 
ATOM   3526  O  O     . LEU A 1  489  ? 448.894 -14.548 632.687 1.00 26.76  ? 489  LEU A O     1 
ATOM   3527  C  CB    . LEU A 1  489  ? 451.551 -15.774 631.841 1.00 25.08  ? 489  LEU A CB    1 
ATOM   3528  C  CG    . LEU A 1  489  ? 451.646 -17.156 632.487 1.00 25.95  ? 489  LEU A CG    1 
ATOM   3529  C  CD1   . LEU A 1  489  ? 453.091 -17.619 632.487 1.00 26.35  ? 489  LEU A CD1   1 
ATOM   3530  C  CD2   . LEU A 1  489  ? 451.106 -17.131 633.906 1.00 26.13  ? 489  LEU A CD2   1 
ATOM   3531  N  N     . HIS A 1  490  ? 448.159 -16.339 631.542 1.00 31.81  ? 490  HIS A N     1 
ATOM   3532  C  CA    . HIS A 1  490  ? 446.894 -16.419 632.266 1.00 33.29  ? 490  HIS A CA    1 
ATOM   3533  C  C     . HIS A 1  490  ? 446.821 -17.695 633.093 1.00 35.65  ? 490  HIS A C     1 
ATOM   3534  O  O     . HIS A 1  490  ? 447.072 -18.786 632.588 1.00 37.89  ? 490  HIS A O     1 
ATOM   3535  C  CB    . HIS A 1  490  ? 445.714 -16.353 631.295 1.00 33.06  ? 490  HIS A CB    1 
ATOM   3536  C  CG    . HIS A 1  490  ? 445.664 -15.092 630.488 1.00 32.49  ? 490  HIS A CG    1 
ATOM   3537  N  ND1   . HIS A 1  490  ? 444.873 -14.018 630.834 1.00 30.18  ? 490  HIS A ND1   1 
ATOM   3538  C  CD2   . HIS A 1  490  ? 446.309 -14.734 629.353 1.00 30.66  ? 490  HIS A CD2   1 
ATOM   3539  C  CE1   . HIS A 1  490  ? 445.031 -13.053 629.946 1.00 29.47  ? 490  HIS A CE1   1 
ATOM   3540  N  NE2   . HIS A 1  490  ? 445.897 -13.462 629.037 1.00 28.23  ? 490  HIS A NE2   1 
ATOM   3541  N  N     . VAL A 1  491  ? 446.474 -17.558 634.368 1.00 31.57  ? 491  VAL A N     1 
ATOM   3542  C  CA    . VAL A 1  491  ? 446.425 -18.709 635.259 1.00 31.84  ? 491  VAL A CA    1 
ATOM   3543  C  C     . VAL A 1  491  ? 444.997 -19.197 635.482 1.00 32.34  ? 491  VAL A C     1 
ATOM   3544  O  O     . VAL A 1  491  ? 444.137 -18.434 635.920 1.00 32.48  ? 491  VAL A O     1 
ATOM   3545  C  CB    . VAL A 1  491  ? 447.059 -18.390 636.623 1.00 31.26  ? 491  VAL A CB    1 
ATOM   3546  C  CG1   . VAL A 1  491  ? 447.032 -19.619 637.519 1.00 32.62  ? 491  VAL A CG1   1 
ATOM   3547  C  CG2   . VAL A 1  491  ? 448.481 -17.891 636.440 1.00 29.38  ? 491  VAL A CG2   1 
ATOM   3548  N  N     . PRO A 1  492  ? 444.743 -20.480 635.179 1.00 33.26  ? 492  PRO A N     1 
ATOM   3549  C  CA    . PRO A 1  492  ? 443.446 -21.120 635.417 1.00 33.83  ? 492  PRO A CA    1 
ATOM   3550  C  C     . PRO A 1  492  ? 443.108 -21.146 636.904 1.00 34.70  ? 492  PRO A C     1 
ATOM   3551  O  O     . PRO A 1  492  ? 444.015 -21.246 637.729 1.00 35.74  ? 492  PRO A O     1 
ATOM   3552  C  CB    . PRO A 1  492  ? 443.649 -22.535 634.871 1.00 35.48  ? 492  PRO A CB    1 
ATOM   3553  C  CG    . PRO A 1  492  ? 445.116 -22.757 634.953 1.00 35.17  ? 492  PRO A CG    1 
ATOM   3554  C  CD    . PRO A 1  492  ? 445.724 -21.428 634.630 1.00 33.62  ? 492  PRO A CD    1 
ATOM   3555  N  N     . GLN A 1  493  ? 441.826 -21.064 637.242 1.00 28.21  ? 493  GLN A N     1 
ATOM   3556  C  CA    . GLN A 1  493  ? 441.431 -20.944 638.640 1.00 28.89  ? 493  GLN A CA    1 
ATOM   3557  C  C     . GLN A 1  493  ? 440.567 -22.102 639.134 1.00 30.12  ? 493  GLN A C     1 
ATOM   3558  O  O     . GLN A 1  493  ? 439.944 -22.008 640.192 1.00 30.88  ? 493  GLN A O     1 
ATOM   3559  C  CB    . GLN A 1  493  ? 440.698 -19.621 638.858 1.00 28.83  ? 493  GLN A CB    1 
ATOM   3560  C  CG    . GLN A 1  493  ? 441.541 -18.399 638.531 1.00 27.71  ? 493  GLN A CG    1 
ATOM   3561  C  CD    . GLN A 1  493  ? 442.827 -18.351 639.334 1.00 27.30  ? 493  GLN A CD    1 
ATOM   3562  O  OE1   . GLN A 1  493  ? 442.803 -18.290 640.563 1.00 27.80  ? 493  GLN A OE1   1 
ATOM   3563  N  NE2   . GLN A 1  493  ? 443.959 -18.386 638.640 1.00 26.45  ? 493  GLN A NE2   1 
ATOM   3564  N  N     . SER A 1  494  ? 440.529 -23.191 638.373 1.00 62.60  ? 494  SER A N     1 
ATOM   3565  C  CA    . SER A 1  494  ? 439.837 -24.399 638.816 1.00 66.16  ? 494  SER A CA    1 
ATOM   3566  C  C     . SER A 1  494  ? 440.446 -25.636 638.164 1.00 65.87  ? 494  SER A C     1 
ATOM   3567  O  O     . SER A 1  494  ? 441.322 -25.528 637.307 1.00 63.45  ? 494  SER A O     1 
ATOM   3568  C  CB    . SER A 1  494  ? 438.338 -24.316 638.511 1.00 67.61  ? 494  SER A CB    1 
ATOM   3569  O  OG    . SER A 1  494  ? 438.078 -24.456 637.127 1.00 69.44  ? 494  SER A OG    1 
ATOM   3570  N  N     . GLU A 1  495  ? 439.983 -26.810 638.578 1.00 55.14  ? 495  GLU A N     1 
ATOM   3571  C  CA    . GLU A 1  495  ? 440.532 -28.065 638.076 1.00 55.62  ? 495  GLU A CA    1 
ATOM   3572  C  C     . GLU A 1  495  ? 440.131 -28.337 636.632 1.00 54.09  ? 495  GLU A C     1 
ATOM   3573  O  O     . GLU A 1  495  ? 440.945 -28.788 635.828 1.00 52.92  ? 495  GLU A O     1 
ATOM   3574  C  CB    . GLU A 1  495  ? 440.095 -29.230 638.965 1.00 53.28  ? 495  GLU A CB    1 
ATOM   3575  C  CG    . GLU A 1  495  ? 440.840 -29.312 640.285 1.00 53.22  ? 495  GLU A CG    1 
ATOM   3576  C  CD    . GLU A 1  495  ? 442.308 -29.650 640.106 1.00 57.06  ? 495  GLU A CD    1 
ATOM   3577  O  OE1   . GLU A 1  495  ? 443.109 -29.322 641.008 1.00 55.11  ? 495  GLU A OE1   1 
ATOM   3578  O  OE2   . GLU A 1  495  ? 442.660 -30.249 639.066 1.00 55.89  ? 495  GLU A OE2   1 
ATOM   3579  N  N     . GLU A 1  496  ? 438.873 -28.059 636.308 1.00 55.26  ? 496  GLU A N     1 
ATOM   3580  C  CA    . GLU A 1  496  ? 438.340 -28.356 634.984 1.00 56.05  ? 496  GLU A CA    1 
ATOM   3581  C  C     . GLU A 1  496  ? 438.958 -27.485 633.895 1.00 53.48  ? 496  GLU A C     1 
ATOM   3582  O  O     . GLU A 1  496  ? 439.142 -27.932 632.760 1.00 53.96  ? 496  GLU A O     1 
ATOM   3583  C  CB    . GLU A 1  496  ? 436.820 -28.197 634.987 1.00 56.48  ? 496  GLU A CB    1 
ATOM   3584  C  CG    . GLU A 1  496  ? 436.322 -27.060 635.858 1.00 56.73  ? 496  GLU A CG    1 
ATOM   3585  C  CD    . GLU A 1  496  ? 434.829 -27.134 636.110 1.00 60.61  ? 496  GLU A CD    1 
ATOM   3586  O  OE1   . GLU A 1  496  ? 434.368 -26.571 637.125 1.00 63.39  ? 496  GLU A OE1   1 
ATOM   3587  O  OE2   . GLU A 1  496  ? 434.117 -27.756 635.294 1.00 62.16  ? 496  GLU A OE2   1 
ATOM   3588  N  N     . THR A 1  497  ? 439.290 -26.248 634.243 1.00 42.06  ? 497  THR A N     1 
ATOM   3589  C  CA    . THR A 1  497  ? 439.844 -25.322 633.267 1.00 41.37  ? 497  THR A CA    1 
ATOM   3590  C  C     . THR A 1  497  ? 441.339 -25.574 633.039 1.00 40.78  ? 497  THR A C     1 
ATOM   3591  O  O     . THR A 1  497  ? 441.832 -25.450 631.914 1.00 41.14  ? 497  THR A O     1 
ATOM   3592  C  CB    . THR A 1  497  ? 439.610 -23.855 633.688 1.00 40.26  ? 497  THR A CB    1 
ATOM   3593  O  OG1   . THR A 1  497  ? 440.183 -22.979 632.713 1.00 42.56  ? 497  THR A OG1   1 
ATOM   3594  C  CG2   . THR A 1  497  ? 440.228 -23.567 635.040 1.00 39.78  ? 497  THR A CG2   1 
ATOM   3595  N  N     . ARG A 1  498  ? 442.059 -25.947 634.094 1.00 45.92  ? 498  ARG A N     1 
ATOM   3596  C  CA    . ARG A 1  498  ? 443.464 -26.300 633.935 1.00 46.06  ? 498  ARG A CA    1 
ATOM   3597  C  C     . ARG A 1  498  ? 443.550 -27.654 633.245 1.00 46.92  ? 498  ARG A C     1 
ATOM   3598  O  O     . ARG A 1  498  ? 444.548 -27.971 632.596 1.00 46.43  ? 498  ARG A O     1 
ATOM   3599  C  CB    . ARG A 1  498  ? 444.198 -26.323 635.280 1.00 48.22  ? 498  ARG A CB    1 
ATOM   3600  C  CG    . ARG A 1  498  ? 443.773 -27.430 636.225 1.00 50.19  ? 498  ARG A CG    1 
ATOM   3601  C  CD    . ARG A 1  498  ? 444.926 -27.851 637.121 1.00 49.18  ? 498  ARG A CD    1 
ATOM   3602  N  NE    . ARG A 1  498  ? 445.544 -26.713 637.796 1.00 46.70  ? 498  ARG A NE    1 
ATOM   3603  C  CZ    . ARG A 1  498  ? 446.686 -26.779 638.473 1.00 49.24  ? 498  ARG A CZ    1 
ATOM   3604  N  NH1   . ARG A 1  498  ? 447.340 -27.929 638.562 1.00 49.66  ? 498  ARG A NH1   1 
ATOM   3605  N  NH2   . ARG A 1  498  ? 447.178 -25.695 639.057 1.00 48.98  ? 498  ARG A NH2   1 
ATOM   3606  N  N     . ALA A 1  499  ? 442.491 -28.447 633.385 1.00 41.21  ? 499  ALA A N     1 
ATOM   3607  C  CA    . ALA A 1  499  ? 442.371 -29.690 632.638 1.00 41.37  ? 499  ALA A CA    1 
ATOM   3608  C  C     . ALA A 1  499  ? 442.168 -29.367 631.166 1.00 40.00  ? 499  ALA A C     1 
ATOM   3609  O  O     . ALA A 1  499  ? 442.741 -30.021 630.296 1.00 40.74  ? 499  ALA A O     1 
ATOM   3610  C  CB    . ALA A 1  499  ? 441.226 -30.535 633.165 1.00 41.21  ? 499  ALA A CB    1 
ATOM   3611  N  N     . GLU A 1  500  ? 441.353 -28.350 630.895 1.00 36.60  ? 500  GLU A N     1 
ATOM   3612  C  CA    . GLU A 1  500  ? 441.163 -27.881 629.527 1.00 36.14  ? 500  GLU A CA    1 
ATOM   3613  C  C     . GLU A 1  500  ? 442.490 -27.443 628.924 1.00 35.39  ? 500  GLU A C     1 
ATOM   3614  O  O     . GLU A 1  500  ? 442.789 -27.758 627.774 1.00 36.45  ? 500  GLU A O     1 
ATOM   3615  C  CB    . GLU A 1  500  ? 440.161 -26.728 629.472 1.00 35.09  ? 500  GLU A CB    1 
ATOM   3616  C  CG    . GLU A 1  500  ? 438.707 -27.159 629.471 1.00 37.57  ? 500  GLU A CG    1 
ATOM   3617  C  CD    . GLU A 1  500  ? 437.768 -26.030 629.090 1.00 38.14  ? 500  GLU A CD    1 
ATOM   3618  O  OE1   . GLU A 1  500  ? 438.222 -24.867 629.029 1.00 35.69  ? 500  GLU A OE1   1 
ATOM   3619  O  OE2   . GLU A 1  500  ? 436.576 -26.305 628.845 1.00 38.68  ? 500  GLU A OE2   1 
ATOM   3620  N  N     . LEU A 1  501  ? 443.288 -26.723 629.704 1.00 35.69  ? 501  LEU A N     1 
ATOM   3621  C  CA    . LEU A 1  501  ? 444.586 -26.263 629.222 1.00 34.35  ? 501  LEU A CA    1 
ATOM   3622  C  C     . LEU A 1  501  ? 445.545 -27.426 628.971 1.00 35.10  ? 501  LEU A C     1 
ATOM   3623  O  O     . LEU A 1  501  ? 446.193 -27.489 627.928 1.00 35.42  ? 501  LEU A O     1 
ATOM   3624  C  CB    . LEU A 1  501  ? 445.208 -25.277 630.212 1.00 34.32  ? 501  LEU A CB    1 
ATOM   3625  C  CG    . LEU A 1  501  ? 444.473 -23.948 630.389 1.00 33.12  ? 501  LEU A CG    1 
ATOM   3626  C  CD1   . LEU A 1  501  ? 445.266 -23.017 631.288 1.00 32.37  ? 501  LEU A CD1   1 
ATOM   3627  C  CD2   . LEU A 1  501  ? 444.203 -23.292 629.045 1.00 33.38  ? 501  LEU A CD2   1 
ATOM   3628  N  N     . SER A 1  502  ? 445.624 -28.350 629.922 1.00 40.10  ? 502  SER A N     1 
ATOM   3629  C  CA    . SER A 1  502  ? 446.586 -29.444 629.839 1.00 41.51  ? 502  SER A CA    1 
ATOM   3630  C  C     . SER A 1  502  ? 446.212 -30.494 628.794 1.00 42.51  ? 502  SER A C     1 
ATOM   3631  O  O     . SER A 1  502  ? 447.078 -31.212 628.293 1.00 43.40  ? 502  SER A O     1 
ATOM   3632  C  CB    . SER A 1  502  ? 446.740 -30.118 631.205 1.00 43.05  ? 502  SER A CB    1 
ATOM   3633  O  OG    . SER A 1  502  ? 445.554 -30.797 631.580 1.00 45.04  ? 502  SER A OG    1 
ATOM   3634  N  N     . GLN A 1  503  ? 444.926 -30.585 628.465 1.00 32.02  ? 503  GLN A N     1 
ATOM   3635  C  CA    . GLN A 1  503  ? 444.452 -31.638 627.570 1.00 33.08  ? 503  GLN A CA    1 
ATOM   3636  C  C     . GLN A 1  503  ? 444.061 -31.129 626.183 1.00 32.34  ? 503  GLN A C     1 
ATOM   3637  O  O     . GLN A 1  503  ? 443.904 -31.920 625.253 1.00 32.87  ? 503  GLN A O     1 
ATOM   3638  C  CB    . GLN A 1  503  ? 443.264 -32.368 628.200 1.00 34.15  ? 503  GLN A CB    1 
ATOM   3639  C  CG    . GLN A 1  503  ? 443.572 -32.993 629.548 1.00 34.31  ? 503  GLN A CG    1 
ATOM   3640  C  CD    . GLN A 1  503  ? 444.711 -33.987 629.480 1.00 34.56  ? 503  GLN A CD    1 
ATOM   3641  O  OE1   . GLN A 1  503  ? 444.644 -34.979 628.753 1.00 35.23  ? 503  GLN A OE1   1 
ATOM   3642  N  NE2   . GLN A 1  503  ? 445.770 -33.724 630.238 1.00 34.93  ? 503  GLN A NE2   1 
ATOM   3643  N  N     . LEU A 1  504  ? 443.903 -29.817 626.043 1.00 30.23  ? 504  LEU A N     1 
ATOM   3644  C  CA    . LEU A 1  504  ? 443.510 -29.238 624.762 1.00 29.91  ? 504  LEU A CA    1 
ATOM   3645  C  C     . LEU A 1  504  ? 444.523 -28.217 624.247 1.00 28.79  ? 504  LEU A C     1 
ATOM   3646  O  O     . LEU A 1  504  ? 444.870 -28.221 623.067 1.00 28.60  ? 504  LEU A O     1 
ATOM   3647  C  CB    . LEU A 1  504  ? 442.130 -28.584 624.875 1.00 30.13  ? 504  LEU A CB    1 
ATOM   3648  C  CG    . LEU A 1  504  ? 440.907 -29.356 624.375 1.00 31.20  ? 504  LEU A CG    1 
ATOM   3649  C  CD1   . LEU A 1  504  ? 440.936 -30.804 624.818 1.00 32.17  ? 504  LEU A CD1   1 
ATOM   3650  C  CD2   . LEU A 1  504  ? 439.636 -28.682 624.862 1.00 31.48  ? 504  LEU A CD2   1 
ATOM   3651  N  N     . CYS A 1  505  ? 444.999 -27.350 625.135 1.00 35.83  ? 505  CYS A N     1 
ATOM   3652  C  CA    . CYS A 1  505  ? 445.847 -26.233 624.730 1.00 34.61  ? 505  CYS A CA    1 
ATOM   3653  C  C     . CYS A 1  505  ? 447.337 -26.481 624.959 1.00 34.98  ? 505  CYS A C     1 
ATOM   3654  O  O     . CYS A 1  505  ? 448.152 -25.579 624.767 1.00 35.34  ? 505  CYS A O     1 
ATOM   3655  C  CB    . CYS A 1  505  ? 445.425 -24.965 625.473 1.00 35.39  ? 505  CYS A CB    1 
ATOM   3656  S  SG    . CYS A 1  505  ? 443.695 -24.512 625.239 1.00 34.91  ? 505  CYS A SG    1 
ATOM   3657  N  N     . ALA A 1  506  ? 447.690 -27.695 625.368 1.00 29.78  ? 506  ALA A N     1 
ATOM   3658  C  CA    . ALA A 1  506  ? 449.084 -28.032 625.644 1.00 28.40  ? 506  ALA A CA    1 
ATOM   3659  C  C     . ALA A 1  506  ? 449.946 -27.892 624.393 1.00 27.75  ? 506  ALA A C     1 
ATOM   3660  O  O     . ALA A 1  506  ? 449.515 -28.236 623.293 1.00 29.76  ? 506  ALA A O     1 
ATOM   3661  C  CB    . ALA A 1  506  ? 449.187 -29.438 626.204 1.00 30.94  ? 506  ALA A CB    1 
ATOM   3662  N  N     . VAL A 1  507  ? 451.160 -27.378 624.571 1.00 30.60  ? 507  VAL A N     1 
ATOM   3663  C  CA    . VAL A 1  507  ? 452.081 -27.140 623.459 1.00 30.20  ? 507  VAL A CA    1 
ATOM   3664  C  C     . VAL A 1  507  ? 452.411 -28.392 622.626 1.00 30.95  ? 507  VAL A C     1 
ATOM   3665  O  O     . VAL A 1  507  ? 452.438 -28.309 621.397 1.00 30.90  ? 507  VAL A O     1 
ATOM   3666  C  CB    . VAL A 1  507  ? 453.403 -26.508 623.962 1.00 29.56  ? 507  VAL A CB    1 
ATOM   3667  C  CG1   . VAL A 1  507  ? 454.389 -26.329 622.817 1.00 29.28  ? 507  VAL A CG1   1 
ATOM   3668  C  CG2   . VAL A 1  507  ? 453.125 -25.177 624.632 1.00 28.82  ? 507  VAL A CG2   1 
ATOM   3669  N  N     . PRO A 1  508  ? 452.663 -29.550 623.274 1.00 33.70  ? 508  PRO A N     1 
ATOM   3670  C  CA    . PRO A 1  508  ? 452.912 -30.733 622.439 1.00 33.49  ? 508  PRO A CA    1 
ATOM   3671  C  C     . PRO A 1  508  ? 451.721 -31.090 621.554 1.00 35.73  ? 508  PRO A C     1 
ATOM   3672  O  O     . PRO A 1  508  ? 451.900 -31.595 620.447 1.00 36.83  ? 508  PRO A O     1 
ATOM   3673  C  CB    . PRO A 1  508  ? 453.173 -31.840 623.467 1.00 35.30  ? 508  PRO A CB    1 
ATOM   3674  C  CG    . PRO A 1  508  ? 453.643 -31.127 624.676 1.00 36.25  ? 508  PRO A CG    1 
ATOM   3675  C  CD    . PRO A 1  508  ? 452.860 -29.853 624.704 1.00 35.14  ? 508  PRO A CD    1 
ATOM   3676  N  N     . LEU A 1  509  ? 450.516 -30.809 622.038 1.00 29.11  ? 509  LEU A N     1 
ATOM   3677  C  CA    . LEU A 1  509  ? 449.300 -31.087 621.282 1.00 29.62  ? 509  LEU A CA    1 
ATOM   3678  C  C     . LEU A 1  509  ? 449.118 -30.107 620.128 1.00 29.02  ? 509  LEU A C     1 
ATOM   3679  O  O     . LEU A 1  509  ? 448.193 -30.240 619.328 1.00 29.53  ? 509  LEU A O     1 
ATOM   3680  C  CB    . LEU A 1  509  ? 448.080 -31.040 622.204 1.00 29.92  ? 509  LEU A CB    1 
ATOM   3681  C  CG    . LEU A 1  509  ? 448.028 -32.099 623.306 1.00 30.71  ? 509  LEU A CG    1 
ATOM   3682  C  CD1   . LEU A 1  509  ? 446.959 -31.754 624.324 1.00 30.84  ? 509  LEU A CD1   1 
ATOM   3683  C  CD2   . LEU A 1  509  ? 447.778 -33.478 622.713 1.00 32.18  ? 509  LEU A CD2   1 
ATOM   3684  N  N     . GLN A 1  510  ? 450.006 -29.122 620.048 1.00 21.35  ? 510  GLN A N     1 
ATOM   3685  C  CA    . GLN A 1  510  ? 449.905 -28.081 619.033 1.00 20.73  ? 510  GLN A CA    1 
ATOM   3686  C  C     . GLN A 1  510  ? 451.047 -28.144 618.024 1.00 20.59  ? 510  GLN A C     1 
ATOM   3687  O  O     . GLN A 1  510  ? 451.112 -27.322 617.110 1.00 20.13  ? 510  GLN A O     1 
ATOM   3688  C  CB    . GLN A 1  510  ? 449.874 -26.701 619.695 1.00 19.81  ? 510  GLN A CB    1 
ATOM   3689  C  CG    . GLN A 1  510  ? 448.732 -26.510 620.678 1.00 19.97  ? 510  GLN A CG    1 
ATOM   3690  C  CD    . GLN A 1  510  ? 447.382 -26.473 619.994 1.00 20.39  ? 510  GLN A CD    1 
ATOM   3691  O  OE1   . GLN A 1  510  ? 447.275 -26.075 618.836 1.00 20.24  ? 510  GLN A OE1   1 
ATOM   3692  N  NE2   . GLN A 1  510  ? 446.343 -26.893 620.707 1.00 20.98  ? 510  GLN A NE2   1 
ATOM   3693  N  N     . ILE A 1  511  ? 451.940 -29.117 618.192 1.00 21.78  ? 511  ILE A N     1 
ATOM   3694  C  CA    . ILE A 1  511  ? 453.109 -29.250 617.326 1.00 21.76  ? 511  ILE A CA    1 
ATOM   3695  C  C     . ILE A 1  511  ? 452.705 -29.387 615.864 1.00 22.11  ? 511  ILE A C     1 
ATOM   3696  O  O     . ILE A 1  511  ? 453.058 -28.546 615.041 1.00 21.60  ? 511  ILE A O     1 
ATOM   3697  C  CB    . ILE A 1  511  ? 453.979 -30.455 617.726 1.00 22.45  ? 511  ILE A CB    1 
ATOM   3698  C  CG1   . ILE A 1  511  ? 454.517 -30.275 619.145 1.00 22.12  ? 511  ILE A CG1   1 
ATOM   3699  C  CG2   . ILE A 1  511  ? 455.136 -30.623 616.755 1.00 22.57  ? 511  ILE A CG2   1 
ATOM   3700  C  CD1   . ILE A 1  511  ? 455.382 -31.424 619.616 1.00 22.83  ? 511  ILE A CD1   1 
ATOM   3701  N  N     . VAL A 1  512  ? 451.962 -30.440 615.542 1.00 39.71  ? 512  VAL A N     1 
ATOM   3702  C  CA    . VAL A 1  512  ? 451.415 -30.591 614.199 1.00 40.02  ? 512  VAL A CA    1 
ATOM   3703  C  C     . VAL A 1  512  ? 450.055 -29.890 614.124 1.00 39.54  ? 512  VAL A C     1 
ATOM   3704  O  O     . VAL A 1  512  ? 449.066 -30.352 614.695 1.00 39.50  ? 512  VAL A O     1 
ATOM   3705  C  CB    . VAL A 1  512  ? 451.294 -32.083 613.792 1.00 38.79  ? 512  VAL A CB    1 
ATOM   3706  C  CG1   . VAL A 1  512  ? 450.717 -32.919 614.929 1.00 42.06  ? 512  VAL A CG1   1 
ATOM   3707  C  CG2   . VAL A 1  512  ? 450.473 -32.234 612.518 1.00 40.12  ? 512  VAL A CG2   1 
ATOM   3708  N  N     . SER A 1  513  ? 450.018 -28.754 613.433 1.00 46.43  ? 513  SER A N     1 
ATOM   3709  C  CA    . SER A 1  513  ? 448.820 -27.922 613.397 1.00 47.16  ? 513  SER A CA    1 
ATOM   3710  C  C     . SER A 1  513  ? 447.960 -28.220 612.175 1.00 47.53  ? 513  SER A C     1 
ATOM   3711  O  O     . SER A 1  513  ? 448.479 -28.569 611.115 1.00 48.12  ? 513  SER A O     1 
ATOM   3712  C  CB    . SER A 1  513  ? 449.198 -26.440 613.413 1.00 46.28  ? 513  SER A CB    1 
ATOM   3713  O  OG    . SER A 1  513  ? 449.647 -26.018 612.137 1.00 48.32  ? 513  SER A OG    1 
ATOM   3714  N  N     . PRO A 1  514  ? 446.633 -28.077 612.322 1.00 30.84  ? 514  PRO A N     1 
ATOM   3715  C  CA    . PRO A 1  514  ? 445.684 -28.296 611.226 1.00 31.54  ? 514  PRO A CA    1 
ATOM   3716  C  C     . PRO A 1  514  ? 445.643 -27.137 610.232 1.00 31.04  ? 514  PRO A C     1 
ATOM   3717  O  O     . PRO A 1  514  ? 444.853 -27.165 609.288 1.00 31.58  ? 514  PRO A O     1 
ATOM   3718  C  CB    . PRO A 1  514  ? 444.345 -28.430 611.954 1.00 31.96  ? 514  PRO A CB    1 
ATOM   3719  C  CG    . PRO A 1  514  ? 444.511 -27.594 613.168 1.00 31.12  ? 514  PRO A CG    1 
ATOM   3720  C  CD    . PRO A 1  514  ? 445.944 -27.777 613.589 1.00 30.64  ? 514  PRO A CD    1 
ATOM   3721  N  N     . GLN A 1  515  ? 446.481 -26.128 610.443 1.00 38.21  ? 515  GLN A N     1 
ATOM   3722  C  CA    . GLN A 1  515  ? 446.522 -24.985 609.542 1.00 37.02  ? 515  GLN A CA    1 
ATOM   3723  C  C     . GLN A 1  515  ? 447.041 -25.398 608.167 1.00 36.75  ? 515  GLN A C     1 
ATOM   3724  O  O     . GLN A 1  515  ? 446.425 -25.093 607.145 1.00 36.62  ? 515  GLN A O     1 
ATOM   3725  C  CB    . GLN A 1  515  ? 447.388 -23.869 610.129 1.00 36.90  ? 515  GLN A CB    1 
ATOM   3726  C  CG    . GLN A 1  515  ? 447.503 -22.642 609.244 1.00 35.25  ? 515  GLN A CG    1 
ATOM   3727  C  CD    . GLN A 1  515  ? 448.039 -21.436 609.990 1.00 33.57  ? 515  GLN A CD    1 
ATOM   3728  O  OE1   . GLN A 1  515  ? 447.761 -21.252 611.175 1.00 32.64  ? 515  GLN A OE1   1 
ATOM   3729  N  NE2   . GLN A 1  515  ? 448.812 -20.607 609.298 1.00 32.98  ? 515  GLN A NE2   1 
ATOM   3730  N  N     . SER A 1  516  ? 448.167 -26.103 608.147 1.00 33.18  ? 516  SER A N     1 
ATOM   3731  C  CA    . SER A 1  516  ? 448.774 -26.540 606.895 1.00 32.26  ? 516  SER A CA    1 
ATOM   3732  C  C     . SER A 1  516  ? 449.101 -28.027 606.922 1.00 34.36  ? 516  SER A C     1 
ATOM   3733  O  O     . SER A 1  516  ? 450.050 -28.466 606.270 1.00 34.04  ? 516  SER A O     1 
ATOM   3734  C  CB    . SER A 1  516  ? 450.042 -25.734 606.606 1.00 31.24  ? 516  SER A CB    1 
ATOM   3735  O  OG    . SER A 1  516  ? 449.765 -24.345 606.563 1.00 32.52  ? 516  SER A OG    1 
ATOM   3736  N  N     . ASN A 1  517  ? 448.296 -28.785 607.666 1.00 26.80  ? 517  ASN A N     1 
ATOM   3737  C  CA    . ASN A 1  517  ? 448.502 -30.218 607.915 1.00 27.67  ? 517  ASN A CA    1 
ATOM   3738  C  C     . ASN A 1  517  ? 449.975 -30.597 608.070 1.00 27.56  ? 517  ASN A C     1 
ATOM   3739  O  O     . ASN A 1  517  ? 450.434 -31.604 607.530 1.00 28.39  ? 517  ASN A O     1 
ATOM   3740  C  CB    . ASN A 1  517  ? 447.848 -31.063 606.810 1.00 28.81  ? 517  ASN A CB    1 
ATOM   3741  C  CG    . ASN A 1  517  ? 448.380 -30.749 605.427 1.00 28.92  ? 517  ASN A CG    1 
ATOM   3742  O  OD1   . ASN A 1  517  ? 447.817 -29.926 604.707 1.00 28.73  ? 517  ASN A OD1   1 
ATOM   3743  N  ND2   . ASN A 1  517  ? 449.464 -31.411 605.045 1.00 29.30  ? 517  ASN A ND2   1 
ATOM   3744  N  N     . LYS A 1  518  ? 450.700 -29.775 608.822 1.00 33.91  ? 518  LYS A N     1 
ATOM   3745  C  CA    . LYS A 1  518  ? 452.129 -29.957 609.032 1.00 34.54  ? 518  LYS A CA    1 
ATOM   3746  C  C     . LYS A 1  518  ? 452.519 -29.397 610.397 1.00 32.98  ? 518  LYS A C     1 
ATOM   3747  O  O     . LYS A 1  518  ? 451.760 -28.628 610.990 1.00 32.37  ? 518  LYS A O     1 
ATOM   3748  C  CB    . LYS A 1  518  ? 452.927 -29.266 607.924 1.00 34.93  ? 518  LYS A CB    1 
ATOM   3749  C  CG    . LYS A 1  518  ? 452.947 -27.751 608.036 1.00 33.46  ? 518  LYS A CG    1 
ATOM   3750  C  CD    . LYS A 1  518  ? 453.952 -27.136 607.079 1.00 32.67  ? 518  LYS A CD    1 
ATOM   3751  C  CE    . LYS A 1  518  ? 454.059 -25.635 607.287 1.00 33.93  ? 518  LYS A CE    1 
ATOM   3752  N  NZ    . LYS A 1  518  ? 454.466 -25.294 608.680 1.00 30.38  ? 518  LYS A NZ    1 
ATOM   3753  N  N     . PRO A 1  519  ? 453.697 -29.786 610.911 1.00 31.19  ? 519  PRO A N     1 
ATOM   3754  C  CA    . PRO A 1  519  ? 454.156 -29.187 612.167 1.00 30.13  ? 519  PRO A CA    1 
ATOM   3755  C  C     . PRO A 1  519  ? 454.413 -27.691 612.031 1.00 29.32  ? 519  PRO A C     1 
ATOM   3756  O  O     . PRO A 1  519  ? 454.938 -27.253 611.007 1.00 28.82  ? 519  PRO A O     1 
ATOM   3757  C  CB    . PRO A 1  519  ? 455.457 -29.941 612.465 1.00 31.09  ? 519  PRO A CB    1 
ATOM   3758  C  CG    . PRO A 1  519  ? 455.878 -30.524 611.161 1.00 31.49  ? 519  PRO A CG    1 
ATOM   3759  C  CD    . PRO A 1  519  ? 454.606 -30.848 610.448 1.00 32.79  ? 519  PRO A CD    1 
ATOM   3760  N  N     . CYS A 1  520  ? 454.039 -26.922 613.050 1.00 25.65  ? 520  CYS A N     1 
ATOM   3761  C  CA    . CYS A 1  520  ? 454.249 -25.478 613.039 1.00 24.70  ? 520  CYS A CA    1 
ATOM   3762  C  C     . CYS A 1  520  ? 455.459 -25.090 613.883 1.00 24.15  ? 520  CYS A C     1 
ATOM   3763  O  O     . CYS A 1  520  ? 455.727 -23.907 614.098 1.00 23.37  ? 520  CYS A O     1 
ATOM   3764  C  CB    . CYS A 1  520  ? 453.003 -24.749 613.542 1.00 25.73  ? 520  CYS A CB    1 
ATOM   3765  S  SG    . CYS A 1  520  ? 452.576 -25.090 615.265 1.00 24.30  ? 520  CYS A SG    1 
ATOM   3766  N  N     . MET A 1  521  ? 456.182 -26.096 614.366 1.00 33.58  ? 521  MET A N     1 
ATOM   3767  C  CA    . MET A 1  521  ? 457.391 -25.872 615.148 1.00 32.84  ? 521  MET A CA    1 
ATOM   3768  C  C     . MET A 1  521  ? 458.537 -26.720 614.611 1.00 32.62  ? 521  MET A C     1 
ATOM   3769  O  O     . MET A 1  521  ? 458.321 -27.819 614.103 1.00 34.26  ? 521  MET A O     1 
ATOM   3770  C  CB    . MET A 1  521  ? 457.153 -26.193 616.624 1.00 32.91  ? 521  MET A CB    1 
ATOM   3771  C  CG    . MET A 1  521  ? 455.938 -25.514 617.226 1.00 31.25  ? 521  MET A CG    1 
ATOM   3772  S  SD    . MET A 1  521  ? 455.734 -25.918 618.970 1.00 33.36  ? 521  MET A SD    1 
ATOM   3773  C  CE    . MET A 1  521  ? 454.024 -25.455 619.220 1.00 33.74  ? 521  MET A CE    1 
ATOM   3774  N  N     . GLY A 1  522  ? 459.756 -26.207 614.732 1.00 28.71  ? 522  GLY A N     1 
ATOM   3775  C  CA    . GLY A 1  522  ? 460.928 -26.922 614.263 1.00 29.33  ? 522  GLY A CA    1 
ATOM   3776  C  C     . GLY A 1  522  ? 462.203 -26.412 614.901 1.00 28.97  ? 522  GLY A C     1 
ATOM   3777  O  O     . GLY A 1  522  ? 462.168 -25.565 615.794 1.00 28.24  ? 522  GLY A O     1 
ATOM   3778  N  N     . ILE A 1  523  ? 463.335 -26.932 614.442 1.00 27.70  ? 523  ILE A N     1 
ATOM   3779  C  CA    . ILE A 1  523  ? 464.634 -26.507 614.949 1.00 27.67  ? 523  ILE A CA    1 
ATOM   3780  C  C     . ILE A 1  523  ? 465.100 -25.261 614.193 1.00 26.59  ? 523  ILE A C     1 
ATOM   3781  O  O     . ILE A 1  523  ? 465.105 -25.236 612.961 1.00 26.85  ? 523  ILE A O     1 
ATOM   3782  C  CB    . ILE A 1  523  ? 465.680 -27.642 614.835 1.00 26.36  ? 523  ILE A CB    1 
ATOM   3783  C  CG1   . ILE A 1  523  ? 465.702 -28.485 616.114 1.00 27.18  ? 523  ILE A CG1   1 
ATOM   3784  C  CG2   . ILE A 1  523  ? 467.064 -27.086 614.592 1.00 27.63  ? 523  ILE A CG2   1 
ATOM   3785  C  CD1   . ILE A 1  523  ? 464.417 -29.234 616.394 1.00 27.80  ? 523  ILE A CD1   1 
ATOM   3786  N  N     . VAL A 1  524  ? 465.472 -24.222 614.937 1.00 28.52  ? 524  VAL A N     1 
ATOM   3787  C  CA    . VAL A 1  524  ? 465.812 -22.935 614.335 1.00 27.98  ? 524  VAL A CA    1 
ATOM   3788  C  C     . VAL A 1  524  ? 467.109 -22.342 614.878 1.00 28.11  ? 524  VAL A C     1 
ATOM   3789  O  O     . VAL A 1  524  ? 467.647 -22.817 615.879 1.00 30.55  ? 524  VAL A O     1 
ATOM   3790  C  CB    . VAL A 1  524  ? 464.689 -21.904 614.554 1.00 26.26  ? 524  VAL A CB    1 
ATOM   3791  C  CG1   . VAL A 1  524  ? 463.426 -22.322 613.817 1.00 27.85  ? 524  VAL A CG1   1 
ATOM   3792  C  CG2   . VAL A 1  524  ? 464.416 -21.730 616.039 1.00 25.15  ? 524  VAL A CG2   1 
ATOM   3793  N  N     . GLN A 1  525  ? 467.597 -21.304 614.202 1.00 40.86  ? 525  GLN A N     1 
ATOM   3794  C  CA    . GLN A 1  525  ? 468.754 -20.525 614.650 1.00 41.67  ? 525  GLN A CA    1 
ATOM   3795  C  C     . GLN A 1  525  ? 470.001 -21.368 614.918 1.00 42.40  ? 525  GLN A C     1 
ATOM   3796  O  O     . GLN A 1  525  ? 470.450 -22.129 614.058 1.00 44.75  ? 525  GLN A O     1 
ATOM   3797  C  CB    . GLN A 1  525  ? 468.393 -19.732 615.910 1.00 42.66  ? 525  GLN A CB    1 
ATOM   3798  C  CG    . GLN A 1  525  ? 467.337 -18.660 615.696 1.00 42.04  ? 525  GLN A CG    1 
ATOM   3799  C  CD    . GLN A 1  525  ? 467.898 -17.405 615.052 1.00 41.06  ? 525  GLN A CD    1 
ATOM   3800  O  OE1   . GLN A 1  525  ? 468.865 -16.822 615.542 1.00 37.58  ? 525  GLN A OE1   1 
ATOM   3801  N  NE2   . GLN A 1  525  ? 467.291 -16.983 613.948 1.00 43.18  ? 525  GLN A NE2   1 
ATOM   3802  N  N     . ASP A 1  526  ? 470.549 -21.218 616.122 1.00 38.79  ? 526  ASP A N     1 
ATOM   3803  C  CA    . ASP A 1  526  ? 471.788 -21.886 616.512 1.00 41.02  ? 526  ASP A CA    1 
ATOM   3804  C  C     . ASP A 1  526  ? 471.695 -23.403 616.423 1.00 40.90  ? 526  ASP A C     1 
ATOM   3805  O  O     . ASP A 1  526  ? 472.670 -24.071 616.089 1.00 41.89  ? 526  ASP A O     1 
ATOM   3806  C  CB    . ASP A 1  526  ? 472.184 -21.488 617.934 1.00 38.92  ? 526  ASP A CB    1 
ATOM   3807  C  CG    . ASP A 1  526  ? 472.681 -20.064 618.021 1.00 37.98  ? 526  ASP A CG    1 
ATOM   3808  O  OD1   . ASP A 1  526  ? 472.317 -19.252 617.142 1.00 38.25  ? 526  ASP A OD1   1 
ATOM   3809  O  OD2   . ASP A 1  526  ? 473.435 -19.756 618.968 1.00 39.13  ? 526  ASP A OD2   1 
ATOM   3810  N  N     . THR A 1  527  ? 470.525 -23.946 616.730 1.00 33.34  ? 527  THR A N     1 
ATOM   3811  C  CA    . THR A 1  527  ? 470.345 -25.388 616.703 1.00 33.89  ? 527  THR A CA    1 
ATOM   3812  C  C     . THR A 1  527  ? 470.330 -25.890 615.262 1.00 36.48  ? 527  THR A C     1 
ATOM   3813  O  O     . THR A 1  527  ? 470.799 -26.987 614.980 1.00 38.61  ? 527  THR A O     1 
ATOM   3814  C  CB    . THR A 1  527  ? 469.051 -25.811 617.423 1.00 34.84  ? 527  THR A CB    1 
ATOM   3815  O  OG1   . THR A 1  527  ? 468.982 -25.169 618.703 1.00 36.57  ? 527  THR A OG1   1 
ATOM   3816  C  CG2   . THR A 1  527  ? 469.016 -27.318 617.619 1.00 34.62  ? 527  THR A CG2   1 
ATOM   3817  N  N     . LEU A 1  528  ? 469.810 -25.073 614.351 1.00 33.50  ? 528  LEU A N     1 
ATOM   3818  C  CA    . LEU A 1  528  ? 469.731 -25.449 612.940 1.00 33.24  ? 528  LEU A CA    1 
ATOM   3819  C  C     . LEU A 1  528  ? 471.088 -25.331 612.252 1.00 33.55  ? 528  LEU A C     1 
ATOM   3820  O  O     . LEU A 1  528  ? 471.552 -26.274 611.599 1.00 36.00  ? 528  LEU A O     1 
ATOM   3821  C  CB    . LEU A 1  528  ? 468.692 -24.587 612.221 1.00 30.45  ? 528  LEU A CB    1 
ATOM   3822  C  CG    . LEU A 1  528  ? 468.388 -24.955 610.768 1.00 31.31  ? 528  LEU A CG    1 
ATOM   3823  C  CD1   . LEU A 1  528  ? 468.092 -26.438 610.648 1.00 34.03  ? 528  LEU A CD1   1 
ATOM   3824  C  CD2   . LEU A 1  528  ? 467.221 -24.136 610.248 1.00 30.95  ? 528  LEU A CD2   1 
ATOM   3825  N  N     . CYS A 1  529  ? 471.718 -24.170 612.402 1.00 30.12  ? 529  CYS A N     1 
ATOM   3826  C  CA    . CYS A 1  529  ? 473.061 -23.949 611.879 1.00 30.73  ? 529  CYS A CA    1 
ATOM   3827  C  C     . CYS A 1  529  ? 474.027 -24.982 612.451 1.00 32.41  ? 529  CYS A C     1 
ATOM   3828  O  O     . CYS A 1  529  ? 474.830 -25.580 611.727 1.00 35.48  ? 529  CYS A O     1 
ATOM   3829  C  CB    . CYS A 1  529  ? 473.534 -22.533 612.211 1.00 30.09  ? 529  CYS A CB    1 
ATOM   3830  S  SG    . CYS A 1  529  ? 475.213 -22.152 611.680 1.00 32.03  ? 529  CYS A SG    1 
ATOM   3831  N  N     . GLY A 1  530  ? 473.920 -25.198 613.757 1.00 27.64  ? 530  GLY A N     1 
ATOM   3832  C  CA    . GLY A 1  530  ? 474.762 -26.144 614.460 1.00 28.47  ? 530  GLY A CA    1 
ATOM   3833  C  C     . GLY A 1  530  ? 474.526 -27.589 614.065 1.00 29.50  ? 530  GLY A C     1 
ATOM   3834  O  O     . GLY A 1  530  ? 475.473 -28.369 613.995 1.00 30.97  ? 530  GLY A O     1 
ATOM   3835  N  N     . ILE A 1  531  ? 473.273 -27.958 613.812 1.00 23.62  ? 531  ILE A N     1 
ATOM   3836  C  CA    . ILE A 1  531  ? 472.970 -29.333 613.428 1.00 24.64  ? 531  ILE A CA    1 
ATOM   3837  C  C     . ILE A 1  531  ? 473.400 -29.572 611.985 1.00 25.40  ? 531  ILE A C     1 
ATOM   3838  O  O     . ILE A 1  531  ? 473.701 -30.701 611.601 1.00 26.54  ? 531  ILE A O     1 
ATOM   3839  C  CB    . ILE A 1  531  ? 471.467 -29.676 613.602 1.00 24.28  ? 531  ILE A CB    1 
ATOM   3840  C  CG1   . ILE A 1  531  ? 471.276 -31.181 613.795 1.00 25.35  ? 531  ILE A CG1   1 
ATOM   3841  C  CG2   . ILE A 1  531  ? 470.639 -29.177 612.428 1.00 23.91  ? 531  ILE A CG2   1 
ATOM   3842  C  CD1   . ILE A 1  531  ? 469.843 -31.575 614.081 1.00 25.10  ? 531  ILE A CD1   1 
ATOM   3843  N  N     . ARG A 1  532  ? 473.442 -28.507 611.189 1.00 41.57  ? 532  ARG A N     1 
ATOM   3844  C  CA    . ARG A 1  532  ? 473.992 -28.609 609.843 1.00 39.93  ? 532  ARG A CA    1 
ATOM   3845  C  C     . ARG A 1  532  ? 475.504 -28.788 609.930 1.00 42.02  ? 532  ARG A C     1 
ATOM   3846  O  O     . ARG A 1  532  ? 476.092 -29.562 609.174 1.00 44.78  ? 532  ARG A O     1 
ATOM   3847  C  CB    . ARG A 1  532  ? 473.634 -27.373 609.012 1.00 40.95  ? 532  ARG A CB    1 
ATOM   3848  C  CG    . ARG A 1  532  ? 474.817 -26.698 608.330 1.00 41.20  ? 532  ARG A CG    1 
ATOM   3849  C  CD    . ARG A 1  532  ? 474.996 -27.159 606.894 1.00 41.07  ? 532  ARG A CD    1 
ATOM   3850  N  NE    . ARG A 1  532  ? 476.404 -27.360 606.555 1.00 44.83  ? 532  ARG A NE    1 
ATOM   3851  C  CZ    . ARG A 1  532  ? 477.293 -26.382 606.398 1.00 46.83  ? 532  ARG A CZ    1 
ATOM   3852  N  NH1   . ARG A 1  532  ? 476.933 -25.115 606.557 1.00 46.99  ? 532  ARG A NH1   1 
ATOM   3853  N  NH2   . ARG A 1  532  ? 478.550 -26.672 606.088 1.00 47.13  ? 532  ARG A NH2   1 
ATOM   3854  N  N     . LYS A 1  533  ? 476.125 -28.078 610.869 1.00 42.19  ? 533  LYS A N     1 
ATOM   3855  C  CA    . LYS A 1  533  ? 477.570 -28.153 611.060 1.00 43.00  ? 533  LYS A CA    1 
ATOM   3856  C  C     . LYS A 1  533  ? 478.007 -29.513 611.598 1.00 44.02  ? 533  LYS A C     1 
ATOM   3857  O  O     . LYS A 1  533  ? 479.078 -30.015 611.257 1.00 47.54  ? 533  LYS A O     1 
ATOM   3858  C  CB    . LYS A 1  533  ? 478.038 -27.049 612.011 1.00 41.61  ? 533  LYS A CB    1 
ATOM   3859  C  CG    . LYS A 1  533  ? 478.084 -25.665 611.395 1.00 39.12  ? 533  LYS A CG    1 
ATOM   3860  C  CD    . LYS A 1  533  ? 479.191 -25.576 610.366 1.00 42.12  ? 533  LYS A CD    1 
ATOM   3861  C  CE    . LYS A 1  533  ? 480.556 -25.729 611.017 1.00 41.96  ? 533  LYS A CE    1 
ATOM   3862  N  NZ    . LYS A 1  533  ? 480.826 -24.636 611.991 1.00 40.07  ? 533  LYS A NZ    1 
ATOM   3863  N  N     . LEU A 1  534  ? 477.164 -30.103 612.438 1.00 27.33  ? 534  LEU A N     1 
ATOM   3864  C  CA    . LEU A 1  534  ? 477.495 -31.336 613.142 1.00 28.29  ? 534  LEU A CA    1 
ATOM   3865  C  C     . LEU A 1  534  ? 477.416 -32.565 612.243 1.00 29.55  ? 534  LEU A C     1 
ATOM   3866  O  O     . LEU A 1  534  ? 478.231 -33.478 612.358 1.00 30.76  ? 534  LEU A O     1 
ATOM   3867  C  CB    . LEU A 1  534  ? 476.564 -31.512 614.345 1.00 27.63  ? 534  LEU A CB    1 
ATOM   3868  C  CG    . LEU A 1  534  ? 476.694 -32.796 615.165 1.00 28.58  ? 534  LEU A CG    1 
ATOM   3869  C  CD1   . LEU A 1  534  ? 478.062 -32.879 615.813 1.00 29.23  ? 534  LEU A CD1   1 
ATOM   3870  C  CD2   . LEU A 1  534  ? 475.597 -32.872 616.214 1.00 27.86  ? 534  LEU A CD2   1 
ATOM   3871  N  N     . THR A 1  535  ? 476.436 -32.583 611.345 1.00 49.23  ? 535  THR A N     1 
ATOM   3872  C  CA    . THR A 1  535  ? 476.178 -33.766 610.530 1.00 51.13  ? 535  THR A CA    1 
ATOM   3873  C  C     . THR A 1  535  ? 476.993 -33.801 609.240 1.00 52.24  ? 535  THR A C     1 
ATOM   3874  O  O     . THR A 1  535  ? 476.719 -34.608 608.352 1.00 56.13  ? 535  THR A O     1 
ATOM   3875  C  CB    . THR A 1  535  ? 474.687 -33.880 610.175 1.00 49.72  ? 535  THR A CB    1 
ATOM   3876  O  OG1   . THR A 1  535  ? 474.228 -32.639 609.626 1.00 49.39  ? 535  THR A OG1   1 
ATOM   3877  C  CG2   . THR A 1  535  ? 473.878 -34.206 611.415 1.00 47.69  ? 535  THR A CG2   1 
ATOM   3878  N  N     . LEU A 1  536  ? 477.991 -32.929 609.135 1.00 29.55  ? 536  LEU A N     1 
ATOM   3879  C  CA    . LEU A 1  536  ? 478.907 -32.978 608.002 1.00 30.69  ? 536  LEU A CA    1 
ATOM   3880  C  C     . LEU A 1  536  ? 479.750 -34.245 608.096 1.00 32.30  ? 536  LEU A C     1 
ATOM   3881  O  O     . LEU A 1  536  ? 479.994 -34.747 609.193 1.00 32.43  ? 536  LEU A O     1 
ATOM   3882  C  CB    . LEU A 1  536  ? 479.802 -31.737 607.965 1.00 30.36  ? 536  LEU A CB    1 
ATOM   3883  C  CG    . LEU A 1  536  ? 479.106 -30.380 607.841 1.00 28.88  ? 536  LEU A CG    1 
ATOM   3884  C  CD1   . LEU A 1  536  ? 480.131 -29.261 607.739 1.00 28.83  ? 536  LEU A CD1   1 
ATOM   3885  C  CD2   . LEU A 1  536  ? 478.166 -30.359 606.647 1.00 28.73  ? 536  LEU A CD2   1 
ATOM   3886  N  N     . ARG A 1  537  ? 480.187 -34.769 606.955 1.00 43.08  ? 537  ARG A N     1 
ATOM   3887  C  CA    . ARG A 1  537  ? 481.000 -35.982 606.953 1.00 44.66  ? 537  ARG A CA    1 
ATOM   3888  C  C     . ARG A 1  537  ? 482.393 -35.719 607.518 1.00 44.93  ? 537  ARG A C     1 
ATOM   3889  O  O     . ARG A 1  537  ? 483.037 -36.626 608.042 1.00 48.53  ? 537  ARG A O     1 
ATOM   3890  C  CB    . ARG A 1  537  ? 481.103 -36.569 605.543 1.00 48.29  ? 537  ARG A CB    1 
ATOM   3891  C  CG    . ARG A 1  537  ? 479.902 -37.417 605.144 1.00 49.10  ? 537  ARG A CG    1 
ATOM   3892  C  CD    . ARG A 1  537  ? 480.310 -38.596 604.270 1.00 48.57  ? 537  ARG A CD    1 
ATOM   3893  N  NE    . ARG A 1  537  ? 480.303 -38.273 602.845 1.00 50.85  ? 537  ARG A NE    1 
ATOM   3894  C  CZ    . ARG A 1  537  ? 479.320 -38.598 602.011 1.00 51.60  ? 537  ARG A CZ    1 
ATOM   3895  N  NH1   . ARG A 1  537  ? 478.260 -39.258 602.456 1.00 48.62  ? 537  ARG A NH1   1 
ATOM   3896  N  NH2   . ARG A 1  537  ? 479.398 -38.265 600.730 1.00 53.44  ? 537  ARG A NH2   1 
ATOM   3897  N  N     . ASP A 1  538  ? 482.850 -34.475 607.419 1.00 51.23  ? 538  ASP A N     1 
ATOM   3898  C  CA    . ASP A 1  538  ? 484.145 -34.089 607.970 1.00 52.36  ? 538  ASP A CA    1 
ATOM   3899  C  C     . ASP A 1  538  ? 484.118 -34.025 609.493 1.00 52.72  ? 538  ASP A C     1 
ATOM   3900  O  O     . ASP A 1  538  ? 485.164 -34.049 610.142 1.00 53.41  ? 538  ASP A O     1 
ATOM   3901  C  CB    . ASP A 1  538  ? 484.586 -32.735 607.413 1.00 50.42  ? 538  ASP A CB    1 
ATOM   3902  C  CG    . ASP A 1  538  ? 485.209 -32.845 606.041 1.00 53.12  ? 538  ASP A CG    1 
ATOM   3903  O  OD1   . ASP A 1  538  ? 485.687 -33.944 605.689 1.00 56.43  ? 538  ASP A OD1   1 
ATOM   3904  O  OD2   . ASP A 1  538  ? 485.232 -31.827 605.318 1.00 55.05  ? 538  ASP A OD2   1 
ATOM   3905  N  N     . THR A 1  539  ? 482.919 -33.941 610.059 1.00 33.63  ? 539  THR A N     1 
ATOM   3906  C  CA    . THR A 1  539  ? 482.769 -33.753 611.496 1.00 32.79  ? 539  THR A CA    1 
ATOM   3907  C  C     . THR A 1  539  ? 482.875 -35.063 612.270 1.00 33.68  ? 539  THR A C     1 
ATOM   3908  O  O     . THR A 1  539  ? 481.970 -35.899 612.231 1.00 33.72  ? 539  THR A O     1 
ATOM   3909  C  CB    . THR A 1  539  ? 481.425 -33.085 611.832 1.00 31.08  ? 539  THR A CB    1 
ATOM   3910  O  OG1   . THR A 1  539  ? 481.327 -31.834 611.140 1.00 30.27  ? 539  THR A OG1   1 
ATOM   3911  C  CG2   . THR A 1  539  ? 481.311 -32.843 613.329 1.00 30.27  ? 539  THR A CG2   1 
ATOM   3912  N  N     . PHE A 1  540  ? 483.990 -35.231 612.973 1.00 44.62  ? 540  PHE A N     1 
ATOM   3913  C  CA    . PHE A 1  540  ? 484.177 -36.375 613.856 1.00 44.95  ? 540  PHE A CA    1 
ATOM   3914  C  C     . PHE A 1  540  ? 484.352 -35.899 615.292 1.00 43.57  ? 540  PHE A C     1 
ATOM   3915  O  O     . PHE A 1  540  ? 484.833 -34.792 615.535 1.00 43.30  ? 540  PHE A O     1 
ATOM   3916  C  CB    . PHE A 1  540  ? 485.380 -37.212 613.421 1.00 46.83  ? 540  PHE A CB    1 
ATOM   3917  C  CG    . PHE A 1  540  ? 485.218 -37.853 612.073 1.00 48.15  ? 540  PHE A CG    1 
ATOM   3918  C  CD1   . PHE A 1  540  ? 484.458 -39.000 611.924 1.00 47.31  ? 540  PHE A CD1   1 
ATOM   3919  C  CD2   . PHE A 1  540  ? 485.829 -37.310 610.955 1.00 50.04  ? 540  PHE A CD2   1 
ATOM   3920  C  CE1   . PHE A 1  540  ? 484.308 -39.593 610.684 1.00 49.79  ? 540  PHE A CE1   1 
ATOM   3921  C  CE2   . PHE A 1  540  ? 485.683 -37.898 609.713 1.00 48.51  ? 540  PHE A CE2   1 
ATOM   3922  C  CZ    . PHE A 1  540  ? 484.921 -39.040 609.577 1.00 49.82  ? 540  PHE A CZ    1 
ATOM   3923  N  N     . ILE A 1  541  ? 483.951 -36.735 616.243 1.00 49.24  ? 541  ILE A N     1 
ATOM   3924  C  CA    . ILE A 1  541  ? 484.002 -36.371 617.653 1.00 49.09  ? 541  ILE A CA    1 
ATOM   3925  C  C     . ILE A 1  541  ? 484.715 -37.444 618.473 1.00 52.43  ? 541  ILE A C     1 
ATOM   3926  O  O     . ILE A 1  541  ? 484.349 -38.618 618.421 1.00 53.09  ? 541  ILE A O     1 
ATOM   3927  C  CB    . ILE A 1  541  ? 482.590 -36.149 618.222 1.00 44.77  ? 541  ILE A CB    1 
ATOM   3928  C  CG1   . ILE A 1  541  ? 481.771 -35.261 617.284 1.00 43.32  ? 541  ILE A CG1   1 
ATOM   3929  C  CG2   . ILE A 1  541  ? 482.663 -35.533 619.604 1.00 46.87  ? 541  ILE A CG2   1 
ATOM   3930  C  CD1   . ILE A 1  541  ? 480.361 -35.019 617.752 1.00 42.90  ? 541  ILE A CD1   1 
ATOM   3931  N  N     . GLU A 1  542  ? 485.732 -37.037 619.228 1.00 59.84  ? 542  GLU A N     1 
ATOM   3932  C  CA    . GLU A 1  542  ? 486.515 -37.981 620.020 1.00 60.89  ? 542  GLU A CA    1 
ATOM   3933  C  C     . GLU A 1  542  ? 485.834 -38.303 621.350 1.00 61.31  ? 542  GLU A C     1 
ATOM   3934  O  O     . GLU A 1  542  ? 484.792 -37.735 621.674 1.00 58.93  ? 542  GLU A O     1 
ATOM   3935  C  CB    . GLU A 1  542  ? 487.927 -37.441 620.255 1.00 60.71  ? 542  GLU A CB    1 
ATOM   3936  C  CG    . GLU A 1  542  ? 487.985 -36.007 620.746 1.00 65.71  ? 542  GLU A CG    1 
ATOM   3937  C  CD    . GLU A 1  542  ? 489.391 -35.439 620.694 1.00 70.02  ? 542  GLU A CD    1 
ATOM   3938  O  OE1   . GLU A 1  542  ? 490.244 -36.030 619.998 1.00 67.89  ? 542  GLU A OE1   1 
ATOM   3939  O  OE2   . GLU A 1  542  ? 489.643 -34.404 621.349 1.00 68.18  ? 542  GLU A OE2   1 
ATOM   3940  N  N     . LEU A 1  543  ? 486.445 -39.207 622.112 1.00 54.03  ? 543  LEU A N     1 
ATOM   3941  C  CA    . LEU A 1  543  ? 485.808 -39.853 623.263 1.00 54.16  ? 543  LEU A CA    1 
ATOM   3942  C  C     . LEU A 1  543  ? 485.155 -38.915 624.279 1.00 53.01  ? 543  LEU A C     1 
ATOM   3943  O  O     . LEU A 1  543  ? 483.956 -39.016 624.523 1.00 53.78  ? 543  LEU A O     1 
ATOM   3944  C  CB    . LEU A 1  543  ? 486.828 -40.734 623.989 1.00 56.36  ? 543  LEU A CB    1 
ATOM   3945  C  CG    . LEU A 1  543  ? 486.305 -41.501 625.205 1.00 55.58  ? 543  LEU A CG    1 
ATOM   3946  C  CD1   . LEU A 1  543  ? 485.099 -42.351 624.831 1.00 53.55  ? 543  LEU A CD1   1 
ATOM   3947  C  CD2   . LEU A 1  543  ? 487.405 -42.363 625.805 1.00 61.39  ? 543  LEU A CD2   1 
ATOM   3948  N  N     . ASP A 1  544  ? 485.942 -38.022 624.872 1.00 65.72  ? 544  ASP A N     1 
ATOM   3949  C  CA    . ASP A 1  544  ? 485.462 -37.153 625.949 1.00 65.58  ? 544  ASP A CA    1 
ATOM   3950  C  C     . ASP A 1  544  ? 484.192 -36.383 625.583 1.00 63.04  ? 544  ASP A C     1 
ATOM   3951  O  O     . ASP A 1  544  ? 483.177 -36.448 626.292 1.00 61.86  ? 544  ASP A O     1 
ATOM   3952  C  CB    . ASP A 1  544  ? 486.561 -36.168 626.357 1.00 67.15  ? 544  ASP A CB    1 
ATOM   3953  C  CG    . ASP A 1  544  ? 487.268 -35.551 625.163 1.00 67.30  ? 544  ASP A CG    1 
ATOM   3954  O  OD1   . ASP A 1  544  ? 486.639 -35.426 624.091 1.00 65.08  ? 544  ASP A OD1   1 
ATOM   3955  O  OD2   . ASP A 1  544  ? 488.457 -35.191 625.296 1.00 71.00  ? 544  ASP A OD2   1 
ATOM   3956  N  N     . GLN A 1  545  ? 484.258 -35.665 624.468 1.00 52.28  ? 545  GLN A N     1 
ATOM   3957  C  CA    . GLN A 1  545  ? 483.140 -34.863 623.996 1.00 48.65  ? 545  GLN A CA    1 
ATOM   3958  C  C     . GLN A 1  545  ? 481.931 -35.750 623.709 1.00 49.02  ? 545  GLN A C     1 
ATOM   3959  O  O     . GLN A 1  545  ? 480.793 -35.368 623.980 1.00 48.36  ? 545  GLN A O     1 
ATOM   3960  C  CB    . GLN A 1  545  ? 483.541 -34.079 622.747 1.00 47.26  ? 545  GLN A CB    1 
ATOM   3961  C  CG    . GLN A 1  545  ? 483.009 -32.656 622.701 1.00 48.75  ? 545  GLN A CG    1 
ATOM   3962  C  CD    . GLN A 1  545  ? 483.281 -31.978 621.370 1.00 49.40  ? 545  GLN A CD    1 
ATOM   3963  O  OE1   . GLN A 1  545  ? 483.909 -32.556 620.482 1.00 49.78  ? 545  GLN A OE1   1 
ATOM   3964  N  NE2   . GLN A 1  545  ? 482.804 -30.746 621.224 1.00 47.75  ? 545  GLN A NE2   1 
ATOM   3965  N  N     . VAL A 1  546  ? 482.189 -36.940 623.173 1.00 37.85  ? 546  VAL A N     1 
ATOM   3966  C  CA    . VAL A 1  546  ? 481.131 -37.910 622.912 1.00 38.12  ? 546  VAL A CA    1 
ATOM   3967  C  C     . VAL A 1  546  ? 480.421 -38.302 624.201 1.00 37.96  ? 546  VAL A C     1 
ATOM   3968  O  O     . VAL A 1  546  ? 479.197 -38.364 624.248 1.00 37.29  ? 546  VAL A O     1 
ATOM   3969  C  CB    . VAL A 1  546  ? 481.677 -39.181 622.224 1.00 39.79  ? 546  VAL A CB    1 
ATOM   3970  C  CG1   . VAL A 1  546  ? 480.683 -40.331 622.335 1.00 40.30  ? 546  VAL A CG1   1 
ATOM   3971  C  CG2   . VAL A 1  546  ? 481.999 -38.896 620.772 1.00 39.90  ? 546  VAL A CG2   1 
ATOM   3972  N  N     . LEU A 1  547  ? 481.197 -38.558 625.249 1.00 38.43  ? 547  LEU A N     1 
ATOM   3973  C  CA    . LEU A 1  547  ? 480.633 -38.930 626.539 1.00 38.41  ? 547  LEU A CA    1 
ATOM   3974  C  C     . LEU A 1  547  ? 479.800 -37.787 627.117 1.00 36.80  ? 547  LEU A C     1 
ATOM   3975  O  O     . LEU A 1  547  ? 478.716 -38.012 627.666 1.00 36.41  ? 547  LEU A O     1 
ATOM   3976  C  CB    . LEU A 1  547  ? 481.742 -39.332 627.515 1.00 39.51  ? 547  LEU A CB    1 
ATOM   3977  C  CG    . LEU A 1  547  ? 482.652 -40.484 627.076 1.00 41.27  ? 547  LEU A CG    1 
ATOM   3978  C  CD1   . LEU A 1  547  ? 483.564 -40.918 628.214 1.00 42.34  ? 547  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU A 1  547  ? 481.842 -41.661 626.551 1.00 41.96  ? 547  LEU A CD2   1 
ATOM   3980  N  N     . ASN A 1  548  ? 480.301 -36.562 626.983 1.00 42.02  ? 548  ASN A N     1 
ATOM   3981  C  CA    . ASN A 1  548  ? 479.558 -35.396 627.456 1.00 40.03  ? 548  ASN A CA    1 
ATOM   3982  C  C     . ASN A 1  548  ? 478.225 -35.207 626.725 1.00 39.11  ? 548  ASN A C     1 
ATOM   3983  O  O     . ASN A 1  548  ? 477.190 -34.978 627.357 1.00 38.38  ? 548  ASN A O     1 
ATOM   3984  C  CB    . ASN A 1  548  ? 480.411 -34.133 627.324 1.00 39.39  ? 548  ASN A CB    1 
ATOM   3985  C  CG    . ASN A 1  548  ? 481.362 -33.947 628.493 1.00 39.83  ? 548  ASN A CG    1 
ATOM   3986  O  OD1   . ASN A 1  548  ? 481.027 -34.260 629.637 1.00 39.96  ? 548  ASN A OD1   1 
ATOM   3987  N  ND2   . ASN A 1  548  ? 482.556 -33.436 628.211 1.00 40.38  ? 548  ASN A ND2   1 
ATOM   3988  N  N     . MET A 1  549  ? 478.252 -35.308 625.399 1.00 40.72  ? 549  MET A N     1 
ATOM   3989  C  CA    . MET A 1  549  ? 477.035 -35.190 624.597 1.00 39.36  ? 549  MET A CA    1 
ATOM   3990  C  C     . MET A 1  549  ? 476.045 -36.300 624.921 1.00 39.86  ? 549  MET A C     1 
ATOM   3991  O  O     . MET A 1  549  ? 474.846 -36.057 625.055 1.00 39.50  ? 549  MET A O     1 
ATOM   3992  C  CB    . MET A 1  549  ? 477.365 -35.221 623.106 1.00 39.64  ? 549  MET A CB    1 
ATOM   3993  C  CG    . MET A 1  549  ? 478.261 -34.094 622.650 1.00 39.75  ? 549  MET A CG    1 
ATOM   3994  S  SD    . MET A 1  549  ? 478.672 -34.207 620.903 1.00 39.65  ? 549  MET A SD    1 
ATOM   3995  C  CE    . MET A 1  549  ? 480.008 -33.027 620.824 1.00 39.46  ? 549  MET A CE    1 
ATOM   3996  N  N     . LEU A 1  550  ? 476.562 -37.519 625.031 1.00 34.97  ? 550  LEU A N     1 
ATOM   3997  C  CA    . LEU A 1  550  ? 475.764 -38.682 625.395 1.00 35.67  ? 550  LEU A CA    1 
ATOM   3998  C  C     . LEU A 1  550  ? 475.049 -38.448 626.715 1.00 35.11  ? 550  LEU A C     1 
ATOM   3999  O  O     . LEU A 1  550  ? 473.856 -38.722 626.843 1.00 34.84  ? 550  LEU A O     1 
ATOM   4000  C  CB    . LEU A 1  550  ? 476.644 -39.930 625.491 1.00 37.33  ? 550  LEU A CB    1 
ATOM   4001  C  CG    . LEU A 1  550  ? 476.689 -40.887 624.299 1.00 38.36  ? 550  LEU A CG    1 
ATOM   4002  C  CD1   . LEU A 1  550  ? 476.799 -40.134 622.985 1.00 37.74  ? 550  LEU A CD1   1 
ATOM   4003  C  CD2   . LEU A 1  550  ? 477.856 -41.842 624.460 1.00 39.96  ? 550  LEU A CD2   1 
ATOM   4004  N  N     . TYR A 1  551  ? 475.784 -37.935 627.695 1.00 35.77  ? 551  TYR A N     1 
ATOM   4005  C  CA    . TYR A 1  551  ? 475.198 -37.677 629.002 1.00 35.31  ? 551  TYR A CA    1 
ATOM   4006  C  C     . TYR A 1  551  ? 474.225 -36.501 628.947 1.00 33.80  ? 551  TYR A C     1 
ATOM   4007  O  O     . TYR A 1  551  ? 473.318 -36.400 629.775 1.00 33.40  ? 551  TYR A O     1 
ATOM   4008  C  CB    . TYR A 1  551  ? 476.288 -37.418 630.045 1.00 35.65  ? 551  TYR A CB    1 
ATOM   4009  C  CG    . TYR A 1  551  ? 475.750 -37.235 631.446 1.00 35.36  ? 551  TYR A CG    1 
ATOM   4010  C  CD1   . TYR A 1  551  ? 474.785 -38.095 631.956 1.00 35.79  ? 551  TYR A CD1   1 
ATOM   4011  C  CD2   . TYR A 1  551  ? 476.208 -36.209 632.261 1.00 34.73  ? 551  TYR A CD2   1 
ATOM   4012  C  CE1   . TYR A 1  551  ? 474.286 -37.934 633.235 1.00 35.60  ? 551  TYR A CE1   1 
ATOM   4013  C  CE2   . TYR A 1  551  ? 475.716 -36.043 633.545 1.00 34.54  ? 551  TYR A CE2   1 
ATOM   4014  C  CZ    . TYR A 1  551  ? 474.755 -36.908 634.025 1.00 34.98  ? 551  TYR A CZ    1 
ATOM   4015  O  OH    . TYR A 1  551  ? 474.260 -36.748 635.299 1.00 34.86  ? 551  TYR A OH    1 
ATOM   4016  N  N     . TRP A 1  552  ? 474.404 -35.619 627.967 1.00 33.71  ? 552  TRP A N     1 
ATOM   4017  C  CA    . TRP A 1  552  ? 473.533 -34.453 627.845 1.00 32.32  ? 552  TRP A CA    1 
ATOM   4018  C  C     . TRP A 1  552  ? 472.106 -34.829 627.448 1.00 32.09  ? 552  TRP A C     1 
ATOM   4019  O  O     . TRP A 1  552  ? 471.173 -34.060 627.680 1.00 31.11  ? 552  TRP A O     1 
ATOM   4020  C  CB    . TRP A 1  552  ? 474.106 -33.452 626.841 1.00 31.67  ? 552  TRP A CB    1 
ATOM   4021  C  CG    . TRP A 1  552  ? 474.742 -32.267 627.502 1.00 30.96  ? 552  TRP A CG    1 
ATOM   4022  C  CD1   . TRP A 1  552  ? 476.077 -32.005 627.611 1.00 31.35  ? 552  TRP A CD1   1 
ATOM   4023  C  CD2   . TRP A 1  552  ? 474.067 -31.188 628.161 1.00 29.84  ? 552  TRP A CD2   1 
ATOM   4024  N  NE1   . TRP A 1  552  ? 476.274 -30.828 628.292 1.00 30.51  ? 552  TRP A NE1   1 
ATOM   4025  C  CE2   . TRP A 1  552  ? 475.056 -30.307 628.640 1.00 29.58  ? 552  TRP A CE2   1 
ATOM   4026  C  CE3   . TRP A 1  552  ? 472.723 -30.881 628.390 1.00 29.10  ? 552  TRP A CE3   1 
ATOM   4027  C  CZ2   . TRP A 1  552  ? 474.744 -29.140 629.334 1.00 28.61  ? 552  TRP A CZ2   1 
ATOM   4028  C  CZ3   . TRP A 1  552  ? 472.415 -29.721 629.079 1.00 28.15  ? 552  TRP A CZ3   1 
ATOM   4029  C  CH2   . TRP A 1  552  ? 473.421 -28.866 629.542 1.00 27.91  ? 552  TRP A CH2   1 
ATOM   4030  N  N     . VAL A 1  553  ? 471.935 -36.007 626.853 1.00 40.08  ? 553  VAL A N     1 
ATOM   4031  C  CA    . VAL A 1  553  ? 470.601 -36.516 626.545 1.00 39.74  ? 553  VAL A CA    1 
ATOM   4032  C  C     . VAL A 1  553  ? 469.984 -37.180 627.771 1.00 42.86  ? 553  VAL A C     1 
ATOM   4033  O  O     . VAL A 1  553  ? 470.527 -38.154 628.292 1.00 44.32  ? 553  VAL A O     1 
ATOM   4034  C  CB    . VAL A 1  553  ? 470.620 -37.537 625.392 1.00 42.06  ? 553  VAL A CB    1 
ATOM   4035  C  CG1   . VAL A 1  553  ? 469.229 -38.117 625.177 1.00 44.42  ? 553  VAL A CG1   1 
ATOM   4036  C  CG2   . VAL A 1  553  ? 471.127 -36.897 624.124 1.00 39.77  ? 553  VAL A CG2   1 
ATOM   4037  N  N     . PRO A 1  554  ? 468.846 -36.651 628.239 1.00 43.97  ? 554  PRO A N     1 
ATOM   4038  C  CA    . PRO A 1  554  ? 468.160 -37.222 629.403 1.00 45.93  ? 554  PRO A CA    1 
ATOM   4039  C  C     . PRO A 1  554  ? 467.527 -38.581 629.106 1.00 49.37  ? 554  PRO A C     1 
ATOM   4040  O  O     . PRO A 1  554  ? 467.319 -39.372 630.025 1.00 50.79  ? 554  PRO A O     1 
ATOM   4041  C  CB    . PRO A 1  554  ? 467.090 -36.175 629.727 1.00 45.06  ? 554  PRO A CB    1 
ATOM   4042  C  CG    . PRO A 1  554  ? 466.859 -35.460 628.442 1.00 44.86  ? 554  PRO A CG    1 
ATOM   4043  C  CD    . PRO A 1  554  ? 468.184 -35.431 627.746 1.00 40.29  ? 554  PRO A CD    1 
ATOM   4044  N  N     . ASP A 1  555  ? 467.233 -38.848 627.838 1.00 77.17  ? 555  ASP A N     1 
ATOM   4045  C  CA    . ASP A 1  555  ? 466.635 -40.121 627.450 1.00 79.23  ? 555  ASP A CA    1 
ATOM   4046  C  C     . ASP A 1  555  ? 467.689 -41.118 626.981 1.00 81.09  ? 555  ASP A C     1 
ATOM   4047  O  O     . ASP A 1  555  ? 467.389 -42.038 626.220 1.00 84.44  ? 555  ASP A O     1 
ATOM   4048  C  CB    . ASP A 1  555  ? 465.593 -39.913 626.349 1.00 80.54  ? 555  ASP A CB    1 
ATOM   4049  C  CG    . ASP A 1  555  ? 464.414 -39.082 626.811 1.00 79.68  ? 555  ASP A CG    1 
ATOM   4050  O  OD1   . ASP A 1  555  ? 464.228 -38.942 628.039 1.00 80.52  ? 555  ASP A OD1   1 
ATOM   4051  O  OD2   . ASP A 1  555  ? 463.668 -38.577 625.946 1.00 80.65  ? 555  ASP A OD2   1 
ATOM   4052  N  N     . TRP A 1  556  ? 468.923 -40.933 627.438 1.00 47.23  ? 556  TRP A N     1 
ATOM   4053  C  CA    . TRP A 1  556  ? 470.018 -41.818 627.060 1.00 48.86  ? 556  TRP A CA    1 
ATOM   4054  C  C     . TRP A 1  556  ? 469.942 -43.143 627.815 1.00 51.29  ? 556  TRP A C     1 
ATOM   4055  O  O     . TRP A 1  556  ? 469.706 -43.164 629.023 1.00 52.71  ? 556  TRP A O     1 
ATOM   4056  C  CB    . TRP A 1  556  ? 471.365 -41.144 627.319 1.00 48.06  ? 556  TRP A CB    1 
ATOM   4057  C  CG    . TRP A 1  556  ? 472.530 -41.948 626.843 1.00 49.14  ? 556  TRP A CG    1 
ATOM   4058  C  CD1   . TRP A 1  556  ? 472.600 -42.694 625.704 1.00 50.52  ? 556  TRP A CD1   1 
ATOM   4059  C  CD2   . TRP A 1  556  ? 473.792 -42.103 627.503 1.00 49.98  ? 556  TRP A CD2   1 
ATOM   4060  N  NE1   . TRP A 1  556  ? 473.831 -43.297 625.608 1.00 51.79  ? 556  TRP A NE1   1 
ATOM   4061  C  CE2   . TRP A 1  556  ? 474.581 -42.950 626.701 1.00 50.69  ? 556  TRP A CE2   1 
ATOM   4062  C  CE3   . TRP A 1  556  ? 474.332 -41.604 628.691 1.00 49.60  ? 556  TRP A CE3   1 
ATOM   4063  C  CZ2   . TRP A 1  556  ? 475.879 -43.310 627.049 1.00 51.44  ? 556  TRP A CZ2   1 
ATOM   4064  C  CZ3   . TRP A 1  556  ? 475.623 -41.962 629.034 1.00 49.58  ? 556  TRP A CZ3   1 
ATOM   4065  C  CH2   . TRP A 1  556  ? 476.381 -42.807 628.216 1.00 50.86  ? 556  TRP A CH2   1 
ATOM   4066  N  N     . ASP A 1  557  ? 470.151 -44.245 627.102 1.00 62.91  ? 557  ASP A N     1 
ATOM   4067  C  CA    . ASP A 1  557  ? 470.068 -45.571 627.707 1.00 63.99  ? 557  ASP A CA    1 
ATOM   4068  C  C     . ASP A 1  557  ? 471.328 -45.926 628.490 1.00 65.78  ? 557  ASP A C     1 
ATOM   4069  O  O     . ASP A 1  557  ? 471.375 -46.947 629.176 1.00 68.75  ? 557  ASP A O     1 
ATOM   4070  C  CB    . ASP A 1  557  ? 469.802 -46.632 626.635 1.00 65.67  ? 557  ASP A CB    1 
ATOM   4071  C  CG    . ASP A 1  557  ? 470.742 -46.518 625.448 1.00 69.08  ? 557  ASP A CG    1 
ATOM   4072  O  OD1   . ASP A 1  557  ? 471.792 -45.852 625.571 1.00 67.97  ? 557  ASP A OD1   1 
ATOM   4073  O  OD2   . ASP A 1  557  ? 470.431 -47.101 624.388 1.00 72.15  ? 557  ASP A OD2   1 
ATOM   4074  N  N     . GLY A 1  558  ? 472.349 -45.082 628.380 1.00 47.29  ? 558  GLY A N     1 
ATOM   4075  C  CA    . GLY A 1  558  ? 473.602 -45.311 629.075 1.00 47.38  ? 558  GLY A CA    1 
ATOM   4076  C  C     . GLY A 1  558  ? 474.530 -46.225 628.302 1.00 48.73  ? 558  GLY A C     1 
ATOM   4077  O  O     . GLY A 1  558  ? 475.604 -46.588 628.782 1.00 50.66  ? 558  GLY A O     1 
ATOM   4078  N  N     . VAL A 1  559  ? 474.112 -46.599 627.097 1.00 51.95  ? 559  VAL A N     1 
ATOM   4079  C  CA    . VAL A 1  559  ? 474.904 -47.474 626.242 1.00 53.99  ? 559  VAL A CA    1 
ATOM   4080  C  C     . VAL A 1  559  ? 475.760 -46.672 625.268 1.00 53.38  ? 559  VAL A C     1 
ATOM   4081  O  O     . VAL A 1  559  ? 475.238 -45.959 624.411 1.00 51.21  ? 559  VAL A O     1 
ATOM   4082  C  CB    . VAL A 1  559  ? 474.008 -48.440 625.441 1.00 54.67  ? 559  VAL A CB    1 
ATOM   4083  C  CG1   . VAL A 1  559  ? 474.842 -49.245 624.455 1.00 59.06  ? 559  VAL A CG1   1 
ATOM   4084  C  CG2   . VAL A 1  559  ? 473.244 -49.360 626.381 1.00 57.02  ? 559  VAL A CG2   1 
ATOM   4085  N  N     . ILE A 1  560  ? 477.077 -46.790 625.407 1.00 55.47  ? 560  ILE A N     1 
ATOM   4086  C  CA    . ILE A 1  560  ? 478.002 -46.131 624.494 1.00 53.41  ? 560  ILE A CA    1 
ATOM   4087  C  C     . ILE A 1  560  ? 477.926 -46.769 623.113 1.00 56.41  ? 560  ILE A C     1 
ATOM   4088  O  O     . ILE A 1  560  ? 478.176 -47.965 622.966 1.00 62.63  ? 560  ILE A O     1 
ATOM   4089  C  CB    . ILE A 1  560  ? 479.457 -46.205 624.995 1.00 55.66  ? 560  ILE A CB    1 
ATOM   4090  C  CG1   . ILE A 1  560  ? 479.543 -45.814 626.470 1.00 57.16  ? 560  ILE A CG1   1 
ATOM   4091  C  CG2   . ILE A 1  560  ? 480.354 -45.313 624.150 1.00 53.79  ? 560  ILE A CG2   1 
ATOM   4092  C  CD1   . ILE A 1  560  ? 479.287 -44.352 626.720 1.00 55.50  ? 560  ILE A CD1   1 
ATOM   4093  N  N     . PRO A 1  561  ? 477.573 -45.973 622.094 1.00 40.90  ? 561  PRO A N     1 
ATOM   4094  C  CA    . PRO A 1  561  ? 477.532 -46.493 620.725 1.00 41.64  ? 561  PRO A CA    1 
ATOM   4095  C  C     . PRO A 1  561  ? 478.930 -46.788 620.198 1.00 42.88  ? 561  PRO A C     1 
ATOM   4096  O  O     . PRO A 1  561  ? 479.850 -46.002 620.428 1.00 42.51  ? 561  PRO A O     1 
ATOM   4097  C  CB    . PRO A 1  561  ? 476.875 -45.356 619.937 1.00 40.10  ? 561  PRO A CB    1 
ATOM   4098  C  CG    . PRO A 1  561  ? 477.201 -44.128 620.716 1.00 38.81  ? 561  PRO A CG    1 
ATOM   4099  C  CD    . PRO A 1  561  ? 477.194 -44.552 622.159 1.00 39.09  ? 561  PRO A CD    1 
ATOM   4100  N  N     . THR A 1  562  ? 479.087 -47.916 619.514 1.00 49.20  ? 562  THR A N     1 
ATOM   4101  C  CA    . THR A 1  562  ? 480.368 -48.272 618.920 1.00 50.55  ? 562  THR A CA    1 
ATOM   4102  C  C     . THR A 1  562  ? 480.741 -47.249 617.853 1.00 49.80  ? 562  THR A C     1 
ATOM   4103  O  O     . THR A 1  562  ? 479.981 -47.031 616.908 1.00 49.25  ? 562  THR A O     1 
ATOM   4104  C  CB    . THR A 1  562  ? 480.337 -49.682 618.307 1.00 52.35  ? 562  THR A CB    1 
ATOM   4105  O  OG1   . THR A 1  562  ? 480.045 -50.639 619.332 1.00 53.14  ? 562  THR A OG1   1 
ATOM   4106  C  CG2   . THR A 1  562  ? 481.678 -50.020 617.674 1.00 53.82  ? 562  THR A CG2   1 
ATOM   4107  N  N     . PRO A 1  563  ? 481.913 -46.611 618.010 1.00 45.68  ? 563  PRO A N     1 
ATOM   4108  C  CA    . PRO A 1  563  ? 482.372 -45.533 617.126 1.00 44.95  ? 563  PRO A CA    1 
ATOM   4109  C  C     . PRO A 1  563  ? 482.462 -45.955 615.665 1.00 45.86  ? 563  PRO A C     1 
ATOM   4110  O  O     . PRO A 1  563  ? 482.758 -47.113 615.372 1.00 47.51  ? 563  PRO A O     1 
ATOM   4111  C  CB    . PRO A 1  563  ? 483.763 -45.191 617.677 1.00 45.45  ? 563  PRO A CB    1 
ATOM   4112  C  CG    . PRO A 1  563  ? 484.178 -46.392 618.458 1.00 46.98  ? 563  PRO A CG    1 
ATOM   4113  C  CD    . PRO A 1  563  ? 482.913 -46.934 619.041 1.00 46.56  ? 563  PRO A CD    1 
ATOM   4114  N  N     . ALA A 1  564  ? 482.202 -45.015 614.763 1.00 48.65  ? 564  ALA A N     1 
ATOM   4115  C  CA    . ALA A 1  564  ? 482.300 -45.275 613.334 1.00 49.43  ? 564  ALA A CA    1 
ATOM   4116  C  C     . ALA A 1  564  ? 483.737 -45.607 612.956 1.00 51.00  ? 564  ALA A C     1 
ATOM   4117  O  O     . ALA A 1  564  ? 483.983 -46.331 611.995 1.00 52.35  ? 564  ALA A O     1 
ATOM   4118  C  CB    . ALA A 1  564  ? 481.800 -44.080 612.539 1.00 47.98  ? 564  ALA A CB    1 
ATOM   4119  N  N     . ILE A 1  565  ? 484.682 -45.072 613.721 1.00 44.77  ? 565  ILE A N     1 
ATOM   4120  C  CA    . ILE A 1  565  ? 486.096 -45.355 613.513 1.00 46.30  ? 565  ILE A CA    1 
ATOM   4121  C  C     . ILE A 1  565  ? 486.668 -46.093 614.719 1.00 47.27  ? 565  ILE A C     1 
ATOM   4122  O  O     . ILE A 1  565  ? 486.477 -45.668 615.859 1.00 46.29  ? 565  ILE A O     1 
ATOM   4123  C  CB    . ILE A 1  565  ? 486.906 -44.065 613.276 1.00 45.57  ? 565  ILE A CB    1 
ATOM   4124  C  CG1   . ILE A 1  565  ? 486.186 -43.147 612.286 1.00 44.26  ? 565  ILE A CG1   1 
ATOM   4125  C  CG2   . ILE A 1  565  ? 488.308 -44.397 612.791 1.00 47.32  ? 565  ILE A CG2   1 
ATOM   4126  C  CD1   . ILE A 1  565  ? 486.068 -43.717 610.893 1.00 45.30  ? 565  ILE A CD1   1 
ATOM   4127  N  N     . ILE A 1  566  ? 487.360 -47.201 614.469 1.00 54.41  ? 566  ILE A N     1 
ATOM   4128  C  CA    . ILE A 1  566  ? 487.993 -47.962 615.541 1.00 55.57  ? 566  ILE A CA    1 
ATOM   4129  C  C     . ILE A 1  566  ? 489.490 -47.677 615.601 1.00 56.55  ? 566  ILE A C     1 
ATOM   4130  O  O     . ILE A 1  566  ? 490.005 -47.220 616.621 1.00 56.19  ? 566  ILE A O     1 
ATOM   4131  C  CB    . ILE A 1  566  ? 487.774 -49.474 615.371 1.00 57.29  ? 566  ILE A CB    1 
ATOM   4132  C  CG1   . ILE A 1  566  ? 486.282 -49.804 615.420 1.00 56.41  ? 566  ILE A CG1   1 
ATOM   4133  C  CG2   . ILE A 1  566  ? 488.517 -50.240 616.454 1.00 58.62  ? 566  ILE A CG2   1 
ATOM   4134  C  CD1   . ILE A 1  566  ? 485.630 -49.478 616.744 1.00 55.11  ? 566  ILE A CD1   1 
ATOM   4135  N  N     . LYS A 1  567  ? 490.182 -47.954 614.501 1.00 63.91  ? 567  LYS A N     1 
ATOM   4136  C  CA    . LYS A 1  567  ? 491.607 -47.668 614.397 1.00 64.96  ? 567  LYS A CA    1 
ATOM   4137  C  C     . LYS A 1  567  ? 491.856 -46.674 613.267 1.00 64.46  ? 567  LYS A C     1 
ATOM   4138  O  O     . LYS A 1  567  ? 491.102 -46.642 612.295 1.00 64.03  ? 567  LYS A O     1 
ATOM   4139  C  CB    . LYS A 1  567  ? 492.403 -48.959 614.172 1.00 67.43  ? 567  LYS A CB    1 
ATOM   4140  C  CG    . LYS A 1  567  ? 492.404 -49.904 615.366 1.00 72.70  ? 567  LYS A CG    1 
ATOM   4141  C  CD    . LYS A 1  567  ? 493.644 -50.788 615.378 1.00 75.85  ? 567  LYS A CD    1 
ATOM   4142  C  CE    . LYS A 1  567  ? 493.756 -51.617 614.109 1.00 79.00  ? 567  LYS A CE    1 
ATOM   4143  N  NZ    . LYS A 1  567  ? 494.975 -52.471 614.115 1.00 80.71  ? 567  LYS A NZ    1 
ATOM   4144  N  N     . PRO A 1  568  ? 492.918 -45.859 613.384 1.00 66.54  ? 568  PRO A N     1 
ATOM   4145  C  CA    . PRO A 1  568  ? 493.900 -45.838 614.473 1.00 67.17  ? 568  PRO A CA    1 
ATOM   4146  C  C     . PRO A 1  568  ? 493.483 -44.967 615.656 1.00 65.30  ? 568  PRO A C     1 
ATOM   4147  O  O     . PRO A 1  568  ? 494.312 -44.672 616.516 1.00 65.57  ? 568  PRO A O     1 
ATOM   4148  C  CB    . PRO A 1  568  ? 495.139 -45.262 613.795 1.00 68.16  ? 568  PRO A CB    1 
ATOM   4149  C  CG    . PRO A 1  568  ? 494.577 -44.308 612.798 1.00 66.86  ? 568  PRO A CG    1 
ATOM   4150  C  CD    . PRO A 1  568  ? 493.278 -44.913 612.312 1.00 66.30  ? 568  PRO A CD    1 
ATOM   4151  N  N     . LYS A 1  569  ? 492.216 -44.566 615.694 1.00 65.19  ? 569  LYS A N     1 
ATOM   4152  C  CA    . LYS A 1  569  ? 491.711 -43.718 616.768 1.00 60.14  ? 569  LYS A CA    1 
ATOM   4153  C  C     . LYS A 1  569  ? 490.189 -43.756 616.822 1.00 58.70  ? 569  LYS A C     1 
ATOM   4154  O  O     . LYS A 1  569  ? 489.524 -43.482 615.823 1.00 59.07  ? 569  LYS A O     1 
ATOM   4155  C  CB    . LYS A 1  569  ? 492.192 -42.277 616.586 1.00 59.82  ? 569  LYS A CB    1 
ATOM   4156  C  CG    . LYS A 1  569  ? 491.644 -41.300 617.611 1.00 57.26  ? 569  LYS A CG    1 
ATOM   4157  C  CD    . LYS A 1  569  ? 492.098 -39.881 617.310 1.00 56.38  ? 569  LYS A CD    1 
ATOM   4158  C  CE    . LYS A 1  569  ? 491.538 -38.895 618.322 1.00 56.76  ? 569  LYS A CE    1 
ATOM   4159  N  NZ    . LYS A 1  569  ? 491.940 -37.493 618.017 1.00 53.83  ? 569  LYS A NZ    1 
ATOM   4160  N  N     . PRO A 1  570  ? 489.632 -44.098 617.993 1.00 49.40  ? 570  PRO A N     1 
ATOM   4161  C  CA    . PRO A 1  570  ? 488.177 -44.161 618.173 1.00 48.14  ? 570  PRO A CA    1 
ATOM   4162  C  C     . PRO A 1  570  ? 487.505 -42.805 617.964 1.00 46.10  ? 570  PRO A C     1 
ATOM   4163  O  O     . PRO A 1  570  ? 487.625 -41.918 618.810 1.00 45.05  ? 570  PRO A O     1 
ATOM   4164  C  CB    . PRO A 1  570  ? 488.019 -44.635 619.623 1.00 48.25  ? 570  PRO A CB    1 
ATOM   4165  C  CG    . PRO A 1  570  ? 489.312 -44.287 620.286 1.00 48.86  ? 570  PRO A CG    1 
ATOM   4166  C  CD    . PRO A 1  570  ? 490.358 -44.444 619.226 1.00 50.19  ? 570  PRO A CD    1 
ATOM   4167  N  N     . LEU A 1  571  ? 486.810 -42.654 616.840 1.00 55.65  ? 571  LEU A N     1 
ATOM   4168  C  CA    . LEU A 1  571  ? 486.110 -41.412 616.529 1.00 52.16  ? 571  LEU A CA    1 
ATOM   4169  C  C     . LEU A 1  571  ? 484.638 -41.655 616.226 1.00 52.23  ? 571  LEU A C     1 
ATOM   4170  O  O     . LEU A 1  571  ? 484.281 -42.626 615.559 1.00 53.86  ? 571  LEU A O     1 
ATOM   4171  C  CB    . LEU A 1  571  ? 486.766 -40.702 615.342 1.00 52.25  ? 571  LEU A CB    1 
ATOM   4172  C  CG    . LEU A 1  571  ? 488.139 -40.072 615.575 1.00 52.76  ? 571  LEU A CG    1 
ATOM   4173  C  CD1   . LEU A 1  571  ? 488.607 -39.342 614.327 1.00 53.60  ? 571  LEU A CD1   1 
ATOM   4174  C  CD2   . LEU A 1  571  ? 488.101 -39.131 616.768 1.00 51.89  ? 571  LEU A CD2   1 
ATOM   4175  N  N     . TRP A 1  572  ? 483.788 -40.764 616.724 1.00 47.84  ? 572  TRP A N     1 
ATOM   4176  C  CA    . TRP A 1  572  ? 482.362 -40.808 616.429 1.00 46.93  ? 572  TRP A CA    1 
ATOM   4177  C  C     . TRP A 1  572  ? 481.999 -39.687 615.466 1.00 45.76  ? 572  TRP A C     1 
ATOM   4178  O  O     . TRP A 1  572  ? 482.523 -38.579 615.571 1.00 44.98  ? 572  TRP A O     1 
ATOM   4179  C  CB    . TRP A 1  572  ? 481.532 -40.681 617.708 1.00 45.95  ? 572  TRP A CB    1 
ATOM   4180  C  CG    . TRP A 1  572  ? 481.603 -41.866 618.621 1.00 47.06  ? 572  TRP A CG    1 
ATOM   4181  C  CD1   . TRP A 1  572  ? 480.640 -42.815 618.805 1.00 47.40  ? 572  TRP A CD1   1 
ATOM   4182  C  CD2   . TRP A 1  572  ? 482.691 -42.226 619.481 1.00 48.04  ? 572  TRP A CD2   1 
ATOM   4183  N  NE1   . TRP A 1  572  ? 481.062 -43.744 619.724 1.00 48.53  ? 572  TRP A NE1   1 
ATOM   4184  C  CE2   . TRP A 1  572  ? 482.317 -43.405 620.154 1.00 48.94  ? 572  TRP A CE2   1 
ATOM   4185  C  CE3   . TRP A 1  572  ? 483.945 -41.667 619.745 1.00 48.29  ? 572  TRP A CE3   1 
ATOM   4186  C  CZ2   . TRP A 1  572  ? 483.152 -44.037 621.072 1.00 50.09  ? 572  TRP A CZ2   1 
ATOM   4187  C  CZ3   . TRP A 1  572  ? 484.772 -42.295 620.658 1.00 49.44  ? 572  TRP A CZ3   1 
ATOM   4188  C  CH2   . TRP A 1  572  ? 484.373 -43.467 621.310 1.00 50.32  ? 572  TRP A CH2   1 
ATOM   4189  N  N     . SER A 1  573  ? 481.101 -39.972 614.530 1.00 56.97  ? 573  SER A N     1 
ATOM   4190  C  CA    . SER A 1  573  ? 480.625 -38.947 613.610 1.00 56.50  ? 573  SER A CA    1 
ATOM   4191  C  C     . SER A 1  573  ? 479.458 -38.185 614.230 1.00 55.59  ? 573  SER A C     1 
ATOM   4192  O  O     . SER A 1  573  ? 478.820 -38.667 615.167 1.00 54.31  ? 573  SER A O     1 
ATOM   4193  C  CB    . SER A 1  573  ? 480.210 -39.566 612.277 1.00 57.18  ? 573  SER A CB    1 
ATOM   4194  O  OG    . SER A 1  573  ? 479.122 -40.456 612.447 1.00 56.95  ? 573  SER A OG    1 
ATOM   4195  N  N     . GLY A 1  574  ? 479.188 -36.993 613.706 1.00 62.92  ? 574  GLY A N     1 
ATOM   4196  C  CA    . GLY A 1  574  ? 478.116 -36.159 614.217 1.00 59.90  ? 574  GLY A CA    1 
ATOM   4197  C  C     . GLY A 1  574  ? 476.763 -36.834 614.118 1.00 59.55  ? 574  GLY A C     1 
ATOM   4198  O  O     . GLY A 1  574  ? 475.980 -36.820 615.072 1.00 59.90  ? 574  GLY A O     1 
ATOM   4199  N  N     . LYS A 1  575  ? 476.496 -37.429 612.958 1.00 35.15  ? 575  LYS A N     1 
ATOM   4200  C  CA    . LYS A 1  575  ? 475.258 -38.162 612.724 1.00 35.28  ? 575  LYS A CA    1 
ATOM   4201  C  C     . LYS A 1  575  ? 475.067 -39.246 613.779 1.00 35.95  ? 575  LYS A C     1 
ATOM   4202  O  O     . LYS A 1  575  ? 473.961 -39.460 614.282 1.00 35.50  ? 575  LYS A O     1 
ATOM   4203  C  CB    . LYS A 1  575  ? 475.259 -38.796 611.330 1.00 36.33  ? 575  LYS A CB    1 
ATOM   4204  C  CG    . LYS A 1  575  ? 475.695 -37.875 610.201 1.00 36.03  ? 575  LYS A CG    1 
ATOM   4205  C  CD    . LYS A 1  575  ? 475.702 -38.624 608.875 1.00 37.25  ? 575  LYS A CD    1 
ATOM   4206  C  CE    . LYS A 1  575  ? 476.349 -37.810 607.767 1.00 37.23  ? 575  LYS A CE    1 
ATOM   4207  N  NZ    . LYS A 1  575  ? 475.594 -36.567 607.462 1.00 35.76  ? 575  LYS A NZ    1 
ATOM   4208  N  N     . GLN A 1  576  ? 476.166 -39.914 614.111 1.00 41.31  ? 576  GLN A N     1 
ATOM   4209  C  CA    . GLN A 1  576  ? 476.146 -41.044 615.028 1.00 42.22  ? 576  GLN A CA    1 
ATOM   4210  C  C     . GLN A 1  576  ? 475.657 -40.648 616.419 1.00 41.23  ? 576  GLN A C     1 
ATOM   4211  O  O     . GLN A 1  576  ? 474.728 -41.254 616.953 1.00 41.28  ? 576  GLN A O     1 
ATOM   4212  C  CB    . GLN A 1  576  ? 477.541 -41.666 615.116 1.00 43.61  ? 576  GLN A CB    1 
ATOM   4213  C  CG    . GLN A 1  576  ? 477.579 -43.049 615.735 1.00 44.95  ? 576  GLN A CG    1 
ATOM   4214  C  CD    . GLN A 1  576  ? 478.954 -43.675 615.649 1.00 46.47  ? 576  GLN A CD    1 
ATOM   4215  O  OE1   . GLN A 1  576  ? 479.882 -43.083 615.099 1.00 46.55  ? 576  GLN A OE1   1 
ATOM   4216  N  NE2   . GLN A 1  576  ? 479.093 -44.878 616.193 1.00 47.76  ? 576  GLN A NE2   1 
ATOM   4217  N  N     . ILE A 1  577  ? 476.277 -39.628 617.002 1.00 47.17  ? 577  ILE A N     1 
ATOM   4218  C  CA    . ILE A 1  577  ? 475.906 -39.194 618.343 1.00 46.85  ? 577  ILE A CA    1 
ATOM   4219  C  C     . ILE A 1  577  ? 474.584 -38.428 618.341 1.00 44.50  ? 577  ILE A C     1 
ATOM   4220  O  O     . ILE A 1  577  ? 473.875 -38.405 619.346 1.00 41.09  ? 577  ILE A O     1 
ATOM   4221  C  CB    . ILE A 1  577  ? 477.010 -38.324 618.982 1.00 43.68  ? 577  ILE A CB    1 
ATOM   4222  C  CG1   . ILE A 1  577  ? 477.446 -37.213 618.026 1.00 45.59  ? 577  ILE A CG1   1 
ATOM   4223  C  CG2   . ILE A 1  577  ? 478.206 -39.180 619.365 1.00 45.61  ? 577  ILE A CG2   1 
ATOM   4224  C  CD1   . ILE A 1  577  ? 476.790 -35.873 618.296 1.00 46.62  ? 577  ILE A CD1   1 
ATOM   4225  N  N     . LEU A 1  578  ? 474.253 -37.804 617.213 1.00 35.23  ? 578  LEU A N     1 
ATOM   4226  C  CA    . LEU A 1  578  ? 472.971 -37.116 617.087 1.00 34.04  ? 578  LEU A CA    1 
ATOM   4227  C  C     . LEU A 1  578  ? 471.825 -38.123 617.041 1.00 34.53  ? 578  LEU A C     1 
ATOM   4228  O  O     . LEU A 1  578  ? 470.705 -37.825 617.462 1.00 33.75  ? 578  LEU A O     1 
ATOM   4229  C  CB    . LEU A 1  578  ? 472.948 -36.232 615.838 1.00 33.47  ? 578  LEU A CB    1 
ATOM   4230  C  CG    . LEU A 1  578  ? 471.627 -35.518 615.538 1.00 32.35  ? 578  LEU A CG    1 
ATOM   4231  C  CD1   . LEU A 1  578  ? 471.274 -34.542 616.647 1.00 31.13  ? 578  LEU A CD1   1 
ATOM   4232  C  CD2   . LEU A 1  578  ? 471.679 -34.810 614.197 1.00 32.05  ? 578  LEU A CD2   1 
ATOM   4233  N  N     . SER A 1  579  ? 472.119 -39.319 616.538 1.00 56.98  ? 579  SER A N     1 
ATOM   4234  C  CA    . SER A 1  579  ? 471.120 -40.378 616.407 1.00 57.38  ? 579  SER A CA    1 
ATOM   4235  C  C     . SER A 1  579  ? 470.527 -40.788 617.752 1.00 56.94  ? 579  SER A C     1 
ATOM   4236  O  O     . SER A 1  579  ? 469.425 -41.336 617.811 1.00 57.62  ? 579  SER A O     1 
ATOM   4237  C  CB    . SER A 1  579  ? 471.729 -41.604 615.728 1.00 62.42  ? 579  SER A CB    1 
ATOM   4238  O  OG    . SER A 1  579  ? 472.437 -41.243 614.558 1.00 62.20  ? 579  SER A OG    1 
ATOM   4239  N  N     . VAL A 1  580  ? 471.268 -40.529 618.825 1.00 40.26  ? 580  VAL A N     1 
ATOM   4240  C  CA    . VAL A 1  580  ? 470.818 -40.866 620.170 1.00 40.24  ? 580  VAL A CA    1 
ATOM   4241  C  C     . VAL A 1  580  ? 469.572 -40.060 620.530 1.00 38.96  ? 580  VAL A C     1 
ATOM   4242  O  O     . VAL A 1  580  ? 468.682 -40.548 621.227 1.00 39.09  ? 580  VAL A O     1 
ATOM   4243  C  CB    . VAL A 1  580  ? 471.924 -40.612 621.217 1.00 40.29  ? 580  VAL A CB    1 
ATOM   4244  C  CG1   . VAL A 1  580  ? 471.503 -41.138 622.578 1.00 40.53  ? 580  VAL A CG1   1 
ATOM   4245  C  CG2   . VAL A 1  580  ? 473.224 -41.264 620.782 1.00 41.53  ? 580  VAL A CG2   1 
ATOM   4246  N  N     . ALA A 1  581  ? 469.512 -38.827 620.035 1.00 31.65  ? 581  ALA A N     1 
ATOM   4247  C  CA    . ALA A 1  581  ? 468.377 -37.946 620.287 1.00 30.44  ? 581  ALA A CA    1 
ATOM   4248  C  C     . ALA A 1  581  ? 467.112 -38.445 619.589 1.00 30.64  ? 581  ALA A C     1 
ATOM   4249  O  O     . ALA A 1  581  ? 465.998 -38.189 620.048 1.00 30.08  ? 581  ALA A O     1 
ATOM   4250  C  CB    . ALA A 1  581  ? 468.702 -36.528 619.843 1.00 29.28  ? 581  ALA A CB    1 
ATOM   4251  N  N     . ILE A 1  582  ? 467.292 -39.157 618.480 1.00 28.97  ? 582  ILE A N     1 
ATOM   4252  C  CA    . ILE A 1  582  ? 466.169 -39.684 617.711 1.00 29.31  ? 582  ILE A CA    1 
ATOM   4253  C  C     . ILE A 1  582  ? 465.702 -41.024 618.269 1.00 30.42  ? 582  ILE A C     1 
ATOM   4254  O  O     . ILE A 1  582  ? 466.497 -41.957 618.395 1.00 31.53  ? 582  ILE A O     1 
ATOM   4255  C  CB    . ILE A 1  582  ? 466.533 -39.861 616.226 1.00 29.84  ? 582  ILE A CB    1 
ATOM   4256  C  CG1   . ILE A 1  582  ? 467.203 -38.597 615.682 1.00 28.91  ? 582  ILE A CG1   1 
ATOM   4257  C  CG2   . ILE A 1  582  ? 465.298 -40.212 615.412 1.00 30.04  ? 582  ILE A CG2   1 
ATOM   4258  C  CD1   . ILE A 1  582  ? 467.631 -38.711 614.233 1.00 29.46  ? 582  ILE A CD1   1 
ATOM   4259  N  N     . PRO A 1  583  ? 464.405 -41.122 618.604 1.00 43.90  ? 583  PRO A N     1 
ATOM   4260  C  CA    . PRO A 1  583  ? 463.803 -42.340 619.160 1.00 48.20  ? 583  PRO A CA    1 
ATOM   4261  C  C     . PRO A 1  583  ? 463.817 -43.506 618.177 1.00 50.02  ? 583  PRO A C     1 
ATOM   4262  O  O     . PRO A 1  583  ? 463.934 -43.292 616.972 1.00 50.37  ? 583  PRO A O     1 
ATOM   4263  C  CB    . PRO A 1  583  ? 462.361 -41.915 619.466 1.00 45.80  ? 583  PRO A CB    1 
ATOM   4264  C  CG    . PRO A 1  583  ? 462.398 -40.427 619.529 1.00 42.39  ? 583  PRO A CG    1 
ATOM   4265  C  CD    . PRO A 1  583  ? 463.435 -40.017 618.535 1.00 41.96  ? 583  PRO A CD    1 
ATOM   4266  N  N     . ASN A 1  584  ? 463.693 -44.725 618.692 1.00 57.79  ? 584  ASN A N     1 
ATOM   4267  C  CA    . ASN A 1  584  ? 463.648 -45.912 617.847 1.00 60.72  ? 584  ASN A CA    1 
ATOM   4268  C  C     . ASN A 1  584  ? 462.328 -46.019 617.093 1.00 62.97  ? 584  ASN A C     1 
ATOM   4269  O  O     . ASN A 1  584  ? 461.317 -45.452 617.511 1.00 61.55  ? 584  ASN A O     1 
ATOM   4270  C  CB    . ASN A 1  584  ? 463.872 -47.172 618.683 1.00 63.64  ? 584  ASN A CB    1 
ATOM   4271  C  CG    . ASN A 1  584  ? 465.179 -47.139 619.446 1.00 63.33  ? 584  ASN A CG    1 
ATOM   4272  O  OD1   . ASN A 1  584  ? 466.110 -46.425 619.073 1.00 63.21  ? 584  ASN A OD1   1 
ATOM   4273  N  ND2   . ASN A 1  584  ? 465.257 -47.915 620.522 1.00 66.80  ? 584  ASN A ND2   1 
ATOM   4274  N  N     . GLY A 1  585  ? 462.343 -46.747 615.981 1.00 69.61  ? 585  GLY A N     1 
ATOM   4275  C  CA    . GLY A 1  585  ? 461.148 -46.944 615.182 1.00 69.81  ? 585  GLY A CA    1 
ATOM   4276  C  C     . GLY A 1  585  ? 460.837 -45.765 614.281 1.00 66.72  ? 585  GLY A C     1 
ATOM   4277  O  O     . GLY A 1  585  ? 459.779 -45.715 613.653 1.00 67.57  ? 585  GLY A O     1 
ATOM   4278  N  N     . ILE A 1  586  ? 461.762 -44.812 614.218 1.00 54.99  ? 586  ILE A N     1 
ATOM   4279  C  CA    . ILE A 1  586  ? 461.589 -43.631 613.378 1.00 54.30  ? 586  ILE A CA    1 
ATOM   4280  C  C     . ILE A 1  586  ? 462.304 -43.802 612.043 1.00 55.02  ? 586  ILE A C     1 
ATOM   4281  O  O     . ILE A 1  586  ? 463.533 -43.777 611.976 1.00 55.25  ? 586  ILE A O     1 
ATOM   4282  C  CB    . ILE A 1  586  ? 462.107 -42.359 614.072 1.00 49.14  ? 586  ILE A CB    1 
ATOM   4283  C  CG1   . ILE A 1  586  ? 461.317 -42.092 615.354 1.00 48.20  ? 586  ILE A CG1   1 
ATOM   4284  C  CG2   . ILE A 1  586  ? 462.005 -41.164 613.139 1.00 47.27  ? 586  ILE A CG2   1 
ATOM   4285  C  CD1   . ILE A 1  586  ? 459.846 -41.832 615.119 1.00 47.13  ? 586  ILE A CD1   1 
ATOM   4286  N  N     . HIS A 1  587  ? 461.525 -43.981 610.983 1.00 50.62  ? 587  HIS A N     1 
ATOM   4287  C  CA    . HIS A 1  587  ? 462.082 -44.160 609.650 1.00 51.78  ? 587  HIS A CA    1 
ATOM   4288  C  C     . HIS A 1  587  ? 461.805 -42.931 608.796 1.00 49.69  ? 587  HIS A C     1 
ATOM   4289  O  O     . HIS A 1  587  ? 460.658 -42.500 608.671 1.00 49.75  ? 587  HIS A O     1 
ATOM   4290  C  CB    . HIS A 1  587  ? 461.504 -45.413 608.986 1.00 58.60  ? 587  HIS A CB    1 
ATOM   4291  C  CG    . HIS A 1  587  ? 461.441 -46.602 609.893 1.00 60.68  ? 587  HIS A CG    1 
ATOM   4292  N  ND1   . HIS A 1  587  ? 462.559 -47.317 610.263 1.00 60.08  ? 587  HIS A ND1   1 
ATOM   4293  C  CD2   . HIS A 1  587  ? 460.392 -47.199 610.508 1.00 59.76  ? 587  HIS A CD2   1 
ATOM   4294  C  CE1   . HIS A 1  587  ? 462.203 -48.304 611.067 1.00 62.79  ? 587  HIS A CE1   1 
ATOM   4295  N  NE2   . HIS A 1  587  ? 460.893 -48.255 611.231 1.00 61.18  ? 587  HIS A NE2   1 
ATOM   4296  N  N     . LEU A 1  588  ? 462.854 -42.365 608.209 1.00 41.53  ? 588  LEU A N     1 
ATOM   4297  C  CA    . LEU A 1  588  ? 462.695 -41.166 607.393 1.00 40.59  ? 588  LEU A CA    1 
ATOM   4298  C  C     . LEU A 1  588  ? 463.481 -41.266 606.092 1.00 41.35  ? 588  LEU A C     1 
ATOM   4299  O  O     . LEU A 1  588  ? 464.698 -41.421 606.102 1.00 41.77  ? 588  LEU A O     1 
ATOM   4300  C  CB    . LEU A 1  588  ? 463.133 -39.928 608.177 1.00 39.16  ? 588  LEU A CB    1 
ATOM   4301  C  CG    . LEU A 1  588  ? 462.970 -38.587 607.464 1.00 38.10  ? 588  LEU A CG    1 
ATOM   4302  C  CD1   . LEU A 1  588  ? 461.510 -38.336 607.120 1.00 37.76  ? 588  LEU A CD1   1 
ATOM   4303  C  CD2   . LEU A 1  588  ? 463.524 -37.462 608.320 1.00 36.85  ? 588  LEU A CD2   1 
ATOM   4304  N  N     . GLN A 1  589  ? 462.778 -41.174 604.969 1.00 54.57  ? 589  GLN A N     1 
ATOM   4305  C  CA    . GLN A 1  589  ? 463.424 -41.276 603.667 1.00 54.92  ? 589  GLN A CA    1 
ATOM   4306  C  C     . GLN A 1  589  ? 463.041 -40.107 602.768 1.00 55.92  ? 589  GLN A C     1 
ATOM   4307  O  O     . GLN A 1  589  ? 461.861 -39.788 602.617 1.00 56.13  ? 589  GLN A O     1 
ATOM   4308  C  CB    . GLN A 1  589  ? 463.063 -42.605 602.999 1.00 59.05  ? 589  GLN A CB    1 
ATOM   4309  C  CG    . GLN A 1  589  ? 463.717 -42.825 601.646 1.00 61.46  ? 589  GLN A CG    1 
ATOM   4310  C  CD    . GLN A 1  589  ? 463.474 -44.221 601.105 1.00 66.33  ? 589  GLN A CD    1 
ATOM   4311  O  OE1   . GLN A 1  589  ? 463.245 -44.405 599.911 1.00 70.70  ? 589  GLN A OE1   1 
ATOM   4312  N  NE2   . GLN A 1  589  ? 463.528 -45.215 601.985 1.00 66.53  ? 589  GLN A NE2   1 
ATOM   4313  N  N     . ARG A 1  590  ? 464.047 -39.468 602.179 1.00 47.86  ? 590  ARG A N     1 
ATOM   4314  C  CA    . ARG A 1  590  ? 463.826 -38.341 601.279 1.00 47.11  ? 590  ARG A CA    1 
ATOM   4315  C  C     . ARG A 1  590  ? 465.003 -38.144 600.331 1.00 49.46  ? 590  ARG A C     1 
ATOM   4316  O  O     . ARG A 1  590  ? 466.124 -37.902 600.767 1.00 48.94  ? 590  ARG A O     1 
ATOM   4317  C  CB    . ARG A 1  590  ? 463.585 -37.055 602.072 1.00 44.80  ? 590  ARG A CB    1 
ATOM   4318  C  CG    . ARG A 1  590  ? 463.623 -35.796 601.221 1.00 43.94  ? 590  ARG A CG    1 
ATOM   4319  C  CD    . ARG A 1  590  ? 463.410 -34.543 602.057 1.00 41.62  ? 590  ARG A CD    1 
ATOM   4320  N  NE    . ARG A 1  590  ? 464.367 -34.441 603.156 1.00 40.04  ? 590  ARG A NE    1 
ATOM   4321  C  CZ    . ARG A 1  590  ? 465.584 -33.920 603.043 1.00 38.97  ? 590  ARG A CZ    1 
ATOM   4322  N  NH1   . ARG A 1  590  ? 466.003 -33.451 601.875 1.00 38.42  ? 590  ARG A NH1   1 
ATOM   4323  N  NH2   . ARG A 1  590  ? 466.385 -33.869 604.100 1.00 39.02  ? 590  ARG A NH2   1 
ATOM   4324  N  N     . PHE A 1  591  ? 464.744 -38.245 599.032 1.00 53.80  ? 591  PHE A N     1 
ATOM   4325  C  CA    . PHE A 1  591  ? 465.775 -37.995 598.033 1.00 54.55  ? 591  PHE A CA    1 
ATOM   4326  C  C     . PHE A 1  591  ? 465.687 -36.557 597.536 1.00 51.02  ? 591  PHE A C     1 
ATOM   4327  O  O     . PHE A 1  591  ? 464.594 -36.032 597.325 1.00 50.92  ? 591  PHE A O     1 
ATOM   4328  C  CB    . PHE A 1  591  ? 465.645 -38.970 596.860 1.00 58.71  ? 591  PHE A CB    1 
ATOM   4329  C  CG    . PHE A 1  591  ? 465.779 -40.412 597.254 1.00 58.95  ? 591  PHE A CG    1 
ATOM   4330  C  CD1   . PHE A 1  591  ? 467.019 -41.029 597.266 1.00 58.84  ? 591  PHE A CD1   1 
ATOM   4331  C  CD2   . PHE A 1  591  ? 464.663 -41.153 597.608 1.00 57.93  ? 591  PHE A CD2   1 
ATOM   4332  C  CE1   . PHE A 1  591  ? 467.146 -42.356 597.627 1.00 61.52  ? 591  PHE A CE1   1 
ATOM   4333  C  CE2   . PHE A 1  591  ? 464.783 -42.480 597.969 1.00 62.76  ? 591  PHE A CE2   1 
ATOM   4334  C  CZ    . PHE A 1  591  ? 466.027 -43.084 597.979 1.00 64.95  ? 591  PHE A CZ    1 
ATOM   4335  N  N     . ASP A 1  592  ? 466.840 -35.920 597.358 1.00 63.31  ? 592  ASP A N     1 
ATOM   4336  C  CA    . ASP A 1  592  ? 466.878 -34.551 596.861 1.00 63.56  ? 592  ASP A CA    1 
ATOM   4337  C  C     . ASP A 1  592  ? 467.159 -34.522 595.362 1.00 66.61  ? 592  ASP A C     1 
ATOM   4338  O  O     . ASP A 1  592  ? 466.340 -34.978 594.565 1.00 70.21  ? 592  ASP A O     1 
ATOM   4339  C  CB    . ASP A 1  592  ? 467.926 -33.730 597.616 1.00 64.96  ? 592  ASP A CB    1 
ATOM   4340  C  CG    . ASP A 1  592  ? 467.492 -33.394 599.033 1.00 63.30  ? 592  ASP A CG    1 
ATOM   4341  O  OD1   . ASP A 1  592  ? 466.272 -33.396 599.300 1.00 61.68  ? 592  ASP A OD1   1 
ATOM   4342  O  OD2   . ASP A 1  592  ? 468.370 -33.120 599.879 1.00 61.63  ? 592  ASP A OD2   1 
ATOM   4343  N  N     . GLU A 1  593  ? 468.314 -33.988 594.982 1.00 101.88 ? 593  GLU A N     1 
ATOM   4344  C  CA    . GLU A 1  593  ? 468.675 -33.896 593.572 1.00 104.20 ? 593  GLU A CA    1 
ATOM   4345  C  C     . GLU A 1  593  ? 469.332 -35.179 593.077 1.00 111.26 ? 593  GLU A C     1 
ATOM   4346  O  O     . GLU A 1  593  ? 468.665 -36.057 592.529 1.00 114.95 ? 593  GLU A O     1 
ATOM   4347  C  CB    . GLU A 1  593  ? 469.605 -32.707 593.334 1.00 103.65 ? 593  GLU A CB    1 
ATOM   4348  C  CG    . GLU A 1  593  ? 468.968 -31.360 593.628 1.00 109.60 ? 593  GLU A CG    1 
ATOM   4349  C  CD    . GLU A 1  593  ? 469.884 -30.199 593.302 1.00 116.38 ? 593  GLU A CD    1 
ATOM   4350  O  OE1   . GLU A 1  593  ? 470.987 -30.442 592.767 1.00 117.64 ? 593  GLU A OE1   1 
ATOM   4351  O  OE2   . GLU A 1  593  ? 469.501 -29.042 593.579 1.00 114.90 ? 593  GLU A OE2   1 
ATOM   4352  N  N     . GLY A 1  594  ? 470.642 -35.282 593.273 1.00 74.68  ? 594  GLY A N     1 
ATOM   4353  C  CA    . GLY A 1  594  ? 471.387 -36.444 592.824 1.00 76.35  ? 594  GLY A CA    1 
ATOM   4354  C  C     . GLY A 1  594  ? 471.577 -37.484 593.911 1.00 76.03  ? 594  GLY A C     1 
ATOM   4355  O  O     . GLY A 1  594  ? 472.627 -38.121 593.994 1.00 81.08  ? 594  GLY A O     1 
ATOM   4356  N  N     . THR A 1  595  ? 470.558 -37.657 594.747 1.00 59.45  ? 595  THR A N     1 
ATOM   4357  C  CA    . THR A 1  595  ? 470.620 -38.624 595.836 1.00 61.71  ? 595  THR A CA    1 
ATOM   4358  C  C     . THR A 1  595  ? 470.377 -40.037 595.315 1.00 62.63  ? 595  THR A C     1 
ATOM   4359  O  O     . THR A 1  595  ? 469.268 -40.374 594.900 1.00 62.45  ? 595  THR A O     1 
ATOM   4360  C  CB    . THR A 1  595  ? 469.593 -38.306 596.938 1.00 59.48  ? 595  THR A CB    1 
ATOM   4361  O  OG1   . THR A 1  595  ? 469.687 -36.923 597.300 1.00 56.11  ? 595  THR A OG1   1 
ATOM   4362  C  CG2   . THR A 1  595  ? 469.850 -39.164 598.165 1.00 60.70  ? 595  THR A CG2   1 
ATOM   4363  N  N     . THR A 1  596  ? 471.420 -40.859 595.339 1.00 66.31  ? 596  THR A N     1 
ATOM   4364  C  CA    . THR A 1  596  ? 471.342 -42.206 594.791 1.00 71.23  ? 596  THR A CA    1 
ATOM   4365  C  C     . THR A 1  596  ? 471.824 -43.257 595.782 1.00 72.46  ? 596  THR A C     1 
ATOM   4366  O  O     . THR A 1  596  ? 472.710 -44.052 595.461 1.00 78.09  ? 596  THR A O     1 
ATOM   4367  C  CB    . THR A 1  596  ? 472.173 -42.332 593.498 1.00 74.83  ? 596  THR A CB    1 
ATOM   4368  O  OG1   . THR A 1  596  ? 473.530 -41.953 593.762 1.00 67.79  ? 596  THR A OG1   1 
ATOM   4369  C  CG2   . THR A 1  596  ? 471.606 -41.440 592.405 1.00 76.96  ? 596  THR A CG2   1 
ATOM   4370  N  N     . LEU A 1  597  ? 471.260 -43.242 596.988 1.00 55.36  ? 597  LEU A N     1 
ATOM   4371  C  CA    . LEU A 1  597  ? 471.584 -44.212 598.043 1.00 57.05  ? 597  LEU A CA    1 
ATOM   4372  C  C     . LEU A 1  597  ? 473.047 -44.169 598.497 1.00 56.52  ? 597  LEU A C     1 
ATOM   4373  O  O     . LEU A 1  597  ? 473.356 -44.504 599.641 1.00 55.15  ? 597  LEU A O     1 
ATOM   4374  C  CB    . LEU A 1  597  ? 471.231 -45.634 597.589 1.00 59.51  ? 597  LEU A CB    1 
ATOM   4375  C  CG    . LEU A 1  597  ? 469.743 -45.960 597.456 1.00 58.59  ? 597  LEU A CG    1 
ATOM   4376  C  CD1   . LEU A 1  597  ? 469.548 -47.335 596.841 1.00 62.46  ? 597  LEU A CD1   1 
ATOM   4377  C  CD2   . LEU A 1  597  ? 469.061 -45.878 598.811 1.00 55.30  ? 597  LEU A CD2   1 
ATOM   4378  N  N     . LEU A 1  598  ? 473.942 -43.767 597.601 1.00 57.82  ? 598  LEU A N     1 
ATOM   4379  C  CA    . LEU A 1  598  ? 475.348 -43.602 597.932 1.00 58.21  ? 598  LEU A CA    1 
ATOM   4380  C  C     . LEU A 1  598  ? 475.655 -42.120 598.122 1.00 56.64  ? 598  LEU A C     1 
ATOM   4381  O  O     . LEU A 1  598  ? 476.629 -41.763 598.786 1.00 56.42  ? 598  LEU A O     1 
ATOM   4382  C  CB    . LEU A 1  598  ? 476.233 -44.207 596.841 1.00 60.08  ? 598  LEU A CB    1 
ATOM   4383  C  CG    . LEU A 1  598  ? 477.704 -44.438 597.192 1.00 61.02  ? 598  LEU A CG    1 
ATOM   4384  C  CD1   . LEU A 1  598  ? 477.826 -45.373 598.384 1.00 61.42  ? 598  LEU A CD1   1 
ATOM   4385  C  CD2   . LEU A 1  598  ? 478.455 -44.992 595.994 1.00 62.93  ? 598  LEU A CD2   1 
ATOM   4386  N  N     . SER A 1  599  ? 474.810 -41.279 597.524 1.00 67.84  ? 599  SER A N     1 
ATOM   4387  C  CA    . SER A 1  599  ? 474.838 -39.817 597.669 1.00 65.20  ? 599  SER A CA    1 
ATOM   4388  C  C     . SER A 1  599  ? 476.235 -39.212 597.792 1.00 65.11  ? 599  SER A C     1 
ATOM   4389  O  O     . SER A 1  599  ? 476.711 -38.963 598.899 1.00 64.09  ? 599  SER A O     1 
ATOM   4390  C  CB    . SER A 1  599  ? 474.001 -39.398 598.881 1.00 62.35  ? 599  SER A CB    1 
ATOM   4391  O  OG    . SER A 1  599  ? 474.542 -39.922 600.081 1.00 64.10  ? 599  SER A OG    1 
ATOM   4392  N  N     . PRO A 1  600  ? 476.889 -38.963 596.650 1.00 68.98  ? 600  PRO A N     1 
ATOM   4393  C  CA    . PRO A 1  600  ? 478.252 -38.421 596.629 1.00 71.34  ? 600  PRO A CA    1 
ATOM   4394  C  C     . PRO A 1  600  ? 478.352 -37.027 597.243 1.00 69.46  ? 600  PRO A C     1 
ATOM   4395  O  O     . PRO A 1  600  ? 479.442 -36.610 597.637 1.00 72.94  ? 600  PRO A O     1 
ATOM   4396  C  CB    . PRO A 1  600  ? 478.590 -38.382 595.134 1.00 76.76  ? 600  PRO A CB    1 
ATOM   4397  C  CG    . PRO A 1  600  ? 477.268 -38.332 594.448 1.00 75.97  ? 600  PRO A CG    1 
ATOM   4398  C  CD    . PRO A 1  600  ? 476.349 -39.154 595.294 1.00 70.29  ? 600  PRO A CD    1 
ATOM   4399  N  N     . LYS A 1  601  ? 477.229 -36.322 597.328 1.00 56.26  ? 601  LYS A N     1 
ATOM   4400  C  CA    . LYS A 1  601  ? 477.216 -34.968 597.870 1.00 54.98  ? 601  LYS A CA    1 
ATOM   4401  C  C     . LYS A 1  601  ? 476.664 -34.935 599.294 1.00 51.96  ? 601  LYS A C     1 
ATOM   4402  O  O     . LYS A 1  601  ? 476.474 -33.861 599.870 1.00 47.96  ? 601  LYS A O     1 
ATOM   4403  C  CB    . LYS A 1  601  ? 476.399 -34.044 596.966 1.00 52.63  ? 601  LYS A CB    1 
ATOM   4404  C  CG    . LYS A 1  601  ? 476.932 -33.942 595.544 1.00 54.95  ? 601  LYS A CG    1 
ATOM   4405  C  CD    . LYS A 1  601  ? 476.010 -33.110 594.664 1.00 55.02  ? 601  LYS A CD    1 
ATOM   4406  C  CE    . LYS A 1  601  ? 475.863 -31.694 595.197 1.00 56.55  ? 601  LYS A CE    1 
ATOM   4407  N  NZ    . LYS A 1  601  ? 474.922 -30.883 594.376 1.00 54.20  ? 601  LYS A NZ    1 
ATOM   4408  N  N     . ASP A 1  602  ? 476.411 -36.120 599.847 1.00 56.15  ? 602  ASP A N     1 
ATOM   4409  C  CA    . ASP A 1  602  ? 475.877 -36.278 601.201 1.00 54.33  ? 602  ASP A CA    1 
ATOM   4410  C  C     . ASP A 1  602  ? 474.572 -35.504 601.384 1.00 50.78  ? 602  ASP A C     1 
ATOM   4411  O  O     . ASP A 1  602  ? 474.262 -35.039 602.480 1.00 52.90  ? 602  ASP A O     1 
ATOM   4412  C  CB    . ASP A 1  602  ? 476.910 -35.837 602.245 1.00 53.82  ? 602  ASP A CB    1 
ATOM   4413  C  CG    . ASP A 1  602  ? 476.615 -36.388 603.633 1.00 52.69  ? 602  ASP A CG    1 
ATOM   4414  O  OD1   . ASP A 1  602  ? 475.997 -37.471 603.729 1.00 52.23  ? 602  ASP A OD1   1 
ATOM   4415  O  OD2   . ASP A 1  602  ? 477.003 -35.739 604.629 1.00 49.68  ? 602  ASP A OD2   1 
ATOM   4416  N  N     . ASN A 1  603  ? 473.811 -35.368 600.304 1.00 61.92  ? 603  ASN A N     1 
ATOM   4417  C  CA    . ASN A 1  603  ? 472.512 -34.713 600.370 1.00 60.39  ? 603  ASN A CA    1 
ATOM   4418  C  C     . ASN A 1  603  ? 471.409 -35.742 600.566 1.00 59.05  ? 603  ASN A C     1 
ATOM   4419  O  O     . ASN A 1  603  ? 471.682 -36.932 600.727 1.00 60.04  ? 603  ASN A O     1 
ATOM   4420  C  CB    . ASN A 1  603  ? 472.254 -33.886 599.110 1.00 60.62  ? 603  ASN A CB    1 
ATOM   4421  C  CG    . ASN A 1  603  ? 472.109 -34.743 597.871 1.00 64.73  ? 603  ASN A CG    1 
ATOM   4422  O  OD1   . ASN A 1  603  ? 471.001 -35.113 597.485 1.00 66.19  ? 603  ASN A OD1   1 
ATOM   4423  N  ND2   . ASN A 1  603  ? 473.232 -35.066 597.239 1.00 66.92  ? 603  ASN A ND2   1 
ATOM   4424  N  N     . GLY A 1  604  ? 470.163 -35.284 600.547 1.00 59.94  ? 604  GLY A N     1 
ATOM   4425  C  CA    . GLY A 1  604  ? 469.039 -36.157 600.822 1.00 61.78  ? 604  GLY A CA    1 
ATOM   4426  C  C     . GLY A 1  604  ? 469.024 -36.539 602.288 1.00 60.53  ? 604  GLY A C     1 
ATOM   4427  O  O     . GLY A 1  604  ? 469.667 -35.885 603.110 1.00 61.13  ? 604  GLY A O     1 
ATOM   4428  N  N     . MET A 1  605  ? 468.296 -37.601 602.616 1.00 47.70  ? 605  MET A N     1 
ATOM   4429  C  CA    . MET A 1  605  ? 468.192 -38.058 603.995 1.00 50.23  ? 605  MET A CA    1 
ATOM   4430  C  C     . MET A 1  605  ? 467.634 -39.471 604.105 1.00 53.54  ? 605  MET A C     1 
ATOM   4431  O  O     . MET A 1  605  ? 466.529 -39.755 603.643 1.00 53.38  ? 605  MET A O     1 
ATOM   4432  C  CB    . MET A 1  605  ? 467.318 -37.106 604.814 1.00 48.60  ? 605  MET A CB    1 
ATOM   4433  C  CG    . MET A 1  605  ? 467.032 -37.594 606.228 1.00 46.19  ? 605  MET A CG    1 
ATOM   4434  S  SD    . MET A 1  605  ? 468.014 -36.776 607.501 1.00 49.84  ? 605  MET A SD    1 
ATOM   4435  C  CE    . MET A 1  605  ? 469.672 -37.286 607.079 1.00 45.86  ? 605  MET A CE    1 
ATOM   4436  N  N     . LEU A 1  606  ? 468.411 -40.352 604.723 1.00 44.25  ? 606  LEU A N     1 
ATOM   4437  C  CA    . LEU A 1  606  ? 467.940 -41.685 605.065 1.00 45.29  ? 606  LEU A CA    1 
ATOM   4438  C  C     . LEU A 1  606  ? 468.252 -41.981 606.523 1.00 45.08  ? 606  LEU A C     1 
ATOM   4439  O  O     . LEU A 1  606  ? 469.418 -41.952 606.945 1.00 45.29  ? 606  LEU A O     1 
ATOM   4440  C  CB    . LEU A 1  606  ? 468.567 -42.745 604.163 1.00 47.02  ? 606  LEU A CB    1 
ATOM   4441  C  CG    . LEU A 1  606  ? 468.196 -44.192 604.497 1.00 48.29  ? 606  LEU A CG    1 
ATOM   4442  C  CD1   . LEU A 1  606  ? 466.691 -44.393 604.422 1.00 48.04  ? 606  LEU A CD1   1 
ATOM   4443  C  CD2   . LEU A 1  606  ? 468.916 -45.159 603.574 1.00 50.05  ? 606  LEU A CD2   1 
ATOM   4444  N  N     . ILE A 1  607  ? 467.187 -42.250 607.275 1.00 41.97  ? 607  ILE A N     1 
ATOM   4445  C  CA    . ILE A 1  607  ? 467.245 -42.565 608.696 1.00 41.78  ? 607  ILE A CA    1 
ATOM   4446  C  C     . ILE A 1  607  ? 466.485 -43.860 608.968 1.00 42.82  ? 607  ILE A C     1 
ATOM   4447  O  O     . ILE A 1  607  ? 465.264 -43.917 608.795 1.00 42.61  ? 607  ILE A O     1 
ATOM   4448  C  CB    . ILE A 1  607  ? 466.637 -41.438 609.557 1.00 40.14  ? 607  ILE A CB    1 
ATOM   4449  C  CG1   . ILE A 1  607  ? 467.309 -40.098 609.257 1.00 39.09  ? 607  ILE A CG1   1 
ATOM   4450  C  CG2   . ILE A 1  607  ? 466.741 -41.777 611.037 1.00 40.03  ? 607  ILE A CG2   1 
ATOM   4451  C  CD1   . ILE A 1  607  ? 466.736 -38.946 610.050 1.00 37.54  ? 607  ILE A CD1   1 
ATOM   4452  N  N     . ILE A 1  608  ? 467.208 -44.892 609.393 1.00 39.61  ? 608  ILE A N     1 
ATOM   4453  C  CA    . ILE A 1  608  ? 466.611 -46.202 609.634 1.00 40.79  ? 608  ILE A CA    1 
ATOM   4454  C  C     . ILE A 1  608  ? 466.564 -46.549 611.120 1.00 40.67  ? 608  ILE A C     1 
ATOM   4455  O  O     . ILE A 1  608  ? 467.605 -46.696 611.763 1.00 40.96  ? 608  ILE A O     1 
ATOM   4456  C  CB    . ILE A 1  608  ? 467.378 -47.314 608.888 1.00 42.55  ? 608  ILE A CB    1 
ATOM   4457  C  CG1   . ILE A 1  608  ? 467.290 -47.102 607.376 1.00 42.86  ? 608  ILE A CG1   1 
ATOM   4458  C  CG2   . ILE A 1  608  ? 466.831 -48.682 609.263 1.00 43.82  ? 608  ILE A CG2   1 
ATOM   4459  C  CD1   . ILE A 1  608  ? 465.876 -47.121 606.841 1.00 42.66  ? 608  ILE A CD1   1 
ATOM   4460  N  N     . ASP A 1  609  ? 465.349 -46.679 611.647 1.00 65.30  ? 609  ASP A N     1 
ATOM   4461  C  CA    . ASP A 1  609  ? 465.119 -47.055 613.041 1.00 66.03  ? 609  ASP A CA    1 
ATOM   4462  C  C     . ASP A 1  609  ? 465.827 -46.112 614.015 1.00 65.24  ? 609  ASP A C     1 
ATOM   4463  O  O     . ASP A 1  609  ? 466.576 -46.548 614.889 1.00 68.09  ? 609  ASP A O     1 
ATOM   4464  C  CB    . ASP A 1  609  ? 465.565 -48.502 613.285 1.00 69.87  ? 609  ASP A CB    1 
ATOM   4465  C  CG    . ASP A 1  609  ? 465.078 -49.049 614.614 1.00 71.74  ? 609  ASP A CG    1 
ATOM   4466  O  OD1   . ASP A 1  609  ? 465.763 -49.922 615.187 1.00 75.93  ? 609  ASP A OD1   1 
ATOM   4467  O  OD2   . ASP A 1  609  ? 464.013 -48.603 615.089 1.00 72.82  ? 609  ASP A OD2   1 
ATOM   4468  N  N     . GLY A 1  610  ? 465.592 -44.814 613.851 1.00 60.58  ? 610  GLY A N     1 
ATOM   4469  C  CA    . GLY A 1  610  ? 466.163 -43.820 614.741 1.00 57.48  ? 610  GLY A CA    1 
ATOM   4470  C  C     . GLY A 1  610  ? 467.652 -43.603 614.546 1.00 57.81  ? 610  GLY A C     1 
ATOM   4471  O  O     . GLY A 1  610  ? 468.289 -42.879 615.312 1.00 57.54  ? 610  GLY A O     1 
ATOM   4472  N  N     . GLN A 1  611  ? 468.208 -44.238 613.521 1.00 47.80  ? 611  GLN A N     1 
ATOM   4473  C  CA    . GLN A 1  611  ? 469.618 -44.078 613.193 1.00 48.48  ? 611  GLN A CA    1 
ATOM   4474  C  C     . GLN A 1  611  ? 469.766 -43.477 611.804 1.00 48.02  ? 611  GLN A C     1 
ATOM   4475  O  O     . GLN A 1  611  ? 469.369 -44.086 610.812 1.00 50.86  ? 611  GLN A O     1 
ATOM   4476  C  CB    . GLN A 1  611  ? 470.349 -45.421 613.270 1.00 53.52  ? 611  GLN A CB    1 
ATOM   4477  C  CG    . GLN A 1  611  ? 470.465 -45.985 614.675 1.00 54.59  ? 611  GLN A CG    1 
ATOM   4478  C  CD    . GLN A 1  611  ? 471.332 -45.126 615.573 1.00 52.73  ? 611  GLN A CD    1 
ATOM   4479  O  OE1   . GLN A 1  611  ? 470.913 -44.723 616.660 1.00 53.97  ? 611  GLN A OE1   1 
ATOM   4480  N  NE2   . GLN A 1  611  ? 472.550 -44.841 615.124 1.00 50.92  ? 611  GLN A NE2   1 
ATOM   4481  N  N     . ILE A 1  612  ? 470.329 -42.276 611.736 1.00 49.92  ? 612  ILE A N     1 
ATOM   4482  C  CA    . ILE A 1  612  ? 470.513 -41.604 610.456 1.00 50.40  ? 612  ILE A CA    1 
ATOM   4483  C  C     . ILE A 1  612  ? 471.577 -42.322 609.629 1.00 50.66  ? 612  ILE A C     1 
ATOM   4484  O  O     . ILE A 1  612  ? 472.751 -42.371 610.001 1.00 50.70  ? 612  ILE A O     1 
ATOM   4485  C  CB    . ILE A 1  612  ? 470.892 -40.116 610.642 1.00 48.02  ? 612  ILE A CB    1 
ATOM   4486  C  CG1   . ILE A 1  612  ? 471.517 -39.552 609.365 1.00 47.26  ? 612  ILE A CG1   1 
ATOM   4487  C  CG2   . ILE A 1  612  ? 471.836 -39.940 611.812 1.00 48.70  ? 612  ILE A CG2   1 
ATOM   4488  C  CD1   . ILE A 1  612  ? 472.108 -38.174 609.543 1.00 46.27  ? 612  ILE A CD1   1 
ATOM   4489  N  N     . ILE A 1  613  ? 471.146 -42.897 608.511 1.00 40.43  ? 613  ILE A N     1 
ATOM   4490  C  CA    . ILE A 1  613  ? 472.046 -43.631 607.631 1.00 41.95  ? 613  ILE A CA    1 
ATOM   4491  C  C     . ILE A 1  613  ? 472.915 -42.672 606.831 1.00 41.65  ? 613  ILE A C     1 
ATOM   4492  O  O     . ILE A 1  613  ? 474.142 -42.783 606.849 1.00 42.35  ? 613  ILE A O     1 
ATOM   4493  C  CB    . ILE A 1  613  ? 471.274 -44.551 606.670 1.00 43.01  ? 613  ILE A CB    1 
ATOM   4494  C  CG1   . ILE A 1  613  ? 470.573 -45.660 607.456 1.00 43.62  ? 613  ILE A CG1   1 
ATOM   4495  C  CG2   . ILE A 1  613  ? 472.210 -45.139 605.628 1.00 44.53  ? 613  ILE A CG2   1 
ATOM   4496  C  CD1   . ILE A 1  613  ? 471.496 -46.438 608.364 1.00 44.54  ? 613  ILE A CD1   1 
ATOM   4497  N  N     . PHE A 1  614  ? 472.289 -41.727 606.132 1.00 43.30  ? 614  PHE A N     1 
ATOM   4498  C  CA    . PHE A 1  614  ? 473.079 -40.723 605.418 1.00 42.93  ? 614  PHE A CA    1 
ATOM   4499  C  C     . PHE A 1  614  ? 472.317 -39.431 605.161 1.00 41.39  ? 614  PHE A C     1 
ATOM   4500  O  O     . PHE A 1  614  ? 471.091 -39.404 605.189 1.00 40.83  ? 614  PHE A O     1 
ATOM   4501  C  CB    . PHE A 1  614  ? 473.607 -41.287 604.087 1.00 44.39  ? 614  PHE A CB    1 
ATOM   4502  C  CG    . PHE A 1  614  ? 472.555 -41.450 603.015 1.00 44.58  ? 614  PHE A CG    1 
ATOM   4503  C  CD1   . PHE A 1  614  ? 472.217 -40.392 602.183 1.00 43.75  ? 614  PHE A CD1   1 
ATOM   4504  C  CD2   . PHE A 1  614  ? 471.936 -42.674 602.814 1.00 45.69  ? 614  PHE A CD2   1 
ATOM   4505  C  CE1   . PHE A 1  614  ? 471.263 -40.544 601.196 1.00 44.00  ? 614  PHE A CE1   1 
ATOM   4506  C  CE2   . PHE A 1  614  ? 470.985 -42.833 601.821 1.00 45.95  ? 614  PHE A CE2   1 
ATOM   4507  C  CZ    . PHE A 1  614  ? 470.646 -41.767 601.015 1.00 45.10  ? 614  PHE A CZ    1 
ATOM   4508  N  N     . GLY A 1  615  ? 473.064 -38.363 604.900 1.00 59.68  ? 615  GLY A N     1 
ATOM   4509  C  CA    . GLY A 1  615  ? 472.476 -37.077 604.578 1.00 56.62  ? 615  GLY A CA    1 
ATOM   4510  C  C     . GLY A 1  615  ? 472.757 -36.013 605.620 1.00 52.62  ? 615  GLY A C     1 
ATOM   4511  O  O     . GLY A 1  615  ? 472.699 -36.275 606.821 1.00 54.39  ? 615  GLY A O     1 
ATOM   4512  N  N     . VAL A 1  616  ? 473.069 -34.807 605.158 1.00 39.22  ? 616  VAL A N     1 
ATOM   4513  C  CA    . VAL A 1  616  ? 473.273 -33.680 606.056 1.00 36.91  ? 616  VAL A CA    1 
ATOM   4514  C  C     . VAL A 1  616  ? 471.934 -33.227 606.622 1.00 36.38  ? 616  VAL A C     1 
ATOM   4515  O  O     . VAL A 1  616  ? 470.984 -32.991 605.873 1.00 36.38  ? 616  VAL A O     1 
ATOM   4516  C  CB    . VAL A 1  616  ? 473.959 -32.501 605.344 1.00 36.51  ? 616  VAL A CB    1 
ATOM   4517  C  CG1   . VAL A 1  616  ? 474.075 -31.310 606.278 1.00 35.16  ? 616  VAL A CG1   1 
ATOM   4518  C  CG2   . VAL A 1  616  ? 475.329 -32.916 604.835 1.00 38.25  ? 616  VAL A CG2   1 
ATOM   4519  N  N     . VAL A 1  617  ? 471.857 -33.119 607.945 1.00 27.14  ? 617  VAL A N     1 
ATOM   4520  C  CA    . VAL A 1  617  ? 470.624 -32.702 608.602 1.00 26.07  ? 617  VAL A CA    1 
ATOM   4521  C  C     . VAL A 1  617  ? 470.514 -31.185 608.665 1.00 24.75  ? 617  VAL A C     1 
ATOM   4522  O  O     . VAL A 1  617  ? 471.309 -30.525 609.334 1.00 24.28  ? 617  VAL A O     1 
ATOM   4523  C  CB    . VAL A 1  617  ? 470.522 -33.267 610.029 1.00 26.02  ? 617  VAL A CB    1 
ATOM   4524  C  CG1   . VAL A 1  617  ? 469.254 -32.768 610.702 1.00 24.95  ? 617  VAL A CG1   1 
ATOM   4525  C  CG2   . VAL A 1  617  ? 470.550 -34.787 609.999 1.00 27.36  ? 617  VAL A CG2   1 
ATOM   4526  N  N     . GLU A 1  618  ? 469.526 -30.636 607.966 1.00 50.62  ? 618  GLU A N     1 
ATOM   4527  C  CA    . GLU A 1  618  ? 469.271 -29.200 608.002 1.00 48.55  ? 618  GLU A CA    1 
ATOM   4528  C  C     . GLU A 1  618  ? 467.774 -28.902 608.046 1.00 48.36  ? 618  GLU A C     1 
ATOM   4529  O  O     . GLU A 1  618  ? 467.002 -29.650 608.646 1.00 48.41  ? 618  GLU A O     1 
ATOM   4530  C  CB    . GLU A 1  618  ? 469.923 -28.509 606.801 1.00 45.46  ? 618  GLU A CB    1 
ATOM   4531  C  CG    . GLU A 1  618  ? 469.936 -29.338 605.530 1.00 48.38  ? 618  GLU A CG    1 
ATOM   4532  C  CD    . GLU A 1  618  ? 468.548 -29.617 605.002 1.00 50.11  ? 618  GLU A CD    1 
ATOM   4533  O  OE1   . GLU A 1  618  ? 468.008 -28.755 604.275 1.00 48.71  ? 618  GLU A OE1   1 
ATOM   4534  O  OE2   . GLU A 1  618  ? 467.999 -30.695 605.318 1.00 50.43  ? 618  GLU A OE2   1 
ATOM   4535  N  N     . LYS A 1  619  ? 467.369 -27.812 607.402 1.00 37.38  ? 619  LYS A N     1 
ATOM   4536  C  CA    . LYS A 1  619  ? 465.996 -27.325 607.506 1.00 36.50  ? 619  LYS A CA    1 
ATOM   4537  C  C     . LYS A 1  619  ? 464.976 -28.264 606.864 1.00 37.90  ? 619  LYS A C     1 
ATOM   4538  O  O     . LYS A 1  619  ? 463.859 -28.399 607.362 1.00 36.59  ? 619  LYS A O     1 
ATOM   4539  C  CB    . LYS A 1  619  ? 465.882 -25.932 606.883 1.00 34.80  ? 619  LYS A CB    1 
ATOM   4540  C  CG    . LYS A 1  619  ? 464.556 -25.239 607.160 1.00 35.12  ? 619  LYS A CG    1 
ATOM   4541  C  CD    . LYS A 1  619  ? 464.568 -23.796 606.682 1.00 32.47  ? 619  LYS A CD    1 
ATOM   4542  C  CE    . LYS A 1  619  ? 463.269 -23.090 607.035 1.00 32.48  ? 619  LYS A CE    1 
ATOM   4543  N  NZ    . LYS A 1  619  ? 463.286 -21.659 606.624 1.00 33.18  ? 619  LYS A NZ    1 
ATOM   4544  N  N     . LYS A 1  620  ? 465.358 -28.912 605.767 1.00 39.58  ? 620  LYS A N     1 
ATOM   4545  C  CA    . LYS A 1  620  ? 464.461 -29.832 605.066 1.00 40.00  ? 620  LYS A CA    1 
ATOM   4546  C  C     . LYS A 1  620  ? 464.047 -31.011 605.940 1.00 40.72  ? 620  LYS A C     1 
ATOM   4547  O  O     . LYS A 1  620  ? 463.037 -31.664 605.679 1.00 41.44  ? 620  LYS A O     1 
ATOM   4548  C  CB    . LYS A 1  620  ? 465.115 -30.361 603.787 1.00 42.17  ? 620  LYS A CB    1 
ATOM   4549  C  CG    . LYS A 1  620  ? 465.280 -29.341 602.677 1.00 40.87  ? 620  LYS A CG    1 
ATOM   4550  C  CD    . LYS A 1  620  ? 465.901 -29.987 601.445 1.00 42.61  ? 620  LYS A CD    1 
ATOM   4551  C  CE    . LYS A 1  620  ? 466.177 -28.965 600.358 1.00 43.58  ? 620  LYS A CE    1 
ATOM   4552  N  NZ    . LYS A 1  620  ? 467.099 -27.896 600.833 1.00 45.60  ? 620  LYS A NZ    1 
ATOM   4553  N  N     . THR A 1  621  ? 464.834 -31.281 606.976 1.00 33.01  ? 621  THR A N     1 
ATOM   4554  C  CA    . THR A 1  621  ? 464.610 -32.441 607.827 1.00 33.58  ? 621  THR A CA    1 
ATOM   4555  C  C     . THR A 1  621  ? 464.097 -32.061 609.212 1.00 32.70  ? 621  THR A C     1 
ATOM   4556  O  O     . THR A 1  621  ? 462.985 -32.424 609.600 1.00 32.68  ? 621  THR A O     1 
ATOM   4557  C  CB    . THR A 1  621  ? 465.903 -33.260 607.995 1.00 34.49  ? 621  THR A CB    1 
ATOM   4558  O  OG1   . THR A 1  621  ? 466.366 -33.700 606.712 1.00 35.46  ? 621  THR A OG1   1 
ATOM   4559  C  CG2   . THR A 1  621  ? 465.656 -34.464 608.887 1.00 35.14  ? 621  THR A CG2   1 
ATOM   4560  N  N     . VAL A 1  622  ? 464.918 -31.326 609.951 1.00 41.52  ? 622  VAL A N     1 
ATOM   4561  C  CA    . VAL A 1  622  ? 464.641 -31.033 611.349 1.00 39.21  ? 622  VAL A CA    1 
ATOM   4562  C  C     . VAL A 1  622  ? 463.895 -29.701 611.496 1.00 38.56  ? 622  VAL A C     1 
ATOM   4563  O  O     . VAL A 1  622  ? 463.679 -29.208 612.605 1.00 38.07  ? 622  VAL A O     1 
ATOM   4564  C  CB    . VAL A 1  622  ? 465.955 -31.020 612.165 1.00 38.52  ? 622  VAL A CB    1 
ATOM   4565  C  CG1   . VAL A 1  622  ? 466.714 -29.716 611.953 1.00 37.67  ? 622  VAL A CG1   1 
ATOM   4566  C  CG2   . VAL A 1  622  ? 465.685 -31.281 613.643 1.00 39.41  ? 622  VAL A CG2   1 
ATOM   4567  N  N     . GLY A 1  623  ? 463.486 -29.130 610.368 1.00 40.05  ? 623  GLY A N     1 
ATOM   4568  C  CA    . GLY A 1  623  ? 462.692 -27.913 610.378 1.00 38.06  ? 623  GLY A CA    1 
ATOM   4569  C  C     . GLY A 1  623  ? 461.209 -28.214 610.496 1.00 40.66  ? 623  GLY A C     1 
ATOM   4570  O  O     . GLY A 1  623  ? 460.822 -29.347 610.782 1.00 43.52  ? 623  GLY A O     1 
ATOM   4571  N  N     . SER A 1  624  ? 460.376 -27.201 610.278 1.00 36.78  ? 624  SER A N     1 
ATOM   4572  C  CA    . SER A 1  624  ? 458.928 -27.383 610.331 1.00 35.20  ? 624  SER A CA    1 
ATOM   4573  C  C     . SER A 1  624  ? 458.375 -27.723 608.952 1.00 37.82  ? 624  SER A C     1 
ATOM   4574  O  O     . SER A 1  624  ? 457.401 -27.123 608.497 1.00 37.10  ? 624  SER A O     1 
ATOM   4575  C  CB    . SER A 1  624  ? 458.242 -26.130 610.880 1.00 34.65  ? 624  SER A CB    1 
ATOM   4576  O  OG    . SER A 1  624  ? 458.372 -25.039 609.983 1.00 35.65  ? 624  SER A OG    1 
ATOM   4577  N  N     . SER A 1  625  ? 459.007 -28.689 608.293 1.00 40.86  ? 625  SER A N     1 
ATOM   4578  C  CA    . SER A 1  625  ? 458.597 -29.113 606.960 1.00 42.81  ? 625  SER A CA    1 
ATOM   4579  C  C     . SER A 1  625  ? 457.395 -30.051 607.020 1.00 43.33  ? 625  SER A C     1 
ATOM   4580  O  O     . SER A 1  625  ? 456.922 -30.397 608.101 1.00 43.49  ? 625  SER A O     1 
ATOM   4581  C  CB    . SER A 1  625  ? 459.762 -29.789 606.237 1.00 44.08  ? 625  SER A CB    1 
ATOM   4582  O  OG    . SER A 1  625  ? 460.380 -30.755 607.069 1.00 43.25  ? 625  SER A OG    1 
ATOM   4583  N  N     . ASN A 1  626  ? 456.904 -30.460 605.854 1.00 54.72  ? 626  ASN A N     1 
ATOM   4584  C  CA    . ASN A 1  626  ? 455.705 -31.287 605.780 1.00 56.37  ? 626  ASN A CA    1 
ATOM   4585  C  C     . ASN A 1  626  ? 455.941 -32.712 606.273 1.00 59.22  ? 626  ASN A C     1 
ATOM   4586  O  O     . ASN A 1  626  ? 455.389 -33.125 607.292 1.00 58.03  ? 626  ASN A O     1 
ATOM   4587  C  CB    . ASN A 1  626  ? 455.169 -31.317 604.348 1.00 55.94  ? 626  ASN A CB    1 
ATOM   4588  C  CG    . ASN A 1  626  ? 453.748 -31.839 604.270 1.00 60.20  ? 626  ASN A CG    1 
ATOM   4589  O  OD1   . ASN A 1  626  ? 452.790 -31.068 604.324 1.00 59.34  ? 626  ASN A OD1   1 
ATOM   4590  N  ND2   . ASN A 1  626  ? 453.602 -33.155 604.144 1.00 60.01  ? 626  ASN A ND2   1 
ATOM   4591  N  N     . GLY A 1  627  ? 456.760 -33.463 605.545 1.00 25.33  ? 627  GLY A N     1 
ATOM   4592  C  CA    . GLY A 1  627  ? 457.051 -34.838 605.911 1.00 26.33  ? 627  GLY A CA    1 
ATOM   4593  C  C     . GLY A 1  627  ? 458.387 -34.975 606.615 1.00 26.21  ? 627  GLY A C     1 
ATOM   4594  O  O     . GLY A 1  627  ? 459.070 -35.992 606.486 1.00 27.18  ? 627  GLY A O     1 
ATOM   4595  N  N     . GLY A 1  628  ? 458.755 -33.944 607.368 1.00 43.97  ? 628  GLY A N     1 
ATOM   4596  C  CA    . GLY A 1  628  ? 460.039 -33.905 608.042 1.00 41.10  ? 628  GLY A CA    1 
ATOM   4597  C  C     . GLY A 1  628  ? 460.149 -34.850 609.223 1.00 39.59  ? 628  GLY A C     1 
ATOM   4598  O  O     . GLY A 1  628  ? 459.298 -35.712 609.430 1.00 40.58  ? 628  GLY A O     1 
ATOM   4599  N  N     . LEU A 1  629  ? 461.212 -34.677 610.001 1.00 32.05  ? 629  LEU A N     1 
ATOM   4600  C  CA    . LEU A 1  629  ? 461.489 -35.534 611.146 1.00 32.48  ? 629  LEU A CA    1 
ATOM   4601  C  C     . LEU A 1  629  ? 460.487 -35.294 612.272 1.00 31.86  ? 629  LEU A C     1 
ATOM   4602  O  O     . LEU A 1  629  ? 460.011 -36.239 612.902 1.00 32.49  ? 629  LEU A O     1 
ATOM   4603  C  CB    . LEU A 1  629  ? 462.923 -35.298 611.636 1.00 32.33  ? 629  LEU A CB    1 
ATOM   4604  C  CG    . LEU A 1  629  ? 463.589 -36.296 612.590 1.00 33.06  ? 629  LEU A CG    1 
ATOM   4605  C  CD1   . LEU A 1  629  ? 463.320 -35.940 614.038 1.00 32.35  ? 629  LEU A CD1   1 
ATOM   4606  C  CD2   . LEU A 1  629  ? 463.141 -37.719 612.297 1.00 34.35  ? 629  LEU A CD2   1 
ATOM   4607  N  N     . ILE A 1  630  ? 460.164 -34.026 612.515 1.00 44.10  ? 630  ILE A N     1 
ATOM   4608  C  CA    . ILE A 1  630  ? 459.250 -33.655 613.592 1.00 43.10  ? 630  ILE A CA    1 
ATOM   4609  C  C     . ILE A 1  630  ? 457.854 -34.230 613.360 1.00 44.95  ? 630  ILE A C     1 
ATOM   4610  O  O     . ILE A 1  630  ? 457.247 -34.789 614.274 1.00 46.56  ? 630  ILE A O     1 
ATOM   4611  C  CB    . ILE A 1  630  ? 459.149 -32.119 613.755 1.00 39.78  ? 630  ILE A CB    1 
ATOM   4612  C  CG1   . ILE A 1  630  ? 460.351 -31.576 614.529 1.00 38.90  ? 630  ILE A CG1   1 
ATOM   4613  C  CG2   . ILE A 1  630  ? 457.883 -31.737 614.498 1.00 39.39  ? 630  ILE A CG2   1 
ATOM   4614  C  CD1   . ILE A 1  630  ? 461.606 -31.427 613.704 1.00 44.18  ? 630  ILE A CD1   1 
ATOM   4615  N  N     . HIS A 1  631  ? 457.357 -34.097 612.133 1.00 42.89  ? 631  HIS A N     1 
ATOM   4616  C  CA    . HIS A 1  631  ? 456.037 -34.605 611.773 1.00 44.80  ? 631  HIS A CA    1 
ATOM   4617  C  C     . HIS A 1  631  ? 455.947 -36.111 612.014 1.00 46.29  ? 631  HIS A C     1 
ATOM   4618  O  O     . HIS A 1  631  ? 454.996 -36.603 612.632 1.00 46.87  ? 631  HIS A O     1 
ATOM   4619  C  CB    . HIS A 1  631  ? 455.729 -34.281 610.309 1.00 44.73  ? 631  HIS A CB    1 
ATOM   4620  C  CG    . HIS A 1  631  ? 454.272 -34.341 609.967 1.00 46.14  ? 631  HIS A CG    1 
ATOM   4621  N  ND1   . HIS A 1  631  ? 453.765 -33.841 608.787 1.00 45.28  ? 631  HIS A ND1   1 
ATOM   4622  C  CD2   . HIS A 1  631  ? 453.213 -34.839 610.649 1.00 46.98  ? 631  HIS A CD2   1 
ATOM   4623  C  CE1   . HIS A 1  631  ? 452.458 -34.028 608.755 1.00 44.68  ? 631  HIS A CE1   1 
ATOM   4624  N  NE2   . HIS A 1  631  ? 452.098 -34.633 609.873 1.00 46.46  ? 631  HIS A NE2   1 
ATOM   4625  N  N     . VAL A 1  632  ? 456.956 -36.831 611.533 1.00 26.57  ? 632  VAL A N     1 
ATOM   4626  C  CA    . VAL A 1  632  ? 457.018 -38.280 611.678 1.00 27.83  ? 632  VAL A CA    1 
ATOM   4627  C  C     . VAL A 1  632  ? 457.086 -38.698 613.143 1.00 27.85  ? 632  VAL A C     1 
ATOM   4628  O  O     . VAL A 1  632  ? 456.335 -39.569 613.576 1.00 28.56  ? 632  VAL A O     1 
ATOM   4629  C  CB    . VAL A 1  632  ? 458.230 -38.868 610.929 1.00 28.60  ? 632  VAL A CB    1 
ATOM   4630  C  CG1   . VAL A 1  632  ? 458.411 -40.337 611.274 1.00 29.90  ? 632  VAL A CG1   1 
ATOM   4631  C  CG2   . VAL A 1  632  ? 458.064 -38.685 609.428 1.00 28.87  ? 632  VAL A CG2   1 
ATOM   4632  N  N     . VAL A 1  633  ? 457.981 -38.075 613.903 1.00 32.59  ? 633  VAL A N     1 
ATOM   4633  C  CA    . VAL A 1  633  ? 458.137 -38.406 615.317 1.00 32.61  ? 633  VAL A CA    1 
ATOM   4634  C  C     . VAL A 1  633  ? 456.854 -38.114 616.092 1.00 32.20  ? 633  VAL A C     1 
ATOM   4635  O  O     . VAL A 1  633  ? 456.485 -38.859 617.000 1.00 32.74  ? 633  VAL A O     1 
ATOM   4636  C  CB    . VAL A 1  633  ? 459.320 -37.638 615.947 1.00 31.84  ? 633  VAL A CB    1 
ATOM   4637  C  CG1   . VAL A 1  633  ? 459.306 -37.766 617.463 1.00 31.71  ? 633  VAL A CG1   1 
ATOM   4638  C  CG2   . VAL A 1  633  ? 460.637 -38.151 615.386 1.00 32.50  ? 633  VAL A CG2   1 
ATOM   4639  N  N     . THR A 1  634  ? 456.162 -37.043 615.718 1.00 32.37  ? 634  THR A N     1 
ATOM   4640  C  CA    . THR A 1  634  ? 454.904 -36.693 616.366 1.00 32.86  ? 634  THR A CA    1 
ATOM   4641  C  C     . THR A 1  634  ? 453.823 -37.724 616.066 1.00 33.80  ? 634  THR A C     1 
ATOM   4642  O  O     . THR A 1  634  ? 453.125 -38.183 616.970 1.00 34.17  ? 634  THR A O     1 
ATOM   4643  C  CB    . THR A 1  634  ? 454.401 -35.307 615.930 1.00 30.97  ? 634  THR A CB    1 
ATOM   4644  O  OG1   . THR A 1  634  ? 455.415 -34.327 616.181 1.00 30.04  ? 634  THR A OG1   1 
ATOM   4645  C  CG2   . THR A 1  634  ? 453.147 -34.937 616.703 1.00 30.68  ? 634  THR A CG2   1 
ATOM   4646  N  N     . ARG A 1  635  ? 453.692 -38.094 614.796 1.00 43.29  ? 635  ARG A N     1 
ATOM   4647  C  CA    . ARG A 1  635  ? 452.650 -39.032 614.388 1.00 45.48  ? 635  ARG A CA    1 
ATOM   4648  C  C     . ARG A 1  635  ? 452.930 -40.468 614.827 1.00 47.66  ? 635  ARG A C     1 
ATOM   4649  O  O     . ARG A 1  635  ? 452.012 -41.282 614.920 1.00 50.43  ? 635  ARG A O     1 
ATOM   4650  C  CB    . ARG A 1  635  ? 452.463 -38.985 612.871 1.00 47.27  ? 635  ARG A CB    1 
ATOM   4651  C  CG    . ARG A 1  635  ? 451.545 -37.870 612.401 1.00 45.00  ? 635  ARG A CG    1 
ATOM   4652  C  CD    . ARG A 1  635  ? 450.109 -38.134 612.828 1.00 45.25  ? 635  ARG A CD    1 
ATOM   4653  N  NE    . ARG A 1  635  ? 449.293 -36.928 612.764 1.00 47.21  ? 635  ARG A NE    1 
ATOM   4654  C  CZ    . ARG A 1  635  ? 449.124 -36.090 613.783 1.00 46.54  ? 635  ARG A CZ    1 
ATOM   4655  N  NH1   . ARG A 1  635  ? 449.714 -36.332 614.946 1.00 47.05  ? 635  ARG A NH1   1 
ATOM   4656  N  NH2   . ARG A 1  635  ? 448.366 -35.011 613.641 1.00 45.04  ? 635  ARG A NH2   1 
ATOM   4657  N  N     . GLU A 1  636  ? 454.192 -40.775 615.102 1.00 44.07  ? 636  GLU A N     1 
ATOM   4658  C  CA    . GLU A 1  636  ? 454.587 -42.144 615.413 1.00 45.82  ? 636  GLU A CA    1 
ATOM   4659  C  C     . GLU A 1  636  ? 454.750 -42.364 616.912 1.00 48.32  ? 636  GLU A C     1 
ATOM   4660  O  O     . GLU A 1  636  ? 454.131 -43.256 617.490 1.00 53.20  ? 636  GLU A O     1 
ATOM   4661  C  CB    . GLU A 1  636  ? 455.889 -42.496 614.693 1.00 46.99  ? 636  GLU A CB    1 
ATOM   4662  C  CG    . GLU A 1  636  ? 456.007 -43.955 614.299 1.00 52.59  ? 636  GLU A CG    1 
ATOM   4663  C  CD    . GLU A 1  636  ? 455.095 -44.318 613.143 1.00 54.09  ? 636  GLU A CD    1 
ATOM   4664  O  OE1   . GLU A 1  636  ? 454.756 -45.512 613.002 1.00 60.29  ? 636  GLU A OE1   1 
ATOM   4665  O  OE2   . GLU A 1  636  ? 454.722 -43.411 612.369 1.00 49.69  ? 636  GLU A OE2   1 
ATOM   4666  N  N     . LYS A 1  637  ? 455.590 -41.544 617.535 1.00 43.55  ? 637  LYS A N     1 
ATOM   4667  C  CA    . LYS A 1  637  ? 455.912 -41.692 618.950 1.00 43.17  ? 637  LYS A CA    1 
ATOM   4668  C  C     . LYS A 1  637  ? 454.967 -40.901 619.853 1.00 42.43  ? 637  LYS A C     1 
ATOM   4669  O  O     . LYS A 1  637  ? 454.838 -41.202 621.039 1.00 43.17  ? 637  LYS A O     1 
ATOM   4670  C  CB    . LYS A 1  637  ? 457.357 -41.259 619.208 1.00 41.64  ? 637  LYS A CB    1 
ATOM   4671  C  CG    . LYS A 1  637  ? 458.398 -42.106 618.493 1.00 45.32  ? 637  LYS A CG    1 
ATOM   4672  C  CD    . LYS A 1  637  ? 458.410 -43.533 619.019 1.00 49.84  ? 637  LYS A CD    1 
ATOM   4673  C  CE    . LYS A 1  637  ? 458.098 -44.533 617.917 1.00 53.07  ? 637  LYS A CE    1 
ATOM   4674  N  NZ    . LYS A 1  637  ? 458.061 -45.933 618.428 1.00 53.27  ? 637  LYS A NZ    1 
ATOM   4675  N  N     . GLY A 1  638  ? 454.311 -39.892 619.292 1.00 49.55  ? 638  GLY A N     1 
ATOM   4676  C  CA    . GLY A 1  638  ? 453.396 -39.065 620.060 1.00 49.72  ? 638  GLY A CA    1 
ATOM   4677  C  C     . GLY A 1  638  ? 453.963 -37.688 620.358 1.00 49.37  ? 638  GLY A C     1 
ATOM   4678  O  O     . GLY A 1  638  ? 455.173 -37.482 620.268 1.00 51.36  ? 638  GLY A O     1 
ATOM   4679  N  N     . PRO A 1  639  ? 453.088 -36.737 620.723 1.00 33.85  ? 639  PRO A N     1 
ATOM   4680  C  CA    . PRO A 1  639  ? 453.468 -35.340 620.969 1.00 32.61  ? 639  PRO A CA    1 
ATOM   4681  C  C     . PRO A 1  639  ? 454.491 -35.171 622.095 1.00 32.31  ? 639  PRO A C     1 
ATOM   4682  O  O     . PRO A 1  639  ? 455.394 -34.338 621.977 1.00 31.55  ? 639  PRO A O     1 
ATOM   4683  C  CB    . PRO A 1  639  ? 452.136 -34.676 621.342 1.00 32.26  ? 639  PRO A CB    1 
ATOM   4684  C  CG    . PRO A 1  639  ? 451.257 -35.792 621.783 1.00 33.32  ? 639  PRO A CG    1 
ATOM   4685  C  CD    . PRO A 1  639  ? 451.650 -36.961 620.941 1.00 34.26  ? 639  PRO A CD    1 
ATOM   4686  N  N     . GLN A 1  640  ? 454.349 -35.949 623.163 1.00 60.40  ? 640  GLN A N     1 
ATOM   4687  C  CA    . GLN A 1  640  ? 455.249 -35.853 624.309 1.00 61.33  ? 640  GLN A CA    1 
ATOM   4688  C  C     . GLN A 1  640  ? 456.681 -36.182 623.904 1.00 62.30  ? 640  GLN A C     1 
ATOM   4689  O  O     . GLN A 1  640  ? 457.622 -35.448 624.225 1.00 60.56  ? 640  GLN A O     1 
ATOM   4690  C  CB    . GLN A 1  640  ? 454.791 -36.791 625.427 1.00 62.70  ? 640  GLN A CB    1 
ATOM   4691  C  CG    . GLN A 1  640  ? 453.282 -36.938 625.532 1.00 66.95  ? 640  GLN A CG    1 
ATOM   4692  C  CD    . GLN A 1  640  ? 452.582 -35.628 625.841 1.00 67.64  ? 640  GLN A CD    1 
ATOM   4693  O  OE1   . GLN A 1  640  ? 453.137 -34.755 626.508 1.00 66.89  ? 640  GLN A OE1   1 
ATOM   4694  N  NE2   . GLN A 1  640  ? 451.354 -35.485 625.352 1.00 66.18  ? 640  GLN A NE2   1 
ATOM   4695  N  N     . VAL A 1  641  ? 456.830 -37.289 623.186 1.00 42.08  ? 641  VAL A N     1 
ATOM   4696  C  CA    . VAL A 1  641  ? 458.134 -37.744 622.725 1.00 42.27  ? 641  VAL A CA    1 
ATOM   4697  C  C     . VAL A 1  641  ? 458.727 -36.763 621.717 1.00 40.48  ? 641  VAL A C     1 
ATOM   4698  O  O     . VAL A 1  641  ? 459.945 -36.650 621.591 1.00 40.61  ? 641  VAL A O     1 
ATOM   4699  C  CB    . VAL A 1  641  ? 458.043 -39.146 622.091 1.00 43.89  ? 641  VAL A CB    1 
ATOM   4700  C  CG1   . VAL A 1  641  ? 459.432 -39.716 621.840 1.00 46.28  ? 641  VAL A CG1   1 
ATOM   4701  C  CG2   . VAL A 1  641  ? 457.245 -40.076 622.991 1.00 43.78  ? 641  VAL A CG2   1 
ATOM   4702  N  N     . CYS A 1  642  ? 457.861 -36.046 621.008 1.00 35.49  ? 642  CYS A N     1 
ATOM   4703  C  CA    . CYS A 1  642  ? 458.310 -35.071 620.023 1.00 34.74  ? 642  CYS A CA    1 
ATOM   4704  C  C     . CYS A 1  642  ? 458.828 -33.803 620.696 1.00 33.65  ? 642  CYS A C     1 
ATOM   4705  O  O     . CYS A 1  642  ? 459.839 -33.236 620.279 1.00 33.25  ? 642  CYS A O     1 
ATOM   4706  C  CB    . CYS A 1  642  ? 457.179 -34.730 619.053 1.00 34.56  ? 642  CYS A CB    1 
ATOM   4707  S  SG    . CYS A 1  642  ? 457.714 -33.811 617.596 1.00 35.05  ? 642  CYS A SG    1 
ATOM   4708  N  N     . ALA A 1  643  ? 458.131 -33.357 621.737 1.00 32.62  ? 643  ALA A N     1 
ATOM   4709  C  CA    . ALA A 1  643  ? 458.590 -32.217 622.523 1.00 31.69  ? 643  ALA A CA    1 
ATOM   4710  C  C     . ALA A 1  643  ? 459.918 -32.551 623.201 1.00 31.95  ? 643  ALA A C     1 
ATOM   4711  O  O     . ALA A 1  643  ? 460.878 -31.761 623.173 1.00 31.38  ? 643  ALA A O     1 
ATOM   4712  C  CB    . ALA A 1  643  ? 457.547 -31.827 623.551 1.00 31.40  ? 643  ALA A CB    1 
ATOM   4713  N  N     . LYS A 1  644  ? 459.969 -33.737 623.799 1.00 43.32  ? 644  LYS A N     1 
ATOM   4714  C  CA    . LYS A 1  644  ? 461.194 -34.221 624.418 1.00 43.54  ? 644  LYS A CA    1 
ATOM   4715  C  C     . LYS A 1  644  ? 462.305 -34.310 623.374 1.00 44.46  ? 644  LYS A C     1 
ATOM   4716  O  O     . LYS A 1  644  ? 463.476 -34.091 623.679 1.00 44.33  ? 644  LYS A O     1 
ATOM   4717  C  CB    . LYS A 1  644  ? 460.964 -35.581 625.078 1.00 45.38  ? 644  LYS A CB    1 
ATOM   4718  C  CG    . LYS A 1  644  ? 461.929 -35.891 626.208 1.00 49.37  ? 644  LYS A CG    1 
ATOM   4719  C  CD    . LYS A 1  644  ? 461.757 -34.911 627.360 1.00 49.69  ? 644  LYS A CD    1 
ATOM   4720  C  CE    . LYS A 1  644  ? 462.709 -35.224 628.505 1.00 52.37  ? 644  LYS A CE    1 
ATOM   4721  N  NZ    . LYS A 1  644  ? 462.512 -34.305 629.663 1.00 49.77  ? 644  LYS A NZ    1 
ATOM   4722  N  N     . LEU A 1  645  ? 461.921 -34.622 622.139 1.00 27.42  ? 645  LEU A N     1 
ATOM   4723  C  CA    . LEU A 1  645  ? 462.861 -34.686 621.025 1.00 27.65  ? 645  LEU A CA    1 
ATOM   4724  C  C     . LEU A 1  645  ? 463.450 -33.313 620.727 1.00 26.61  ? 645  LEU A C     1 
ATOM   4725  O  O     . LEU A 1  645  ? 464.664 -33.181 620.542 1.00 26.71  ? 645  LEU A O     1 
ATOM   4726  C  CB    . LEU A 1  645  ? 462.180 -35.244 619.777 1.00 28.15  ? 645  LEU A CB    1 
ATOM   4727  C  CG    . LEU A 1  645  ? 462.961 -35.109 618.471 1.00 28.28  ? 645  LEU A CG    1 
ATOM   4728  C  CD1   . LEU A 1  645  ? 464.140 -36.071 618.441 1.00 29.30  ? 645  LEU A CD1   1 
ATOM   4729  C  CD2   . LEU A 1  645  ? 462.041 -35.334 617.289 1.00 28.52  ? 645  LEU A CD2   1 
ATOM   4730  N  N     . PHE A 1  646  ? 462.583 -32.302 620.667 1.00 21.19  ? 646  PHE A N     1 
ATOM   4731  C  CA    . PHE A 1  646  ? 463.027 -30.913 620.570 1.00 20.17  ? 646  PHE A CA    1 
ATOM   4732  C  C     . PHE A 1  646  ? 464.082 -30.643 621.627 1.00 20.03  ? 646  PHE A C     1 
ATOM   4733  O  O     . PHE A 1  646  ? 465.178 -30.157 621.323 1.00 19.85  ? 646  PHE A O     1 
ATOM   4734  C  CB    . PHE A 1  646  ? 461.858 -29.945 620.749 1.00 19.31  ? 646  PHE A CB    1 
ATOM   4735  C  CG    . PHE A 1  646  ? 461.082 -29.682 619.494 1.00 19.17  ? 646  PHE A CG    1 
ATOM   4736  C  CD1   . PHE A 1  646  ? 461.568 -28.807 618.540 1.00 18.67  ? 646  PHE A CD1   1 
ATOM   4737  C  CD2   . PHE A 1  646  ? 459.858 -30.292 619.277 1.00 19.58  ? 646  PHE A CD2   1 
ATOM   4738  C  CE1   . PHE A 1  646  ? 460.852 -28.552 617.386 1.00 18.58  ? 646  PHE A CE1   1 
ATOM   4739  C  CE2   . PHE A 1  646  ? 459.136 -30.043 618.124 1.00 19.50  ? 646  PHE A CE2   1 
ATOM   4740  C  CZ    . PHE A 1  646  ? 459.634 -29.171 617.177 1.00 19.00  ? 646  PHE A CZ    1 
ATOM   4741  N  N     . GLY A 1  647  ? 463.744 -30.987 622.869 1.00 43.77  ? 647  GLY A N     1 
ATOM   4742  C  CA    . GLY A 1  647  ? 464.668 -30.843 623.981 1.00 45.96  ? 647  GLY A CA    1 
ATOM   4743  C  C     . GLY A 1  647  ? 466.030 -31.469 623.734 1.00 46.06  ? 647  GLY A C     1 
ATOM   4744  O  O     . GLY A 1  647  ? 467.050 -30.785 623.790 1.00 45.80  ? 647  GLY A O     1 
ATOM   4745  N  N     . ASN A 1  648  ? 466.042 -32.767 623.443 1.00 34.91  ? 648  ASN A N     1 
ATOM   4746  C  CA    . ASN A 1  648  ? 467.283 -33.511 623.239 1.00 36.27  ? 648  ASN A CA    1 
ATOM   4747  C  C     . ASN A 1  648  ? 468.146 -32.947 622.112 1.00 35.57  ? 648  ASN A C     1 
ATOM   4748  O  O     . ASN A 1  648  ? 469.345 -32.693 622.298 1.00 36.37  ? 648  ASN A O     1 
ATOM   4749  C  CB    . ASN A 1  648  ? 466.974 -34.981 622.955 1.00 37.15  ? 648  ASN A CB    1 
ATOM   4750  C  CG    . ASN A 1  648  ? 466.105 -35.611 624.023 1.00 36.94  ? 648  ASN A CG    1 
ATOM   4751  O  OD1   . ASN A 1  648  ? 466.160 -35.228 625.192 1.00 38.89  ? 648  ASN A OD1   1 
ATOM   4752  N  ND2   . ASN A 1  648  ? 465.293 -36.582 623.626 1.00 39.87  ? 648  ASN A ND2   1 
ATOM   4753  N  N     . ILE A 1  649  ? 467.532 -32.761 620.945 1.00 32.42  ? 649  ILE A N     1 
ATOM   4754  C  CA    . ILE A 1  649  ? 468.232 -32.198 619.795 1.00 33.34  ? 649  ILE A CA    1 
ATOM   4755  C  C     . ILE A 1  649  ? 468.868 -30.867 620.168 1.00 33.20  ? 649  ILE A C     1 
ATOM   4756  O  O     . ILE A 1  649  ? 470.056 -30.640 619.912 1.00 32.60  ? 649  ILE A O     1 
ATOM   4757  C  CB    . ILE A 1  649  ? 467.292 -31.991 618.592 1.00 34.22  ? 649  ILE A CB    1 
ATOM   4758  C  CG1   . ILE A 1  649  ? 466.752 -33.332 618.095 1.00 33.51  ? 649  ILE A CG1   1 
ATOM   4759  C  CG2   . ILE A 1  649  ? 468.017 -31.270 617.467 1.00 31.92  ? 649  ILE A CG2   1 
ATOM   4760  C  CD1   . ILE A 1  649  ? 465.836 -33.208 616.901 1.00 32.59  ? 649  ILE A CD1   1 
ATOM   4761  N  N     . GLN A 1  650  ? 468.079 -29.997 620.793 1.00 32.83  ? 650  GLN A N     1 
ATOM   4762  C  CA    . GLN A 1  650  ? 468.583 -28.693 621.204 1.00 31.58  ? 650  GLN A CA    1 
ATOM   4763  C  C     . GLN A 1  650  ? 469.770 -28.814 622.158 1.00 30.44  ? 650  GLN A C     1 
ATOM   4764  O  O     . GLN A 1  650  ? 470.768 -28.126 621.988 1.00 29.96  ? 650  GLN A O     1 
ATOM   4765  C  CB    . GLN A 1  650  ? 467.473 -27.866 621.852 1.00 28.88  ? 650  GLN A CB    1 
ATOM   4766  C  CG    . GLN A 1  650  ? 466.464 -27.316 620.870 1.00 28.35  ? 650  GLN A CG    1 
ATOM   4767  C  CD    . GLN A 1  650  ? 465.374 -26.524 621.551 1.00 27.56  ? 650  GLN A CD    1 
ATOM   4768  O  OE1   . GLN A 1  650  ? 464.190 -26.766 621.332 1.00 30.40  ? 650  GLN A OE1   1 
ATOM   4769  N  NE2   . GLN A 1  650  ? 465.768 -25.566 622.383 1.00 26.95  ? 650  GLN A NE2   1 
ATOM   4770  N  N     . LYS A 1  651  ? 469.668 -29.695 623.148 1.00 37.14  ? 651  LYS A N     1 
ATOM   4771  C  CA    . LYS A 1  651  ? 470.738 -29.847 624.132 1.00 39.36  ? 651  LYS A CA    1 
ATOM   4772  C  C     . LYS A 1  651  ? 472.042 -30.320 623.488 1.00 38.66  ? 651  LYS A C     1 
ATOM   4773  O  O     . LYS A 1  651  ? 473.098 -29.707 623.687 1.00 38.91  ? 651  LYS A O     1 
ATOM   4774  C  CB    . LYS A 1  651  ? 470.319 -30.816 625.239 1.00 37.42  ? 651  LYS A CB    1 
ATOM   4775  C  CG    . LYS A 1  651  ? 469.135 -30.334 626.063 1.00 35.68  ? 651  LYS A CG    1 
ATOM   4776  C  CD    . LYS A 1  651  ? 468.741 -31.350 627.121 1.00 38.20  ? 651  LYS A CD    1 
ATOM   4777  C  CE    . LYS A 1  651  ? 467.292 -31.163 627.554 1.00 39.00  ? 651  LYS A CE    1 
ATOM   4778  N  NZ    . LYS A 1  651  ? 467.011 -29.771 628.004 1.00 37.90  ? 651  LYS A NZ    1 
ATOM   4779  N  N     . VAL A 1  652  ? 471.967 -31.396 622.710 1.00 29.49  ? 652  VAL A N     1 
ATOM   4780  C  CA    . VAL A 1  652  ? 473.159 -31.934 622.055 1.00 30.42  ? 652  VAL A CA    1 
ATOM   4781  C  C     . VAL A 1  652  ? 473.784 -30.936 621.086 1.00 29.95  ? 652  VAL A C     1 
ATOM   4782  O  O     . VAL A 1  652  ? 474.983 -30.640 621.167 1.00 30.22  ? 652  VAL A O     1 
ATOM   4783  C  CB    . VAL A 1  652  ? 472.850 -33.225 621.281 1.00 31.43  ? 652  VAL A CB    1 
ATOM   4784  C  CG1   . VAL A 1  652  ? 474.124 -33.790 620.666 1.00 32.51  ? 652  VAL A CG1   1 
ATOM   4785  C  CG2   . VAL A 1  652  ? 472.208 -34.238 622.192 1.00 31.97  ? 652  VAL A CG2   1 
ATOM   4786  N  N     . VAL A 1  653  ? 472.967 -30.421 620.170 1.00 22.35  ? 653  VAL A N     1 
ATOM   4787  C  CA    . VAL A 1  653  ? 473.466 -29.518 619.140 1.00 21.98  ? 653  VAL A CA    1 
ATOM   4788  C  C     . VAL A 1  653  ? 474.029 -28.235 619.747 1.00 21.16  ? 653  VAL A C     1 
ATOM   4789  O  O     . VAL A 1  653  ? 475.098 -27.777 619.350 1.00 21.33  ? 653  VAL A O     1 
ATOM   4790  C  CB    . VAL A 1  653  ? 472.371 -29.166 618.117 1.00 21.43  ? 653  VAL A CB    1 
ATOM   4791  C  CG1   . VAL A 1  653  ? 472.876 -28.118 617.142 1.00 21.00  ? 653  VAL A CG1   1 
ATOM   4792  C  CG2   . VAL A 1  653  ? 471.931 -30.415 617.370 1.00 22.36  ? 653  VAL A CG2   1 
ATOM   4793  N  N     . ASN A 1  654  ? 473.323 -27.661 620.717 1.00 30.72  ? 654  ASN A N     1 
ATOM   4794  C  CA    . ASN A 1  654  ? 473.812 -26.455 621.376 1.00 29.19  ? 654  ASN A CA    1 
ATOM   4795  C  C     . ASN A 1  654  ? 475.104 -26.726 622.133 1.00 30.34  ? 654  ASN A C     1 
ATOM   4796  O  O     . ASN A 1  654  ? 475.987 -25.869 622.186 1.00 32.63  ? 654  ASN A O     1 
ATOM   4797  C  CB    . ASN A 1  654  ? 472.761 -25.879 622.326 1.00 28.32  ? 654  ASN A CB    1 
ATOM   4798  C  CG    . ASN A 1  654  ? 471.613 -25.214 621.589 1.00 29.67  ? 654  ASN A CG    1 
ATOM   4799  O  OD1   . ASN A 1  654  ? 471.807 -24.607 620.536 1.00 28.48  ? 654  ASN A OD1   1 
ATOM   4800  N  ND2   . ASN A 1  654  ? 470.409 -25.328 622.140 1.00 28.13  ? 654  ASN A ND2   1 
ATOM   4801  N  N     . PHE A 1  655  ? 475.221 -27.918 622.712 1.00 30.30  ? 655  PHE A N     1 
ATOM   4802  C  CA    . PHE A 1  655  ? 476.462 -28.282 623.386 1.00 31.05  ? 655  PHE A CA    1 
ATOM   4803  C  C     . PHE A 1  655  ? 477.625 -28.321 622.402 1.00 31.03  ? 655  PHE A C     1 
ATOM   4804  O  O     . PHE A 1  655  ? 478.647 -27.669 622.620 1.00 31.22  ? 655  PHE A O     1 
ATOM   4805  C  CB    . PHE A 1  655  ? 476.344 -29.631 624.093 1.00 30.74  ? 655  PHE A CB    1 
ATOM   4806  C  CG    . PHE A 1  655  ? 477.608 -30.053 624.788 1.00 31.72  ? 655  PHE A CG    1 
ATOM   4807  C  CD1   . PHE A 1  655  ? 478.461 -30.975 624.206 1.00 33.44  ? 655  PHE A CD1   1 
ATOM   4808  C  CD2   . PHE A 1  655  ? 477.953 -29.509 626.012 1.00 30.95  ? 655  PHE A CD2   1 
ATOM   4809  C  CE1   . PHE A 1  655  ? 479.627 -31.357 624.841 1.00 34.67  ? 655  PHE A CE1   1 
ATOM   4810  C  CE2   . PHE A 1  655  ? 479.116 -29.888 626.652 1.00 31.90  ? 655  PHE A CE2   1 
ATOM   4811  C  CZ    . PHE A 1  655  ? 479.955 -30.812 626.065 1.00 34.90  ? 655  PHE A CZ    1 
ATOM   4812  N  N     . TRP A 1  656  ? 477.465 -29.086 621.324 1.00 29.26  ? 656  TRP A N     1 
ATOM   4813  C  CA    . TRP A 1  656  ? 478.519 -29.207 620.319 1.00 30.02  ? 656  TRP A CA    1 
ATOM   4814  C  C     . TRP A 1  656  ? 478.895 -27.846 619.739 1.00 29.26  ? 656  TRP A C     1 
ATOM   4815  O  O     . TRP A 1  656  ? 480.075 -27.534 619.583 1.00 29.79  ? 656  TRP A O     1 
ATOM   4816  C  CB    . TRP A 1  656  ? 478.094 -30.151 619.190 1.00 30.69  ? 656  TRP A CB    1 
ATOM   4817  C  CG    . TRP A 1  656  ? 479.135 -30.288 618.111 1.00 31.55  ? 656  TRP A CG    1 
ATOM   4818  C  CD1   . TRP A 1  656  ? 480.137 -31.212 618.052 1.00 32.91  ? 656  TRP A CD1   1 
ATOM   4819  C  CD2   . TRP A 1  656  ? 479.279 -29.470 616.942 1.00 31.24  ? 656  TRP A CD2   1 
ATOM   4820  N  NE1   . TRP A 1  656  ? 480.893 -31.023 616.922 1.00 33.48  ? 656  TRP A NE1   1 
ATOM   4821  C  CE2   . TRP A 1  656  ? 480.387 -29.960 616.224 1.00 32.54  ? 656  TRP A CE2   1 
ATOM   4822  C  CE3   . TRP A 1  656  ? 478.579 -28.373 616.434 1.00 30.15  ? 656  TRP A CE3   1 
ATOM   4823  C  CZ2   . TRP A 1  656  ? 480.810 -29.392 615.027 1.00 32.79  ? 656  TRP A CZ2   1 
ATOM   4824  C  CZ3   . TRP A 1  656  ? 479.002 -27.811 615.247 1.00 30.39  ? 656  TRP A CZ3   1 
ATOM   4825  C  CH2   . TRP A 1  656  ? 480.106 -28.322 614.556 1.00 31.70  ? 656  TRP A CH2   1 
ATOM   4826  N  N     . LEU A 1  657  ? 477.882 -27.043 619.429 1.00 38.91  ? 657  LEU A N     1 
ATOM   4827  C  CA    . LEU A 1  657  ? 478.082 -25.731 618.825 1.00 37.90  ? 657  LEU A CA    1 
ATOM   4828  C  C     . LEU A 1  657  ? 478.814 -24.792 619.772 1.00 38.47  ? 657  LEU A C     1 
ATOM   4829  O  O     . LEU A 1  657  ? 479.656 -24.001 619.346 1.00 39.17  ? 657  LEU A O     1 
ATOM   4830  C  CB    . LEU A 1  657  ? 476.740 -25.121 618.421 1.00 35.75  ? 657  LEU A CB    1 
ATOM   4831  C  CG    . LEU A 1  657  ? 476.813 -23.812 617.633 1.00 35.63  ? 657  LEU A CG    1 
ATOM   4832  C  CD1   . LEU A 1  657  ? 477.429 -24.047 616.262 1.00 35.43  ? 657  LEU A CD1   1 
ATOM   4833  C  CD2   . LEU A 1  657  ? 475.438 -23.183 617.511 1.00 35.05  ? 657  LEU A CD2   1 
ATOM   4834  N  N     . LEU A 1  658  ? 478.479 -24.880 621.056 1.00 22.64  ? 658  LEU A N     1 
ATOM   4835  C  CA    . LEU A 1  658  ? 479.136 -24.072 622.077 1.00 22.39  ? 658  LEU A CA    1 
ATOM   4836  C  C     . LEU A 1  658  ? 480.643 -24.295 622.070 1.00 23.49  ? 658  LEU A C     1 
ATOM   4837  O  O     . LEU A 1  658  ? 481.425 -23.345 622.142 1.00 23.46  ? 658  LEU A O     1 
ATOM   4838  C  CB    . LEU A 1  658  ? 478.567 -24.393 623.461 1.00 22.13  ? 658  LEU A CB    1 
ATOM   4839  C  CG    . LEU A 1  658  ? 479.328 -23.854 624.675 1.00 22.12  ? 658  LEU A CG    1 
ATOM   4840  C  CD1   . LEU A 1  658  ? 479.461 -22.340 624.615 1.00 21.22  ? 658  LEU A CD1   1 
ATOM   4841  C  CD2   . LEU A 1  658  ? 478.636 -24.278 625.958 1.00 22.02  ? 658  LEU A CD2   1 
ATOM   4842  N  N     . HIS A 1  659  ? 481.042 -25.557 621.972 1.00 42.08  ? 659  HIS A N     1 
ATOM   4843  C  CA    . HIS A 1  659  ? 482.451 -25.917 622.022 1.00 43.77  ? 659  HIS A CA    1 
ATOM   4844  C  C     . HIS A 1  659  ? 483.050 -26.054 620.625 1.00 43.65  ? 659  HIS A C     1 
ATOM   4845  O  O     . HIS A 1  659  ? 484.153 -26.575 620.460 1.00 47.32  ? 659  HIS A O     1 
ATOM   4846  C  CB    . HIS A 1  659  ? 482.634 -27.212 622.814 1.00 45.53  ? 659  HIS A CB    1 
ATOM   4847  C  CG    . HIS A 1  659  ? 482.153 -27.121 624.228 1.00 42.04  ? 659  HIS A CG    1 
ATOM   4848  N  ND1   . HIS A 1  659  ? 482.850 -26.450 625.209 1.00 40.93  ? 659  HIS A ND1   1 
ATOM   4849  C  CD2   . HIS A 1  659  ? 481.039 -27.608 624.825 1.00 41.53  ? 659  HIS A CD2   1 
ATOM   4850  C  CE1   . HIS A 1  659  ? 482.189 -26.530 626.350 1.00 43.13  ? 659  HIS A CE1   1 
ATOM   4851  N  NE2   . HIS A 1  659  ? 481.086 -27.228 626.144 1.00 43.48  ? 659  HIS A NE2   1 
ATOM   4852  N  N     . ASN A 1  660  ? 482.315 -25.585 619.622 1.00 42.50  ? 660  ASN A N     1 
ATOM   4853  C  CA    . ASN A 1  660  ? 482.840 -25.512 618.265 1.00 44.23  ? 660  ASN A CA    1 
ATOM   4854  C  C     . ASN A 1  660  ? 482.920 -24.065 617.803 1.00 43.89  ? 660  ASN A C     1 
ATOM   4855  O  O     . ASN A 1  660  ? 483.887 -23.659 617.160 1.00 42.41  ? 660  ASN A O     1 
ATOM   4856  C  CB    . ASN A 1  660  ? 481.979 -26.323 617.298 1.00 44.97  ? 660  ASN A CB    1 
ATOM   4857  C  CG    . ASN A 1  660  ? 482.567 -26.377 615.900 1.00 45.98  ? 660  ASN A CG    1 
ATOM   4858  O  OD1   . ASN A 1  660  ? 483.275 -27.321 615.549 1.00 49.74  ? 660  ASN A OD1   1 
ATOM   4859  N  ND2   . ASN A 1  660  ? 482.279 -25.361 615.095 1.00 42.29  ? 660  ASN A ND2   1 
ATOM   4860  N  N     . GLY A 1  661  ? 481.891 -23.293 618.136 1.00 27.58  ? 661  GLY A N     1 
ATOM   4861  C  CA    . GLY A 1  661  ? 481.849 -21.881 617.804 1.00 26.86  ? 661  GLY A CA    1 
ATOM   4862  C  C     . GLY A 1  661  ? 481.412 -21.615 616.377 1.00 26.79  ? 661  GLY A C     1 
ATOM   4863  O  O     . GLY A 1  661  ? 481.647 -22.425 615.481 1.00 27.64  ? 661  GLY A O     1 
ATOM   4864  N  N     . PHE A 1  662  ? 480.770 -20.469 616.173 1.00 31.29  ? 662  PHE A N     1 
ATOM   4865  C  CA    . PHE A 1  662  ? 480.329 -20.045 614.849 1.00 30.64  ? 662  PHE A CA    1 
ATOM   4866  C  C     . PHE A 1  662  ? 480.152 -18.532 614.826 1.00 30.79  ? 662  PHE A C     1 
ATOM   4867  O  O     . PHE A 1  662  ? 479.571 -17.961 615.747 1.00 28.83  ? 662  PHE A O     1 
ATOM   4868  C  CB    . PHE A 1  662  ? 479.023 -20.739 614.461 1.00 29.10  ? 662  PHE A CB    1 
ATOM   4869  C  CG    . PHE A 1  662  ? 478.473 -20.292 613.139 1.00 29.70  ? 662  PHE A CG    1 
ATOM   4870  C  CD1   . PHE A 1  662  ? 479.029 -20.745 611.956 1.00 32.40  ? 662  PHE A CD1   1 
ATOM   4871  C  CD2   . PHE A 1  662  ? 477.403 -19.418 613.079 1.00 28.01  ? 662  PHE A CD2   1 
ATOM   4872  C  CE1   . PHE A 1  662  ? 478.529 -20.334 610.737 1.00 31.54  ? 662  PHE A CE1   1 
ATOM   4873  C  CE2   . PHE A 1  662  ? 476.899 -19.004 611.863 1.00 28.11  ? 662  PHE A CE2   1 
ATOM   4874  C  CZ    . PHE A 1  662  ? 477.463 -19.464 610.691 1.00 28.64  ? 662  PHE A CZ    1 
ATOM   4875  N  N     . SER A 1  663  ? 480.646 -17.885 613.775 1.00 36.33  ? 663  SER A N     1 
ATOM   4876  C  CA    . SER A 1  663  ? 480.648 -16.426 613.722 1.00 33.62  ? 663  SER A CA    1 
ATOM   4877  C  C     . SER A 1  663  ? 480.221 -15.883 612.361 1.00 34.08  ? 663  SER A C     1 
ATOM   4878  O  O     . SER A 1  663  ? 479.676 -16.615 611.539 1.00 36.87  ? 663  SER A O     1 
ATOM   4879  C  CB    . SER A 1  663  ? 482.037 -15.892 614.073 1.00 35.40  ? 663  SER A CB    1 
ATOM   4880  O  OG    . SER A 1  663  ? 482.049 -14.475 614.086 1.00 34.78  ? 663  SER A OG    1 
ATOM   4881  N  N     . THR A 1  664  ? 480.466 -14.591 612.148 1.00 21.11  ? 664  THR A N     1 
ATOM   4882  C  CA    . THR A 1  664  ? 480.178 -13.912 610.882 1.00 21.05  ? 664  THR A CA    1 
ATOM   4883  C  C     . THR A 1  664  ? 480.814 -12.523 610.871 1.00 20.96  ? 664  THR A C     1 
ATOM   4884  O  O     . THR A 1  664  ? 480.604 -11.732 611.790 1.00 20.28  ? 664  THR A O     1 
ATOM   4885  C  CB    . THR A 1  664  ? 478.659 -13.763 610.627 1.00 20.11  ? 664  THR A CB    1 
ATOM   4886  O  OG1   . THR A 1  664  ? 478.077 -15.051 610.392 1.00 20.31  ? 664  THR A OG1   1 
ATOM   4887  C  CG2   . THR A 1  664  ? 478.404 -12.884 609.416 1.00 20.01  ? 664  THR A CG2   1 
ATOM   4888  N  N     . GLY A 1  665  ? 481.588 -12.227 609.830 1.00 42.18  ? 665  GLY A N     1 
ATOM   4889  C  CA    . GLY A 1  665  ? 482.229 -10.930 609.703 1.00 42.28  ? 665  GLY A CA    1 
ATOM   4890  C  C     . GLY A 1  665  ? 482.095 -10.347 608.310 1.00 42.19  ? 665  GLY A C     1 
ATOM   4891  O  O     . GLY A 1  665  ? 481.392 -10.903 607.467 1.00 44.52  ? 665  GLY A O     1 
ATOM   4892  N  N     . ILE A 1  666  ? 482.768 -9.224  608.065 1.00 30.38  ? 666  ILE A N     1 
ATOM   4893  C  CA    . ILE A 1  666  ? 482.746 -8.595  606.746 1.00 30.63  ? 666  ILE A CA    1 
ATOM   4894  C  C     . ILE A 1  666  ? 483.438 -9.466  605.707 1.00 31.80  ? 666  ILE A C     1 
ATOM   4895  O  O     . ILE A 1  666  ? 483.171 -9.347  604.511 1.00 32.03  ? 666  ILE A O     1 
ATOM   4896  C  CB    . ILE A 1  666  ? 483.420 -7.206  606.745 1.00 30.70  ? 666  ILE A CB    1 
ATOM   4897  C  CG1   . ILE A 1  666  ? 484.200 -6.975  608.041 1.00 30.74  ? 666  ILE A CG1   1 
ATOM   4898  C  CG2   . ILE A 1  666  ? 482.393 -6.110  606.511 1.00 29.76  ? 666  ILE A CG2   1 
ATOM   4899  C  CD1   . ILE A 1  666  ? 485.586 -7.574  608.029 1.00 31.94  ? 666  ILE A CD1   1 
ATOM   4900  N  N     . GLY A 1  667  ? 484.326 -10.340 606.169 1.00 31.92  ? 667  GLY A N     1 
ATOM   4901  C  CA    . GLY A 1  667  ? 485.038 -11.240 605.283 1.00 33.15  ? 667  GLY A CA    1 
ATOM   4902  C  C     . GLY A 1  667  ? 484.104 -12.204 604.578 1.00 33.09  ? 667  GLY A C     1 
ATOM   4903  O  O     . GLY A 1  667  ? 484.427 -12.735 603.516 1.00 34.01  ? 667  GLY A O     1 
ATOM   4904  N  N     . ASP A 1  668  ? 482.938 -12.427 605.175 1.00 40.62  ? 668  ASP A N     1 
ATOM   4905  C  CA    . ASP A 1  668  ? 481.937 -13.314 604.601 1.00 40.41  ? 668  ASP A CA    1 
ATOM   4906  C  C     . ASP A 1  668  ? 481.079 -12.582 603.574 1.00 40.61  ? 668  ASP A C     1 
ATOM   4907  O  O     . ASP A 1  668  ? 480.135 -13.146 603.025 1.00 43.13  ? 668  ASP A O     1 
ATOM   4908  C  CB    . ASP A 1  668  ? 481.058 -13.905 605.703 1.00 40.50  ? 668  ASP A CB    1 
ATOM   4909  C  CG    . ASP A 1  668  ? 481.855 -14.693 606.723 1.00 42.19  ? 668  ASP A CG    1 
ATOM   4910  O  OD1   . ASP A 1  668  ? 482.750 -15.462 606.312 1.00 42.66  ? 668  ASP A OD1   1 
ATOM   4911  O  OD2   . ASP A 1  668  ? 481.588 -14.537 607.934 1.00 41.76  ? 668  ASP A OD2   1 
ATOM   4912  N  N     . THR A 1  669  ? 481.413 -11.320 603.324 1.00 25.21  ? 669  THR A N     1 
ATOM   4913  C  CA    . THR A 1  669  ? 480.715 -10.524 602.323 1.00 24.85  ? 669  THR A CA    1 
ATOM   4914  C  C     . THR A 1  669  ? 481.671 -10.118 601.209 1.00 25.87  ? 669  THR A C     1 
ATOM   4915  O  O     . THR A 1  669  ? 481.330 -9.307  600.348 1.00 25.72  ? 669  THR A O     1 
ATOM   4916  C  CB    . THR A 1  669  ? 480.088 -9.257  602.935 1.00 23.73  ? 669  THR A CB    1 
ATOM   4917  O  OG1   . THR A 1  669  ? 481.114 -8.449  603.526 1.00 23.92  ? 669  THR A OG1   1 
ATOM   4918  C  CG2   . THR A 1  669  ? 479.063 -9.625  603.997 1.00 22.75  ? 669  THR A CG2   1 
ATOM   4919  N  N     . ILE A 1  670  ? 482.871 -10.689 601.232 1.00 24.07  ? 670  ILE A N     1 
ATOM   4920  C  CA    . ILE A 1  670  ? 483.905 -10.334 600.268 1.00 25.18  ? 670  ILE A CA    1 
ATOM   4921  C  C     . ILE A 1  670  ? 484.161 -11.443 599.254 1.00 26.32  ? 670  ILE A C     1 
ATOM   4922  O  O     . ILE A 1  670  ? 484.591 -12.540 599.611 1.00 26.94  ? 670  ILE A O     1 
ATOM   4923  C  CB    . ILE A 1  670  ? 485.227 -9.994  600.975 1.00 25.76  ? 670  ILE A CB    1 
ATOM   4924  C  CG1   . ILE A 1  670  ? 485.030 -8.807  601.915 1.00 24.73  ? 670  ILE A CG1   1 
ATOM   4925  C  CG2   . ILE A 1  670  ? 486.314 -9.691  599.957 1.00 27.02  ? 670  ILE A CG2   1 
ATOM   4926  C  CD1   . ILE A 1  670  ? 486.264 -8.437  602.687 1.00 25.24  ? 670  ILE A CD1   1 
ATOM   4927  N  N     . ALA A 1  671  ? 483.891 -11.150 597.987 1.00 35.78  ? 671  ALA A N     1 
ATOM   4928  C  CA    . ALA A 1  671  ? 484.198 -12.079 596.909 1.00 37.00  ? 671  ALA A CA    1 
ATOM   4929  C  C     . ALA A 1  671  ? 485.589 -11.789 596.360 1.00 38.33  ? 671  ALA A C     1 
ATOM   4930  O  O     . ALA A 1  671  ? 486.149 -10.721 596.607 1.00 38.21  ? 671  ALA A O     1 
ATOM   4931  C  CB    . ALA A 1  671  ? 483.158 -11.986 595.809 1.00 36.74  ? 671  ALA A CB    1 
ATOM   4932  N  N     . ASP A 1  672  ? 486.141 -12.743 595.616 1.00 60.36  ? 672  ASP A N     1 
ATOM   4933  C  CA    . ASP A 1  672  ? 487.488 -12.610 595.070 1.00 62.16  ? 672  ASP A CA    1 
ATOM   4934  C  C     . ASP A 1  672  ? 487.589 -11.467 594.066 1.00 63.06  ? 672  ASP A C     1 
ATOM   4935  O  O     . ASP A 1  672  ? 486.586 -11.034 593.500 1.00 64.21  ? 672  ASP A O     1 
ATOM   4936  C  CB    . ASP A 1  672  ? 487.926 -13.919 594.412 1.00 63.84  ? 672  ASP A CB    1 
ATOM   4937  C  CG    . ASP A 1  672  ? 488.017 -15.066 595.399 1.00 68.46  ? 672  ASP A CG    1 
ATOM   4938  O  OD1   . ASP A 1  672  ? 488.427 -14.826 596.555 1.00 67.50  ? 672  ASP A OD1   1 
ATOM   4939  O  OD2   . ASP A 1  672  ? 487.675 -16.205 595.021 1.00 68.80  ? 672  ASP A OD2   1 
ATOM   4940  N  N     . GLY A 1  673  ? 488.811 -10.985 593.863 1.00 58.29  ? 673  GLY A N     1 
ATOM   4941  C  CA    . GLY A 1  673  ? 489.090 -9.931  592.903 1.00 60.84  ? 673  GLY A CA    1 
ATOM   4942  C  C     . GLY A 1  673  ? 488.526 -10.155 591.510 1.00 61.90  ? 673  GLY A C     1 
ATOM   4943  O  O     . GLY A 1  673  ? 487.740 -9.336  591.026 1.00 61.50  ? 673  GLY A O     1 
ATOM   4944  N  N     . PRO A 1  674  ? 488.926 -11.258 590.850 1.00 61.04  ? 674  PRO A N     1 
ATOM   4945  C  CA    . PRO A 1  674  ? 488.406 -11.576 589.515 1.00 62.60  ? 674  PRO A CA    1 
ATOM   4946  C  C     . PRO A 1  674  ? 486.885 -11.707 589.488 1.00 59.98  ? 674  PRO A C     1 
ATOM   4947  O  O     . PRO A 1  674  ? 486.259 -11.388 588.476 1.00 60.63  ? 674  PRO A O     1 
ATOM   4948  C  CB    . PRO A 1  674  ? 489.075 -12.919 589.185 1.00 64.23  ? 674  PRO A CB    1 
ATOM   4949  C  CG    . PRO A 1  674  ? 489.556 -13.453 590.498 1.00 61.60  ? 674  PRO A CG    1 
ATOM   4950  C  CD    . PRO A 1  674  ? 489.925 -12.246 591.289 1.00 62.82  ? 674  PRO A CD    1 
ATOM   4951  N  N     . THR A 1  675  ? 486.304 -12.167 590.592 1.00 38.23  ? 675  THR A N     1 
ATOM   4952  C  CA    . THR A 1  675  ? 484.855 -12.269 590.702 1.00 36.94  ? 675  THR A CA    1 
ATOM   4953  C  C     . THR A 1  675  ? 484.223 -10.883 590.672 1.00 35.80  ? 675  THR A C     1 
ATOM   4954  O  O     . THR A 1  675  ? 483.226 -10.658 589.986 1.00 35.34  ? 675  THR A O     1 
ATOM   4955  C  CB    . THR A 1  675  ? 484.436 -12.995 591.989 1.00 36.07  ? 675  THR A CB    1 
ATOM   4956  O  OG1   . THR A 1  675  ? 485.029 -14.299 592.016 1.00 37.19  ? 675  THR A OG1   1 
ATOM   4957  C  CG2   . THR A 1  675  ? 482.922 -13.128 592.057 1.00 34.85  ? 675  THR A CG2   1 
ATOM   4958  N  N     . MET A 1  676  ? 484.815 -9.954  591.415 1.00 62.97  ? 676  MET A N     1 
ATOM   4959  C  CA    . MET A 1  676  ? 484.343 -8.575  591.428 1.00 62.17  ? 676  MET A CA    1 
ATOM   4960  C  C     . MET A 1  676  ? 484.514 -7.926  590.060 1.00 63.45  ? 676  MET A C     1 
ATOM   4961  O  O     . MET A 1  676  ? 483.687 -7.114  589.643 1.00 62.53  ? 676  MET A O     1 
ATOM   4962  C  CB    . MET A 1  676  ? 485.077 -7.763  592.496 1.00 59.69  ? 676  MET A CB    1 
ATOM   4963  C  CG    . MET A 1  676  ? 484.692 -8.137  593.914 1.00 57.25  ? 676  MET A CG    1 
ATOM   4964  S  SD    . MET A 1  676  ? 482.907 -8.074  594.160 1.00 60.70  ? 676  MET A SD    1 
ATOM   4965  C  CE    . MET A 1  676  ? 482.570 -6.352  593.792 1.00 57.61  ? 676  MET A CE    1 
ATOM   4966  N  N     . ARG A 1  677  ? 485.587 -8.288  589.364 1.00 77.51  ? 677  ARG A N     1 
ATOM   4967  C  CA    . ARG A 1  677  ? 485.822 -7.775  588.021 1.00 79.02  ? 677  ARG A CA    1 
ATOM   4968  C  C     . ARG A 1  677  ? 484.745 -8.281  587.063 1.00 78.75  ? 677  ARG A C     1 
ATOM   4969  O  O     . ARG A 1  677  ? 484.232 -7.523  586.236 1.00 78.30  ? 677  ARG A O     1 
ATOM   4970  C  CB    . ARG A 1  677  ? 487.213 -8.174  587.521 1.00 81.60  ? 677  ARG A CB    1 
ATOM   4971  C  CG    . ARG A 1  677  ? 487.580 -7.573  586.171 1.00 83.11  ? 677  ARG A CG    1 
ATOM   4972  C  CD    . ARG A 1  677  ? 488.990 -7.957  585.735 1.00 89.37  ? 677  ARG A CD    1 
ATOM   4973  N  NE    . ARG A 1  677  ? 490.020 -7.379  586.596 1.00 91.93  ? 677  ARG A NE    1 
ATOM   4974  C  CZ    . ARG A 1  677  ? 490.708 -8.063  587.506 1.00 90.85  ? 677  ARG A CZ    1 
ATOM   4975  N  NH1   . ARG A 1  677  ? 490.483 -9.359  587.675 1.00 90.85  ? 677  ARG A NH1   1 
ATOM   4976  N  NH2   . ARG A 1  677  ? 491.625 -7.452  588.244 1.00 87.92  ? 677  ARG A NH2   1 
ATOM   4977  N  N     . GLU A 1  678  ? 484.397 -9.560  587.187 1.00 54.01  ? 678  GLU A N     1 
ATOM   4978  C  CA    . GLU A 1  678  ? 483.350 -10.149 586.356 1.00 53.66  ? 678  GLU A CA    1 
ATOM   4979  C  C     . GLU A 1  678  ? 481.988 -9.538  586.659 1.00 50.70  ? 678  GLU A C     1 
ATOM   4980  O  O     . GLU A 1  678  ? 481.165 -9.353  585.763 1.00 51.53  ? 678  GLU A O     1 
ATOM   4981  C  CB    . GLU A 1  678  ? 483.289 -11.665 586.546 1.00 54.29  ? 678  GLU A CB    1 
ATOM   4982  C  CG    . GLU A 1  678  ? 484.392 -12.423 585.836 1.00 60.36  ? 678  GLU A CG    1 
ATOM   4983  C  CD    . GLU A 1  678  ? 484.018 -13.865 585.563 1.00 62.24  ? 678  GLU A CD    1 
ATOM   4984  O  OE1   . GLU A 1  678  ? 482.839 -14.223 585.775 1.00 58.76  ? 678  GLU A OE1   1 
ATOM   4985  O  OE2   . GLU A 1  678  ? 484.901 -14.639 585.133 1.00 66.15  ? 678  GLU A OE2   1 
ATOM   4986  N  N     . ILE A 1  679  ? 481.754 -9.236  587.931 1.00 51.47  ? 679  ILE A N     1 
ATOM   4987  C  CA    . ILE A 1  679  ? 480.524 -8.579  588.350 1.00 49.71  ? 679  ILE A CA    1 
ATOM   4988  C  C     . ILE A 1  679  ? 480.426 -7.188  587.728 1.00 49.09  ? 679  ILE A C     1 
ATOM   4989  O  O     . ILE A 1  679  ? 479.403 -6.825  587.134 1.00 48.51  ? 679  ILE A O     1 
ATOM   4990  C  CB    . ILE A 1  679  ? 480.446 -8.477  589.886 1.00 43.35  ? 679  ILE A CB    1 
ATOM   4991  C  CG1   . ILE A 1  679  ? 480.168 -9.854  590.492 1.00 43.95  ? 679  ILE A CG1   1 
ATOM   4992  C  CG2   . ILE A 1  679  ? 479.378 -7.480  590.308 1.00 43.69  ? 679  ILE A CG2   1 
ATOM   4993  C  CD1   . ILE A 1  679  ? 480.275 -9.897  592.000 1.00 45.33  ? 679  ILE A CD1   1 
ATOM   4994  N  N     . THR A 1  680  ? 481.506 -6.423  587.854 1.00 57.46  ? 680  THR A N     1 
ATOM   4995  C  CA    . THR A 1  680  ? 481.562 -5.070  587.317 1.00 58.17  ? 680  THR A CA    1 
ATOM   4996  C  C     . THR A 1  680  ? 481.375 -5.063  585.803 1.00 61.26  ? 680  THR A C     1 
ATOM   4997  O  O     . THR A 1  680  ? 480.659 -4.217  585.265 1.00 62.12  ? 680  THR A O     1 
ATOM   4998  C  CB    . THR A 1  680  ? 482.895 -4.381  587.667 1.00 59.04  ? 680  THR A CB    1 
ATOM   4999  O  OG1   . THR A 1  680  ? 483.045 -4.326  589.091 1.00 58.59  ? 680  THR A OG1   1 
ATOM   5000  C  CG2   . THR A 1  680  ? 482.932 -2.966  587.108 1.00 60.08  ? 680  THR A CG2   1 
ATOM   5001  N  N     . GLU A 1  681  ? 482.006 -6.011  585.116 1.00 71.78  ? 681  GLU A N     1 
ATOM   5002  C  CA    . GLU A 1  681  ? 481.891 -6.077  583.663 1.00 74.34  ? 681  GLU A CA    1 
ATOM   5003  C  C     . GLU A 1  681  ? 480.510 -6.587  583.248 1.00 74.03  ? 681  GLU A C     1 
ATOM   5004  O  O     . GLU A 1  681  ? 480.038 -6.296  582.147 1.00 75.29  ? 681  GLU A O     1 
ATOM   5005  C  CB    . GLU A 1  681  ? 482.996 -6.957  583.067 1.00 79.23  ? 681  GLU A CB    1 
ATOM   5006  C  CG    . GLU A 1  681  ? 482.765 -8.453  583.187 1.00 80.75  ? 681  GLU A CG    1 
ATOM   5007  C  CD    . GLU A 1  681  ? 483.955 -9.268  582.711 1.00 84.87  ? 681  GLU A CD    1 
ATOM   5008  O  OE1   . GLU A 1  681  ? 485.089 -8.744  582.744 1.00 87.86  ? 681  GLU A OE1   1 
ATOM   5009  O  OE2   . GLU A 1  681  ? 483.754 -10.431 582.301 1.00 85.08  ? 681  GLU A OE2   1 
ATOM   5010  N  N     . THR A 1  682  ? 479.862 -7.337  584.135 1.00 44.22  ? 682  THR A N     1 
ATOM   5011  C  CA    . THR A 1  682  ? 478.497 -7.797  583.894 1.00 43.57  ? 682  THR A CA    1 
ATOM   5012  C  C     . THR A 1  682  ? 477.528 -6.621  583.949 1.00 41.92  ? 682  THR A C     1 
ATOM   5013  O  O     . THR A 1  682  ? 476.699 -6.436  583.051 1.00 41.70  ? 682  THR A O     1 
ATOM   5014  C  CB    . THR A 1  682  ? 478.062 -8.861  584.918 1.00 39.42  ? 682  THR A CB    1 
ATOM   5015  O  OG1   . THR A 1  682  ? 478.886 -10.025 584.781 1.00 42.18  ? 682  THR A OG1   1 
ATOM   5016  C  CG2   . THR A 1  682  ? 476.610 -9.247  584.700 1.00 38.41  ? 682  THR A CG2   1 
ATOM   5017  N  N     . ILE A 1  683  ? 477.640 -5.827  585.010 1.00 43.25  ? 683  ILE A N     1 
ATOM   5018  C  CA    . ILE A 1  683  ? 476.853 -4.604  585.125 1.00 40.87  ? 683  ILE A CA    1 
ATOM   5019  C  C     . ILE A 1  683  ? 477.167 -3.681  583.949 1.00 41.71  ? 683  ILE A C     1 
ATOM   5020  O  O     . ILE A 1  683  ? 476.292 -2.972  583.448 1.00 41.92  ? 683  ILE A O     1 
ATOM   5021  C  CB    . ILE A 1  683  ? 477.127 -3.874  586.456 1.00 39.31  ? 683  ILE A CB    1 
ATOM   5022  C  CG1   . ILE A 1  683  ? 476.896 -4.816  587.639 1.00 36.12  ? 683  ILE A CG1   1 
ATOM   5023  C  CG2   . ILE A 1  683  ? 476.241 -2.645  586.589 1.00 38.88  ? 683  ILE A CG2   1 
ATOM   5024  C  CD1   . ILE A 1  683  ? 475.469 -5.290  587.769 1.00 35.97  ? 683  ILE A CD1   1 
ATOM   5025  N  N     . ALA A 1  684  ? 478.418 -3.718  583.498 1.00 44.43  ? 684  ALA A N     1 
ATOM   5026  C  CA    . ALA A 1  684  ? 478.862 -2.905  582.372 1.00 48.11  ? 684  ALA A CA    1 
ATOM   5027  C  C     . ALA A 1  684  ? 478.144 -3.288  581.082 1.00 49.00  ? 684  ALA A C     1 
ATOM   5028  O  O     . ALA A 1  684  ? 477.600 -2.426  580.391 1.00 46.78  ? 684  ALA A O     1 
ATOM   5029  C  CB    . ALA A 1  684  ? 480.367 -3.026  582.193 1.00 49.73  ? 684  ALA A CB    1 
ATOM   5030  N  N     . GLU A 1  685  ? 478.142 -4.578  580.757 1.00 67.26  ? 685  GLU A N     1 
ATOM   5031  C  CA    . GLU A 1  685  ? 477.504 -5.040  579.528 1.00 66.60  ? 685  GLU A CA    1 
ATOM   5032  C  C     . GLU A 1  685  ? 475.988 -4.892  579.623 1.00 65.10  ? 685  GLU A C     1 
ATOM   5033  O  O     . GLU A 1  685  ? 475.302 -4.739  578.608 1.00 67.90  ? 685  GLU A O     1 
ATOM   5034  C  CB    . GLU A 1  685  ? 477.888 -6.492  579.222 1.00 70.00  ? 685  GLU A CB    1 
ATOM   5035  C  CG    . GLU A 1  685  ? 477.331 -7.521  580.191 1.00 73.51  ? 685  GLU A CG    1 
ATOM   5036  C  CD    . GLU A 1  685  ? 477.823 -8.927  579.898 1.00 78.45  ? 685  GLU A CD    1 
ATOM   5037  O  OE1   . GLU A 1  685  ? 478.781 -9.073  579.109 1.00 79.66  ? 685  GLU A OE1   1 
ATOM   5038  O  OE2   . GLU A 1  685  ? 477.251 -9.887  580.457 1.00 76.71  ? 685  GLU A OE2   1 
ATOM   5039  N  N     . ALA A 1  686  ? 475.470 -4.926  580.847 1.00 39.54  ? 686  ALA A N     1 
ATOM   5040  C  CA    . ALA A 1  686  ? 474.050 -4.675  581.073 1.00 38.59  ? 686  ALA A CA    1 
ATOM   5041  C  C     . ALA A 1  686  ? 473.697 -3.228  580.735 1.00 38.35  ? 686  ALA A C     1 
ATOM   5042  O  O     . ALA A 1  686  ? 472.753 -2.965  579.983 1.00 38.58  ? 686  ALA A O     1 
ATOM   5043  C  CB    . ALA A 1  686  ? 473.679 -4.987  582.509 1.00 37.22  ? 686  ALA A CB    1 
ATOM   5044  N  N     . LYS A 1  687  ? 474.462 -2.295  581.294 1.00 50.32  ? 687  LYS A N     1 
ATOM   5045  C  CA    . LYS A 1  687  ? 474.259 -0.877  581.024 1.00 49.43  ? 687  LYS A CA    1 
ATOM   5046  C  C     . LYS A 1  687  ? 474.466 -0.566  579.546 1.00 51.40  ? 687  LYS A C     1 
ATOM   5047  O  O     . LYS A 1  687  ? 473.813 0.319   578.994 1.00 52.49  ? 687  LYS A O     1 
ATOM   5048  C  CB    . LYS A 1  687  ? 475.199 -0.020  581.876 1.00 47.42  ? 687  LYS A CB    1 
ATOM   5049  C  CG    . LYS A 1  687  ? 474.926 -0.088  583.369 1.00 49.11  ? 687  LYS A CG    1 
ATOM   5050  C  CD    . LYS A 1  687  ? 475.379 1.182   584.073 1.00 49.03  ? 687  LYS A CD    1 
ATOM   5051  C  CE    . LYS A 1  687  ? 476.836 1.497   583.775 1.00 51.88  ? 687  LYS A CE    1 
ATOM   5052  N  NZ    . LYS A 1  687  ? 477.255 2.787   584.392 1.00 51.45  ? 687  LYS A NZ    1 
ATOM   5053  N  N     . LYS A 1  688  ? 475.376 -1.300  578.912 1.00 44.09  ? 688  LYS A N     1 
ATOM   5054  C  CA    . LYS A 1  688  ? 475.636 -1.135  577.487 1.00 45.96  ? 688  LYS A CA    1 
ATOM   5055  C  C     . LYS A 1  688  ? 474.424 -1.595  576.687 1.00 44.64  ? 688  LYS A C     1 
ATOM   5056  O  O     . LYS A 1  688  ? 474.036 -0.956  575.710 1.00 47.33  ? 688  LYS A O     1 
ATOM   5057  C  CB    . LYS A 1  688  ? 476.887 -1.914  577.070 1.00 49.01  ? 688  LYS A CB    1 
ATOM   5058  C  CG    . LYS A 1  688  ? 477.693 -1.274  575.942 1.00 53.94  ? 688  LYS A CG    1 
ATOM   5059  C  CD    . LYS A 1  688  ? 477.036 -1.462  574.581 1.00 54.05  ? 688  LYS A CD    1 
ATOM   5060  C  CE    . LYS A 1  688  ? 477.837 -0.781  573.480 1.00 56.54  ? 688  LYS A CE    1 
ATOM   5061  N  NZ    . LYS A 1  688  ? 479.223 -1.321  573.379 1.00 59.59  ? 688  LYS A NZ    1 
ATOM   5062  N  N     . LYS A 1  689  ? 473.829 -2.706  577.112 1.00 37.61  ? 689  LYS A N     1 
ATOM   5063  C  CA    . LYS A 1  689  ? 472.623 -3.222  576.472 1.00 37.88  ? 689  LYS A CA    1 
ATOM   5064  C  C     . LYS A 1  689  ? 471.471 -2.224  576.592 1.00 37.05  ? 689  LYS A C     1 
ATOM   5065  O  O     . LYS A 1  689  ? 470.772 -1.941  575.612 1.00 37.72  ? 689  LYS A O     1 
ATOM   5066  C  CB    . LYS A 1  689  ? 472.228 -4.565  577.086 1.00 37.47  ? 689  LYS A CB    1 
ATOM   5067  C  CG    . LYS A 1  689  ? 471.079 -5.260  576.379 1.00 37.95  ? 689  LYS A CG    1 
ATOM   5068  C  CD    . LYS A 1  689  ? 470.741 -6.583  577.049 1.00 37.57  ? 689  LYS A CD    1 
ATOM   5069  C  CE    . LYS A 1  689  ? 471.948 -7.508  577.098 1.00 38.31  ? 689  LYS A CE    1 
ATOM   5070  N  NZ    . LYS A 1  689  ? 471.617 -8.824  577.718 1.00 38.04  ? 689  LYS A NZ    1 
ATOM   5071  N  N     . VAL A 1  690  ? 471.285 -1.690  577.797 1.00 30.35  ? 690  VAL A N     1 
ATOM   5072  C  CA    . VAL A 1  690  ? 470.265 -0.673  578.037 1.00 29.54  ? 690  VAL A CA    1 
ATOM   5073  C  C     . VAL A 1  690  ? 470.512 0.554   577.163 1.00 30.25  ? 690  VAL A C     1 
ATOM   5074  O  O     . VAL A 1  690  ? 469.575 1.142   576.626 1.00 30.37  ? 690  VAL A O     1 
ATOM   5075  C  CB    . VAL A 1  690  ? 470.229 -0.247  579.521 1.00 28.03  ? 690  VAL A CB    1 
ATOM   5076  C  CG1   . VAL A 1  690  ? 469.214 0.864   579.738 1.00 27.31  ? 690  VAL A CG1   1 
ATOM   5077  C  CG2   . VAL A 1  690  ? 469.910 -1.440  580.407 1.00 27.34  ? 690  VAL A CG2   1 
ATOM   5078  N  N     . LEU A 1  691  ? 471.781 0.924   577.018 1.00 33.58  ? 691  LEU A N     1 
ATOM   5079  C  CA    . LEU A 1  691  ? 472.175 2.051   576.179 1.00 34.38  ? 691  LEU A CA    1 
ATOM   5080  C  C     . LEU A 1  691  ? 471.792 1.797   574.723 1.00 35.77  ? 691  LEU A C     1 
ATOM   5081  O  O     . LEU A 1  691  ? 471.277 2.686   574.042 1.00 36.16  ? 691  LEU A O     1 
ATOM   5082  C  CB    . LEU A 1  691  ? 473.683 2.305   576.306 1.00 34.82  ? 691  LEU A CB    1 
ATOM   5083  C  CG    . LEU A 1  691  ? 474.314 3.565   575.699 1.00 35.54  ? 691  LEU A CG    1 
ATOM   5084  C  CD1   . LEU A 1  691  ? 474.689 3.364   574.236 1.00 37.26  ? 691  LEU A CD1   1 
ATOM   5085  C  CD2   . LEU A 1  691  ? 473.392 4.764   575.857 1.00 34.85  ? 691  LEU A CD2   1 
ATOM   5086  N  N     . ASP A 1  692  ? 472.044 0.578   574.255 1.00 46.82  ? 692  ASP A N     1 
ATOM   5087  C  CA    . ASP A 1  692  ? 471.705 0.196   572.888 1.00 47.07  ? 692  ASP A CA    1 
ATOM   5088  C  C     . ASP A 1  692  ? 470.200 0.258   572.653 1.00 46.96  ? 692  ASP A C     1 
ATOM   5089  O  O     . ASP A 1  692  ? 469.746 0.787   571.637 1.00 49.64  ? 692  ASP A O     1 
ATOM   5090  C  CB    . ASP A 1  692  ? 472.227 -1.209  572.571 1.00 48.70  ? 692  ASP A CB    1 
ATOM   5091  C  CG    . ASP A 1  692  ? 473.733 -1.247  572.395 1.00 52.66  ? 692  ASP A CG    1 
ATOM   5092  O  OD1   . ASP A 1  692  ? 474.329 -0.184  572.119 1.00 51.80  ? 692  ASP A OD1   1 
ATOM   5093  O  OD2   . ASP A 1  692  ? 474.320 -2.343  572.528 1.00 52.69  ? 692  ASP A OD2   1 
ATOM   5094  N  N     . VAL A 1  693  ? 469.429 -0.279  573.594 1.00 46.15  ? 693  VAL A N     1 
ATOM   5095  C  CA    . VAL A 1  693  ? 467.974 -0.262  573.476 1.00 45.86  ? 693  VAL A CA    1 
ATOM   5096  C  C     . VAL A 1  693  ? 467.440 1.168   573.498 1.00 45.90  ? 693  VAL A C     1 
ATOM   5097  O  O     . VAL A 1  693  ? 466.509 1.505   572.767 1.00 46.54  ? 693  VAL A O     1 
ATOM   5098  C  CB    . VAL A 1  693  ? 467.313 -1.080  574.599 1.00 44.83  ? 693  VAL A CB    1 
ATOM   5099  C  CG1   . VAL A 1  693  ? 465.798 -0.976  574.520 1.00 43.44  ? 693  VAL A CG1   1 
ATOM   5100  C  CG2   . VAL A 1  693  ? 467.747 -2.527  574.504 1.00 46.75  ? 693  VAL A CG2   1 
ATOM   5101  N  N     . THR A 1  694  ? 468.047 2.006   574.334 1.00 32.12  ? 694  THR A N     1 
ATOM   5102  C  CA    . THR A 1  694  ? 467.688 3.417   574.413 1.00 31.76  ? 694  THR A CA    1 
ATOM   5103  C  C     . THR A 1  694  ? 467.921 4.114   573.078 1.00 33.15  ? 694  THR A C     1 
ATOM   5104  O  O     . THR A 1  694  ? 467.035 4.791   572.554 1.00 33.43  ? 694  THR A O     1 
ATOM   5105  C  CB    . THR A 1  694  ? 468.493 4.143   575.506 1.00 30.78  ? 694  THR A CB    1 
ATOM   5106  O  OG1   . THR A 1  694  ? 468.124 3.632   576.792 1.00 29.45  ? 694  THR A OG1   1 
ATOM   5107  C  CG2   . THR A 1  694  ? 468.223 5.638   575.462 1.00 30.63  ? 694  THR A CG2   1 
ATOM   5108  N  N     . LYS A 1  695  ? 469.120 3.934   572.533 1.00 57.07  ? 695  LYS A N     1 
ATOM   5109  C  CA    . LYS A 1  695  ? 469.487 4.543   571.263 1.00 59.03  ? 695  LYS A CA    1 
ATOM   5110  C  C     . LYS A 1  695  ? 468.579 4.047   570.143 1.00 59.94  ? 695  LYS A C     1 
ATOM   5111  O  O     . LYS A 1  695  ? 468.253 4.791   569.219 1.00 59.69  ? 695  LYS A O     1 
ATOM   5112  C  CB    . LYS A 1  695  ? 470.950 4.244   570.937 1.00 59.94  ? 695  LYS A CB    1 
ATOM   5113  C  CG    . LYS A 1  695  ? 471.545 5.121   569.851 1.00 64.87  ? 695  LYS A CG    1 
ATOM   5114  C  CD    . LYS A 1  695  ? 473.043 4.893   569.744 1.00 68.48  ? 695  LYS A CD    1 
ATOM   5115  C  CE    . LYS A 1  695  ? 473.722 5.105   571.090 1.00 63.17  ? 695  LYS A CE    1 
ATOM   5116  N  NZ    . LYS A 1  695  ? 475.167 4.743   571.055 1.00 66.69  ? 695  LYS A NZ    1 
ATOM   5117  N  N     . GLU A 1  696  ? 468.169 2.787   570.241 1.00 46.33  ? 696  GLU A N     1 
ATOM   5118  C  CA    . GLU A 1  696  ? 467.257 2.194   569.269 1.00 46.62  ? 696  GLU A CA    1 
ATOM   5119  C  C     . GLU A 1  696  ? 465.878 2.842   569.341 1.00 47.49  ? 696  GLU A C     1 
ATOM   5120  O  O     . GLU A 1  696  ? 465.297 3.205   568.318 1.00 50.83  ? 696  GLU A O     1 
ATOM   5121  C  CB    . GLU A 1  696  ? 467.142 0.687   569.500 1.00 48.36  ? 696  GLU A CB    1 
ATOM   5122  C  CG    . GLU A 1  696  ? 466.125 -0.006  568.610 1.00 53.14  ? 696  GLU A CG    1 
ATOM   5123  C  CD    . GLU A 1  696  ? 466.030 -1.497  568.884 1.00 53.41  ? 696  GLU A CD    1 
ATOM   5124  O  OE1   . GLU A 1  696  ? 466.761 -1.987  569.770 1.00 53.02  ? 696  GLU A OE1   1 
ATOM   5125  O  OE2   . GLU A 1  696  ? 465.226 -2.179  568.213 1.00 53.51  ? 696  GLU A OE2   1 
ATOM   5126  N  N     . ALA A 1  697  ? 465.363 2.985   570.558 1.00 38.46  ? 697  ALA A N     1 
ATOM   5127  C  CA    . ALA A 1  697  ? 464.054 3.588   570.781 1.00 37.90  ? 697  ALA A CA    1 
ATOM   5128  C  C     . ALA A 1  697  ? 464.032 5.046   570.338 1.00 38.26  ? 697  ALA A C     1 
ATOM   5129  O  O     . ALA A 1  697  ? 463.034 5.525   569.798 1.00 38.68  ? 697  ALA A O     1 
ATOM   5130  C  CB    . ALA A 1  697  ? 463.663 3.475   572.247 1.00 36.25  ? 697  ALA A CB    1 
ATOM   5131  N  N     . GLN A 1  698  ? 465.136 5.748   570.571 1.00 42.41  ? 698  GLN A N     1 
ATOM   5132  C  CA    . GLN A 1  698  ? 465.243 7.149   570.184 1.00 42.80  ? 698  GLN A CA    1 
ATOM   5133  C  C     . GLN A 1  698  ? 465.325 7.301   568.670 1.00 44.52  ? 698  GLN A C     1 
ATOM   5134  O  O     . GLN A 1  698  ? 465.024 8.363   568.126 1.00 45.07  ? 698  GLN A O     1 
ATOM   5135  C  CB    . GLN A 1  698  ? 466.459 7.793   570.850 1.00 42.29  ? 698  GLN A CB    1 
ATOM   5136  C  CG    . GLN A 1  698  ? 466.334 7.918   572.359 1.00 40.62  ? 698  GLN A CG    1 
ATOM   5137  C  CD    . GLN A 1  698  ? 467.602 8.432   573.009 1.00 40.22  ? 698  GLN A CD    1 
ATOM   5138  O  OE1   . GLN A 1  698  ? 468.671 8.433   572.396 1.00 41.15  ? 698  GLN A OE1   1 
ATOM   5139  N  NE2   . GLN A 1  698  ? 467.489 8.877   574.257 1.00 38.90  ? 698  GLN A NE2   1 
ATOM   5140  N  N     . ALA A 1  699  ? 465.731 6.231   567.995 1.00 48.50  ? 699  ALA A N     1 
ATOM   5141  C  CA    . ALA A 1  699  ? 465.825 6.233   566.539 1.00 49.98  ? 699  ALA A CA    1 
ATOM   5142  C  C     . ALA A 1  699  ? 464.495 5.840   565.905 1.00 50.50  ? 699  ALA A C     1 
ATOM   5143  O  O     . ALA A 1  699  ? 464.408 5.668   564.689 1.00 54.49  ? 699  ALA A O     1 
ATOM   5144  C  CB    . ALA A 1  699  ? 466.928 5.297   566.076 1.00 53.20  ? 699  ALA A CB    1 
ATOM   5145  N  N     . ASN A 1  700  ? 463.470 5.704   566.743 1.00 53.04  ? 700  ASN A N     1 
ATOM   5146  C  CA    . ASN A 1  700  ? 462.132 5.307   566.312 1.00 52.65  ? 700  ASN A CA    1 
ATOM   5147  C  C     . ASN A 1  700  ? 462.148 4.000   565.527 1.00 53.91  ? 700  ASN A C     1 
ATOM   5148  O  O     . ASN A 1  700  ? 461.442 3.852   564.531 1.00 56.07  ? 700  ASN A O     1 
ATOM   5149  C  CB    . ASN A 1  700  ? 461.484 6.413   565.474 1.00 52.80  ? 700  ASN A CB    1 
ATOM   5150  C  CG    . ASN A 1  700  ? 459.967 6.364   565.514 1.00 52.64  ? 700  ASN A CG    1 
ATOM   5151  O  OD1   . ASN A 1  700  ? 459.374 5.341   565.854 1.00 51.05  ? 700  ASN A OD1   1 
ATOM   5152  N  ND2   . ASN A 1  700  ? 459.331 7.476   565.166 1.00 53.72  ? 700  ASN A ND2   1 
ATOM   5153  N  N     . LEU A 1  701  ? 462.964 3.056   565.982 1.00 58.95  ? 701  LEU A N     1 
ATOM   5154  C  CA    . LEU A 1  701  ? 463.046 1.745   565.353 1.00 61.45  ? 701  LEU A CA    1 
ATOM   5155  C  C     . LEU A 1  701  ? 462.519 0.677   566.304 1.00 61.76  ? 701  LEU A C     1 
ATOM   5156  O  O     . LEU A 1  701  ? 462.346 -0.482  565.924 1.00 62.93  ? 701  LEU A O     1 
ATOM   5157  C  CB    . LEU A 1  701  ? 464.485 1.432   564.942 1.00 60.78  ? 701  LEU A CB    1 
ATOM   5158  C  CG    . LEU A 1  701  ? 465.150 2.455   564.018 1.00 61.59  ? 701  LEU A CG    1 
ATOM   5159  C  CD1   . LEU A 1  701  ? 466.566 2.027   563.669 1.00 63.80  ? 701  LEU A CD1   1 
ATOM   5160  C  CD2   . LEU A 1  701  ? 464.322 2.660   562.759 1.00 66.09  ? 701  LEU A CD2   1 
ATOM   5161  N  N     . LEU A 1  702  ? 462.264 1.083   567.543 1.00 79.30  ? 702  LEU A N     1 
ATOM   5162  C  CA    . LEU A 1  702  ? 461.741 0.184   568.563 1.00 77.20  ? 702  LEU A CA    1 
ATOM   5163  C  C     . LEU A 1  702  ? 460.286 -0.163  568.268 1.00 77.71  ? 702  LEU A C     1 
ATOM   5164  O  O     . LEU A 1  702  ? 459.398 0.677   568.414 1.00 77.72  ? 702  LEU A O     1 
ATOM   5165  C  CB    . LEU A 1  702  ? 461.870 0.823   569.951 1.00 75.04  ? 702  LEU A CB    1 
ATOM   5166  C  CG    . LEU A 1  702  ? 462.021 -0.060  571.196 1.00 69.82  ? 702  LEU A CG    1 
ATOM   5167  C  CD1   . LEU A 1  702  ? 460.738 -0.811  571.529 1.00 68.51  ? 702  LEU A CD1   1 
ATOM   5168  C  CD2   . LEU A 1  702  ? 463.184 -1.026  571.029 1.00 71.73  ? 702  LEU A CD2   1 
ATOM   5169  N  N     . THR A 1  703  ? 460.046 -1.400  567.846 1.00 85.93  ? 703  THR A N     1 
ATOM   5170  C  CA    . THR A 1  703  ? 458.687 -1.865  567.597 1.00 85.58  ? 703  THR A CA    1 
ATOM   5171  C  C     . THR A 1  703  ? 458.043 -2.323  568.901 1.00 84.93  ? 703  THR A C     1 
ATOM   5172  O  O     . THR A 1  703  ? 458.534 -3.241  569.558 1.00 84.66  ? 703  THR A O     1 
ATOM   5173  C  CB    . THR A 1  703  ? 458.656 -3.015  566.576 1.00 84.73  ? 703  THR A CB    1 
ATOM   5174  O  OG1   . THR A 1  703  ? 459.237 -2.575  565.343 1.00 88.50  ? 703  THR A OG1   1 
ATOM   5175  C  CG2   . THR A 1  703  ? 457.224 -3.463  566.326 1.00 86.42  ? 703  THR A CG2   1 
ATOM   5176  N  N     . ALA A 1  704  ? 456.945 -1.672  569.272 1.00 94.70  ? 704  ALA A N     1 
ATOM   5177  C  CA    . ALA A 1  704  ? 456.269 -1.959  570.532 1.00 90.70  ? 704  ALA A CA    1 
ATOM   5178  C  C     . ALA A 1  704  ? 455.656 -3.354  570.544 1.00 92.84  ? 704  ALA A C     1 
ATOM   5179  O  O     . ALA A 1  704  ? 455.168 -3.839  569.522 1.00 93.70  ? 704  ALA A O     1 
ATOM   5180  C  CB    . ALA A 1  704  ? 455.199 -0.916  570.804 1.00 90.38  ? 704  ALA A CB    1 
ATOM   5181  N  N     . LYS A 1  705  ? 455.689 -3.992  571.709 1.00 108.20 ? 705  LYS A N     1 
ATOM   5182  C  CA    . LYS A 1  705  ? 455.049 -5.287  571.892 1.00 108.32 ? 705  LYS A CA    1 
ATOM   5183  C  C     . LYS A 1  705  ? 453.539 -5.125  571.777 1.00 109.12 ? 705  LYS A C     1 
ATOM   5184  O  O     . LYS A 1  705  ? 452.996 -4.074  572.119 1.00 108.54 ? 705  LYS A O     1 
ATOM   5185  C  CB    . LYS A 1  705  ? 455.424 -5.890  573.246 1.00 107.06 ? 705  LYS A CB    1 
ATOM   5186  C  CG    . LYS A 1  705  ? 456.922 -5.966  573.490 1.00 104.76 ? 705  LYS A CG    1 
ATOM   5187  C  CD    . LYS A 1  705  ? 457.233 -6.371  574.920 1.00 101.69 ? 705  LYS A CD    1 
ATOM   5188  C  CE    . LYS A 1  705  ? 458.728 -6.331  575.188 1.00 100.36 ? 705  LYS A CE    1 
ATOM   5189  N  NZ    . LYS A 1  705  ? 459.049 -6.666  576.603 1.00 98.08  ? 705  LYS A NZ    1 
ATOM   5190  N  N     . HIS A 1  706  ? 452.865 -6.162  571.290 1.00 90.06  ? 706  HIS A N     1 
ATOM   5191  C  CA    . HIS A 1  706  ? 451.427 -6.094  571.062 1.00 89.37  ? 706  HIS A CA    1 
ATOM   5192  C  C     . HIS A 1  706  ? 450.652 -5.854  572.353 1.00 86.27  ? 706  HIS A C     1 
ATOM   5193  O  O     . HIS A 1  706  ? 450.670 -6.682  573.264 1.00 86.98  ? 706  HIS A O     1 
ATOM   5194  C  CB    . HIS A 1  706  ? 450.929 -7.375  570.392 1.00 90.43  ? 706  HIS A CB    1 
ATOM   5195  C  CG    . HIS A 1  706  ? 449.453 -7.387  570.142 1.00 91.72  ? 706  HIS A CG    1 
ATOM   5196  N  ND1   . HIS A 1  706  ? 448.808 -6.384  569.451 1.00 93.58  ? 706  HIS A ND1   1 
ATOM   5197  C  CD2   . HIS A 1  706  ? 448.495 -8.277  570.495 1.00 92.65  ? 706  HIS A CD2   1 
ATOM   5198  C  CE1   . HIS A 1  706  ? 447.517 -6.656  569.386 1.00 94.02  ? 706  HIS A CE1   1 
ATOM   5199  N  NE2   . HIS A 1  706  ? 447.301 -7.799  570.012 1.00 93.01  ? 706  HIS A NE2   1 
ATOM   5200  N  N     . GLY A 1  707  ? 449.978 -4.711  572.425 1.00 101.35 ? 707  GLY A N     1 
ATOM   5201  C  CA    . GLY A 1  707  ? 449.134 -4.396  573.561 1.00 100.68 ? 707  GLY A CA    1 
ATOM   5202  C  C     . GLY A 1  707  ? 449.733 -3.398  574.532 1.00 97.54  ? 707  GLY A C     1 
ATOM   5203  O  O     . GLY A 1  707  ? 449.177 -3.166  575.605 1.00 99.94  ? 707  GLY A O     1 
ATOM   5204  N  N     . MET A 1  708  ? 450.864 -2.802  574.166 1.00 62.85  ? 708  MET A N     1 
ATOM   5205  C  CA    . MET A 1  708  ? 451.500 -1.819  575.036 1.00 62.17  ? 708  MET A CA    1 
ATOM   5206  C  C     . MET A 1  708  ? 452.301 -0.768  574.268 1.00 60.96  ? 708  MET A C     1 
ATOM   5207  O  O     . MET A 1  708  ? 452.592 -0.925  573.082 1.00 62.28  ? 708  MET A O     1 
ATOM   5208  C  CB    . MET A 1  708  ? 452.404 -2.517  576.056 1.00 63.07  ? 708  MET A CB    1 
ATOM   5209  C  CG    . MET A 1  708  ? 453.453 -3.433  575.453 1.00 65.64  ? 708  MET A CG    1 
ATOM   5210  S  SD    . MET A 1  708  ? 454.521 -4.158  576.714 1.00 64.62  ? 708  MET A SD    1 
ATOM   5211  C  CE    . MET A 1  708  ? 453.309 -4.943  577.774 1.00 65.40  ? 708  MET A CE    1 
ATOM   5212  N  N     . THR A 1  709  ? 452.649 0.304   574.972 1.00 60.04  ? 709  THR A N     1 
ATOM   5213  C  CA    . THR A 1  709  ? 453.357 1.442   574.399 1.00 59.41  ? 709  THR A CA    1 
ATOM   5214  C  C     . THR A 1  709  ? 454.800 1.096   574.038 1.00 62.40  ? 709  THR A C     1 
ATOM   5215  O  O     . THR A 1  709  ? 455.386 0.176   574.611 1.00 63.29  ? 709  THR A O     1 
ATOM   5216  C  CB    . THR A 1  709  ? 453.358 2.634   575.385 1.00 59.53  ? 709  THR A CB    1 
ATOM   5217  O  OG1   . THR A 1  709  ? 452.055 2.783   575.963 1.00 59.92  ? 709  THR A OG1   1 
ATOM   5218  C  CG2   . THR A 1  709  ? 453.751 3.926   574.689 1.00 62.35  ? 709  THR A CG2   1 
ATOM   5219  N  N     . LEU A 1  710  ? 455.363 1.827   573.078 1.00 64.13  ? 710  LEU A N     1 
ATOM   5220  C  CA    . LEU A 1  710  ? 456.793 1.762   572.796 1.00 64.41  ? 710  LEU A CA    1 
ATOM   5221  C  C     . LEU A 1  710  ? 457.581 2.083   574.059 1.00 63.51  ? 710  LEU A C     1 
ATOM   5222  O  O     . LEU A 1  710  ? 458.602 1.458   574.348 1.00 65.82  ? 710  LEU A O     1 
ATOM   5223  C  CB    . LEU A 1  710  ? 457.184 2.738   571.681 1.00 64.80  ? 710  LEU A CB    1 
ATOM   5224  C  CG    . LEU A 1  710  ? 456.827 2.430   570.224 1.00 71.46  ? 710  LEU A CG    1 
ATOM   5225  C  CD1   . LEU A 1  710  ? 455.347 2.650   569.947 1.00 73.33  ? 710  LEU A CD1   1 
ATOM   5226  C  CD2   . LEU A 1  710  ? 457.676 3.280   569.290 1.00 74.21  ? 710  LEU A CD2   1 
ATOM   5227  N  N     . ARG A 1  711  ? 457.089 3.065   574.807 1.00 47.91  ? 711  ARG A N     1 
ATOM   5228  C  CA    . ARG A 1  711  ? 457.729 3.500   576.039 1.00 47.34  ? 711  ARG A CA    1 
ATOM   5229  C  C     . ARG A 1  711  ? 457.619 2.422   577.115 1.00 46.91  ? 711  ARG A C     1 
ATOM   5230  O  O     . ARG A 1  711  ? 458.554 2.205   577.887 1.00 47.25  ? 711  ARG A O     1 
ATOM   5231  C  CB    . ARG A 1  711  ? 457.105 4.811   576.521 1.00 47.99  ? 711  ARG A CB    1 
ATOM   5232  C  CG    . ARG A 1  711  ? 457.991 5.626   577.444 1.00 51.27  ? 711  ARG A CG    1 
ATOM   5233  C  CD    . ARG A 1  711  ? 457.329 6.948   577.809 1.00 54.20  ? 711  ARG A CD    1 
ATOM   5234  N  NE    . ARG A 1  711  ? 456.999 7.743   576.628 1.00 51.01  ? 711  ARG A NE    1 
ATOM   5235  C  CZ    . ARG A 1  711  ? 457.794 8.672   576.107 1.00 50.90  ? 711  ARG A CZ    1 
ATOM   5236  N  NH1   . ARG A 1  711  ? 458.971 8.929   576.661 1.00 50.55  ? 711  ARG A NH1   1 
ATOM   5237  N  NH2   . ARG A 1  711  ? 457.412 9.345   575.031 1.00 51.47  ? 711  ARG A NH2   1 
ATOM   5238  N  N     . GLU A 1  712  ? 456.474 1.747   577.156 1.00 55.20  ? 712  GLU A N     1 
ATOM   5239  C  CA    . GLU A 1  712  ? 456.263 0.655   578.102 1.00 54.49  ? 712  GLU A CA    1 
ATOM   5240  C  C     . GLU A 1  712  ? 457.115 -0.556  577.737 1.00 56.02  ? 712  GLU A C     1 
ATOM   5241  O  O     . GLU A 1  712  ? 457.614 -1.263  578.614 1.00 56.69  ? 712  GLU A O     1 
ATOM   5242  C  CB    . GLU A 1  712  ? 454.786 0.260   578.154 1.00 54.11  ? 712  GLU A CB    1 
ATOM   5243  C  CG    . GLU A 1  712  ? 453.890 1.288   578.826 1.00 56.75  ? 712  GLU A CG    1 
ATOM   5244  C  CD    . GLU A 1  712  ? 452.453 0.819   578.945 1.00 56.04  ? 712  GLU A CD    1 
ATOM   5245  O  OE1   . GLU A 1  712  ? 452.074 -0.130  578.225 1.00 54.94  ? 712  GLU A OE1   1 
ATOM   5246  O  OE2   . GLU A 1  712  ? 451.705 1.397   579.761 1.00 55.81  ? 712  GLU A OE2   1 
ATOM   5247  N  N     . SER A 1  713  ? 457.273 -0.791  576.439 1.00 49.84  ? 713  SER A N     1 
ATOM   5248  C  CA    . SER A 1  713  ? 458.136 -1.859  575.951 1.00 49.98  ? 713  SER A CA    1 
ATOM   5249  C  C     . SER A 1  713  ? 459.582 -1.581  576.345 1.00 51.36  ? 713  SER A C     1 
ATOM   5250  O  O     . SER A 1  713  ? 460.298 -2.473  576.806 1.00 52.37  ? 713  SER A O     1 
ATOM   5251  C  CB    . SER A 1  713  ? 458.019 -1.997  574.432 1.00 51.85  ? 713  SER A CB    1 
ATOM   5252  O  OG    . SER A 1  713  ? 456.665 -2.114  574.032 1.00 54.83  ? 713  SER A OG    1 
ATOM   5253  N  N     . PHE A 1  714  ? 459.998 -0.331  576.160 1.00 41.15  ? 714  PHE A N     1 
ATOM   5254  C  CA    . PHE A 1  714  ? 461.334 0.116   576.536 1.00 38.35  ? 714  PHE A CA    1 
ATOM   5255  C  C     . PHE A 1  714  ? 461.573 -0.065  578.033 1.00 38.30  ? 714  PHE A C     1 
ATOM   5256  O  O     . PHE A 1  714  ? 462.603 -0.601  578.446 1.00 37.88  ? 714  PHE A O     1 
ATOM   5257  C  CB    . PHE A 1  714  ? 461.533 1.581   576.137 1.00 38.37  ? 714  PHE A CB    1 
ATOM   5258  C  CG    . PHE A 1  714  ? 462.762 2.214   576.725 1.00 37.85  ? 714  PHE A CG    1 
ATOM   5259  C  CD1   . PHE A 1  714  ? 464.006 1.999   576.160 1.00 39.04  ? 714  PHE A CD1   1 
ATOM   5260  C  CD2   . PHE A 1  714  ? 462.669 3.036   577.838 1.00 36.68  ? 714  PHE A CD2   1 
ATOM   5261  C  CE1   . PHE A 1  714  ? 465.136 2.583   576.699 1.00 38.20  ? 714  PHE A CE1   1 
ATOM   5262  C  CE2   . PHE A 1  714  ? 463.795 3.623   578.382 1.00 36.39  ? 714  PHE A CE2   1 
ATOM   5263  C  CZ    . PHE A 1  714  ? 465.030 3.397   577.811 1.00 37.01  ? 714  PHE A CZ    1 
ATOM   5264  N  N     . GLU A 1  715  ? 460.614 0.383   578.838 1.00 41.31  ? 715  GLU A N     1 
ATOM   5265  C  CA    . GLU A 1  715  ? 460.701 0.243   580.286 1.00 38.92  ? 715  GLU A CA    1 
ATOM   5266  C  C     . GLU A 1  715  ? 460.813 -1.219  580.698 1.00 39.15  ? 715  GLU A C     1 
ATOM   5267  O  O     . GLU A 1  715  ? 461.659 -1.576  581.519 1.00 38.99  ? 715  GLU A O     1 
ATOM   5268  C  CB    . GLU A 1  715  ? 459.489 0.887   580.960 1.00 37.63  ? 715  GLU A CB    1 
ATOM   5269  C  CG    . GLU A 1  715  ? 459.575 2.399   581.043 1.00 40.11  ? 715  GLU A CG    1 
ATOM   5270  C  CD    . GLU A 1  715  ? 460.736 2.859   581.900 1.00 38.68  ? 715  GLU A CD    1 
ATOM   5271  O  OE1   . GLU A 1  715  ? 460.947 2.259   582.974 1.00 33.79  ? 715  GLU A OE1   1 
ATOM   5272  O  OE2   . GLU A 1  715  ? 461.440 3.810   581.498 1.00 38.56  ? 715  GLU A OE2   1 
ATOM   5273  N  N     . ASP A 1  716  ? 459.963 -2.059  580.118 1.00 73.45  ? 716  ASP A N     1 
ATOM   5274  C  CA    . ASP A 1  716  ? 459.973 -3.489  580.406 1.00 73.75  ? 716  ASP A CA    1 
ATOM   5275  C  C     . ASP A 1  716  ? 461.335 -4.101  580.083 1.00 73.08  ? 716  ASP A C     1 
ATOM   5276  O  O     . ASP A 1  716  ? 461.915 -4.825  580.900 1.00 72.44  ? 716  ASP A O     1 
ATOM   5277  C  CB    . ASP A 1  716  ? 458.868 -4.197  579.617 1.00 73.63  ? 716  ASP A CB    1 
ATOM   5278  C  CG    . ASP A 1  716  ? 458.680 -5.640  580.044 1.00 76.83  ? 716  ASP A CG    1 
ATOM   5279  O  OD1   . ASP A 1  716  ? 459.264 -6.536  579.399 1.00 78.35  ? 716  ASP A OD1   1 
ATOM   5280  O  OD2   . ASP A 1  716  ? 457.947 -5.877  581.028 1.00 78.72  ? 716  ASP A OD2   1 
ATOM   5281  N  N     . ASN A 1  717  ? 461.846 -3.792  578.894 1.00 45.75  ? 717  ASN A N     1 
ATOM   5282  C  CA    . ASN A 1  717  ? 463.149 -4.286  578.463 1.00 46.93  ? 717  ASN A CA    1 
ATOM   5283  C  C     . ASN A 1  717  ? 464.278 -3.862  579.398 1.00 45.47  ? 717  ASN A C     1 
ATOM   5284  O  O     . ASN A 1  717  ? 465.080 -4.694  579.827 1.00 46.49  ? 717  ASN A O     1 
ATOM   5285  C  CB    . ASN A 1  717  ? 463.456 -3.813  577.039 1.00 47.63  ? 717  ASN A CB    1 
ATOM   5286  C  CG    . ASN A 1  717  ? 462.571 -4.474  576.000 1.00 51.84  ? 717  ASN A CG    1 
ATOM   5287  O  OD1   . ASN A 1  717  ? 462.094 -5.592  576.195 1.00 52.95  ? 717  ASN A OD1   1 
ATOM   5288  N  ND2   . ASN A 1  717  ? 462.350 -3.786  574.886 1.00 53.36  ? 717  ASN A ND2   1 
ATOM   5289  N  N     . VAL A 1  718  ? 464.333 -2.571  579.713 1.00 33.52  ? 718  VAL A N     1 
ATOM   5290  C  CA    . VAL A 1  718  ? 465.385 -2.032  580.573 1.00 32.82  ? 718  VAL A CA    1 
ATOM   5291  C  C     . VAL A 1  718  ? 465.339 -2.637  581.972 1.00 31.69  ? 718  VAL A C     1 
ATOM   5292  O  O     . VAL A 1  718  ? 466.361 -3.094  582.495 1.00 31.55  ? 718  VAL A O     1 
ATOM   5293  C  CB    . VAL A 1  718  ? 465.290 -0.500  580.684 1.00 32.40  ? 718  VAL A CB    1 
ATOM   5294  C  CG1   . VAL A 1  718  ? 466.222 0.013   581.768 1.00 31.53  ? 718  VAL A CG1   1 
ATOM   5295  C  CG2   . VAL A 1  718  ? 465.612 0.149   579.347 1.00 33.57  ? 718  VAL A CG2   1 
ATOM   5296  N  N     . VAL A 1  719  ? 464.152 -2.642  582.572 1.00 26.04  ? 719  VAL A N     1 
ATOM   5297  C  CA    . VAL A 1  719  ? 463.966 -3.217  583.900 1.00 25.02  ? 719  VAL A CA    1 
ATOM   5298  C  C     . VAL A 1  719  ? 464.386 -4.685  583.922 1.00 25.42  ? 719  VAL A C     1 
ATOM   5299  O  O     . VAL A 1  719  ? 465.090 -5.125  584.837 1.00 24.91  ? 719  VAL A O     1 
ATOM   5300  C  CB    . VAL A 1  719  ? 462.502 -3.093  584.368 1.00 24.41  ? 719  VAL A CB    1 
ATOM   5301  C  CG1   . VAL A 1  719  ? 462.258 -3.943  585.603 1.00 23.58  ? 719  VAL A CG1   1 
ATOM   5302  C  CG2   . VAL A 1  719  ? 462.156 -1.641  584.644 1.00 23.86  ? 719  VAL A CG2   1 
ATOM   5303  N  N     . ARG A 1  720  ? 463.967 -5.434  582.904 1.00 55.87  ? 720  ARG A N     1 
ATOM   5304  C  CA    . ARG A 1  720  ? 464.333 -6.843  582.802 1.00 57.45  ? 720  ARG A CA    1 
ATOM   5305  C  C     . ARG A 1  720  ? 465.847 -7.013  582.688 1.00 57.03  ? 720  ARG A C     1 
ATOM   5306  O  O     . ARG A 1  720  ? 466.425 -7.923  583.283 1.00 56.61  ? 720  ARG A O     1 
ATOM   5307  C  CB    . ARG A 1  720  ? 463.638 -7.499  581.606 1.00 61.09  ? 720  ARG A CB    1 
ATOM   5308  C  CG    . ARG A 1  720  ? 463.706 -9.020  581.615 1.00 63.86  ? 720  ARG A CG    1 
ATOM   5309  C  CD    . ARG A 1  720  ? 463.022 -9.628  580.400 1.00 63.69  ? 720  ARG A CD    1 
ATOM   5310  N  NE    . ARG A 1  720  ? 463.814 -9.470  579.183 1.00 67.53  ? 720  ARG A NE    1 
ATOM   5311  C  CZ    . ARG A 1  720  ? 463.599 -8.533  578.266 1.00 67.24  ? 720  ARG A CZ    1 
ATOM   5312  N  NH1   . ARG A 1  720  ? 462.609 -7.663  578.421 1.00 66.95  ? 720  ARG A NH1   1 
ATOM   5313  N  NH2   . ARG A 1  720  ? 464.371 -8.468  577.189 1.00 67.08  ? 720  ARG A NH2   1 
ATOM   5314  N  N     . PHE A 1  721  ? 466.484 -6.127  581.927 1.00 36.46  ? 721  PHE A N     1 
ATOM   5315  C  CA    . PHE A 1  721  ? 467.931 -6.171  581.746 1.00 37.01  ? 721  PHE A CA    1 
ATOM   5316  C  C     . PHE A 1  721  ? 468.672 -5.932  583.055 1.00 36.00  ? 721  PHE A C     1 
ATOM   5317  O  O     . PHE A 1  721  ? 469.607 -6.661  583.392 1.00 36.22  ? 721  PHE A O     1 
ATOM   5318  C  CB    . PHE A 1  721  ? 468.377 -5.138  580.709 1.00 37.77  ? 721  PHE A CB    1 
ATOM   5319  C  CG    . PHE A 1  721  ? 467.966 -5.472  579.306 1.00 39.61  ? 721  PHE A CG    1 
ATOM   5320  C  CD1   . PHE A 1  721  ? 467.644 -6.773  578.955 1.00 42.94  ? 721  PHE A CD1   1 
ATOM   5321  C  CD2   . PHE A 1  721  ? 467.902 -4.486  578.338 1.00 39.67  ? 721  PHE A CD2   1 
ATOM   5322  C  CE1   . PHE A 1  721  ? 467.265 -7.083  577.665 1.00 43.79  ? 721  PHE A CE1   1 
ATOM   5323  C  CE2   . PHE A 1  721  ? 467.524 -4.791  577.047 1.00 40.91  ? 721  PHE A CE2   1 
ATOM   5324  C  CZ    . PHE A 1  721  ? 467.206 -6.090  576.708 1.00 43.88  ? 721  PHE A CZ    1 
ATOM   5325  N  N     . LEU A 1  722  ? 468.253 -4.906  583.788 1.00 31.98  ? 722  LEU A N     1 
ATOM   5326  C  CA    . LEU A 1  722  ? 468.895 -4.562  585.052 1.00 31.01  ? 722  LEU A CA    1 
ATOM   5327  C  C     . LEU A 1  722  ? 468.672 -5.650  586.102 1.00 30.40  ? 722  LEU A C     1 
ATOM   5328  O  O     . LEU A 1  722  ? 469.564 -5.947  586.904 1.00 30.12  ? 722  LEU A O     1 
ATOM   5329  C  CB    . LEU A 1  722  ? 468.381 -3.212  585.556 1.00 30.11  ? 722  LEU A CB    1 
ATOM   5330  C  CG    . LEU A 1  722  ? 468.693 -2.026  584.640 1.00 30.67  ? 722  LEU A CG    1 
ATOM   5331  C  CD1   . LEU A 1  722  ? 468.076 -0.747  585.177 1.00 29.81  ? 722  LEU A CD1   1 
ATOM   5332  C  CD2   . LEU A 1  722  ? 470.196 -1.863  584.464 1.00 31.23  ? 722  LEU A CD2   1 
ATOM   5333  N  N     . ASN A 1  723  ? 467.483 -6.247  586.091 1.00 45.92  ? 723  ASN A N     1 
ATOM   5334  C  CA    . ASN A 1  723  ? 467.192 -7.363  586.984 1.00 46.00  ? 723  ASN A CA    1 
ATOM   5335  C  C     . ASN A 1  723  ? 468.070 -8.571  586.671 1.00 48.92  ? 723  ASN A C     1 
ATOM   5336  O  O     . ASN A 1  723  ? 468.623 -9.201  587.577 1.00 49.08  ? 723  ASN A O     1 
ATOM   5337  C  CB    . ASN A 1  723  ? 465.716 -7.749  586.900 1.00 46.49  ? 723  ASN A CB    1 
ATOM   5338  C  CG    . ASN A 1  723  ? 464.805 -6.688  587.483 1.00 48.13  ? 723  ASN A CG    1 
ATOM   5339  O  OD1   . ASN A 1  723  ? 465.225 -5.878  588.311 1.00 46.57  ? 723  ASN A OD1   1 
ATOM   5340  N  ND2   . ASN A 1  723  ? 463.549 -6.689  587.055 1.00 47.64  ? 723  ASN A ND2   1 
ATOM   5341  N  N     . GLU A 1  724  ? 468.198 -8.885  585.385 1.00 45.64  ? 724  GLU A N     1 
ATOM   5342  C  CA    . GLU A 1  724  ? 469.079 -9.960  584.944 1.00 45.18  ? 724  GLU A CA    1 
ATOM   5343  C  C     . GLU A 1  724  ? 470.520 -9.669  585.343 1.00 46.03  ? 724  GLU A C     1 
ATOM   5344  O  O     . GLU A 1  724  ? 471.288 -10.583 585.635 1.00 49.82  ? 724  GLU A O     1 
ATOM   5345  C  CB    . GLU A 1  724  ? 468.982 -10.158 583.430 1.00 48.97  ? 724  GLU A CB    1 
ATOM   5346  C  CG    . GLU A 1  724  ? 467.697 -10.825 582.964 1.00 52.68  ? 724  GLU A CG    1 
ATOM   5347  C  CD    . GLU A 1  724  ? 467.648 -11.008 581.457 1.00 59.22  ? 724  GLU A CD    1 
ATOM   5348  O  OE1   . GLU A 1  724  ? 468.530 -10.463 580.758 1.00 59.16  ? 724  GLU A OE1   1 
ATOM   5349  O  OE2   . GLU A 1  724  ? 466.728 -11.701 580.972 1.00 60.32  ? 724  GLU A OE2   1 
ATOM   5350  N  N     . ALA A 1  725  ? 470.877 -8.388  585.354 1.00 34.91  ? 725  ALA A N     1 
ATOM   5351  C  CA    . ALA A 1  725  ? 472.211 -7.965  585.763 1.00 34.68  ? 725  ALA A CA    1 
ATOM   5352  C  C     . ALA A 1  725  ? 472.445 -8.247  587.242 1.00 34.82  ? 725  ALA A C     1 
ATOM   5353  O  O     . ALA A 1  725  ? 473.450 -8.863  587.613 1.00 36.94  ? 725  ALA A O     1 
ATOM   5354  C  CB    . ALA A 1  725  ? 472.414 -6.491  585.470 1.00 34.53  ? 725  ALA A CB    1 
ATOM   5355  N  N     . ARG A 1  726  ? 471.516 -7.791  588.081 1.00 42.63  ? 726  ARG A N     1 
ATOM   5356  C  CA    . ARG A 1  726  ? 471.613 -8.025  589.519 1.00 40.12  ? 726  ARG A CA    1 
ATOM   5357  C  C     . ARG A 1  726  ? 471.680 -9.515  589.832 1.00 42.48  ? 726  ARG A C     1 
ATOM   5358  O  O     . ARG A 1  726  ? 472.509 -9.952  590.628 1.00 42.12  ? 726  ARG A O     1 
ATOM   5359  C  CB    . ARG A 1  726  ? 470.430 -7.401  590.262 1.00 38.45  ? 726  ARG A CB    1 
ATOM   5360  C  CG    . ARG A 1  726  ? 470.480 -7.643  591.766 1.00 38.27  ? 726  ARG A CG    1 
ATOM   5361  C  CD    . ARG A 1  726  ? 469.186 -7.256  592.470 1.00 37.28  ? 726  ARG A CD    1 
ATOM   5362  N  NE    . ARG A 1  726  ? 468.062 -8.103  592.080 1.00 35.11  ? 726  ARG A NE    1 
ATOM   5363  C  CZ    . ARG A 1  726  ? 467.031 -7.689  591.351 1.00 39.84  ? 726  ARG A CZ    1 
ATOM   5364  N  NH1   . ARG A 1  726  ? 466.972 -6.431  590.932 1.00 40.74  ? 726  ARG A NH1   1 
ATOM   5365  N  NH2   . ARG A 1  726  ? 466.054 -8.532  591.045 1.00 42.95  ? 726  ARG A NH2   1 
ATOM   5366  N  N     . ASP A 1  727  ? 470.804 -10.290 589.198 1.00 46.71  ? 727  ASP A N     1 
ATOM   5367  C  CA    . ASP A 1  727  ? 470.758 -11.730 589.426 1.00 46.58  ? 727  ASP A CA    1 
ATOM   5368  C  C     . ASP A 1  727  ? 472.043 -12.419 588.968 1.00 48.21  ? 727  ASP A C     1 
ATOM   5369  O  O     . ASP A 1  727  ? 472.548 -13.315 589.646 1.00 49.25  ? 727  ASP A O     1 
ATOM   5370  C  CB    . ASP A 1  727  ? 469.549 -12.342 588.716 1.00 48.38  ? 727  ASP A CB    1 
ATOM   5371  C  CG    . ASP A 1  727  ? 468.231 -11.901 589.328 1.00 44.96  ? 727  ASP A CG    1 
ATOM   5372  O  OD1   . ASP A 1  727  ? 468.218 -10.883 590.052 1.00 42.02  ? 727  ASP A OD1   1 
ATOM   5373  O  OD2   . ASP A 1  727  ? 467.206 -12.572 589.082 1.00 46.61  ? 727  ASP A OD2   1 
ATOM   5374  N  N     . LYS A 1  728  ? 472.568 -11.995 587.822 1.00 54.30  ? 728  LYS A N     1 
ATOM   5375  C  CA    . LYS A 1  728  ? 473.806 -12.556 587.286 1.00 57.40  ? 728  LYS A CA    1 
ATOM   5376  C  C     . LYS A 1  728  ? 474.977 -12.299 588.229 1.00 57.46  ? 728  LYS A C     1 
ATOM   5377  O  O     . LYS A 1  728  ? 475.688 -13.228 588.626 1.00 59.52  ? 728  LYS A O     1 
ATOM   5378  C  CB    . LYS A 1  728  ? 474.107 -11.970 585.905 1.00 59.02  ? 728  LYS A CB    1 
ATOM   5379  C  CG    . LYS A 1  728  ? 475.277 -12.616 585.178 1.00 62.77  ? 728  LYS A CG    1 
ATOM   5380  C  CD    . LYS A 1  728  ? 474.841 -13.851 584.410 1.00 67.33  ? 728  LYS A CD    1 
ATOM   5381  C  CE    . LYS A 1  728  ? 475.947 -14.348 583.491 1.00 70.99  ? 728  LYS A CE    1 
ATOM   5382  N  NZ    . LYS A 1  728  ? 475.508 -15.500 582.655 1.00 69.78  ? 728  LYS A NZ    1 
ATOM   5383  N  N     . ALA A 1  729  ? 475.167 -11.030 588.584 1.00 44.17  ? 729  ALA A N     1 
ATOM   5384  C  CA    . ALA A 1  729  ? 476.250 -10.633 589.478 1.00 44.00  ? 729  ALA A CA    1 
ATOM   5385  C  C     . ALA A 1  729  ? 476.137 -11.341 590.823 1.00 42.57  ? 729  ALA A C     1 
ATOM   5386  O  O     . ALA A 1  729  ? 477.130 -11.832 591.370 1.00 43.13  ? 729  ALA A O     1 
ATOM   5387  C  CB    . ALA A 1  729  ? 476.247 -9.130  589.672 1.00 42.16  ? 729  ALA A CB    1 
ATOM   5388  N  N     . GLY A 1  730  ? 474.915 -11.394 591.342 1.00 35.98  ? 730  GLY A N     1 
ATOM   5389  C  CA    . GLY A 1  730  ? 474.642 -12.051 592.605 1.00 35.33  ? 730  GLY A CA    1 
ATOM   5390  C  C     . GLY A 1  730  ? 474.979 -13.526 592.565 1.00 36.22  ? 730  GLY A C     1 
ATOM   5391  O  O     . GLY A 1  730  ? 475.529 -14.067 593.523 1.00 36.24  ? 730  GLY A O     1 
ATOM   5392  N  N     . ARG A 1  731  ? 474.654 -14.179 591.454 1.00 50.80  ? 731  ARG A N     1 
ATOM   5393  C  CA    . ARG A 1  731  ? 474.952 -15.598 591.297 1.00 52.55  ? 731  ARG A CA    1 
ATOM   5394  C  C     . ARG A 1  731  ? 476.455 -15.832 591.169 1.00 52.93  ? 731  ARG A C     1 
ATOM   5395  O  O     . ARG A 1  731  ? 476.970 -16.848 591.639 1.00 54.34  ? 731  ARG A O     1 
ATOM   5396  C  CB    . ARG A 1  731  ? 474.210 -16.176 590.089 1.00 52.16  ? 731  ARG A CB    1 
ATOM   5397  C  CG    . ARG A 1  731  ? 472.736 -16.447 590.361 1.00 53.29  ? 731  ARG A CG    1 
ATOM   5398  C  CD    . ARG A 1  731  ? 472.037 -17.097 589.174 1.00 60.88  ? 731  ARG A CD    1 
ATOM   5399  N  NE    . ARG A 1  731  ? 471.796 -16.159 588.079 1.00 59.87  ? 731  ARG A NE    1 
ATOM   5400  C  CZ    . ARG A 1  731  ? 472.518 -16.104 586.963 1.00 64.31  ? 731  ARG A CZ    1 
ATOM   5401  N  NH1   . ARG A 1  731  ? 473.534 -16.939 586.782 1.00 63.38  ? 731  ARG A NH1   1 
ATOM   5402  N  NH2   . ARG A 1  731  ? 472.218 -15.217 586.024 1.00 64.29  ? 731  ARG A NH2   1 
ATOM   5403  N  N     . LEU A 1  732  ? 477.156 -14.891 590.543 1.00 33.91  ? 732  LEU A N     1 
ATOM   5404  C  CA    . LEU A 1  732  ? 478.614 -14.957 590.480 1.00 35.01  ? 732  LEU A CA    1 
ATOM   5405  C  C     . LEU A 1  732  ? 479.209 -14.884 591.884 1.00 34.99  ? 732  LEU A C     1 
ATOM   5406  O  O     . LEU A 1  732  ? 480.059 -15.700 592.260 1.00 37.35  ? 732  LEU A O     1 
ATOM   5407  C  CB    . LEU A 1  732  ? 479.177 -13.831 589.611 1.00 35.44  ? 732  LEU A CB    1 
ATOM   5408  C  CG    . LEU A 1  732  ? 478.868 -13.884 588.113 1.00 36.29  ? 732  LEU A CG    1 
ATOM   5409  C  CD1   . LEU A 1  732  ? 479.507 -12.706 587.396 1.00 38.65  ? 732  LEU A CD1   1 
ATOM   5410  C  CD2   . LEU A 1  732  ? 479.337 -15.198 587.514 1.00 39.91  ? 732  LEU A CD2   1 
ATOM   5411  N  N     . ALA A 1  733  ? 478.747 -13.903 592.654 1.00 32.10  ? 733  ALA A N     1 
ATOM   5412  C  CA    . ALA A 1  733  ? 479.201 -13.724 594.028 1.00 31.51  ? 733  ALA A CA    1 
ATOM   5413  C  C     . ALA A 1  733  ? 478.910 -14.961 594.872 1.00 31.39  ? 733  ALA A C     1 
ATOM   5414  O  O     . ALA A 1  733  ? 479.739 -15.376 595.680 1.00 31.72  ? 733  ALA A O     1 
ATOM   5415  C  CB    . ALA A 1  733  ? 478.552 -12.499 594.644 1.00 30.14  ? 733  ALA A CB    1 
ATOM   5416  N  N     . GLU A 1  734  ? 477.734 -15.549 594.673 1.00 50.12  ? 734  GLU A N     1 
ATOM   5417  C  CA    . GLU A 1  734  ? 477.339 -16.748 595.404 1.00 50.94  ? 734  GLU A CA    1 
ATOM   5418  C  C     . GLU A 1  734  ? 478.234 -17.931 595.052 1.00 54.28  ? 734  GLU A C     1 
ATOM   5419  O  O     . GLU A 1  734  ? 478.630 -18.702 595.928 1.00 54.68  ? 734  GLU A O     1 
ATOM   5420  C  CB    . GLU A 1  734  ? 475.879 -17.098 595.118 1.00 50.86  ? 734  GLU A CB    1 
ATOM   5421  C  CG    . GLU A 1  734  ? 475.391 -18.340 595.846 1.00 52.11  ? 734  GLU A CG    1 
ATOM   5422  C  CD    . GLU A 1  734  ? 473.979 -18.728 595.454 1.00 53.56  ? 734  GLU A CD    1 
ATOM   5423  O  OE1   . GLU A 1  734  ? 473.578 -18.436 594.308 1.00 53.65  ? 734  GLU A OE1   1 
ATOM   5424  O  OE2   . GLU A 1  734  ? 473.269 -19.322 596.293 1.00 54.93  ? 734  GLU A OE2   1 
ATOM   5425  N  N     . VAL A 1  735  ? 478.542 -18.072 593.767 1.00 43.41  ? 735  VAL A N     1 
ATOM   5426  C  CA    . VAL A 1  735  ? 479.433 -19.132 593.310 1.00 45.24  ? 735  VAL A CA    1 
ATOM   5427  C  C     . VAL A 1  735  ? 480.818 -18.974 593.930 1.00 45.23  ? 735  VAL A C     1 
ATOM   5428  O  O     . VAL A 1  735  ? 481.423 -19.951 594.373 1.00 45.99  ? 735  VAL A O     1 
ATOM   5429  C  CB    . VAL A 1  735  ? 479.551 -19.149 591.769 1.00 44.73  ? 735  VAL A CB    1 
ATOM   5430  C  CG1   . VAL A 1  735  ? 480.767 -19.946 591.325 1.00 48.05  ? 735  VAL A CG1   1 
ATOM   5431  C  CG2   . VAL A 1  735  ? 478.284 -19.715 591.146 1.00 45.15  ? 735  VAL A CG2   1 
ATOM   5432  N  N     . ASN A 1  736  ? 481.304 -17.737 593.983 1.00 45.94  ? 736  ASN A N     1 
ATOM   5433  C  CA    . ASN A 1  736  ? 482.636 -17.470 594.520 1.00 45.89  ? 736  ASN A CA    1 
ATOM   5434  C  C     . ASN A 1  736  ? 482.779 -17.807 596.005 1.00 46.10  ? 736  ASN A C     1 
ATOM   5435  O  O     . ASN A 1  736  ? 483.883 -18.077 596.480 1.00 47.13  ? 736  ASN A O     1 
ATOM   5436  C  CB    . ASN A 1  736  ? 483.012 -16.006 594.291 1.00 46.79  ? 736  ASN A CB    1 
ATOM   5437  C  CG    . ASN A 1  736  ? 484.436 -15.698 594.710 1.00 48.05  ? 736  ASN A CG    1 
ATOM   5438  O  OD1   . ASN A 1  736  ? 484.676 -15.169 595.795 1.00 48.98  ? 736  ASN A OD1   1 
ATOM   5439  N  ND2   . ASN A 1  736  ? 485.391 -16.034 593.851 1.00 50.40  ? 736  ASN A ND2   1 
ATOM   5440  N  N     . LEU A 1  737  ? 481.668 -17.795 596.736 1.00 43.61  ? 737  LEU A N     1 
ATOM   5441  C  CA    . LEU A 1  737  ? 481.701 -18.061 598.172 1.00 41.11  ? 737  LEU A CA    1 
ATOM   5442  C  C     . LEU A 1  737  ? 482.089 -19.502 598.482 1.00 42.52  ? 737  LEU A C     1 
ATOM   5443  O  O     . LEU A 1  737  ? 481.568 -20.439 597.879 1.00 45.20  ? 737  LEU A O     1 
ATOM   5444  C  CB    . LEU A 1  737  ? 480.348 -17.746 598.809 1.00 40.44  ? 737  LEU A CB    1 
ATOM   5445  C  CG    . LEU A 1  737  ? 479.916 -16.280 598.800 1.00 39.27  ? 737  LEU A CG    1 
ATOM   5446  C  CD1   . LEU A 1  737  ? 478.734 -16.075 599.732 1.00 36.04  ? 737  LEU A CD1   1 
ATOM   5447  C  CD2   . LEU A 1  737  ? 481.073 -15.367 599.178 1.00 37.01  ? 737  LEU A CD2   1 
ATOM   5448  N  N     . LYS A 1  738  ? 483.002 -19.668 599.433 1.00 36.46  ? 738  LYS A N     1 
ATOM   5449  C  CA    . LYS A 1  738  ? 483.464 -20.990 599.839 1.00 37.37  ? 738  LYS A CA    1 
ATOM   5450  C  C     . LYS A 1  738  ? 482.478 -21.641 600.803 1.00 36.46  ? 738  LYS A C     1 
ATOM   5451  O  O     . LYS A 1  738  ? 481.524 -21.005 601.247 1.00 37.31  ? 738  LYS A O     1 
ATOM   5452  C  CB    . LYS A 1  738  ? 484.844 -20.893 600.487 1.00 38.23  ? 738  LYS A CB    1 
ATOM   5453  C  CG    . LYS A 1  738  ? 485.849 -20.099 599.673 1.00 38.93  ? 738  LYS A CG    1 
ATOM   5454  C  CD    . LYS A 1  738  ? 487.154 -19.927 600.426 1.00 39.56  ? 738  LYS A CD    1 
ATOM   5455  C  CE    . LYS A 1  738  ? 488.121 -19.063 599.641 1.00 40.37  ? 738  LYS A CE    1 
ATOM   5456  N  NZ    . LYS A 1  738  ? 487.556 -17.711 599.368 1.00 42.18  ? 738  LYS A NZ    1 
ATOM   5457  N  N     . ASP A 1  739  ? 482.713 -22.908 601.128 1.00 43.32  ? 739  ASP A N     1 
ATOM   5458  C  CA    . ASP A 1  739  ? 481.855 -23.622 602.067 1.00 42.61  ? 739  ASP A CA    1 
ATOM   5459  C  C     . ASP A 1  739  ? 482.181 -23.229 603.503 1.00 41.91  ? 739  ASP A C     1 
ATOM   5460  O  O     . ASP A 1  739  ? 481.439 -23.552 604.430 1.00 41.11  ? 739  ASP A O     1 
ATOM   5461  C  CB    . ASP A 1  739  ? 481.994 -25.134 601.888 1.00 44.07  ? 739  ASP A CB    1 
ATOM   5462  C  CG    . ASP A 1  739  ? 481.439 -25.617 600.561 1.00 46.37  ? 739  ASP A CG    1 
ATOM   5463  O  OD1   . ASP A 1  739  ? 481.617 -24.908 599.548 1.00 50.40  ? 739  ASP A OD1   1 
ATOM   5464  O  OD2   . ASP A 1  739  ? 480.821 -26.703 600.532 1.00 47.85  ? 739  ASP A OD2   1 
ATOM   5465  N  N     . LEU A 1  740  ? 483.300 -22.533 603.677 1.00 37.77  ? 740  LEU A N     1 
ATOM   5466  C  CA    . LEU A 1  740  ? 483.702 -22.035 604.987 1.00 37.94  ? 740  LEU A CA    1 
ATOM   5467  C  C     . LEU A 1  740  ? 483.127 -20.644 605.230 1.00 37.72  ? 740  LEU A C     1 
ATOM   5468  O  O     . LEU A 1  740  ? 483.278 -20.080 606.315 1.00 38.30  ? 740  LEU A O     1 
ATOM   5469  C  CB    . LEU A 1  740  ? 485.226 -22.010 605.107 1.00 40.55  ? 740  LEU A CB    1 
ATOM   5470  C  CG    . LEU A 1  740  ? 485.982 -21.137 604.100 1.00 41.95  ? 740  LEU A CG    1 
ATOM   5471  C  CD1   . LEU A 1  740  ? 486.371 -19.794 604.708 1.00 39.09  ? 740  LEU A CD1   1 
ATOM   5472  C  CD2   . LEU A 1  740  ? 487.206 -21.867 603.570 1.00 45.77  ? 740  LEU A CD2   1 
ATOM   5473  N  N     . ASN A 1  741  ? 482.477 -20.094 604.209 1.00 34.63  ? 741  ASN A N     1 
ATOM   5474  C  CA    . ASN A 1  741  ? 481.823 -18.797 604.321 1.00 32.20  ? 741  ASN A CA    1 
ATOM   5475  C  C     . ASN A 1  741  ? 480.613 -18.884 605.241 1.00 31.57  ? 741  ASN A C     1 
ATOM   5476  O  O     . ASN A 1  741  ? 479.652 -19.596 604.946 1.00 30.99  ? 741  ASN A O     1 
ATOM   5477  C  CB    . ASN A 1  741  ? 481.403 -18.285 602.944 1.00 32.25  ? 741  ASN A CB    1 
ATOM   5478  C  CG    . ASN A 1  741  ? 480.883 -16.863 602.985 1.00 31.15  ? 741  ASN A CG    1 
ATOM   5479  O  OD1   . ASN A 1  741  ? 479.762 -16.609 603.429 1.00 30.93  ? 741  ASN A OD1   1 
ATOM   5480  N  ND2   . ASN A 1  741  ? 481.695 -15.924 602.512 1.00 31.51  ? 741  ASN A ND2   1 
ATOM   5481  N  N     . ASN A 1  742  ? 480.666 -18.152 606.348 1.00 46.85  ? 742  ASN A N     1 
ATOM   5482  C  CA    . ASN A 1  742  ? 479.649 -18.242 607.391 1.00 45.33  ? 742  ASN A CA    1 
ATOM   5483  C  C     . ASN A 1  742  ? 478.241 -17.896 606.912 1.00 43.21  ? 742  ASN A C     1 
ATOM   5484  O  O     . ASN A 1  742  ? 477.272 -18.564 607.281 1.00 43.49  ? 742  ASN A O     1 
ATOM   5485  C  CB    . ASN A 1  742  ? 480.029 -17.338 608.560 1.00 44.22  ? 742  ASN A CB    1 
ATOM   5486  C  CG    . ASN A 1  742  ? 481.357 -17.721 609.183 1.00 45.81  ? 742  ASN A CG    1 
ATOM   5487  O  OD1   . ASN A 1  742  ? 482.389 -17.114 608.896 1.00 48.55  ? 742  ASN A OD1   1 
ATOM   5488  N  ND2   . ASN A 1  742  ? 481.338 -18.736 610.040 1.00 45.11  ? 742  ASN A ND2   1 
ATOM   5489  N  N     . VAL A 1  743  ? 478.132 -16.849 606.099 1.00 25.88  ? 743  VAL A N     1 
ATOM   5490  C  CA    . VAL A 1  743  ? 476.851 -16.470 605.516 1.00 25.13  ? 743  VAL A CA    1 
ATOM   5491  C  C     . VAL A 1  743  ? 476.295 -17.620 604.684 1.00 25.64  ? 743  VAL A C     1 
ATOM   5492  O  O     . VAL A 1  743  ? 475.137 -18.020 604.844 1.00 25.08  ? 743  VAL A O     1 
ATOM   5493  C  CB    . VAL A 1  743  ? 476.972 -15.214 604.633 1.00 25.00  ? 743  VAL A CB    1 
ATOM   5494  C  CG1   . VAL A 1  743  ? 475.643 -14.908 603.964 1.00 24.34  ? 743  VAL A CG1   1 
ATOM   5495  C  CG2   . VAL A 1  743  ? 477.440 -14.029 605.458 1.00 24.49  ? 743  VAL A CG2   1 
ATOM   5496  N  N     . LYS A 1  744  ? 477.138 -18.159 603.808 1.00 31.74  ? 744  LYS A N     1 
ATOM   5497  C  CA    . LYS A 1  744  ? 476.750 -19.273 602.957 1.00 32.43  ? 744  LYS A CA    1 
ATOM   5498  C  C     . LYS A 1  744  ? 476.415 -20.502 603.795 1.00 32.49  ? 744  LYS A C     1 
ATOM   5499  O  O     . LYS A 1  744  ? 475.555 -21.294 603.420 1.00 32.56  ? 744  LYS A O     1 
ATOM   5500  C  CB    . LYS A 1  744  ? 477.857 -19.598 601.952 1.00 33.78  ? 744  LYS A CB    1 
ATOM   5501  C  CG    . LYS A 1  744  ? 477.450 -20.610 600.889 1.00 34.57  ? 744  LYS A CG    1 
ATOM   5502  C  CD    . LYS A 1  744  ? 478.541 -20.801 599.848 1.00 35.94  ? 744  LYS A CD    1 
ATOM   5503  C  CE    . LYS A 1  744  ? 478.080 -21.721 598.726 1.00 36.75  ? 744  LYS A CE    1 
ATOM   5504  N  NZ    . LYS A 1  744  ? 479.123 -21.897 597.678 1.00 38.17  ? 744  LYS A NZ    1 
ATOM   5505  N  N     . GLN A 1  745  ? 477.089 -20.654 604.931 1.00 31.08  ? 745  GLN A N     1 
ATOM   5506  C  CA    . GLN A 1  745  ? 476.799 -21.755 605.844 1.00 31.12  ? 745  GLN A CA    1 
ATOM   5507  C  C     . GLN A 1  745  ? 475.396 -21.624 606.428 1.00 29.95  ? 745  GLN A C     1 
ATOM   5508  O  O     . GLN A 1  745  ? 474.638 -22.595 606.469 1.00 30.03  ? 745  GLN A O     1 
ATOM   5509  C  CB    . GLN A 1  745  ? 477.832 -21.816 606.972 1.00 31.36  ? 745  GLN A CB    1 
ATOM   5510  C  CG    . GLN A 1  745  ? 479.206 -22.300 606.538 1.00 32.72  ? 745  GLN A CG    1 
ATOM   5511  C  CD    . GLN A 1  745  ? 480.192 -22.360 607.687 1.00 32.97  ? 745  GLN A CD    1 
ATOM   5512  O  OE1   . GLN A 1  745  ? 479.967 -23.056 608.675 1.00 32.83  ? 745  GLN A OE1   1 
ATOM   5513  N  NE2   . GLN A 1  745  ? 481.289 -21.622 607.567 1.00 34.34  ? 745  GLN A NE2   1 
ATOM   5514  N  N     . MET A 1  746  ? 475.055 -20.421 606.880 1.00 34.84  ? 746  MET A N     1 
ATOM   5515  C  CA    . MET A 1  746  ? 473.721 -20.165 607.415 1.00 33.41  ? 746  MET A CA    1 
ATOM   5516  C  C     . MET A 1  746  ? 472.655 -20.340 606.338 1.00 33.18  ? 746  MET A C     1 
ATOM   5517  O  O     . MET A 1  746  ? 471.536 -20.767 606.624 1.00 31.91  ? 746  MET A O     1 
ATOM   5518  C  CB    . MET A 1  746  ? 473.641 -18.761 608.020 1.00 31.05  ? 746  MET A CB    1 
ATOM   5519  C  CG    . MET A 1  746  ? 474.314 -18.640 609.376 1.00 30.59  ? 746  MET A CG    1 
ATOM   5520  S  SD    . MET A 1  746  ? 474.214 -16.983 610.075 1.00 28.70  ? 746  MET A SD    1 
ATOM   5521  C  CE    . MET A 1  746  ? 475.210 -16.062 608.908 1.00 29.48  ? 746  MET A CE    1 
ATOM   5522  N  N     . VAL A 1  747  ? 473.010 -20.011 605.099 1.00 26.78  ? 747  VAL A N     1 
ATOM   5523  C  CA    . VAL A 1  747  ? 472.102 -20.209 603.973 1.00 26.85  ? 747  VAL A CA    1 
ATOM   5524  C  C     . VAL A 1  747  ? 471.861 -21.701 603.727 1.00 27.63  ? 747  VAL A C     1 
ATOM   5525  O  O     . VAL A 1  747  ? 470.720 -22.132 603.547 1.00 27.46  ? 747  VAL A O     1 
ATOM   5526  C  CB    . VAL A 1  747  ? 472.645 -19.549 602.687 1.00 27.35  ? 747  VAL A CB    1 
ATOM   5527  C  CG1   . VAL A 1  747  ? 471.859 -20.012 601.469 1.00 27.71  ? 747  VAL A CG1   1 
ATOM   5528  C  CG2   . VAL A 1  747  ? 472.601 -18.030 602.813 1.00 26.51  ? 747  VAL A CG2   1 
ATOM   5529  N  N     . MET A 1  748  ? 472.939 -22.481 603.732 1.00 40.72  ? 748  MET A N     1 
ATOM   5530  C  CA    . MET A 1  748  ? 472.856 -23.928 603.551 1.00 41.57  ? 748  MET A CA    1 
ATOM   5531  C  C     . MET A 1  748  ? 472.019 -24.579 604.645 1.00 41.17  ? 748  MET A C     1 
ATOM   5532  O  O     . MET A 1  748  ? 471.171 -25.428 604.371 1.00 42.17  ? 748  MET A O     1 
ATOM   5533  C  CB    . MET A 1  748  ? 474.252 -24.550 603.538 1.00 42.51  ? 748  MET A CB    1 
ATOM   5534  C  CG    . MET A 1  748  ? 475.067 -24.254 602.294 1.00 46.04  ? 748  MET A CG    1 
ATOM   5535  S  SD    . MET A 1  748  ? 476.772 -24.809 602.482 1.00 50.93  ? 748  MET A SD    1 
ATOM   5536  C  CE    . MET A 1  748  ? 477.398 -24.568 600.823 1.00 53.83  ? 748  MET A CE    1 
ATOM   5537  N  N     . ALA A 1  749  ? 472.271 -24.175 605.885 1.00 32.02  ? 749  ALA A N     1 
ATOM   5538  C  CA    . ALA A 1  749  ? 471.542 -24.702 607.033 1.00 31.60  ? 749  ALA A CA    1 
ATOM   5539  C  C     . ALA A 1  749  ? 470.066 -24.330 606.976 1.00 30.86  ? 749  ALA A C     1 
ATOM   5540  O  O     . ALA A 1  749  ? 469.216 -25.038 607.515 1.00 30.86  ? 749  ALA A O     1 
ATOM   5541  C  CB    . ALA A 1  749  ? 472.158 -24.193 608.325 1.00 32.63  ? 749  ALA A CB    1 
ATOM   5542  N  N     . GLY A 1  750  ? 469.769 -23.213 606.322 1.00 29.57  ? 750  GLY A N     1 
ATOM   5543  C  CA    . GLY A 1  750  ? 468.413 -22.705 606.268 1.00 28.86  ? 750  GLY A CA    1 
ATOM   5544  C  C     . GLY A 1  750  ? 468.082 -21.965 607.547 1.00 27.84  ? 750  GLY A C     1 
ATOM   5545  O  O     . GLY A 1  750  ? 466.919 -21.677 607.832 1.00 27.27  ? 750  GLY A O     1 
ATOM   5546  N  N     . SER A 1  751  ? 469.119 -21.656 608.318 1.00 24.93  ? 751  SER A N     1 
ATOM   5547  C  CA    . SER A 1  751  ? 468.955 -20.978 609.596 1.00 24.51  ? 751  SER A CA    1 
ATOM   5548  C  C     . SER A 1  751  ? 468.615 -19.502 609.410 1.00 25.03  ? 751  SER A C     1 
ATOM   5549  O  O     . SER A 1  751  ? 467.760 -18.962 610.115 1.00 26.05  ? 751  SER A O     1 
ATOM   5550  C  CB    . SER A 1  751  ? 470.221 -21.125 610.441 1.00 24.29  ? 751  SER A CB    1 
ATOM   5551  O  OG    . SER A 1  751  ? 471.345 -20.572 609.780 1.00 26.73  ? 751  SER A OG    1 
ATOM   5552  N  N     . LYS A 1  752  ? 469.284 -18.855 608.458 1.00 41.80  ? 752  LYS A N     1 
ATOM   5553  C  CA    . LYS A 1  752  ? 469.042 -17.444 608.179 1.00 43.48  ? 752  LYS A CA    1 
ATOM   5554  C  C     . LYS A 1  752  ? 469.634 -17.017 606.842 1.00 40.97  ? 752  LYS A C     1 
ATOM   5555  O  O     . LYS A 1  752  ? 470.638 -17.567 606.391 1.00 41.52  ? 752  LYS A O     1 
ATOM   5556  C  CB    . LYS A 1  752  ? 469.623 -16.572 609.292 1.00 41.08  ? 752  LYS A CB    1 
ATOM   5557  C  CG    . LYS A 1  752  ? 468.831 -15.308 609.554 1.00 37.50  ? 752  LYS A CG    1 
ATOM   5558  C  CD    . LYS A 1  752  ? 467.457 -15.648 610.098 1.00 38.91  ? 752  LYS A CD    1 
ATOM   5559  C  CE    . LYS A 1  752  ? 466.695 -14.400 610.479 1.00 42.79  ? 752  LYS A CE    1 
ATOM   5560  N  NZ    . LYS A 1  752  ? 467.383 -13.617 611.545 1.00 46.45  ? 752  LYS A NZ    1 
ATOM   5561  N  N     . GLY A 1  753  ? 469.007 -16.029 606.214 1.00 41.00  ? 753  GLY A N     1 
ATOM   5562  C  CA    . GLY A 1  753  ? 469.528 -15.456 604.986 1.00 42.10  ? 753  GLY A CA    1 
ATOM   5563  C  C     . GLY A 1  753  ? 469.174 -16.232 603.732 1.00 43.27  ? 753  GLY A C     1 
ATOM   5564  O  O     . GLY A 1  753  ? 468.839 -17.415 603.789 1.00 45.19  ? 753  GLY A O     1 
ATOM   5565  N  N     . SER A 1  754  ? 469.251 -15.553 602.592 1.00 40.42  ? 754  SER A N     1 
ATOM   5566  C  CA    . SER A 1  754  ? 468.959 -16.168 601.305 1.00 41.35  ? 754  SER A CA    1 
ATOM   5567  C  C     . SER A 1  754  ? 469.916 -15.659 600.234 1.00 43.01  ? 754  SER A C     1 
ATOM   5568  O  O     . SER A 1  754  ? 470.901 -14.985 600.538 1.00 43.84  ? 754  SER A O     1 
ATOM   5569  C  CB    . SER A 1  754  ? 467.514 -15.892 600.890 1.00 44.40  ? 754  SER A CB    1 
ATOM   5570  O  OG    . SER A 1  754  ? 467.321 -14.515 600.619 1.00 44.33  ? 754  SER A OG    1 
ATOM   5571  N  N     . PHE A 1  755  ? 469.615 -15.981 598.980 1.00 34.09  ? 755  PHE A N     1 
ATOM   5572  C  CA    . PHE A 1  755  ? 470.471 -15.602 597.862 1.00 35.53  ? 755  PHE A CA    1 
ATOM   5573  C  C     . PHE A 1  755  ? 470.551 -14.093 597.675 1.00 34.54  ? 755  PHE A C     1 
ATOM   5574  O  O     . PHE A 1  755  ? 471.635 -13.543 597.481 1.00 34.50  ? 755  PHE A O     1 
ATOM   5575  C  CB    . PHE A 1  755  ? 469.975 -16.251 596.569 1.00 39.96  ? 755  PHE A CB    1 
ATOM   5576  C  CG    . PHE A 1  755  ? 470.478 -15.578 595.323 1.00 38.55  ? 755  PHE A CG    1 
ATOM   5577  C  CD1   . PHE A 1  755  ? 471.779 -15.773 594.893 1.00 40.32  ? 755  PHE A CD1   1 
ATOM   5578  C  CD2   . PHE A 1  755  ? 469.648 -14.752 594.582 1.00 37.09  ? 755  PHE A CD2   1 
ATOM   5579  C  CE1   . PHE A 1  755  ? 472.243 -15.155 593.749 1.00 41.00  ? 755  PHE A CE1   1 
ATOM   5580  C  CE2   . PHE A 1  755  ? 470.107 -14.130 593.438 1.00 37.71  ? 755  PHE A CE2   1 
ATOM   5581  C  CZ    . PHE A 1  755  ? 471.406 -14.332 593.020 1.00 39.02  ? 755  PHE A CZ    1 
ATOM   5582  N  N     . ILE A 1  756  ? 469.400 -13.431 597.732 1.00 49.37  ? 756  ILE A N     1 
ATOM   5583  C  CA    . ILE A 1  756  ? 469.322 -11.999 597.466 1.00 47.53  ? 756  ILE A CA    1 
ATOM   5584  C  C     . ILE A 1  756  ? 470.133 -11.195 598.485 1.00 45.96  ? 756  ILE A C     1 
ATOM   5585  O  O     . ILE A 1  756  ? 470.612 -10.101 598.187 1.00 46.44  ? 756  ILE A O     1 
ATOM   5586  C  CB    . ILE A 1  756  ? 467.853 -11.513 597.456 1.00 46.54  ? 756  ILE A CB    1 
ATOM   5587  C  CG1   . ILE A 1  756  ? 467.762 -10.071 596.952 1.00 46.31  ? 756  ILE A CG1   1 
ATOM   5588  C  CG2   . ILE A 1  756  ? 467.215 -11.668 598.830 1.00 47.26  ? 756  ILE A CG2   1 
ATOM   5589  C  CD1   . ILE A 1  756  ? 468.288 -9.884  595.545 1.00 46.23  ? 756  ILE A CD1   1 
ATOM   5590  N  N     . ASN A 1  757  ? 470.303 -11.752 599.681 1.00 32.53  ? 757  ASN A N     1 
ATOM   5591  C  CA    . ASN A 1  757  ? 471.119 -11.117 600.707 1.00 32.82  ? 757  ASN A CA    1 
ATOM   5592  C  C     . ASN A 1  757  ? 472.585 -11.093 600.291 1.00 34.98  ? 757  ASN A C     1 
ATOM   5593  O  O     . ASN A 1  757  ? 473.244 -10.056 600.359 1.00 35.22  ? 757  ASN A O     1 
ATOM   5594  C  CB    . ASN A 1  757  ? 470.957 -11.840 602.044 1.00 31.69  ? 757  ASN A CB    1 
ATOM   5595  C  CG    . ASN A 1  757  ? 469.506 -11.952 602.472 1.00 32.66  ? 757  ASN A CG    1 
ATOM   5596  O  OD1   . ASN A 1  757  ? 469.014 -13.044 602.760 1.00 32.50  ? 757  ASN A OD1   1 
ATOM   5597  N  ND2   . ASN A 1  757  ? 468.811 -10.821 602.508 1.00 31.33  ? 757  ASN A ND2   1 
ATOM   5598  N  N     . ILE A 1  758  ? 473.083 -12.245 599.851 1.00 24.14  ? 758  ILE A N     1 
ATOM   5599  C  CA    . ILE A 1  758  ? 474.445 -12.356 599.342 1.00 25.18  ? 758  ILE A CA    1 
ATOM   5600  C  C     . ILE A 1  758  ? 474.636 -11.462 598.118 1.00 25.52  ? 758  ILE A C     1 
ATOM   5601  O  O     . ILE A 1  758  ? 475.664 -10.793 597.972 1.00 25.95  ? 758  ILE A O     1 
ATOM   5602  C  CB    . ILE A 1  758  ? 474.788 -13.816 598.974 1.00 26.15  ? 758  ILE A CB    1 
ATOM   5603  C  CG1   . ILE A 1  758  ? 474.712 -14.708 600.215 1.00 25.91  ? 758  ILE A CG1   1 
ATOM   5604  C  CG2   . ILE A 1  758  ? 476.166 -13.901 598.337 1.00 27.34  ? 758  ILE A CG2   1 
ATOM   5605  C  CD1   . ILE A 1  758  ? 475.025 -16.161 599.948 1.00 26.88  ? 758  ILE A CD1   1 
ATOM   5606  N  N     . ALA A 1  759  ? 473.628 -11.449 597.250 1.00 35.76  ? 759  ALA A N     1 
ATOM   5607  C  CA    . ALA A 1  759  ? 473.661 -10.653 596.029 1.00 35.06  ? 759  ALA A CA    1 
ATOM   5608  C  C     . ALA A 1  759  ? 473.789 -9.165  596.328 1.00 34.33  ? 759  ALA A C     1 
ATOM   5609  O  O     . ALA A 1  759  ? 474.631 -8.477  595.752 1.00 35.55  ? 759  ALA A O     1 
ATOM   5610  C  CB    . ALA A 1  759  ? 472.414 -10.916 595.199 1.00 33.56  ? 759  ALA A CB    1 
ATOM   5611  N  N     . GLN A 1  760  ? 472.955 -8.675  597.240 1.00 28.70  ? 760  GLN A N     1 
ATOM   5612  C  CA    . GLN A 1  760  ? 472.904 -7.248  597.538 1.00 27.28  ? 760  GLN A CA    1 
ATOM   5613  C  C     . GLN A 1  760  ? 474.038 -6.794  598.454 1.00 28.13  ? 760  GLN A C     1 
ATOM   5614  O  O     . GLN A 1  760  ? 474.428 -5.628  598.431 1.00 28.73  ? 760  GLN A O     1 
ATOM   5615  C  CB    . GLN A 1  760  ? 471.551 -6.890  598.159 1.00 24.98  ? 760  GLN A CB    1 
ATOM   5616  C  CG    . GLN A 1  760  ? 470.381 -7.060  597.203 1.00 24.90  ? 760  GLN A CG    1 
ATOM   5617  C  CD    . GLN A 1  760  ? 469.060 -6.636  597.810 1.00 23.62  ? 760  GLN A CD    1 
ATOM   5618  O  OE1   . GLN A 1  760  ? 468.789 -6.896  598.982 1.00 25.72  ? 760  GLN A OE1   1 
ATOM   5619  N  NE2   . GLN A 1  760  ? 468.230 -5.973  597.013 1.00 23.96  ? 760  GLN A NE2   1 
ATOM   5620  N  N     . MET A 1  761  ? 474.570 -7.710  599.256 1.00 32.34  ? 761  MET A N     1 
ATOM   5621  C  CA    . MET A 1  761  ? 475.677 -7.366  600.141 1.00 32.26  ? 761  MET A CA    1 
ATOM   5622  C  C     . MET A 1  761  ? 477.021 -7.399  599.420 1.00 34.19  ? 761  MET A C     1 
ATOM   5623  O  O     . MET A 1  761  ? 477.868 -6.535  599.642 1.00 33.44  ? 761  MET A O     1 
ATOM   5624  C  CB    . MET A 1  761  ? 475.721 -8.305  601.349 1.00 32.82  ? 761  MET A CB    1 
ATOM   5625  C  CG    . MET A 1  761  ? 474.667 -8.015  602.406 1.00 32.54  ? 761  MET A CG    1 
ATOM   5626  S  SD    . MET A 1  761  ? 474.960 -8.916  603.942 1.00 33.74  ? 761  MET A SD    1 
ATOM   5627  C  CE    . MET A 1  761  ? 475.008 -10.605 603.344 1.00 34.44  ? 761  MET A CE    1 
ATOM   5628  N  N     . SER A 1  762  ? 477.210 -8.389  598.551 1.00 31.29  ? 762  SER A N     1 
ATOM   5629  C  CA    . SER A 1  762  ? 478.517 -8.623  597.941 1.00 32.50  ? 762  SER A CA    1 
ATOM   5630  C  C     . SER A 1  762  ? 478.630 -8.126  596.500 1.00 33.12  ? 762  SER A C     1 
ATOM   5631  O  O     . SER A 1  762  ? 479.661 -7.578  596.107 1.00 33.84  ? 762  SER A O     1 
ATOM   5632  C  CB    . SER A 1  762  ? 478.853 -10.114 597.986 1.00 33.24  ? 762  SER A CB    1 
ATOM   5633  O  OG    . SER A 1  762  ? 478.838 -10.599 599.317 1.00 32.77  ? 762  SER A OG    1 
ATOM   5634  N  N     . ALA A 1  763  ? 477.574 -8.321  595.716 1.00 28.22  ? 763  ALA A N     1 
ATOM   5635  C  CA    . ALA A 1  763  ? 477.637 -8.061  594.280 1.00 28.94  ? 763  ALA A CA    1 
ATOM   5636  C  C     . ALA A 1  763  ? 477.022 -6.722  593.881 1.00 28.30  ? 763  ALA A C     1 
ATOM   5637  O  O     . ALA A 1  763  ? 477.736 -5.780  593.537 1.00 28.65  ? 763  ALA A O     1 
ATOM   5638  C  CB    . ALA A 1  763  ? 476.959 -9.190  593.520 1.00 29.33  ? 763  ALA A CB    1 
ATOM   5639  N  N     . CYS A 1  764  ? 475.695 -6.651  593.923 1.00 32.39  ? 764  CYS A N     1 
ATOM   5640  C  CA    . CYS A 1  764  ? 474.961 -5.483  593.449 1.00 29.19  ? 764  CYS A CA    1 
ATOM   5641  C  C     . CYS A 1  764  ? 473.544 -5.484  594.010 1.00 28.93  ? 764  CYS A C     1 
ATOM   5642  O  O     . CYS A 1  764  ? 472.809 -6.456  593.835 1.00 28.46  ? 764  CYS A O     1 
ATOM   5643  C  CB    . CYS A 1  764  ? 474.933 -5.465  591.919 1.00 29.97  ? 764  CYS A CB    1 
ATOM   5644  S  SG    . CYS A 1  764  ? 473.578 -4.528  591.186 1.00 32.39  ? 764  CYS A SG    1 
ATOM   5645  N  N     . VAL A 1  765  ? 473.154 -4.403  594.681 1.00 23.18  ? 765  VAL A N     1 
ATOM   5646  C  CA    . VAL A 1  765  ? 471.850 -4.376  595.340 1.00 22.14  ? 765  VAL A CA    1 
ATOM   5647  C  C     . VAL A 1  765  ? 470.724 -4.252  594.313 1.00 22.32  ? 765  VAL A C     1 
ATOM   5648  O  O     . VAL A 1  765  ? 469.571 -4.574  594.605 1.00 21.87  ? 765  VAL A O     1 
ATOM   5649  C  CB    . VAL A 1  765  ? 471.742 -3.234  596.388 1.00 21.32  ? 765  VAL A CB    1 
ATOM   5650  C  CG1   . VAL A 1  765  ? 473.104 -2.923  596.989 1.00 21.71  ? 765  VAL A CG1   1 
ATOM   5651  C  CG2   . VAL A 1  765  ? 471.126 -1.989  595.789 1.00 21.01  ? 765  VAL A CG2   1 
ATOM   5652  N  N     . GLY A 1  766  ? 471.060 -3.795  593.110 1.00 36.25  ? 766  GLY A N     1 
ATOM   5653  C  CA    . GLY A 1  766  ? 470.121 -3.811  592.003 1.00 38.42  ? 766  GLY A CA    1 
ATOM   5654  C  C     . GLY A 1  766  ? 469.259 -2.575  591.829 1.00 37.84  ? 766  GLY A C     1 
ATOM   5655  O  O     . GLY A 1  766  ? 469.539 -1.515  592.390 1.00 37.10  ? 766  GLY A O     1 
ATOM   5656  N  N     . GLN A 1  767  ? 468.200 -2.726  591.040 1.00 30.77  ? 767  GLN A N     1 
ATOM   5657  C  CA    . GLN A 1  767  ? 467.318 -1.619  590.686 1.00 30.58  ? 767  GLN A CA    1 
ATOM   5658  C  C     . GLN A 1  767  ? 466.284 -1.330  591.767 1.00 28.89  ? 767  GLN A C     1 
ATOM   5659  O  O     . GLN A 1  767  ? 465.571 -2.227  592.216 1.00 28.63  ? 767  GLN A O     1 
ATOM   5660  C  CB    . GLN A 1  767  ? 466.608 -1.915  589.360 1.00 30.73  ? 767  GLN A CB    1 
ATOM   5661  C  CG    . GLN A 1  767  ? 465.506 -0.931  588.998 1.00 30.59  ? 767  GLN A CG    1 
ATOM   5662  C  CD    . GLN A 1  767  ? 466.039 0.443   588.645 1.00 31.75  ? 767  GLN A CD    1 
ATOM   5663  O  OE1   . GLN A 1  767  ? 467.024 0.571   587.919 1.00 33.21  ? 767  GLN A OE1   1 
ATOM   5664  N  NE2   . GLN A 1  767  ? 465.391 1.480   589.161 1.00 31.40  ? 767  GLN A NE2   1 
ATOM   5665  N  N     . GLN A 1  768  ? 466.210 -0.068  592.179 1.00 35.71  ? 768  GLN A N     1 
ATOM   5666  C  CA    . GLN A 1  768  ? 465.196 0.376   593.127 1.00 33.97  ? 768  GLN A CA    1 
ATOM   5667  C  C     . GLN A 1  768  ? 463.905 0.698   592.388 1.00 34.92  ? 768  GLN A C     1 
ATOM   5668  O  O     . GLN A 1  768  ? 463.935 1.089   591.222 1.00 37.34  ? 768  GLN A O     1 
ATOM   5669  C  CB    . GLN A 1  768  ? 465.685 1.594   593.909 1.00 32.55  ? 768  GLN A CB    1 
ATOM   5670  C  CG    . GLN A 1  768  ? 466.957 1.341   594.698 1.00 33.11  ? 768  GLN A CG    1 
ATOM   5671  C  CD    . GLN A 1  768  ? 466.773 0.292   595.779 1.00 32.61  ? 768  GLN A CD    1 
ATOM   5672  O  OE1   . GLN A 1  768  ? 465.715 0.203   596.402 1.00 31.34  ? 768  GLN A OE1   1 
ATOM   5673  N  NE2   . GLN A 1  768  ? 467.805 -0.513  596.003 1.00 33.66  ? 768  GLN A NE2   1 
ATOM   5674  N  N     . SER A 1  769  ? 462.772 0.534   593.062 1.00 28.83  ? 769  SER A N     1 
ATOM   5675  C  CA    . SER A 1  769  ? 461.484 0.761   592.418 1.00 29.20  ? 769  SER A CA    1 
ATOM   5676  C  C     . SER A 1  769  ? 460.443 1.335   593.370 1.00 28.74  ? 769  SER A C     1 
ATOM   5677  O  O     . SER A 1  769  ? 460.423 1.011   594.558 1.00 27.26  ? 769  SER A O     1 
ATOM   5678  C  CB    . SER A 1  769  ? 460.958 -0.541  591.813 1.00 32.85  ? 769  SER A CB    1 
ATOM   5679  O  OG    . SER A 1  769  ? 460.630 -1.475  592.827 1.00 34.73  ? 769  SER A OG    1 
ATOM   5680  N  N     . VAL A 1  770  ? 459.584 2.196   592.832 1.00 25.03  ? 770  VAL A N     1 
ATOM   5681  C  CA    . VAL A 1  770  ? 458.445 2.733   593.567 1.00 24.57  ? 770  VAL A CA    1 
ATOM   5682  C  C     . VAL A 1  770  ? 457.184 2.585   592.721 1.00 25.17  ? 770  VAL A C     1 
ATOM   5683  O  O     . VAL A 1  770  ? 457.169 2.971   591.552 1.00 25.90  ? 770  VAL A O     1 
ATOM   5684  C  CB    . VAL A 1  770  ? 458.644 4.214   593.942 1.00 24.26  ? 770  VAL A CB    1 
ATOM   5685  C  CG1   . VAL A 1  770  ? 457.408 4.753   594.642 1.00 23.92  ? 770  VAL A CG1   1 
ATOM   5686  C  CG2   . VAL A 1  770  ? 459.872 4.382   594.822 1.00 23.71  ? 770  VAL A CG2   1 
ATOM   5687  N  N     . GLU A 1  771  ? 456.138 2.017   593.318 1.00 48.11  ? 771  GLU A N     1 
ATOM   5688  C  CA    . GLU A 1  771  ? 454.867 1.777   592.635 1.00 48.90  ? 771  GLU A CA    1 
ATOM   5689  C  C     . GLU A 1  771  ? 455.034 0.946   591.365 1.00 49.95  ? 771  GLU A C     1 
ATOM   5690  O  O     . GLU A 1  771  ? 454.410 1.228   590.343 1.00 52.62  ? 771  GLU A O     1 
ATOM   5691  C  CB    . GLU A 1  771  ? 454.174 3.101   592.299 1.00 48.62  ? 771  GLU A CB    1 
ATOM   5692  C  CG    . GLU A 1  771  ? 453.739 3.902   593.514 1.00 52.42  ? 771  GLU A CG    1 
ATOM   5693  C  CD    . GLU A 1  771  ? 452.912 5.118   593.144 1.00 55.89  ? 771  GLU A CD    1 
ATOM   5694  O  OE1   . GLU A 1  771  ? 452.527 5.241   591.961 1.00 55.00  ? 771  GLU A OE1   1 
ATOM   5695  O  OE2   . GLU A 1  771  ? 452.647 5.951   594.036 1.00 57.75  ? 771  GLU A OE2   1 
ATOM   5696  N  N     . GLY A 1  772  ? 455.884 -0.073  591.434 1.00 32.44  ? 772  GLY A N     1 
ATOM   5697  C  CA    . GLY A 1  772  ? 456.045 -1.006  590.332 1.00 34.56  ? 772  GLY A CA    1 
ATOM   5698  C  C     . GLY A 1  772  ? 456.941 -0.518  589.209 1.00 34.23  ? 772  GLY A C     1 
ATOM   5699  O  O     . GLY A 1  772  ? 457.373 -1.305  588.366 1.00 37.62  ? 772  GLY A O     1 
ATOM   5700  N  N     . LYS A 1  773  ? 457.216 0.781   589.192 1.00 25.74  ? 773  LYS A N     1 
ATOM   5701  C  CA    . LYS A 1  773  ? 458.083 1.364   588.176 1.00 26.35  ? 773  LYS A CA    1 
ATOM   5702  C  C     . LYS A 1  773  ? 459.386 1.837   588.807 1.00 25.83  ? 773  LYS A C     1 
ATOM   5703  O  O     . LYS A 1  773  ? 459.481 1.951   590.029 1.00 24.97  ? 773  LYS A O     1 
ATOM   5704  C  CB    . LYS A 1  773  ? 457.379 2.526   587.476 1.00 26.78  ? 773  LYS A CB    1 
ATOM   5705  C  CG    . LYS A 1  773  ? 455.969 2.207   587.009 1.00 27.26  ? 773  LYS A CG    1 
ATOM   5706  C  CD    . LYS A 1  773  ? 455.267 3.452   586.490 1.00 28.09  ? 773  LYS A CD    1 
ATOM   5707  C  CE    . LYS A 1  773  ? 453.812 3.169   586.145 1.00 30.83  ? 773  LYS A CE    1 
ATOM   5708  N  NZ    . LYS A 1  773  ? 453.118 4.386   585.638 1.00 33.98  ? 773  LYS A NZ    1 
ATOM   5709  N  N     . ARG A 1  774  ? 460.392 2.109   587.981 1.00 27.23  ? 774  ARG A N     1 
ATOM   5710  C  CA    . ARG A 1  774  ? 461.637 2.671   588.492 1.00 26.86  ? 774  ARG A CA    1 
ATOM   5711  C  C     . ARG A 1  774  ? 461.420 4.136   588.856 1.00 26.49  ? 774  ARG A C     1 
ATOM   5712  O  O     . ARG A 1  774  ? 460.380 4.707   588.528 1.00 27.30  ? 774  ARG A O     1 
ATOM   5713  C  CB    . ARG A 1  774  ? 462.773 2.513   587.476 1.00 27.70  ? 774  ARG A CB    1 
ATOM   5714  C  CG    . ARG A 1  774  ? 462.366 2.701   586.027 1.00 30.76  ? 774  ARG A CG    1 
ATOM   5715  C  CD    . ARG A 1  774  ? 463.163 1.771   585.118 1.00 31.45  ? 774  ARG A CD    1 
ATOM   5716  N  NE    . ARG A 1  774  ? 464.567 2.153   584.991 1.00 30.01  ? 774  ARG A NE    1 
ATOM   5717  C  CZ    . ARG A 1  774  ? 465.088 2.732   583.913 1.00 30.77  ? 774  ARG A CZ    1 
ATOM   5718  N  NH1   . ARG A 1  774  ? 464.322 2.998   582.863 1.00 31.50  ? 774  ARG A NH1   1 
ATOM   5719  N  NH2   . ARG A 1  774  ? 466.377 3.042   583.883 1.00 30.99  ? 774  ARG A NH2   1 
ATOM   5720  N  N     . ILE A 1  775  ? 462.398 4.726   589.540 1.00 25.07  ? 775  ILE A N     1 
ATOM   5721  C  CA    . ILE A 1  775  ? 462.271 6.072   590.102 1.00 24.64  ? 775  ILE A CA    1 
ATOM   5722  C  C     . ILE A 1  775  ? 461.748 7.089   589.094 1.00 25.30  ? 775  ILE A C     1 
ATOM   5723  O  O     . ILE A 1  775  ? 462.395 7.370   588.087 1.00 26.05  ? 775  ILE A O     1 
ATOM   5724  C  CB    . ILE A 1  775  ? 463.614 6.577   590.652 1.00 24.36  ? 775  ILE A CB    1 
ATOM   5725  C  CG1   . ILE A 1  775  ? 464.164 5.603   591.696 1.00 23.74  ? 775  ILE A CG1   1 
ATOM   5726  C  CG2   . ILE A 1  775  ? 463.451 7.965   591.247 1.00 23.96  ? 775  ILE A CG2   1 
ATOM   5727  C  CD1   . ILE A 1  775  ? 463.267 5.429   592.897 1.00 22.90  ? 775  ILE A CD1   1 
ATOM   5728  N  N     . ALA A 1  776  ? 460.569 7.632   589.380 1.00 23.04  ? 776  ALA A N     1 
ATOM   5729  C  CA    . ALA A 1  776  ? 459.900 8.554   588.471 1.00 23.71  ? 776  ALA A CA    1 
ATOM   5730  C  C     . ALA A 1  776  ? 460.519 9.944   588.515 1.00 23.75  ? 776  ALA A C     1 
ATOM   5731  O  O     . ALA A 1  776  ? 461.333 10.247  589.387 1.00 23.18  ? 776  ALA A O     1 
ATOM   5732  C  CB    . ALA A 1  776  ? 458.418 8.629   588.799 1.00 23.53  ? 776  ALA A CB    1 
ATOM   5733  N  N     . PHE A 1  777  ? 460.122 10.785  587.566 1.00 22.05  ? 777  PHE A N     1 
ATOM   5734  C  CA    . PHE A 1  777  ? 460.632 12.147  587.477 1.00 22.25  ? 777  PHE A CA    1 
ATOM   5735  C  C     . PHE A 1  777  ? 459.897 13.088  588.428 1.00 21.71  ? 777  PHE A C     1 
ATOM   5736  O  O     . PHE A 1  777  ? 458.885 13.689  588.059 1.00 22.10  ? 777  PHE A O     1 
ATOM   5737  C  CB    . PHE A 1  777  ? 460.517 12.662  586.041 1.00 23.37  ? 777  PHE A CB    1 
ATOM   5738  C  CG    . PHE A 1  777  ? 461.446 11.983  585.073 1.00 24.05  ? 777  PHE A CG    1 
ATOM   5739  C  CD1   . PHE A 1  777  ? 462.575 11.323  585.523 1.00 23.68  ? 777  PHE A CD1   1 
ATOM   5740  C  CD2   . PHE A 1  777  ? 461.193 12.012  583.712 1.00 25.12  ? 777  PHE A CD2   1 
ATOM   5741  C  CE1   . PHE A 1  777  ? 463.434 10.702  584.632 1.00 24.39  ? 777  PHE A CE1   1 
ATOM   5742  C  CE2   . PHE A 1  777  ? 462.049 11.393  582.817 1.00 25.82  ? 777  PHE A CE2   1 
ATOM   5743  C  CZ    . PHE A 1  777  ? 463.170 10.738  583.278 1.00 25.47  ? 777  PHE A CZ    1 
ATOM   5744  N  N     . GLY A 1  778  ? 460.408 13.211  589.650 1.00 26.41  ? 778  GLY A N     1 
ATOM   5745  C  CA    . GLY A 1  778  ? 459.829 14.109  590.634 1.00 25.92  ? 778  GLY A CA    1 
ATOM   5746  C  C     . GLY A 1  778  ? 459.977 15.550  590.192 1.00 26.46  ? 778  GLY A C     1 
ATOM   5747  O  O     . GLY A 1  778  ? 459.024 16.328  590.235 1.00 26.64  ? 778  GLY A O     1 
ATOM   5748  N  N     . PHE A 1  779  ? 461.188 15.904  589.777 1.00 27.30  ? 779  PHE A N     1 
ATOM   5749  C  CA    . PHE A 1  779  ? 461.430 17.166  589.098 1.00 29.03  ? 779  PHE A CA    1 
ATOM   5750  C  C     . PHE A 1  779  ? 461.006 16.995  587.643 1.00 32.34  ? 779  PHE A C     1 
ATOM   5751  O  O     . PHE A 1  779  ? 460.775 15.870  587.197 1.00 32.54  ? 779  PHE A O     1 
ATOM   5752  C  CB    . PHE A 1  779  ? 462.904 17.573  589.197 1.00 29.33  ? 779  PHE A CB    1 
ATOM   5753  C  CG    . PHE A 1  779  ? 463.403 17.716  590.609 1.00 27.22  ? 779  PHE A CG    1 
ATOM   5754  C  CD1   . PHE A 1  779  ? 463.382 18.946  591.247 1.00 28.90  ? 779  PHE A CD1   1 
ATOM   5755  C  CD2   . PHE A 1  779  ? 463.897 16.621  591.299 1.00 26.52  ? 779  PHE A CD2   1 
ATOM   5756  C  CE1   . PHE A 1  779  ? 463.840 19.081  592.547 1.00 26.31  ? 779  PHE A CE1   1 
ATOM   5757  C  CE2   . PHE A 1  779  ? 464.354 16.750  592.598 1.00 25.76  ? 779  PHE A CE2   1 
ATOM   5758  C  CZ    . PHE A 1  779  ? 464.326 17.982  593.221 1.00 25.66  ? 779  PHE A CZ    1 
ATOM   5759  N  N     . VAL A 1  780  ? 460.900 18.094  586.901 1.00 35.23  ? 780  VAL A N     1 
ATOM   5760  C  CA    . VAL A 1  780  ? 460.491 18.003  585.503 1.00 36.24  ? 780  VAL A CA    1 
ATOM   5761  C  C     . VAL A 1  780  ? 461.547 17.284  584.665 1.00 36.62  ? 780  VAL A C     1 
ATOM   5762  O  O     . VAL A 1  780  ? 462.699 17.714  584.587 1.00 37.87  ? 780  VAL A O     1 
ATOM   5763  C  CB    . VAL A 1  780  ? 460.206 19.392  584.890 1.00 36.18  ? 780  VAL A CB    1 
ATOM   5764  C  CG1   . VAL A 1  780  ? 458.795 19.847  585.236 1.00 34.47  ? 780  VAL A CG1   1 
ATOM   5765  C  CG2   . VAL A 1  780  ? 461.237 20.409  585.349 1.00 38.87  ? 780  VAL A CG2   1 
ATOM   5766  N  N     . ASP A 1  781  ? 461.135 16.166  584.070 1.00 41.68  ? 781  ASP A N     1 
ATOM   5767  C  CA    . ASP A 1  781  ? 461.963 15.379  583.156 1.00 44.62  ? 781  ASP A CA    1 
ATOM   5768  C  C     . ASP A 1  781  ? 463.243 14.817  583.784 1.00 43.99  ? 781  ASP A C     1 
ATOM   5769  O  O     . ASP A 1  781  ? 464.128 14.340  583.073 1.00 44.27  ? 781  ASP A O     1 
ATOM   5770  C  CB    . ASP A 1  781  ? 462.324 16.212  581.923 1.00 47.29  ? 781  ASP A CB    1 
ATOM   5771  C  CG    . ASP A 1  781  ? 461.105 16.640  581.132 1.00 49.72  ? 781  ASP A CG    1 
ATOM   5772  O  OD1   . ASP A 1  781  ? 460.026 16.044  581.338 1.00 50.16  ? 781  ASP A OD1   1 
ATOM   5773  O  OD2   . ASP A 1  781  ? 461.228 17.565  580.300 1.00 50.83  ? 781  ASP A OD2   1 
ATOM   5774  N  N     . ARG A 1  782  ? 463.340 14.862  585.109 1.00 21.63  ? 782  ARG A N     1 
ATOM   5775  C  CA    . ARG A 1  782  ? 464.501 14.302  585.793 1.00 21.12  ? 782  ARG A CA    1 
ATOM   5776  C  C     . ARG A 1  782  ? 464.189 13.913  587.234 1.00 19.95  ? 782  ARG A C     1 
ATOM   5777  O  O     . ARG A 1  782  ? 463.288 14.472  587.861 1.00 19.50  ? 782  ARG A O     1 
ATOM   5778  C  CB    . ARG A 1  782  ? 465.670 15.287  585.757 1.00 21.43  ? 782  ARG A CB    1 
ATOM   5779  C  CG    . ARG A 1  782  ? 465.347 16.660  586.307 1.00 21.22  ? 782  ARG A CG    1 
ATOM   5780  C  CD    . ARG A 1  782  ? 466.573 17.553  586.280 1.00 21.59  ? 782  ARG A CD    1 
ATOM   5781  N  NE    . ARG A 1  782  ? 466.293 18.876  586.827 1.00 21.43  ? 782  ARG A NE    1 
ATOM   5782  C  CZ    . ARG A 1  782  ? 467.227 19.775  587.116 1.00 21.58  ? 782  ARG A CZ    1 
ATOM   5783  N  NH1   . ARG A 1  782  ? 468.508 19.494  586.914 1.00 21.88  ? 782  ARG A NH1   1 
ATOM   5784  N  NH2   . ARG A 1  782  ? 466.881 20.955  587.613 1.00 21.48  ? 782  ARG A NH2   1 
ATOM   5785  N  N     . THR A 1  783  ? 464.950 12.951  587.748 1.00 31.93  ? 783  THR A N     1 
ATOM   5786  C  CA    . THR A 1  783  ? 464.742 12.416  589.089 1.00 29.63  ? 783  THR A CA    1 
ATOM   5787  C  C     . THR A 1  783  ? 465.417 13.266  590.161 1.00 28.33  ? 783  THR A C     1 
ATOM   5788  O  O     . THR A 1  783  ? 464.877 13.448  591.251 1.00 27.57  ? 783  THR A O     1 
ATOM   5789  C  CB    . THR A 1  783  ? 465.265 10.975  589.195 1.00 28.74  ? 783  THR A CB    1 
ATOM   5790  O  OG1   . THR A 1  783  ? 466.635 10.934  588.776 1.00 29.23  ? 783  THR A OG1   1 
ATOM   5791  C  CG2   . THR A 1  783  ? 464.448 10.048  588.312 1.00 29.20  ? 783  THR A CG2   1 
ATOM   5792  N  N     . LEU A 1  784  ? 466.603 13.778  589.844 1.00 19.08  ? 784  LEU A N     1 
ATOM   5793  C  CA    . LEU A 1  784  ? 467.348 14.641  590.756 1.00 18.71  ? 784  LEU A CA    1 
ATOM   5794  C  C     . LEU A 1  784  ? 467.940 15.830  590.002 1.00 19.52  ? 784  LEU A C     1 
ATOM   5795  O  O     . LEU A 1  784  ? 468.167 15.749  588.795 1.00 20.39  ? 784  LEU A O     1 
ATOM   5796  C  CB    . LEU A 1  784  ? 468.457 13.853  591.458 1.00 18.34  ? 784  LEU A CB    1 
ATOM   5797  C  CG    . LEU A 1  784  ? 468.024 12.817  592.495 1.00 17.46  ? 784  LEU A CG    1 
ATOM   5798  C  CD1   . LEU A 1  784  ? 469.239 12.142  593.105 1.00 17.25  ? 784  LEU A CD1   1 
ATOM   5799  C  CD2   . LEU A 1  784  ? 467.174 13.465  593.572 1.00 16.72  ? 784  LEU A CD2   1 
ATOM   5800  N  N     . PRO A 1  785  ? 468.196 16.943  590.711 1.00 23.51  ? 785  PRO A N     1 
ATOM   5801  C  CA    . PRO A 1  785  ? 468.768 18.142  590.084 1.00 24.29  ? 785  PRO A CA    1 
ATOM   5802  C  C     . PRO A 1  785  ? 470.218 17.954  589.643 1.00 24.86  ? 785  PRO A C     1 
ATOM   5803  O  O     . PRO A 1  785  ? 470.835 18.895  589.147 1.00 25.57  ? 785  PRO A O     1 
ATOM   5804  C  CB    . PRO A 1  785  ? 468.681 19.198  591.193 1.00 23.78  ? 785  PRO A CB    1 
ATOM   5805  C  CG    . PRO A 1  785  ? 467.692 18.659  592.174 1.00 22.84  ? 785  PRO A CG    1 
ATOM   5806  C  CD    . PRO A 1  785  ? 467.849 17.180  592.122 1.00 22.57  ? 785  PRO A CD    1 
ATOM   5807  N  N     . HIS A 1  786  ? 470.751 16.751  589.829 1.00 23.61  ? 786  HIS A N     1 
ATOM   5808  C  CA    . HIS A 1  786  ? 472.129 16.450  589.466 1.00 24.19  ? 786  HIS A CA    1 
ATOM   5809  C  C     . HIS A 1  786  ? 472.194 15.805  588.088 1.00 25.10  ? 786  HIS A C     1 
ATOM   5810  O  O     . HIS A 1  786  ? 473.270 15.658  587.506 1.00 25.86  ? 786  HIS A O     1 
ATOM   5811  C  CB    . HIS A 1  786  ? 472.764 15.538  590.515 1.00 23.51  ? 786  HIS A CB    1 
ATOM   5812  C  CG    . HIS A 1  786  ? 472.566 16.015  591.920 1.00 22.58  ? 786  HIS A CG    1 
ATOM   5813  N  ND1   . HIS A 1  786  ? 471.343 15.972  592.555 1.00 21.81  ? 786  HIS A ND1   1 
ATOM   5814  C  CD2   . HIS A 1  786  ? 473.432 16.558  592.808 1.00 22.37  ? 786  HIS A CD2   1 
ATOM   5815  C  CE1   . HIS A 1  786  ? 471.465 16.462  593.775 1.00 21.17  ? 786  HIS A CE1   1 
ATOM   5816  N  NE2   . HIS A 1  786  ? 472.722 16.825  593.954 1.00 21.48  ? 786  HIS A NE2   1 
ATOM   5817  N  N     . PHE A 1  787  ? 471.031 15.417  587.575 1.00 28.56  ? 787  PHE A N     1 
ATOM   5818  C  CA    . PHE A 1  787  ? 470.931 14.852  586.236 1.00 29.47  ? 787  PHE A CA    1 
ATOM   5819  C  C     . PHE A 1  787  ? 470.388 15.883  585.256 1.00 31.29  ? 787  PHE A C     1 
ATOM   5820  O  O     . PHE A 1  787  ? 469.778 16.875  585.658 1.00 31.03  ? 787  PHE A O     1 
ATOM   5821  C  CB    . PHE A 1  787  ? 470.030 13.614  586.230 1.00 29.08  ? 787  PHE A CB    1 
ATOM   5822  C  CG    . PHE A 1  787  ? 470.513 12.504  587.115 1.00 28.41  ? 787  PHE A CG    1 
ATOM   5823  C  CD1   . PHE A 1  787  ? 471.504 11.639  586.684 1.00 28.96  ? 787  PHE A CD1   1 
ATOM   5824  C  CD2   . PHE A 1  787  ? 469.966 12.318  588.374 1.00 27.32  ? 787  PHE A CD2   1 
ATOM   5825  C  CE1   . PHE A 1  787  ? 471.947 10.612  587.497 1.00 28.42  ? 787  PHE A CE1   1 
ATOM   5826  C  CE2   . PHE A 1  787  ? 470.404 11.292  589.192 1.00 26.76  ? 787  PHE A CE2   1 
ATOM   5827  C  CZ    . PHE A 1  787  ? 471.396 10.438  588.753 1.00 27.31  ? 787  PHE A CZ    1 
ATOM   5828  N  N     . SER A 1  788  ? 470.613 15.645  583.969 1.00 35.09  ? 788  SER A N     1 
ATOM   5829  C  CA    . SER A 1  788  ? 469.999 16.461  582.933 1.00 35.92  ? 788  SER A CA    1 
ATOM   5830  C  C     . SER A 1  788  ? 468.605 15.920  582.645 1.00 35.74  ? 788  SER A C     1 
ATOM   5831  O  O     . SER A 1  788  ? 468.275 14.804  583.041 1.00 35.17  ? 788  SER A O     1 
ATOM   5832  C  CB    . SER A 1  788  ? 470.851 16.470  581.666 1.00 37.23  ? 788  SER A CB    1 
ATOM   5833  O  OG    . SER A 1  788  ? 472.125 17.035  581.918 1.00 37.49  ? 788  SER A OG    1 
ATOM   5834  N  N     . LYS A 1  789  ? 467.786 16.711  581.962 1.00 26.94  ? 789  LYS A N     1 
ATOM   5835  C  CA    . LYS A 1  789  ? 466.415 16.308  581.678 1.00 26.87  ? 789  LYS A CA    1 
ATOM   5836  C  C     . LYS A 1  789  ? 466.348 15.191  580.638 1.00 27.58  ? 789  LYS A C     1 
ATOM   5837  O  O     . LYS A 1  789  ? 467.260 15.029  579.825 1.00 28.44  ? 789  LYS A O     1 
ATOM   5838  C  CB    . LYS A 1  789  ? 465.595 17.512  581.216 1.00 27.38  ? 789  LYS A CB    1 
ATOM   5839  C  CG    . LYS A 1  789  ? 465.299 18.505  582.326 1.00 26.61  ? 789  LYS A CG    1 
ATOM   5840  C  CD    . LYS A 1  789  ? 464.373 19.603  581.849 1.00 27.18  ? 789  LYS A CD    1 
ATOM   5841  C  CE    . LYS A 1  789  ? 463.985 20.527  582.988 1.00 26.45  ? 789  LYS A CE    1 
ATOM   5842  N  NZ    . LYS A 1  789  ? 463.187 21.690  582.509 1.00 27.13  ? 789  LYS A NZ    1 
ATOM   5843  N  N     . ASP A 1  790  ? 465.260 14.426  580.684 1.00 39.00  ? 790  ASP A N     1 
ATOM   5844  C  CA    . ASP A 1  790  ? 465.043 13.286  579.795 1.00 38.41  ? 790  ASP A CA    1 
ATOM   5845  C  C     . ASP A 1  790  ? 466.187 12.278  579.874 1.00 38.06  ? 790  ASP A C     1 
ATOM   5846  O  O     . ASP A 1  790  ? 466.663 11.782  578.855 1.00 38.77  ? 790  ASP A O     1 
ATOM   5847  C  CB    . ASP A 1  790  ? 464.850 13.758  578.353 1.00 38.24  ? 790  ASP A CB    1 
ATOM   5848  C  CG    . ASP A 1  790  ? 463.638 14.657  578.195 1.00 40.59  ? 790  ASP A CG    1 
ATOM   5849  O  OD1   . ASP A 1  790  ? 462.502 14.137  578.218 1.00 42.22  ? 790  ASP A OD1   1 
ATOM   5850  O  OD2   . ASP A 1  790  ? 463.819 15.884  578.046 1.00 41.21  ? 790  ASP A OD2   1 
ATOM   5851  N  N     . ASP A 1  791  ? 466.614 11.981  581.097 1.00 28.07  ? 791  ASP A N     1 
ATOM   5852  C  CA    . ASP A 1  791  ? 467.672 11.008  581.345 1.00 27.99  ? 791  ASP A CA    1 
ATOM   5853  C  C     . ASP A 1  791  ? 467.074 9.682   581.815 1.00 27.39  ? 791  ASP A C     1 
ATOM   5854  O  O     . ASP A 1  791  ? 466.727 9.531   582.988 1.00 26.32  ? 791  ASP A O     1 
ATOM   5855  C  CB    . ASP A 1  791  ? 468.655 11.553  582.386 1.00 27.34  ? 791  ASP A CB    1 
ATOM   5856  C  CG    . ASP A 1  791  ? 469.946 10.758  582.454 1.00 27.57  ? 791  ASP A CG    1 
ATOM   5857  O  OD1   . ASP A 1  791  ? 469.968 9.598   581.998 1.00 27.93  ? 791  ASP A OD1   1 
ATOM   5858  O  OD2   . ASP A 1  791  ? 470.945 11.296  582.974 1.00 27.44  ? 791  ASP A OD2   1 
ATOM   5859  N  N     . TYR A 1  792  ? 466.963 8.723   580.900 1.00 28.80  ? 792  TYR A N     1 
ATOM   5860  C  CA    . TYR A 1  792  ? 466.354 7.433   581.210 1.00 28.41  ? 792  TYR A CA    1 
ATOM   5861  C  C     . TYR A 1  792  ? 467.392 6.357   581.511 1.00 28.38  ? 792  TYR A C     1 
ATOM   5862  O  O     . TYR A 1  792  ? 467.060 5.174   581.598 1.00 28.29  ? 792  TYR A O     1 
ATOM   5863  C  CB    . TYR A 1  792  ? 465.456 6.980   580.056 1.00 29.28  ? 792  TYR A CB    1 
ATOM   5864  C  CG    . TYR A 1  792  ? 464.189 7.794   579.919 1.00 29.20  ? 792  TYR A CG    1 
ATOM   5865  C  CD1   . TYR A 1  792  ? 464.165 8.959   579.163 1.00 29.90  ? 792  TYR A CD1   1 
ATOM   5866  C  CD2   . TYR A 1  792  ? 463.017 7.398   580.550 1.00 28.50  ? 792  TYR A CD2   1 
ATOM   5867  C  CE1   . TYR A 1  792  ? 463.009 9.706   579.039 1.00 29.91  ? 792  TYR A CE1   1 
ATOM   5868  C  CE2   . TYR A 1  792  ? 461.856 8.137   580.431 1.00 28.52  ? 792  TYR A CE2   1 
ATOM   5869  C  CZ    . TYR A 1  792  ? 461.858 9.290   579.675 1.00 29.22  ? 792  TYR A CZ    1 
ATOM   5870  O  OH    . TYR A 1  792  ? 460.702 10.027  579.557 1.00 29.31  ? 792  TYR A OH    1 
ATOM   5871  N  N     . SER A 1  793  ? 468.644 6.774   581.675 1.00 36.22  ? 793  SER A N     1 
ATOM   5872  C  CA    . SER A 1  793  ? 469.740 5.860   581.984 1.00 36.00  ? 793  SER A CA    1 
ATOM   5873  C  C     . SER A 1  793  ? 469.493 5.137   583.306 1.00 34.64  ? 793  SER A C     1 
ATOM   5874  O  O     . SER A 1  793  ? 468.769 5.646   584.159 1.00 38.28  ? 793  SER A O     1 
ATOM   5875  C  CB    . SER A 1  793  ? 471.065 6.626   582.032 1.00 38.80  ? 793  SER A CB    1 
ATOM   5876  O  OG    . SER A 1  793  ? 470.990 7.718   582.931 1.00 38.82  ? 793  SER A OG    1 
ATOM   5877  N  N     . PRO A 1  794  ? 470.086 3.941   583.475 1.00 41.22  ? 794  PRO A N     1 
ATOM   5878  C  CA    . PRO A 1  794  ? 469.876 3.146   584.692 1.00 41.43  ? 794  PRO A CA    1 
ATOM   5879  C  C     . PRO A 1  794  ? 470.224 3.887   585.982 1.00 39.10  ? 794  PRO A C     1 
ATOM   5880  O  O     . PRO A 1  794  ? 469.433 3.853   586.925 1.00 39.33  ? 794  PRO A O     1 
ATOM   5881  C  CB    . PRO A 1  794  ? 470.807 1.939   584.492 1.00 43.18  ? 794  PRO A CB    1 
ATOM   5882  C  CG    . PRO A 1  794  ? 471.744 2.335   583.393 1.00 44.24  ? 794  PRO A CG    1 
ATOM   5883  C  CD    . PRO A 1  794  ? 470.949 3.236   582.513 1.00 44.91  ? 794  PRO A CD    1 
ATOM   5884  N  N     . GLU A 1  795  ? 471.376 4.551   586.020 1.00 50.55  ? 795  GLU A N     1 
ATOM   5885  C  CA    . GLU A 1  795  ? 471.814 5.244   587.229 1.00 50.44  ? 795  GLU A CA    1 
ATOM   5886  C  C     . GLU A 1  795  ? 470.919 6.438   587.552 1.00 48.97  ? 795  GLU A C     1 
ATOM   5887  O  O     . GLU A 1  795  ? 470.830 6.862   588.704 1.00 49.60  ? 795  GLU A O     1 
ATOM   5888  C  CB    . GLU A 1  795  ? 473.270 5.703   587.094 1.00 52.79  ? 795  GLU A CB    1 
ATOM   5889  C  CG    . GLU A 1  795  ? 473.510 6.776   586.041 1.00 54.35  ? 795  GLU A CG    1 
ATOM   5890  C  CD    . GLU A 1  795  ? 473.660 6.212   584.638 1.00 59.31  ? 795  GLU A CD    1 
ATOM   5891  O  OE1   . GLU A 1  795  ? 473.910 7.002   583.702 1.00 59.14  ? 795  GLU A OE1   1 
ATOM   5892  O  OE2   . GLU A 1  795  ? 473.535 4.980   584.469 1.00 59.87  ? 795  GLU A OE2   1 
ATOM   5893  N  N     . SER A 1  796  ? 470.254 6.972   586.533 1.00 21.22  ? 796  SER A N     1 
ATOM   5894  C  CA    . SER A 1  796  ? 469.366 8.115   586.708 1.00 20.83  ? 796  SER A CA    1 
ATOM   5895  C  C     . SER A 1  796  ? 468.011 7.704   587.271 1.00 20.08  ? 796  SER A C     1 
ATOM   5896  O  O     . SER A 1  796  ? 467.390 8.456   588.020 1.00 19.40  ? 796  SER A O     1 
ATOM   5897  C  CB    . SER A 1  796  ? 469.170 8.846   585.380 1.00 21.83  ? 796  SER A CB    1 
ATOM   5898  O  OG    . SER A 1  796  ? 468.153 9.827   585.486 1.00 21.53  ? 796  SER A OG    1 
ATOM   5899  N  N     . LYS A 1  797  ? 467.557 6.510   586.905 1.00 32.51  ? 797  LYS A N     1 
ATOM   5900  C  CA    . LYS A 1  797  ? 466.232 6.046   587.298 1.00 30.95  ? 797  LYS A CA    1 
ATOM   5901  C  C     . LYS A 1  797  ? 466.278 5.122   588.512 1.00 31.18  ? 797  LYS A C     1 
ATOM   5902  O  O     . LYS A 1  797  ? 465.292 4.458   588.833 1.00 31.49  ? 797  LYS A O     1 
ATOM   5903  C  CB    . LYS A 1  797  ? 465.554 5.335   586.128 1.00 33.11  ? 797  LYS A CB    1 
ATOM   5904  C  CG    . LYS A 1  797  ? 465.453 6.177   584.866 1.00 35.54  ? 797  LYS A CG    1 
ATOM   5905  C  CD    . LYS A 1  797  ? 464.572 7.401   585.073 1.00 36.25  ? 797  LYS A CD    1 
ATOM   5906  C  CE    . LYS A 1  797  ? 463.130 7.136   584.661 1.00 36.09  ? 797  LYS A CE    1 
ATOM   5907  N  NZ    . LYS A 1  797  ? 462.462 6.112   585.509 1.00 35.31  ? 797  LYS A NZ    1 
ATOM   5908  N  N     . GLY A 1  798  ? 467.429 5.069   589.174 1.00 28.98  ? 798  GLY A N     1 
ATOM   5909  C  CA    . GLY A 1  798  ? 467.530 4.384   590.450 1.00 28.15  ? 798  GLY A CA    1 
ATOM   5910  C  C     . GLY A 1  798  ? 468.173 3.011   590.449 1.00 28.41  ? 798  GLY A C     1 
ATOM   5911  O  O     . GLY A 1  798  ? 467.826 2.162   591.270 1.00 27.86  ? 798  GLY A O     1 
ATOM   5912  N  N     . PHE A 1  799  ? 469.111 2.779   589.538 1.00 29.44  ? 799  PHE A N     1 
ATOM   5913  C  CA    . PHE A 1  799  ? 469.863 1.532   589.565 1.00 29.78  ? 799  PHE A CA    1 
ATOM   5914  C  C     . PHE A 1  799  ? 471.113 1.700   590.415 1.00 29.53  ? 799  PHE A C     1 
ATOM   5915  O  O     . PHE A 1  799  ? 471.897 2.629   590.213 1.00 29.81  ? 799  PHE A O     1 
ATOM   5916  C  CB    . PHE A 1  799  ? 470.244 1.072   588.155 1.00 31.00  ? 799  PHE A CB    1 
ATOM   5917  C  CG    . PHE A 1  799  ? 470.952 -0.255  588.125 1.00 31.46  ? 799  PHE A CG    1 
ATOM   5918  C  CD1   . PHE A 1  799  ? 470.238 -1.438  588.208 1.00 31.40  ? 799  PHE A CD1   1 
ATOM   5919  C  CD2   . PHE A 1  799  ? 472.332 -0.320  588.015 1.00 32.03  ? 799  PHE A CD2   1 
ATOM   5920  C  CE1   . PHE A 1  799  ? 470.884 -2.658  588.184 1.00 31.89  ? 799  PHE A CE1   1 
ATOM   5921  C  CE2   . PHE A 1  799  ? 472.982 -1.538  587.990 1.00 32.54  ? 799  PHE A CE2   1 
ATOM   5922  C  CZ    . PHE A 1  799  ? 472.258 -2.708  588.074 1.00 32.47  ? 799  PHE A CZ    1 
ATOM   5923  N  N     . VAL A 1  800  ? 471.290 0.797   591.371 1.00 25.88  ? 800  VAL A N     1 
ATOM   5924  C  CA    . VAL A 1  800  ? 472.451 0.832   592.245 1.00 25.67  ? 800  VAL A CA    1 
ATOM   5925  C  C     . VAL A 1  800  ? 473.444 -0.253  591.846 1.00 26.49  ? 800  VAL A C     1 
ATOM   5926  O  O     . VAL A 1  800  ? 473.247 -1.427  592.159 1.00 26.44  ? 800  VAL A O     1 
ATOM   5927  C  CB    . VAL A 1  800  ? 472.048 0.645   593.717 1.00 24.60  ? 800  VAL A CB    1 
ATOM   5928  C  CG1   . VAL A 1  800  ? 473.255 0.802   594.628 1.00 24.56  ? 800  VAL A CG1   1 
ATOM   5929  C  CG2   . VAL A 1  800  ? 470.951 1.625   594.099 1.00 23.87  ? 800  VAL A CG2   1 
ATOM   5930  N  N     . GLU A 1  801  ? 474.502 0.140   591.141 1.00 57.25  ? 801  GLU A N     1 
ATOM   5931  C  CA    . GLU A 1  801  ? 475.538 -0.804  590.733 1.00 59.35  ? 801  GLU A CA    1 
ATOM   5932  C  C     . GLU A 1  801  ? 476.274 -1.345  591.948 1.00 59.73  ? 801  GLU A C     1 
ATOM   5933  O  O     . GLU A 1  801  ? 476.599 -2.530  592.020 1.00 59.78  ? 801  GLU A O     1 
ATOM   5934  C  CB    . GLU A 1  801  ? 476.539 -0.146  589.783 1.00 62.76  ? 801  GLU A CB    1 
ATOM   5935  C  CG    . GLU A 1  801  ? 475.922 0.538   588.582 1.00 64.37  ? 801  GLU A CG    1 
ATOM   5936  C  CD    . GLU A 1  801  ? 476.971 1.123   587.659 1.00 68.88  ? 801  GLU A CD    1 
ATOM   5937  O  OE1   . GLU A 1  801  ? 478.110 0.609   587.657 1.00 68.00  ? 801  GLU A OE1   1 
ATOM   5938  O  OE2   . GLU A 1  801  ? 476.659 2.098   586.944 1.00 71.19  ? 801  GLU A OE2   1 
ATOM   5939  N  N     . ASN A 1  802  ? 476.532 -0.457  592.901 1.00 32.41  ? 802  ASN A N     1 
ATOM   5940  C  CA    . ASN A 1  802  ? 477.309 -0.798  594.080 1.00 32.17  ? 802  ASN A CA    1 
ATOM   5941  C  C     . ASN A 1  802  ? 476.583 -1.760  595.005 1.00 30.96  ? 802  ASN A C     1 
ATOM   5942  O  O     . ASN A 1  802  ? 475.355 -1.845  594.995 1.00 30.46  ? 802  ASN A O     1 
ATOM   5943  C  CB    . ASN A 1  802  ? 477.682 0.468   594.848 1.00 30.04  ? 802  ASN A CB    1 
ATOM   5944  C  CG    . ASN A 1  802  ? 478.448 1.458   593.998 1.00 31.85  ? 802  ASN A CG    1 
ATOM   5945  O  OD1   . ASN A 1  802  ? 479.634 1.271   593.727 1.00 34.09  ? 802  ASN A OD1   1 
ATOM   5946  N  ND2   . ASN A 1  802  ? 477.774 2.521   593.574 1.00 30.69  ? 802  ASN A ND2   1 
ATOM   5947  N  N     . SER A 1  803  ? 477.359 -2.490  595.797 1.00 30.85  ? 803  SER A N     1 
ATOM   5948  C  CA    . SER A 1  803  ? 476.812 -3.371  596.816 1.00 30.24  ? 803  SER A CA    1 
ATOM   5949  C  C     . SER A 1  803  ? 476.964 -2.717  598.181 1.00 29.57  ? 803  SER A C     1 
ATOM   5950  O  O     . SER A 1  803  ? 477.647 -1.699  598.311 1.00 29.71  ? 803  SER A O     1 
ATOM   5951  C  CB    . SER A 1  803  ? 477.511 -4.729  596.786 1.00 31.06  ? 803  SER A CB    1 
ATOM   5952  O  OG    . SER A 1  803  ? 478.919 -4.568  596.771 1.00 31.94  ? 803  SER A OG    1 
ATOM   5953  N  N     . TYR A 1  804  ? 476.327 -3.297  599.193 1.00 26.83  ? 804  TYR A N     1 
ATOM   5954  C  CA    . TYR A 1  804  ? 476.399 -2.764  600.550 1.00 25.61  ? 804  TYR A CA    1 
ATOM   5955  C  C     . TYR A 1  804  ? 477.832 -2.783  601.076 1.00 26.72  ? 804  TYR A C     1 
ATOM   5956  O  O     . TYR A 1  804  ? 478.214 -1.945  601.894 1.00 26.60  ? 804  TYR A O     1 
ATOM   5957  C  CB    . TYR A 1  804  ? 475.483 -3.553  601.485 1.00 24.52  ? 804  TYR A CB    1 
ATOM   5958  C  CG    . TYR A 1  804  ? 474.010 -3.324  601.236 1.00 23.76  ? 804  TYR A CG    1 
ATOM   5959  C  CD1   . TYR A 1  804  ? 473.527 -2.065  600.908 1.00 23.37  ? 804  TYR A CD1   1 
ATOM   5960  C  CD2   . TYR A 1  804  ? 473.102 -4.370  601.325 1.00 23.48  ? 804  TYR A CD2   1 
ATOM   5961  C  CE1   . TYR A 1  804  ? 472.179 -1.854  600.680 1.00 22.73  ? 804  TYR A CE1   1 
ATOM   5962  C  CE2   . TYR A 1  804  ? 471.754 -4.170  601.098 1.00 22.84  ? 804  TYR A CE2   1 
ATOM   5963  C  CZ    . TYR A 1  804  ? 471.298 -2.910  600.776 1.00 22.47  ? 804  TYR A CZ    1 
ATOM   5964  O  OH    . TYR A 1  804  ? 469.955 -2.712  600.550 1.00 21.88  ? 804  TYR A OH    1 
ATOM   5965  N  N     . LEU A 1  805  ? 478.619 -3.741  600.598 1.00 22.98  ? 805  LEU A N     1 
ATOM   5966  C  CA    . LEU A 1  805  ? 480.028 -3.830  600.961 1.00 23.77  ? 805  LEU A CA    1 
ATOM   5967  C  C     . LEU A 1  805  ? 480.795 -2.644  600.386 1.00 24.24  ? 805  LEU A C     1 
ATOM   5968  O  O     . LEU A 1  805  ? 481.631 -2.047  601.064 1.00 24.39  ? 805  LEU A O     1 
ATOM   5969  C  CB    . LEU A 1  805  ? 480.627 -5.152  600.467 1.00 24.72  ? 805  LEU A CB    1 
ATOM   5970  C  CG    . LEU A 1  805  ? 482.029 -5.580  600.917 1.00 25.63  ? 805  LEU A CG    1 
ATOM   5971  C  CD1   . LEU A 1  805  ? 483.123 -4.968  600.050 1.00 26.63  ? 805  LEU A CD1   1 
ATOM   5972  C  CD2   . LEU A 1  805  ? 482.251 -5.238  602.382 1.00 25.08  ? 805  LEU A CD2   1 
ATOM   5973  N  N     . ARG A 1  806  ? 480.499 -2.309  599.134 1.00 33.84  ? 806  ARG A N     1 
ATOM   5974  C  CA    . ARG A 1  806  ? 481.208 -1.248  598.426 1.00 34.40  ? 806  ARG A CA    1 
ATOM   5975  C  C     . ARG A 1  806  ? 480.781 0.140   598.887 1.00 33.62  ? 806  ARG A C     1 
ATOM   5976  O  O     . ARG A 1  806  ? 481.605 1.049   598.981 1.00 33.97  ? 806  ARG A O     1 
ATOM   5977  C  CB    . ARG A 1  806  ? 480.991 -1.382  596.918 1.00 34.98  ? 806  ARG A CB    1 
ATOM   5978  C  CG    . ARG A 1  806  ? 482.244 -1.742  596.139 1.00 37.64  ? 806  ARG A CG    1 
ATOM   5979  C  CD    . ARG A 1  806  ? 481.916 -2.057  594.692 1.00 37.45  ? 806  ARG A CD    1 
ATOM   5980  N  NE    . ARG A 1  806  ? 483.113 -2.337  593.906 1.00 41.00  ? 806  ARG A NE    1 
ATOM   5981  C  CZ    . ARG A 1  806  ? 483.095 -2.834  592.674 1.00 43.21  ? 806  ARG A CZ    1 
ATOM   5982  N  NH1   . ARG A 1  806  ? 481.940 -3.113  592.088 1.00 41.00  ? 806  ARG A NH1   1 
ATOM   5983  N  NH2   . ARG A 1  806  ? 484.233 -3.057  592.028 1.00 45.43  ? 806  ARG A NH2   1 
ATOM   5984  N  N     . GLY A 1  807  ? 479.493 0.301   599.167 1.00 35.93  ? 807  GLY A N     1 
ATOM   5985  C  CA    . GLY A 1  807  ? 478.965 1.580   599.605 1.00 36.00  ? 807  GLY A CA    1 
ATOM   5986  C  C     . GLY A 1  807  ? 478.162 2.271   598.521 1.00 35.46  ? 807  GLY A C     1 
ATOM   5987  O  O     . GLY A 1  807  ? 478.545 2.262   597.354 1.00 37.62  ? 807  GLY A O     1 
ATOM   5988  N  N     . LEU A 1  808  ? 477.046 2.879   598.911 1.00 17.28  ? 808  LEU A N     1 
ATOM   5989  C  CA    . LEU A 1  808  ? 476.154 3.525   597.954 1.00 17.05  ? 808  LEU A CA    1 
ATOM   5990  C  C     . LEU A 1  808  ? 476.506 4.993   597.723 1.00 17.16  ? 808  LEU A C     1 
ATOM   5991  O  O     . LEU A 1  808  ? 476.898 5.705   598.647 1.00 16.97  ? 808  LEU A O     1 
ATOM   5992  C  CB    . LEU A 1  808  ? 474.700 3.414   598.422 1.00 16.07  ? 808  LEU A CB    1 
ATOM   5993  C  CG    . LEU A 1  808  ? 473.925 2.157   598.017 1.00 15.97  ? 808  LEU A CG    1 
ATOM   5994  C  CD1   . LEU A 1  808  ? 474.506 0.906   598.663 1.00 16.23  ? 808  LEU A CD1   1 
ATOM   5995  C  CD2   . LEU A 1  808  ? 472.448 2.307   598.356 1.00 15.07  ? 808  LEU A CD2   1 
ATOM   5996  N  N     . THR A 1  809  ? 476.364 5.434   596.478 1.00 23.30  ? 809  THR A N     1 
ATOM   5997  C  CA    . THR A 1  809  ? 476.540 6.839   596.134 1.00 23.41  ? 809  THR A CA    1 
ATOM   5998  C  C     . THR A 1  809  ? 475.321 7.624   596.616 1.00 22.45  ? 809  THR A C     1 
ATOM   5999  O  O     . THR A 1  809  ? 474.267 7.032   596.849 1.00 21.83  ? 809  THR A O     1 
ATOM   6000  C  CB    . THR A 1  809  ? 476.731 7.025   594.613 1.00 24.16  ? 809  THR A CB    1 
ATOM   6001  O  OG1   . THR A 1  809  ? 475.561 6.574   593.922 1.00 23.83  ? 809  THR A OG1   1 
ATOM   6002  C  CG2   . THR A 1  809  ? 477.937 6.238   594.129 1.00 25.21  ? 809  THR A CG2   1 
ATOM   6003  N  N     . PRO A 1  810  ? 475.463 8.951   596.789 1.00 18.92  ? 810  PRO A N     1 
ATOM   6004  C  CA    . PRO A 1  810  ? 474.354 9.812   597.225 1.00 18.13  ? 810  PRO A CA    1 
ATOM   6005  C  C     . PRO A 1  810  ? 473.047 9.592   596.458 1.00 17.74  ? 810  PRO A C     1 
ATOM   6006  O  O     . PRO A 1  810  ? 471.996 9.441   597.085 1.00 17.02  ? 810  PRO A O     1 
ATOM   6007  C  CB    . PRO A 1  810  ? 474.895 11.217  596.970 1.00 18.47  ? 810  PRO A CB    1 
ATOM   6008  C  CG    . PRO A 1  810  ? 476.356 11.077  597.184 1.00 19.19  ? 810  PRO A CG    1 
ATOM   6009  C  CD    . PRO A 1  810  ? 476.732 9.700   596.714 1.00 19.63  ? 810  PRO A CD    1 
ATOM   6010  N  N     . GLN A 1  811  ? 473.116 9.575   595.130 1.00 24.26  ? 811  GLN A N     1 
ATOM   6011  C  CA    . GLN A 1  811  ? 471.935 9.337   594.309 1.00 24.38  ? 811  GLN A CA    1 
ATOM   6012  C  C     . GLN A 1  811  ? 471.334 7.973   594.625 1.00 23.99  ? 811  GLN A C     1 
ATOM   6013  O  O     . GLN A 1  811  ? 470.135 7.856   594.898 1.00 23.50  ? 811  GLN A O     1 
ATOM   6014  C  CB    . GLN A 1  811  ? 472.276 9.429   592.820 1.00 25.42  ? 811  GLN A CB    1 
ATOM   6015  C  CG    . GLN A 1  811  ? 472.828 10.776  592.371 1.00 25.94  ? 811  GLN A CG    1 
ATOM   6016  C  CD    . GLN A 1  811  ? 474.335 10.883  592.535 1.00 26.36  ? 811  GLN A CD    1 
ATOM   6017  O  OE1   . GLN A 1  811  ? 474.950 10.107  593.268 1.00 26.09  ? 811  GLN A OE1   1 
ATOM   6018  N  NE2   . GLN A 1  811  ? 474.939 11.845  591.843 1.00 27.10  ? 811  GLN A NE2   1 
ATOM   6019  N  N     . GLU A 1  812  ? 472.180 6.948   594.592 1.00 26.50  ? 812  GLU A N     1 
ATOM   6020  C  CA    . GLU A 1  812  ? 471.769 5.587   594.921 1.00 26.22  ? 812  GLU A CA    1 
ATOM   6021  C  C     . GLU A 1  812  ? 471.191 5.513   596.327 1.00 25.23  ? 812  GLU A C     1 
ATOM   6022  O  O     . GLU A 1  812  ? 470.204 4.819   596.566 1.00 24.86  ? 812  GLU A O     1 
ATOM   6023  C  CB    . GLU A 1  812  ? 472.951 4.624   594.795 1.00 26.74  ? 812  GLU A CB    1 
ATOM   6024  C  CG    . GLU A 1  812  ? 473.389 4.350   593.369 1.00 27.81  ? 812  GLU A CG    1 
ATOM   6025  C  CD    . GLU A 1  812  ? 474.699 3.595   593.309 1.00 29.61  ? 812  GLU A CD    1 
ATOM   6026  O  OE1   . GLU A 1  812  ? 475.407 3.560   594.339 1.00 28.44  ? 812  GLU A OE1   1 
ATOM   6027  O  OE2   . GLU A 1  812  ? 475.018 3.033   592.238 1.00 31.66  ? 812  GLU A OE2   1 
ATOM   6028  N  N     . PHE A 1  813  ? 471.815 6.235   597.251 1.00 23.95  ? 813  PHE A N     1 
ATOM   6029  C  CA    . PHE A 1  813  ? 471.357 6.268   598.631 1.00 23.27  ? 813  PHE A CA    1 
ATOM   6030  C  C     . PHE A 1  813  ? 469.939 6.817   598.721 1.00 22.59  ? 813  PHE A C     1 
ATOM   6031  O  O     . PHE A 1  813  ? 469.090 6.252   599.410 1.00 22.07  ? 813  PHE A O     1 
ATOM   6032  C  CB    . PHE A 1  813  ? 472.302 7.106   599.495 1.00 23.39  ? 813  PHE A CB    1 
ATOM   6033  C  CG    . PHE A 1  813  ? 471.918 7.148   600.948 1.00 22.80  ? 813  PHE A CG    1 
ATOM   6034  C  CD1   . PHE A 1  813  ? 472.317 6.143   601.813 1.00 22.79  ? 813  PHE A CD1   1 
ATOM   6035  C  CD2   . PHE A 1  813  ? 471.156 8.191   601.447 1.00 22.31  ? 813  PHE A CD2   1 
ATOM   6036  C  CE1   . PHE A 1  813  ? 471.964 6.177   603.148 1.00 22.29  ? 813  PHE A CE1   1 
ATOM   6037  C  CE2   . PHE A 1  813  ? 470.800 8.229   602.781 1.00 21.85  ? 813  PHE A CE2   1 
ATOM   6038  C  CZ    . PHE A 1  813  ? 471.206 7.221   603.633 1.00 21.84  ? 813  PHE A CZ    1 
ATOM   6039  N  N     . PHE A 1  814  ? 469.686 7.917   598.016 1.00 18.49  ? 814  PHE A N     1 
ATOM   6040  C  CA    . PHE A 1  814  ? 468.378 8.559   598.067 1.00 18.19  ? 814  PHE A CA    1 
ATOM   6041  C  C     . PHE A 1  814  ? 467.307 7.711   597.391 1.00 18.34  ? 814  PHE A C     1 
ATOM   6042  O  O     . PHE A 1  814  ? 466.191 7.596   597.898 1.00 17.89  ? 814  PHE A O     1 
ATOM   6043  C  CB    . PHE A 1  814  ? 468.429 9.944   597.421 1.00 18.60  ? 814  PHE A CB    1 
ATOM   6044  C  CG    . PHE A 1  814  ? 467.169 10.739  597.603 1.00 18.34  ? 814  PHE A CG    1 
ATOM   6045  C  CD1   . PHE A 1  814  ? 466.952 11.458  598.769 1.00 17.78  ? 814  PHE A CD1   1 
ATOM   6046  C  CD2   . PHE A 1  814  ? 466.198 10.764  596.615 1.00 18.73  ? 814  PHE A CD2   1 
ATOM   6047  C  CE1   . PHE A 1  814  ? 465.792 12.191  598.947 1.00 17.62  ? 814  PHE A CE1   1 
ATOM   6048  C  CE2   . PHE A 1  814  ? 465.033 11.495  596.786 1.00 18.57  ? 814  PHE A CE2   1 
ATOM   6049  C  CZ    . PHE A 1  814  ? 464.831 12.210  597.955 1.00 18.02  ? 814  PHE A CZ    1 
ATOM   6050  N  N     . PHE A 1  815  ? 467.644 7.121   596.249 1.00 25.01  ? 815  PHE A N     1 
ATOM   6051  C  CA    . PHE A 1  815  ? 466.690 6.288   595.522 1.00 25.26  ? 815  PHE A CA    1 
ATOM   6052  C  C     . PHE A 1  815  ? 466.335 5.035   596.326 1.00 24.79  ? 815  PHE A C     1 
ATOM   6053  O  O     . PHE A 1  815  ? 465.159 4.659   596.437 1.00 24.58  ? 815  PHE A O     1 
ATOM   6054  C  CB    . PHE A 1  815  ? 467.254 5.911   594.151 1.00 26.18  ? 815  PHE A CB    1 
ATOM   6055  C  CG    . PHE A 1  815  ? 467.454 7.088   593.237 1.00 26.76  ? 815  PHE A CG    1 
ATOM   6056  C  CD1   . PHE A 1  815  ? 466.571 8.153   593.257 1.00 26.60  ? 815  PHE A CD1   1 
ATOM   6057  C  CD2   . PHE A 1  815  ? 468.528 7.132   592.363 1.00 27.53  ? 815  PHE A CD2   1 
ATOM   6058  C  CE1   . PHE A 1  815  ? 466.752 9.237   592.419 1.00 27.19  ? 815  PHE A CE1   1 
ATOM   6059  C  CE2   . PHE A 1  815  ? 468.715 8.214   591.524 1.00 28.13  ? 815  PHE A CE2   1 
ATOM   6060  C  CZ    . PHE A 1  815  ? 467.825 9.267   591.552 1.00 27.95  ? 815  PHE A CZ    1 
ATOM   6061  N  N     . HIS A 1  816  ? 467.356 4.404   596.898 1.00 31.57  ? 816  HIS A N     1 
ATOM   6062  C  CA    . HIS A 1  816  ? 467.156 3.254   597.768 1.00 31.35  ? 816  HIS A CA    1 
ATOM   6063  C  C     . HIS A 1  816  ? 466.347 3.655   598.997 1.00 31.65  ? 816  HIS A C     1 
ATOM   6064  O  O     . HIS A 1  816  ? 465.581 2.855   599.535 1.00 31.26  ? 816  HIS A O     1 
ATOM   6065  C  CB    . HIS A 1  816  ? 468.499 2.652   598.184 1.00 31.28  ? 816  HIS A CB    1 
ATOM   6066  C  CG    . HIS A 1  816  ? 468.377 1.467   599.092 1.00 31.61  ? 816  HIS A CG    1 
ATOM   6067  N  ND1   . HIS A 1  816  ? 467.454 0.465   598.889 1.00 32.24  ? 816  HIS A ND1   1 
ATOM   6068  C  CD2   . HIS A 1  816  ? 469.067 1.124   600.206 1.00 31.93  ? 816  HIS A CD2   1 
ATOM   6069  C  CE1   . HIS A 1  816  ? 467.577 -0.444  599.841 1.00 33.67  ? 816  HIS A CE1   1 
ATOM   6070  N  NE2   . HIS A 1  816  ? 468.548 -0.067  600.652 1.00 32.53  ? 816  HIS A NE2   1 
ATOM   6071  N  N     . ALA A 1  817  ? 466.515 4.900   599.431 1.00 29.59  ? 817  ALA A N     1 
ATOM   6072  C  CA    . ALA A 1  817  ? 465.740 5.424   600.548 1.00 29.53  ? 817  ALA A CA    1 
ATOM   6073  C  C     . ALA A 1  817  ? 464.274 5.563   600.157 1.00 28.67  ? 817  ALA A C     1 
ATOM   6074  O  O     . ALA A 1  817  ? 463.385 5.332   600.973 1.00 30.50  ? 817  ALA A O     1 
ATOM   6075  C  CB    . ALA A 1  817  ? 466.299 6.757   601.009 1.00 30.79  ? 817  ALA A CB    1 
ATOM   6076  N  N     . MET A 1  818  ? 464.029 5.941   598.905 1.00 22.14  ? 818  MET A N     1 
ATOM   6077  C  CA    . MET A 1  818  ? 462.667 6.052   598.392 1.00 22.65  ? 818  MET A CA    1 
ATOM   6078  C  C     . MET A 1  818  ? 461.999 4.681   598.359 1.00 22.32  ? 818  MET A C     1 
ATOM   6079  O  O     . MET A 1  818  ? 460.867 4.506   598.838 1.00 22.07  ? 818  MET A O     1 
ATOM   6080  C  CB    . MET A 1  818  ? 462.661 6.677   596.995 1.00 23.03  ? 818  MET A CB    1 
ATOM   6081  C  CG    . MET A 1  818  ? 463.150 8.116   596.948 1.00 23.11  ? 818  MET A CG    1 
ATOM   6082  S  SD    . MET A 1  818  ? 463.187 8.786   595.273 1.00 24.06  ? 818  MET A SD    1 
ATOM   6083  C  CE    . MET A 1  818  ? 461.464 8.646   594.808 1.00 24.47  ? 818  MET A CE    1 
ATOM   6084  N  N     . GLY A 1  819  ? 462.711 3.709   597.795 1.00 20.06  ? 819  GLY A N     1 
ATOM   6085  C  CA    . GLY A 1  819  ? 462.223 2.342   597.750 1.00 20.15  ? 819  GLY A CA    1 
ATOM   6086  C  C     . GLY A 1  819  ? 461.909 1.798   599.133 1.00 19.49  ? 819  GLY A C     1 
ATOM   6087  O  O     . GLY A 1  819  ? 460.812 1.287   599.381 1.00 20.48  ? 819  GLY A O     1 
ATOM   6088  N  N     . GLY A 1  820  ? 462.876 1.919   600.037 1.00 29.23  ? 820  GLY A N     1 
ATOM   6089  C  CA    . GLY A 1  820  ? 462.708 1.466   601.406 1.00 29.26  ? 820  GLY A CA    1 
ATOM   6090  C  C     . GLY A 1  820  ? 461.540 2.142   602.096 1.00 27.63  ? 820  GLY A C     1 
ATOM   6091  O  O     . GLY A 1  820  ? 460.805 1.509   602.860 1.00 29.45  ? 820  GLY A O     1 
ATOM   6092  N  N     . ARG A 1  821  ? 461.371 3.434   601.824 1.00 29.52  ? 821  ARG A N     1 
ATOM   6093  C  CA    . ARG A 1  821  ? 460.244 4.188   602.359 1.00 30.15  ? 821  ARG A CA    1 
ATOM   6094  C  C     . ARG A 1  821  ? 458.935 3.560   601.909 1.00 32.27  ? 821  ARG A C     1 
ATOM   6095  O  O     . ARG A 1  821  ? 458.047 3.308   602.730 1.00 32.79  ? 821  ARG A O     1 
ATOM   6096  C  CB    . ARG A 1  821  ? 460.303 5.652   601.922 1.00 28.97  ? 821  ARG A CB    1 
ATOM   6097  C  CG    . ARG A 1  821  ? 459.028 6.436   602.215 1.00 29.04  ? 821  ARG A CG    1 
ATOM   6098  C  CD    . ARG A 1  821  ? 458.881 6.767   603.693 1.00 26.65  ? 821  ARG A CD    1 
ATOM   6099  N  NE    . ARG A 1  821  ? 459.172 8.173   603.960 1.00 26.62  ? 821  ARG A NE    1 
ATOM   6100  C  CZ    . ARG A 1  821  ? 460.346 8.625   604.388 1.00 27.03  ? 821  ARG A CZ    1 
ATOM   6101  N  NH1   . ARG A 1  821  ? 461.344 7.780   604.607 1.00 27.54  ? 821  ARG A NH1   1 
ATOM   6102  N  NH2   . ARG A 1  821  ? 460.519 9.923   604.602 1.00 28.81  ? 821  ARG A NH2   1 
ATOM   6103  N  N     . GLU A 1  822  ? 458.822 3.300   600.608 1.00 37.30  ? 822  GLU A N     1 
ATOM   6104  C  CA    . GLU A 1  822  ? 457.634 2.634   600.078 1.00 39.08  ? 822  GLU A CA    1 
ATOM   6105  C  C     . GLU A 1  822  ? 457.418 1.305   600.790 1.00 37.29  ? 822  GLU A C     1 
ATOM   6106  O  O     . GLU A 1  822  ? 456.283 0.920   601.086 1.00 39.07  ? 822  GLU A O     1 
ATOM   6107  C  CB    . GLU A 1  822  ? 457.753 2.406   598.573 1.00 40.40  ? 822  GLU A CB    1 
ATOM   6108  C  CG    . GLU A 1  822  ? 456.486 1.848   597.946 1.00 40.82  ? 822  GLU A CG    1 
ATOM   6109  C  CD    . GLU A 1  822  ? 456.702 1.349   596.532 1.00 42.62  ? 822  GLU A CD    1 
ATOM   6110  O  OE1   . GLU A 1  822  ? 455.742 1.382   595.735 1.00 43.07  ? 822  GLU A OE1   1 
ATOM   6111  O  OE2   . GLU A 1  822  ? 457.830 0.914   596.221 1.00 45.62  ? 822  GLU A OE2   1 
ATOM   6112  N  N     . GLY A 1  823  ? 458.522 0.619   601.071 1.00 31.09  ? 823  GLY A N     1 
ATOM   6113  C  CA    . GLY A 1  823  ? 458.488 -0.635  601.801 1.00 32.53  ? 823  GLY A CA    1 
ATOM   6114  C  C     . GLY A 1  823  ? 457.844 -0.506  603.169 1.00 30.01  ? 823  GLY A C     1 
ATOM   6115  O  O     . GLY A 1  823  ? 456.924 -1.254  603.497 1.00 30.48  ? 823  GLY A O     1 
ATOM   6116  N  N     . LEU A 1  824  ? 458.322 0.446   603.965 1.00 30.07  ? 824  LEU A N     1 
ATOM   6117  C  CA    . LEU A 1  824  ? 457.778 0.669   605.302 1.00 28.60  ? 824  LEU A CA    1 
ATOM   6118  C  C     . LEU A 1  824  ? 456.305 1.074   605.249 1.00 30.87  ? 824  LEU A C     1 
ATOM   6119  O  O     . LEU A 1  824  ? 455.483 0.587   606.038 1.00 31.98  ? 824  LEU A O     1 
ATOM   6120  C  CB    . LEU A 1  824  ? 458.587 1.741   606.035 1.00 28.34  ? 824  LEU A CB    1 
ATOM   6121  C  CG    . LEU A 1  824  ? 460.084 1.471   606.198 1.00 28.80  ? 824  LEU A CG    1 
ATOM   6122  C  CD1   . LEU A 1  824  ? 460.744 2.595   606.976 1.00 26.89  ? 824  LEU A CD1   1 
ATOM   6123  C  CD2   . LEU A 1  824  ? 460.322 0.133   606.880 1.00 29.81  ? 824  LEU A CD2   1 
ATOM   6124  N  N     . ILE A 1  825  ? 455.982 1.964   604.312 1.00 33.13  ? 825  ILE A N     1 
ATOM   6125  C  CA    . ILE A 1  825  ? 454.608 2.421   604.125 1.00 32.61  ? 825  ILE A CA    1 
ATOM   6126  C  C     . ILE A 1  825  ? 453.666 1.256   603.855 1.00 34.01  ? 825  ILE A C     1 
ATOM   6127  O  O     . ILE A 1  825  ? 452.705 1.038   604.598 1.00 33.40  ? 825  ILE A O     1 
ATOM   6128  C  CB    . ILE A 1  825  ? 454.494 3.427   602.964 1.00 33.15  ? 825  ILE A CB    1 
ATOM   6129  C  CG1   . ILE A 1  825  ? 455.274 4.701   603.283 1.00 32.59  ? 825  ILE A CG1   1 
ATOM   6130  C  CG2   . ILE A 1  825  ? 453.038 3.762   602.693 1.00 33.65  ? 825  ILE A CG2   1 
ATOM   6131  C  CD1   . ILE A 1  825  ? 454.883 5.335   604.592 1.00 34.34  ? 825  ILE A CD1   1 
ATOM   6132  N  N     . ASP A 1  826  ? 453.949 0.498   602.801 1.00 96.11  ? 826  ASP A N     1 
ATOM   6133  C  CA    . ASP A 1  826  ? 453.073 -0.604  602.427 1.00 96.82  ? 826  ASP A CA    1 
ATOM   6134  C  C     . ASP A 1  826  ? 453.162 -1.742  603.440 1.00 94.47  ? 826  ASP A C     1 
ATOM   6135  O  O     . ASP A 1  826  ? 452.329 -2.643  603.433 1.00 97.65  ? 826  ASP A O     1 
ATOM   6136  C  CB    . ASP A 1  826  ? 453.400 -1.109  601.018 1.00 98.10  ? 826  ASP A CB    1 
ATOM   6137  C  CG    . ASP A 1  826  ? 454.467 -2.183  601.012 1.00 101.36 ? 826  ASP A CG    1 
ATOM   6138  O  OD1   . ASP A 1  826  ? 454.111 -3.380  601.079 1.00 104.57 ? 826  ASP A OD1   1 
ATOM   6139  O  OD2   . ASP A 1  826  ? 455.661 -1.834  600.928 1.00 103.05 ? 826  ASP A OD2   1 
ATOM   6140  N  N     . THR A 1  827  ? 454.168 -1.699  604.310 1.00 44.02  ? 827  THR A N     1 
ATOM   6141  C  CA    . THR A 1  827  ? 454.263 -2.658  605.408 1.00 46.52  ? 827  THR A CA    1 
ATOM   6142  C  C     . THR A 1  827  ? 453.225 -2.332  606.476 1.00 43.85  ? 827  THR A C     1 
ATOM   6143  O  O     . THR A 1  827  ? 452.464 -3.205  606.904 1.00 44.99  ? 827  THR A O     1 
ATOM   6144  C  CB    . THR A 1  827  ? 455.669 -2.671  606.050 1.00 44.00  ? 827  THR A CB    1 
ATOM   6145  O  OG1   . THR A 1  827  ? 456.616 -3.216  605.124 1.00 46.76  ? 827  THR A OG1   1 
ATOM   6146  C  CG2   . THR A 1  827  ? 455.675 -3.515  607.317 1.00 37.24  ? 827  THR A CG2   1 
ATOM   6147  N  N     . ALA A 1  828  ? 453.199 -1.073  606.907 1.00 21.47  ? 828  ALA A N     1 
ATOM   6148  C  CA    . ALA A 1  828  ? 452.193 -0.624  607.866 1.00 21.38  ? 828  ALA A CA    1 
ATOM   6149  C  C     . ALA A 1  828  ? 450.784 -0.809  607.294 1.00 21.93  ? 828  ALA A C     1 
ATOM   6150  O  O     . ALA A 1  828  ? 449.868 -1.286  607.982 1.00 22.06  ? 828  ALA A O     1 
ATOM   6151  C  CB    . ALA A 1  828  ? 452.432 0.829   608.245 1.00 21.10  ? 828  ALA A CB    1 
ATOM   6152  N  N     . VAL A 1  829  ? 450.621 -0.435  606.028 1.00 32.41  ? 829  VAL A N     1 
ATOM   6153  C  CA    . VAL A 1  829  ? 449.357 -0.631  605.330 1.00 32.39  ? 829  VAL A CA    1 
ATOM   6154  C  C     . VAL A 1  829  ? 448.968 -2.107  605.329 1.00 33.06  ? 829  VAL A C     1 
ATOM   6155  O  O     . VAL A 1  829  ? 447.814 -2.460  605.592 1.00 35.36  ? 829  VAL A O     1 
ATOM   6156  C  CB    . VAL A 1  829  ? 449.429 -0.116  603.877 1.00 32.89  ? 829  VAL A CB    1 
ATOM   6157  C  CG1   . VAL A 1  829  ? 448.198 -0.544  603.091 1.00 35.17  ? 829  VAL A CG1   1 
ATOM   6158  C  CG2   . VAL A 1  829  ? 449.581 1.396   603.857 1.00 33.62  ? 829  VAL A CG2   1 
ATOM   6159  N  N     . LYS A 1  830  ? 449.945 -2.965  605.051 1.00 50.75  ? 830  LYS A N     1 
ATOM   6160  C  CA    . LYS A 1  830  ? 449.709 -4.403  604.986 1.00 54.12  ? 830  LYS A CA    1 
ATOM   6161  C  C     . LYS A 1  830  ? 449.246 -4.955  606.327 1.00 53.35  ? 830  LYS A C     1 
ATOM   6162  O  O     . LYS A 1  830  ? 448.259 -5.683  606.388 1.00 54.40  ? 830  LYS A O     1 
ATOM   6163  C  CB    . LYS A 1  830  ? 450.972 -5.139  604.532 1.00 56.38  ? 830  LYS A CB    1 
ATOM   6164  C  CG    . LYS A 1  830  ? 450.706 -6.447  603.807 1.00 58.11  ? 830  LYS A CG    1 
ATOM   6165  C  CD    . LYS A 1  830  ? 451.238 -6.399  602.381 1.00 60.42  ? 830  LYS A CD    1 
ATOM   6166  C  CE    . LYS A 1  830  ? 450.594 -5.272  601.584 1.00 56.65  ? 830  LYS A CE    1 
ATOM   6167  N  NZ    . LYS A 1  830  ? 451.167 -5.151  600.215 1.00 54.87  ? 830  LYS A NZ    1 
ATOM   6168  N  N     . THR A 1  831  ? 449.951 -4.606  607.399 1.00 46.25  ? 831  THR A N     1 
ATOM   6169  C  CA    . THR A 1  831  ? 449.607 -5.133  608.716 1.00 44.58  ? 831  THR A CA    1 
ATOM   6170  C  C     . THR A 1  831  ? 448.246 -4.593  609.167 1.00 42.99  ? 831  THR A C     1 
ATOM   6171  O  O     . THR A 1  831  ? 447.507 -5.273  609.885 1.00 43.32  ? 831  THR A O     1 
ATOM   6172  C  CB    . THR A 1  831  ? 450.701 -4.811  609.772 1.00 43.68  ? 831  THR A CB    1 
ATOM   6173  O  OG1   . THR A 1  831  ? 450.499 -5.616  610.940 1.00 47.18  ? 831  THR A OG1   1 
ATOM   6174  C  CG2   . THR A 1  831  ? 450.694 -3.346  610.166 1.00 41.73  ? 831  THR A CG2   1 
ATOM   6175  N  N     . ALA A 1  832  ? 447.900 -3.389  608.716 1.00 41.67  ? 832  ALA A N     1 
ATOM   6176  C  CA    . ALA A 1  832  ? 446.598 -2.814  609.042 1.00 42.17  ? 832  ALA A CA    1 
ATOM   6177  C  C     . ALA A 1  832  ? 445.460 -3.555  608.333 1.00 41.67  ? 832  ALA A C     1 
ATOM   6178  O  O     . ALA A 1  832  ? 444.548 -4.093  608.977 1.00 42.19  ? 832  ALA A O     1 
ATOM   6179  C  CB    . ALA A 1  832  ? 446.570 -1.335  608.685 1.00 41.04  ? 832  ALA A CB    1 
ATOM   6180  N  N     . GLU A 1  833  ? 445.521 -3.583  607.004 1.00 51.83  ? 833  GLU A N     1 
ATOM   6181  C  CA    . GLU A 1  833  ? 444.473 -4.205  606.201 1.00 54.36  ? 833  GLU A CA    1 
ATOM   6182  C  C     . GLU A 1  833  ? 444.346 -5.698  606.486 1.00 53.82  ? 833  GLU A C     1 
ATOM   6183  O  O     . GLU A 1  833  ? 443.248 -6.253  606.450 1.00 55.14  ? 833  GLU A O     1 
ATOM   6184  C  CB    . GLU A 1  833  ? 444.734 -3.974  604.712 1.00 55.34  ? 833  GLU A CB    1 
ATOM   6185  C  CG    . GLU A 1  833  ? 444.586 -2.522  604.284 1.00 57.21  ? 833  GLU A CG    1 
ATOM   6186  C  CD    . GLU A 1  833  ? 444.696 -2.341  602.784 1.00 60.47  ? 833  GLU A CD    1 
ATOM   6187  O  OE1   . GLU A 1  833  ? 445.068 -3.312  602.092 1.00 63.39  ? 833  GLU A OE1   1 
ATOM   6188  O  OE2   . GLU A 1  833  ? 444.406 -1.229  602.296 1.00 58.62  ? 833  GLU A OE2   1 
ATOM   6189  N  N     . THR A 1  834  ? 445.471 -6.346  606.768 1.00 30.30  ? 834  THR A N     1 
ATOM   6190  C  CA    . THR A 1  834  ? 445.448 -7.743  607.176 1.00 29.30  ? 834  THR A CA    1 
ATOM   6191  C  C     . THR A 1  834  ? 444.781 -7.867  608.537 1.00 28.45  ? 834  THR A C     1 
ATOM   6192  O  O     . THR A 1  834  ? 443.956 -8.756  608.756 1.00 30.14  ? 834  THR A O     1 
ATOM   6193  C  CB    . THR A 1  834  ? 446.857 -8.353  607.247 1.00 29.97  ? 834  THR A CB    1 
ATOM   6194  O  OG1   . THR A 1  834  ? 447.472 -8.300  605.954 1.00 32.33  ? 834  THR A OG1   1 
ATOM   6195  C  CG2   . THR A 1  834  ? 446.780 -9.797  607.705 1.00 30.54  ? 834  THR A CG2   1 
ATOM   6196  N  N     . GLY A 1  835  ? 445.144 -6.967  609.447 1.00 33.34  ? 835  GLY A N     1 
ATOM   6197  C  CA    . GLY A 1  835  ? 444.533 -6.928  610.762 1.00 34.08  ? 835  GLY A CA    1 
ATOM   6198  C  C     . GLY A 1  835  ? 443.020 -6.849  610.688 1.00 33.55  ? 835  GLY A C     1 
ATOM   6199  O  O     . GLY A 1  835  ? 442.319 -7.446  611.505 1.00 32.48  ? 835  GLY A O     1 
ATOM   6200  N  N     . TYR A 1  836  ? 442.514 -6.117  609.699 1.00 40.23  ? 836  TYR A N     1 
ATOM   6201  C  CA    . TYR A 1  836  ? 441.070 -6.003  609.505 1.00 42.07  ? 836  TYR A CA    1 
ATOM   6202  C  C     . TYR A 1  836  ? 440.482 -7.257  608.852 1.00 43.21  ? 836  TYR A C     1 
ATOM   6203  O  O     . TYR A 1  836  ? 439.456 -7.781  609.300 1.00 45.01  ? 836  TYR A O     1 
ATOM   6204  C  CB    . TYR A 1  836  ? 440.747 -4.768  608.662 1.00 41.82  ? 836  TYR A CB    1 
ATOM   6205  C  CG    . TYR A 1  836  ? 439.270 -4.477  608.529 1.00 44.31  ? 836  TYR A CG    1 
ATOM   6206  C  CD1   . TYR A 1  836  ? 438.414 -4.618  609.614 1.00 44.56  ? 836  TYR A CD1   1 
ATOM   6207  C  CD2   . TYR A 1  836  ? 438.734 -4.042  607.324 1.00 47.08  ? 836  TYR A CD2   1 
ATOM   6208  C  CE1   . TYR A 1  836  ? 437.063 -4.348  609.498 1.00 46.36  ? 836  TYR A CE1   1 
ATOM   6209  C  CE2   . TYR A 1  836  ? 437.385 -3.766  607.200 1.00 49.88  ? 836  TYR A CE2   1 
ATOM   6210  C  CZ    . TYR A 1  836  ? 436.555 -3.923  608.289 1.00 50.48  ? 836  TYR A CZ    1 
ATOM   6211  O  OH    . TYR A 1  836  ? 435.211 -3.650  608.169 1.00 56.05  ? 836  TYR A OH    1 
ATOM   6212  N  N     . ILE A 1  837  ? 441.139 -7.728  607.795 1.00 26.07  ? 837  ILE A N     1 
ATOM   6213  C  CA    . ILE A 1  837  ? 440.704 -8.916  607.060 1.00 26.76  ? 837  ILE A CA    1 
ATOM   6214  C  C     . ILE A 1  837  ? 440.548 -10.131 607.971 1.00 26.91  ? 837  ILE A C     1 
ATOM   6215  O  O     . ILE A 1  837  ? 439.555 -10.858 607.890 1.00 27.67  ? 837  ILE A O     1 
ATOM   6216  C  CB    . ILE A 1  837  ? 441.694 -9.257  605.922 1.00 26.66  ? 837  ILE A CB    1 
ATOM   6217  C  CG1   . ILE A 1  837  ? 441.456 -8.343  604.720 1.00 26.94  ? 837  ILE A CG1   1 
ATOM   6218  C  CG2   . ILE A 1  837  ? 441.566 -10.714 605.497 1.00 27.24  ? 837  ILE A CG2   1 
ATOM   6219  C  CD1   . ILE A 1  837  ? 442.333 -8.666  603.527 1.00 27.57  ? 837  ILE A CD1   1 
ATOM   6220  N  N     . GLN A 1  838  ? 441.529 -10.335 608.845 1.00 34.35  ? 838  GLN A N     1 
ATOM   6221  C  CA    . GLN A 1  838  ? 441.513 -11.460 609.771 1.00 35.55  ? 838  GLN A CA    1 
ATOM   6222  C  C     . GLN A 1  838  ? 440.305 -11.379 610.702 1.00 35.10  ? 838  GLN A C     1 
ATOM   6223  O  O     . GLN A 1  838  ? 439.596 -12.367 610.898 1.00 35.99  ? 838  GLN A O     1 
ATOM   6224  C  CB    . GLN A 1  838  ? 442.816 -11.506 610.576 1.00 35.79  ? 838  GLN A CB    1 
ATOM   6225  C  CG    . GLN A 1  838  ? 443.042 -12.801 611.344 1.00 33.40  ? 838  GLN A CG    1 
ATOM   6226  C  CD    . GLN A 1  838  ? 442.529 -12.737 612.769 1.00 37.18  ? 838  GLN A CD    1 
ATOM   6227  O  OE1   . GLN A 1  838  ? 442.044 -11.698 613.221 1.00 38.83  ? 838  GLN A OE1   1 
ATOM   6228  N  NE2   . GLN A 1  838  ? 442.639 -13.849 613.488 1.00 34.72  ? 838  GLN A NE2   1 
ATOM   6229  N  N     . ARG A 1  839  ? 440.066 -10.195 611.260 1.00 49.05  ? 839  ARG A N     1 
ATOM   6230  C  CA    . ARG A 1  839  ? 438.916 -9.990  612.133 1.00 50.19  ? 839  ARG A CA    1 
ATOM   6231  C  C     . ARG A 1  839  ? 437.609 -10.276 611.407 1.00 49.16  ? 839  ARG A C     1 
ATOM   6232  O  O     . ARG A 1  839  ? 436.719 -10.927 611.952 1.00 49.42  ? 839  ARG A O     1 
ATOM   6233  C  CB    . ARG A 1  839  ? 438.892 -8.565  612.687 1.00 50.02  ? 839  ARG A CB    1 
ATOM   6234  C  CG    . ARG A 1  839  ? 437.515 -8.156  613.181 1.00 47.21  ? 839  ARG A CG    1 
ATOM   6235  C  CD    . ARG A 1  839  ? 437.539 -6.896  614.018 1.00 49.78  ? 839  ARG A CD    1 
ATOM   6236  N  NE    . ARG A 1  839  ? 436.185 -6.491  614.384 1.00 50.69  ? 839  ARG A NE    1 
ATOM   6237  C  CZ    . ARG A 1  839  ? 435.478 -7.045  615.365 1.00 52.36  ? 839  ARG A CZ    1 
ATOM   6238  N  NH1   . ARG A 1  839  ? 434.252 -6.613  615.626 1.00 53.94  ? 839  ARG A NH1   1 
ATOM   6239  N  NH2   . ARG A 1  839  ? 435.996 -8.031  616.086 1.00 51.12  ? 839  ARG A NH2   1 
ATOM   6240  N  N     . ARG A 1  840  ? 437.496 -9.784  610.177 1.00 51.17  ? 840  ARG A N     1 
ATOM   6241  C  CA    . ARG A 1  840  ? 436.300 -10.020 609.375 1.00 52.02  ? 840  ARG A CA    1 
ATOM   6242  C  C     . ARG A 1  840  ? 436.066 -11.509 609.145 1.00 54.29  ? 840  ARG A C     1 
ATOM   6243  O  O     . ARG A 1  840  ? 434.951 -12.005 609.316 1.00 54.82  ? 840  ARG A O     1 
ATOM   6244  C  CB    . ARG A 1  840  ? 436.407 -9.294  608.037 1.00 52.53  ? 840  ARG A CB    1 
ATOM   6245  C  CG    . ARG A 1  840  ? 436.368 -7.785  608.153 1.00 53.08  ? 840  ARG A CG    1 
ATOM   6246  C  CD    . ARG A 1  840  ? 436.901 -7.148  606.890 1.00 53.94  ? 840  ARG A CD    1 
ATOM   6247  N  NE    . ARG A 1  840  ? 436.295 -7.723  605.695 1.00 55.62  ? 840  ARG A NE    1 
ATOM   6248  C  CZ    . ARG A 1  840  ? 436.670 -7.429  604.455 1.00 58.00  ? 840  ARG A CZ    1 
ATOM   6249  N  NH1   . ARG A 1  840  ? 437.654 -6.563  604.247 1.00 56.93  ? 840  ARG A NH1   1 
ATOM   6250  N  NH2   . ARG A 1  840  ? 436.063 -8.001  603.423 1.00 58.75  ? 840  ARG A NH2   1 
ATOM   6251  N  N     . LEU A 1  841  ? 437.126 -12.213 608.758 1.00 24.37  ? 841  LEU A N     1 
ATOM   6252  C  CA    . LEU A 1  841  ? 437.063 -13.656 608.547 1.00 24.91  ? 841  LEU A CA    1 
ATOM   6253  C  C     . LEU A 1  841  ? 436.596 -14.379 609.803 1.00 25.16  ? 841  LEU A C     1 
ATOM   6254  O  O     . LEU A 1  841  ? 435.700 -15.225 609.747 1.00 26.04  ? 841  LEU A O     1 
ATOM   6255  C  CB    . LEU A 1  841  ? 438.427 -14.193 608.114 1.00 24.37  ? 841  LEU A CB    1 
ATOM   6256  C  CG    . LEU A 1  841  ? 438.837 -13.891 606.675 1.00 24.42  ? 841  LEU A CG    1 
ATOM   6257  C  CD1   . LEU A 1  841  ? 440.288 -14.267 606.443 1.00 23.82  ? 841  LEU A CD1   1 
ATOM   6258  C  CD2   . LEU A 1  841  ? 437.932 -14.638 605.714 1.00 25.48  ? 841  LEU A CD2   1 
ATOM   6259  N  N     . VAL A 1  842  ? 437.210 -14.040 610.934 1.00 27.96  ? 842  VAL A N     1 
ATOM   6260  C  CA    . VAL A 1  842  ? 436.846 -14.641 612.212 1.00 28.17  ? 842  VAL A CA    1 
ATOM   6261  C  C     . VAL A 1  842  ? 435.377 -14.408 612.537 1.00 29.01  ? 842  VAL A C     1 
ATOM   6262  O  O     . VAL A 1  842  ? 434.634 -15.353 612.793 1.00 29.80  ? 842  VAL A O     1 
ATOM   6263  C  CB    . VAL A 1  842  ? 437.707 -14.090 613.363 1.00 27.27  ? 842  VAL A CB    1 
ATOM   6264  C  CG1   . VAL A 1  842  ? 437.158 -14.558 614.698 1.00 27.61  ? 842  VAL A CG1   1 
ATOM   6265  C  CG2   . VAL A 1  842  ? 439.154 -14.523 613.196 1.00 26.58  ? 842  VAL A CG2   1 
ATOM   6266  N  N     . LYS A 1  843  ? 434.961 -13.147 612.507 1.00 36.08  ? 843  LYS A N     1 
ATOM   6267  C  CA    . LYS A 1  843  ? 433.590 -12.777 612.838 1.00 37.40  ? 843  LYS A CA    1 
ATOM   6268  C  C     . LYS A 1  843  ? 432.567 -13.364 611.870 1.00 38.64  ? 843  LYS A C     1 
ATOM   6269  O  O     . LYS A 1  843  ? 431.392 -13.498 612.211 1.00 39.11  ? 843  LYS A O     1 
ATOM   6270  C  CB    . LYS A 1  843  ? 433.452 -11.254 612.877 1.00 37.32  ? 843  LYS A CB    1 
ATOM   6271  C  CG    . LYS A 1  843  ? 433.913 -10.636 614.182 1.00 36.27  ? 843  LYS A CG    1 
ATOM   6272  C  CD    . LYS A 1  843  ? 433.116 -11.201 615.346 1.00 38.10  ? 843  LYS A CD    1 
ATOM   6273  C  CE    . LYS A 1  843  ? 433.564 -10.608 616.667 1.00 40.50  ? 843  LYS A CE    1 
ATOM   6274  N  NZ    . LYS A 1  843  ? 432.747 -11.132 617.793 1.00 42.81  ? 843  LYS A NZ    1 
ATOM   6275  N  N     . ALA A 1  844  ? 433.010 -13.714 610.667 1.00 26.12  ? 844  ALA A N     1 
ATOM   6276  C  CA    . ALA A 1  844  ? 432.114 -14.305 609.680 1.00 27.17  ? 844  ALA A CA    1 
ATOM   6277  C  C     . ALA A 1  844  ? 431.980 -15.810 609.874 1.00 27.73  ? 844  ALA A C     1 
ATOM   6278  O  O     . ALA A 1  844  ? 430.886 -16.361 609.760 1.00 28.80  ? 844  ALA A O     1 
ATOM   6279  C  CB    . ALA A 1  844  ? 432.596 -13.999 608.276 1.00 27.01  ? 844  ALA A CB    1 
ATOM   6280  N  N     . LEU A 1  845  ? 433.095 -16.470 610.169 1.00 26.77  ? 845  LEU A N     1 
ATOM   6281  C  CA    . LEU A 1  845  ? 433.105 -17.920 610.338 1.00 27.29  ? 845  LEU A CA    1 
ATOM   6282  C  C     . LEU A 1  845  ? 433.022 -18.316 611.811 1.00 27.24  ? 845  LEU A C     1 
ATOM   6283  O  O     . LEU A 1  845  ? 433.221 -19.476 612.164 1.00 27.52  ? 845  LEU A O     1 
ATOM   6284  C  CB    . LEU A 1  845  ? 434.363 -18.513 609.704 1.00 26.77  ? 845  LEU A CB    1 
ATOM   6285  C  CG    . LEU A 1  845  ? 434.549 -18.233 608.212 1.00 26.87  ? 845  LEU A CG    1 
ATOM   6286  C  CD1   . LEU A 1  845  ? 435.904 -18.721 607.735 1.00 26.30  ? 845  LEU A CD1   1 
ATOM   6287  C  CD2   . LEU A 1  845  ? 433.440 -18.891 607.420 1.00 28.11  ? 845  LEU A CD2   1 
ATOM   6288  N  N     . GLU A 1  846  ? 432.710 -17.339 612.656 1.00 44.17  ? 846  GLU A N     1 
ATOM   6289  C  CA    . GLU A 1  846  ? 432.721 -17.492 614.111 1.00 42.61  ? 846  GLU A CA    1 
ATOM   6290  C  C     . GLU A 1  846  ? 431.939 -18.695 614.644 1.00 44.39  ? 846  GLU A C     1 
ATOM   6291  O  O     . GLU A 1  846  ? 432.504 -19.569 615.300 1.00 43.17  ? 846  GLU A O     1 
ATOM   6292  C  CB    . GLU A 1  846  ? 432.177 -16.210 614.745 1.00 44.03  ? 846  GLU A CB    1 
ATOM   6293  C  CG    . GLU A 1  846  ? 432.244 -16.158 616.255 1.00 46.64  ? 846  GLU A CG    1 
ATOM   6294  C  CD    . GLU A 1  846  ? 431.628 -14.886 616.806 1.00 50.28  ? 846  GLU A CD    1 
ATOM   6295  O  OE1   . GLU A 1  846  ? 430.763 -14.300 616.120 1.00 46.88  ? 846  GLU A OE1   1 
ATOM   6296  O  OE2   . GLU A 1  846  ? 432.011 -14.467 617.920 1.00 52.50  ? 846  GLU A OE2   1 
ATOM   6297  N  N     . ASP A 1  847  ? 430.643 -18.736 614.354 1.00 56.50  ? 847  ASP A N     1 
ATOM   6298  C  CA    . ASP A 1  847  ? 429.744 -19.711 614.969 1.00 55.87  ? 847  ASP A CA    1 
ATOM   6299  C  C     . ASP A 1  847  ? 429.647 -21.029 614.209 1.00 55.92  ? 847  ASP A C     1 
ATOM   6300  O  O     . ASP A 1  847  ? 428.618 -21.700 614.257 1.00 58.37  ? 847  ASP A O     1 
ATOM   6301  C  CB    . ASP A 1  847  ? 428.345 -19.110 615.106 1.00 59.26  ? 847  ASP A CB    1 
ATOM   6302  C  CG    . ASP A 1  847  ? 427.748 -18.718 613.766 1.00 61.65  ? 847  ASP A CG    1 
ATOM   6303  O  OD1   . ASP A 1  847  ? 428.525 -18.392 612.843 1.00 62.31  ? 847  ASP A OD1   1 
ATOM   6304  O  OD2   . ASP A 1  847  ? 426.506 -18.737 613.634 1.00 62.76  ? 847  ASP A OD2   1 
ATOM   6305  N  N     . ILE A 1  848  ? 430.716 -21.407 613.518 1.00 41.69  ? 848  ILE A N     1 
ATOM   6306  C  CA    . ILE A 1  848  ? 430.708 -22.631 612.726 1.00 40.00  ? 848  ILE A CA    1 
ATOM   6307  C  C     . ILE A 1  848  ? 431.531 -23.738 613.373 1.00 40.80  ? 848  ILE A C     1 
ATOM   6308  O  O     . ILE A 1  848  ? 432.683 -23.524 613.750 1.00 42.84  ? 848  ILE A O     1 
ATOM   6309  C  CB    . ILE A 1  848  ? 431.246 -22.380 611.311 1.00 40.67  ? 848  ILE A CB    1 
ATOM   6310  C  CG1   . ILE A 1  848  ? 430.380 -21.355 610.585 1.00 42.36  ? 848  ILE A CG1   1 
ATOM   6311  C  CG2   . ILE A 1  848  ? 431.291 -23.667 610.521 1.00 39.28  ? 848  ILE A CG2   1 
ATOM   6312  C  CD1   . ILE A 1  848  ? 430.846 -21.080 609.186 1.00 41.32  ? 848  ILE A CD1   1 
ATOM   6313  N  N     . MET A 1  849  ? 430.937 -24.920 613.501 1.00 37.43  ? 849  MET A N     1 
ATOM   6314  C  CA    . MET A 1  849  ? 431.660 -26.073 614.023 1.00 37.46  ? 849  MET A CA    1 
ATOM   6315  C  C     . MET A 1  849  ? 431.108 -27.382 613.482 1.00 38.17  ? 849  MET A C     1 
ATOM   6316  O  O     . MET A 1  849  ? 430.076 -27.408 612.813 1.00 38.70  ? 849  MET A O     1 
ATOM   6317  C  CB    . MET A 1  849  ? 431.616 -26.096 615.551 1.00 37.75  ? 849  MET A CB    1 
ATOM   6318  C  CG    . MET A 1  849  ? 430.270 -26.480 616.143 1.00 38.79  ? 849  MET A CG    1 
ATOM   6319  S  SD    . MET A 1  849  ? 430.357 -26.733 617.929 1.00 39.28  ? 849  MET A SD    1 
ATOM   6320  C  CE    . MET A 1  849  ? 428.647 -27.119 618.300 1.00 40.64  ? 849  MET A CE    1 
ATOM   6321  N  N     . VAL A 1  850  ? 431.810 -28.469 613.781 1.00 29.00  ? 850  VAL A N     1 
ATOM   6322  C  CA    . VAL A 1  850  ? 431.379 -29.798 613.378 1.00 29.75  ? 850  VAL A CA    1 
ATOM   6323  C  C     . VAL A 1  850  ? 430.459 -30.392 614.436 1.00 30.74  ? 850  VAL A C     1 
ATOM   6324  O  O     . VAL A 1  850  ? 430.841 -30.516 615.600 1.00 30.84  ? 850  VAL A O     1 
ATOM   6325  C  CB    . VAL A 1  850  ? 432.578 -30.738 613.157 1.00 29.50  ? 850  VAL A CB    1 
ATOM   6326  C  CG1   . VAL A 1  850  ? 432.098 -32.138 612.817 1.00 30.38  ? 850  VAL A CG1   1 
ATOM   6327  C  CG2   . VAL A 1  850  ? 433.478 -30.198 612.060 1.00 28.66  ? 850  VAL A CG2   1 
ATOM   6328  N  N     . HIS A 1  851  ? 429.245 -30.749 614.031 1.00 41.23  ? 851  HIS A N     1 
ATOM   6329  C  CA    . HIS A 1  851  ? 428.288 -31.351 614.951 1.00 44.25  ? 851  HIS A CA    1 
ATOM   6330  C  C     . HIS A 1  851  ? 428.461 -32.865 614.995 1.00 45.48  ? 851  HIS A C     1 
ATOM   6331  O  O     . HIS A 1  851  ? 429.308 -33.421 614.295 1.00 43.38  ? 851  HIS A O     1 
ATOM   6332  C  CB    . HIS A 1  851  ? 426.859 -30.981 614.557 1.00 44.60  ? 851  HIS A CB    1 
ATOM   6333  C  CG    . HIS A 1  851  ? 426.521 -29.544 614.804 1.00 44.52  ? 851  HIS A CG    1 
ATOM   6334  N  ND1   . HIS A 1  851  ? 425.824 -29.125 615.917 1.00 45.87  ? 851  HIS A ND1   1 
ATOM   6335  C  CD2   . HIS A 1  851  ? 426.793 -28.428 614.088 1.00 44.91  ? 851  HIS A CD2   1 
ATOM   6336  C  CE1   . HIS A 1  851  ? 425.677 -27.812 615.873 1.00 46.93  ? 851  HIS A CE1   1 
ATOM   6337  N  NE2   . HIS A 1  851  ? 426.256 -27.365 614.773 1.00 44.38  ? 851  HIS A NE2   1 
ATOM   6338  N  N     . TYR A 1  852  ? 427.650 -33.529 615.813 1.00 43.70  ? 852  TYR A N     1 
ATOM   6339  C  CA    . TYR A 1  852  ? 427.809 -34.961 616.049 1.00 44.53  ? 852  TYR A CA    1 
ATOM   6340  C  C     . TYR A 1  852  ? 427.278 -35.829 614.907 1.00 45.11  ? 852  TYR A C     1 
ATOM   6341  O  O     . TYR A 1  852  ? 427.088 -37.034 615.072 1.00 46.09  ? 852  TYR A O     1 
ATOM   6342  C  CB    . TYR A 1  852  ? 427.129 -35.355 617.361 1.00 45.70  ? 852  TYR A CB    1 
ATOM   6343  C  CG    . TYR A 1  852  ? 427.945 -35.019 618.589 1.00 45.37  ? 852  TYR A CG    1 
ATOM   6344  C  CD1   . TYR A 1  852  ? 428.943 -35.874 619.035 1.00 45.45  ? 852  TYR A CD1   1 
ATOM   6345  C  CD2   . TYR A 1  852  ? 427.719 -33.848 619.302 1.00 45.07  ? 852  TYR A CD2   1 
ATOM   6346  C  CE1   . TYR A 1  852  ? 429.693 -35.575 620.155 1.00 45.24  ? 852  TYR A CE1   1 
ATOM   6347  C  CE2   . TYR A 1  852  ? 428.464 -33.541 620.425 1.00 44.83  ? 852  TYR A CE2   1 
ATOM   6348  C  CZ    . TYR A 1  852  ? 429.449 -34.409 620.847 1.00 44.93  ? 852  TYR A CZ    1 
ATOM   6349  O  OH    . TYR A 1  852  ? 430.197 -34.111 621.963 1.00 44.79  ? 852  TYR A OH    1 
ATOM   6350  N  N     . ASP A 1  853  ? 427.041 -35.215 613.754 1.00 48.29  ? 853  ASP A N     1 
ATOM   6351  C  CA    . ASP A 1  853  ? 426.730 -35.960 612.541 1.00 47.92  ? 853  ASP A CA    1 
ATOM   6352  C  C     . ASP A 1  853  ? 427.726 -35.590 611.447 1.00 47.85  ? 853  ASP A C     1 
ATOM   6353  O  O     . ASP A 1  853  ? 427.440 -35.735 610.257 1.00 47.20  ? 853  ASP A O     1 
ATOM   6354  C  CB    . ASP A 1  853  ? 425.292 -35.693 612.081 1.00 48.86  ? 853  ASP A CB    1 
ATOM   6355  C  CG    . ASP A 1  853  ? 424.946 -34.215 612.060 1.00 48.44  ? 853  ASP A CG    1 
ATOM   6356  O  OD1   . ASP A 1  853  ? 425.864 -33.380 612.198 1.00 49.06  ? 853  ASP A OD1   1 
ATOM   6357  O  OD2   . ASP A 1  853  ? 423.751 -33.888 611.899 1.00 49.69  ? 853  ASP A OD2   1 
ATOM   6358  N  N     . ASN A 1  854  ? 428.891 -35.104 611.873 1.00 69.57  ? 854  ASN A N     1 
ATOM   6359  C  CA    . ASN A 1  854  ? 429.956 -34.657 610.975 1.00 66.95  ? 854  ASN A CA    1 
ATOM   6360  C  C     . ASN A 1  854  ? 429.496 -33.600 609.978 1.00 66.72  ? 854  ASN A C     1 
ATOM   6361  O  O     . ASN A 1  854  ? 430.101 -33.428 608.920 1.00 67.44  ? 854  ASN A O     1 
ATOM   6362  C  CB    . ASN A 1  854  ? 430.559 -35.846 610.223 1.00 67.92  ? 854  ASN A CB    1 
ATOM   6363  C  CG    . ASN A 1  854  ? 431.361 -36.758 611.127 1.00 69.89  ? 854  ASN A CG    1 
ATOM   6364  O  OD1   . ASN A 1  854  ? 432.538 -36.510 611.390 1.00 71.17  ? 854  ASN A OD1   1 
ATOM   6365  N  ND2   . ASN A 1  854  ? 430.728 -37.823 611.607 1.00 75.09  ? 854  ASN A ND2   1 
ATOM   6366  N  N     . THR A 1  855  ? 428.427 -32.891 610.324 1.00 43.01  ? 855  THR A N     1 
ATOM   6367  C  CA    . THR A 1  855  ? 427.906 -31.838 609.467 1.00 42.91  ? 855  THR A CA    1 
ATOM   6368  C  C     . THR A 1  855  ? 428.428 -30.483 609.920 1.00 42.80  ? 855  THR A C     1 
ATOM   6369  O  O     . THR A 1  855  ? 428.345 -30.136 611.098 1.00 43.89  ? 855  THR A O     1 
ATOM   6370  C  CB    . THR A 1  855  ? 426.367 -31.814 609.463 1.00 45.01  ? 855  THR A CB    1 
ATOM   6371  O  OG1   . THR A 1  855  ? 425.866 -33.146 609.304 1.00 49.34  ? 855  THR A OG1   1 
ATOM   6372  C  CG2   . THR A 1  855  ? 425.851 -30.943 608.330 1.00 45.10  ? 855  THR A CG2   1 
ATOM   6373  N  N     . THR A 1  856  ? 428.973 -29.723 608.978 1.00 55.63  ? 856  THR A N     1 
ATOM   6374  C  CA    . THR A 1  856  ? 429.469 -28.386 609.265 1.00 54.36  ? 856  THR A CA    1 
ATOM   6375  C  C     . THR A 1  856  ? 428.328 -27.377 609.192 1.00 54.83  ? 856  THR A C     1 
ATOM   6376  O  O     . THR A 1  856  ? 427.830 -27.069 608.110 1.00 55.35  ? 856  THR A O     1 
ATOM   6377  C  CB    . THR A 1  856  ? 430.585 -27.982 608.287 1.00 53.20  ? 856  THR A CB    1 
ATOM   6378  O  OG1   . THR A 1  856  ? 431.708 -28.856 608.457 1.00 53.96  ? 856  THR A OG1   1 
ATOM   6379  C  CG2   . THR A 1  856  ? 431.027 -26.561 608.540 1.00 54.15  ? 856  THR A CG2   1 
ATOM   6380  N  N     . ARG A 1  857  ? 427.909 -26.875 610.349 1.00 41.73  ? 857  ARG A N     1 
ATOM   6381  C  CA    . ARG A 1  857  ? 426.781 -25.954 610.414 1.00 43.16  ? 857  ARG A CA    1 
ATOM   6382  C  C     . ARG A 1  857  ? 427.112 -24.689 611.195 1.00 44.44  ? 857  ARG A C     1 
ATOM   6383  O  O     . ARG A 1  857  ? 428.234 -24.514 611.670 1.00 45.60  ? 857  ARG A O     1 
ATOM   6384  C  CB    . ARG A 1  857  ? 425.568 -26.635 611.049 1.00 45.71  ? 857  ARG A CB    1 
ATOM   6385  C  CG    . ARG A 1  857  ? 425.209 -27.983 610.453 1.00 47.68  ? 857  ARG A CG    1 
ATOM   6386  C  CD    . ARG A 1  857  ? 423.868 -28.460 610.980 1.00 48.70  ? 857  ARG A CD    1 
ATOM   6387  N  NE    . ARG A 1  857  ? 423.556 -29.819 610.556 1.00 48.53  ? 857  ARG A NE    1 
ATOM   6388  C  CZ    . ARG A 1  857  ? 422.341 -30.353 610.613 1.00 51.57  ? 857  ARG A CZ    1 
ATOM   6389  N  NH1   . ARG A 1  857  ? 421.322 -29.635 611.066 1.00 50.68  ? 857  ARG A NH1   1 
ATOM   6390  N  NH2   . ARG A 1  857  ? 422.142 -31.600 610.209 1.00 54.80  ? 857  ARG A NH2   1 
ATOM   6391  N  N     . ASN A 1  858  ? 426.121 -23.814 611.327 1.00 53.86  ? 858  ASN A N     1 
ATOM   6392  C  CA    . ASN A 1  858  ? 426.261 -22.599 612.120 1.00 53.83  ? 858  ASN A CA    1 
ATOM   6393  C  C     . ASN A 1  858  ? 425.289 -22.590 613.297 1.00 57.33  ? 858  ASN A C     1 
ATOM   6394  O  O     . ASN A 1  858  ? 424.770 -23.634 613.691 1.00 59.60  ? 858  ASN A O     1 
ATOM   6395  C  CB    . ASN A 1  858  ? 426.050 -21.358 611.247 1.00 53.96  ? 858  ASN A CB    1 
ATOM   6396  C  CG    . ASN A 1  858  ? 424.769 -21.420 610.433 1.00 56.88  ? 858  ASN A CG    1 
ATOM   6397  O  OD1   . ASN A 1  858  ? 423.791 -22.053 610.831 1.00 58.55  ? 858  ASN A OD1   1 
ATOM   6398  N  ND2   . ASN A 1  858  ? 424.772 -20.762 609.280 1.00 59.09  ? 858  ASN A ND2   1 
ATOM   6399  N  N     . SER A 1  859  ? 425.043 -21.408 613.853 1.00 70.74  ? 859  SER A N     1 
ATOM   6400  C  CA    . SER A 1  859  ? 424.130 -21.271 614.983 1.00 72.74  ? 859  SER A CA    1 
ATOM   6401  C  C     . SER A 1  859  ? 422.679 -21.469 614.553 1.00 72.51  ? 859  SER A C     1 
ATOM   6402  O  O     . SER A 1  859  ? 421.822 -21.817 615.365 1.00 74.59  ? 859  SER A O     1 
ATOM   6403  C  CB    . SER A 1  859  ? 424.301 -19.904 615.647 1.00 74.77  ? 859  SER A CB    1 
ATOM   6404  O  OG    . SER A 1  859  ? 424.096 -18.855 614.716 1.00 73.57  ? 859  SER A OG    1 
ATOM   6405  N  N     . LEU A 1  860  ? 422.408 -21.246 613.272 1.00 45.40  ? 860  LEU A N     1 
ATOM   6406  C  CA    . LEU A 1  860  ? 421.064 -21.422 612.735 1.00 48.70  ? 860  LEU A CA    1 
ATOM   6407  C  C     . LEU A 1  860  ? 420.807 -22.878 612.355 1.00 48.23  ? 860  LEU A C     1 
ATOM   6408  O  O     . LEU A 1  860  ? 419.682 -23.254 612.025 1.00 48.28  ? 860  LEU A O     1 
ATOM   6409  C  CB    . LEU A 1  860  ? 420.848 -20.517 611.520 1.00 46.63  ? 860  LEU A CB    1 
ATOM   6410  C  CG    . LEU A 1  860  ? 420.959 -19.011 611.762 1.00 45.33  ? 860  LEU A CG    1 
ATOM   6411  C  CD1   . LEU A 1  860  ? 420.681 -18.243 610.479 1.00 47.10  ? 860  LEU A CD1   1 
ATOM   6412  C  CD2   . LEU A 1  860  ? 420.012 -18.576 612.869 1.00 46.58  ? 860  LEU A CD2   1 
ATOM   6413  N  N     . GLY A 1  861  ? 421.856 -23.692 612.405 1.00 52.91  ? 861  GLY A N     1 
ATOM   6414  C  CA    . GLY A 1  861  ? 421.752 -25.089 612.026 1.00 52.76  ? 861  GLY A CA    1 
ATOM   6415  C  C     . GLY A 1  861  ? 421.826 -25.274 610.523 1.00 52.90  ? 861  GLY A C     1 
ATOM   6416  O  O     . GLY A 1  861  ? 421.598 -26.371 610.012 1.00 55.25  ? 861  GLY A O     1 
ATOM   6417  N  N     . ASN A 1  862  ? 422.143 -24.194 609.816 1.00 55.80  ? 862  ASN A N     1 
ATOM   6418  C  CA    . ASN A 1  862  ? 422.261 -24.227 608.363 1.00 55.82  ? 862  ASN A CA    1 
ATOM   6419  C  C     . ASN A 1  862  ? 423.488 -25.007 607.911 1.00 52.94  ? 862  ASN A C     1 
ATOM   6420  O  O     . ASN A 1  862  ? 424.606 -24.719 608.333 1.00 52.77  ? 862  ASN A O     1 
ATOM   6421  C  CB    . ASN A 1  862  ? 422.313 -22.805 607.801 1.00 55.28  ? 862  ASN A CB    1 
ATOM   6422  C  CG    . ASN A 1  862  ? 421.021 -22.044 608.019 1.00 58.65  ? 862  ASN A CG    1 
ATOM   6423  O  OD1   . ASN A 1  862  ? 420.122 -22.511 608.719 1.00 61.79  ? 862  ASN A OD1   1 
ATOM   6424  N  ND2   . ASN A 1  862  ? 420.923 -20.861 607.422 1.00 58.77  ? 862  ASN A ND2   1 
ATOM   6425  N  N     . VAL A 1  863  ? 423.274 -25.993 607.047 1.00 41.79  ? 863  VAL A N     1 
ATOM   6426  C  CA    . VAL A 1  863  ? 424.367 -26.823 606.560 1.00 41.16  ? 863  VAL A CA    1 
ATOM   6427  C  C     . VAL A 1  863  ? 425.304 -26.038 605.649 1.00 40.31  ? 863  VAL A C     1 
ATOM   6428  O  O     . VAL A 1  863  ? 424.908 -25.578 604.577 1.00 40.66  ? 863  VAL A O     1 
ATOM   6429  C  CB    . VAL A 1  863  ? 423.844 -28.057 605.798 1.00 42.03  ? 863  VAL A CB    1 
ATOM   6430  C  CG1   . VAL A 1  863  ? 424.997 -28.826 605.171 1.00 41.42  ? 863  VAL A CG1   1 
ATOM   6431  C  CG2   . VAL A 1  863  ? 423.051 -28.955 606.730 1.00 42.92  ? 863  VAL A CG2   1 
ATOM   6432  N  N     . ILE A 1  864  ? 426.548 -25.878 606.090 1.00 34.94  ? 864  ILE A N     1 
ATOM   6433  C  CA    . ILE A 1  864  ? 427.581 -25.267 605.265 1.00 34.17  ? 864  ILE A CA    1 
ATOM   6434  C  C     . ILE A 1  864  ? 428.268 -26.360 604.460 1.00 34.11  ? 864  ILE A C     1 
ATOM   6435  O  O     . ILE A 1  864  ? 428.452 -26.240 603.249 1.00 34.19  ? 864  ILE A O     1 
ATOM   6436  C  CB    . ILE A 1  864  ? 428.619 -24.512 606.111 1.00 33.19  ? 864  ILE A CB    1 
ATOM   6437  C  CG1   . ILE A 1  864  ? 427.923 -23.624 607.145 1.00 33.34  ? 864  ILE A CG1   1 
ATOM   6438  C  CG2   . ILE A 1  864  ? 429.538 -23.694 605.218 1.00 32.59  ? 864  ILE A CG2   1 
ATOM   6439  C  CD1   . ILE A 1  864  ? 427.018 -22.574 606.545 1.00 33.85  ? 864  ILE A CD1   1 
ATOM   6440  N  N     . GLN A 1  865  ? 428.645 -27.427 605.157 1.00 41.23  ? 865  GLN A N     1 
ATOM   6441  C  CA    . GLN A 1  865  ? 429.176 -28.631 604.532 1.00 42.62  ? 865  GLN A CA    1 
ATOM   6442  C  C     . GLN A 1  865  ? 428.495 -29.845 605.152 1.00 43.63  ? 865  GLN A C     1 
ATOM   6443  O  O     . GLN A 1  865  ? 428.406 -29.953 606.375 1.00 45.03  ? 865  GLN A O     1 
ATOM   6444  C  CB    . GLN A 1  865  ? 430.693 -28.719 604.708 1.00 41.38  ? 865  GLN A CB    1 
ATOM   6445  C  CG    . GLN A 1  865  ? 431.469 -27.593 604.043 1.00 40.88  ? 865  GLN A CG    1 
ATOM   6446  C  CD    . GLN A 1  865  ? 432.954 -27.645 604.351 1.00 40.73  ? 865  GLN A CD    1 
ATOM   6447  O  OE1   . GLN A 1  865  ? 433.379 -28.293 605.307 1.00 38.89  ? 865  GLN A OE1   1 
ATOM   6448  N  NE2   . GLN A 1  865  ? 433.752 -26.963 603.538 1.00 41.60  ? 865  GLN A NE2   1 
ATOM   6449  N  N     . PHE A 1  866  ? 428.004 -30.751 604.313 1.00 38.74  ? 866  PHE A N     1 
ATOM   6450  C  CA    . PHE A 1  866  ? 427.307 -31.935 604.804 1.00 39.91  ? 866  PHE A CA    1 
ATOM   6451  C  C     . PHE A 1  866  ? 428.276 -32.880 605.503 1.00 39.23  ? 866  PHE A C     1 
ATOM   6452  O  O     . PHE A 1  866  ? 427.950 -33.470 606.533 1.00 39.32  ? 866  PHE A O     1 
ATOM   6453  C  CB    . PHE A 1  866  ? 426.586 -32.644 603.659 1.00 42.14  ? 866  PHE A CB    1 
ATOM   6454  C  CG    . PHE A 1  866  ? 425.451 -31.848 603.082 1.00 42.13  ? 866  PHE A CG    1 
ATOM   6455  C  CD1   . PHE A 1  866  ? 424.168 -31.982 603.586 1.00 41.61  ? 866  PHE A CD1   1 
ATOM   6456  C  CD2   . PHE A 1  866  ? 425.670 -30.955 602.047 1.00 42.32  ? 866  PHE A CD2   1 
ATOM   6457  C  CE1   . PHE A 1  866  ? 423.123 -31.246 603.062 1.00 42.56  ? 866  PHE A CE1   1 
ATOM   6458  C  CE2   . PHE A 1  866  ? 424.629 -30.216 601.519 1.00 43.63  ? 866  PHE A CE2   1 
ATOM   6459  C  CZ    . PHE A 1  866  ? 423.353 -30.362 602.027 1.00 45.31  ? 866  PHE A CZ    1 
ATOM   6460  N  N     . ILE A 1  867  ? 429.466 -33.022 604.931 1.00 43.78  ? 867  ILE A N     1 
ATOM   6461  C  CA    . ILE A 1  867  ? 430.564 -33.708 605.598 1.00 43.40  ? 867  ILE A CA    1 
ATOM   6462  C  C     . ILE A 1  867  ? 431.725 -32.727 605.692 1.00 42.30  ? 867  ILE A C     1 
ATOM   6463  O  O     . ILE A 1  867  ? 432.144 -32.164 604.682 1.00 41.93  ? 867  ILE A O     1 
ATOM   6464  C  CB    . ILE A 1  867  ? 431.006 -34.987 604.854 1.00 43.83  ? 867  ILE A CB    1 
ATOM   6465  C  CG1   . ILE A 1  867  ? 429.814 -35.921 604.616 1.00 48.72  ? 867  ILE A CG1   1 
ATOM   6466  C  CG2   . ILE A 1  867  ? 432.089 -35.710 605.635 1.00 43.59  ? 867  ILE A CG2   1 
ATOM   6467  C  CD1   . ILE A 1  867  ? 429.157 -35.771 603.249 1.00 48.14  ? 867  ILE A CD1   1 
ATOM   6468  N  N     . TYR A 1  868  ? 432.227 -32.508 606.904 1.00 40.71  ? 868  TYR A N     1 
ATOM   6469  C  CA    . TYR A 1  868  ? 433.255 -31.494 607.129 1.00 39.75  ? 868  TYR A CA    1 
ATOM   6470  C  C     . TYR A 1  868  ? 434.505 -31.717 606.285 1.00 39.33  ? 868  TYR A C     1 
ATOM   6471  O  O     . TYR A 1  868  ? 435.098 -32.794 606.304 1.00 39.56  ? 868  TYR A O     1 
ATOM   6472  C  CB    . TYR A 1  868  ? 433.651 -31.442 608.601 1.00 39.52  ? 868  TYR A CB    1 
ATOM   6473  C  CG    . TYR A 1  868  ? 434.996 -30.793 608.810 1.00 38.65  ? 868  TYR A CG    1 
ATOM   6474  C  CD1   . TYR A 1  868  ? 435.188 -29.449 608.526 1.00 38.03  ? 868  TYR A CD1   1 
ATOM   6475  C  CD2   . TYR A 1  868  ? 436.077 -31.527 609.273 1.00 39.22  ? 868  TYR A CD2   1 
ATOM   6476  C  CE1   . TYR A 1  868  ? 436.416 -28.857 608.698 1.00 37.33  ? 868  TYR A CE1   1 
ATOM   6477  C  CE2   . TYR A 1  868  ? 437.310 -30.939 609.456 1.00 37.87  ? 868  TYR A CE2   1 
ATOM   6478  C  CZ    . TYR A 1  868  ? 437.475 -29.604 609.168 1.00 37.25  ? 868  TYR A CZ    1 
ATOM   6479  O  OH    . TYR A 1  868  ? 438.705 -29.017 609.351 1.00 36.66  ? 868  TYR A OH    1 
ATOM   6480  N  N     . GLY A 1  869  ? 434.903 -30.684 605.550 1.00 38.23  ? 869  GLY A N     1 
ATOM   6481  C  CA    . GLY A 1  869  ? 436.055 -30.768 604.674 1.00 37.95  ? 869  GLY A CA    1 
ATOM   6482  C  C     . GLY A 1  869  ? 435.825 -31.760 603.552 1.00 38.40  ? 869  GLY A C     1 
ATOM   6483  O  O     . GLY A 1  869  ? 436.774 -32.237 602.934 1.00 38.70  ? 869  GLY A O     1 
ATOM   6484  N  N     . GLU A 1  870  ? 434.554 -32.078 603.316 1.00 43.98  ? 870  GLU A N     1 
ATOM   6485  C  CA    . GLU A 1  870  ? 434.126 -33.003 602.268 1.00 45.56  ? 870  GLU A CA    1 
ATOM   6486  C  C     . GLU A 1  870  ? 434.631 -34.436 602.463 1.00 45.47  ? 870  GLU A C     1 
ATOM   6487  O  O     . GLU A 1  870  ? 434.386 -35.296 601.620 1.00 47.00  ? 870  GLU A O     1 
ATOM   6488  C  CB    . GLU A 1  870  ? 434.560 -32.482 600.894 1.00 44.26  ? 870  GLU A CB    1 
ATOM   6489  C  CG    . GLU A 1  870  ? 434.072 -31.075 600.592 1.00 44.54  ? 870  GLU A CG    1 
ATOM   6490  C  CD    . GLU A 1  870  ? 434.504 -30.588 599.225 1.00 46.42  ? 870  GLU A CD    1 
ATOM   6491  O  OE1   . GLU A 1  870  ? 435.175 -31.354 598.503 1.00 47.08  ? 870  GLU A OE1   1 
ATOM   6492  O  OE2   . GLU A 1  870  ? 434.174 -29.437 598.869 1.00 47.96  ? 870  GLU A OE2   1 
ATOM   6493  N  N     . ASP A 1  871  ? 435.315 -34.699 603.574 1.00 40.25  ? 871  ASP A N     1 
ATOM   6494  C  CA    . ASP A 1  871  ? 435.831 -36.040 603.842 1.00 40.70  ? 871  ASP A CA    1 
ATOM   6495  C  C     . ASP A 1  871  ? 435.727 -36.426 605.318 1.00 40.84  ? 871  ASP A C     1 
ATOM   6496  O  O     . ASP A 1  871  ? 435.934 -37.584 605.679 1.00 41.41  ? 871  ASP A O     1 
ATOM   6497  C  CB    . ASP A 1  871  ? 437.284 -36.157 603.375 1.00 40.32  ? 871  ASP A CB    1 
ATOM   6498  C  CG    . ASP A 1  871  ? 438.238 -35.341 604.223 1.00 39.52  ? 871  ASP A CG    1 
ATOM   6499  O  OD1   . ASP A 1  871  ? 437.803 -34.331 604.816 1.00 39.51  ? 871  ASP A OD1   1 
ATOM   6500  O  OD2   . ASP A 1  871  ? 439.431 -35.708 604.293 1.00 39.39  ? 871  ASP A OD2   1 
ATOM   6501  N  N     . GLY A 1  872  ? 435.415 -35.451 606.165 1.00 35.45  ? 872  GLY A N     1 
ATOM   6502  C  CA    . GLY A 1  872  ? 435.203 -35.708 607.579 1.00 35.66  ? 872  GLY A CA    1 
ATOM   6503  C  C     . GLY A 1  872  ? 436.472 -35.972 608.365 1.00 35.35  ? 872  GLY A C     1 
ATOM   6504  O  O     . GLY A 1  872  ? 436.427 -36.566 609.441 1.00 35.79  ? 872  GLY A O     1 
ATOM   6505  N  N     . MET A 1  873  ? 437.605 -35.525 607.834 1.00 32.78  ? 873  MET A N     1 
ATOM   6506  C  CA    . MET A 1  873  ? 438.891 -35.728 608.491 1.00 32.54  ? 873  MET A CA    1 
ATOM   6507  C  C     . MET A 1  873  ? 439.398 -34.453 609.156 1.00 31.73  ? 873  MET A C     1 
ATOM   6508  O  O     . MET A 1  873  ? 439.126 -33.349 608.687 1.00 31.21  ? 873  MET A O     1 
ATOM   6509  C  CB    . MET A 1  873  ? 439.928 -36.230 607.485 1.00 32.54  ? 873  MET A CB    1 
ATOM   6510  C  CG    . MET A 1  873  ? 439.662 -37.630 606.974 1.00 33.42  ? 873  MET A CG    1 
ATOM   6511  S  SD    . MET A 1  873  ? 439.850 -38.851 608.282 1.00 34.20  ? 873  MET A SD    1 
ATOM   6512  C  CE    . MET A 1  873  ? 438.369 -39.825 608.041 1.00 35.21  ? 873  MET A CE    1 
ATOM   6513  N  N     . ASP A 1  874  ? 440.136 -34.613 610.250 1.00 47.79  ? 874  ASP A N     1 
ATOM   6514  C  CA    . ASP A 1  874  ? 440.806 -33.488 610.890 1.00 46.67  ? 874  ASP A CA    1 
ATOM   6515  C  C     . ASP A 1  874  ? 442.103 -33.189 610.149 1.00 46.27  ? 874  ASP A C     1 
ATOM   6516  O  O     . ASP A 1  874  ? 442.881 -34.098 609.861 1.00 45.38  ? 874  ASP A O     1 
ATOM   6517  C  CB    . ASP A 1  874  ? 441.085 -33.780 612.366 1.00 46.70  ? 874  ASP A CB    1 
ATOM   6518  C  CG    . ASP A 1  874  ? 441.794 -32.632 613.064 1.00 47.85  ? 874  ASP A CG    1 
ATOM   6519  O  OD1   . ASP A 1  874  ? 442.618 -32.898 613.964 1.00 48.78  ? 874  ASP A OD1   1 
ATOM   6520  O  OD2   . ASP A 1  874  ? 441.527 -31.463 612.717 1.00 47.93  ? 874  ASP A OD2   1 
ATOM   6521  N  N     . ALA A 1  875  ? 442.330 -31.914 609.847 1.00 39.83  ? 875  ALA A N     1 
ATOM   6522  C  CA    . ALA A 1  875  ? 443.475 -31.501 609.042 1.00 38.05  ? 875  ALA A CA    1 
ATOM   6523  C  C     . ALA A 1  875  ? 444.812 -31.880 609.676 1.00 37.71  ? 875  ALA A C     1 
ATOM   6524  O  O     . ALA A 1  875  ? 445.804 -32.068 608.975 1.00 38.04  ? 875  ALA A O     1 
ATOM   6525  C  CB    . ALA A 1  875  ? 443.424 -30.007 608.794 1.00 38.53  ? 875  ALA A CB    1 
ATOM   6526  N  N     . ALA A 1  876  ? 444.832 -31.999 610.999 1.00 32.94  ? 876  ALA A N     1 
ATOM   6527  C  CA    . ALA A 1  876  ? 446.059 -32.323 611.717 1.00 33.13  ? 876  ALA A CA    1 
ATOM   6528  C  C     . ALA A 1  876  ? 446.583 -33.711 611.353 1.00 34.35  ? 876  ALA A C     1 
ATOM   6529  O  O     . ALA A 1  876  ? 447.792 -33.924 611.271 1.00 33.97  ? 876  ALA A O     1 
ATOM   6530  C  CB    . ALA A 1  876  ? 445.832 -32.223 613.216 1.00 33.27  ? 876  ALA A CB    1 
ATOM   6531  N  N     . HIS A 1  877  ? 445.669 -34.650 611.129 1.00 41.49  ? 877  HIS A N     1 
ATOM   6532  C  CA    . HIS A 1  877  ? 446.048 -36.030 610.844 1.00 43.41  ? 877  HIS A CA    1 
ATOM   6533  C  C     . HIS A 1  877  ? 446.053 -36.326 609.348 1.00 43.07  ? 877  HIS A C     1 
ATOM   6534  O  O     . HIS A 1  877  ? 445.615 -37.393 608.917 1.00 44.54  ? 877  HIS A O     1 
ATOM   6535  C  CB    . HIS A 1  877  ? 445.104 -36.995 611.561 1.00 44.39  ? 877  HIS A CB    1 
ATOM   6536  C  CG    . HIS A 1  877  ? 445.071 -36.816 613.046 1.00 44.18  ? 877  HIS A CG    1 
ATOM   6537  N  ND1   . HIS A 1  877  ? 445.820 -37.590 613.906 1.00 46.44  ? 877  HIS A ND1   1 
ATOM   6538  C  CD2   . HIS A 1  877  ? 444.381 -35.949 613.824 1.00 43.92  ? 877  HIS A CD2   1 
ATOM   6539  C  CE1   . HIS A 1  877  ? 445.592 -37.208 615.150 1.00 47.21  ? 877  HIS A CE1   1 
ATOM   6540  N  NE2   . HIS A 1  877  ? 444.723 -36.215 615.128 1.00 47.31  ? 877  HIS A NE2   1 
ATOM   6541  N  N     . ILE A 1  878  ? 446.556 -35.382 608.560 1.00 41.01  ? 878  ILE A N     1 
ATOM   6542  C  CA    . ILE A 1  878  ? 446.570 -35.526 607.109 1.00 40.24  ? 878  ILE A CA    1 
ATOM   6543  C  C     . ILE A 1  878  ? 447.958 -35.251 606.536 1.00 40.55  ? 878  ILE A C     1 
ATOM   6544  O  O     . ILE A 1  878  ? 448.574 -34.232 606.846 1.00 40.63  ? 878  ILE A O     1 
ATOM   6545  C  CB    . ILE A 1  878  ? 445.541 -34.586 606.451 1.00 39.32  ? 878  ILE A CB    1 
ATOM   6546  C  CG1   . ILE A 1  878  ? 444.121 -35.022 606.815 1.00 41.26  ? 878  ILE A CG1   1 
ATOM   6547  C  CG2   . ILE A 1  878  ? 445.705 -34.581 604.950 1.00 41.99  ? 878  ILE A CG2   1 
ATOM   6548  C  CD1   . ILE A 1  878  ? 443.042 -34.223 606.129 1.00 41.24  ? 878  ILE A CD1   1 
ATOM   6549  N  N     . GLU A 1  879  ? 448.450 -36.168 605.706 1.00 32.54  ? 879  GLU A N     1 
ATOM   6550  C  CA    . GLU A 1  879  ? 449.788 -36.046 605.134 1.00 32.68  ? 879  GLU A CA    1 
ATOM   6551  C  C     . GLU A 1  879  ? 449.787 -36.253 603.623 1.00 32.96  ? 879  GLU A C     1 
ATOM   6552  O  O     . GLU A 1  879  ? 449.035 -37.072 603.101 1.00 33.38  ? 879  GLU A O     1 
ATOM   6553  C  CB    . GLU A 1  879  ? 450.740 -37.050 605.786 1.00 33.35  ? 879  GLU A CB    1 
ATOM   6554  C  CG    . GLU A 1  879  ? 450.796 -36.966 607.296 1.00 33.26  ? 879  GLU A CG    1 
ATOM   6555  C  CD    . GLU A 1  879  ? 451.704 -38.014 607.893 1.00 34.08  ? 879  GLU A CD    1 
ATOM   6556  O  OE1   . GLU A 1  879  ? 451.552 -38.322 609.095 1.00 34.30  ? 879  GLU A OE1   1 
ATOM   6557  O  OE2   . GLU A 1  879  ? 452.573 -38.531 607.159 1.00 34.60  ? 879  GLU A OE2   1 
ATOM   6558  N  N     . LYS A 1  880  ? 450.647 -35.516 602.927 1.00 42.58  ? 880  LYS A N     1 
ATOM   6559  C  CA    . LYS A 1  880  ? 450.741 -35.612 601.475 1.00 42.51  ? 880  LYS A CA    1 
ATOM   6560  C  C     . LYS A 1  880  ? 451.284 -36.971 601.039 1.00 43.41  ? 880  LYS A C     1 
ATOM   6561  O  O     . LYS A 1  880  ? 452.456 -37.279 601.252 1.00 43.80  ? 880  LYS A O     1 
ATOM   6562  C  CB    . LYS A 1  880  ? 451.623 -34.487 600.929 1.00 43.95  ? 880  LYS A CB    1 
ATOM   6563  C  CG    . LYS A 1  880  ? 451.694 -34.418 599.412 1.00 44.47  ? 880  LYS A CG    1 
ATOM   6564  C  CD    . LYS A 1  880  ? 452.360 -33.128 598.955 1.00 45.67  ? 880  LYS A CD    1 
ATOM   6565  C  CE    . LYS A 1  880  ? 451.587 -31.912 599.449 1.00 47.03  ? 880  LYS A CE    1 
ATOM   6566  N  NZ    . LYS A 1  880  ? 452.227 -30.625 599.054 1.00 44.87  ? 880  LYS A NZ    1 
ATOM   6567  N  N     . GLN A 1  881  ? 450.419 -37.781 600.433 1.00 35.83  ? 881  GLN A N     1 
ATOM   6568  C  CA    . GLN A 1  881  ? 450.801 -39.105 599.948 1.00 36.76  ? 881  GLN A CA    1 
ATOM   6569  C  C     . GLN A 1  881  ? 450.579 -39.220 598.446 1.00 37.17  ? 881  GLN A C     1 
ATOM   6570  O  O     . GLN A 1  881  ? 449.623 -38.666 597.910 1.00 36.85  ? 881  GLN A O     1 
ATOM   6571  C  CB    . GLN A 1  881  ? 450.009 -40.196 600.672 1.00 37.11  ? 881  GLN A CB    1 
ATOM   6572  C  CG    . GLN A 1  881  ? 450.118 -40.151 602.183 1.00 36.84  ? 881  GLN A CG    1 
ATOM   6573  C  CD    . GLN A 1  881  ? 449.344 -41.269 602.851 1.00 37.37  ? 881  GLN A CD    1 
ATOM   6574  O  OE1   . GLN A 1  881  ? 449.742 -42.433 602.800 1.00 38.23  ? 881  GLN A OE1   1 
ATOM   6575  N  NE2   . GLN A 1  881  ? 448.226 -40.920 603.478 1.00 36.94  ? 881  GLN A NE2   1 
ATOM   6576  N  N     . SER A 1  882  ? 451.460 -39.949 597.769 1.00 37.44  ? 882  SER A N     1 
ATOM   6577  C  CA    . SER A 1  882  ? 451.360 -40.104 596.323 1.00 37.98  ? 882  SER A CA    1 
ATOM   6578  C  C     . SER A 1  882  ? 450.363 -41.192 595.939 1.00 38.53  ? 882  SER A C     1 
ATOM   6579  O  O     . SER A 1  882  ? 450.298 -42.243 596.577 1.00 38.95  ? 882  SER A O     1 
ATOM   6580  C  CB    . SER A 1  882  ? 452.731 -40.420 595.720 1.00 38.71  ? 882  SER A CB    1 
ATOM   6581  O  OG    . SER A 1  882  ? 453.183 -41.701 596.124 1.00 39.45  ? 882  SER A OG    1 
ATOM   6582  N  N     . LEU A 1  883  ? 449.585 -40.925 594.895 1.00 38.39  ? 883  LEU A N     1 
ATOM   6583  C  CA    . LEU A 1  883  ? 448.670 -41.911 594.331 1.00 39.05  ? 883  LEU A CA    1 
ATOM   6584  C  C     . LEU A 1  883  ? 449.287 -42.511 593.072 1.00 40.00  ? 883  LEU A C     1 
ATOM   6585  O  O     . LEU A 1  883  ? 448.967 -42.100 591.957 1.00 40.21  ? 883  LEU A O     1 
ATOM   6586  C  CB    . LEU A 1  883  ? 447.318 -41.273 594.015 1.00 38.66  ? 883  LEU A CB    1 
ATOM   6587  C  CG    . LEU A 1  883  ? 446.616 -40.572 595.178 1.00 37.76  ? 883  LEU A CG    1 
ATOM   6588  C  CD1   . LEU A 1  883  ? 445.446 -39.749 594.673 1.00 37.47  ? 883  LEU A CD1   1 
ATOM   6589  C  CD2   . LEU A 1  883  ? 446.152 -41.588 596.208 1.00 37.99  ? 883  LEU A CD2   1 
ATOM   6590  N  N     . ASP A 1  884  ? 450.167 -43.489 593.256 1.00 88.78  ? 884  ASP A N     1 
ATOM   6591  C  CA    . ASP A 1  884  ? 450.996 -44.003 592.168 1.00 90.88  ? 884  ASP A CA    1 
ATOM   6592  C  C     . ASP A 1  884  ? 450.247 -44.852 591.139 1.00 93.16  ? 884  ASP A C     1 
ATOM   6593  O  O     . ASP A 1  884  ? 450.863 -45.630 590.410 1.00 92.94  ? 884  ASP A O     1 
ATOM   6594  C  CB    . ASP A 1  884  ? 452.157 -44.810 592.750 1.00 90.48  ? 884  ASP A CB    1 
ATOM   6595  C  CG    . ASP A 1  884  ? 451.791 -45.499 594.048 1.00 93.07  ? 884  ASP A CG    1 
ATOM   6596  O  OD1   . ASP A 1  884  ? 450.603 -45.841 594.228 1.00 93.30  ? 884  ASP A OD1   1 
ATOM   6597  O  OD2   . ASP A 1  884  ? 452.691 -45.692 594.892 1.00 94.17  ? 884  ASP A OD2   1 
ATOM   6598  N  N     . THR A 1  885  ? 448.928 -44.703 591.076 1.00 71.91  ? 885  THR A N     1 
ATOM   6599  C  CA    . THR A 1  885  ? 448.144 -45.339 590.023 1.00 69.33  ? 885  THR A CA    1 
ATOM   6600  C  C     . THR A 1  885  ? 447.720 -44.309 588.982 1.00 69.20  ? 885  THR A C     1 
ATOM   6601  O  O     . THR A 1  885  ? 447.380 -44.660 587.854 1.00 72.35  ? 885  THR A O     1 
ATOM   6602  C  CB    . THR A 1  885  ? 446.892 -46.044 590.578 1.00 67.70  ? 885  THR A CB    1 
ATOM   6603  O  OG1   . THR A 1  885  ? 446.231 -45.187 591.515 1.00 67.72  ? 885  THR A OG1   1 
ATOM   6604  C  CG2   . THR A 1  885  ? 447.275 -47.340 591.268 1.00 70.28  ? 885  THR A CG2   1 
ATOM   6605  N  N     . ILE A 1  886  ? 447.754 -43.036 589.365 1.00 47.12  ? 886  ILE A N     1 
ATOM   6606  C  CA    . ILE A 1  886  ? 447.339 -41.959 588.474 1.00 46.98  ? 886  ILE A CA    1 
ATOM   6607  C  C     . ILE A 1  886  ? 448.436 -41.633 587.461 1.00 47.54  ? 886  ILE A C     1 
ATOM   6608  O  O     . ILE A 1  886  ? 448.174 -41.020 586.425 1.00 47.86  ? 886  ILE A O     1 
ATOM   6609  C  CB    . ILE A 1  886  ? 446.967 -40.683 589.266 1.00 45.83  ? 886  ILE A CB    1 
ATOM   6610  C  CG1   . ILE A 1  886  ? 446.037 -39.786 588.448 1.00 45.81  ? 886  ILE A CG1   1 
ATOM   6611  C  CG2   . ILE A 1  886  ? 448.213 -39.924 589.689 1.00 45.34  ? 886  ILE A CG2   1 
ATOM   6612  C  CD1   . ILE A 1  886  ? 445.686 -38.486 589.140 1.00 44.79  ? 886  ILE A CD1   1 
ATOM   6613  N  N     . GLY A 1  887  ? 449.660 -42.058 587.756 1.00 57.11  ? 887  GLY A N     1 
ATOM   6614  C  CA    . GLY A 1  887  ? 450.788 -41.786 586.884 1.00 56.93  ? 887  GLY A CA    1 
ATOM   6615  C  C     . GLY A 1  887  ? 451.347 -43.038 586.236 1.00 59.81  ? 887  GLY A C     1 
ATOM   6616  O  O     . GLY A 1  887  ? 450.825 -44.136 586.431 1.00 60.35  ? 887  GLY A O     1 
ATOM   6617  N  N     . GLY A 1  888  ? 452.411 -42.870 585.458 1.00 50.31  ? 888  GLY A N     1 
ATOM   6618  C  CA    . GLY A 1  888  ? 453.057 -43.988 584.795 1.00 50.64  ? 888  GLY A CA    1 
ATOM   6619  C  C     . GLY A 1  888  ? 452.292 -44.486 583.583 1.00 53.48  ? 888  GLY A C     1 
ATOM   6620  O  O     . GLY A 1  888  ? 451.084 -44.278 583.466 1.00 53.43  ? 888  GLY A O     1 
ATOM   6621  N  N     . SER A 1  889  ? 453.003 -45.149 582.677 1.00 62.70  ? 889  SER A N     1 
ATOM   6622  C  CA    . SER A 1  889  ? 452.391 -45.704 581.477 1.00 65.13  ? 889  SER A CA    1 
ATOM   6623  C  C     . SER A 1  889  ? 451.436 -46.838 581.826 1.00 64.22  ? 889  SER A C     1 
ATOM   6624  O  O     . SER A 1  889  ? 451.482 -47.379 582.930 1.00 63.79  ? 889  SER A O     1 
ATOM   6625  C  CB    . SER A 1  889  ? 453.464 -46.207 580.510 1.00 69.06  ? 889  SER A CB    1 
ATOM   6626  O  OG    . SER A 1  889  ? 454.206 -47.269 581.084 1.00 66.19  ? 889  SER A OG    1 
ATOM   6627  N  N     . ASP A 1  890  ? 450.573 -47.194 580.881 1.00 85.40  ? 890  ASP A N     1 
ATOM   6628  C  CA    . ASP A 1  890  ? 449.672 -48.325 581.066 1.00 86.77  ? 890  ASP A CA    1 
ATOM   6629  C  C     . ASP A 1  890  ? 450.479 -49.614 581.162 1.00 85.17  ? 890  ASP A C     1 
ATOM   6630  O  O     . ASP A 1  890  ? 450.091 -50.557 581.853 1.00 85.22  ? 890  ASP A O     1 
ATOM   6631  C  CB    . ASP A 1  890  ? 448.659 -48.411 579.921 1.00 87.65  ? 890  ASP A CB    1 
ATOM   6632  C  CG    . ASP A 1  890  ? 447.763 -47.189 579.839 1.00 86.71  ? 890  ASP A CG    1 
ATOM   6633  O  OD1   . ASP A 1  890  ? 446.797 -47.103 580.627 1.00 85.16  ? 890  ASP A OD1   1 
ATOM   6634  O  OD2   . ASP A 1  890  ? 448.019 -46.318 578.983 1.00 86.69  ? 890  ASP A OD2   1 
ATOM   6635  N  N     . ALA A 1  891  ? 451.610 -49.639 580.464 1.00 49.43  ? 891  ALA A N     1 
ATOM   6636  C  CA    . ALA A 1  891  ? 452.507 -50.787 580.487 1.00 50.46  ? 891  ALA A CA    1 
ATOM   6637  C  C     . ALA A 1  891  ? 453.090 -50.999 581.881 1.00 49.76  ? 891  ALA A C     1 
ATOM   6638  O  O     . ALA A 1  891  ? 453.137 -52.123 582.379 1.00 50.27  ? 891  ALA A O     1 
ATOM   6639  C  CB    . ALA A 1  891  ? 453.622 -50.609 579.467 1.00 51.50  ? 891  ALA A CB    1 
ATOM   6640  N  N     . ALA A 1  892  ? 453.534 -49.911 582.503 1.00 75.61  ? 892  ALA A N     1 
ATOM   6641  C  CA    . ALA A 1  892  ? 454.096 -49.973 583.847 1.00 74.67  ? 892  ALA A CA    1 
ATOM   6642  C  C     . ALA A 1  892  ? 453.012 -50.298 584.868 1.00 73.30  ? 892  ALA A C     1 
ATOM   6643  O  O     . ALA A 1  892  ? 453.244 -51.049 585.816 1.00 73.09  ? 892  ALA A O     1 
ATOM   6644  C  CB    . ALA A 1  892  ? 454.782 -48.663 584.195 1.00 73.81  ? 892  ALA A CB    1 
ATOM   6645  N  N     . PHE A 1  893  ? 451.829 -49.725 584.662 1.00 50.04  ? 893  PHE A N     1 
ATOM   6646  C  CA    . PHE A 1  893  ? 450.672 -49.981 585.514 1.00 49.19  ? 893  PHE A CA    1 
ATOM   6647  C  C     . PHE A 1  893  ? 450.339 -51.468 585.528 1.00 50.79  ? 893  PHE A C     1 
ATOM   6648  O  O     . PHE A 1  893  ? 450.145 -52.067 586.589 1.00 50.07  ? 893  PHE A O     1 
ATOM   6649  C  CB    . PHE A 1  893  ? 449.470 -49.165 585.030 1.00 48.65  ? 893  PHE A CB    1 
ATOM   6650  C  CG    . PHE A 1  893  ? 448.220 -49.376 585.837 1.00 48.12  ? 893  PHE A CG    1 
ATOM   6651  C  CD1   . PHE A 1  893  ? 447.977 -48.623 586.972 1.00 46.89  ? 893  PHE A CD1   1 
ATOM   6652  C  CD2   . PHE A 1  893  ? 447.277 -50.317 585.450 1.00 48.93  ? 893  PHE A CD2   1 
ATOM   6653  C  CE1   . PHE A 1  893  ? 446.824 -48.810 587.712 1.00 46.51  ? 893  PHE A CE1   1 
ATOM   6654  C  CE2   . PHE A 1  893  ? 446.123 -50.511 586.186 1.00 48.57  ? 893  PHE A CE2   1 
ATOM   6655  C  CZ    . PHE A 1  893  ? 445.896 -49.756 587.318 1.00 47.37  ? 893  PHE A CZ    1 
ATOM   6656  N  N     . GLU A 1  894  ? 450.280 -52.056 584.337 1.00 54.06  ? 894  GLU A N     1 
ATOM   6657  C  CA    . GLU A 1  894  ? 450.025 -53.483 584.193 1.00 55.25  ? 894  GLU A CA    1 
ATOM   6658  C  C     . GLU A 1  894  ? 451.152 -54.299 584.821 1.00 55.81  ? 894  GLU A C     1 
ATOM   6659  O  O     . GLU A 1  894  ? 450.905 -55.242 585.567 1.00 56.16  ? 894  GLU A O     1 
ATOM   6660  C  CB    . GLU A 1  894  ? 449.859 -53.849 582.716 1.00 56.45  ? 894  GLU A CB    1 
ATOM   6661  C  CG    . GLU A 1  894  ? 449.630 -55.329 582.456 1.00 57.81  ? 894  GLU A CG    1 
ATOM   6662  C  CD    . GLU A 1  894  ? 449.431 -55.640 580.984 1.00 59.02  ? 894  GLU A CD    1 
ATOM   6663  O  OE1   . GLU A 1  894  ? 449.255 -54.688 580.193 1.00 58.76  ? 894  GLU A OE1   1 
ATOM   6664  O  OE2   . GLU A 1  894  ? 449.451 -56.835 580.618 1.00 63.81  ? 894  GLU A OE2   1 
ATOM   6665  N  N     . LYS A 1  895  ? 452.390 -53.915 584.528 1.00 57.64  ? 895  LYS A N     1 
ATOM   6666  C  CA    . LYS A 1  895  ? 453.563 -54.618 585.041 1.00 58.30  ? 895  LYS A CA    1 
ATOM   6667  C  C     . LYS A 1  895  ? 453.619 -54.584 586.569 1.00 57.45  ? 895  LYS A C     1 
ATOM   6668  O  O     . LYS A 1  895  ? 454.250 -55.435 587.196 1.00 58.12  ? 895  LYS A O     1 
ATOM   6669  C  CB    . LYS A 1  895  ? 454.841 -54.012 584.450 1.00 58.59  ? 895  LYS A CB    1 
ATOM   6670  C  CG    . LYS A 1  895  ? 456.129 -54.736 584.823 1.00 59.51  ? 895  LYS A CG    1 
ATOM   6671  C  CD    . LYS A 1  895  ? 456.107 -56.191 584.375 1.00 62.08  ? 895  LYS A CD    1 
ATOM   6672  C  CE    . LYS A 1  895  ? 456.030 -56.311 582.859 1.00 62.33  ? 895  LYS A CE    1 
ATOM   6673  N  NZ    . LYS A 1  895  ? 455.972 -57.733 582.414 1.00 63.60  ? 895  LYS A NZ    1 
ATOM   6674  N  N     . ARG A 1  896  ? 452.936 -53.611 587.163 1.00 82.46  ? 896  ARG A N     1 
ATOM   6675  C  CA    . ARG A 1  896  ? 453.007 -53.406 588.604 1.00 80.89  ? 896  ARG A CA    1 
ATOM   6676  C  C     . ARG A 1  896  ? 451.749 -53.867 589.345 1.00 78.11  ? 896  ARG A C     1 
ATOM   6677  O  O     . ARG A 1  896  ? 451.767 -54.005 590.567 1.00 78.98  ? 896  ARG A O     1 
ATOM   6678  C  CB    . ARG A 1  896  ? 453.268 -51.928 588.902 1.00 80.80  ? 896  ARG A CB    1 
ATOM   6679  C  CG    . ARG A 1  896  ? 453.934 -51.656 590.240 1.00 81.36  ? 896  ARG A CG    1 
ATOM   6680  C  CD    . ARG A 1  896  ? 453.045 -50.809 591.132 1.00 77.80  ? 896  ARG A CD    1 
ATOM   6681  N  NE    . ARG A 1  896  ? 453.818 -50.060 592.117 1.00 78.48  ? 896  ARG A NE    1 
ATOM   6682  C  CZ    . ARG A 1  896  ? 454.276 -48.827 591.922 1.00 77.60  ? 896  ARG A CZ    1 
ATOM   6683  N  NH1   . ARG A 1  896  ? 454.036 -48.204 590.776 1.00 74.63  ? 896  ARG A NH1   1 
ATOM   6684  N  NH2   . ARG A 1  896  ? 454.971 -48.218 592.872 1.00 78.29  ? 896  ARG A NH2   1 
ATOM   6685  N  N     . TYR A 1  897  ? 450.661 -54.111 588.618 1.00 59.93  ? 897  TYR A N     1 
ATOM   6686  C  CA    . TYR A 1  897  ? 449.403 -54.464 589.278 1.00 61.03  ? 897  TYR A CA    1 
ATOM   6687  C  C     . TYR A 1  897  ? 448.703 -55.710 588.728 1.00 65.87  ? 897  TYR A C     1 
ATOM   6688  O  O     . TYR A 1  897  ? 447.849 -56.288 589.401 1.00 63.46  ? 897  TYR A O     1 
ATOM   6689  C  CB    . TYR A 1  897  ? 448.435 -53.280 589.213 1.00 58.06  ? 897  TYR A CB    1 
ATOM   6690  C  CG    . TYR A 1  897  ? 448.859 -52.094 590.048 1.00 56.52  ? 897  TYR A CG    1 
ATOM   6691  C  CD1   . TYR A 1  897  ? 448.708 -52.104 591.427 1.00 55.96  ? 897  TYR A CD1   1 
ATOM   6692  C  CD2   . TYR A 1  897  ? 449.403 -50.962 589.457 1.00 58.27  ? 897  TYR A CD2   1 
ATOM   6693  C  CE1   . TYR A 1  897  ? 449.092 -51.023 592.197 1.00 55.61  ? 897  TYR A CE1   1 
ATOM   6694  C  CE2   . TYR A 1  897  ? 449.789 -49.874 590.217 1.00 57.01  ? 897  TYR A CE2   1 
ATOM   6695  C  CZ    . TYR A 1  897  ? 449.632 -49.911 591.587 1.00 54.82  ? 897  TYR A CZ    1 
ATOM   6696  O  OH    . TYR A 1  897  ? 450.016 -48.832 592.349 1.00 55.47  ? 897  TYR A OH    1 
ATOM   6697  N  N     . ARG A 1  898  ? 449.053 -56.125 587.515 1.00 60.04  ? 898  ARG A N     1 
ATOM   6698  C  CA    . ARG A 1  898  ? 448.360 -57.242 586.877 1.00 61.18  ? 898  ARG A CA    1 
ATOM   6699  C  C     . ARG A 1  898  ? 448.817 -58.599 587.401 1.00 62.34  ? 898  ARG A C     1 
ATOM   6700  O  O     . ARG A 1  898  ? 449.998 -58.939 587.337 1.00 62.92  ? 898  ARG A O     1 
ATOM   6701  C  CB    . ARG A 1  898  ? 448.544 -57.191 585.359 1.00 61.91  ? 898  ARG A CB    1 
ATOM   6702  C  CG    . ARG A 1  898  ? 447.945 -58.370 584.612 1.00 65.94  ? 898  ARG A CG    1 
ATOM   6703  C  CD    . ARG A 1  898  ? 446.454 -58.498 584.876 1.00 64.17  ? 898  ARG A CD    1 
ATOM   6704  N  NE    . ARG A 1  898  ? 445.851 -59.562 584.078 1.00 65.82  ? 898  ARG A NE    1 
ATOM   6705  C  CZ    . ARG A 1  898  ? 444.582 -59.944 584.179 1.00 66.96  ? 898  ARG A CZ    1 
ATOM   6706  N  NH1   . ARG A 1  898  ? 443.778 -59.350 585.049 1.00 63.91  ? 898  ARG A NH1   1 
ATOM   6707  N  NH2   . ARG A 1  898  ? 444.119 -60.921 583.411 1.00 70.05  ? 898  ARG A NH2   1 
ATOM   6708  N  N     . VAL A 1  899  ? 447.864 -59.368 587.920 1.00 75.03  ? 899  VAL A N     1 
ATOM   6709  C  CA    . VAL A 1  899  ? 448.112 -60.747 588.319 1.00 77.37  ? 899  VAL A CA    1 
ATOM   6710  C  C     . VAL A 1  899  ? 447.322 -61.685 587.417 1.00 81.42  ? 899  VAL A C     1 
ATOM   6711  O  O     . VAL A 1  899  ? 446.093 -61.630 587.382 1.00 80.59  ? 899  VAL A O     1 
ATOM   6712  C  CB    . VAL A 1  899  ? 447.718 -61.010 589.783 1.00 74.89  ? 899  VAL A CB    1 
ATOM   6713  C  CG1   . VAL A 1  899  ? 448.362 -62.293 590.274 1.00 77.41  ? 899  VAL A CG1   1 
ATOM   6714  C  CG2   . VAL A 1  899  ? 448.123 -59.845 590.661 1.00 76.79  ? 899  VAL A CG2   1 
ATOM   6715  N  N     . ASP A 1  900  ? 448.028 -62.541 586.686 1.00 67.09  ? 900  ASP A N     1 
ATOM   6716  C  CA    . ASP A 1  900  ? 447.382 -63.461 585.758 1.00 67.35  ? 900  ASP A CA    1 
ATOM   6717  C  C     . ASP A 1  900  ? 447.758 -64.903 586.077 1.00 67.36  ? 900  ASP A C     1 
ATOM   6718  O  O     . ASP A 1  900  ? 448.779 -65.403 585.609 1.00 70.46  ? 900  ASP A O     1 
ATOM   6719  C  CB    . ASP A 1  900  ? 447.763 -63.119 584.314 1.00 68.63  ? 900  ASP A CB    1 
ATOM   6720  C  CG    . ASP A 1  900  ? 446.786 -63.684 583.299 1.00 68.45  ? 900  ASP A CG    1 
ATOM   6721  O  OD1   . ASP A 1  900  ? 446.012 -64.598 583.652 1.00 69.17  ? 900  ASP A OD1   1 
ATOM   6722  O  OD2   . ASP A 1  900  ? 446.794 -63.213 582.141 1.00 66.15  ? 900  ASP A OD2   1 
ATOM   6723  N  N     . LEU A 1  901  ? 446.928 -65.569 586.874 1.00 58.51  ? 901  LEU A N     1 
ATOM   6724  C  CA    . LEU A 1  901  ? 447.175 -66.956 587.253 1.00 60.09  ? 901  LEU A CA    1 
ATOM   6725  C  C     . LEU A 1  901  ? 446.986 -67.897 586.069 1.00 61.69  ? 901  LEU A C     1 
ATOM   6726  O  O     . LEU A 1  901  ? 447.430 -69.044 586.097 1.00 63.19  ? 901  LEU A O     1 
ATOM   6727  C  CB    . LEU A 1  901  ? 446.254 -67.374 588.400 1.00 60.17  ? 901  LEU A CB    1 
ATOM   6728  C  CG    . LEU A 1  901  ? 446.345 -66.539 589.676 1.00 58.74  ? 901  LEU A CG    1 
ATOM   6729  C  CD1   . LEU A 1  901  ? 445.491 -67.142 590.781 1.00 59.20  ? 901  LEU A CD1   1 
ATOM   6730  C  CD2   . LEU A 1  901  ? 447.792 -66.400 590.121 1.00 58.56  ? 901  LEU A CD2   1 
ATOM   6731  N  N     . LEU A 1  902  ? 446.317 -67.405 585.032 1.00 64.80  ? 902  LEU A N     1 
ATOM   6732  C  CA    . LEU A 1  902  ? 446.070 -68.195 583.835 1.00 66.29  ? 902  LEU A CA    1 
ATOM   6733  C  C     . LEU A 1  902  ? 447.244 -68.098 582.870 1.00 66.72  ? 902  LEU A C     1 
ATOM   6734  O  O     . LEU A 1  902  ? 447.399 -68.932 581.978 1.00 68.21  ? 902  LEU A O     1 
ATOM   6735  C  CB    . LEU A 1  902  ? 444.781 -67.737 583.153 1.00 66.00  ? 902  LEU A CB    1 
ATOM   6736  C  CG    . LEU A 1  902  ? 443.549 -67.727 584.058 1.00 65.58  ? 902  LEU A CG    1 
ATOM   6737  C  CD1   . LEU A 1  902  ? 442.295 -67.366 583.277 1.00 65.58  ? 902  LEU A CD1   1 
ATOM   6738  C  CD2   . LEU A 1  902  ? 443.387 -69.065 584.761 1.00 66.97  ? 902  LEU A CD2   1 
ATOM   6739  N  N     . ASN A 1  903  ? 448.069 -67.073 583.056 1.00 67.17  ? 903  ASN A N     1 
ATOM   6740  C  CA    . ASN A 1  903  ? 449.272 -66.893 582.255 1.00 67.55  ? 903  ASN A CA    1 
ATOM   6741  C  C     . ASN A 1  903  ? 450.496 -67.362 583.032 1.00 67.96  ? 903  ASN A C     1 
ATOM   6742  O  O     . ASN A 1  903  ? 450.701 -66.963 584.175 1.00 66.97  ? 903  ASN A O     1 
ATOM   6743  C  CB    . ASN A 1  903  ? 449.426 -65.425 581.845 1.00 66.09  ? 903  ASN A CB    1 
ATOM   6744  C  CG    . ASN A 1  903  ? 450.450 -65.226 580.742 1.00 66.71  ? 903  ASN A CG    1 
ATOM   6745  O  OD1   . ASN A 1  903  ? 451.460 -65.926 580.676 1.00 67.79  ? 903  ASN A OD1   1 
ATOM   6746  N  ND2   . ASN A 1  903  ? 450.191 -64.262 579.866 1.00 66.12  ? 903  ASN A ND2   1 
ATOM   6747  N  N     . THR A 1  904  ? 451.312 -68.206 582.409 1.00 77.53  ? 904  THR A N     1 
ATOM   6748  C  CA    . THR A 1  904  ? 452.488 -68.751 583.078 1.00 79.25  ? 904  THR A CA    1 
ATOM   6749  C  C     . THR A 1  904  ? 453.626 -67.731 583.137 1.00 79.56  ? 904  THR A C     1 
ATOM   6750  O  O     . THR A 1  904  ? 454.678 -67.995 583.719 1.00 81.92  ? 904  THR A O     1 
ATOM   6751  C  CB    . THR A 1  904  ? 452.987 -70.037 582.383 1.00 84.43  ? 904  THR A CB    1 
ATOM   6752  O  OG1   . THR A 1  904  ? 454.123 -70.556 583.085 1.00 88.40  ? 904  THR A OG1   1 
ATOM   6753  C  CG2   . THR A 1  904  ? 453.373 -69.755 580.942 1.00 83.51  ? 904  THR A CG2   1 
ATOM   6754  N  N     . ASP A 1  905  ? 453.406 -66.565 582.536 1.00 73.37  ? 905  ASP A N     1 
ATOM   6755  C  CA    . ASP A 1  905  ? 454.401 -65.497 582.537 1.00 71.86  ? 905  ASP A CA    1 
ATOM   6756  C  C     . ASP A 1  905  ? 453.991 -64.352 583.459 1.00 69.70  ? 905  ASP A C     1 
ATOM   6757  O  O     . ASP A 1  905  ? 454.818 -63.808 584.191 1.00 67.54  ? 905  ASP A O     1 
ATOM   6758  C  CB    . ASP A 1  905  ? 454.623 -64.967 581.118 1.00 72.17  ? 905  ASP A CB    1 
ATOM   6759  C  CG    . ASP A 1  905  ? 455.333 -65.966 580.225 1.00 76.45  ? 905  ASP A CG    1 
ATOM   6760  O  OD1   . ASP A 1  905  ? 455.309 -67.174 580.541 1.00 78.65  ? 905  ASP A OD1   1 
ATOM   6761  O  OD2   . ASP A 1  905  ? 455.914 -65.543 579.204 1.00 78.03  ? 905  ASP A OD2   1 
ATOM   6762  N  N     . HIS A 1  906  ? 452.712 -63.992 583.419 1.00 97.93  ? 906  HIS A N     1 
ATOM   6763  C  CA    . HIS A 1  906  ? 452.206 -62.878 584.214 1.00 92.73  ? 906  HIS A CA    1 
ATOM   6764  C  C     . HIS A 1  906  ? 451.558 -63.348 585.515 1.00 91.35  ? 906  HIS A C     1 
ATOM   6765  O  O     . HIS A 1  906  ? 450.602 -62.740 585.995 1.00 90.38  ? 906  HIS A O     1 
ATOM   6766  C  CB    . HIS A 1  906  ? 451.201 -62.056 583.402 1.00 91.19  ? 906  HIS A CB    1 
ATOM   6767  C  CG    . HIS A 1  906  ? 451.811 -61.313 582.254 1.00 92.77  ? 906  HIS A CG    1 
ATOM   6768  N  ND1   . HIS A 1  906  ? 452.435 -61.949 581.202 1.00 95.04  ? 906  HIS A ND1   1 
ATOM   6769  C  CD2   . HIS A 1  906  ? 451.890 -59.987 581.992 1.00 95.26  ? 906  HIS A CD2   1 
ATOM   6770  C  CE1   . HIS A 1  906  ? 452.873 -61.046 580.342 1.00 98.57  ? 906  HIS A CE1   1 
ATOM   6771  N  NE2   . HIS A 1  906  ? 452.555 -59.848 580.798 1.00 98.70  ? 906  HIS A NE2   1 
ATOM   6772  N  N     . THR A 1  907  ? 452.082 -64.428 586.082 1.00 60.62  ? 907  THR A N     1 
ATOM   6773  C  CA    . THR A 1  907  ? 451.558 -64.961 587.335 1.00 60.60  ? 907  THR A CA    1 
ATOM   6774  C  C     . THR A 1  907  ? 452.494 -64.664 588.501 1.00 60.07  ? 907  THR A C     1 
ATOM   6775  O  O     . THR A 1  907  ? 453.558 -64.071 588.323 1.00 59.75  ? 907  THR A O     1 
ATOM   6776  C  CB    . THR A 1  907  ? 451.331 -66.486 587.255 1.00 62.42  ? 907  THR A CB    1 
ATOM   6777  O  OG1   . THR A 1  907  ? 450.830 -66.967 588.509 1.00 62.47  ? 907  THR A OG1   1 
ATOM   6778  C  CG2   . THR A 1  907  ? 452.631 -67.206 586.923 1.00 63.79  ? 907  THR A CG2   1 
ATOM   6779  N  N     . LEU A 1  908  ? 452.086 -65.084 589.693 1.00 68.58  ? 908  LEU A N     1 
ATOM   6780  C  CA    . LEU A 1  908  ? 452.913 -64.942 590.883 1.00 68.31  ? 908  LEU A CA    1 
ATOM   6781  C  C     . LEU A 1  908  ? 453.933 -66.069 590.963 1.00 71.50  ? 908  LEU A C     1 
ATOM   6782  O  O     . LEU A 1  908  ? 453.567 -67.245 590.987 1.00 75.82  ? 908  LEU A O     1 
ATOM   6783  C  CB    . LEU A 1  908  ? 452.047 -64.927 592.142 1.00 67.74  ? 908  LEU A CB    1 
ATOM   6784  C  CG    . LEU A 1  908  ? 451.044 -63.780 592.254 1.00 66.06  ? 908  LEU A CG    1 
ATOM   6785  C  CD1   . LEU A 1  908  ? 450.072 -64.036 593.390 1.00 65.94  ? 908  LEU A CD1   1 
ATOM   6786  C  CD2   . LEU A 1  908  ? 451.767 -62.457 592.452 1.00 64.61  ? 908  LEU A CD2   1 
ATOM   6787  N  N     . ASP A 1  909  ? 455.211 -65.706 590.997 1.00 75.01  ? 909  ASP A N     1 
ATOM   6788  C  CA    . ASP A 1  909  ? 456.284 -66.684 591.118 1.00 77.34  ? 909  ASP A CA    1 
ATOM   6789  C  C     . ASP A 1  909  ? 456.138 -67.444 592.434 1.00 78.27  ? 909  ASP A C     1 
ATOM   6790  O  O     . ASP A 1  909  ? 455.732 -66.865 593.441 1.00 77.77  ? 909  ASP A O     1 
ATOM   6791  C  CB    . ASP A 1  909  ? 457.650 -65.995 591.041 1.00 79.53  ? 909  ASP A CB    1 
ATOM   6792  C  CG    . ASP A 1  909  ? 458.705 -66.858 590.374 1.00 84.43  ? 909  ASP A CG    1 
ATOM   6793  O  OD1   . ASP A 1  909  ? 459.835 -66.933 590.902 1.00 85.68  ? 909  ASP A OD1   1 
ATOM   6794  O  OD2   . ASP A 1  909  ? 458.405 -67.455 589.318 1.00 86.16  ? 909  ASP A OD2   1 
ATOM   6795  N  N     . PRO A 1  910  ? 456.459 -68.748 592.430 1.00 89.90  ? 910  PRO A N     1 
ATOM   6796  C  CA    . PRO A 1  910  ? 456.351 -69.573 593.640 1.00 91.65  ? 910  PRO A CA    1 
ATOM   6797  C  C     . PRO A 1  910  ? 457.253 -69.095 594.778 1.00 91.86  ? 910  PRO A C     1 
ATOM   6798  O  O     . PRO A 1  910  ? 457.097 -69.551 595.911 1.00 90.92  ? 910  PRO A O     1 
ATOM   6799  C  CB    . PRO A 1  910  ? 456.776 -70.966 593.157 1.00 93.26  ? 910  PRO A CB    1 
ATOM   6800  C  CG    . PRO A 1  910  ? 457.542 -70.724 591.897 1.00 94.95  ? 910  PRO A CG    1 
ATOM   6801  C  CD    . PRO A 1  910  ? 456.887 -69.540 591.266 1.00 92.41  ? 910  PRO A CD    1 
ATOM   6802  N  N     . SER A 1  911  ? 458.180 -68.191 594.478 1.00 83.55  ? 911  SER A N     1 
ATOM   6803  C  CA    . SER A 1  911  ? 459.047 -67.618 595.500 1.00 82.73  ? 911  SER A CA    1 
ATOM   6804  C  C     . SER A 1  911  ? 458.294 -66.587 596.335 1.00 78.14  ? 911  SER A C     1 
ATOM   6805  O  O     . SER A 1  911  ? 458.579 -66.406 597.518 1.00 77.10  ? 911  SER A O     1 
ATOM   6806  C  CB    . SER A 1  911  ? 460.281 -66.976 594.864 1.00 81.85  ? 911  SER A CB    1 
ATOM   6807  O  OG    . SER A 1  911  ? 459.923 -65.859 594.069 1.00 77.34  ? 911  SER A OG    1 
ATOM   6808  N  N     . LEU A 1  912  ? 457.330 -65.917 595.710 1.00 59.58  ? 912  LEU A N     1 
ATOM   6809  C  CA    . LEU A 1  912  ? 456.557 -64.873 596.374 1.00 57.82  ? 912  LEU A CA    1 
ATOM   6810  C  C     . LEU A 1  912  ? 455.535 -65.458 597.341 1.00 58.10  ? 912  LEU A C     1 
ATOM   6811  O  O     . LEU A 1  912  ? 455.591 -65.211 598.546 1.00 57.76  ? 912  LEU A O     1 
ATOM   6812  C  CB    . LEU A 1  912  ? 455.850 -63.993 595.342 1.00 56.53  ? 912  LEU A CB    1 
ATOM   6813  C  CG    . LEU A 1  912  ? 456.730 -63.356 594.265 1.00 56.28  ? 912  LEU A CG    1 
ATOM   6814  C  CD1   . LEU A 1  912  ? 455.901 -62.470 593.349 1.00 55.05  ? 912  LEU A CD1   1 
ATOM   6815  C  CD2   . LEU A 1  912  ? 457.868 -62.568 594.893 1.00 55.73  ? 912  LEU A CD2   1 
ATOM   6816  N  N     . LEU A 1  913  ? 454.598 -66.232 596.804 1.00 90.77  ? 913  LEU A N     1 
ATOM   6817  C  CA    . LEU A 1  913  ? 453.550 -66.838 597.614 1.00 93.56  ? 913  LEU A CA    1 
ATOM   6818  C  C     . LEU A 1  913  ? 453.951 -68.243 598.050 1.00 97.86  ? 913  LEU A C     1 
ATOM   6819  O  O     . LEU A 1  913  ? 454.692 -68.931 597.348 1.00 99.51  ? 913  LEU A O     1 
ATOM   6820  C  CB    . LEU A 1  913  ? 452.230 -66.877 596.839 1.00 92.42  ? 913  LEU A CB    1 
ATOM   6821  C  CG    . LEU A 1  913  ? 450.961 -67.130 597.653 1.00 93.30  ? 913  LEU A CG    1 
ATOM   6822  C  CD1   . LEU A 1  913  ? 450.745 -66.006 598.653 1.00 91.59  ? 913  LEU A CD1   1 
ATOM   6823  C  CD2   . LEU A 1  913  ? 449.755 -67.278 596.740 1.00 94.76  ? 913  LEU A CD2   1 
ATOM   6824  N  N     . GLU A 1  914  ? 453.464 -68.664 599.213 1.00 70.99  ? 914  GLU A N     1 
ATOM   6825  C  CA    . GLU A 1  914  ? 453.770 -69.991 599.735 1.00 74.90  ? 914  GLU A CA    1 
ATOM   6826  C  C     . GLU A 1  914  ? 452.972 -71.055 598.988 1.00 77.85  ? 914  GLU A C     1 
ATOM   6827  O  O     . GLU A 1  914  ? 453.345 -72.229 598.967 1.00 82.10  ? 914  GLU A O     1 
ATOM   6828  C  CB    . GLU A 1  914  ? 453.478 -70.053 601.237 1.00 74.38  ? 914  GLU A CB    1 
ATOM   6829  C  CG    . GLU A 1  914  ? 454.017 -71.284 601.943 1.00 80.02  ? 914  GLU A CG    1 
ATOM   6830  C  CD    . GLU A 1  914  ? 454.028 -71.125 603.452 1.00 78.61  ? 914  GLU A CD    1 
ATOM   6831  O  OE1   . GLU A 1  914  ? 453.618 -72.070 604.158 1.00 85.58  ? 914  GLU A OE1   1 
ATOM   6832  O  OE2   . GLU A 1  914  ? 454.453 -70.055 603.935 1.00 74.88  ? 914  GLU A OE2   1 
ATOM   6833  N  N     . SER A 1  915  ? 451.876 -70.632 598.366 1.00 89.90  ? 915  SER A N     1 
ATOM   6834  C  CA    . SER A 1  915  ? 451.022 -71.539 597.609 1.00 90.68  ? 915  SER A CA    1 
ATOM   6835  C  C     . SER A 1  915  ? 450.972 -71.147 596.137 1.00 88.30  ? 915  SER A C     1 
ATOM   6836  O  O     . SER A 1  915  ? 449.978 -71.391 595.456 1.00 88.68  ? 915  SER A O     1 
ATOM   6837  C  CB    . SER A 1  915  ? 449.608 -71.555 598.193 1.00 89.71  ? 915  SER A CB    1 
ATOM   6838  O  OG    . SER A 1  915  ? 449.008 -70.274 598.105 1.00 85.43  ? 915  SER A OG    1 
ATOM   6839  N  N     . GLY A 1  916  ? 452.052 -70.541 595.652 1.00 66.84  ? 916  GLY A N     1 
ATOM   6840  C  CA    . GLY A 1  916  ? 452.108 -70.053 594.285 1.00 66.26  ? 916  GLY A CA    1 
ATOM   6841  C  C     . GLY A 1  916  ? 452.079 -71.143 593.231 1.00 67.91  ? 916  GLY A C     1 
ATOM   6842  O  O     . GLY A 1  916  ? 451.708 -70.895 592.083 1.00 67.63  ? 916  GLY A O     1 
ATOM   6843  N  N     . SER A 1  917  ? 452.472 -72.352 593.618 1.00 70.17  ? 917  SER A N     1 
ATOM   6844  C  CA    . SER A 1  917  ? 452.513 -73.476 592.689 1.00 71.94  ? 917  SER A CA    1 
ATOM   6845  C  C     . SER A 1  917  ? 451.120 -74.036 592.421 1.00 72.46  ? 917  SER A C     1 
ATOM   6846  O  O     . SER A 1  917  ? 450.763 -74.311 591.276 1.00 72.95  ? 917  SER A O     1 
ATOM   6847  C  CB    . SER A 1  917  ? 453.423 -74.580 593.229 1.00 73.83  ? 917  SER A CB    1 
ATOM   6848  O  OG    . SER A 1  917  ? 452.923 -75.101 594.447 1.00 74.41  ? 917  SER A OG    1 
ATOM   6849  N  N     . GLU A 1  918  ? 450.338 -74.202 593.484 1.00 88.16  ? 918  GLU A N     1 
ATOM   6850  C  CA    . GLU A 1  918  ? 448.989 -74.747 593.368 1.00 88.64  ? 918  GLU A CA    1 
ATOM   6851  C  C     . GLU A 1  918  ? 447.964 -73.650 593.113 1.00 86.36  ? 918  GLU A C     1 
ATOM   6852  O  O     . GLU A 1  918  ? 446.761 -73.862 593.265 1.00 86.75  ? 918  GLU A O     1 
ATOM   6853  C  CB    . GLU A 1  918  ? 448.615 -75.525 594.631 1.00 90.53  ? 918  GLU A CB    1 
ATOM   6854  C  CG    . GLU A 1  918  ? 448.637 -74.691 595.902 1.00 90.21  ? 918  GLU A CG    1 
ATOM   6855  C  CD    . GLU A 1  918  ? 448.193 -75.476 597.121 1.00 93.29  ? 918  GLU A CD    1 
ATOM   6856  O  OE1   . GLU A 1  918  ? 447.650 -76.588 596.950 1.00 97.53  ? 918  GLU A OE1   1 
ATOM   6857  O  OE2   . GLU A 1  918  ? 448.389 -74.981 598.252 1.00 91.31  ? 918  GLU A OE2   1 
ATOM   6858  N  N     . ILE A 1  919  ? 448.447 -72.475 592.725 1.00 68.74  ? 919  ILE A N     1 
ATOM   6859  C  CA    . ILE A 1  919  ? 447.577 -71.334 592.483 1.00 67.02  ? 919  ILE A CA    1 
ATOM   6860  C  C     . ILE A 1  919  ? 447.486 -71.049 590.984 1.00 66.85  ? 919  ILE A C     1 
ATOM   6861  O  O     . ILE A 1  919  ? 446.548 -70.400 590.517 1.00 65.96  ? 919  ILE A O     1 
ATOM   6862  C  CB    . ILE A 1  919  ? 448.080 -70.082 593.249 1.00 65.20  ? 919  ILE A CB    1 
ATOM   6863  C  CG1   . ILE A 1  919  ? 446.938 -69.441 594.041 1.00 64.12  ? 919  ILE A CG1   1 
ATOM   6864  C  CG2   . ILE A 1  919  ? 448.777 -69.090 592.322 1.00 64.05  ? 919  ILE A CG2   1 
ATOM   6865  C  CD1   . ILE A 1  919  ? 446.456 -70.298 595.194 1.00 65.21  ? 919  ILE A CD1   1 
ATOM   6866  N  N     . LEU A 1  920  ? 448.457 -71.565 590.237 1.00 65.53  ? 920  LEU A N     1 
ATOM   6867  C  CA    . LEU A 1  920  ? 448.532 -71.360 588.794 1.00 65.58  ? 920  LEU A CA    1 
ATOM   6868  C  C     . LEU A 1  920  ? 447.350 -71.991 588.063 1.00 66.52  ? 920  LEU A C     1 
ATOM   6869  O  O     . LEU A 1  920  ? 447.186 -73.211 588.067 1.00 68.24  ? 920  LEU A O     1 
ATOM   6870  C  CB    . LEU A 1  920  ? 449.843 -71.930 588.249 1.00 66.74  ? 920  LEU A CB    1 
ATOM   6871  C  CG    . LEU A 1  920  ? 450.101 -71.794 586.747 1.00 67.05  ? 920  LEU A CG    1 
ATOM   6872  C  CD1   . LEU A 1  920  ? 450.366 -70.345 586.373 1.00 65.26  ? 920  LEU A CD1   1 
ATOM   6873  C  CD2   . LEU A 1  920  ? 451.259 -72.680 586.319 1.00 68.69  ? 920  LEU A CD2   1 
ATOM   6874  N  N     . GLY A 1  921  ? 446.529 -71.153 587.439 1.00 65.47  ? 921  GLY A N     1 
ATOM   6875  C  CA    . GLY A 1  921  ? 445.417 -71.630 586.638 1.00 66.33  ? 921  GLY A CA    1 
ATOM   6876  C  C     . GLY A 1  921  ? 444.088 -71.654 587.368 1.00 66.13  ? 921  GLY A C     1 
ATOM   6877  O  O     . GLY A 1  921  ? 443.069 -72.039 586.795 1.00 66.88  ? 921  GLY A O     1 
ATOM   6878  N  N     . ASP A 1  922  ? 444.094 -71.242 588.631 1.00 69.72  ? 922  ASP A N     1 
ATOM   6879  C  CA    . ASP A 1  922  ? 442.875 -71.223 589.432 1.00 69.56  ? 922  ASP A CA    1 
ATOM   6880  C  C     . ASP A 1  922  ? 441.906 -70.165 588.910 1.00 68.32  ? 922  ASP A C     1 
ATOM   6881  O  O     . ASP A 1  922  ? 442.115 -68.968 589.107 1.00 66.64  ? 922  ASP A O     1 
ATOM   6882  C  CB    . ASP A 1  922  ? 443.205 -70.966 590.906 1.00 68.88  ? 922  ASP A CB    1 
ATOM   6883  C  CG    . ASP A 1  922  ? 442.092 -71.408 591.843 1.00 69.45  ? 922  ASP A CG    1 
ATOM   6884  O  OD1   . ASP A 1  922  ? 440.905 -71.240 591.492 1.00 69.42  ? 922  ASP A OD1   1 
ATOM   6885  O  OD2   . ASP A 1  922  ? 442.406 -71.928 592.935 1.00 70.03  ? 922  ASP A OD2   1 
ATOM   6886  N  N     . LEU A 1  923  ? 440.846 -70.618 588.247 1.00 64.74  ? 923  LEU A N     1 
ATOM   6887  C  CA    . LEU A 1  923  ? 439.856 -69.722 587.656 1.00 63.86  ? 923  LEU A CA    1 
ATOM   6888  C  C     . LEU A 1  923  ? 439.105 -68.919 588.714 1.00 62.65  ? 923  LEU A C     1 
ATOM   6889  O  O     . LEU A 1  923  ? 438.905 -67.712 588.565 1.00 61.17  ? 923  LEU A O     1 
ATOM   6890  C  CB    . LEU A 1  923  ? 438.861 -70.516 586.807 1.00 65.39  ? 923  LEU A CB    1 
ATOM   6891  C  CG    . LEU A 1  923  ? 439.424 -71.305 585.623 1.00 66.73  ? 923  LEU A CG    1 
ATOM   6892  C  CD1   . LEU A 1  923  ? 438.349 -72.185 585.008 1.00 68.37  ? 923  LEU A CD1   1 
ATOM   6893  C  CD2   . LEU A 1  923  ? 440.004 -70.366 584.581 1.00 65.75  ? 923  LEU A CD2   1 
ATOM   6894  N  N     . LYS A 1  924  ? 438.695 -69.599 589.781 1.00 63.39  ? 924  LYS A N     1 
ATOM   6895  C  CA    . LYS A 1  924  ? 437.910 -68.983 590.846 1.00 62.53  ? 924  LYS A CA    1 
ATOM   6896  C  C     . LYS A 1  924  ? 438.644 -67.819 591.507 1.00 60.68  ? 924  LYS A C     1 
ATOM   6897  O  O     . LYS A 1  924  ? 438.033 -66.810 591.856 1.00 59.45  ? 924  LYS A O     1 
ATOM   6898  C  CB    . LYS A 1  924  ? 437.536 -70.031 591.896 1.00 63.89  ? 924  LYS A CB    1 
ATOM   6899  C  CG    . LYS A 1  924  ? 436.741 -71.206 591.344 1.00 65.84  ? 924  LYS A CG    1 
ATOM   6900  C  CD    . LYS A 1  924  ? 436.544 -72.287 592.395 1.00 67.32  ? 924  LYS A CD    1 
ATOM   6901  C  CE    . LYS A 1  924  ? 437.878 -72.840 592.874 1.00 67.70  ? 924  LYS A CE    1 
ATOM   6902  N  NZ    . LYS A 1  924  ? 437.706 -73.883 593.921 1.00 69.25  ? 924  LYS A NZ    1 
ATOM   6903  N  N     . LEU A 1  925  ? 439.955 -67.962 591.676 1.00 60.55  ? 925  LEU A N     1 
ATOM   6904  C  CA    . LEU A 1  925  ? 440.769 -66.898 592.254 1.00 58.92  ? 925  LEU A CA    1 
ATOM   6905  C  C     . LEU A 1  925  ? 441.079 -65.831 591.211 1.00 57.71  ? 925  LEU A C     1 
ATOM   6906  O  O     . LEU A 1  925  ? 441.214 -64.647 591.533 1.00 56.15  ? 925  LEU A O     1 
ATOM   6907  C  CB    . LEU A 1  925  ? 442.064 -67.466 592.833 1.00 59.39  ? 925  LEU A CB    1 
ATOM   6908  C  CG    . LEU A 1  925  ? 441.886 -68.404 594.028 1.00 60.52  ? 925  LEU A CG    1 
ATOM   6909  C  CD1   . LEU A 1  925  ? 443.224 -68.939 594.491 1.00 61.08  ? 925  LEU A CD1   1 
ATOM   6910  C  CD2   . LEU A 1  925  ? 441.171 -67.690 595.164 1.00 59.55  ? 925  LEU A CD2   1 
ATOM   6911  N  N     . GLN A 1  926  ? 441.186 -66.258 589.957 1.00 62.44  ? 926  GLN A N     1 
ATOM   6912  C  CA    . GLN A 1  926  ? 441.419 -65.334 588.857 1.00 61.57  ? 926  GLN A CA    1 
ATOM   6913  C  C     . GLN A 1  926  ? 440.225 -64.412 588.663 1.00 60.70  ? 926  GLN A C     1 
ATOM   6914  O  O     . GLN A 1  926  ? 440.358 -63.329 588.101 1.00 59.60  ? 926  GLN A O     1 
ATOM   6915  C  CB    . GLN A 1  926  ? 441.716 -66.092 587.564 1.00 62.88  ? 926  GLN A CB    1 
ATOM   6916  C  CG    . GLN A 1  926  ? 443.136 -65.907 587.075 1.00 62.70  ? 926  GLN A CG    1 
ATOM   6917  C  CD    . GLN A 1  926  ? 443.467 -64.455 586.797 1.00 61.06  ? 926  GLN A CD    1 
ATOM   6918  O  OE1   . GLN A 1  926  ? 444.520 -63.961 587.198 1.00 60.30  ? 926  GLN A OE1   1 
ATOM   6919  N  NE2   . GLN A 1  926  ? 442.570 -63.764 586.103 1.00 60.60  ? 926  GLN A NE2   1 
ATOM   6920  N  N     . VAL A 1  927  ? 439.058 -64.850 589.123 1.00 61.54  ? 927  VAL A N     1 
ATOM   6921  C  CA    . VAL A 1  927  ? 437.879 -63.994 589.126 1.00 60.80  ? 927  VAL A CA    1 
ATOM   6922  C  C     . VAL A 1  927  ? 438.084 -62.841 590.103 1.00 59.11  ? 927  VAL A C     1 
ATOM   6923  O  O     . VAL A 1  927  ? 437.819 -61.681 589.780 1.00 57.95  ? 927  VAL A O     1 
ATOM   6924  C  CB    . VAL A 1  927  ? 436.606 -64.777 589.501 1.00 61.98  ? 927  VAL A CB    1 
ATOM   6925  C  CG1   . VAL A 1  927  ? 435.441 -63.827 589.729 1.00 61.17  ? 927  VAL A CG1   1 
ATOM   6926  C  CG2   . VAL A 1  927  ? 436.272 -65.789 588.418 1.00 63.64  ? 927  VAL A CG2   1 
ATOM   6927  N  N     . LEU A 1  928  ? 438.575 -63.169 591.295 1.00 54.93  ? 928  LEU A N     1 
ATOM   6928  C  CA    . LEU A 1  928  ? 438.853 -62.165 592.316 1.00 53.46  ? 928  LEU A CA    1 
ATOM   6929  C  C     . LEU A 1  928  ? 439.954 -61.211 591.873 1.00 52.23  ? 928  LEU A C     1 
ATOM   6930  O  O     . LEU A 1  928  ? 439.880 -60.009 592.122 1.00 50.85  ? 928  LEU A O     1 
ATOM   6931  C  CB    . LEU A 1  928  ? 439.244 -62.832 593.637 1.00 53.90  ? 928  LEU A CB    1 
ATOM   6932  C  CG    . LEU A 1  928  ? 438.157 -63.628 594.360 1.00 55.01  ? 928  LEU A CG    1 
ATOM   6933  C  CD1   . LEU A 1  928  ? 438.675 -64.145 595.694 1.00 55.38  ? 928  LEU A CD1   1 
ATOM   6934  C  CD2   . LEU A 1  928  ? 436.911 -62.779 594.556 1.00 54.31  ? 928  LEU A CD2   1 
ATOM   6935  N  N     . LEU A 1  929  ? 440.977 -61.750 591.218 1.00 53.26  ? 929  LEU A N     1 
ATOM   6936  C  CA    . LEU A 1  929  ? 442.092 -60.931 590.754 1.00 52.32  ? 929  LEU A CA    1 
ATOM   6937  C  C     . LEU A 1  929  ? 441.689 -60.033 589.588 1.00 51.75  ? 929  LEU A C     1 
ATOM   6938  O  O     . LEU A 1  929  ? 442.152 -58.897 589.482 1.00 50.54  ? 929  LEU A O     1 
ATOM   6939  C  CB    . LEU A 1  929  ? 443.274 -61.814 590.359 1.00 53.33  ? 929  LEU A CB    1 
ATOM   6940  C  CG    . LEU A 1  929  ? 443.993 -62.460 591.542 1.00 53.71  ? 929  LEU A CG    1 
ATOM   6941  C  CD1   . LEU A 1  929  ? 445.044 -63.437 591.059 1.00 54.96  ? 929  LEU A CD1   1 
ATOM   6942  C  CD2   . LEU A 1  929  ? 444.616 -61.393 592.428 1.00 52.25  ? 929  LEU A CD2   1 
ATOM   6943  N  N     . ASP A 1  930  ? 440.829 -60.545 588.713 1.00 64.64  ? 930  ASP A N     1 
ATOM   6944  C  CA    . ASP A 1  930  ? 440.290 -59.738 587.626 1.00 62.27  ? 930  ASP A CA    1 
ATOM   6945  C  C     . ASP A 1  930  ? 439.410 -58.636 588.198 1.00 63.05  ? 930  ASP A C     1 
ATOM   6946  O  O     . ASP A 1  930  ? 439.369 -57.528 587.668 1.00 64.93  ? 930  ASP A O     1 
ATOM   6947  C  CB    . ASP A 1  930  ? 439.497 -60.597 586.638 1.00 66.45  ? 930  ASP A CB    1 
ATOM   6948  C  CG    . ASP A 1  930  ? 440.393 -61.411 585.722 1.00 68.78  ? 930  ASP A CG    1 
ATOM   6949  O  OD1   . ASP A 1  930  ? 441.541 -60.982 585.479 1.00 70.59  ? 930  ASP A OD1   1 
ATOM   6950  O  OD2   . ASP A 1  930  ? 439.950 -62.477 585.243 1.00 69.31  ? 930  ASP A OD2   1 
ATOM   6951  N  N     . GLU A 1  931  ? 438.713 -58.950 589.286 1.00 86.53  ? 931  GLU A N     1 
ATOM   6952  C  CA    . GLU A 1  931  ? 437.901 -57.964 589.990 1.00 84.76  ? 931  GLU A CA    1 
ATOM   6953  C  C     . GLU A 1  931  ? 438.773 -56.852 590.565 1.00 82.35  ? 931  GLU A C     1 
ATOM   6954  O  O     . GLU A 1  931  ? 438.479 -55.664 590.403 1.00 80.40  ? 931  GLU A O     1 
ATOM   6955  C  CB    . GLU A 1  931  ? 437.093 -58.633 591.104 1.00 84.03  ? 931  GLU A CB    1 
ATOM   6956  C  CG    . GLU A 1  931  ? 436.388 -57.658 592.032 1.00 85.21  ? 931  GLU A CG    1 
ATOM   6957  C  CD    . GLU A 1  931  ? 435.366 -56.800 591.312 1.00 89.26  ? 931  GLU A CD    1 
ATOM   6958  O  OE1   . GLU A 1  931  ? 434.765 -57.285 590.328 1.00 91.98  ? 931  GLU A OE1   1 
ATOM   6959  O  OE2   . GLU A 1  931  ? 435.166 -55.639 591.729 1.00 87.99  ? 931  GLU A OE2   1 
ATOM   6960  N  N     . GLU A 1  932  ? 439.851 -57.252 591.234 1.00 53.85  ? 932  GLU A N     1 
ATOM   6961  C  CA    . GLU A 1  932  ? 440.792 -56.314 591.833 1.00 52.57  ? 932  GLU A CA    1 
ATOM   6962  C  C     . GLU A 1  932  ? 441.420 -55.407 590.781 1.00 51.94  ? 932  GLU A C     1 
ATOM   6963  O  O     . GLU A 1  932  ? 441.451 -54.186 590.941 1.00 50.74  ? 932  GLU A O     1 
ATOM   6964  C  CB    . GLU A 1  932  ? 441.886 -57.069 592.593 1.00 52.96  ? 932  GLU A CB    1 
ATOM   6965  C  CG    . GLU A 1  932  ? 442.919 -56.169 593.252 1.00 51.77  ? 932  GLU A CG    1 
ATOM   6966  C  CD    . GLU A 1  932  ? 444.053 -56.947 593.895 1.00 52.33  ? 932  GLU A CD    1 
ATOM   6967  O  OE1   . GLU A 1  932  ? 444.138 -56.960 595.141 1.00 52.08  ? 932  GLU A OE1   1 
ATOM   6968  O  OE2   . GLU A 1  932  ? 444.865 -57.541 593.155 1.00 53.10  ? 932  GLU A OE2   1 
ATOM   6969  N  N     . TYR A 1  933  ? 441.913 -56.011 589.705 1.00 48.72  ? 933  TYR A N     1 
ATOM   6970  C  CA    . TYR A 1  933  ? 442.572 -55.264 588.640 1.00 48.38  ? 933  TYR A CA    1 
ATOM   6971  C  C     . TYR A 1  933  ? 441.597 -54.333 587.928 1.00 47.95  ? 933  TYR A C     1 
ATOM   6972  O  O     . TYR A 1  933  ? 441.950 -53.207 587.577 1.00 47.09  ? 933  TYR A O     1 
ATOM   6973  C  CB    . TYR A 1  933  ? 443.218 -56.221 587.635 1.00 49.66  ? 933  TYR A CB    1 
ATOM   6974  C  CG    . TYR A 1  933  ? 444.083 -55.534 586.602 1.00 49.47  ? 933  TYR A CG    1 
ATOM   6975  C  CD1   . TYR A 1  933  ? 443.588 -55.238 585.339 1.00 49.87  ? 933  TYR A CD1   1 
ATOM   6976  C  CD2   . TYR A 1  933  ? 445.394 -55.181 586.890 1.00 49.01  ? 933  TYR A CD2   1 
ATOM   6977  C  CE1   . TYR A 1  933  ? 444.376 -54.611 584.391 1.00 49.83  ? 933  TYR A CE1   1 
ATOM   6978  C  CE2   . TYR A 1  933  ? 446.189 -54.552 585.949 1.00 48.96  ? 933  TYR A CE2   1 
ATOM   6979  C  CZ    . TYR A 1  933  ? 445.675 -54.270 584.701 1.00 49.38  ? 933  TYR A CZ    1 
ATOM   6980  O  OH    . TYR A 1  933  ? 446.463 -53.646 583.761 1.00 49.46  ? 933  TYR A OH    1 
ATOM   6981  N  N     . LYS A 1  934  ? 440.370 -54.803 587.719 1.00 57.49  ? 934  LYS A N     1 
ATOM   6982  C  CA    . LYS A 1  934  ? 439.339 -53.982 587.094 1.00 57.25  ? 934  LYS A CA    1 
ATOM   6983  C  C     . LYS A 1  934  ? 439.026 -52.776 587.970 1.00 55.87  ? 934  LYS A C     1 
ATOM   6984  O  O     . LYS A 1  934  ? 438.867 -51.657 587.475 1.00 55.22  ? 934  LYS A O     1 
ATOM   6985  C  CB    . LYS A 1  934  ? 438.070 -54.800 586.842 1.00 59.90  ? 934  LYS A CB    1 
ATOM   6986  C  CG    . LYS A 1  934  ? 436.976 -54.045 586.102 1.00 62.97  ? 934  LYS A CG    1 
ATOM   6987  C  CD    . LYS A 1  934  ? 435.765 -54.928 585.808 1.00 65.67  ? 934  LYS A CD    1 
ATOM   6988  C  CE    . LYS A 1  934  ? 436.020 -55.898 584.656 1.00 69.23  ? 934  LYS A CE    1 
ATOM   6989  N  NZ    . LYS A 1  934  ? 436.764 -57.128 585.063 1.00 67.08  ? 934  LYS A NZ    1 
ATOM   6990  N  N     . GLN A 1  935  ? 438.950 -53.012 589.277 1.00 55.11  ? 935  GLN A N     1 
ATOM   6991  C  CA    . GLN A 1  935  ? 438.710 -51.937 590.232 1.00 52.41  ? 935  GLN A CA    1 
ATOM   6992  C  C     . GLN A 1  935  ? 439.863 -50.938 590.227 1.00 49.81  ? 935  GLN A C     1 
ATOM   6993  O  O     . GLN A 1  935  ? 439.651 -49.734 590.374 1.00 49.15  ? 935  GLN A O     1 
ATOM   6994  C  CB    . GLN A 1  935  ? 438.502 -52.501 591.639 1.00 51.83  ? 935  GLN A CB    1 
ATOM   6995  C  CG    . GLN A 1  935  ? 438.185 -51.444 592.685 1.00 49.41  ? 935  GLN A CG    1 
ATOM   6996  C  CD    . GLN A 1  935  ? 436.945 -50.639 592.345 1.00 48.63  ? 935  GLN A CD    1 
ATOM   6997  O  OE1   . GLN A 1  935  ? 435.989 -51.160 591.767 1.00 51.75  ? 935  GLN A OE1   1 
ATOM   6998  N  NE2   . GLN A 1  935  ? 436.956 -49.359 592.699 1.00 47.34  ? 935  GLN A NE2   1 
ATOM   6999  N  N     . LEU A 1  936  ? 441.081 -51.443 590.051 1.00 49.52  ? 936  LEU A N     1 
ATOM   7000  C  CA    . LEU A 1  936  ? 442.257 -50.584 589.966 1.00 48.71  ? 936  LEU A CA    1 
ATOM   7001  C  C     . LEU A 1  936  ? 442.214 -49.716 588.712 1.00 48.61  ? 936  LEU A C     1 
ATOM   7002  O  O     . LEU A 1  936  ? 442.569 -48.538 588.751 1.00 47.68  ? 936  LEU A O     1 
ATOM   7003  C  CB    . LEU A 1  936  ? 443.539 -51.419 589.984 1.00 49.29  ? 936  LEU A CB    1 
ATOM   7004  C  CG    . LEU A 1  936  ? 443.876 -52.118 591.301 1.00 49.34  ? 936  LEU A CG    1 
ATOM   7005  C  CD1   . LEU A 1  936  ? 445.175 -52.898 591.175 1.00 50.04  ? 936  LEU A CD1   1 
ATOM   7006  C  CD2   . LEU A 1  936  ? 443.960 -51.110 592.436 1.00 48.07  ? 936  LEU A CD2   1 
ATOM   7007  N  N     . VAL A 1  937  ? 441.780 -50.304 587.601 1.00 43.22  ? 937  VAL A N     1 
ATOM   7008  C  CA    . VAL A 1  937  ? 441.639 -49.564 586.352 1.00 43.35  ? 937  VAL A CA    1 
ATOM   7009  C  C     . VAL A 1  937  ? 440.591 -48.464 586.502 1.00 42.61  ? 937  VAL A C     1 
ATOM   7010  O  O     . VAL A 1  937  ? 440.813 -47.317 586.097 1.00 42.03  ? 937  VAL A O     1 
ATOM   7011  C  CB    . VAL A 1  937  ? 441.253 -50.493 585.183 1.00 44.75  ? 937  VAL A CB    1 
ATOM   7012  C  CG1   . VAL A 1  937  ? 440.900 -49.680 583.946 1.00 44.96  ? 937  VAL A CG1   1 
ATOM   7013  C  CG2   . VAL A 1  937  ? 442.385 -51.464 584.882 1.00 45.54  ? 937  VAL A CG2   1 
ATOM   7014  N  N     . LYS A 1  938  ? 439.455 -48.821 587.095 1.00 56.95  ? 938  LYS A N     1 
ATOM   7015  C  CA    . LYS A 1  938  ? 438.392 -47.859 587.364 1.00 56.65  ? 938  LYS A CA    1 
ATOM   7016  C  C     . LYS A 1  938  ? 438.911 -46.721 588.236 1.00 56.32  ? 938  LYS A C     1 
ATOM   7017  O  O     . LYS A 1  938  ? 438.586 -45.553 588.012 1.00 56.04  ? 938  LYS A O     1 
ATOM   7018  C  CB    . LYS A 1  938  ? 437.204 -48.545 588.040 1.00 56.03  ? 938  LYS A CB    1 
ATOM   7019  C  CG    . LYS A 1  938  ? 436.009 -47.636 588.271 1.00 56.01  ? 938  LYS A CG    1 
ATOM   7020  C  CD    . LYS A 1  938  ? 434.961 -48.313 589.141 1.00 59.12  ? 938  LYS A CD    1 
ATOM   7021  C  CE    . LYS A 1  938  ? 434.498 -49.625 588.529 1.00 63.74  ? 938  LYS A CE    1 
ATOM   7022  N  NZ    . LYS A 1  938  ? 433.533 -50.340 589.410 1.00 66.69  ? 938  LYS A NZ    1 
ATOM   7023  N  N     . ASP A 1  939  ? 439.726 -47.073 589.226 1.00 52.85  ? 939  ASP A N     1 
ATOM   7024  C  CA    . ASP A 1  939  ? 440.343 -46.087 590.103 1.00 50.82  ? 939  ASP A CA    1 
ATOM   7025  C  C     . ASP A 1  939  ? 441.279 -45.167 589.328 1.00 50.67  ? 939  ASP A C     1 
ATOM   7026  O  O     . ASP A 1  939  ? 441.358 -43.975 589.610 1.00 51.28  ? 939  ASP A O     1 
ATOM   7027  C  CB    . ASP A 1  939  ? 441.109 -46.775 591.237 1.00 51.66  ? 939  ASP A CB    1 
ATOM   7028  C  CG    . ASP A 1  939  ? 440.196 -47.273 592.342 1.00 51.43  ? 939  ASP A CG    1 
ATOM   7029  O  OD1   . ASP A 1  939  ? 439.013 -47.557 592.061 1.00 50.79  ? 939  ASP A OD1   1 
ATOM   7030  O  OD2   . ASP A 1  939  ? 440.665 -47.380 593.495 1.00 49.23  ? 939  ASP A OD2   1 
ATOM   7031  N  N     . ARG A 1  940  ? 441.985 -45.727 588.351 1.00 39.58  ? 940  ARG A N     1 
ATOM   7032  C  CA    . ARG A 1  940  ? 442.906 -44.951 587.525 1.00 39.46  ? 940  ARG A CA    1 
ATOM   7033  C  C     . ARG A 1  940  ? 442.142 -43.934 586.684 1.00 39.42  ? 940  ARG A C     1 
ATOM   7034  O  O     . ARG A 1  940  ? 442.518 -42.759 586.613 1.00 38.78  ? 940  ARG A O     1 
ATOM   7035  C  CB    . ARG A 1  940  ? 443.729 -45.878 586.629 1.00 40.51  ? 940  ARG A CB    1 
ATOM   7036  C  CG    . ARG A 1  940  ? 444.907 -45.211 585.944 1.00 40.50  ? 940  ARG A CG    1 
ATOM   7037  C  CD    . ARG A 1  940  ? 445.834 -46.252 585.335 1.00 41.55  ? 940  ARG A CD    1 
ATOM   7038  N  NE    . ARG A 1  940  ? 447.165 -45.718 585.062 1.00 41.48  ? 940  ARG A NE    1 
ATOM   7039  C  CZ    . ARG A 1  940  ? 447.581 -45.318 583.865 1.00 42.10  ? 940  ARG A CZ    1 
ATOM   7040  N  NH1   . ARG A 1  940  ? 446.769 -45.395 582.819 1.00 42.81  ? 940  ARG A NH1   1 
ATOM   7041  N  NH2   . ARG A 1  940  ? 448.811 -44.847 583.714 1.00 42.10  ? 940  ARG A NH2   1 
ATOM   7042  N  N     . LYS A 1  941  ? 441.067 -44.398 586.052 1.00 58.26  ? 941  LYS A N     1 
ATOM   7043  C  CA    . LYS A 1  941  ? 440.180 -43.520 585.296 1.00 59.60  ? 941  LYS A CA    1 
ATOM   7044  C  C     . LYS A 1  941  ? 439.645 -42.393 586.174 1.00 57.29  ? 941  LYS A C     1 
ATOM   7045  O  O     . LYS A 1  941  ? 439.746 -41.216 585.822 1.00 58.13  ? 941  LYS A O     1 
ATOM   7046  C  CB    . LYS A 1  941  ? 439.015 -44.318 584.703 1.00 63.09  ? 941  LYS A CB    1 
ATOM   7047  C  CG    . LYS A 1  941  ? 439.394 -45.212 583.533 1.00 68.92  ? 941  LYS A CG    1 
ATOM   7048  C  CD    . LYS A 1  941  ? 439.450 -44.429 582.229 1.00 69.74  ? 941  LYS A CD    1 
ATOM   7049  C  CE    . LYS A 1  941  ? 438.079 -43.886 581.852 1.00 67.04  ? 941  LYS A CE    1 
ATOM   7050  N  NZ    . LYS A 1  941  ? 438.096 -43.188 580.537 1.00 71.04  ? 941  LYS A NZ    1 
ATOM   7051  N  N     . PHE A 1  942  ? 439.088 -42.769 587.321 1.00 38.86  ? 942  PHE A N     1 
ATOM   7052  C  CA    . PHE A 1  942  ? 438.502 -41.814 588.257 1.00 37.94  ? 942  PHE A CA    1 
ATOM   7053  C  C     . PHE A 1  942  ? 439.501 -40.757 588.719 1.00 36.91  ? 942  PHE A C     1 
ATOM   7054  O  O     . PHE A 1  942  ? 439.209 -39.561 588.689 1.00 36.41  ? 942  PHE A O     1 
ATOM   7055  C  CB    . PHE A 1  942  ? 437.931 -42.551 589.471 1.00 37.82  ? 942  PHE A CB    1 
ATOM   7056  C  CG    . PHE A 1  942  ? 437.433 -41.639 590.554 1.00 36.90  ? 942  PHE A CG    1 
ATOM   7057  C  CD1   . PHE A 1  942  ? 436.213 -40.997 590.429 1.00 36.99  ? 942  PHE A CD1   1 
ATOM   7058  C  CD2   . PHE A 1  942  ? 438.181 -41.428 591.700 1.00 36.04  ? 942  PHE A CD2   1 
ATOM   7059  C  CE1   . PHE A 1  942  ? 435.751 -40.158 591.424 1.00 36.22  ? 942  PHE A CE1   1 
ATOM   7060  C  CE2   . PHE A 1  942  ? 437.724 -40.590 592.700 1.00 35.26  ? 942  PHE A CE2   1 
ATOM   7061  C  CZ    . PHE A 1  942  ? 436.507 -39.955 592.562 1.00 35.34  ? 942  PHE A CZ    1 
ATOM   7062  N  N     . LEU A 1  943  ? 440.674 -41.207 589.151 1.00 40.59  ? 943  LEU A N     1 
ATOM   7063  C  CA    . LEU A 1  943  ? 441.717 -40.301 589.616 1.00 39.73  ? 943  LEU A CA    1 
ATOM   7064  C  C     . LEU A 1  943  ? 442.170 -39.367 588.500 1.00 39.87  ? 943  LEU A C     1 
ATOM   7065  O  O     . LEU A 1  943  ? 442.389 -38.178 588.729 1.00 39.18  ? 943  LEU A O     1 
ATOM   7066  C  CB    . LEU A 1  943  ? 442.913 -41.085 590.163 1.00 39.72  ? 943  LEU A CB    1 
ATOM   7067  C  CG    . LEU A 1  943  ? 442.716 -41.807 591.498 1.00 39.47  ? 943  LEU A CG    1 
ATOM   7068  C  CD1   . LEU A 1  943  ? 443.997 -42.506 591.923 1.00 39.59  ? 943  LEU A CD1   1 
ATOM   7069  C  CD2   . LEU A 1  943  ? 442.245 -40.843 592.576 1.00 38.48  ? 943  LEU A CD2   1 
ATOM   7070  N  N     . ARG A 1  944  ? 442.303 -39.902 587.291 1.00 37.97  ? 944  ARG A N     1 
ATOM   7071  C  CA    . ARG A 1  944  ? 442.715 -39.075 586.163 1.00 38.31  ? 944  ARG A CA    1 
ATOM   7072  C  C     . ARG A 1  944  ? 441.614 -38.097 585.757 1.00 38.29  ? 944  ARG A C     1 
ATOM   7073  O  O     . ARG A 1  944  ? 441.883 -37.092 585.098 1.00 38.36  ? 944  ARG A O     1 
ATOM   7074  C  CB    . ARG A 1  944  ? 443.124 -39.946 584.974 1.00 39.48  ? 944  ARG A CB    1 
ATOM   7075  C  CG    . ARG A 1  944  ? 444.486 -40.597 585.154 1.00 39.60  ? 944  ARG A CG    1 
ATOM   7076  C  CD    . ARG A 1  944  ? 445.048 -41.113 583.844 1.00 40.79  ? 944  ARG A CD    1 
ATOM   7077  N  NE    . ARG A 1  944  ? 446.488 -41.333 583.935 1.00 40.88  ? 944  ARG A NE    1 
ATOM   7078  C  CZ    . ARG A 1  944  ? 447.248 -41.747 582.927 1.00 41.90  ? 944  ARG A CZ    1 
ATOM   7079  N  NH1   . ARG A 1  944  ? 446.705 -41.993 581.741 1.00 42.90  ? 944  ARG A NH1   1 
ATOM   7080  N  NH2   . ARG A 1  944  ? 448.551 -41.916 583.104 1.00 42.01  ? 944  ARG A NH2   1 
ATOM   7081  N  N     . GLU A 1  945  ? 440.379 -38.386 586.158 1.00 62.42  ? 945  GLU A N     1 
ATOM   7082  C  CA    . GLU A 1  945  ? 439.275 -37.457 585.935 1.00 60.90  ? 945  GLU A CA    1 
ATOM   7083  C  C     . GLU A 1  945  ? 439.281 -36.344 586.978 1.00 61.44  ? 945  GLU A C     1 
ATOM   7084  O  O     . GLU A 1  945  ? 439.041 -35.179 586.659 1.00 63.53  ? 945  GLU A O     1 
ATOM   7085  C  CB    . GLU A 1  945  ? 437.931 -38.191 585.959 1.00 62.23  ? 945  GLU A CB    1 
ATOM   7086  C  CG    . GLU A 1  945  ? 437.670 -39.065 584.743 1.00 67.66  ? 945  GLU A CG    1 
ATOM   7087  C  CD    . GLU A 1  945  ? 436.337 -39.784 584.816 1.00 71.56  ? 945  GLU A CD    1 
ATOM   7088  O  OE1   . GLU A 1  945  ? 435.506 -39.409 585.670 1.00 69.75  ? 945  GLU A OE1   1 
ATOM   7089  O  OE2   . GLU A 1  945  ? 436.123 -40.725 584.022 1.00 74.73  ? 945  GLU A OE2   1 
ATOM   7090  N  N     . VAL A 1  946  ? 439.554 -36.712 588.226 1.00 44.95  ? 946  VAL A N     1 
ATOM   7091  C  CA    . VAL A 1  946  ? 439.597 -35.746 589.320 1.00 43.91  ? 946  VAL A CA    1 
ATOM   7092  C  C     . VAL A 1  946  ? 440.778 -34.792 589.172 1.00 43.45  ? 946  VAL A C     1 
ATOM   7093  O  O     . VAL A 1  946  ? 440.603 -33.575 589.096 1.00 43.14  ? 946  VAL A O     1 
ATOM   7094  C  CB    . VAL A 1  946  ? 439.685 -36.447 590.691 1.00 43.37  ? 946  VAL A CB    1 
ATOM   7095  C  CG1   . VAL A 1  946  ? 439.907 -35.428 591.797 1.00 42.34  ? 946  VAL A CG1   1 
ATOM   7096  C  CG2   . VAL A 1  946  ? 438.428 -37.262 590.955 1.00 43.84  ? 946  VAL A CG2   1 
ATOM   7097  N  N     . PHE A 1  947  ? 441.982 -35.351 589.131 1.00 47.93  ? 947  PHE A N     1 
ATOM   7098  C  CA    . PHE A 1  947  ? 443.191 -34.553 588.983 1.00 48.54  ? 947  PHE A CA    1 
ATOM   7099  C  C     . PHE A 1  947  ? 443.672 -34.587 587.536 1.00 51.46  ? 947  PHE A C     1 
ATOM   7100  O  O     . PHE A 1  947  ? 444.515 -35.407 587.171 1.00 54.20  ? 947  PHE A O     1 
ATOM   7101  C  CB    . PHE A 1  947  ? 444.282 -35.060 589.926 1.00 48.37  ? 947  PHE A CB    1 
ATOM   7102  C  CG    . PHE A 1  947  ? 443.803 -35.297 591.331 1.00 45.77  ? 947  PHE A CG    1 
ATOM   7103  C  CD1   . PHE A 1  947  ? 443.434 -34.236 592.140 1.00 46.90  ? 947  PHE A CD1   1 
ATOM   7104  C  CD2   . PHE A 1  947  ? 443.721 -36.581 591.843 1.00 47.12  ? 947  PHE A CD2   1 
ATOM   7105  C  CE1   . PHE A 1  947  ? 442.994 -34.451 593.434 1.00 44.14  ? 947  PHE A CE1   1 
ATOM   7106  C  CE2   . PHE A 1  947  ? 443.281 -36.801 593.136 1.00 46.29  ? 947  PHE A CE2   1 
ATOM   7107  C  CZ    . PHE A 1  947  ? 442.918 -35.734 593.931 1.00 44.84  ? 947  PHE A CZ    1 
ATOM   7108  N  N     . VAL A 1  948  ? 443.130 -33.687 586.721 1.00 50.45  ? 948  VAL A N     1 
ATOM   7109  C  CA    . VAL A 1  948  ? 443.372 -33.700 585.281 1.00 51.48  ? 948  VAL A CA    1 
ATOM   7110  C  C     . VAL A 1  948  ? 444.822 -33.393 584.911 1.00 53.20  ? 948  VAL A C     1 
ATOM   7111  O  O     . VAL A 1  948  ? 445.283 -33.767 583.833 1.00 52.70  ? 948  VAL A O     1 
ATOM   7112  C  CB    . VAL A 1  948  ? 442.452 -32.695 584.557 1.00 50.76  ? 948  VAL A CB    1 
ATOM   7113  C  CG1   . VAL A 1  948  ? 440.996 -33.100 584.724 1.00 50.72  ? 948  VAL A CG1   1 
ATOM   7114  C  CG2   . VAL A 1  948  ? 442.682 -31.287 585.082 1.00 53.77  ? 948  VAL A CG2   1 
ATOM   7115  N  N     . ASP A 1  949  ? 445.541 -32.719 585.802 1.00 66.25  ? 949  ASP A N     1 
ATOM   7116  C  CA    . ASP A 1  949  ? 446.935 -32.377 585.542 1.00 65.80  ? 949  ASP A CA    1 
ATOM   7117  C  C     . ASP A 1  949  ? 447.850 -33.569 585.805 1.00 64.15  ? 949  ASP A C     1 
ATOM   7118  O  O     . ASP A 1  949  ? 449.037 -33.536 585.480 1.00 65.24  ? 949  ASP A O     1 
ATOM   7119  C  CB    . ASP A 1  949  ? 447.364 -31.177 586.390 1.00 66.17  ? 949  ASP A CB    1 
ATOM   7120  C  CG    . ASP A 1  949  ? 447.147 -31.401 587.873 1.00 66.60  ? 949  ASP A CG    1 
ATOM   7121  O  OD1   . ASP A 1  949  ? 446.254 -32.198 588.234 1.00 65.28  ? 949  ASP A OD1   1 
ATOM   7122  O  OD2   . ASP A 1  949  ? 447.866 -30.774 588.680 1.00 65.44  ? 949  ASP A OD2   1 
ATOM   7123  N  N     . GLY A 1  950  ? 447.291 -34.622 586.394 1.00 70.30  ? 950  GLY A N     1 
ATOM   7124  C  CA    . GLY A 1  950  ? 448.031 -35.848 586.629 1.00 70.73  ? 950  GLY A CA    1 
ATOM   7125  C  C     . GLY A 1  950  ? 448.852 -35.843 587.903 1.00 71.98  ? 950  GLY A C     1 
ATOM   7126  O  O     . GLY A 1  950  ? 449.779 -36.639 588.052 1.00 70.61  ? 950  GLY A O     1 
ATOM   7127  N  N     . GLU A 1  951  ? 448.514 -34.946 588.825 1.00 57.94  ? 951  GLU A N     1 
ATOM   7128  C  CA    . GLU A 1  951  ? 449.217 -34.862 590.101 1.00 54.58  ? 951  GLU A CA    1 
ATOM   7129  C  C     . GLU A 1  951  ? 448.884 -36.059 590.985 1.00 52.65  ? 951  GLU A C     1 
ATOM   7130  O  O     . GLU A 1  951  ? 447.720 -36.434 591.122 1.00 52.09  ? 951  GLU A O     1 
ATOM   7131  C  CB    . GLU A 1  951  ? 448.868 -33.559 590.823 1.00 54.71  ? 951  GLU A CB    1 
ATOM   7132  C  CG    . GLU A 1  951  ? 449.591 -33.373 592.145 1.00 53.12  ? 951  GLU A CG    1 
ATOM   7133  C  CD    . GLU A 1  951  ? 451.099 -33.314 591.984 1.00 55.14  ? 951  GLU A CD    1 
ATOM   7134  O  OE1   . GLU A 1  951  ? 451.570 -32.786 590.954 1.00 55.88  ? 951  GLU A OE1   1 
ATOM   7135  O  OE2   . GLU A 1  951  ? 451.814 -33.800 592.885 1.00 53.64  ? 951  GLU A OE2   1 
ATOM   7136  N  N     . ALA A 1  952  ? 449.912 -36.655 591.581 1.00 55.43  ? 952  ALA A N     1 
ATOM   7137  C  CA    . ALA A 1  952  ? 449.733 -37.842 592.412 1.00 56.44  ? 952  ALA A CA    1 
ATOM   7138  C  C     . ALA A 1  952  ? 449.828 -37.510 593.897 1.00 54.63  ? 952  ALA A C     1 
ATOM   7139  O  O     . ALA A 1  952  ? 449.111 -38.083 594.716 1.00 54.11  ? 952  ALA A O     1 
ATOM   7140  C  CB    . ALA A 1  952  ? 450.760 -38.901 592.044 1.00 56.80  ? 952  ALA A CB    1 
ATOM   7141  N  N     . ASN A 1  953  ? 450.718 -36.584 594.236 1.00 48.34  ? 953  ASN A N     1 
ATOM   7142  C  CA    . ASN A 1  953  ? 450.939 -36.208 595.626 1.00 46.28  ? 953  ASN A CA    1 
ATOM   7143  C  C     . ASN A 1  953  ? 449.791 -35.373 596.179 1.00 45.04  ? 953  ASN A C     1 
ATOM   7144  O  O     . ASN A 1  953  ? 449.630 -34.207 595.820 1.00 47.24  ? 953  ASN A O     1 
ATOM   7145  C  CB    . ASN A 1  953  ? 452.255 -35.441 595.763 1.00 45.70  ? 953  ASN A CB    1 
ATOM   7146  C  CG    . ASN A 1  953  ? 453.413 -36.152 595.091 1.00 48.14  ? 953  ASN A CG    1 
ATOM   7147  O  OD1   . ASN A 1  953  ? 453.459 -37.380 595.042 1.00 46.60  ? 953  ASN A OD1   1 
ATOM   7148  N  ND2   . ASN A 1  953  ? 454.356 -35.379 594.563 1.00 51.25  ? 953  ASN A ND2   1 
ATOM   7149  N  N     . TRP A 1  954  ? 448.993 -35.976 597.055 1.00 35.40  ? 954  TRP A N     1 
ATOM   7150  C  CA    . TRP A 1  954  ? 447.849 -35.290 597.641 1.00 34.76  ? 954  TRP A CA    1 
ATOM   7151  C  C     . TRP A 1  954  ? 447.685 -35.611 599.122 1.00 34.42  ? 954  TRP A C     1 
ATOM   7152  O  O     . TRP A 1  954  ? 447.862 -36.756 599.537 1.00 34.87  ? 954  TRP A O     1 
ATOM   7153  C  CB    . TRP A 1  954  ? 446.571 -35.652 596.885 1.00 35.10  ? 954  TRP A CB    1 
ATOM   7154  C  CG    . TRP A 1  954  ? 446.484 -34.994 595.551 1.00 35.33  ? 954  TRP A CG    1 
ATOM   7155  C  CD1   . TRP A 1  954  ? 446.751 -35.557 594.338 1.00 36.10  ? 954  TRP A CD1   1 
ATOM   7156  C  CD2   . TRP A 1  954  ? 446.118 -33.634 595.291 1.00 34.90  ? 954  TRP A CD2   1 
ATOM   7157  N  NE1   . TRP A 1  954  ? 446.566 -34.633 593.337 1.00 36.20  ? 954  TRP A NE1   1 
ATOM   7158  C  CE2   . TRP A 1  954  ? 446.179 -33.444 593.897 1.00 35.48  ? 954  TRP A CE2   1 
ATOM   7159  C  CE3   . TRP A 1  954  ? 445.741 -32.560 596.103 1.00 34.17  ? 954  TRP A CE3   1 
ATOM   7160  C  CZ2   . TRP A 1  954  ? 445.877 -32.225 593.297 1.00 35.38  ? 954  TRP A CZ2   1 
ATOM   7161  C  CZ3   . TRP A 1  954  ? 445.442 -31.352 595.505 1.00 34.03  ? 954  TRP A CZ3   1 
ATOM   7162  C  CH2   . TRP A 1  954  ? 445.511 -31.193 594.116 1.00 34.65  ? 954  TRP A CH2   1 
ATOM   7163  N  N     . PRO A 1  955  ? 447.346 -34.591 599.924 1.00 32.23  ? 955  PRO A N     1 
ATOM   7164  C  CA    . PRO A 1  955  ? 447.113 -34.761 601.362 1.00 31.94  ? 955  PRO A CA    1 
ATOM   7165  C  C     . PRO A 1  955  ? 445.955 -35.716 601.659 1.00 32.29  ? 955  PRO A C     1 
ATOM   7166  O  O     . PRO A 1  955  ? 444.818 -35.479 601.248 1.00 32.27  ? 955  PRO A O     1 
ATOM   7167  C  CB    . PRO A 1  955  ? 446.796 -33.337 601.839 1.00 31.18  ? 955  PRO A CB    1 
ATOM   7168  C  CG    . PRO A 1  955  ? 446.386 -32.596 600.614 1.00 31.16  ? 955  PRO A CG    1 
ATOM   7169  C  CD    . PRO A 1  955  ? 447.195 -33.188 599.506 1.00 31.75  ? 955  PRO A CD    1 
ATOM   7170  N  N     . LEU A 1  956  ? 446.269 -36.796 602.366 1.00 29.23  ? 956  LEU A N     1 
ATOM   7171  C  CA    . LEU A 1  956  ? 445.294 -37.801 602.768 1.00 29.72  ? 956  LEU A CA    1 
ATOM   7172  C  C     . LEU A 1  956  ? 445.637 -38.318 604.161 1.00 29.85  ? 956  LEU A C     1 
ATOM   7173  O  O     . LEU A 1  956  ? 446.796 -38.270 604.571 1.00 29.81  ? 956  LEU A O     1 
ATOM   7174  C  CB    . LEU A 1  956  ? 445.262 -38.959 601.765 1.00 30.54  ? 956  LEU A CB    1 
ATOM   7175  C  CG    . LEU A 1  956  ? 444.524 -38.734 600.445 1.00 30.67  ? 956  LEU A CG    1 
ATOM   7176  C  CD1   . LEU A 1  956  ? 444.635 -39.966 599.560 1.00 31.58  ? 956  LEU A CD1   1 
ATOM   7177  C  CD2   . LEU A 1  956  ? 443.067 -38.385 600.701 1.00 30.52  ? 956  LEU A CD2   1 
ATOM   7178  N  N     . PRO A 1  957  ? 444.632 -38.811 604.900 1.00 32.57  ? 957  PRO A N     1 
ATOM   7179  C  CA    . PRO A 1  957  ? 444.913 -39.360 606.230 1.00 32.86  ? 957  PRO A CA    1 
ATOM   7180  C  C     . PRO A 1  957  ? 445.662 -40.689 606.158 1.00 33.73  ? 957  PRO A C     1 
ATOM   7181  O  O     . PRO A 1  957  ? 445.701 -41.306 605.094 1.00 34.17  ? 957  PRO A O     1 
ATOM   7182  C  CB    . PRO A 1  957  ? 443.518 -39.550 606.831 1.00 33.08  ? 957  PRO A CB    1 
ATOM   7183  C  CG    . PRO A 1  957  ? 442.629 -39.741 605.647 1.00 33.30  ? 957  PRO A CG    1 
ATOM   7184  C  CD    . PRO A 1  957  ? 443.194 -38.853 604.576 1.00 32.72  ? 957  PRO A CD    1 
ATOM   7185  N  N     . VAL A 1  958  ? 446.251 -41.101 607.281 1.00 35.56  ? 958  VAL A N     1 
ATOM   7186  C  CA    . VAL A 1  958  ? 446.945 -42.384 607.411 1.00 36.52  ? 958  VAL A CA    1 
ATOM   7187  C  C     . VAL A 1  958  ? 448.104 -42.561 606.435 1.00 36.68  ? 958  VAL A C     1 
ATOM   7188  O  O     . VAL A 1  958  ? 447.906 -42.929 605.277 1.00 36.92  ? 958  VAL A O     1 
ATOM   7189  C  CB    . VAL A 1  958  ? 445.977 -43.567 607.223 1.00 37.39  ? 958  VAL A CB    1 
ATOM   7190  C  CG1   . VAL A 1  958  ? 446.687 -44.882 607.502 1.00 38.48  ? 958  VAL A CG1   1 
ATOM   7191  C  CG2   . VAL A 1  958  ? 444.782 -43.410 608.131 1.00 37.37  ? 958  VAL A CG2   1 
ATOM   7192  N  N     . ASN A 1  959  ? 449.318 -42.310 606.912 1.00 51.30  ? 959  ASN A N     1 
ATOM   7193  C  CA    . ASN A 1  959  ? 450.508 -42.544 606.107 1.00 52.67  ? 959  ASN A CA    1 
ATOM   7194  C  C     . ASN A 1  959  ? 450.758 -44.042 605.977 1.00 54.66  ? 959  ASN A C     1 
ATOM   7195  O  O     . ASN A 1  959  ? 451.293 -44.672 606.889 1.00 57.08  ? 959  ASN A O     1 
ATOM   7196  C  CB    . ASN A 1  959  ? 451.722 -41.845 606.723 1.00 52.35  ? 959  ASN A CB    1 
ATOM   7197  C  CG    . ASN A 1  959  ? 452.868 -41.684 605.739 1.00 53.84  ? 959  ASN A CG    1 
ATOM   7198  O  OD1   . ASN A 1  959  ? 453.111 -42.549 604.897 1.00 55.17  ? 959  ASN A OD1   1 
ATOM   7199  N  ND2   . ASN A 1  959  ? 453.580 -40.567 605.842 1.00 55.61  ? 959  ASN A ND2   1 
ATOM   7200  N  N     . ILE A 1  960  ? 450.364 -44.607 604.840 1.00 37.79  ? 960  ILE A N     1 
ATOM   7201  C  CA    . ILE A 1  960  ? 450.449 -46.048 604.633 1.00 38.97  ? 960  ILE A CA    1 
ATOM   7202  C  C     . ILE A 1  960  ? 451.895 -46.524 604.499 1.00 39.66  ? 960  ILE A C     1 
ATOM   7203  O  O     . ILE A 1  960  ? 452.247 -47.596 604.997 1.00 40.66  ? 960  ILE A O     1 
ATOM   7204  C  CB    . ILE A 1  960  ? 449.645 -46.481 603.388 1.00 39.22  ? 960  ILE A CB    1 
ATOM   7205  C  CG1   . ILE A 1  960  ? 448.176 -46.085 603.547 1.00 38.72  ? 960  ILE A CG1   1 
ATOM   7206  C  CG2   . ILE A 1  960  ? 449.760 -47.983 603.161 1.00 40.52  ? 960  ILE A CG2   1 
ATOM   7207  C  CD1   . ILE A 1  960  ? 447.291 -46.551 602.415 1.00 39.09  ? 960  ILE A CD1   1 
ATOM   7208  N  N     . ARG A 1  961  ? 452.731 -45.725 603.839 1.00 54.72  ? 961  ARG A N     1 
ATOM   7209  C  CA    . ARG A 1  961  ? 454.136 -46.079 603.647 1.00 55.50  ? 961  ARG A CA    1 
ATOM   7210  C  C     . ARG A 1  961  ? 454.850 -46.335 604.968 1.00 57.67  ? 961  ARG A C     1 
ATOM   7211  O  O     . ARG A 1  961  ? 455.593 -47.309 605.099 1.00 59.51  ? 961  ARG A O     1 
ATOM   7212  C  CB    . ARG A 1  961  ? 454.871 -44.984 602.875 1.00 56.97  ? 961  ARG A CB    1 
ATOM   7213  C  CG    . ARG A 1  961  ? 454.843 -45.160 601.366 1.00 63.03  ? 961  ARG A CG    1 
ATOM   7214  C  CD    . ARG A 1  961  ? 455.834 -44.231 600.674 1.00 66.06  ? 961  ARG A CD    1 
ATOM   7215  N  NE    . ARG A 1  961  ? 457.220 -44.532 601.027 1.00 67.51  ? 961  ARG A NE    1 
ATOM   7216  C  CZ    . ARG A 1  961  ? 457.935 -43.846 601.915 1.00 68.06  ? 961  ARG A CZ    1 
ATOM   7217  N  NH1   . ARG A 1  961  ? 457.397 -42.811 602.547 1.00 65.25  ? 961  ARG A NH1   1 
ATOM   7218  N  NH2   . ARG A 1  961  ? 459.189 -44.195 602.171 1.00 66.01  ? 961  ARG A NH2   1 
ATOM   7219  N  N     . ARG A 1  962  ? 454.622 -45.463 605.945 1.00 55.26  ? 962  ARG A N     1 
ATOM   7220  C  CA    . ARG A 1  962  ? 455.253 -45.610 607.251 1.00 55.20  ? 962  ARG A CA    1 
ATOM   7221  C  C     . ARG A 1  962  ? 454.728 -46.846 607.979 1.00 56.82  ? 962  ARG A C     1 
ATOM   7222  O  O     . ARG A 1  962  ? 455.475 -47.510 608.695 1.00 61.55  ? 962  ARG A O     1 
ATOM   7223  C  CB    . ARG A 1  962  ? 455.046 -44.352 608.100 1.00 53.45  ? 962  ARG A CB    1 
ATOM   7224  C  CG    . ARG A 1  962  ? 455.930 -43.185 607.672 1.00 54.34  ? 962  ARG A CG    1 
ATOM   7225  C  CD    . ARG A 1  962  ? 456.053 -42.113 608.749 1.00 51.38  ? 962  ARG A CD    1 
ATOM   7226  N  NE    . ARG A 1  962  ? 454.922 -41.188 608.759 1.00 50.40  ? 962  ARG A NE    1 
ATOM   7227  C  CZ    . ARG A 1  962  ? 453.908 -41.257 609.615 1.00 48.78  ? 962  ARG A CZ    1 
ATOM   7228  N  NH1   . ARG A 1  962  ? 453.880 -42.209 610.537 1.00 50.91  ? 962  ARG A NH1   1 
ATOM   7229  N  NH2   . ARG A 1  962  ? 452.922 -40.372 609.552 1.00 47.03  ? 962  ARG A NH2   1 
ATOM   7230  N  N     . ILE A 1  963  ? 453.452 -47.160 607.783 1.00 37.55  ? 963  ILE A N     1 
ATOM   7231  C  CA    . ILE A 1  963  ? 452.863 -48.355 608.379 1.00 38.56  ? 963  ILE A CA    1 
ATOM   7232  C  C     . ILE A 1  963  ? 453.489 -49.624 607.799 1.00 39.85  ? 963  ILE A C     1 
ATOM   7233  O  O     . ILE A 1  963  ? 453.814 -50.560 608.533 1.00 40.97  ? 963  ILE A O     1 
ATOM   7234  C  CB    . ILE A 1  963  ? 451.335 -48.399 608.173 1.00 38.22  ? 963  ILE A CB    1 
ATOM   7235  C  CG1   . ILE A 1  963  ? 450.671 -47.203 608.856 1.00 37.10  ? 963  ILE A CG1   1 
ATOM   7236  C  CG2   . ILE A 1  963  ? 450.756 -49.699 608.712 1.00 39.44  ? 963  ILE A CG2   1 
ATOM   7237  C  CD1   . ILE A 1  963  ? 449.161 -47.249 608.830 1.00 36.92  ? 963  ILE A CD1   1 
ATOM   7238  N  N     . ILE A 1  964  ? 453.663 -49.648 606.481 1.00 48.75  ? 964  ILE A N     1 
ATOM   7239  C  CA    . ILE A 1  964  ? 454.266 -50.796 605.811 1.00 50.49  ? 964  ILE A CA    1 
ATOM   7240  C  C     . ILE A 1  964  ? 455.733 -50.958 606.202 1.00 52.68  ? 964  ILE A C     1 
ATOM   7241  O  O     . ILE A 1  964  ? 456.178 -52.059 606.535 1.00 56.96  ? 964  ILE A O     1 
ATOM   7242  C  CB    . ILE A 1  964  ? 454.160 -50.677 604.277 1.00 50.35  ? 964  ILE A CB    1 
ATOM   7243  C  CG1   . ILE A 1  964  ? 452.693 -50.629 603.847 1.00 49.14  ? 964  ILE A CG1   1 
ATOM   7244  C  CG2   . ILE A 1  964  ? 454.864 -51.840 603.598 1.00 52.40  ? 964  ILE A CG2   1 
ATOM   7245  C  CD1   . ILE A 1  964  ? 451.908 -51.865 604.222 1.00 50.10  ? 964  ILE A CD1   1 
ATOM   7246  N  N     . GLN A 1  965  ? 456.482 -49.859 606.174 1.00 64.99  ? 965  GLN A N     1 
ATOM   7247  C  CA    . GLN A 1  965  ? 457.900 -49.915 606.511 1.00 66.58  ? 965  GLN A CA    1 
ATOM   7248  C  C     . GLN A 1  965  ? 458.097 -50.163 608.004 1.00 67.16  ? 965  GLN A C     1 
ATOM   7249  O  O     . GLN A 1  965  ? 459.189 -50.527 608.438 1.00 69.94  ? 965  GLN A O     1 
ATOM   7250  C  CB    . GLN A 1  965  ? 458.614 -48.633 606.081 1.00 66.19  ? 965  GLN A CB    1 
ATOM   7251  C  CG    . GLN A 1  965  ? 458.316 -47.426 606.943 1.00 64.51  ? 965  GLN A CG    1 
ATOM   7252  C  CD    . GLN A 1  965  ? 458.896 -46.151 606.367 1.00 65.33  ? 965  GLN A CD    1 
ATOM   7253  O  OE1   . GLN A 1  965  ? 459.490 -46.158 605.288 1.00 66.95  ? 965  GLN A OE1   1 
ATOM   7254  N  NE2   . GLN A 1  965  ? 458.725 -45.046 607.085 1.00 65.49  ? 965  GLN A NE2   1 
ATOM   7255  N  N     . ASN A 1  966  ? 457.040 -49.962 608.786 1.00 43.23  ? 966  ASN A N     1 
ATOM   7256  C  CA    . ASN A 1  966  ? 457.058 -50.352 610.192 1.00 43.90  ? 966  ASN A CA    1 
ATOM   7257  C  C     . ASN A 1  966  ? 456.702 -51.822 610.351 1.00 45.31  ? 966  ASN A C     1 
ATOM   7258  O  O     . ASN A 1  966  ? 457.112 -52.470 611.313 1.00 46.41  ? 966  ASN A O     1 
ATOM   7259  C  CB    . ASN A 1  966  ? 456.103 -49.491 611.016 1.00 42.85  ? 966  ASN A CB    1 
ATOM   7260  C  CG    . ASN A 1  966  ? 456.788 -48.286 611.625 1.00 42.07  ? 966  ASN A CG    1 
ATOM   7261  O  OD1   . ASN A 1  966  ? 456.412 -47.144 611.362 1.00 40.78  ? 966  ASN A OD1   1 
ATOM   7262  N  ND2   . ASN A 1  966  ? 457.803 -48.535 612.445 1.00 42.95  ? 966  ASN A ND2   1 
ATOM   7263  N  N     . ALA A 1  967  ? 455.933 -52.343 609.400 1.00 43.68  ? 967  ALA A N     1 
ATOM   7264  C  CA    . ALA A 1  967  ? 455.598 -53.759 609.389 1.00 45.08  ? 967  ALA A CA    1 
ATOM   7265  C  C     . ALA A 1  967  ? 456.839 -54.577 609.063 1.00 46.39  ? 967  ALA A C     1 
ATOM   7266  O  O     . ALA A 1  967  ? 457.163 -55.532 609.767 1.00 47.78  ? 967  ALA A O     1 
ATOM   7267  C  CB    . ALA A 1  967  ? 454.490 -54.043 608.393 1.00 44.81  ? 967  ALA A CB    1 
ATOM   7268  N  N     . GLN A 1  968  ? 457.547 -54.184 608.007 1.00 95.38  ? 968  GLN A N     1 
ATOM   7269  C  CA    . GLN A 1  968  ? 458.776 -54.871 607.619 1.00 98.64  ? 968  GLN A CA    1 
ATOM   7270  C  C     . GLN A 1  968  ? 459.955 -54.425 608.485 1.00 97.82  ? 968  GLN A C     1 
ATOM   7271  O  O     . GLN A 1  968  ? 461.103 -54.416 608.040 1.00 100.00 ? 968  GLN A O     1 
ATOM   7272  C  CB    . GLN A 1  968  ? 459.081 -54.636 606.137 1.00 97.71  ? 968  GLN A CB    1 
ATOM   7273  C  CG    . GLN A 1  968  ? 459.198 -53.175 605.743 1.00 95.48  ? 968  GLN A CG    1 
ATOM   7274  C  CD    . GLN A 1  968  ? 459.295 -52.983 604.242 1.00 96.81  ? 968  GLN A CD    1 
ATOM   7275  O  OE1   . GLN A 1  968  ? 459.268 -53.949 603.479 1.00 101.12 ? 968  GLN A OE1   1 
ATOM   7276  N  NE2   . GLN A 1  968  ? 459.408 -51.732 603.811 1.00 96.28  ? 968  GLN A NE2   1 
ATOM   7277  N  N     . GLN A 1  969  ? 459.652 -54.059 609.726 1.00 76.29  ? 969  GLN A N     1 
ATOM   7278  C  CA    . GLN A 1  969  ? 460.660 -53.675 610.705 1.00 77.66  ? 969  GLN A CA    1 
ATOM   7279  C  C     . GLN A 1  969  ? 460.323 -54.304 612.053 1.00 77.65  ? 969  GLN A C     1 
ATOM   7280  O  O     . GLN A 1  969  ? 461.210 -54.700 612.808 1.00 81.08  ? 969  GLN A O     1 
ATOM   7281  C  CB    . GLN A 1  969  ? 460.743 -52.151 610.829 1.00 76.04  ? 969  GLN A CB    1 
ATOM   7282  C  CG    . GLN A 1  969  ? 461.712 -51.655 611.893 1.00 75.84  ? 969  GLN A CG    1 
ATOM   7283  C  CD    . GLN A 1  969  ? 463.164 -51.851 611.502 1.00 80.52  ? 969  GLN A CD    1 
ATOM   7284  O  OE1   . GLN A 1  969  ? 463.481 -52.084 610.335 1.00 80.53  ? 969  GLN A OE1   1 
ATOM   7285  N  NE2   . GLN A 1  969  ? 464.057 -51.755 612.481 1.00 81.43  ? 969  GLN A NE2   1 
ATOM   7286  N  N     . THR A 1  970  ? 459.028 -54.396 612.339 1.00 57.97  ? 970  THR A N     1 
ATOM   7287  C  CA    . THR A 1  970  ? 458.549 -54.980 613.587 1.00 58.87  ? 970  THR A CA    1 
ATOM   7288  C  C     . THR A 1  970  ? 458.637 -56.503 613.551 1.00 61.49  ? 970  THR A C     1 
ATOM   7289  O  O     . THR A 1  970  ? 458.963 -57.143 614.552 1.00 63.58  ? 970  THR A O     1 
ATOM   7290  C  CB    . THR A 1  970  ? 457.091 -54.561 613.879 1.00 57.86  ? 970  THR A CB    1 
ATOM   7291  O  OG1   . THR A 1  970  ? 457.004 -53.132 613.940 1.00 57.49  ? 970  THR A OG1   1 
ATOM   7292  C  CG2   . THR A 1  970  ? 456.610 -55.148 615.196 1.00 58.91  ? 970  THR A CG2   1 
ATOM   7293  N  N     . PHE A 1  971  ? 458.354 -57.079 612.387 1.00 68.80  ? 971  PHE A N     1 
ATOM   7294  C  CA    . PHE A 1  971  ? 458.323 -58.530 612.239 1.00 70.84  ? 971  PHE A CA    1 
ATOM   7295  C  C     . PHE A 1  971  ? 459.597 -59.068 611.590 1.00 72.97  ? 971  PHE A C     1 
ATOM   7296  O  O     . PHE A 1  971  ? 459.787 -60.281 611.497 1.00 74.02  ? 971  PHE A O     1 
ATOM   7297  C  CB    . PHE A 1  971  ? 457.098 -58.949 611.424 1.00 68.37  ? 971  PHE A CB    1 
ATOM   7298  C  CG    . PHE A 1  971  ? 455.795 -58.466 612.000 1.00 66.73  ? 971  PHE A CG    1 
ATOM   7299  C  CD1   . PHE A 1  971  ? 455.116 -59.221 612.942 1.00 68.26  ? 971  PHE A CD1   1 
ATOM   7300  C  CD2   . PHE A 1  971  ? 455.250 -57.256 611.600 1.00 63.83  ? 971  PHE A CD2   1 
ATOM   7301  C  CE1   . PHE A 1  971  ? 453.918 -58.780 613.475 1.00 66.39  ? 971  PHE A CE1   1 
ATOM   7302  C  CE2   . PHE A 1  971  ? 454.053 -56.809 612.129 1.00 63.44  ? 971  PHE A CE2   1 
ATOM   7303  C  CZ    . PHE A 1  971  ? 453.386 -57.573 613.068 1.00 64.58  ? 971  PHE A CZ    1 
ATOM   7304  N  N     . HIS A 1  972  ? 460.460 -58.154 611.152 1.00 122.74 ? 972  HIS A N     1 
ATOM   7305  C  CA    . HIS A 1  972  ? 461.751 -58.497 610.554 1.00 124.28 ? 972  HIS A CA    1 
ATOM   7306  C  C     . HIS A 1  972  ? 461.628 -59.529 609.437 1.00 124.08 ? 972  HIS A C     1 
ATOM   7307  O  O     . HIS A 1  972  ? 462.227 -60.602 609.504 1.00 128.06 ? 972  HIS A O     1 
ATOM   7308  C  CB    . HIS A 1  972  ? 462.719 -59.011 611.625 1.00 127.60 ? 972  HIS A CB    1 
ATOM   7309  C  CG    . HIS A 1  972  ? 463.147 -57.964 612.606 1.00 125.87 ? 972  HIS A CG    1 
ATOM   7310  N  ND1   . HIS A 1  972  ? 462.445 -57.693 613.760 1.00 124.81 ? 972  HIS A ND1   1 
ATOM   7311  C  CD2   . HIS A 1  972  ? 464.207 -57.121 612.604 1.00 124.65 ? 972  HIS A CD2   1 
ATOM   7312  C  CE1   . HIS A 1  972  ? 463.053 -56.729 614.428 1.00 121.80 ? 972  HIS A CE1   1 
ATOM   7313  N  NE2   . HIS A 1  972  ? 464.125 -56.363 613.747 1.00 123.14 ? 972  HIS A NE2   1 
ATOM   7314  N  N     . ILE A 1  973  ? 460.850 -59.201 608.412 1.00 105.57 ? 973  ILE A N     1 
ATOM   7315  C  CA    . ILE A 1  973  ? 460.650 -60.111 607.293 1.00 109.10 ? 973  ILE A CA    1 
ATOM   7316  C  C     . ILE A 1  973  ? 461.780 -59.983 606.269 1.00 110.61 ? 973  ILE A C     1 
ATOM   7317  O  O     . ILE A 1  973  ? 462.156 -58.878 605.873 1.00 108.52 ? 973  ILE A O     1 
ATOM   7318  C  CB    . ILE A 1  973  ? 459.284 -59.868 606.608 1.00 109.33 ? 973  ILE A CB    1 
ATOM   7319  C  CG1   . ILE A 1  973  ? 459.140 -60.744 605.360 1.00 111.36 ? 973  ILE A CG1   1 
ATOM   7320  C  CG2   . ILE A 1  973  ? 459.096 -58.393 606.270 1.00 100.59 ? 973  ILE A CG2   1 
ATOM   7321  C  CD1   . ILE A 1  973  ? 459.142 -62.232 605.650 1.00 110.20 ? 973  ILE A CD1   1 
ATOM   7322  N  N     . ASP A 1  974  ? 462.329 -61.123 605.860 1.00 114.63 ? 974  ASP A N     1 
ATOM   7323  C  CA    . ASP A 1  974  ? 463.403 -61.147 604.874 1.00 116.16 ? 974  ASP A CA    1 
ATOM   7324  C  C     . ASP A 1  974  ? 462.844 -61.161 603.455 1.00 114.22 ? 974  ASP A C     1 
ATOM   7325  O  O     . ASP A 1  974  ? 461.733 -61.639 603.219 1.00 110.66 ? 974  ASP A O     1 
ATOM   7326  C  CB    . ASP A 1  974  ? 464.309 -62.361 605.096 1.00 117.15 ? 974  ASP A CB    1 
ATOM   7327  C  CG    . ASP A 1  974  ? 463.555 -63.672 605.016 1.00 116.32 ? 974  ASP A CG    1 
ATOM   7328  O  OD1   . ASP A 1  974  ? 462.358 -63.693 605.372 1.00 115.67 ? 974  ASP A OD1   1 
ATOM   7329  O  OD2   . ASP A 1  974  ? 464.159 -64.682 604.598 1.00 118.23 ? 974  ASP A OD2   1 
ATOM   7330  N  N     . HIS A 1  975  ? 463.623 -60.640 602.513 1.00 152.24 ? 975  HIS A N     1 
ATOM   7331  C  CA    . HIS A 1  975  ? 463.186 -60.530 601.126 1.00 151.37 ? 975  HIS A CA    1 
ATOM   7332  C  C     . HIS A 1  975  ? 463.502 -61.792 600.326 1.00 154.76 ? 975  HIS A C     1 
ATOM   7333  O  O     . HIS A 1  975  ? 463.583 -61.755 599.099 1.00 153.75 ? 975  HIS A O     1 
ATOM   7334  C  CB    . HIS A 1  975  ? 463.831 -59.312 600.462 1.00 151.44 ? 975  HIS A CB    1 
ATOM   7335  C  CG    . HIS A 1  975  ? 463.480 -58.010 601.114 1.00 152.51 ? 975  HIS A CG    1 
ATOM   7336  N  ND1   . HIS A 1  975  ? 462.477 -57.894 602.054 1.00 150.18 ? 975  HIS A ND1   1 
ATOM   7337  C  CD2   . HIS A 1  975  ? 463.999 -56.769 600.965 1.00 152.01 ? 975  HIS A CD2   1 
ATOM   7338  C  CE1   . HIS A 1  975  ? 462.393 -56.638 602.452 1.00 146.55 ? 975  HIS A CE1   1 
ATOM   7339  N  NE2   . HIS A 1  975  ? 463.306 -55.934 601.807 1.00 148.52 ? 975  HIS A NE2   1 
ATOM   7340  N  N     . THR A 1  976  ? 463.682 -62.906 601.029 1.00 125.07 ? 976  THR A N     1 
ATOM   7341  C  CA    . THR A 1  976  ? 463.934 -64.190 600.385 1.00 125.73 ? 976  THR A CA    1 
ATOM   7342  C  C     . THR A 1  976  ? 463.186 -65.300 601.120 1.00 123.71 ? 976  THR A C     1 
ATOM   7343  O  O     . THR A 1  976  ? 463.792 -66.237 601.641 1.00 122.39 ? 976  THR A O     1 
ATOM   7344  C  CB    . THR A 1  976  ? 465.441 -64.521 600.339 1.00 125.79 ? 976  THR A CB    1 
ATOM   7345  O  OG1   . THR A 1  976  ? 466.188 -63.329 600.064 1.00 123.94 ? 976  THR A OG1   1 
ATOM   7346  C  CG2   . THR A 1  976  ? 465.732 -65.558 599.260 1.00 127.78 ? 976  THR A CG2   1 
ATOM   7347  N  N     . LYS A 1  977  ? 461.863 -65.177 601.163 1.00 127.72 ? 977  LYS A N     1 
ATOM   7348  C  CA    . LYS A 1  977  ? 461.017 -66.149 601.847 1.00 128.60 ? 977  LYS A CA    1 
ATOM   7349  C  C     . LYS A 1  977  ? 459.570 -66.021 601.383 1.00 126.50 ? 977  LYS A C     1 
ATOM   7350  O  O     . LYS A 1  977  ? 459.015 -64.922 601.370 1.00 123.87 ? 977  LYS A O     1 
ATOM   7351  C  CB    . LYS A 1  977  ? 461.105 -65.965 603.364 1.00 129.13 ? 977  LYS A CB    1 
ATOM   7352  C  CG    . LYS A 1  977  ? 460.305 -66.979 604.167 1.00 128.45 ? 977  LYS A CG    1 
ATOM   7353  C  CD    . LYS A 1  977  ? 461.210 -67.828 605.049 1.00 132.70 ? 977  LYS A CD    1 
ATOM   7354  C  CE    . LYS A 1  977  ? 462.207 -68.626 604.222 1.00 136.60 ? 977  LYS A CE    1 
ATOM   7355  N  NZ    . LYS A 1  977  ? 463.114 -69.441 605.076 1.00 137.50 ? 977  LYS A NZ    1 
ATOM   7356  N  N     . PRO A 1  978  ? 458.954 -67.150 600.999 1.00 92.24  ? 978  PRO A N     1 
ATOM   7357  C  CA    . PRO A 1  978  ? 457.570 -67.162 600.510 1.00 88.60  ? 978  PRO A CA    1 
ATOM   7358  C  C     . PRO A 1  978  ? 456.560 -66.729 601.570 1.00 84.95  ? 978  PRO A C     1 
ATOM   7359  O  O     . PRO A 1  978  ? 456.523 -67.298 602.662 1.00 84.48  ? 978  PRO A O     1 
ATOM   7360  C  CB    . PRO A 1  978  ? 457.351 -68.627 600.113 1.00 90.48  ? 978  PRO A CB    1 
ATOM   7361  C  CG    . PRO A 1  978  ? 458.354 -69.392 600.909 1.00 93.21  ? 978  PRO A CG    1 
ATOM   7362  C  CD    . PRO A 1  978  ? 459.550 -68.497 600.999 1.00 95.11  ? 978  PRO A CD    1 
ATOM   7363  N  N     . SER A 1  979  ? 455.754 -65.725 601.240 1.00 59.55  ? 979  SER A N     1 
ATOM   7364  C  CA    . SER A 1  979  ? 454.721 -65.230 602.142 1.00 58.59  ? 979  SER A CA    1 
ATOM   7365  C  C     . SER A 1  979  ? 453.645 -66.282 602.376 1.00 59.72  ? 979  SER A C     1 
ATOM   7366  O  O     . SER A 1  979  ? 453.219 -66.957 601.442 1.00 60.42  ? 979  SER A O     1 
ATOM   7367  C  CB    . SER A 1  979  ? 454.091 -63.954 601.583 1.00 56.63  ? 979  SER A CB    1 
ATOM   7368  O  OG    . SER A 1  979  ? 453.002 -63.530 602.386 1.00 55.82  ? 979  SER A OG    1 
ATOM   7369  N  N     . ASP A 1  980  ? 453.202 -66.410 603.622 1.00 67.30  ? 980  ASP A N     1 
ATOM   7370  C  CA    . ASP A 1  980  ? 452.179 -67.390 603.973 1.00 68.71  ? 980  ASP A CA    1 
ATOM   7371  C  C     . ASP A 1  980  ? 450.768 -66.847 603.756 1.00 67.37  ? 980  ASP A C     1 
ATOM   7372  O  O     . ASP A 1  980  ? 449.800 -67.369 604.310 1.00 68.06  ? 980  ASP A O     1 
ATOM   7373  C  CB    . ASP A 1  980  ? 452.348 -67.839 605.425 1.00 72.86  ? 980  ASP A CB    1 
ATOM   7374  C  CG    . ASP A 1  980  ? 452.365 -66.676 606.395 1.00 69.05  ? 980  ASP A CG    1 
ATOM   7375  O  OD1   . ASP A 1  980  ? 452.933 -65.620 606.046 1.00 67.77  ? 980  ASP A OD1   1 
ATOM   7376  O  OD2   . ASP A 1  980  ? 451.810 -66.818 607.505 1.00 68.48  ? 980  ASP A OD2   1 
ATOM   7377  N  N     . LEU A 1  981  ? 450.658 -65.800 602.945 1.00 77.71  ? 981  LEU A N     1 
ATOM   7378  C  CA    . LEU A 1  981  ? 449.366 -65.208 602.621 1.00 76.00  ? 981  LEU A CA    1 
ATOM   7379  C  C     . LEU A 1  981  ? 448.609 -66.031 601.585 1.00 78.96  ? 981  LEU A C     1 
ATOM   7380  O  O     . LEU A 1  981  ? 449.061 -67.096 601.165 1.00 82.66  ? 981  LEU A O     1 
ATOM   7381  C  CB    . LEU A 1  981  ? 449.549 -63.777 602.110 1.00 73.89  ? 981  LEU A CB    1 
ATOM   7382  C  CG    . LEU A 1  981  ? 449.738 -62.681 603.159 1.00 71.71  ? 981  LEU A CG    1 
ATOM   7383  C  CD1   . LEU A 1  981  ? 450.248 -61.405 602.512 1.00 66.91  ? 981  LEU A CD1   1 
ATOM   7384  C  CD2   . LEU A 1  981  ? 448.428 -62.424 603.885 1.00 71.08  ? 981  LEU A CD2   1 
ATOM   7385  N  N     . THR A 1  982  ? 447.448 -65.527 601.184 1.00 60.61  ? 982  THR A N     1 
ATOM   7386  C  CA    . THR A 1  982  ? 446.652 -66.144 600.131 1.00 61.31  ? 982  THR A CA    1 
ATOM   7387  C  C     . THR A 1  982  ? 445.961 -65.037 599.342 1.00 59.76  ? 982  THR A C     1 
ATOM   7388  O  O     . THR A 1  982  ? 445.773 -63.934 599.857 1.00 58.34  ? 982  THR A O     1 
ATOM   7389  C  CB    . THR A 1  982  ? 445.601 -67.128 600.698 1.00 62.69  ? 982  THR A CB    1 
ATOM   7390  O  OG1   . THR A 1  982  ? 446.184 -67.908 601.749 1.00 63.93  ? 982  THR A OG1   1 
ATOM   7391  C  CG2   . THR A 1  982  ? 445.081 -68.063 599.611 1.00 63.91  ? 982  THR A CG2   1 
ATOM   7392  N  N     . ILE A 1  983  ? 445.601 -65.325 598.094 1.00 65.81  ? 983  ILE A N     1 
ATOM   7393  C  CA    . ILE A 1  983  ? 444.889 -64.364 597.259 1.00 63.54  ? 983  ILE A CA    1 
ATOM   7394  C  C     . ILE A 1  983  ? 443.628 -63.876 597.964 1.00 62.95  ? 983  ILE A C     1 
ATOM   7395  O  O     . ILE A 1  983  ? 443.348 -62.677 597.991 1.00 62.23  ? 983  ILE A O     1 
ATOM   7396  C  CB    . ILE A 1  983  ? 444.514 -64.968 595.895 1.00 64.41  ? 983  ILE A CB    1 
ATOM   7397  C  CG1   . ILE A 1  983  ? 445.761 -65.501 595.191 1.00 65.15  ? 983  ILE A CG1   1 
ATOM   7398  C  CG2   . ILE A 1  983  ? 443.813 -63.936 595.028 1.00 63.22  ? 983  ILE A CG2   1 
ATOM   7399  C  CD1   . ILE A 1  983  ? 446.813 -64.449 594.945 1.00 63.88  ? 983  ILE A CD1   1 
ATOM   7400  N  N     . LYS A 1  984  ? 442.885 -64.810 598.550 1.00 68.13  ? 984  LYS A N     1 
ATOM   7401  C  CA    . LYS A 1  984  ? 441.682 -64.474 599.303 1.00 68.07  ? 984  LYS A CA    1 
ATOM   7402  C  C     . LYS A 1  984  ? 442.005 -63.585 600.502 1.00 67.64  ? 984  LYS A C     1 
ATOM   7403  O  O     . LYS A 1  984  ? 441.288 -62.624 600.778 1.00 65.61  ? 984  LYS A O     1 
ATOM   7404  C  CB    . LYS A 1  984  ? 440.967 -65.743 599.772 1.00 72.13  ? 984  LYS A CB    1 
ATOM   7405  C  CG    . LYS A 1  984  ? 440.338 -66.558 598.654 1.00 74.05  ? 984  LYS A CG    1 
ATOM   7406  C  CD    . LYS A 1  984  ? 439.568 -67.745 599.211 1.00 74.44  ? 984  LYS A CD    1 
ATOM   7407  C  CE    . LYS A 1  984  ? 438.899 -68.543 598.104 1.00 75.10  ? 984  LYS A CE    1 
ATOM   7408  N  NZ    . LYS A 1  984  ? 438.174 -69.730 598.636 1.00 82.25  ? 984  LYS A NZ    1 
ATOM   7409  N  N     . ASP A 1  985  ? 443.088 -63.910 601.204 1.00 77.50  ? 985  ASP A N     1 
ATOM   7410  C  CA    . ASP A 1  985  ? 443.516 -63.137 602.366 1.00 76.44  ? 985  ASP A CA    1 
ATOM   7411  C  C     . ASP A 1  985  ? 443.717 -61.668 602.014 1.00 72.78  ? 985  ASP A C     1 
ATOM   7412  O  O     . ASP A 1  985  ? 443.137 -60.782 602.644 1.00 71.29  ? 985  ASP A O     1 
ATOM   7413  C  CB    . ASP A 1  985  ? 444.810 -63.711 602.950 1.00 77.96  ? 985  ASP A CB    1 
ATOM   7414  C  CG    . ASP A 1  985  ? 444.638 -65.120 603.480 1.00 83.18  ? 985  ASP A CG    1 
ATOM   7415  O  OD1   . ASP A 1  985  ? 443.716 -65.823 603.017 1.00 87.19  ? 985  ASP A OD1   1 
ATOM   7416  O  OD2   . ASP A 1  985  ? 445.427 -65.526 604.360 1.00 80.96  ? 985  ASP A OD2   1 
ATOM   7417  N  N     . ILE A 1  986  ? 444.532 -61.419 600.995 1.00 51.08  ? 986  ILE A N     1 
ATOM   7418  C  CA    . ILE A 1  986  ? 444.847 -60.060 600.578 1.00 49.41  ? 986  ILE A CA    1 
ATOM   7419  C  C     . ILE A 1  986  ? 443.643 -59.351 599.969 1.00 48.62  ? 986  ILE A C     1 
ATOM   7420  O  O     . ILE A 1  986  ? 443.237 -58.293 600.447 1.00 47.44  ? 986  ILE A O     1 
ATOM   7421  C  CB    . ILE A 1  986  ? 446.002 -60.041 599.563 1.00 49.38  ? 986  ILE A CB    1 
ATOM   7422  C  CG1   . ILE A 1  986  ? 447.262 -60.638 600.188 1.00 50.14  ? 986  ILE A CG1   1 
ATOM   7423  C  CG2   . ILE A 1  986  ? 446.266 -58.623 599.080 1.00 47.76  ? 986  ILE A CG2   1 
ATOM   7424  C  CD1   . ILE A 1  986  ? 448.479 -60.536 599.308 1.00 50.13  ? 986  ILE A CD1   1 
ATOM   7425  N  N     . VAL A 1  987  ? 443.076 -59.937 598.919 1.00 49.37  ? 987  VAL A N     1 
ATOM   7426  C  CA    . VAL A 1  987  ? 441.974 -59.307 598.195 1.00 48.79  ? 987  VAL A CA    1 
ATOM   7427  C  C     . VAL A 1  987  ? 440.758 -59.065 599.086 1.00 48.66  ? 987  VAL A C     1 
ATOM   7428  O  O     . VAL A 1  987  ? 440.301 -57.928 599.229 1.00 47.46  ? 987  VAL A O     1 
ATOM   7429  C  CB    . VAL A 1  987  ? 441.544 -60.153 596.981 1.00 49.91  ? 987  VAL A CB    1 
ATOM   7430  C  CG1   . VAL A 1  987  ? 440.287 -59.575 596.350 1.00 49.52  ? 987  VAL A CG1   1 
ATOM   7431  C  CG2   . VAL A 1  987  ? 442.672 -60.227 595.962 1.00 49.97  ? 987  VAL A CG2   1 
ATOM   7432  N  N     . LEU A 1  988  ? 440.242 -60.131 599.692 1.00 73.22  ? 988  LEU A N     1 
ATOM   7433  C  CA    . LEU A 1  988  ? 439.053 -60.013 600.528 1.00 73.17  ? 988  LEU A CA    1 
ATOM   7434  C  C     . LEU A 1  988  ? 439.366 -59.260 601.818 1.00 71.99  ? 988  LEU A C     1 
ATOM   7435  O  O     . LEU A 1  988  ? 438.495 -58.598 602.381 1.00 72.50  ? 988  LEU A O     1 
ATOM   7436  C  CB    . LEU A 1  988  ? 438.471 -61.393 600.841 1.00 76.18  ? 988  LEU A CB    1 
ATOM   7437  C  CG    . LEU A 1  988  ? 437.091 -61.421 601.498 1.00 82.26  ? 988  LEU A CG    1 
ATOM   7438  C  CD1   . LEU A 1  988  ? 436.066 -60.726 600.614 1.00 79.25  ? 988  LEU A CD1   1 
ATOM   7439  C  CD2   . LEU A 1  988  ? 436.669 -62.851 601.795 1.00 84.27  ? 988  LEU A CD2   1 
ATOM   7440  N  N     . GLY A 1  989  ? 440.611 -59.354 602.279 1.00 55.89  ? 989  GLY A N     1 
ATOM   7441  C  CA    . GLY A 1  989  ? 441.035 -58.620 603.458 1.00 55.06  ? 989  GLY A CA    1 
ATOM   7442  C  C     . GLY A 1  989  ? 440.964 -57.118 603.251 1.00 53.32  ? 989  GLY A C     1 
ATOM   7443  O  O     . GLY A 1  989  ? 440.350 -56.401 604.043 1.00 52.71  ? 989  GLY A O     1 
ATOM   7444  N  N     . VAL A 1  990  ? 441.593 -56.645 602.179 1.00 45.83  ? 990  VAL A N     1 
ATOM   7445  C  CA    . VAL A 1  990  ? 441.564 -55.229 601.826 1.00 44.29  ? 990  VAL A CA    1 
ATOM   7446  C  C     . VAL A 1  990  ? 440.141 -54.786 601.506 1.00 44.07  ? 990  VAL A C     1 
ATOM   7447  O  O     . VAL A 1  990  ? 439.720 -53.694 601.889 1.00 43.03  ? 990  VAL A O     1 
ATOM   7448  C  CB    . VAL A 1  990  ? 442.480 -54.927 600.620 1.00 43.85  ? 990  VAL A CB    1 
ATOM   7449  C  CG1   . VAL A 1  990  ? 442.323 -53.484 600.172 1.00 42.42  ? 990  VAL A CG1   1 
ATOM   7450  C  CG2   . VAL A 1  990  ? 443.928 -55.220 600.970 1.00 44.02  ? 990  VAL A CG2   1 
ATOM   7451  N  N     . LYS A 1  991  ? 439.398 -55.645 600.815 1.00 68.70  ? 991  LYS A N     1 
ATOM   7452  C  CA    . LYS A 1  991  ? 438.022 -55.328 600.446 1.00 68.52  ? 991  LYS A CA    1 
ATOM   7453  C  C     . LYS A 1  991  ? 437.129 -55.199 601.679 1.00 68.25  ? 991  LYS A C     1 
ATOM   7454  O  O     . LYS A 1  991  ? 436.133 -54.476 601.659 1.00 68.79  ? 991  LYS A O     1 
ATOM   7455  C  CB    . LYS A 1  991  ? 437.464 -56.390 599.496 1.00 70.70  ? 991  LYS A CB    1 
ATOM   7456  C  CG    . LYS A 1  991  ? 436.150 -56.002 598.836 1.00 71.09  ? 991  LYS A CG    1 
ATOM   7457  C  CD    . LYS A 1  991  ? 435.719 -57.031 597.804 1.00 72.45  ? 991  LYS A CD    1 
ATOM   7458  C  CE    . LYS A 1  991  ? 434.438 -56.604 597.106 1.00 73.48  ? 991  LYS A CE    1 
ATOM   7459  N  NZ    . LYS A 1  991  ? 434.029 -57.575 596.055 1.00 78.00  ? 991  LYS A NZ    1 
ATOM   7460  N  N     . ASP A 1  992  ? 437.491 -55.895 602.753 1.00 91.30  ? 992  ASP A N     1 
ATOM   7461  C  CA    . ASP A 1  992  ? 436.720 -55.830 603.990 1.00 93.38  ? 992  ASP A CA    1 
ATOM   7462  C  C     . ASP A 1  992  ? 437.235 -54.740 604.925 1.00 91.73  ? 992  ASP A C     1 
ATOM   7463  O  O     . ASP A 1  992  ? 436.533 -54.325 605.847 1.00 92.74  ? 992  ASP A O     1 
ATOM   7464  C  CB    . ASP A 1  992  ? 436.734 -57.183 604.705 1.00 99.07  ? 992  ASP A CB    1 
ATOM   7465  C  CG    . ASP A 1  992  ? 435.922 -58.237 603.975 1.00 104.65 ? 992  ASP A CG    1 
ATOM   7466  O  OD1   . ASP A 1  992  ? 434.982 -57.863 603.241 1.00 103.17 ? 992  ASP A OD1   1 
ATOM   7467  O  OD2   . ASP A 1  992  ? 436.222 -59.438 604.134 1.00 106.27 ? 992  ASP A OD2   1 
ATOM   7468  N  N     . LEU A 1  993  ? 438.460 -54.281 604.688 1.00 47.51  ? 993  LEU A N     1 
ATOM   7469  C  CA    . LEU A 1  993  ? 439.028 -53.188 605.473 1.00 46.31  ? 993  LEU A CA    1 
ATOM   7470  C  C     . LEU A 1  993  ? 438.301 -51.881 605.177 1.00 45.13  ? 993  LEU A C     1 
ATOM   7471  O  O     . LEU A 1  993  ? 438.101 -51.053 606.066 1.00 44.47  ? 993  LEU A O     1 
ATOM   7472  C  CB    . LEU A 1  993  ? 440.525 -53.036 605.190 1.00 45.78  ? 993  LEU A CB    1 
ATOM   7473  C  CG    . LEU A 1  993  ? 441.225 -51.811 605.788 1.00 44.47  ? 993  LEU A CG    1 
ATOM   7474  C  CD1   . LEU A 1  993  ? 441.102 -51.799 607.304 1.00 44.69  ? 993  LEU A CD1   1 
ATOM   7475  C  CD2   . LEU A 1  993  ? 442.685 -51.760 605.368 1.00 44.16  ? 993  LEU A CD2   1 
ATOM   7476  N  N     . GLN A 1  994  ? 437.901 -51.712 603.921 1.00 58.11  ? 994  GLN A N     1 
ATOM   7477  C  CA    . GLN A 1  994  ? 437.220 -50.501 603.477 1.00 54.56  ? 994  GLN A CA    1 
ATOM   7478  C  C     . GLN A 1  994  ? 435.848 -50.354 604.126 1.00 55.12  ? 994  GLN A C     1 
ATOM   7479  O  O     . GLN A 1  994  ? 435.300 -49.255 604.199 1.00 54.89  ? 994  GLN A O     1 
ATOM   7480  C  CB    . GLN A 1  994  ? 437.077 -50.501 601.954 1.00 53.75  ? 994  GLN A CB    1 
ATOM   7481  C  CG    . GLN A 1  994  ? 438.377 -50.761 601.212 1.00 54.26  ? 994  GLN A CG    1 
ATOM   7482  C  CD    . GLN A 1  994  ? 438.200 -50.756 599.708 1.00 57.60  ? 994  GLN A CD    1 
ATOM   7483  O  OE1   . GLN A 1  994  ? 437.227 -50.211 599.187 1.00 55.60  ? 994  GLN A OE1   1 
ATOM   7484  N  NE2   . GLN A 1  994  ? 439.142 -51.368 599.000 1.00 59.09  ? 994  GLN A NE2   1 
ATOM   7485  N  N     . GLU A 1  995  ? 435.299 -51.469 604.597 1.00 76.48  ? 995  GLU A N     1 
ATOM   7486  C  CA    . GLU A 1  995  ? 433.985 -51.469 605.225 1.00 77.58  ? 995  GLU A CA    1 
ATOM   7487  C  C     . GLU A 1  995  ? 434.047 -50.937 606.653 1.00 78.14  ? 995  GLU A C     1 
ATOM   7488  O  O     . GLU A 1  995  ? 433.022 -50.589 607.239 1.00 75.65  ? 995  GLU A O     1 
ATOM   7489  C  CB    . GLU A 1  995  ? 433.390 -52.880 605.220 1.00 82.65  ? 995  GLU A CB    1 
ATOM   7490  C  CG    . GLU A 1  995  ? 433.346 -53.540 603.848 1.00 84.50  ? 995  GLU A CG    1 
ATOM   7491  C  CD    . GLU A 1  995  ? 432.334 -52.900 602.915 1.00 87.49  ? 995  GLU A CD    1 
ATOM   7492  O  OE1   . GLU A 1  995  ? 432.404 -53.159 601.695 1.00 91.36  ? 995  GLU A OE1   1 
ATOM   7493  O  OE2   . GLU A 1  995  ? 431.465 -52.144 603.399 1.00 82.17  ? 995  GLU A OE2   1 
ATOM   7494  N  N     . ASN A 1  996  ? 435.253 -50.874 607.209 1.00 70.63  ? 996  ASN A N     1 
ATOM   7495  C  CA    . ASN A 1  996  ? 435.438 -50.426 608.585 1.00 70.60  ? 996  ASN A CA    1 
ATOM   7496  C  C     . ASN A 1  996  ? 435.904 -48.976 608.677 1.00 66.17  ? 996  ASN A C     1 
ATOM   7497  O  O     . ASN A 1  996  ? 435.790 -48.346 609.729 1.00 65.56  ? 996  ASN A O     1 
ATOM   7498  C  CB    . ASN A 1  996  ? 436.433 -51.333 609.308 1.00 73.40  ? 996  ASN A CB    1 
ATOM   7499  C  CG    . ASN A 1  996  ? 435.954 -52.768 609.395 1.00 77.28  ? 996  ASN A CG    1 
ATOM   7500  O  OD1   . ASN A 1  996  ? 436.671 -53.697 609.024 1.00 78.62  ? 996  ASN A OD1   1 
ATOM   7501  N  ND2   . ASN A 1  996  ? 434.734 -52.955 609.886 1.00 77.33  ? 996  ASN A ND2   1 
ATOM   7502  N  N     . LEU A 1  997  ? 436.429 -48.453 607.574 1.00 44.17  ? 997  LEU A N     1 
ATOM   7503  C  CA    . LEU A 1  997  ? 436.866 -47.061 607.517 1.00 42.75  ? 997  LEU A CA    1 
ATOM   7504  C  C     . LEU A 1  997  ? 435.668 -46.120 607.590 1.00 42.37  ? 997  LEU A C     1 
ATOM   7505  O  O     . LEU A 1  997  ? 435.295 -45.500 606.594 1.00 41.89  ? 997  LEU A O     1 
ATOM   7506  C  CB    . LEU A 1  997  ? 437.663 -46.798 606.239 1.00 42.12  ? 997  LEU A CB    1 
ATOM   7507  C  CG    . LEU A 1  997  ? 438.836 -47.737 605.960 1.00 42.59  ? 997  LEU A CG    1 
ATOM   7508  C  CD1   . LEU A 1  997  ? 439.482 -47.399 604.626 1.00 42.05  ? 997  LEU A CD1   1 
ATOM   7509  C  CD2   . LEU A 1  997  ? 439.854 -47.677 607.087 1.00 42.40  ? 997  LEU A CD2   1 
ATOM   7510  N  N     . LEU A 1  998  ? 435.075 -46.010 608.774 1.00 49.65  ? 998  LEU A N     1 
ATOM   7511  C  CA    . LEU A 1  998  ? 433.829 -45.271 608.937 1.00 52.06  ? 998  LEU A CA    1 
ATOM   7512  C  C     . LEU A 1  998  ? 434.035 -43.809 609.324 1.00 51.06  ? 998  LEU A C     1 
ATOM   7513  O  O     . LEU A 1  998  ? 434.789 -43.494 610.246 1.00 49.65  ? 998  LEU A O     1 
ATOM   7514  C  CB    . LEU A 1  998  ? 432.947 -45.954 609.983 1.00 52.56  ? 998  LEU A CB    1 
ATOM   7515  C  CG    . LEU A 1  998  ? 432.462 -47.361 609.635 1.00 53.79  ? 998  LEU A CG    1 
ATOM   7516  C  CD1   . LEU A 1  998  ? 431.556 -47.901 610.730 1.00 58.44  ? 998  LEU A CD1   1 
ATOM   7517  C  CD2   . LEU A 1  998  ? 431.747 -47.358 608.294 1.00 55.14  ? 998  LEU A CD2   1 
ATOM   7518  N  N     . VAL A 1  999  ? 433.353 -42.924 608.605 1.00 50.48  ? 999  VAL A N     1 
ATOM   7519  C  CA    . VAL A 1  999  ? 433.307 -41.510 608.950 1.00 47.26  ? 999  VAL A CA    1 
ATOM   7520  C  C     . VAL A 1  999  ? 431.900 -41.169 609.428 1.00 48.31  ? 999  VAL A C     1 
ATOM   7521  O  O     . VAL A 1  999  ? 431.716 -40.582 610.493 1.00 50.71  ? 999  VAL A O     1 
ATOM   7522  C  CB    . VAL A 1  999  ? 433.682 -40.616 607.759 1.00 47.06  ? 999  VAL A CB    1 
ATOM   7523  C  CG1   . VAL A 1  999  ? 433.691 -39.155 608.178 1.00 46.68  ? 999  VAL A CG1   1 
ATOM   7524  C  CG2   . VAL A 1  999  ? 435.033 -41.024 607.198 1.00 46.80  ? 999  VAL A CG2   1 
ATOM   7525  N  N     . LEU A 1  1000 ? 430.912 -41.546 608.623 1.00 40.65  ? 1000 LEU A N     1 
ATOM   7526  C  CA    . LEU A 1  1000 ? 429.512 -41.455 609.016 1.00 41.46  ? 1000 LEU A CA    1 
ATOM   7527  C  C     . LEU A 1  1000 ? 429.017 -42.841 609.415 1.00 43.19  ? 1000 LEU A C     1 
ATOM   7528  O  O     . LEU A 1  1000 ? 429.564 -43.850 608.966 1.00 43.27  ? 1000 LEU A O     1 
ATOM   7529  C  CB    . LEU A 1  1000 ? 428.664 -40.878 607.881 1.00 41.44  ? 1000 LEU A CB    1 
ATOM   7530  C  CG    . LEU A 1  1000 ? 428.847 -39.383 607.612 1.00 40.28  ? 1000 LEU A CG    1 
ATOM   7531  C  CD1   . LEU A 1  1000 ? 428.037 -38.946 606.402 1.00 40.46  ? 1000 LEU A CD1   1 
ATOM   7532  C  CD2   . LEU A 1  1000 ? 428.456 -38.577 608.839 1.00 40.11  ? 1000 LEU A CD2   1 
ATOM   7533  N  N     . ARG A 1  1001 ? 427.988 -42.898 610.254 1.00 58.04  ? 1001 ARG A N     1 
ATOM   7534  C  CA    . ARG A 1  1001 ? 427.568 -44.172 610.828 1.00 62.09  ? 1001 ARG A CA    1 
ATOM   7535  C  C     . ARG A 1  1001 ? 426.055 -44.372 610.823 1.00 64.17  ? 1001 ARG A C     1 
ATOM   7536  O  O     . ARG A 1  1001 ? 425.506 -45.016 611.716 1.00 67.18  ? 1001 ARG A O     1 
ATOM   7537  C  CB    . ARG A 1  1001 ? 428.098 -44.292 612.258 1.00 64.30  ? 1001 ARG A CB    1 
ATOM   7538  C  CG    . ARG A 1  1001 ? 428.909 -45.548 612.523 1.00 63.93  ? 1001 ARG A CG    1 
ATOM   7539  C  CD    . ARG A 1  1001 ? 429.683 -45.418 613.821 1.00 60.83  ? 1001 ARG A CD    1 
ATOM   7540  N  NE    . ARG A 1  1001 ? 430.663 -44.337 613.757 1.00 59.73  ? 1001 ARG A NE    1 
ATOM   7541  C  CZ    . ARG A 1  1001 ? 431.954 -44.515 613.495 1.00 58.82  ? 1001 ARG A CZ    1 
ATOM   7542  N  NH1   . ARG A 1  1001 ? 432.425 -45.735 613.279 1.00 58.45  ? 1001 ARG A NH1   1 
ATOM   7543  N  NH2   . ARG A 1  1001 ? 432.777 -43.475 613.455 1.00 56.25  ? 1001 ARG A NH2   1 
ATOM   7544  N  N     . GLY A 1  1002 ? 425.383 -43.832 609.813 1.00 71.19  ? 1002 GLY A N     1 
ATOM   7545  C  CA    . GLY A 1  1002 ? 423.946 -43.998 609.693 1.00 70.94  ? 1002 GLY A CA    1 
ATOM   7546  C  C     . GLY A 1  1002 ? 423.575 -45.398 609.243 1.00 76.13  ? 1002 GLY A C     1 
ATOM   7547  O  O     . GLY A 1  1002 ? 424.445 -46.249 609.056 1.00 76.86  ? 1002 GLY A O     1 
ATOM   7548  N  N     . LYS A 1  1003 ? 422.279 -45.638 609.070 1.00 97.96  ? 1003 LYS A N     1 
ATOM   7549  C  CA    . LYS A 1  1003 ? 421.795 -46.938 608.619 1.00 98.96  ? 1003 LYS A CA    1 
ATOM   7550  C  C     . LYS A 1  1003 ? 420.928 -46.800 607.373 1.00 98.73  ? 1003 LYS A C     1 
ATOM   7551  O  O     . LYS A 1  1003 ? 420.405 -47.787 606.857 1.00 100.12 ? 1003 LYS A O     1 
ATOM   7552  C  CB    . LYS A 1  1003 ? 421.008 -47.636 609.731 1.00 98.73  ? 1003 LYS A CB    1 
ATOM   7553  C  CG    . LYS A 1  1003 ? 421.834 -47.971 610.963 1.00 103.55 ? 1003 LYS A CG    1 
ATOM   7554  C  CD    . LYS A 1  1003 ? 420.997 -48.691 612.008 1.00 110.48 ? 1003 LYS A CD    1 
ATOM   7555  C  CE    . LYS A 1  1003 ? 421.824 -49.040 613.235 1.00 109.91 ? 1003 LYS A CE    1 
ATOM   7556  N  NZ    . LYS A 1  1003 ? 422.959 -49.946 612.904 1.00 109.00 ? 1003 LYS A NZ    1 
ATOM   7557  N  N     . ASN A 1  1004 ? 420.780 -45.570 606.893 1.00 65.83  ? 1004 ASN A N     1 
ATOM   7558  C  CA    . ASN A 1  1004 ? 419.974 -45.302 605.708 1.00 64.84  ? 1004 ASN A CA    1 
ATOM   7559  C  C     . ASN A 1  1004 ? 420.829 -45.157 604.454 1.00 62.79  ? 1004 ASN A C     1 
ATOM   7560  O  O     . ASN A 1  1004 ? 422.054 -45.071 604.534 1.00 59.70  ? 1004 ASN A O     1 
ATOM   7561  C  CB    . ASN A 1  1004 ? 419.132 -44.043 605.913 1.00 64.57  ? 1004 ASN A CB    1 
ATOM   7562  C  CG    . ASN A 1  1004 ? 419.976 -42.819 606.206 1.00 63.97  ? 1004 ASN A CG    1 
ATOM   7563  O  OD1   . ASN A 1  1004 ? 420.462 -42.153 605.291 1.00 62.07  ? 1004 ASN A OD1   1 
ATOM   7564  N  ND2   . ASN A 1  1004 ? 420.148 -42.511 607.487 1.00 64.55  ? 1004 ASN A ND2   1 
ATOM   7565  N  N     . GLU A 1  1005 ? 420.173 -45.122 603.299 1.00 97.27  ? 1005 GLU A N     1 
ATOM   7566  C  CA    . GLU A 1  1005 ? 420.863 -45.087 602.013 1.00 96.11  ? 1005 GLU A CA    1 
ATOM   7567  C  C     . GLU A 1  1005 ? 421.696 -43.820 601.823 1.00 92.63  ? 1005 GLU A C     1 
ATOM   7568  O  O     . GLU A 1  1005 ? 422.837 -43.886 601.366 1.00 93.39  ? 1005 GLU A O     1 
ATOM   7569  C  CB    . GLU A 1  1005 ? 419.851 -45.215 600.870 1.00 100.54 ? 1005 GLU A CB    1 
ATOM   7570  C  CG    . GLU A 1  1005 ? 420.471 -45.273 599.479 1.00 103.42 ? 1005 GLU A CG    1 
ATOM   7571  C  CD    . GLU A 1  1005 ? 421.126 -46.610 599.178 1.00 106.26 ? 1005 GLU A CD    1 
ATOM   7572  O  OE1   . GLU A 1  1005 ? 422.197 -46.901 599.752 1.00 106.06 ? 1005 GLU A OE1   1 
ATOM   7573  O  OE2   . GLU A 1  1005 ? 420.567 -47.371 598.361 1.00 109.41 ? 1005 GLU A OE2   1 
ATOM   7574  N  N     . ILE A 1  1006 ? 421.119 -42.675 602.176 1.00 56.40  ? 1006 ILE A N     1 
ATOM   7575  C  CA    . ILE A 1  1006 ? 421.781 -41.383 602.002 1.00 53.73  ? 1006 ILE A CA    1 
ATOM   7576  C  C     . ILE A 1  1006 ? 423.116 -41.309 602.738 1.00 52.47  ? 1006 ILE A C     1 
ATOM   7577  O  O     . ILE A 1  1006 ? 424.148 -40.978 602.148 1.00 51.45  ? 1006 ILE A O     1 
ATOM   7578  C  CB    . ILE A 1  1006 ? 420.886 -40.227 602.490 1.00 53.76  ? 1006 ILE A CB    1 
ATOM   7579  C  CG1   . ILE A 1  1006 ? 419.565 -40.211 601.720 1.00 55.07  ? 1006 ILE A CG1   1 
ATOM   7580  C  CG2   . ILE A 1  1006 ? 421.604 -38.896 602.338 1.00 52.30  ? 1006 ILE A CG2   1 
ATOM   7581  C  CD1   . ILE A 1  1006 ? 419.727 -39.978 600.233 1.00 58.74  ? 1006 ILE A CD1   1 
ATOM   7582  N  N     . ILE A 1  1007 ? 423.087 -41.624 604.029 1.00 51.85  ? 1007 ILE A N     1 
ATOM   7583  C  CA    . ILE A 1  1007 ? 424.277 -41.547 604.865 1.00 50.81  ? 1007 ILE A CA    1 
ATOM   7584  C  C     . ILE A 1  1007 ? 425.344 -42.539 604.406 1.00 50.68  ? 1007 ILE A C     1 
ATOM   7585  O  O     . ILE A 1  1007 ? 426.535 -42.238 604.453 1.00 49.58  ? 1007 ILE A O     1 
ATOM   7586  C  CB    . ILE A 1  1007 ? 423.937 -41.800 606.349 1.00 51.33  ? 1007 ILE A CB    1 
ATOM   7587  C  CG1   . ILE A 1  1007 ? 422.923 -40.769 606.845 1.00 51.49  ? 1007 ILE A CG1   1 
ATOM   7588  C  CG2   . ILE A 1  1007 ? 425.186 -41.734 607.207 1.00 50.35  ? 1007 ILE A CG2   1 
ATOM   7589  C  CD1   . ILE A 1  1007 ? 423.425 -39.343 606.790 1.00 50.10  ? 1007 ILE A CD1   1 
ATOM   7590  N  N     . GLN A 1  1008 ? 424.919 -43.713 603.949 1.00 50.19  ? 1008 GLN A N     1 
ATOM   7591  C  CA    . GLN A 1  1008 ? 425.861 -44.712 603.453 1.00 51.41  ? 1008 GLN A CA    1 
ATOM   7592  C  C     . GLN A 1  1008 ? 426.513 -44.262 602.147 1.00 51.86  ? 1008 GLN A C     1 
ATOM   7593  O  O     . GLN A 1  1008 ? 427.705 -44.493 601.925 1.00 50.59  ? 1008 GLN A O     1 
ATOM   7594  C  CB    . GLN A 1  1008 ? 425.165 -46.060 603.261 1.00 54.44  ? 1008 GLN A CB    1 
ATOM   7595  C  CG    . GLN A 1  1008 ? 424.765 -46.734 604.562 1.00 54.88  ? 1008 GLN A CG    1 
ATOM   7596  C  CD    . GLN A 1  1008 ? 425.944 -46.960 605.487 1.00 54.88  ? 1008 GLN A CD    1 
ATOM   7597  O  OE1   . GLN A 1  1008 ? 426.971 -47.506 605.083 1.00 53.77  ? 1008 GLN A OE1   1 
ATOM   7598  N  NE2   . GLN A 1  1008 ? 425.805 -46.533 606.737 1.00 53.53  ? 1008 GLN A NE2   1 
ATOM   7599  N  N     . ASN A 1  1009 ? 425.728 -43.621 601.286 1.00 63.56  ? 1009 ASN A N     1 
ATOM   7600  C  CA    . ASN A 1  1009 ? 426.258 -43.062 600.048 1.00 63.99  ? 1009 ASN A CA    1 
ATOM   7601  C  C     . ASN A 1  1009 ? 427.273 -41.966 600.343 1.00 60.39  ? 1009 ASN A C     1 
ATOM   7602  O  O     . ASN A 1  1009 ? 428.333 -41.900 599.717 1.00 60.44  ? 1009 ASN A O     1 
ATOM   7603  C  CB    . ASN A 1  1009 ? 425.131 -42.515 599.171 1.00 65.32  ? 1009 ASN A CB    1 
ATOM   7604  C  CG    . ASN A 1  1009 ? 424.230 -43.609 598.628 1.00 65.92  ? 1009 ASN A CG    1 
ATOM   7605  O  OD1   . ASN A 1  1009 ? 424.645 -44.760 598.491 1.00 65.71  ? 1009 ASN A OD1   1 
ATOM   7606  N  ND2   . ASN A 1  1009 ? 422.991 -43.252 598.311 1.00 67.63  ? 1009 ASN A ND2   1 
ATOM   7607  N  N     . ALA A 1  1010 ? 426.944 -41.111 601.307 1.00 53.80  ? 1010 ALA A N     1 
ATOM   7608  C  CA    . ALA A 1  1010 ? 427.861 -40.065 601.744 1.00 52.64  ? 1010 ALA A CA    1 
ATOM   7609  C  C     . ALA A 1  1010 ? 429.129 -40.680 602.327 1.00 50.77  ? 1010 ALA A C     1 
ATOM   7610  O  O     . ALA A 1  1010 ? 430.223 -40.130 602.191 1.00 48.73  ? 1010 ALA A O     1 
ATOM   7611  C  CB    . ALA A 1  1010 ? 427.189 -39.160 602.765 1.00 51.07  ? 1010 ALA A CB    1 
ATOM   7612  N  N     . GLN A 1  1011 ? 428.968 -41.832 602.971 1.00 55.22  ? 1011 GLN A N     1 
ATOM   7613  C  CA    . GLN A 1  1011 ? 430.082 -42.552 603.570 1.00 55.10  ? 1011 GLN A CA    1 
ATOM   7614  C  C     . GLN A 1  1011 ? 431.036 -43.077 602.508 1.00 53.95  ? 1011 GLN A C     1 
ATOM   7615  O  O     . GLN A 1  1011 ? 432.243 -42.875 602.599 1.00 55.08  ? 1011 GLN A O     1 
ATOM   7616  C  CB    . GLN A 1  1011 ? 429.571 -43.706 604.433 1.00 54.42  ? 1011 GLN A CB    1 
ATOM   7617  C  CG    . GLN A 1  1011 ? 430.630 -44.738 604.785 1.00 54.51  ? 1011 GLN A CG    1 
ATOM   7618  C  CD    . GLN A 1  1011 ? 431.718 -44.185 605.682 1.00 53.00  ? 1011 GLN A CD    1 
ATOM   7619  O  OE1   . GLN A 1  1011 ? 431.524 -43.183 606.371 1.00 54.06  ? 1011 GLN A OE1   1 
ATOM   7620  N  NE2   . GLN A 1  1011 ? 432.873 -44.838 605.678 1.00 52.87  ? 1011 GLN A NE2   1 
ATOM   7621  N  N     . ARG A 1  1012 ? 430.494 -43.748 601.498 1.00 72.69  ? 1012 ARG A N     1 
ATOM   7622  C  CA    . ARG A 1  1012 ? 431.325 -44.269 600.418 1.00 73.95  ? 1012 ARG A CA    1 
ATOM   7623  C  C     . ARG A 1  1012 ? 431.923 -43.141 599.579 1.00 74.15  ? 1012 ARG A C     1 
ATOM   7624  O  O     . ARG A 1  1012 ? 432.983 -43.303 598.975 1.00 72.73  ? 1012 ARG A O     1 
ATOM   7625  C  CB    . ARG A 1  1012 ? 430.523 -45.224 599.533 1.00 78.77  ? 1012 ARG A CB    1 
ATOM   7626  C  CG    . ARG A 1  1012 ? 430.425 -46.636 600.091 1.00 82.12  ? 1012 ARG A CG    1 
ATOM   7627  C  CD    . ARG A 1  1012 ? 429.624 -47.555 599.180 1.00 86.37  ? 1012 ARG A CD    1 
ATOM   7628  N  NE    . ARG A 1  1012 ? 428.185 -47.342 599.306 1.00 86.62  ? 1012 ARG A NE    1 
ATOM   7629  C  CZ    . ARG A 1  1012 ? 427.464 -46.579 598.490 1.00 87.51  ? 1012 ARG A CZ    1 
ATOM   7630  N  NH1   . ARG A 1  1012 ? 428.044 -45.949 597.477 1.00 85.89  ? 1012 ARG A NH1   1 
ATOM   7631  N  NH2   . ARG A 1  1012 ? 426.160 -46.449 598.686 1.00 86.39  ? 1012 ARG A NH2   1 
ATOM   7632  N  N     . ASP A 1  1013 ? 431.243 -41.998 599.549 1.00 64.37  ? 1013 ASP A N     1 
ATOM   7633  C  CA    . ASP A 1  1013 ? 431.750 -40.836 598.827 1.00 62.95  ? 1013 ASP A CA    1 
ATOM   7634  C  C     . ASP A 1  1013 ? 432.915 -40.181 599.566 1.00 61.06  ? 1013 ASP A C     1 
ATOM   7635  O  O     . ASP A 1  1013 ? 433.876 -39.725 598.947 1.00 62.08  ? 1013 ASP A O     1 
ATOM   7636  C  CB    . ASP A 1  1013 ? 430.636 -39.811 598.602 1.00 64.92  ? 1013 ASP A CB    1 
ATOM   7637  C  CG    . ASP A 1  1013 ? 429.684 -40.216 597.494 1.00 67.94  ? 1013 ASP A CG    1 
ATOM   7638  O  OD1   . ASP A 1  1013 ? 430.120 -40.928 596.564 1.00 68.14  ? 1013 ASP A OD1   1 
ATOM   7639  O  OD2   . ASP A 1  1013 ? 428.502 -39.816 597.551 1.00 70.15  ? 1013 ASP A OD2   1 
ATOM   7640  N  N     . ALA A 1  1014 ? 432.824 -40.140 600.891 1.00 48.24  ? 1014 ALA A N     1 
ATOM   7641  C  CA    . ALA A 1  1014 ? 433.821 -39.457 601.709 1.00 45.41  ? 1014 ALA A CA    1 
ATOM   7642  C  C     . ALA A 1  1014 ? 435.148 -40.213 601.775 1.00 44.13  ? 1014 ALA A C     1 
ATOM   7643  O  O     . ALA A 1  1014 ? 436.204 -39.609 601.960 1.00 43.01  ? 1014 ALA A O     1 
ATOM   7644  C  CB    . ALA A 1  1014 ? 433.278 -39.234 603.112 1.00 43.85  ? 1014 ALA A CB    1 
ATOM   7645  N  N     . VAL A 1  1015 ? 435.091 -41.532 601.623 1.00 41.44  ? 1015 VAL A N     1 
ATOM   7646  C  CA    . VAL A 1  1015 ? 436.281 -42.364 601.767 1.00 40.56  ? 1015 VAL A CA    1 
ATOM   7647  C  C     . VAL A 1  1015 ? 436.765 -42.881 600.410 1.00 40.93  ? 1015 VAL A C     1 
ATOM   7648  O  O     . VAL A 1  1015 ? 437.680 -43.701 600.337 1.00 41.23  ? 1015 VAL A O     1 
ATOM   7649  C  CB    . VAL A 1  1015 ? 436.011 -43.556 602.718 1.00 41.43  ? 1015 VAL A CB    1 
ATOM   7650  C  CG1   . VAL A 1  1015 ? 437.310 -44.090 603.304 1.00 43.63  ? 1015 VAL A CG1   1 
ATOM   7651  C  CG2   . VAL A 1  1015 ? 435.092 -43.129 603.845 1.00 41.41  ? 1015 VAL A CG2   1 
ATOM   7652  N  N     . THR A 1  1016 ? 436.159 -42.384 599.336 1.00 41.49  ? 1016 THR A N     1 
ATOM   7653  C  CA    . THR A 1  1016 ? 436.496 -42.826 597.984 1.00 42.48  ? 1016 THR A CA    1 
ATOM   7654  C  C     . THR A 1  1016 ? 437.980 -42.647 597.657 1.00 42.21  ? 1016 THR A C     1 
ATOM   7655  O  O     . THR A 1  1016 ? 438.639 -43.585 597.202 1.00 43.32  ? 1016 THR A O     1 
ATOM   7656  C  CB    . THR A 1  1016 ? 435.662 -42.075 596.929 1.00 43.02  ? 1016 THR A CB    1 
ATOM   7657  O  OG1   . THR A 1  1016 ? 434.272 -42.362 597.125 1.00 46.38  ? 1016 THR A OG1   1 
ATOM   7658  C  CG2   . THR A 1  1016 ? 436.069 -42.498 595.524 1.00 43.32  ? 1016 THR A CG2   1 
ATOM   7659  N  N     . LEU A 1  1017 ? 438.502 -41.448 597.898 1.00 38.55  ? 1017 LEU A N     1 
ATOM   7660  C  CA    . LEU A 1  1017 ? 439.901 -41.145 597.611 1.00 38.12  ? 1017 LEU A CA    1 
ATOM   7661  C  C     . LEU A 1  1017 ? 440.843 -42.023 598.428 1.00 39.69  ? 1017 LEU A C     1 
ATOM   7662  O  O     . LEU A 1  1017 ? 441.753 -42.655 597.882 1.00 40.35  ? 1017 LEU A O     1 
ATOM   7663  C  CB    . LEU A 1  1017 ? 440.198 -39.670 597.888 1.00 37.11  ? 1017 LEU A CB    1 
ATOM   7664  C  CG    . LEU A 1  1017 ? 441.000 -38.901 596.836 1.00 36.86  ? 1017 LEU A CG    1 
ATOM   7665  C  CD1   . LEU A 1  1017 ? 441.275 -37.482 597.309 1.00 35.93  ? 1017 LEU A CD1   1 
ATOM   7666  C  CD2   . LEU A 1  1017 ? 442.299 -39.613 596.502 1.00 37.17  ? 1017 LEU A CD2   1 
ATOM   7667  N  N     . PHE A 1  1018 ? 440.622 -42.061 599.739 1.00 36.51  ? 1018 PHE A N     1 
ATOM   7668  C  CA    . PHE A 1  1018 ? 441.482 -42.840 600.620 1.00 36.74  ? 1018 PHE A CA    1 
ATOM   7669  C  C     . PHE A 1  1018 ? 441.413 -44.323 600.285 1.00 37.86  ? 1018 PHE A C     1 
ATOM   7670  O  O     . PHE A 1  1018 ? 442.381 -45.053 600.482 1.00 38.24  ? 1018 PHE A O     1 
ATOM   7671  C  CB    . PHE A 1  1018 ? 441.115 -42.621 602.087 1.00 36.46  ? 1018 PHE A CB    1 
ATOM   7672  C  CG    . PHE A 1  1018 ? 441.970 -43.406 603.040 1.00 36.81  ? 1018 PHE A CG    1 
ATOM   7673  C  CD1   . PHE A 1  1018 ? 443.296 -43.058 603.244 1.00 36.39  ? 1018 PHE A CD1   1 
ATOM   7674  C  CD2   . PHE A 1  1018 ? 441.456 -44.495 603.721 1.00 37.68  ? 1018 PHE A CD2   1 
ATOM   7675  C  CE1   . PHE A 1  1018 ? 444.090 -43.780 604.113 1.00 36.82  ? 1018 PHE A CE1   1 
ATOM   7676  C  CE2   . PHE A 1  1018 ? 442.247 -45.220 604.591 1.00 38.12  ? 1018 PHE A CE2   1 
ATOM   7677  C  CZ    . PHE A 1  1018 ? 443.565 -44.861 604.788 1.00 37.69  ? 1018 PHE A CZ    1 
ATOM   7678  N  N     . CYS A 1  1019 ? 440.268 -44.765 599.778 1.00 48.66  ? 1019 CYS A N     1 
ATOM   7679  C  CA    . CYS A 1  1019 ? 440.123 -46.152 599.360 1.00 48.00  ? 1019 CYS A CA    1 
ATOM   7680  C  C     . CYS A 1  1019 ? 440.863 -46.395 598.053 1.00 49.22  ? 1019 CYS A C     1 
ATOM   7681  O  O     . CYS A 1  1019 ? 441.354 -47.495 597.812 1.00 52.79  ? 1019 CYS A O     1 
ATOM   7682  C  CB    . CYS A 1  1019 ? 438.648 -46.529 599.221 1.00 49.86  ? 1019 CYS A CB    1 
ATOM   7683  S  SG    . CYS A 1  1019 ? 437.805 -46.771 600.803 1.00 50.61  ? 1019 CYS A SG    1 
ATOM   7684  N  N     . CYS A 1  1020 ? 440.943 -45.370 597.209 1.00 47.26  ? 1020 CYS A N     1 
ATOM   7685  C  CA    . CYS A 1  1020 ? 441.770 -45.455 596.009 1.00 47.50  ? 1020 CYS A CA    1 
ATOM   7686  C  C     . CYS A 1  1020 ? 443.228 -45.629 596.415 1.00 47.37  ? 1020 CYS A C     1 
ATOM   7687  O  O     . CYS A 1  1020 ? 443.950 -46.453 595.847 1.00 48.08  ? 1020 CYS A O     1 
ATOM   7688  C  CB    . CYS A 1  1020 ? 441.604 -44.214 595.129 1.00 46.93  ? 1020 CYS A CB    1 
ATOM   7689  S  SG    . CYS A 1  1020 ? 440.002 -44.083 594.306 0.74 47.38  ? 1020 CYS A SG    1 
ATOM   7690  N  N     . LEU A 1  1021 ? 443.649 -44.854 597.411 1.00 40.03  ? 1021 LEU A N     1 
ATOM   7691  C  CA    . LEU A 1  1021 ? 445.001 -44.968 597.948 1.00 39.93  ? 1021 LEU A CA    1 
ATOM   7692  C  C     . LEU A 1  1021 ? 445.246 -46.354 598.535 1.00 40.84  ? 1021 LEU A C     1 
ATOM   7693  O  O     . LEU A 1  1021 ? 446.311 -46.947 598.344 1.00 41.35  ? 1021 LEU A O     1 
ATOM   7694  C  CB    . LEU A 1  1021 ? 445.247 -43.902 599.016 1.00 38.94  ? 1021 LEU A CB    1 
ATOM   7695  C  CG    . LEU A 1  1021 ? 446.596 -43.989 599.732 1.00 38.88  ? 1021 LEU A CG    1 
ATOM   7696  C  CD1   . LEU A 1  1021 ? 447.734 -43.756 598.750 1.00 38.99  ? 1021 LEU A CD1   1 
ATOM   7697  C  CD2   . LEU A 1  1021 ? 446.664 -43.005 600.890 1.00 38.00  ? 1021 LEU A CD2   1 
ATOM   7698  N  N     . LEU A 1  1022 ? 444.246 -46.862 599.246 1.00 39.34  ? 1022 LEU A N     1 
ATOM   7699  C  CA    . LEU A 1  1022 ? 444.333 -48.160 599.902 1.00 40.30  ? 1022 LEU A CA    1 
ATOM   7700  C  C     . LEU A 1  1022 ? 444.494 -49.283 598.882 1.00 41.39  ? 1022 LEU A C     1 
ATOM   7701  O  O     . LEU A 1  1022 ? 445.400 -50.109 598.996 1.00 42.07  ? 1022 LEU A O     1 
ATOM   7702  C  CB    . LEU A 1  1022 ? 443.091 -48.400 600.763 1.00 40.50  ? 1022 LEU A CB    1 
ATOM   7703  C  CG    . LEU A 1  1022 ? 443.130 -49.587 601.723 1.00 41.47  ? 1022 LEU A CG    1 
ATOM   7704  C  CD1   . LEU A 1  1022 ? 444.238 -49.402 602.745 1.00 41.19  ? 1022 LEU A CD1   1 
ATOM   7705  C  CD2   . LEU A 1  1022 ? 441.784 -49.756 602.409 1.00 41.76  ? 1022 LEU A CD2   1 
ATOM   7706  N  N     . ARG A 1  1023 ? 443.613 -49.303 597.887 1.00 38.71  ? 1023 ARG A N     1 
ATOM   7707  C  CA    . ARG A 1  1023 ? 443.671 -50.305 596.830 1.00 39.77  ? 1023 ARG A CA    1 
ATOM   7708  C  C     . ARG A 1  1023 ? 444.977 -50.202 596.052 1.00 39.80  ? 1023 ARG A C     1 
ATOM   7709  O  O     . ARG A 1  1023 ? 445.547 -51.215 595.647 1.00 40.77  ? 1023 ARG A O     1 
ATOM   7710  C  CB    . ARG A 1  1023 ? 442.486 -50.154 595.876 1.00 39.95  ? 1023 ARG A CB    1 
ATOM   7711  C  CG    . ARG A 1  1023 ? 441.127 -50.332 596.525 1.00 40.13  ? 1023 ARG A CG    1 
ATOM   7712  C  CD    . ARG A 1  1023 ? 440.043 -49.699 595.669 1.00 39.98  ? 1023 ARG A CD    1 
ATOM   7713  N  NE    . ARG A 1  1023 ? 438.816 -49.460 596.422 1.00 39.87  ? 1023 ARG A NE    1 
ATOM   7714  C  CZ    . ARG A 1  1023 ? 437.915 -48.536 596.102 1.00 39.42  ? 1023 ARG A CZ    1 
ATOM   7715  N  NH1   . ARG A 1  1023 ? 438.108 -47.760 595.044 1.00 39.03  ? 1023 ARG A NH1   1 
ATOM   7716  N  NH2   . ARG A 1  1023 ? 436.824 -48.383 596.842 1.00 39.46  ? 1023 ARG A NH2   1 
ATOM   7717  N  N     . SER A 1  1024 ? 445.445 -48.974 595.846 1.00 41.36  ? 1024 SER A N     1 
ATOM   7718  C  CA    . SER A 1  1024 ? 446.681 -48.752 595.105 1.00 41.41  ? 1024 SER A CA    1 
ATOM   7719  C  C     . SER A 1  1024 ? 447.884 -49.306 595.860 1.00 41.75  ? 1024 SER A C     1 
ATOM   7720  O  O     . SER A 1  1024 ? 448.770 -49.923 595.268 1.00 42.52  ? 1024 SER A O     1 
ATOM   7721  C  CB    . SER A 1  1024 ? 446.882 -47.262 594.822 1.00 40.35  ? 1024 SER A CB    1 
ATOM   7722  O  OG    . SER A 1  1024 ? 447.101 -46.538 596.019 1.00 39.46  ? 1024 SER A OG    1 
ATOM   7723  N  N     . ARG A 1  1025 ? 447.910 -49.086 597.171 1.00 62.85  ? 1025 ARG A N     1 
ATOM   7724  C  CA    . ARG A 1  1025 ? 449.034 -49.525 597.991 1.00 62.33  ? 1025 ARG A CA    1 
ATOM   7725  C  C     . ARG A 1  1025 ? 448.942 -51.004 598.355 1.00 63.68  ? 1025 ARG A C     1 
ATOM   7726  O  O     . ARG A 1  1025 ? 449.947 -51.714 598.349 1.00 63.95  ? 1025 ARG A O     1 
ATOM   7727  C  CB    . ARG A 1  1025 ? 449.128 -48.682 599.264 1.00 60.56  ? 1025 ARG A CB    1 
ATOM   7728  C  CG    . ARG A 1  1025 ? 450.332 -47.754 599.301 1.00 60.29  ? 1025 ARG A CG    1 
ATOM   7729  C  CD    . ARG A 1  1025 ? 450.284 -46.741 598.170 1.00 60.21  ? 1025 ARG A CD    1 
ATOM   7730  N  NE    . ARG A 1  1025 ? 451.504 -45.944 598.093 1.00 59.71  ? 1025 ARG A NE    1 
ATOM   7731  C  CZ    . ARG A 1  1025 ? 451.731 -44.852 598.816 1.00 60.41  ? 1025 ARG A CZ    1 
ATOM   7732  N  NH1   . ARG A 1  1025 ? 450.822 -44.425 599.681 1.00 58.07  ? 1025 ARG A NH1   1 
ATOM   7733  N  NH2   . ARG A 1  1025 ? 452.871 -44.187 598.678 1.00 61.54  ? 1025 ARG A NH2   1 
ATOM   7734  N  N     . LEU A 1  1026 ? 447.736 -51.467 598.670 1.00 40.54  ? 1026 LEU A N     1 
ATOM   7735  C  CA    . LEU A 1  1026 ? 447.549 -52.845 599.108 1.00 41.77  ? 1026 LEU A CA    1 
ATOM   7736  C  C     . LEU A 1  1026 ? 447.022 -53.748 597.994 1.00 42.74  ? 1026 LEU A C     1 
ATOM   7737  O  O     . LEU A 1  1026 ? 446.095 -54.532 598.203 1.00 43.46  ? 1026 LEU A O     1 
ATOM   7738  C  CB    . LEU A 1  1026 ? 446.604 -52.899 600.310 1.00 41.66  ? 1026 LEU A CB    1 
ATOM   7739  C  CG    . LEU A 1  1026 ? 447.101 -52.260 601.609 1.00 41.00  ? 1026 LEU A CG    1 
ATOM   7740  C  CD1   . LEU A 1  1026 ? 446.131 -52.539 602.746 1.00 41.23  ? 1026 LEU A CD1   1 
ATOM   7741  C  CD2   . LEU A 1  1026 ? 448.496 -52.753 601.960 1.00 41.59  ? 1026 LEU A CD2   1 
ATOM   7742  N  N     . ALA A 1  1027 ? 447.618 -53.633 596.812 1.00 53.62  ? 1027 ALA A N     1 
ATOM   7743  C  CA    . ALA A 1  1027 ? 447.310 -54.539 595.713 1.00 54.68  ? 1027 ALA A CA    1 
ATOM   7744  C  C     . ALA A 1  1027 ? 448.100 -55.831 595.886 1.00 56.01  ? 1027 ALA A C     1 
ATOM   7745  O  O     . ALA A 1  1027 ? 449.190 -55.820 596.456 1.00 56.03  ? 1027 ALA A O     1 
ATOM   7746  C  CB    . ALA A 1  1027 ? 447.625 -53.891 594.377 1.00 54.39  ? 1027 ALA A CB    1 
ATOM   7747  N  N     . THR A 1  1028 ? 447.547 -56.936 595.391 1.00 50.87  ? 1028 THR A N     1 
ATOM   7748  C  CA    . THR A 1  1028 ? 448.138 -58.261 595.578 1.00 52.30  ? 1028 THR A CA    1 
ATOM   7749  C  C     . THR A 1  1028 ? 449.596 -58.328 595.125 1.00 52.65  ? 1028 THR A C     1 
ATOM   7750  O  O     . THR A 1  1028 ? 450.467 -58.769 595.879 1.00 53.16  ? 1028 THR A O     1 
ATOM   7751  C  CB    . THR A 1  1028 ? 447.335 -59.336 594.826 1.00 53.54  ? 1028 THR A CB    1 
ATOM   7752  O  OG1   . THR A 1  1028 ? 445.966 -59.295 595.248 1.00 53.34  ? 1028 THR A OG1   1 
ATOM   7753  C  CG2   . THR A 1  1028 ? 447.906 -60.719 595.103 1.00 55.10  ? 1028 THR A CG2   1 
ATOM   7754  N  N     . ARG A 1  1029 ? 449.852 -57.887 593.896 1.00 63.42  ? 1029 ARG A N     1 
ATOM   7755  C  CA    . ARG A 1  1029 ? 451.209 -57.832 593.360 1.00 65.12  ? 1029 ARG A CA    1 
ATOM   7756  C  C     . ARG A 1  1029 ? 452.126 -57.024 594.264 1.00 62.76  ? 1029 ARG A C     1 
ATOM   7757  O  O     . ARG A 1  1029 ? 453.240 -57.442 594.570 1.00 63.27  ? 1029 ARG A O     1 
ATOM   7758  C  CB    . ARG A 1  1029 ? 451.213 -57.228 591.953 1.00 65.11  ? 1029 ARG A CB    1 
ATOM   7759  C  CG    . ARG A 1  1029 ? 451.280 -58.245 590.830 1.00 69.78  ? 1029 ARG A CG    1 
ATOM   7760  C  CD    . ARG A 1  1029 ? 452.595 -59.004 590.845 1.00 68.73  ? 1029 ARG A CD    1 
ATOM   7761  N  NE    . ARG A 1  1029 ? 452.630 -60.043 589.820 1.00 72.79  ? 1029 ARG A NE    1 
ATOM   7762  C  CZ    . ARG A 1  1029 ? 453.008 -59.838 588.563 1.00 74.24  ? 1029 ARG A CZ    1 
ATOM   7763  N  NH1   . ARG A 1  1029 ? 453.386 -58.629 588.171 1.00 72.74  ? 1029 ARG A NH1   1 
ATOM   7764  N  NH2   . ARG A 1  1029 ? 453.008 -60.842 587.696 1.00 77.16  ? 1029 ARG A NH2   1 
ATOM   7765  N  N     . ARG A 1  1030 ? 451.642 -55.867 594.698 1.00 61.55  ? 1030 ARG A N     1 
ATOM   7766  C  CA    . ARG A 1  1030 ? 452.442 -54.958 595.504 1.00 59.94  ? 1030 ARG A CA    1 
ATOM   7767  C  C     . ARG A 1  1030 ? 452.723 -55.535 596.889 1.00 60.11  ? 1030 ARG A C     1 
ATOM   7768  O  O     . ARG A 1  1030 ? 453.854 -55.485 597.373 1.00 61.13  ? 1030 ARG A O     1 
ATOM   7769  C  CB    . ARG A 1  1030 ? 451.740 -53.605 595.622 1.00 58.01  ? 1030 ARG A CB    1 
ATOM   7770  C  CG    . ARG A 1  1030 ? 452.645 -52.481 596.087 1.00 60.04  ? 1030 ARG A CG    1 
ATOM   7771  C  CD    . ARG A 1  1030 ? 452.056 -51.127 595.737 1.00 57.74  ? 1030 ARG A CD    1 
ATOM   7772  N  NE    . ARG A 1  1030 ? 452.985 -50.040 596.029 1.00 55.45  ? 1030 ARG A NE    1 
ATOM   7773  C  CZ    . ARG A 1  1030 ? 452.738 -48.761 595.775 1.00 55.18  ? 1030 ARG A CZ    1 
ATOM   7774  N  NH1   . ARG A 1  1030 ? 451.587 -48.406 595.221 1.00 56.29  ? 1030 ARG A NH1   1 
ATOM   7775  N  NH2   . ARG A 1  1030 ? 453.641 -47.837 596.075 1.00 58.01  ? 1030 ARG A NH2   1 
ATOM   7776  N  N     . VAL A 1  1031 ? 451.693 -56.091 597.518 1.00 45.87  ? 1031 VAL A N     1 
ATOM   7777  C  CA    . VAL A 1  1031 ? 451.832 -56.666 598.851 1.00 46.36  ? 1031 VAL A CA    1 
ATOM   7778  C  C     . VAL A 1  1031 ? 452.768 -57.872 598.852 1.00 47.92  ? 1031 VAL A C     1 
ATOM   7779  O  O     . VAL A 1  1031 ? 453.651 -57.979 599.702 1.00 48.24  ? 1031 VAL A O     1 
ATOM   7780  C  CB    . VAL A 1  1031 ? 450.465 -57.089 599.427 1.00 46.49  ? 1031 VAL A CB    1 
ATOM   7781  C  CG1   . VAL A 1  1031 ? 450.644 -57.847 600.733 1.00 47.32  ? 1031 VAL A CG1   1 
ATOM   7782  C  CG2   . VAL A 1  1031 ? 449.578 -55.875 599.633 1.00 45.02  ? 1031 VAL A CG2   1 
ATOM   7783  N  N     . LEU A 1  1032 ? 452.580 -58.771 597.891 1.00 48.95  ? 1032 LEU A N     1 
ATOM   7784  C  CA    . LEU A 1  1032 ? 453.351 -60.011 597.857 1.00 50.59  ? 1032 LEU A CA    1 
ATOM   7785  C  C     . LEU A 1  1032 ? 454.778 -59.826 597.348 1.00 50.89  ? 1032 LEU A C     1 
ATOM   7786  O  O     . LEU A 1  1032 ? 455.706 -60.454 597.857 1.00 51.91  ? 1032 LEU A O     1 
ATOM   7787  C  CB    . LEU A 1  1032 ? 452.636 -61.055 596.998 1.00 51.69  ? 1032 LEU A CB    1 
ATOM   7788  C  CG    . LEU A 1  1032 ? 451.397 -61.689 597.629 1.00 52.08  ? 1032 LEU A CG    1 
ATOM   7789  C  CD1   . LEU A 1  1032 ? 450.773 -62.704 596.692 1.00 53.26  ? 1032 LEU A CD1   1 
ATOM   7790  C  CD2   . LEU A 1  1032 ? 451.743 -62.329 598.964 1.00 52.88  ? 1032 LEU A CD2   1 
ATOM   7791  N  N     . GLN A 1  1033 ? 454.956 -58.970 596.346 1.00 72.66  ? 1033 GLN A N     1 
ATOM   7792  C  CA    . GLN A 1  1033 ? 456.260 -58.829 595.705 1.00 73.98  ? 1033 GLN A CA    1 
ATOM   7793  C  C     . GLN A 1  1033 ? 457.079 -57.668 596.267 1.00 74.16  ? 1033 GLN A C     1 
ATOM   7794  O  O     . GLN A 1  1033 ? 458.223 -57.856 596.680 1.00 77.04  ? 1033 GLN A O     1 
ATOM   7795  C  CB    . GLN A 1  1033 ? 456.089 -58.662 594.193 1.00 74.47  ? 1033 GLN A CB    1 
ATOM   7796  C  CG    . GLN A 1  1033 ? 457.392 -58.646 593.415 1.00 75.58  ? 1033 GLN A CG    1 
ATOM   7797  C  CD    . GLN A 1  1033 ? 457.170 -58.683 591.916 1.00 78.89  ? 1033 GLN A CD    1 
ATOM   7798  O  OE1   . GLN A 1  1033 ? 456.044 -58.848 591.447 1.00 81.18  ? 1033 GLN A OE1   1 
ATOM   7799  N  NE2   . GLN A 1  1033 ? 458.248 -58.530 591.155 1.00 82.60  ? 1033 GLN A NE2   1 
ATOM   7800  N  N     . GLU A 1  1034 ? 456.497 -56.473 596.283 1.00 65.42  ? 1034 GLU A N     1 
ATOM   7801  C  CA    . GLU A 1  1034 ? 457.217 -55.287 596.740 1.00 64.26  ? 1034 GLU A CA    1 
ATOM   7802  C  C     . GLU A 1  1034 ? 457.369 -55.255 598.258 1.00 63.52  ? 1034 GLU A C     1 
ATOM   7803  O  O     . GLU A 1  1034 ? 458.444 -54.951 598.773 1.00 64.14  ? 1034 GLU A O     1 
ATOM   7804  C  CB    . GLU A 1  1034 ? 456.515 -54.014 596.263 1.00 59.74  ? 1034 GLU A CB    1 
ATOM   7805  C  CG    . GLU A 1  1034 ? 456.533 -53.822 594.757 1.00 62.65  ? 1034 GLU A CG    1 
ATOM   7806  C  CD    . GLU A 1  1034 ? 455.862 -52.532 594.327 1.00 62.78  ? 1034 GLU A CD    1 
ATOM   7807  O  OE1   . GLU A 1  1034 ? 456.348 -51.447 594.710 1.00 65.49  ? 1034 GLU A OE1   1 
ATOM   7808  O  OE2   . GLU A 1  1034 ? 454.843 -52.602 593.607 1.00 59.29  ? 1034 GLU A OE2   1 
ATOM   7809  N  N     . TYR A 1  1035 ? 456.292 -55.571 598.970 1.00 52.01  ? 1035 TYR A N     1 
ATOM   7810  C  CA    . TYR A 1  1035 ? 456.306 -55.523 600.428 1.00 51.85  ? 1035 TYR A CA    1 
ATOM   7811  C  C     . TYR A 1  1035 ? 456.777 -56.848 601.019 1.00 53.45  ? 1035 TYR A C     1 
ATOM   7812  O  O     . TYR A 1  1035 ? 457.504 -56.867 602.012 1.00 53.78  ? 1035 TYR A O     1 
ATOM   7813  C  CB    . TYR A 1  1035 ? 454.918 -55.179 600.979 1.00 50.94  ? 1035 TYR A CB    1 
ATOM   7814  C  CG    . TYR A 1  1035 ? 454.335 -53.876 600.474 1.00 49.42  ? 1035 TYR A CG    1 
ATOM   7815  C  CD1   . TYR A 1  1035 ? 452.969 -53.635 600.548 1.00 48.76  ? 1035 TYR A CD1   1 
ATOM   7816  C  CD2   . TYR A 1  1035 ? 455.145 -52.886 599.929 1.00 48.76  ? 1035 TYR A CD2   1 
ATOM   7817  C  CE1   . TYR A 1  1035 ? 452.426 -52.451 600.089 1.00 47.49  ? 1035 TYR A CE1   1 
ATOM   7818  C  CE2   . TYR A 1  1035 ? 454.609 -51.699 599.465 1.00 47.49  ? 1035 TYR A CE2   1 
ATOM   7819  C  CZ    . TYR A 1  1035 ? 453.248 -51.487 599.549 1.00 46.86  ? 1035 TYR A CZ    1 
ATOM   7820  O  OH    . TYR A 1  1035 ? 452.708 -50.307 599.093 1.00 45.69  ? 1035 TYR A OH    1 
ATOM   7821  N  N     . ARG A 1  1036 ? 456.356 -57.946 600.394 1.00 63.30  ? 1036 ARG A N     1 
ATOM   7822  C  CA    . ARG A 1  1036 ? 456.630 -59.295 600.886 1.00 64.70  ? 1036 ARG A CA    1 
ATOM   7823  C  C     . ARG A 1  1036 ? 456.176 -59.470 602.331 1.00 63.14  ? 1036 ARG A C     1 
ATOM   7824  O  O     . ARG A 1  1036 ? 456.899 -60.029 603.155 1.00 64.16  ? 1036 ARG A O     1 
ATOM   7825  C  CB    . ARG A 1  1036 ? 458.118 -59.634 600.756 1.00 68.20  ? 1036 ARG A CB    1 
ATOM   7826  C  CG    . ARG A 1  1036 ? 458.525 -60.103 599.369 1.00 70.31  ? 1036 ARG A CG    1 
ATOM   7827  C  CD    . ARG A 1  1036 ? 459.916 -60.716 599.373 1.00 74.56  ? 1036 ARG A CD    1 
ATOM   7828  N  NE    . ARG A 1  1036 ? 460.192 -61.444 598.137 1.00 79.08  ? 1036 ARG A NE    1 
ATOM   7829  C  CZ    . ARG A 1  1036 ? 460.750 -60.903 597.058 1.00 79.77  ? 1036 ARG A CZ    1 
ATOM   7830  N  NH1   . ARG A 1  1036 ? 461.097 -59.622 597.058 1.00 77.78  ? 1036 ARG A NH1   1 
ATOM   7831  N  NH2   . ARG A 1  1036 ? 460.963 -61.643 595.978 1.00 78.35  ? 1036 ARG A NH2   1 
ATOM   7832  N  N     . LEU A 1  1037 ? 454.972 -58.993 602.628 1.00 49.86  ? 1037 LEU A N     1 
ATOM   7833  C  CA    . LEU A 1  1037 ? 454.415 -59.100 603.971 1.00 49.91  ? 1037 LEU A CA    1 
ATOM   7834  C  C     . LEU A 1  1037 ? 453.942 -60.516 604.276 1.00 51.53  ? 1037 LEU A C     1 
ATOM   7835  O  O     . LEU A 1  1037 ? 453.599 -61.278 603.373 1.00 52.27  ? 1037 LEU A O     1 
ATOM   7836  C  CB    . LEU A 1  1037 ? 453.252 -58.124 604.152 1.00 48.42  ? 1037 LEU A CB    1 
ATOM   7837  C  CG    . LEU A 1  1037 ? 453.565 -56.629 604.089 1.00 46.79  ? 1037 LEU A CG    1 
ATOM   7838  C  CD1   . LEU A 1  1037 ? 452.322 -55.820 604.424 1.00 45.58  ? 1037 LEU A CD1   1 
ATOM   7839  C  CD2   . LEU A 1  1037 ? 454.712 -56.275 605.024 1.00 46.84  ? 1037 LEU A CD2   1 
ATOM   7840  N  N     . THR A 1  1038 ? 453.925 -60.859 605.559 1.00 62.74  ? 1038 THR A N     1 
ATOM   7841  C  CA    . THR A 1  1038 ? 453.382 -62.134 606.005 1.00 64.31  ? 1038 THR A CA    1 
ATOM   7842  C  C     . THR A 1  1038 ? 451.915 -61.964 606.381 1.00 63.94  ? 1038 THR A C     1 
ATOM   7843  O  O     . THR A 1  1038 ? 451.381 -60.859 606.323 1.00 64.51  ? 1038 THR A O     1 
ATOM   7844  C  CB    . THR A 1  1038 ? 454.160 -62.694 607.208 1.00 67.38  ? 1038 THR A CB    1 
ATOM   7845  O  OG1   . THR A 1  1038 ? 454.067 -61.780 608.307 1.00 64.66  ? 1038 THR A OG1   1 
ATOM   7846  C  CG2   . THR A 1  1038 ? 455.623 -62.898 606.847 1.00 71.25  ? 1038 THR A CG2   1 
ATOM   7847  N  N     . LYS A 1  1039 ? 451.267 -63.061 606.760 1.00 60.09  ? 1039 LYS A N     1 
ATOM   7848  C  CA    . LYS A 1  1039 ? 449.871 -63.025 607.185 1.00 59.91  ? 1039 LYS A CA    1 
ATOM   7849  C  C     . LYS A 1  1039 ? 449.695 -62.154 608.428 1.00 59.07  ? 1039 LYS A C     1 
ATOM   7850  O  O     . LYS A 1  1039 ? 448.853 -61.252 608.459 1.00 57.78  ? 1039 LYS A O     1 
ATOM   7851  C  CB    . LYS A 1  1039 ? 449.365 -64.445 607.453 1.00 61.86  ? 1039 LYS A CB    1 
ATOM   7852  C  CG    . LYS A 1  1039 ? 448.010 -64.522 608.138 1.00 62.03  ? 1039 LYS A CG    1 
ATOM   7853  C  CD    . LYS A 1  1039 ? 446.893 -64.015 607.246 1.00 61.00  ? 1039 LYS A CD    1 
ATOM   7854  C  CE    . LYS A 1  1039 ? 445.537 -64.230 607.900 1.00 61.47  ? 1039 LYS A CE    1 
ATOM   7855  N  NZ    . LYS A 1  1039 ? 444.423 -63.699 607.068 1.00 60.53  ? 1039 LYS A NZ    1 
ATOM   7856  N  N     . GLN A 1  1040 ? 450.506 -62.433 609.444 1.00 68.45  ? 1040 GLN A N     1 
ATOM   7857  C  CA    . GLN A 1  1040 ? 450.495 -61.679 610.692 1.00 67.92  ? 1040 GLN A CA    1 
ATOM   7858  C  C     . GLN A 1  1040 ? 450.763 -60.195 610.455 1.00 65.87  ? 1040 GLN A C     1 
ATOM   7859  O  O     . GLN A 1  1040 ? 450.038 -59.330 610.957 1.00 64.81  ? 1040 GLN A O     1 
ATOM   7860  C  CB    . GLN A 1  1040 ? 451.534 -62.256 611.655 1.00 70.61  ? 1040 GLN A CB    1 
ATOM   7861  C  CG    . GLN A 1  1040 ? 451.627 -61.548 612.992 1.00 70.94  ? 1040 GLN A CG    1 
ATOM   7862  C  CD    . GLN A 1  1040 ? 452.790 -62.048 613.827 1.00 72.20  ? 1040 GLN A CD    1 
ATOM   7863  O  OE1   . GLN A 1  1040 ? 453.745 -62.620 613.300 1.00 70.96  ? 1040 GLN A OE1   1 
ATOM   7864  N  NE2   . GLN A 1  1040 ? 452.713 -61.839 615.136 1.00 75.96  ? 1040 GLN A NE2   1 
ATOM   7865  N  N     . ALA A 1  1041 ? 451.806 -59.911 609.681 1.00 51.41  ? 1041 ALA A N     1 
ATOM   7866  C  CA    . ALA A 1  1041 ? 452.187 -58.539 609.368 1.00 49.67  ? 1041 ALA A CA    1 
ATOM   7867  C  C     . ALA A 1  1041 ? 451.092 -57.825 608.580 1.00 48.36  ? 1041 ALA A C     1 
ATOM   7868  O  O     . ALA A 1  1041 ? 450.836 -56.644 608.797 1.00 46.95  ? 1041 ALA A O     1 
ATOM   7869  C  CB    . ALA A 1  1041 ? 453.497 -58.517 608.596 1.00 49.77  ? 1041 ALA A CB    1 
ATOM   7870  N  N     . PHE A 1  1042 ? 450.447 -58.550 607.671 1.00 59.57  ? 1042 PHE A N     1 
ATOM   7871  C  CA    . PHE A 1  1042 ? 449.373 -57.984 606.860 1.00 57.87  ? 1042 PHE A CA    1 
ATOM   7872  C  C     . PHE A 1  1042 ? 448.168 -57.620 607.723 1.00 56.99  ? 1042 PHE A C     1 
ATOM   7873  O  O     . PHE A 1  1042 ? 447.599 -56.533 607.586 1.00 55.64  ? 1042 PHE A O     1 
ATOM   7874  C  CB    . PHE A 1  1042 ? 448.961 -58.963 605.760 1.00 59.19  ? 1042 PHE A CB    1 
ATOM   7875  C  CG    . PHE A 1  1042 ? 447.956 -58.407 604.795 1.00 57.37  ? 1042 PHE A CG    1 
ATOM   7876  C  CD1   . PHE A 1  1042 ? 446.622 -58.770 604.878 1.00 57.74  ? 1042 PHE A CD1   1 
ATOM   7877  C  CD2   . PHE A 1  1042 ? 448.344 -57.522 603.804 1.00 56.25  ? 1042 PHE A CD2   1 
ATOM   7878  C  CE1   . PHE A 1  1042 ? 445.695 -58.261 603.988 1.00 57.00  ? 1042 PHE A CE1   1 
ATOM   7879  C  CE2   . PHE A 1  1042 ? 447.422 -57.007 602.912 1.00 55.52  ? 1042 PHE A CE2   1 
ATOM   7880  C  CZ    . PHE A 1  1042 ? 446.096 -57.378 603.004 1.00 55.89  ? 1042 PHE A CZ    1 
ATOM   7881  N  N     . ASP A 1  1043 ? 447.787 -58.532 608.613 1.00 63.95  ? 1043 ASP A N     1 
ATOM   7882  C  CA    . ASP A 1  1043 ? 446.681 -58.284 609.534 1.00 66.52  ? 1043 ASP A CA    1 
ATOM   7883  C  C     . ASP A 1  1043 ? 446.987 -57.096 610.441 1.00 65.42  ? 1043 ASP A C     1 
ATOM   7884  O  O     . ASP A 1  1043 ? 446.117 -56.260 610.707 1.00 63.26  ? 1043 ASP A O     1 
ATOM   7885  C  CB    . ASP A 1  1043 ? 446.388 -59.528 610.375 1.00 71.13  ? 1043 ASP A CB    1 
ATOM   7886  C  CG    . ASP A 1  1043 ? 445.967 -60.716 609.533 1.00 72.65  ? 1043 ASP A CG    1 
ATOM   7887  O  OD1   . ASP A 1  1043 ? 445.360 -60.505 608.462 1.00 73.18  ? 1043 ASP A OD1   1 
ATOM   7888  O  OD2   . ASP A 1  1043 ? 446.245 -61.861 609.946 1.00 73.39  ? 1043 ASP A OD2   1 
ATOM   7889  N  N     . TRP A 1  1044 ? 448.230 -57.029 610.909 1.00 71.85  ? 1044 TRP A N     1 
ATOM   7890  C  CA    . TRP A 1  1044 ? 448.680 -55.910 611.729 1.00 70.48  ? 1044 TRP A CA    1 
ATOM   7891  C  C     . TRP A 1  1044 ? 448.586 -54.598 610.956 1.00 66.71  ? 1044 TRP A C     1 
ATOM   7892  O  O     . TRP A 1  1044 ? 448.204 -53.567 611.512 1.00 65.34  ? 1044 TRP A O     1 
ATOM   7893  C  CB    . TRP A 1  1044 ? 450.114 -56.139 612.212 1.00 71.78  ? 1044 TRP A CB    1 
ATOM   7894  C  CG    . TRP A 1  1044 ? 450.667 -55.002 613.015 1.00 70.20  ? 1044 TRP A CG    1 
ATOM   7895  C  CD1   . TRP A 1  1044 ? 450.500 -54.785 614.351 1.00 69.12  ? 1044 TRP A CD1   1 
ATOM   7896  C  CD2   . TRP A 1  1044 ? 451.479 -53.925 612.531 1.00 70.89  ? 1044 TRP A CD2   1 
ATOM   7897  N  NE1   . TRP A 1  1044 ? 451.156 -53.639 614.730 1.00 69.51  ? 1044 TRP A NE1   1 
ATOM   7898  C  CE2   . TRP A 1  1044 ? 451.766 -53.092 613.632 1.00 69.03  ? 1044 TRP A CE2   1 
ATOM   7899  C  CE3   . TRP A 1  1044 ? 451.992 -53.584 611.276 1.00 67.86  ? 1044 TRP A CE3   1 
ATOM   7900  C  CZ2   . TRP A 1  1044 ? 452.541 -51.941 613.515 1.00 69.18  ? 1044 TRP A CZ2   1 
ATOM   7901  C  CZ3   . TRP A 1  1044 ? 452.762 -52.440 611.162 1.00 65.15  ? 1044 TRP A CZ3   1 
ATOM   7902  C  CH2   . TRP A 1  1044 ? 453.029 -51.633 612.275 1.00 66.00  ? 1044 TRP A CH2   1 
ATOM   7903  N  N     . VAL A 1  1045 ? 448.929 -54.645 609.671 1.00 44.60  ? 1045 VAL A N     1 
ATOM   7904  C  CA    . VAL A 1  1045 ? 448.843 -53.474 608.806 1.00 43.08  ? 1045 VAL A CA    1 
ATOM   7905  C  C     . VAL A 1  1045 ? 447.397 -53.016 608.652 1.00 42.44  ? 1045 VAL A C     1 
ATOM   7906  O  O     . VAL A 1  1045 ? 447.107 -51.829 608.762 1.00 41.20  ? 1045 VAL A O     1 
ATOM   7907  C  CB    . VAL A 1  1045 ? 449.447 -53.749 607.412 1.00 43.17  ? 1045 VAL A CB    1 
ATOM   7908  C  CG1   . VAL A 1  1045 ? 448.959 -52.724 606.397 1.00 41.87  ? 1045 VAL A CG1   1 
ATOM   7909  C  CG2   . VAL A 1  1045 ? 450.963 -53.748 607.483 1.00 43.43  ? 1045 VAL A CG2   1 
ATOM   7910  N  N     . LEU A 1  1046 ? 446.492 -53.959 608.409 1.00 45.22  ? 1046 LEU A N     1 
ATOM   7911  C  CA    . LEU A 1  1046 ? 445.073 -53.634 608.273 1.00 44.85  ? 1046 LEU A CA    1 
ATOM   7912  C  C     . LEU A 1  1046 ? 444.514 -53.006 609.547 1.00 44.49  ? 1046 LEU A C     1 
ATOM   7913  O  O     . LEU A 1  1046 ? 443.853 -51.962 609.503 1.00 43.41  ? 1046 LEU A O     1 
ATOM   7914  C  CB    . LEU A 1  1046 ? 444.267 -54.884 607.914 1.00 46.19  ? 1046 LEU A CB    1 
ATOM   7915  C  CG    . LEU A 1  1046 ? 443.984 -55.122 606.430 1.00 46.18  ? 1046 LEU A CG    1 
ATOM   7916  C  CD1   . LEU A 1  1046 ? 445.269 -55.119 605.619 1.00 46.00  ? 1046 LEU A CD1   1 
ATOM   7917  C  CD2   . LEU A 1  1046 ? 443.228 -56.427 606.237 1.00 47.69  ? 1046 LEU A CD2   1 
ATOM   7918  N  N     . SER A 1  1047 ? 444.788 -53.649 610.678 1.00 48.94  ? 1047 SER A N     1 
ATOM   7919  C  CA    . SER A 1  1047 ? 444.335 -53.155 611.975 1.00 48.83  ? 1047 SER A CA    1 
ATOM   7920  C  C     . SER A 1  1047 ? 444.868 -51.750 612.251 1.00 47.35  ? 1047 SER A C     1 
ATOM   7921  O  O     . SER A 1  1047 ? 444.129 -50.867 612.696 1.00 46.61  ? 1047 SER A O     1 
ATOM   7922  C  CB    . SER A 1  1047 ? 444.769 -54.112 613.088 1.00 50.28  ? 1047 SER A CB    1 
ATOM   7923  O  OG    . SER A 1  1047 ? 444.364 -53.639 614.359 1.00 52.89  ? 1047 SER A OG    1 
ATOM   7924  N  N     . ASN A 1  1048 ? 446.153 -51.553 611.974 1.00 67.14  ? 1048 ASN A N     1 
ATOM   7925  C  CA    . ASN A 1  1048 ? 446.802 -50.267 612.196 1.00 64.06  ? 1048 ASN A CA    1 
ATOM   7926  C  C     . ASN A 1  1048 ? 446.220 -49.171 611.306 1.00 61.91  ? 1048 ASN A C     1 
ATOM   7927  O  O     . ASN A 1  1048 ? 445.998 -48.047 611.758 1.00 61.01  ? 1048 ASN A O     1 
ATOM   7928  C  CB    . ASN A 1  1048 ? 448.308 -50.392 611.961 1.00 65.17  ? 1048 ASN A CB    1 
ATOM   7929  C  CG    . ASN A 1  1048 ? 449.096 -49.298 612.646 1.00 65.36  ? 1048 ASN A CG    1 
ATOM   7930  O  OD1   . ASN A 1  1048 ? 449.324 -48.230 612.077 1.00 67.96  ? 1048 ASN A OD1   1 
ATOM   7931  N  ND2   . ASN A 1  1048 ? 449.522 -49.560 613.876 1.00 65.83  ? 1048 ASN A ND2   1 
ATOM   7932  N  N     . ILE A 1  1049 ? 445.974 -49.506 610.042 1.00 39.10  ? 1049 ILE A N     1 
ATOM   7933  C  CA    . ILE A 1  1049 ? 445.378 -48.571 609.095 1.00 38.01  ? 1049 ILE A CA    1 
ATOM   7934  C  C     . ILE A 1  1049 ? 443.990 -48.154 609.561 1.00 37.78  ? 1049 ILE A C     1 
ATOM   7935  O  O     . ILE A 1  1049 ? 443.663 -46.965 609.571 1.00 36.71  ? 1049 ILE A O     1 
ATOM   7936  C  CB    . ILE A 1  1049 ? 445.282 -49.173 607.676 1.00 38.35  ? 1049 ILE A CB    1 
ATOM   7937  C  CG1   . ILE A 1  1049 ? 446.666 -49.245 607.031 1.00 38.34  ? 1049 ILE A CG1   1 
ATOM   7938  C  CG2   . ILE A 1  1049 ? 444.354 -48.346 606.801 1.00 37.51  ? 1049 ILE A CG2   1 
ATOM   7939  C  CD1   . ILE A 1  1049 ? 446.656 -49.802 605.623 1.00 38.72  ? 1049 ILE A CD1   1 
ATOM   7940  N  N     . GLU A 1  1050 ? 443.180 -49.133 609.953 1.00 48.53  ? 1050 GLU A N     1 
ATOM   7941  C  CA    . GLU A 1  1050 ? 441.843 -48.845 610.463 1.00 48.55  ? 1050 GLU A CA    1 
ATOM   7942  C  C     . GLU A 1  1050 ? 441.911 -47.927 611.682 1.00 47.97  ? 1050 GLU A C     1 
ATOM   7943  O  O     . GLU A 1  1050 ? 441.184 -46.931 611.766 1.00 47.18  ? 1050 GLU A O     1 
ATOM   7944  C  CB    . GLU A 1  1050 ? 441.107 -50.138 610.819 1.00 51.38  ? 1050 GLU A CB    1 
ATOM   7945  C  CG    . GLU A 1  1050 ? 439.720 -49.914 611.403 1.00 52.35  ? 1050 GLU A CG    1 
ATOM   7946  C  CD    . GLU A 1  1050 ? 439.012 -51.208 611.751 1.00 56.25  ? 1050 GLU A CD    1 
ATOM   7947  O  OE1   . GLU A 1  1050 ? 439.511 -52.285 611.361 1.00 58.28  ? 1050 GLU A OE1   1 
ATOM   7948  O  OE2   . GLU A 1  1050 ? 437.956 -51.148 612.416 1.00 57.48  ? 1050 GLU A OE2   1 
ATOM   7949  N  N     . ALA A 1  1051 ? 442.799 -48.264 612.614 1.00 40.81  ? 1051 ALA A N     1 
ATOM   7950  C  CA    . ALA A 1  1051 ? 442.970 -47.481 613.835 1.00 40.43  ? 1051 ALA A CA    1 
ATOM   7951  C  C     . ALA A 1  1051 ? 443.333 -46.030 613.532 1.00 38.92  ? 1051 ALA A C     1 
ATOM   7952  O  O     . ALA A 1  1051 ? 442.678 -45.105 614.016 1.00 38.31  ? 1051 ALA A O     1 
ATOM   7953  C  CB    . ALA A 1  1051 ? 444.030 -48.113 614.725 1.00 41.25  ? 1051 ALA A CB    1 
ATOM   7954  N  N     . GLN A 1  1052 ? 444.375 -45.838 612.726 1.00 43.80  ? 1052 GLN A N     1 
ATOM   7955  C  CA    . GLN A 1  1052 ? 444.833 -44.497 612.379 1.00 42.22  ? 1052 GLN A CA    1 
ATOM   7956  C  C     . GLN A 1  1052 ? 443.763 -43.722 611.618 1.00 41.46  ? 1052 GLN A C     1 
ATOM   7957  O  O     . GLN A 1  1052 ? 443.650 -42.505 611.764 1.00 40.71  ? 1052 GLN A O     1 
ATOM   7958  C  CB    . GLN A 1  1052 ? 446.121 -44.560 611.554 1.00 42.04  ? 1052 GLN A CB    1 
ATOM   7959  C  CG    . GLN A 1  1052 ? 447.326 -45.092 612.316 1.00 42.90  ? 1052 GLN A CG    1 
ATOM   7960  C  CD    . GLN A 1  1052 ? 448.633 -44.858 611.579 1.00 44.65  ? 1052 GLN A CD    1 
ATOM   7961  O  OE1   . GLN A 1  1052 ? 448.747 -43.940 610.767 1.00 44.78  ? 1052 GLN A OE1   1 
ATOM   7962  N  NE2   . GLN A 1  1052 ? 449.628 -45.692 611.861 1.00 45.92  ? 1052 GLN A NE2   1 
ATOM   7963  N  N     . PHE A 1  1053 ? 442.979 -44.430 610.810 1.00 40.80  ? 1053 PHE A N     1 
ATOM   7964  C  CA    . PHE A 1  1053 ? 441.885 -43.800 610.081 1.00 39.13  ? 1053 PHE A CA    1 
ATOM   7965  C  C     . PHE A 1  1053 ? 440.842 -43.275 611.051 1.00 40.60  ? 1053 PHE A C     1 
ATOM   7966  O  O     . PHE A 1  1053 ? 440.375 -42.145 610.919 1.00 41.23  ? 1053 PHE A O     1 
ATOM   7967  C  CB    . PHE A 1  1053 ? 441.243 -44.779 609.096 1.00 39.68  ? 1053 PHE A CB    1 
ATOM   7968  C  CG    . PHE A 1  1053 ? 440.186 -44.155 608.228 1.00 39.66  ? 1053 PHE A CG    1 
ATOM   7969  C  CD1   . PHE A 1  1053 ? 438.853 -44.176 608.606 1.00 40.52  ? 1053 PHE A CD1   1 
ATOM   7970  C  CD2   . PHE A 1  1053 ? 440.527 -43.541 607.034 1.00 39.66  ? 1053 PHE A CD2   1 
ATOM   7971  C  CE1   . PHE A 1  1053 ? 437.880 -43.599 607.809 1.00 40.07  ? 1053 PHE A CE1   1 
ATOM   7972  C  CE2   . PHE A 1  1053 ? 439.559 -42.964 606.232 1.00 39.52  ? 1053 PHE A CE2   1 
ATOM   7973  C  CZ    . PHE A 1  1053 ? 438.234 -42.995 606.620 1.00 40.24  ? 1053 PHE A CZ    1 
ATOM   7974  N  N     . LEU A 1  1054 ? 440.481 -44.100 612.028 1.00 41.47  ? 1054 LEU A N     1 
ATOM   7975  C  CA    . LEU A 1  1054 ? 439.504 -43.696 613.029 1.00 42.06  ? 1054 LEU A CA    1 
ATOM   7976  C  C     . LEU A 1  1054 ? 440.034 -42.546 613.882 1.00 40.41  ? 1054 LEU A C     1 
ATOM   7977  O  O     . LEU A 1  1054 ? 439.265 -41.700 614.339 1.00 39.35  ? 1054 LEU A O     1 
ATOM   7978  C  CB    . LEU A 1  1054 ? 439.118 -44.887 613.907 1.00 45.86  ? 1054 LEU A CB    1 
ATOM   7979  C  CG    . LEU A 1  1054 ? 438.375 -45.997 613.161 1.00 44.01  ? 1054 LEU A CG    1 
ATOM   7980  C  CD1   . LEU A 1  1054 ? 438.047 -47.157 614.085 1.00 47.55  ? 1054 LEU A CD1   1 
ATOM   7981  C  CD2   . LEU A 1  1054 ? 437.111 -45.450 612.514 1.00 42.65  ? 1054 LEU A CD2   1 
ATOM   7982  N  N     . ARG A 1  1055 ? 441.348 -42.511 614.089 1.00 58.39  ? 1055 ARG A N     1 
ATOM   7983  C  CA    . ARG A 1  1055 ? 441.966 -41.403 614.812 1.00 57.83  ? 1055 ARG A CA    1 
ATOM   7984  C  C     . ARG A 1  1055 ? 441.930 -40.122 613.986 1.00 56.81  ? 1055 ARG A C     1 
ATOM   7985  O  O     . ARG A 1  1055 ? 441.817 -39.024 614.531 1.00 56.84  ? 1055 ARG A O     1 
ATOM   7986  C  CB    . ARG A 1  1055 ? 443.414 -41.727 615.185 1.00 58.05  ? 1055 ARG A CB    1 
ATOM   7987  C  CG    . ARG A 1  1055 ? 443.589 -42.867 616.172 1.00 63.29  ? 1055 ARG A CG    1 
ATOM   7988  C  CD    . ARG A 1  1055 ? 445.006 -42.880 616.728 1.00 60.85  ? 1055 ARG A CD    1 
ATOM   7989  N  NE    . ARG A 1  1055 ? 445.329 -44.132 617.404 1.00 65.29  ? 1055 ARG A NE    1 
ATOM   7990  C  CZ    . ARG A 1  1055 ? 446.034 -45.115 616.853 1.00 68.73  ? 1055 ARG A CZ    1 
ATOM   7991  N  NH1   . ARG A 1  1055 ? 446.495 -44.989 615.616 1.00 68.85  ? 1055 ARG A NH1   1 
ATOM   7992  N  NH2   . ARG A 1  1055 ? 446.282 -46.223 617.539 1.00 73.11  ? 1055 ARG A NH2   1 
ATOM   7993  N  N     . SER A 1  1056 ? 442.028 -40.271 612.669 1.00 34.96  ? 1056 SER A N     1 
ATOM   7994  C  CA    . SER A 1  1056 ? 442.145 -39.126 611.771 1.00 33.93  ? 1056 SER A CA    1 
ATOM   7995  C  C     . SER A 1  1056 ? 440.824 -38.384 611.575 1.00 33.62  ? 1056 SER A C     1 
ATOM   7996  O  O     . SER A 1  1056 ? 440.806 -37.273 611.046 1.00 32.81  ? 1056 SER A O     1 
ATOM   7997  C  CB    . SER A 1  1056 ? 442.690 -39.577 610.414 1.00 33.95  ? 1056 SER A CB    1 
ATOM   7998  O  OG    . SER A 1  1056 ? 444.000 -40.107 610.539 1.00 34.21  ? 1056 SER A OG    1 
ATOM   7999  N  N     . VAL A 1  1057 ? 439.725 -39.001 611.996 1.00 31.44  ? 1057 VAL A N     1 
ATOM   8000  C  CA    . VAL A 1  1057 ? 438.406 -38.392 611.859 1.00 31.34  ? 1057 VAL A CA    1 
ATOM   8001  C  C     . VAL A 1  1057 ? 438.306 -37.134 612.716 1.00 30.70  ? 1057 VAL A C     1 
ATOM   8002  O  O     . VAL A 1  1057 ? 438.837 -37.089 613.826 1.00 30.76  ? 1057 VAL A O     1 
ATOM   8003  C  CB    . VAL A 1  1057 ? 437.285 -39.373 612.258 1.00 32.46  ? 1057 VAL A CB    1 
ATOM   8004  C  CG1   . VAL A 1  1057 ? 435.924 -38.818 611.869 1.00 32.48  ? 1057 VAL A CG1   1 
ATOM   8005  C  CG2   . VAL A 1  1057 ? 437.510 -40.724 611.607 1.00 33.24  ? 1057 VAL A CG2   1 
ATOM   8006  N  N     . VAL A 1  1058 ? 437.634 -36.112 612.193 1.00 37.76  ? 1058 VAL A N     1 
ATOM   8007  C  CA    . VAL A 1  1058 ? 437.443 -34.866 612.926 1.00 37.20  ? 1058 VAL A CA    1 
ATOM   8008  C  C     . VAL A 1  1058 ? 436.556 -35.100 614.148 1.00 37.90  ? 1058 VAL A C     1 
ATOM   8009  O  O     . VAL A 1  1058 ? 435.597 -35.872 614.094 1.00 38.74  ? 1058 VAL A O     1 
ATOM   8010  C  CB    . VAL A 1  1058 ? 436.828 -33.770 612.024 1.00 36.64  ? 1058 VAL A CB    1 
ATOM   8011  C  CG1   . VAL A 1  1058 ? 435.485 -34.221 611.468 1.00 37.32  ? 1058 VAL A CG1   1 
ATOM   8012  C  CG2   . VAL A 1  1058 ? 436.688 -32.457 612.783 1.00 36.10  ? 1058 VAL A CG2   1 
ATOM   8013  N  N     . HIS A 1  1059 ? 436.898 -34.450 615.256 1.00 40.69  ? 1059 HIS A N     1 
ATOM   8014  C  CA    . HIS A 1  1059 ? 436.123 -34.573 616.485 1.00 40.40  ? 1059 HIS A CA    1 
ATOM   8015  C  C     . HIS A 1  1059 ? 434.961 -33.586 616.497 1.00 40.29  ? 1059 HIS A C     1 
ATOM   8016  O  O     . HIS A 1  1059 ? 435.164 -32.390 616.304 1.00 40.16  ? 1059 HIS A O     1 
ATOM   8017  C  CB    . HIS A 1  1059 ? 437.017 -34.350 617.706 1.00 40.62  ? 1059 HIS A CB    1 
ATOM   8018  C  CG    . HIS A 1  1059 ? 438.060 -35.408 617.893 1.00 41.52  ? 1059 HIS A CG    1 
ATOM   8019  N  ND1   . HIS A 1  1059 ? 438.207 -36.108 619.072 1.00 44.60  ? 1059 HIS A ND1   1 
ATOM   8020  C  CD2   . HIS A 1  1059 ? 439.003 -35.890 617.050 1.00 41.09  ? 1059 HIS A CD2   1 
ATOM   8021  C  CE1   . HIS A 1  1059 ? 439.197 -36.973 618.947 1.00 45.28  ? 1059 HIS A CE1   1 
ATOM   8022  N  NE2   . HIS A 1  1059 ? 439.697 -36.862 617.730 1.00 43.68  ? 1059 HIS A NE2   1 
ATOM   8023  N  N     . PRO A 1  1060 ? 433.734 -34.090 616.709 1.00 31.84  ? 1060 PRO A N     1 
ATOM   8024  C  CA    . PRO A 1  1060 ? 432.554 -33.224 616.813 1.00 31.95  ? 1060 PRO A CA    1 
ATOM   8025  C  C     . PRO A 1  1060 ? 432.708 -32.196 617.927 1.00 31.64  ? 1060 PRO A C     1 
ATOM   8026  O  O     . PRO A 1  1060 ? 433.127 -32.540 619.032 1.00 32.01  ? 1060 PRO A O     1 
ATOM   8027  C  CB    . PRO A 1  1060 ? 431.423 -34.208 617.123 1.00 33.25  ? 1060 PRO A CB    1 
ATOM   8028  C  CG    . PRO A 1  1060 ? 431.891 -35.504 616.554 1.00 33.62  ? 1060 PRO A CG    1 
ATOM   8029  C  CD    . PRO A 1  1060 ? 433.377 -35.517 616.772 1.00 32.93  ? 1060 PRO A CD    1 
ATOM   8030  N  N     . GLY A 1  1061 ? 432.371 -30.946 617.629 1.00 30.77  ? 1061 GLY A N     1 
ATOM   8031  C  CA    . GLY A 1  1061 ? 432.568 -29.856 618.565 1.00 30.40  ? 1061 GLY A CA    1 
ATOM   8032  C  C     . GLY A 1  1061 ? 433.728 -28.990 618.122 1.00 29.25  ? 1061 GLY A C     1 
ATOM   8033  O  O     . GLY A 1  1061 ? 433.979 -27.929 618.691 1.00 28.82  ? 1061 GLY A O     1 
ATOM   8034  N  N     . GLU A 1  1062 ? 434.435 -29.450 617.093 1.00 43.40  ? 1062 GLU A N     1 
ATOM   8035  C  CA    . GLU A 1  1062 ? 435.584 -28.733 616.553 1.00 42.19  ? 1062 GLU A CA    1 
ATOM   8036  C  C     . GLU A 1  1062 ? 435.176 -27.396 615.948 1.00 43.04  ? 1062 GLU A C     1 
ATOM   8037  O  O     . GLU A 1  1062 ? 434.596 -27.349 614.864 1.00 45.34  ? 1062 GLU A O     1 
ATOM   8038  C  CB    . GLU A 1  1062 ? 436.295 -29.582 615.496 1.00 41.76  ? 1062 GLU A CB    1 
ATOM   8039  C  CG    . GLU A 1  1062 ? 437.587 -28.980 614.970 1.00 40.57  ? 1062 GLU A CG    1 
ATOM   8040  C  CD    . GLU A 1  1062 ? 438.738 -29.123 615.944 1.00 42.66  ? 1062 GLU A CD    1 
ATOM   8041  O  OE1   . GLU A 1  1062 ? 438.642 -29.969 616.860 1.00 41.75  ? 1062 GLU A OE1   1 
ATOM   8042  O  OE2   . GLU A 1  1062 ? 439.741 -28.392 615.793 1.00 43.61  ? 1062 GLU A OE2   1 
ATOM   8043  N  N     . MET A 1  1063 ? 435.481 -26.313 616.656 1.00 38.45  ? 1063 MET A N     1 
ATOM   8044  C  CA    . MET A 1  1063 ? 435.216 -24.971 616.153 1.00 37.68  ? 1063 MET A CA    1 
ATOM   8045  C  C     . MET A 1  1063 ? 436.085 -24.682 614.938 1.00 37.36  ? 1063 MET A C     1 
ATOM   8046  O  O     . MET A 1  1063 ? 437.093 -23.982 615.033 1.00 36.94  ? 1063 MET A O     1 
ATOM   8047  C  CB    . MET A 1  1063 ? 435.467 -23.930 617.242 1.00 37.46  ? 1063 MET A CB    1 
ATOM   8048  C  CG    . MET A 1  1063 ? 434.590 -24.102 618.459 1.00 38.71  ? 1063 MET A CG    1 
ATOM   8049  S  SD    . MET A 1  1063 ? 432.844 -24.105 618.027 1.00 42.80  ? 1063 MET A SD    1 
ATOM   8050  C  CE    . MET A 1  1063 ? 432.691 -22.520 617.205 1.00 41.69  ? 1063 MET A CE    1 
ATOM   8051  N  N     . VAL A 1  1064 ? 435.687 -25.222 613.793 1.00 45.66  ? 1064 VAL A N     1 
ATOM   8052  C  CA    . VAL A 1  1064 ? 436.530 -25.163 612.611 1.00 45.83  ? 1064 VAL A CA    1 
ATOM   8053  C  C     . VAL A 1  1064 ? 436.254 -23.921 611.766 1.00 45.78  ? 1064 VAL A C     1 
ATOM   8054  O  O     . VAL A 1  1064 ? 436.968 -23.638 610.804 1.00 45.61  ? 1064 VAL A O     1 
ATOM   8055  C  CB    . VAL A 1  1064 ? 436.357 -26.421 611.749 1.00 45.62  ? 1064 VAL A CB    1 
ATOM   8056  C  CG1   . VAL A 1  1064 ? 435.088 -26.330 610.916 1.00 45.29  ? 1064 VAL A CG1   1 
ATOM   8057  C  CG2   . VAL A 1  1064 ? 437.580 -26.611 610.874 1.00 47.18  ? 1064 VAL A CG2   1 
ATOM   8058  N  N     . GLY A 1  1065 ? 435.221 -23.172 612.128 1.00 42.11  ? 1065 GLY A N     1 
ATOM   8059  C  CA    . GLY A 1  1065 ? 434.972 -21.904 611.474 1.00 41.64  ? 1065 GLY A CA    1 
ATOM   8060  C  C     . GLY A 1  1065 ? 436.075 -20.930 611.833 1.00 40.97  ? 1065 GLY A C     1 
ATOM   8061  O  O     . GLY A 1  1065 ? 436.745 -20.372 610.959 1.00 40.34  ? 1065 GLY A O     1 
ATOM   8062  N  N     . VAL A 1  1066 ? 436.267 -20.737 613.135 1.00 26.43  ? 1066 VAL A N     1 
ATOM   8063  C  CA    . VAL A 1  1066 ? 437.340 -19.897 613.648 1.00 25.92  ? 1066 VAL A CA    1 
ATOM   8064  C  C     . VAL A 1  1066 ? 438.695 -20.443 613.213 1.00 25.57  ? 1066 VAL A C     1 
ATOM   8065  O  O     . VAL A 1  1066 ? 439.595 -19.683 612.854 1.00 25.20  ? 1066 VAL A O     1 
ATOM   8066  C  CB    . VAL A 1  1066 ? 437.297 -19.804 615.186 1.00 26.04  ? 1066 VAL A CB    1 
ATOM   8067  C  CG1   . VAL A 1  1066 ? 438.448 -18.961 615.705 1.00 25.58  ? 1066 VAL A CG1   1 
ATOM   8068  C  CG2   . VAL A 1  1066 ? 435.964 -19.236 615.645 1.00 26.48  ? 1066 VAL A CG2   1 
ATOM   8069  N  N     . LEU A 1  1067 ? 438.827 -21.766 613.240 1.00 31.78  ? 1067 LEU A N     1 
ATOM   8070  C  CA    . LEU A 1  1067 ? 440.063 -22.425 612.834 1.00 31.16  ? 1067 LEU A CA    1 
ATOM   8071  C  C     . LEU A 1  1067 ? 440.410 -22.100 611.385 1.00 31.43  ? 1067 LEU A C     1 
ATOM   8072  O  O     . LEU A 1  1067 ? 441.567 -21.846 611.061 1.00 32.02  ? 1067 LEU A O     1 
ATOM   8073  C  CB    . LEU A 1  1067 ? 439.956 -23.939 613.024 1.00 31.28  ? 1067 LEU A CB    1 
ATOM   8074  C  CG    . LEU A 1  1067 ? 441.148 -24.771 612.545 1.00 31.17  ? 1067 LEU A CG    1 
ATOM   8075  C  CD1   . LEU A 1  1067 ? 442.416 -24.361 613.273 1.00 31.43  ? 1067 LEU A CD1   1 
ATOM   8076  C  CD2   . LEU A 1  1067 ? 440.877 -26.255 612.730 1.00 32.44  ? 1067 LEU A CD2   1 
ATOM   8077  N  N     . ALA A 1  1068 ? 439.401 -22.103 610.520 1.00 33.60  ? 1068 ALA A N     1 
ATOM   8078  C  CA    . ALA A 1  1068 ? 439.597 -21.788 609.111 1.00 33.58  ? 1068 ALA A CA    1 
ATOM   8079  C  C     . ALA A 1  1068 ? 439.936 -20.315 608.928 1.00 33.38  ? 1068 ALA A C     1 
ATOM   8080  O  O     . ALA A 1  1068 ? 440.871 -19.965 608.203 1.00 33.60  ? 1068 ALA A O     1 
ATOM   8081  C  CB    . ALA A 1  1068 ? 438.358 -22.146 608.312 1.00 34.57  ? 1068 ALA A CB    1 
ATOM   8082  N  N     . ALA A 1  1069 ? 439.167 -19.460 609.596 1.00 23.57  ? 1069 ALA A N     1 
ATOM   8083  C  CA    . ALA A 1  1069 ? 439.354 -18.016 609.505 1.00 23.41  ? 1069 ALA A CA    1 
ATOM   8084  C  C     . ALA A 1  1069 ? 440.753 -17.602 609.944 1.00 23.02  ? 1069 ALA A C     1 
ATOM   8085  O  O     . ALA A 1  1069 ? 441.347 -16.687 609.374 1.00 22.93  ? 1069 ALA A O     1 
ATOM   8086  C  CB    . ALA A 1  1069 ? 438.313 -17.303 610.336 1.00 23.57  ? 1069 ALA A CB    1 
ATOM   8087  N  N     . GLN A 1  1070 ? 441.275 -18.282 610.959 1.00 26.86  ? 1070 GLN A N     1 
ATOM   8088  C  CA    . GLN A 1  1070 ? 442.622 -18.014 611.443 1.00 26.60  ? 1070 GLN A CA    1 
ATOM   8089  C  C     . GLN A 1  1070 ? 443.663 -18.654 610.533 1.00 26.60  ? 1070 GLN A C     1 
ATOM   8090  O  O     . GLN A 1  1070 ? 444.737 -18.096 610.319 1.00 26.49  ? 1070 GLN A O     1 
ATOM   8091  C  CB    . GLN A 1  1070 ? 442.790 -18.520 612.875 1.00 26.58  ? 1070 GLN A CB    1 
ATOM   8092  C  CG    . GLN A 1  1070 ? 441.952 -17.775 613.898 1.00 26.64  ? 1070 GLN A CG    1 
ATOM   8093  C  CD    . GLN A 1  1070 ? 442.105 -18.342 615.294 1.00 26.75  ? 1070 GLN A CD    1 
ATOM   8094  O  OE1   . GLN A 1  1070 ? 442.482 -19.502 615.467 1.00 26.89  ? 1070 GLN A OE1   1 
ATOM   8095  N  NE2   . GLN A 1  1070 ? 441.819 -17.524 616.299 1.00 26.79  ? 1070 GLN A NE2   1 
ATOM   8096  N  N     . SER A 1  1071 ? 443.336 -19.823 609.991 1.00 34.03  ? 1071 SER A N     1 
ATOM   8097  C  CA    . SER A 1  1071 ? 444.244 -20.534 609.098 1.00 32.77  ? 1071 SER A CA    1 
ATOM   8098  C  C     . SER A 1  1071 ? 444.400 -19.806 607.769 1.00 34.52  ? 1071 SER A C     1 
ATOM   8099  O  O     . SER A 1  1071 ? 445.314 -20.098 607.001 1.00 33.94  ? 1071 SER A O     1 
ATOM   8100  C  CB    . SER A 1  1071 ? 443.756 -21.962 608.854 1.00 32.77  ? 1071 SER A CB    1 
ATOM   8101  O  OG    . SER A 1  1071 ? 443.669 -22.684 610.070 1.00 32.33  ? 1071 SER A OG    1 
ATOM   8102  N  N     . ILE A 1  1072 ? 443.497 -18.870 607.495 1.00 26.07  ? 1072 ILE A N     1 
ATOM   8103  C  CA    . ILE A 1  1072 ? 443.604 -18.038 606.302 1.00 26.26  ? 1072 ILE A CA    1 
ATOM   8104  C  C     . ILE A 1  1072 ? 444.157 -16.660 606.664 1.00 26.11  ? 1072 ILE A C     1 
ATOM   8105  O  O     . ILE A 1  1072 ? 444.977 -16.097 605.938 1.00 26.26  ? 1072 ILE A O     1 
ATOM   8106  C  CB    . ILE A 1  1072 ? 442.243 -17.883 605.594 1.00 26.58  ? 1072 ILE A CB    1 
ATOM   8107  C  CG1   . ILE A 1  1072 ? 441.703 -19.252 605.180 1.00 26.81  ? 1072 ILE A CG1   1 
ATOM   8108  C  CG2   . ILE A 1  1072 ? 442.367 -16.986 604.375 1.00 26.90  ? 1072 ILE A CG2   1 
ATOM   8109  C  CD1   . ILE A 1  1072 ? 440.367 -19.193 604.473 1.00 27.24  ? 1072 ILE A CD1   1 
ATOM   8110  N  N     . GLY A 1  1073 ? 443.716 -16.132 607.802 1.00 32.24  ? 1073 GLY A N     1 
ATOM   8111  C  CA    . GLY A 1  1073 ? 444.113 -14.805 608.238 1.00 32.15  ? 1073 GLY A CA    1 
ATOM   8112  C  C     . GLY A 1  1073 ? 445.561 -14.698 608.679 1.00 32.00  ? 1073 GLY A C     1 
ATOM   8113  O  O     . GLY A 1  1073 ? 446.235 -13.715 608.373 1.00 32.11  ? 1073 GLY A O     1 
ATOM   8114  N  N     . GLU A 1  1074 ? 446.041 -15.706 609.402 1.00 37.07  ? 1074 GLU A N     1 
ATOM   8115  C  CA    . GLU A 1  1074 ? 447.407 -15.689 609.924 1.00 35.01  ? 1074 GLU A CA    1 
ATOM   8116  C  C     . GLU A 1  1074 ? 448.474 -15.716 608.819 1.00 36.33  ? 1074 GLU A C     1 
ATOM   8117  O  O     . GLU A 1  1074 ? 449.410 -14.917 608.862 1.00 38.73  ? 1074 GLU A O     1 
ATOM   8118  C  CB    . GLU A 1  1074 ? 447.624 -16.853 610.901 1.00 34.70  ? 1074 GLU A CB    1 
ATOM   8119  C  CG    . GLU A 1  1074 ? 448.931 -16.787 611.681 1.00 35.78  ? 1074 GLU A CG    1 
ATOM   8120  C  CD    . GLU A 1  1074 ? 450.093 -17.444 610.956 1.00 36.10  ? 1074 GLU A CD    1 
ATOM   8121  O  OE1   . GLU A 1  1074 ? 449.848 -18.217 610.004 1.00 35.87  ? 1074 GLU A OE1   1 
ATOM   8122  O  OE2   . GLU A 1  1074 ? 451.254 -17.186 611.339 1.00 35.06  ? 1074 GLU A OE2   1 
ATOM   8123  N  N     . PRO A 1  1075 ? 448.353 -16.626 607.829 1.00 35.31  ? 1075 PRO A N     1 
ATOM   8124  C  CA    . PRO A 1  1075 ? 449.368 -16.560 606.771 1.00 36.70  ? 1075 PRO A CA    1 
ATOM   8125  C  C     . PRO A 1  1075 ? 449.192 -15.339 605.873 1.00 36.87  ? 1075 PRO A C     1 
ATOM   8126  O  O     . PRO A 1  1075 ? 450.105 -14.990 605.124 1.00 37.51  ? 1075 PRO A O     1 
ATOM   8127  C  CB    . PRO A 1  1075 ? 449.140 -17.853 605.984 1.00 35.47  ? 1075 PRO A CB    1 
ATOM   8128  C  CG    . PRO A 1  1075 ? 447.715 -18.170 606.205 1.00 36.77  ? 1075 PRO A CG    1 
ATOM   8129  C  CD    . PRO A 1  1075 ? 447.430 -17.757 607.618 1.00 34.53  ? 1075 PRO A CD    1 
ATOM   8130  N  N     . ALA A 1  1076 ? 448.029 -14.699 605.956 1.00 30.29  ? 1076 ALA A N     1 
ATOM   8131  C  CA    . ALA A 1  1076 ? 447.770 -13.475 605.208 1.00 30.61  ? 1076 ALA A CA    1 
ATOM   8132  C  C     . ALA A 1  1076 ? 448.512 -12.297 605.829 1.00 30.62  ? 1076 ALA A C     1 
ATOM   8133  O  O     . ALA A 1  1076 ? 448.553 -11.208 605.259 1.00 30.99  ? 1076 ALA A O     1 
ATOM   8134  C  CB    . ALA A 1  1076 ? 446.277 -13.190 605.149 1.00 30.60  ? 1076 ALA A CB    1 
ATOM   8135  N  N     . THR A 1  1077 ? 449.095 -12.525 607.001 1.00 59.16  ? 1077 THR A N     1 
ATOM   8136  C  CA    . THR A 1  1077 ? 449.857 -11.495 607.695 1.00 59.04  ? 1077 THR A CA    1 
ATOM   8137  C  C     . THR A 1  1077 ? 451.302 -11.484 607.215 1.00 61.98  ? 1077 THR A C     1 
ATOM   8138  O  O     . THR A 1  1077 ? 451.930 -10.428 607.128 1.00 63.75  ? 1077 THR A O     1 
ATOM   8139  C  CB    . THR A 1  1077 ? 449.816 -11.700 609.221 1.00 58.79  ? 1077 THR A CB    1 
ATOM   8140  O  OG1   . THR A 1  1077 ? 448.457 -11.854 609.647 1.00 57.22  ? 1077 THR A OG1   1 
ATOM   8141  C  CG2   . THR A 1  1077 ? 450.438 -10.513 609.940 1.00 62.98  ? 1077 THR A CG2   1 
ATOM   8142  N  N     . GLN A 1  1078 ? 451.823 -12.663 606.894 1.00 104.51 ? 1078 GLN A N     1 
ATOM   8143  C  CA    . GLN A 1  1078 ? 453.186 -12.783 606.392 1.00 104.75 ? 1078 GLN A CA    1 
ATOM   8144  C  C     . GLN A 1  1078 ? 453.235 -12.695 604.869 1.00 105.89 ? 1078 GLN A C     1 
ATOM   8145  O  O     . GLN A 1  1078 ? 454.043 -13.365 604.226 1.00 107.39 ? 1078 GLN A O     1 
ATOM   8146  C  CB    . GLN A 1  1078 ? 453.820 -14.096 606.861 1.00 102.45 ? 1078 GLN A CB    1 
ATOM   8147  C  CG    . GLN A 1  1078 ? 454.469 -14.030 608.241 1.00 105.05 ? 1078 GLN A CG    1 
ATOM   8148  C  CD    . GLN A 1  1078 ? 453.461 -13.934 609.373 1.00 105.62 ? 1078 GLN A CD    1 
ATOM   8149  O  OE1   . GLN A 1  1078 ? 452.825 -12.898 609.571 1.00 102.47 ? 1078 GLN A OE1   1 
ATOM   8150  N  NE2   . GLN A 1  1078 ? 453.316 -15.017 610.127 1.00 105.79 ? 1078 GLN A NE2   1 
ATOM   8151  N  N     . MET A 1  1079 ? 452.367 -11.865 604.296 1.00 65.41  ? 1079 MET A N     1 
ATOM   8152  C  CA    . MET A 1  1079 ? 452.376 -11.622 602.858 1.00 69.59  ? 1079 MET A CA    1 
ATOM   8153  C  C     . MET A 1  1079 ? 453.024 -10.277 602.548 1.00 73.56  ? 1079 MET A C     1 
ATOM   8154  O  O     . MET A 1  1079 ? 452.653 -9.251  603.121 1.00 69.54  ? 1079 MET A O     1 
ATOM   8155  C  CB    . MET A 1  1079 ? 450.957 -11.672 602.287 1.00 68.81  ? 1079 MET A CB    1 
ATOM   8156  C  CG    . MET A 1  1079 ? 450.242 -12.994 602.517 1.00 69.53  ? 1079 MET A CG    1 
ATOM   8157  S  SD    . MET A 1  1079 ? 448.705 -13.144 601.585 1.00 62.83  ? 1079 MET A SD    1 
ATOM   8158  C  CE    . MET A 1  1079 ? 449.339 -13.256 599.914 1.00 68.12  ? 1079 MET A CE    1 
ATOM   8159  N  N     . THR A 1  1080 ? 453.995 -10.291 601.639 1.00 100.33 ? 1080 THR A N     1 
ATOM   8160  C  CA    . THR A 1  1080 ? 454.745 -9.089  601.289 1.00 99.59  ? 1080 THR A CA    1 
ATOM   8161  C  C     . THR A 1  1080 ? 453.872 -8.061  600.576 1.00 100.30 ? 1080 THR A C     1 
ATOM   8162  O  O     . THR A 1  1080 ? 454.366 -7.040  600.097 1.00 102.59 ? 1080 THR A O     1 
ATOM   8163  C  CB    . THR A 1  1080 ? 455.950 -9.424  600.393 1.00 99.72  ? 1080 THR A CB    1 
ATOM   8164  O  OG1   . THR A 1  1080 ? 455.488 -9.970  599.152 1.00 99.48  ? 1080 THR A OG1   1 
ATOM   8165  C  CG2   . THR A 1  1080 ? 456.859 -10.433 601.079 1.00 98.33  ? 1080 THR A CG2   1 
ATOM   8166  N  N     . LYS A 1  1093 ? 450.669 -8.850  584.219 1.00 90.27  ? 1093 LYS A N     1 
ATOM   8167  C  CA    . LYS A 1  1093 ? 450.823 -8.849  585.669 1.00 90.90  ? 1093 LYS A CA    1 
ATOM   8168  C  C     . LYS A 1  1093 ? 449.540 -8.397  586.358 1.00 89.88  ? 1093 LYS A C     1 
ATOM   8169  O  O     . LYS A 1  1093 ? 449.224 -7.207  586.386 1.00 89.82  ? 1093 LYS A O     1 
ATOM   8170  C  CB    . LYS A 1  1093 ? 451.990 -7.951  586.084 1.00 92.49  ? 1093 LYS A CB    1 
ATOM   8171  C  CG    . LYS A 1  1093 ? 453.330 -8.372  585.503 1.00 95.94  ? 1093 LYS A CG    1 
ATOM   8172  C  CD    . LYS A 1  1093 ? 454.437 -7.414  585.910 1.00 93.73  ? 1093 LYS A CD    1 
ATOM   8173  C  CE    . LYS A 1  1093 ? 455.765 -7.808  585.285 1.00 94.18  ? 1093 LYS A CE    1 
ATOM   8174  N  NZ    . LYS A 1  1093 ? 456.851 -6.856  585.647 1.00 96.16  ? 1093 LYS A NZ    1 
ATOM   8175  N  N     . VAL A 1  1094 ? 448.805 -9.355  586.914 1.00 94.59  ? 1094 VAL A N     1 
ATOM   8176  C  CA    . VAL A 1  1094 ? 447.543 -9.068  587.586 1.00 93.59  ? 1094 VAL A CA    1 
ATOM   8177  C  C     . VAL A 1  1094 ? 447.761 -8.725  589.056 1.00 91.01  ? 1094 VAL A C     1 
ATOM   8178  O  O     . VAL A 1  1094 ? 448.857 -8.900  589.587 1.00 93.63  ? 1094 VAL A O     1 
ATOM   8179  C  CB    . VAL A 1  1094 ? 446.570 -10.258 587.489 1.00 92.83  ? 1094 VAL A CB    1 
ATOM   8180  C  CG1   . VAL A 1  1094 ? 446.313 -10.616 586.033 1.00 94.50  ? 1094 VAL A CG1   1 
ATOM   8181  C  CG2   . VAL A 1  1094 ? 447.123 -11.455 588.246 1.00 90.46  ? 1094 VAL A CG2   1 
ATOM   8182  N  N     . THR A 1  1095 ? 446.710 -8.238  589.708 1.00 49.67  ? 1095 THR A N     1 
ATOM   8183  C  CA    . THR A 1  1095 ? 446.779 -7.893  591.123 1.00 47.72  ? 1095 THR A CA    1 
ATOM   8184  C  C     . THR A 1  1095 ? 446.725 -9.139  591.999 1.00 46.32  ? 1095 THR A C     1 
ATOM   8185  O  O     . THR A 1  1095 ? 445.793 -9.936  591.901 1.00 47.47  ? 1095 THR A O     1 
ATOM   8186  C  CB    . THR A 1  1095 ? 445.639 -6.943  591.531 1.00 45.34  ? 1095 THR A CB    1 
ATOM   8187  O  OG1   . THR A 1  1095 ? 444.381 -7.508  591.141 1.00 45.70  ? 1095 THR A OG1   1 
ATOM   8188  C  CG2   . THR A 1  1095 ? 445.810 -5.587  590.862 1.00 47.74  ? 1095 THR A CG2   1 
ATOM   8189  N  N     . SER A 1  1096 ? 447.729 -9.300  592.853 1.00 99.18  ? 1096 SER A N     1 
ATOM   8190  C  CA    . SER A 1  1096 ? 447.794 -10.449 593.747 1.00 97.05  ? 1096 SER A CA    1 
ATOM   8191  C  C     . SER A 1  1096 ? 448.052 -10.011 595.183 1.00 95.14  ? 1096 SER A C     1 
ATOM   8192  O  O     . SER A 1  1096 ? 448.177 -8.819  595.466 1.00 95.37  ? 1096 SER A O     1 
ATOM   8193  C  CB    . SER A 1  1096 ? 448.882 -11.425 593.292 1.00 101.55 ? 1096 SER A CB    1 
ATOM   8194  O  OG    . SER A 1  1096 ? 450.158 -10.809 593.304 1.00 106.32 ? 1096 SER A OG    1 
ATOM   8195  N  N     . GLY A 1  1097 ? 448.124 -10.981 596.088 1.00 61.24  ? 1097 GLY A N     1 
ATOM   8196  C  CA    . GLY A 1  1097 ? 448.430 -10.706 597.479 1.00 59.72  ? 1097 GLY A CA    1 
ATOM   8197  C  C     . GLY A 1  1097 ? 447.279 -10.109 598.265 1.00 55.55  ? 1097 GLY A C     1 
ATOM   8198  O  O     . GLY A 1  1097 ? 446.110 -10.346 597.959 1.00 57.42  ? 1097 GLY A O     1 
ATOM   8199  N  N     . VAL A 1  1098 ? 447.624 -9.330  599.286 1.00 50.20  ? 1098 VAL A N     1 
ATOM   8200  C  CA    . VAL A 1  1098 ? 446.643 -8.718  600.180 1.00 52.33  ? 1098 VAL A CA    1 
ATOM   8201  C  C     . VAL A 1  1098 ? 445.565 -7.872  599.479 1.00 54.10  ? 1098 VAL A C     1 
ATOM   8202  O  O     . VAL A 1  1098 ? 444.387 -7.998  599.816 1.00 53.45  ? 1098 VAL A O     1 
ATOM   8203  C  CB    . VAL A 1  1098 ? 447.346 -7.845  601.246 1.00 51.73  ? 1098 VAL A CB    1 
ATOM   8204  C  CG1   . VAL A 1  1098 ? 446.326 -7.187  602.164 1.00 46.95  ? 1098 VAL A CG1   1 
ATOM   8205  C  CG2   . VAL A 1  1098 ? 448.322 -8.686  602.051 1.00 52.42  ? 1098 VAL A CG2   1 
ATOM   8206  N  N     . PRO A 1  1099 ? 445.946 -7.012  598.510 1.00 59.19  ? 1099 PRO A N     1 
ATOM   8207  C  CA    . PRO A 1  1099 ? 444.870 -6.240  597.872 1.00 59.51  ? 1099 PRO A CA    1 
ATOM   8208  C  C     . PRO A 1  1099 ? 443.883 -7.119  597.105 1.00 59.80  ? 1099 PRO A C     1 
ATOM   8209  O  O     . PRO A 1  1099 ? 442.681 -6.841  597.109 1.00 60.07  ? 1099 PRO A O     1 
ATOM   8210  C  CB    . PRO A 1  1099 ? 445.623 -5.307  596.917 1.00 61.43  ? 1099 PRO A CB    1 
ATOM   8211  C  CG    . PRO A 1  1099 ? 446.923 -5.986  596.670 1.00 60.25  ? 1099 PRO A CG    1 
ATOM   8212  C  CD    . PRO A 1  1099 ? 447.267 -6.644  597.967 1.00 59.15  ? 1099 PRO A CD    1 
ATOM   8213  N  N     . ARG A 1  1100 ? 444.389 -8.168  596.463 1.00 41.98  ? 1100 ARG A N     1 
ATOM   8214  C  CA    . ARG A 1  1100 ? 443.532 -9.105  595.746 1.00 41.83  ? 1100 ARG A CA    1 
ATOM   8215  C  C     . ARG A 1  1100 ? 442.642 -9.869  596.720 1.00 38.43  ? 1100 ARG A C     1 
ATOM   8216  O  O     . ARG A 1  1100 ? 441.467 -10.103 596.441 1.00 40.21  ? 1100 ARG A O     1 
ATOM   8217  C  CB    . ARG A 1  1100 ? 444.369 -10.078 594.911 1.00 42.08  ? 1100 ARG A CB    1 
ATOM   8218  C  CG    . ARG A 1  1100 ? 443.550 -11.108 594.141 1.00 42.15  ? 1100 ARG A CG    1 
ATOM   8219  C  CD    . ARG A 1  1100 ? 442.437 -10.449 593.341 1.00 43.96  ? 1100 ARG A CD    1 
ATOM   8220  N  NE    . ARG A 1  1100 ? 441.574 -11.424 592.681 1.00 42.32  ? 1100 ARG A NE    1 
ATOM   8221  C  CZ    . ARG A 1  1100 ? 440.340 -11.161 592.263 1.00 43.07  ? 1100 ARG A CZ    1 
ATOM   8222  N  NH1   . ARG A 1  1100 ? 439.820 -9.955  592.446 1.00 44.55  ? 1100 ARG A NH1   1 
ATOM   8223  N  NH2   . ARG A 1  1100 ? 439.620 -12.102 591.668 1.00 42.47  ? 1100 ARG A NH2   1 
ATOM   8224  N  N     . LEU A 1  1101 ? 443.205 -10.252 597.862 1.00 42.35  ? 1101 LEU A N     1 
ATOM   8225  C  CA    . LEU A 1  1101 ? 442.438 -10.929 598.902 1.00 40.66  ? 1101 LEU A CA    1 
ATOM   8226  C  C     . LEU A 1  1101 ? 441.309 -10.030 599.393 1.00 41.17  ? 1101 LEU A C     1 
ATOM   8227  O  O     . LEU A 1  1101 ? 440.196 -10.493 599.659 1.00 41.96  ? 1101 LEU A O     1 
ATOM   8228  C  CB    . LEU A 1  1101 ? 443.343 -11.329 600.068 1.00 39.21  ? 1101 LEU A CB    1 
ATOM   8229  C  CG    . LEU A 1  1101 ? 442.678 -12.110 601.201 1.00 36.65  ? 1101 LEU A CG    1 
ATOM   8230  C  CD1   . LEU A 1  1101 ? 442.223 -13.477 600.714 1.00 35.34  ? 1101 LEU A CD1   1 
ATOM   8231  C  CD2   . LEU A 1  1101 ? 443.616 -12.243 602.391 1.00 34.59  ? 1101 LEU A CD2   1 
ATOM   8232  N  N     . LYS A 1  1102 ? 441.607 -8.739  599.500 1.00 53.49  ? 1102 LYS A N     1 
ATOM   8233  C  CA    . LYS A 1  1102 ? 440.624 -7.750  599.917 1.00 53.86  ? 1102 LYS A CA    1 
ATOM   8234  C  C     . LYS A 1  1102 ? 439.526 -7.616  598.865 1.00 54.72  ? 1102 LYS A C     1 
ATOM   8235  O  O     . LYS A 1  1102 ? 438.349 -7.491  599.202 1.00 54.80  ? 1102 LYS A O     1 
ATOM   8236  C  CB    . LYS A 1  1102 ? 441.298 -6.398  600.167 1.00 55.24  ? 1102 LYS A CB    1 
ATOM   8237  C  CG    . LYS A 1  1102 ? 440.445 -5.408  600.943 1.00 55.65  ? 1102 LYS A CG    1 
ATOM   8238  C  CD    . LYS A 1  1102 ? 441.228 -4.143  601.272 1.00 57.15  ? 1102 LYS A CD    1 
ATOM   8239  C  CE    . LYS A 1  1102 ? 440.412 -3.192  602.137 1.00 57.65  ? 1102 LYS A CE    1 
ATOM   8240  N  NZ    . LYS A 1  1102 ? 439.158 -2.753  601.463 1.00 59.47  ? 1102 LYS A NZ    1 
ATOM   8241  N  N     . GLU A 1  1103 ? 439.918 -7.650  597.593 1.00 44.77  ? 1103 GLU A N     1 
ATOM   8242  C  CA    . GLU A 1  1103 ? 438.955 -7.626  596.493 1.00 45.93  ? 1103 GLU A CA    1 
ATOM   8243  C  C     . GLU A 1  1103 ? 438.016 -8.824  596.552 1.00 47.83  ? 1103 GLU A C     1 
ATOM   8244  O  O     . GLU A 1  1103 ? 436.801 -8.685  596.408 1.00 49.31  ? 1103 GLU A O     1 
ATOM   8245  C  CB    . GLU A 1  1103 ? 439.671 -7.611  595.142 1.00 45.07  ? 1103 GLU A CB    1 
ATOM   8246  C  CG    . GLU A 1  1103 ? 440.317 -6.294  594.777 1.00 48.82  ? 1103 GLU A CG    1 
ATOM   8247  C  CD    . GLU A 1  1103 ? 440.886 -6.307  593.372 1.00 52.99  ? 1103 GLU A CD    1 
ATOM   8248  O  OE1   . GLU A 1  1103 ? 440.816 -7.364  592.709 1.00 51.17  ? 1103 GLU A OE1   1 
ATOM   8249  O  OE2   . GLU A 1  1103 ? 441.401 -5.261  592.930 1.00 57.83  ? 1103 GLU A OE2   1 
ATOM   8250  N  N     . ILE A 1  1104 ? 438.595 -10.002 596.758 1.00 29.26  ? 1104 ILE A N     1 
ATOM   8251  C  CA    . ILE A 1  1104 ? 437.835 -11.242 596.819 1.00 29.08  ? 1104 ILE A CA    1 
ATOM   8252  C  C     . ILE A 1  1104 ? 436.850 -11.233 597.979 1.00 28.70  ? 1104 ILE A C     1 
ATOM   8253  O  O     . ILE A 1  1104 ? 435.661 -11.494 597.794 1.00 29.15  ? 1104 ILE A O     1 
ATOM   8254  C  CB    . ILE A 1  1104 ? 438.765 -12.460 596.957 1.00 28.44  ? 1104 ILE A CB    1 
ATOM   8255  C  CG1   . ILE A 1  1104 ? 439.614 -12.626 595.696 1.00 28.98  ? 1104 ILE A CG1   1 
ATOM   8256  C  CG2   . ILE A 1  1104 ? 437.961 -13.717 597.221 1.00 28.24  ? 1104 ILE A CG2   1 
ATOM   8257  C  CD1   . ILE A 1  1104 ? 440.596 -13.774 595.769 1.00 28.49  ? 1104 ILE A CD1   1 
ATOM   8258  N  N     . LEU A 1  1105 ? 437.347 -10.924 599.173 1.00 42.11  ? 1105 LEU A N     1 
ATOM   8259  C  CA    . LEU A 1  1105 ? 436.510 -10.929 600.369 1.00 42.90  ? 1105 LEU A CA    1 
ATOM   8260  C  C     . LEU A 1  1105 ? 435.425 -9.856  600.311 1.00 44.81  ? 1105 LEU A C     1 
ATOM   8261  O  O     . LEU A 1  1105 ? 434.307 -10.071 600.779 1.00 45.27  ? 1105 LEU A O     1 
ATOM   8262  C  CB    . LEU A 1  1105 ? 437.366 -10.746 601.623 1.00 40.31  ? 1105 LEU A CB    1 
ATOM   8263  C  CG    . LEU A 1  1105 ? 437.795 -12.031 602.338 1.00 38.02  ? 1105 LEU A CG    1 
ATOM   8264  C  CD1   . LEU A 1  1105 ? 438.581 -12.948 601.414 1.00 36.90  ? 1105 LEU A CD1   1 
ATOM   8265  C  CD2   . LEU A 1  1105 ? 438.603 -11.701 603.580 1.00 39.04  ? 1105 LEU A CD2   1 
ATOM   8266  N  N     . ASN A 1  1106 ? 435.752 -8.703  599.735 1.00 45.94  ? 1106 ASN A N     1 
ATOM   8267  C  CA    . ASN A 1  1106 ? 434.763 -7.644  599.573 1.00 47.43  ? 1106 ASN A CA    1 
ATOM   8268  C  C     . ASN A 1  1106 ? 433.823 -7.922  598.407 1.00 49.47  ? 1106 ASN A C     1 
ATOM   8269  O  O     . ASN A 1  1106 ? 432.810 -7.239  598.245 1.00 49.97  ? 1106 ASN A O     1 
ATOM   8270  C  CB    . ASN A 1  1106 ? 435.444 -6.288  599.370 1.00 47.11  ? 1106 ASN A CB    1 
ATOM   8271  C  CG    . ASN A 1  1106 ? 436.142 -5.794  600.619 1.00 47.28  ? 1106 ASN A CG    1 
ATOM   8272  O  OD1   . ASN A 1  1106 ? 435.826 -6.218  601.729 1.00 47.70  ? 1106 ASN A OD1   1 
ATOM   8273  N  ND2   . ASN A 1  1106 ? 437.093 -4.884  600.444 1.00 48.05  ? 1106 ASN A ND2   1 
ATOM   8274  N  N     . VAL A 1  1107 ? 434.163 -8.937  597.613 1.00 59.48  ? 1107 VAL A N     1 
ATOM   8275  C  CA    . VAL A 1  1107 ? 433.455 -9.249  596.373 1.00 62.03  ? 1107 VAL A CA    1 
ATOM   8276  C  C     . VAL A 1  1107 ? 433.365 -7.985  595.520 1.00 61.04  ? 1107 VAL A C     1 
ATOM   8277  O  O     . VAL A 1  1107 ? 432.300 -7.382  595.380 1.00 61.52  ? 1107 VAL A O     1 
ATOM   8278  C  CB    . VAL A 1  1107 ? 432.047 -9.827  596.638 1.00 60.13  ? 1107 VAL A CB    1 
ATOM   8279  C  CG1   . VAL A 1  1107 ? 431.434 -10.349 595.352 1.00 58.53  ? 1107 VAL A CG1   1 
ATOM   8280  C  CG2   . VAL A 1  1107 ? 432.126 -10.945 597.658 1.00 57.33  ? 1107 VAL A CG2   1 
ATOM   8281  N  N     . ALA A 1  1108 ? 434.507 -7.583  594.973 1.00 56.10  ? 1108 ALA A N     1 
ATOM   8282  C  CA    . ALA A 1  1108 ? 434.614 -6.336  594.230 1.00 58.18  ? 1108 ALA A CA    1 
ATOM   8283  C  C     . ALA A 1  1108 ? 433.802 -6.375  592.943 1.00 62.45  ? 1108 ALA A C     1 
ATOM   8284  O  O     . ALA A 1  1108 ? 434.000 -7.246  592.095 1.00 64.11  ? 1108 ALA A O     1 
ATOM   8285  C  CB    . ALA A 1  1108 ? 436.070 -6.028  593.926 1.00 60.64  ? 1108 ALA A CB    1 
ATOM   8286  N  N     . LYS A 1  1109 ? 432.885 -5.423  592.809 1.00 70.24  ? 1109 LYS A N     1 
ATOM   8287  C  CA    . LYS A 1  1109 ? 432.079 -5.289  591.605 1.00 70.37  ? 1109 LYS A CA    1 
ATOM   8288  C  C     . LYS A 1  1109 ? 432.966 -4.878  590.435 1.00 69.96  ? 1109 LYS A C     1 
ATOM   8289  O  O     . LYS A 1  1109 ? 432.703 -5.227  589.285 1.00 69.95  ? 1109 LYS A O     1 
ATOM   8290  C  CB    . LYS A 1  1109 ? 430.966 -4.262  591.818 1.00 72.26  ? 1109 LYS A CB    1 
ATOM   8291  C  CG    . LYS A 1  1109 ? 430.241 -4.399  593.150 1.00 72.13  ? 1109 LYS A CG    1 
ATOM   8292  C  CD    . LYS A 1  1109 ? 428.998 -5.263  593.030 1.00 73.45  ? 1109 LYS A CD    1 
ATOM   8293  C  CE    . LYS A 1  1109 ? 427.922 -4.560  592.218 1.00 78.23  ? 1109 LYS A CE    1 
ATOM   8294  N  NZ    . LYS A 1  1109 ? 426.653 -5.339  592.176 1.00 81.75  ? 1109 LYS A NZ    1 
ATOM   8295  N  N     . ASN A 1  1110 ? 434.023 -4.134  590.746 1.00 77.65  ? 1110 ASN A N     1 
ATOM   8296  C  CA    . ASN A 1  1110 ? 434.962 -3.660  589.738 1.00 78.65  ? 1110 ASN A CA    1 
ATOM   8297  C  C     . ASN A 1  1110 ? 436.412 -3.916  590.143 1.00 76.66  ? 1110 ASN A C     1 
ATOM   8298  O  O     . ASN A 1  1110 ? 437.094 -3.026  590.650 1.00 76.99  ? 1110 ASN A O     1 
ATOM   8299  C  CB    . ASN A 1  1110 ? 434.743 -2.169  589.473 1.00 83.31  ? 1110 ASN A CB    1 
ATOM   8300  C  CG    . ASN A 1  1110 ? 434.537 -1.371  590.750 1.00 84.33  ? 1110 ASN A CG    1 
ATOM   8301  O  OD1   . ASN A 1  1110 ? 434.874 -1.827  591.844 1.00 79.42  ? 1110 ASN A OD1   1 
ATOM   8302  N  ND2   . ASN A 1  1110 ? 433.979 -0.173  590.615 1.00 87.86  ? 1110 ASN A ND2   1 
ATOM   8303  N  N     . MET A 1  1111 ? 436.875 -5.141  589.914 1.00 52.34  ? 1111 MET A N     1 
ATOM   8304  C  CA    . MET A 1  1111 ? 438.237 -5.528  590.261 1.00 52.19  ? 1111 MET A CA    1 
ATOM   8305  C  C     . MET A 1  1111 ? 439.260 -4.758  589.434 1.00 50.58  ? 1111 MET A C     1 
ATOM   8306  O  O     . MET A 1  1111 ? 438.971 -4.330  588.316 1.00 53.00  ? 1111 MET A O     1 
ATOM   8307  C  CB    . MET A 1  1111 ? 438.427 -7.034  590.071 1.00 52.38  ? 1111 MET A CB    1 
ATOM   8308  C  CG    . MET A 1  1111 ? 438.091 -7.529  588.675 1.00 52.73  ? 1111 MET A CG    1 
ATOM   8309  S  SD    . MET A 1  1111 ? 438.172 -9.324  588.546 1.00 47.96  ? 1111 MET A SD    1 
ATOM   8310  C  CE    . MET A 1  1111 ? 439.856 -9.622  589.073 1.00 48.12  ? 1111 MET A CE    1 
ATOM   8311  N  N     . LYS A 1  1112 ? 440.455 -4.586  589.989 1.00 82.35  ? 1112 LYS A N     1 
ATOM   8312  C  CA    . LYS A 1  1112 ? 441.493 -3.782  589.352 1.00 84.43  ? 1112 LYS A CA    1 
ATOM   8313  C  C     . LYS A 1  1112 ? 442.010 -4.402  588.057 1.00 84.05  ? 1112 LYS A C     1 
ATOM   8314  O  O     . LYS A 1  1112 ? 442.297 -3.689  587.096 1.00 85.23  ? 1112 LYS A O     1 
ATOM   8315  C  CB    . LYS A 1  1112 ? 442.655 -3.557  590.321 1.00 84.90  ? 1112 LYS A CB    1 
ATOM   8316  C  CG    . LYS A 1  1112 ? 442.331 -2.610  591.465 1.00 83.95  ? 1112 LYS A CG    1 
ATOM   8317  C  CD    . LYS A 1  1112 ? 443.443 -2.592  592.499 1.00 82.27  ? 1112 LYS A CD    1 
ATOM   8318  C  CE    . LYS A 1  1112 ? 444.765 -2.166  591.883 1.00 89.41  ? 1112 LYS A CE    1 
ATOM   8319  N  NZ    . LYS A 1  1112 ? 445.877 -2.217  592.872 1.00 90.33  ? 1112 LYS A NZ    1 
ATOM   8320  N  N     . THR A 1  1113 ? 442.127 -5.725  588.029 1.00 64.13  ? 1113 THR A N     1 
ATOM   8321  C  CA    . THR A 1  1113 ? 442.636 -6.404  586.842 1.00 66.55  ? 1113 THR A CA    1 
ATOM   8322  C  C     . THR A 1  1113 ? 441.724 -7.541  586.388 1.00 66.49  ? 1113 THR A C     1 
ATOM   8323  O  O     . THR A 1  1113 ? 442.003 -8.710  586.657 1.00 64.73  ? 1113 THR A O     1 
ATOM   8324  C  CB    . THR A 1  1113 ? 444.049 -6.968  587.083 1.00 65.91  ? 1113 THR A CB    1 
ATOM   8325  O  OG1   . THR A 1  1113 ? 444.844 -5.993  587.768 1.00 68.73  ? 1113 THR A OG1   1 
ATOM   8326  C  CG2   . THR A 1  1113 ? 444.716 -7.320  585.761 1.00 70.02  ? 1113 THR A CG2   1 
ATOM   8327  N  N     . PRO A 1  1114 ? 440.622 -7.200  585.702 1.00 50.53  ? 1114 PRO A N     1 
ATOM   8328  C  CA    . PRO A 1  1114 ? 439.747 -8.219  585.116 1.00 50.31  ? 1114 PRO A CA    1 
ATOM   8329  C  C     . PRO A 1  1114 ? 440.438 -8.924  583.955 1.00 52.80  ? 1114 PRO A C     1 
ATOM   8330  O  O     . PRO A 1  1114 ? 440.787 -8.273  582.971 1.00 55.09  ? 1114 PRO A O     1 
ATOM   8331  C  CB    . PRO A 1  1114 ? 438.536 -7.413  584.626 1.00 51.47  ? 1114 PRO A CB    1 
ATOM   8332  C  CG    . PRO A 1  1114 ? 438.624 -6.095  585.330 1.00 51.40  ? 1114 PRO A CG    1 
ATOM   8333  C  CD    . PRO A 1  1114 ? 440.085 -5.844  585.511 1.00 52.47  ? 1114 PRO A CD    1 
ATOM   8334  N  N     . SER A 1  1115 ? 440.635 -10.233 584.069 1.00 48.95  ? 1115 SER A N     1 
ATOM   8335  C  CA    . SER A 1  1115 ? 441.342 -10.979 583.034 1.00 48.75  ? 1115 SER A CA    1 
ATOM   8336  C  C     . SER A 1  1115 ? 440.524 -12.146 582.494 1.00 48.48  ? 1115 SER A C     1 
ATOM   8337  O  O     . SER A 1  1115 ? 439.778 -12.791 583.229 1.00 46.99  ? 1115 SER A O     1 
ATOM   8338  C  CB    . SER A 1  1115 ? 442.680 -11.492 583.567 1.00 50.41  ? 1115 SER A CB    1 
ATOM   8339  O  OG    . SER A 1  1115 ? 443.356 -12.260 582.586 1.00 50.60  ? 1115 SER A OG    1 
ATOM   8340  N  N     . LEU A 1  1116 ? 440.679 -12.411 581.201 1.00 57.87  ? 1116 LEU A N     1 
ATOM   8341  C  CA    . LEU A 1  1116 ? 439.992 -13.518 580.551 1.00 57.13  ? 1116 LEU A CA    1 
ATOM   8342  C  C     . LEU A 1  1116 ? 441.012 -14.517 580.013 1.00 56.83  ? 1116 LEU A C     1 
ATOM   8343  O  O     . LEU A 1  1116 ? 441.815 -14.185 579.144 1.00 59.80  ? 1116 LEU A O     1 
ATOM   8344  C  CB    . LEU A 1  1116 ? 439.096 -13.006 579.418 1.00 61.18  ? 1116 LEU A CB    1 
ATOM   8345  C  CG    . LEU A 1  1116 ? 437.699 -13.613 579.246 1.00 59.72  ? 1116 LEU A CG    1 
ATOM   8346  C  CD1   . LEU A 1  1116 ? 437.746 -15.132 579.271 1.00 59.23  ? 1116 LEU A CD1   1 
ATOM   8347  C  CD2   . LEU A 1  1116 ? 436.740 -13.083 580.301 1.00 60.30  ? 1116 LEU A CD2   1 
ATOM   8348  N  N     . THR A 1  1117 ? 440.984 -15.737 580.534 1.00 42.09  ? 1117 THR A N     1 
ATOM   8349  C  CA    . THR A 1  1117 ? 441.896 -16.777 580.069 1.00 42.35  ? 1117 THR A CA    1 
ATOM   8350  C  C     . THR A 1  1117 ? 441.196 -17.692 579.070 1.00 43.19  ? 1117 THR A C     1 
ATOM   8351  O  O     . THR A 1  1117 ? 440.352 -18.505 579.444 1.00 43.06  ? 1117 THR A O     1 
ATOM   8352  C  CB    . THR A 1  1117 ? 442.445 -17.612 581.238 1.00 41.50  ? 1117 THR A CB    1 
ATOM   8353  O  OG1   . THR A 1  1117 ? 443.143 -16.755 582.151 1.00 40.98  ? 1117 THR A OG1   1 
ATOM   8354  C  CG2   . THR A 1  1117 ? 443.397 -18.682 580.727 1.00 41.95  ? 1117 THR A CG2   1 
ATOM   8355  N  N     . VAL A 1  1118 ? 441.553 -17.552 577.797 1.00 48.90  ? 1118 VAL A N     1 
ATOM   8356  C  CA    . VAL A 1  1118 ? 440.887 -18.289 576.729 1.00 50.05  ? 1118 VAL A CA    1 
ATOM   8357  C  C     . VAL A 1  1118 ? 441.763 -19.402 576.162 1.00 50.86  ? 1118 VAL A C     1 
ATOM   8358  O  O     . VAL A 1  1118 ? 442.850 -19.145 575.644 1.00 51.38  ? 1118 VAL A O     1 
ATOM   8359  C  CB    . VAL A 1  1118 ? 440.474 -17.351 575.579 1.00 51.01  ? 1118 VAL A CB    1 
ATOM   8360  C  CG1   . VAL A 1  1118 ? 439.739 -18.130 574.498 1.00 52.43  ? 1118 VAL A CG1   1 
ATOM   8361  C  CG2   . VAL A 1  1118 ? 439.609 -16.218 576.105 1.00 50.40  ? 1118 VAL A CG2   1 
ATOM   8362  N  N     . TYR A 1  1119 ? 441.281 -20.637 576.261 1.00 63.49  ? 1119 TYR A N     1 
ATOM   8363  C  CA    . TYR A 1  1119 ? 442.000 -21.785 575.722 1.00 63.59  ? 1119 TYR A CA    1 
ATOM   8364  C  C     . TYR A 1  1119 ? 441.503 -22.125 574.322 1.00 67.12  ? 1119 TYR A C     1 
ATOM   8365  O  O     . TYR A 1  1119 ? 440.323 -21.959 574.015 1.00 66.90  ? 1119 TYR A O     1 
ATOM   8366  C  CB    . TYR A 1  1119 ? 441.854 -22.994 576.646 1.00 62.64  ? 1119 TYR A CB    1 
ATOM   8367  C  CG    . TYR A 1  1119 ? 442.548 -22.822 577.977 1.00 59.70  ? 1119 TYR A CG    1 
ATOM   8368  C  CD1   . TYR A 1  1119 ? 443.884 -23.163 578.132 1.00 60.28  ? 1119 TYR A CD1   1 
ATOM   8369  C  CD2   . TYR A 1  1119 ? 441.870 -22.314 579.076 1.00 58.95  ? 1119 TYR A CD2   1 
ATOM   8370  C  CE1   . TYR A 1  1119 ? 444.525 -23.006 579.346 1.00 58.71  ? 1119 TYR A CE1   1 
ATOM   8371  C  CE2   . TYR A 1  1119 ? 442.502 -22.153 580.295 1.00 58.67  ? 1119 TYR A CE2   1 
ATOM   8372  C  CZ    . TYR A 1  1119 ? 443.830 -22.500 580.424 1.00 57.57  ? 1119 TYR A CZ    1 
ATOM   8373  O  OH    . TYR A 1  1119 ? 444.465 -22.342 581.634 1.00 57.56  ? 1119 TYR A OH    1 
ATOM   8374  N  N     . LEU A 1  1120 ? 442.411 -22.606 573.479 1.00 59.57  ? 1120 LEU A N     1 
ATOM   8375  C  CA    . LEU A 1  1120 ? 442.093 -22.880 572.082 1.00 61.65  ? 1120 LEU A CA    1 
ATOM   8376  C  C     . LEU A 1  1120 ? 441.310 -24.175 571.895 1.00 64.40  ? 1120 LEU A C     1 
ATOM   8377  O  O     . LEU A 1  1120 ? 441.156 -24.966 572.827 1.00 62.66  ? 1120 LEU A O     1 
ATOM   8378  C  CB    . LEU A 1  1120 ? 443.374 -22.935 571.247 1.00 62.99  ? 1120 LEU A CB    1 
ATOM   8379  C  CG    . LEU A 1  1120 ? 443.585 -21.797 570.247 1.00 63.82  ? 1120 LEU A CG    1 
ATOM   8380  C  CD1   . LEU A 1  1120 ? 443.699 -20.461 570.966 1.00 62.05  ? 1120 LEU A CD1   1 
ATOM   8381  C  CD2   . LEU A 1  1120 ? 444.815 -22.060 569.390 1.00 68.22  ? 1120 LEU A CD2   1 
ATOM   8382  N  N     . GLU A 1  1121 ? 440.819 -24.370 570.675 1.00 77.09  ? 1121 GLU A N     1 
ATOM   8383  C  CA    . GLU A 1  1121 ? 440.104 -25.579 570.282 1.00 78.35  ? 1121 GLU A CA    1 
ATOM   8384  C  C     . GLU A 1  1121 ? 440.965 -26.817 570.516 1.00 79.89  ? 1121 GLU A C     1 
ATOM   8385  O  O     . GLU A 1  1121 ? 442.171 -26.786 570.267 1.00 79.27  ? 1121 GLU A O     1 
ATOM   8386  C  CB    . GLU A 1  1121 ? 439.693 -25.481 568.809 1.00 84.10  ? 1121 GLU A CB    1 
ATOM   8387  C  CG    . GLU A 1  1121 ? 438.858 -26.633 568.280 1.00 87.95  ? 1121 GLU A CG    1 
ATOM   8388  C  CD    . GLU A 1  1121 ? 438.492 -26.456 566.818 1.00 92.61  ? 1121 GLU A CD    1 
ATOM   8389  O  OE1   . GLU A 1  1121 ? 437.692 -27.265 566.301 1.00 94.90  ? 1121 GLU A OE1   1 
ATOM   8390  O  OE2   . GLU A 1  1121 ? 439.005 -25.508 566.186 1.00 93.11  ? 1121 GLU A OE2   1 
ATOM   8391  N  N     . PRO A 1  1122 ? 440.350 -27.906 571.012 1.00 80.49  ? 1122 PRO A N     1 
ATOM   8392  C  CA    . PRO A 1  1122 ? 441.038 -29.184 571.240 1.00 81.30  ? 1122 PRO A CA    1 
ATOM   8393  C  C     . PRO A 1  1122 ? 441.829 -29.671 570.025 1.00 84.15  ? 1122 PRO A C     1 
ATOM   8394  O  O     . PRO A 1  1122 ? 442.841 -30.352 570.186 1.00 82.58  ? 1122 PRO A O     1 
ATOM   8395  C  CB    . PRO A 1  1122 ? 439.889 -30.142 571.558 1.00 77.16  ? 1122 PRO A CB    1 
ATOM   8396  C  CG    . PRO A 1  1122 ? 438.866 -29.276 572.196 1.00 76.96  ? 1122 PRO A CG    1 
ATOM   8397  C  CD    . PRO A 1  1122 ? 438.958 -27.943 571.499 1.00 77.73  ? 1122 PRO A CD    1 
ATOM   8398  N  N     . GLY A 1  1123 ? 441.368 -29.322 568.829 1.00 120.19 ? 1123 GLY A N     1 
ATOM   8399  C  CA    . GLY A 1  1123 ? 442.075 -29.668 567.610 1.00 125.63 ? 1123 GLY A CA    1 
ATOM   8400  C  C     . GLY A 1  1123 ? 443.364 -28.883 567.459 1.00 125.85 ? 1123 GLY A C     1 
ATOM   8401  O  O     . GLY A 1  1123 ? 444.438 -29.361 567.825 1.00 123.63 ? 1123 GLY A O     1 
ATOM   8402  N  N     . HIS A 1  1124 ? 443.256 -27.672 566.921 1.00 147.29 ? 1124 HIS A N     1 
ATOM   8403  C  CA    . HIS A 1  1124 ? 444.421 -26.820 566.711 1.00 147.11 ? 1124 HIS A CA    1 
ATOM   8404  C  C     . HIS A 1  1124 ? 444.956 -26.282 568.036 1.00 143.04 ? 1124 HIS A C     1 
ATOM   8405  O  O     . HIS A 1  1124 ? 444.397 -25.346 568.608 1.00 139.08 ? 1124 HIS A O     1 
ATOM   8406  C  CB    . HIS A 1  1124 ? 444.075 -25.660 565.775 1.00 147.90 ? 1124 HIS A CB    1 
ATOM   8407  C  CG    . HIS A 1  1124 ? 443.433 -26.088 564.491 1.00 152.41 ? 1124 HIS A CG    1 
ATOM   8408  N  ND1   . HIS A 1  1124 ? 442.114 -26.480 564.413 1.00 153.95 ? 1124 HIS A ND1   1 
ATOM   8409  C  CD2   . HIS A 1  1124 ? 443.929 -26.183 563.235 1.00 158.39 ? 1124 HIS A CD2   1 
ATOM   8410  C  CE1   . HIS A 1  1124 ? 441.825 -26.799 563.164 1.00 158.85 ? 1124 HIS A CE1   1 
ATOM   8411  N  NE2   . HIS A 1  1124 ? 442.909 -26.628 562.429 1.00 161.72 ? 1124 HIS A NE2   1 
ATOM   8412  N  N     . ALA A 1  1125 ? 446.043 -26.878 568.517 1.00 109.79 ? 1125 ALA A N     1 
ATOM   8413  C  CA    . ALA A 1  1125 ? 446.638 -26.477 569.788 1.00 103.57 ? 1125 ALA A CA    1 
ATOM   8414  C  C     . ALA A 1  1125 ? 447.963 -25.746 569.586 1.00 101.79 ? 1125 ALA A C     1 
ATOM   8415  O  O     . ALA A 1  1125 ? 448.197 -24.694 570.181 1.00 98.37  ? 1125 ALA A O     1 
ATOM   8416  C  CB    . ALA A 1  1125 ? 446.836 -27.693 570.683 1.00 100.13 ? 1125 ALA A CB    1 
ATOM   8417  N  N     . ALA A 1  1126 ? 448.825 -26.309 568.745 1.00 98.35  ? 1126 ALA A N     1 
ATOM   8418  C  CA    . ALA A 1  1126 ? 450.142 -25.732 568.494 1.00 99.27  ? 1126 ALA A CA    1 
ATOM   8419  C  C     . ALA A 1  1126 ? 450.109 -24.735 567.339 1.00 102.25 ? 1126 ALA A C     1 
ATOM   8420  O  O     . ALA A 1  1126 ? 451.065 -23.990 567.122 1.00 98.23  ? 1126 ALA A O     1 
ATOM   8421  C  CB    . ALA A 1  1126 ? 451.156 -26.832 568.215 1.00 94.32  ? 1126 ALA A CB    1 
ATOM   8422  N  N     . ASP A 1  1127 ? 449.005 -24.724 566.599 1.00 139.20 ? 1127 ASP A N     1 
ATOM   8423  C  CA    . ASP A 1  1127 ? 448.851 -23.809 565.474 1.00 140.56 ? 1127 ASP A CA    1 
ATOM   8424  C  C     . ASP A 1  1127 ? 448.611 -22.386 565.965 1.00 136.11 ? 1127 ASP A C     1 
ATOM   8425  O  O     . ASP A 1  1127 ? 447.467 -21.962 566.134 1.00 133.44 ? 1127 ASP A O     1 
ATOM   8426  C  CB    . ASP A 1  1127 ? 447.701 -24.259 564.569 1.00 144.33 ? 1127 ASP A CB    1 
ATOM   8427  C  CG    . ASP A 1  1127 ? 447.564 -23.398 563.328 1.00 148.19 ? 1127 ASP A CG    1 
ATOM   8428  O  OD1   . ASP A 1  1127 ? 448.593 -22.877 562.848 1.00 150.68 ? 1127 ASP A OD1   1 
ATOM   8429  O  OD2   . ASP A 1  1127 ? 446.428 -23.244 562.832 1.00 145.96 ? 1127 ASP A OD2   1 
ATOM   8430  N  N     . GLN A 1  1128 ? 449.695 -21.650 566.192 1.00 86.13  ? 1128 GLN A N     1 
ATOM   8431  C  CA    . GLN A 1  1128 ? 449.596 -20.280 566.684 1.00 82.83  ? 1128 GLN A CA    1 
ATOM   8432  C  C     . GLN A 1  1128 ? 449.025 -19.353 565.620 1.00 85.23  ? 1128 GLN A C     1 
ATOM   8433  O  O     . GLN A 1  1128 ? 448.549 -18.261 565.930 1.00 83.34  ? 1128 GLN A O     1 
ATOM   8434  C  CB    . GLN A 1  1128 ? 450.963 -19.764 567.140 1.00 82.28  ? 1128 GLN A CB    1 
ATOM   8435  C  CG    . GLN A 1  1128 ? 451.948 -19.521 566.007 1.00 86.00  ? 1128 GLN A CG    1 
ATOM   8436  C  CD    . GLN A 1  1128 ? 453.089 -18.607 566.413 1.00 83.85  ? 1128 GLN A CD    1 
ATOM   8437  O  OE1   . GLN A 1  1128 ? 453.102 -18.064 567.518 1.00 79.55  ? 1128 GLN A OE1   1 
ATOM   8438  N  NE2   . GLN A 1  1128 ? 454.053 -18.430 565.517 1.00 87.89  ? 1128 GLN A NE2   1 
ATOM   8439  N  N     . GLU A 1  1129 ? 449.078 -19.793 564.367 1.00 138.82 ? 1129 GLU A N     1 
ATOM   8440  C  CA    . GLU A 1  1129 ? 448.565 -19.003 563.256 1.00 143.26 ? 1129 GLU A CA    1 
ATOM   8441  C  C     . GLU A 1  1129 ? 447.050 -18.860 563.360 1.00 140.92 ? 1129 GLU A C     1 
ATOM   8442  O  O     . GLU A 1  1129 ? 446.475 -17.885 562.876 1.00 139.85 ? 1129 GLU A O     1 
ATOM   8443  C  CB    . GLU A 1  1129 ? 448.952 -19.638 561.919 1.00 147.11 ? 1129 GLU A CB    1 
ATOM   8444  C  CG    . GLU A 1  1129 ? 448.802 -18.710 560.723 1.00 150.04 ? 1129 GLU A CG    1 
ATOM   8445  C  CD    . GLU A 1  1129 ? 449.779 -17.549 560.755 1.00 150.36 ? 1129 GLU A CD    1 
ATOM   8446  O  OE1   . GLU A 1  1129 ? 449.510 -16.526 560.091 1.00 151.61 ? 1129 GLU A OE1   1 
ATOM   8447  O  OE2   . GLU A 1  1129 ? 450.820 -17.659 561.438 1.00 148.59 ? 1129 GLU A OE2   1 
ATOM   8448  N  N     . GLN A 1  1130 ? 446.411 -19.838 563.996 1.00 122.04 ? 1130 GLN A N     1 
ATOM   8449  C  CA    . GLN A 1  1130 ? 444.980 -19.768 564.260 1.00 120.82 ? 1130 GLN A CA    1 
ATOM   8450  C  C     . GLN A 1  1130 ? 444.722 -18.945 565.516 1.00 115.44 ? 1130 GLN A C     1 
ATOM   8451  O  O     . GLN A 1  1130 ? 443.718 -18.238 565.612 1.00 114.58 ? 1130 GLN A O     1 
ATOM   8452  C  CB    . GLN A 1  1130 ? 444.380 -21.166 564.418 1.00 121.36 ? 1130 GLN A CB    1 
ATOM   8453  C  CG    . GLN A 1  1130 ? 442.861 -21.172 564.492 1.00 119.22 ? 1130 GLN A CG    1 
ATOM   8454  C  CD    . GLN A 1  1130 ? 442.320 -22.315 565.327 1.00 118.01 ? 1130 GLN A CD    1 
ATOM   8455  O  OE1   . GLN A 1  1130 ? 442.917 -22.701 566.331 1.00 117.61 ? 1130 GLN A OE1   1 
ATOM   8456  N  NE2   . GLN A 1  1130 ? 441.183 -22.862 564.915 1.00 118.58 ? 1130 GLN A NE2   1 
ATOM   8457  N  N     . ALA A 1  1131 ? 445.636 -19.048 566.476 1.00 84.97  ? 1131 ALA A N     1 
ATOM   8458  C  CA    . ALA A 1  1131 ? 445.540 -18.292 567.720 1.00 80.44  ? 1131 ALA A CA    1 
ATOM   8459  C  C     . ALA A 1  1131 ? 445.604 -16.795 567.443 1.00 80.77  ? 1131 ALA A C     1 
ATOM   8460  O  O     . ALA A 1  1131 ? 444.982 -15.997 568.144 1.00 77.07  ? 1131 ALA A O     1 
ATOM   8461  C  CB    . ALA A 1  1131 ? 446.645 -18.703 568.679 1.00 78.58  ? 1131 ALA A CB    1 
ATOM   8462  N  N     . LYS A 1  1132 ? 446.359 -16.424 566.414 1.00 126.28 ? 1132 LYS A N     1 
ATOM   8463  C  CA    . LYS A 1  1132 ? 446.446 -15.034 565.988 1.00 124.23 ? 1132 LYS A CA    1 
ATOM   8464  C  C     . LYS A 1  1132 ? 445.115 -14.581 565.399 1.00 123.15 ? 1132 LYS A C     1 
ATOM   8465  O  O     . LYS A 1  1132 ? 444.700 -13.436 565.581 1.00 121.16 ? 1132 LYS A O     1 
ATOM   8466  C  CB    . LYS A 1  1132 ? 447.573 -14.851 564.969 1.00 129.67 ? 1132 LYS A CB    1 
ATOM   8467  C  CG    . LYS A 1  1132 ? 447.740 -13.424 564.469 1.00 131.09 ? 1132 LYS A CG    1 
ATOM   8468  C  CD    . LYS A 1  1132 ? 448.912 -13.306 563.509 1.00 134.04 ? 1132 LYS A CD    1 
ATOM   8469  C  CE    . LYS A 1  1132 ? 448.729 -14.211 562.301 1.00 141.21 ? 1132 LYS A CE    1 
ATOM   8470  N  NZ    . LYS A 1  1132 ? 447.492 -13.881 561.539 1.00 141.51 ? 1132 LYS A NZ    1 
ATOM   8471  N  N     . LEU A 1  1133 ? 444.449 -15.492 564.696 1.00 97.84  ? 1133 LEU A N     1 
ATOM   8472  C  CA    . LEU A 1  1133 ? 443.148 -15.205 564.102 1.00 98.75  ? 1133 LEU A CA    1 
ATOM   8473  C  C     . LEU A 1  1133 ? 442.093 -15.021 565.187 1.00 91.34  ? 1133 LEU A C     1 
ATOM   8474  O  O     . LEU A 1  1133 ? 441.244 -14.132 565.099 1.00 92.07  ? 1133 LEU A O     1 
ATOM   8475  C  CB    . LEU A 1  1133 ? 442.733 -16.322 563.141 1.00 100.20 ? 1133 LEU A CB    1 
ATOM   8476  C  CG    . LEU A 1  1133 ? 443.644 -16.546 561.932 1.00 102.04 ? 1133 LEU A CG    1 
ATOM   8477  C  CD1   . LEU A 1  1133 ? 443.108 -17.664 561.051 1.00 102.87 ? 1133 LEU A CD1   1 
ATOM   8478  C  CD2   . LEU A 1  1133 ? 443.811 -15.261 561.133 1.00 104.22 ? 1133 LEU A CD2   1 
ATOM   8479  N  N     . ILE A 1  1134 ? 442.154 -15.867 566.210 1.00 57.14  ? 1134 ILE A N     1 
ATOM   8480  C  CA    . ILE A 1  1134 ? 441.241 -15.759 567.340 1.00 55.42  ? 1134 ILE A CA    1 
ATOM   8481  C  C     . ILE A 1  1134 ? 441.496 -14.466 568.106 1.00 53.81  ? 1134 ILE A C     1 
ATOM   8482  O  O     . ILE A 1  1134 ? 440.556 -13.787 568.516 1.00 52.98  ? 1134 ILE A O     1 
ATOM   8483  C  CB    . ILE A 1  1134 ? 441.374 -16.955 568.296 1.00 54.75  ? 1134 ILE A CB    1 
ATOM   8484  C  CG1   . ILE A 1  1134 ? 441.086 -18.260 567.553 1.00 56.54  ? 1134 ILE A CG1   1 
ATOM   8485  C  CG2   . ILE A 1  1134 ? 440.427 -16.802 569.473 1.00 53.12  ? 1134 ILE A CG2   1 
ATOM   8486  C  CD1   . ILE A 1  1134 ? 441.129 -19.485 568.435 1.00 56.01  ? 1134 ILE A CD1   1 
ATOM   8487  N  N     . ARG A 1  1135 ? 442.769 -14.126 568.288 1.00 81.62  ? 1135 ARG A N     1 
ATOM   8488  C  CA    . ARG A 1  1135 ? 443.134 -12.869 568.934 1.00 79.99  ? 1135 ARG A CA    1 
ATOM   8489  C  C     . ARG A 1  1135 ? 442.579 -11.692 568.143 1.00 81.84  ? 1135 ARG A C     1 
ATOM   8490  O  O     . ARG A 1  1135 ? 442.091 -10.718 568.716 1.00 79.84  ? 1135 ARG A O     1 
ATOM   8491  C  CB    . ARG A 1  1135 ? 444.653 -12.736 569.068 1.00 78.63  ? 1135 ARG A CB    1 
ATOM   8492  C  CG    . ARG A 1  1135 ? 445.081 -11.514 569.868 1.00 76.38  ? 1135 ARG A CG    1 
ATOM   8493  C  CD    . ARG A 1  1135 ? 446.573 -11.246 569.772 1.00 78.13  ? 1135 ARG A CD    1 
ATOM   8494  N  NE    . ARG A 1  1135 ? 446.941 -10.645 568.493 1.00 81.34  ? 1135 ARG A NE    1 
ATOM   8495  C  CZ    . ARG A 1  1135 ? 447.569 -11.290 567.518 1.00 86.78  ? 1135 ARG A CZ    1 
ATOM   8496  N  NH1   . ARG A 1  1135 ? 447.911 -12.561 567.677 1.00 89.89  ? 1135 ARG A NH1   1 
ATOM   8497  N  NH2   . ARG A 1  1135 ? 447.864 -10.664 566.386 1.00 88.07  ? 1135 ARG A NH2   1 
ATOM   8498  N  N     . SER A 1  1136 ? 442.651 -11.797 566.821 1.00 75.25  ? 1136 SER A N     1 
ATOM   8499  C  CA    . SER A 1  1136 ? 442.139 -10.760 565.937 1.00 75.48  ? 1136 SER A CA    1 
ATOM   8500  C  C     . SER A 1  1136 ? 440.615 -10.717 565.969 1.00 74.36  ? 1136 SER A C     1 
ATOM   8501  O  O     . SER A 1  1136 ? 440.008 -9.699  565.640 1.00 77.41  ? 1136 SER A O     1 
ATOM   8502  C  CB    . SER A 1  1136 ? 442.629 -10.988 564.506 1.00 76.43  ? 1136 SER A CB    1 
ATOM   8503  O  OG    . SER A 1  1136 ? 442.139 -9.987  563.631 1.00 81.94  ? 1136 SER A OG    1 
ATOM   8504  N  N     . ALA A 1  1137 ? 440.003 -11.827 566.371 1.00 59.17  ? 1137 ALA A N     1 
ATOM   8505  C  CA    . ALA A 1  1137 ? 438.548 -11.929 566.399 1.00 59.31  ? 1137 ALA A CA    1 
ATOM   8506  C  C     . ALA A 1  1137 ? 437.972 -11.639 567.785 1.00 57.66  ? 1137 ALA A C     1 
ATOM   8507  O  O     . ALA A 1  1137 ? 436.754 -11.577 567.955 1.00 57.77  ? 1137 ALA A O     1 
ATOM   8508  C  CB    . ALA A 1  1137 ? 438.112 -13.309 565.927 1.00 60.65  ? 1137 ALA A CB    1 
ATOM   8509  N  N     . ILE A 1  1138 ? 438.846 -11.460 568.771 1.00 66.88  ? 1138 ILE A N     1 
ATOM   8510  C  CA    . ILE A 1  1138 ? 438.407 -11.221 570.143 1.00 63.33  ? 1138 ILE A CA    1 
ATOM   8511  C  C     . ILE A 1  1138 ? 438.754 -9.812  570.620 1.00 64.38  ? 1138 ILE A C     1 
ATOM   8512  O  O     . ILE A 1  1138 ? 437.902 -9.106  571.161 1.00 60.27  ? 1138 ILE A O     1 
ATOM   8513  C  CB    . ILE A 1  1138 ? 439.023 -12.248 571.115 1.00 60.79  ? 1138 ILE A CB    1 
ATOM   8514  C  CG1   . ILE A 1  1138 ? 438.465 -13.642 570.834 1.00 64.60  ? 1138 ILE A CG1   1 
ATOM   8515  C  CG2   . ILE A 1  1138 ? 438.734 -11.868 572.555 1.00 59.56  ? 1138 ILE A CG2   1 
ATOM   8516  C  CD1   . ILE A 1  1138 ? 436.962 -13.721 570.936 1.00 67.79  ? 1138 ILE A CD1   1 
ATOM   8517  N  N     . GLU A 1  1139 ? 440.006 -9.412  570.413 1.00 72.43  ? 1139 GLU A N     1 
ATOM   8518  C  CA    . GLU A 1  1139 ? 440.485 -8.106  570.859 1.00 68.63  ? 1139 GLU A CA    1 
ATOM   8519  C  C     . GLU A 1  1139 ? 439.689 -6.968  570.228 1.00 69.63  ? 1139 GLU A C     1 
ATOM   8520  O  O     . GLU A 1  1139 ? 439.537 -6.905  569.007 1.00 72.57  ? 1139 GLU A O     1 
ATOM   8521  C  CB    . GLU A 1  1139 ? 441.973 -7.949  570.538 1.00 67.91  ? 1139 GLU A CB    1 
ATOM   8522  C  CG    . GLU A 1  1139 ? 442.580 -6.649  571.034 1.00 70.22  ? 1139 GLU A CG    1 
ATOM   8523  C  CD    . GLU A 1  1139 ? 444.076 -6.583  570.801 1.00 72.79  ? 1139 GLU A CD    1 
ATOM   8524  O  OE1   . GLU A 1  1139 ? 444.638 -7.561  570.264 1.00 70.74  ? 1139 GLU A OE1   1 
ATOM   8525  O  OE2   . GLU A 1  1139 ? 444.692 -5.555  571.156 1.00 75.85  ? 1139 GLU A OE2   1 
ATOM   8526  N  N     . HIS A 1  1140 ? 439.184 -6.073  571.072 1.00 61.86  ? 1140 HIS A N     1 
ATOM   8527  C  CA    . HIS A 1  1140 ? 438.336 -4.974  570.621 1.00 63.30  ? 1140 HIS A CA    1 
ATOM   8528  C  C     . HIS A 1  1140 ? 439.096 -4.005  569.722 1.00 64.10  ? 1140 HIS A C     1 
ATOM   8529  O  O     . HIS A 1  1140 ? 440.299 -3.802  569.887 1.00 63.30  ? 1140 HIS A O     1 
ATOM   8530  C  CB    . HIS A 1  1140 ? 437.756 -4.222  571.820 1.00 62.86  ? 1140 HIS A CB    1 
ATOM   8531  C  CG    . HIS A 1  1140 ? 436.607 -3.328  571.475 1.00 63.20  ? 1140 HIS A CG    1 
ATOM   8532  N  ND1   . HIS A 1  1140 ? 436.291 -2.205  572.209 1.00 62.27  ? 1140 HIS A ND1   1 
ATOM   8533  C  CD2   . HIS A 1  1140 ? 435.694 -3.395  570.478 1.00 64.68  ? 1140 HIS A CD2   1 
ATOM   8534  C  CE1   . HIS A 1  1140 ? 435.235 -1.617  571.677 1.00 65.02  ? 1140 HIS A CE1   1 
ATOM   8535  N  NE2   . HIS A 1  1140 ? 434.853 -2.319  570.625 1.00 65.32  ? 1140 HIS A NE2   1 
ATOM   8536  N  N     . THR A 1  1141 ? 438.384 -3.410  568.772 1.00 61.53  ? 1141 THR A N     1 
ATOM   8537  C  CA    . THR A 1  1141 ? 438.984 -2.460  567.844 1.00 62.15  ? 1141 THR A CA    1 
ATOM   8538  C  C     . THR A 1  1141 ? 437.974 -1.402  567.413 1.00 62.58  ? 1141 THR A C     1 
ATOM   8539  O  O     . THR A 1  1141 ? 437.051 -1.686  566.649 1.00 64.08  ? 1141 THR A O     1 
ATOM   8540  C  CB    . THR A 1  1141 ? 439.538 -3.166  566.593 1.00 63.17  ? 1141 THR A CB    1 
ATOM   8541  O  OG1   . THR A 1  1141 ? 440.522 -4.133  566.981 1.00 62.99  ? 1141 THR A OG1   1 
ATOM   8542  C  CG2   . THR A 1  1141 ? 440.170 -2.156  565.650 1.00 63.90  ? 1141 THR A CG2   1 
ATOM   8543  N  N     . THR A 1  1142 ? 438.150 -0.181  567.907 1.00 61.98  ? 1142 THR A N     1 
ATOM   8544  C  CA    . THR A 1  1142 ? 437.267 0.922   567.547 1.00 63.23  ? 1142 THR A CA    1 
ATOM   8545  C  C     . THR A 1  1142 ? 437.822 1.702   566.362 1.00 64.40  ? 1142 THR A C     1 
ATOM   8546  O  O     . THR A 1  1142 ? 439.012 1.620   566.054 1.00 63.74  ? 1142 THR A O     1 
ATOM   8547  C  CB    . THR A 1  1142 ? 437.049 1.885   568.730 1.00 61.87  ? 1142 THR A CB    1 
ATOM   8548  O  OG1   . THR A 1  1142 ? 438.315 2.253   569.291 1.00 62.54  ? 1142 THR A OG1   1 
ATOM   8549  C  CG2   . THR A 1  1142 ? 436.199 1.226   569.804 1.00 62.30  ? 1142 THR A CG2   1 
ATOM   8550  N  N     . LEU A 1  1143 ? 436.952 2.455   565.697 1.00 53.01  ? 1143 LEU A N     1 
ATOM   8551  C  CA    . LEU A 1  1143 ? 437.358 3.288   564.572 1.00 53.71  ? 1143 LEU A CA    1 
ATOM   8552  C  C     . LEU A 1  1143 ? 438.281 4.406   565.049 1.00 53.44  ? 1143 LEU A C     1 
ATOM   8553  O  O     . LEU A 1  1143 ? 439.189 4.829   564.333 1.00 53.94  ? 1143 LEU A O     1 
ATOM   8554  C  CB    . LEU A 1  1143 ? 436.128 3.866   563.866 1.00 54.37  ? 1143 LEU A CB    1 
ATOM   8555  C  CG    . LEU A 1  1143 ? 436.352 4.827   562.698 1.00 55.12  ? 1143 LEU A CG    1 
ATOM   8556  C  CD1   . LEU A 1  1143 ? 437.293 4.223   561.671 1.00 55.76  ? 1143 LEU A CD1   1 
ATOM   8557  C  CD2   . LEU A 1  1143 ? 435.025 5.198   562.056 1.00 55.84  ? 1143 LEU A CD2   1 
ATOM   8558  N  N     . LYS A 1  1144 ? 438.043 4.870   566.271 1.00 69.93  ? 1144 LYS A N     1 
ATOM   8559  C  CA    . LYS A 1  1144 ? 438.865 5.906   566.887 1.00 69.44  ? 1144 LYS A CA    1 
ATOM   8560  C  C     . LYS A 1  1144 ? 440.302 5.430   567.084 1.00 68.77  ? 1144 LYS A C     1 
ATOM   8561  O  O     . LYS A 1  1144 ? 441.245 6.221   567.019 1.00 70.25  ? 1144 LYS A O     1 
ATOM   8562  C  CB    . LYS A 1  1144 ? 438.253 6.330   568.225 1.00 71.02  ? 1144 LYS A CB    1 
ATOM   8563  C  CG    . LYS A 1  1144 ? 439.080 7.314   569.035 1.00 73.08  ? 1144 LYS A CG    1 
ATOM   8564  C  CD    . LYS A 1  1144 ? 438.371 7.674   570.332 1.00 73.97  ? 1144 LYS A CD    1 
ATOM   8565  C  CE    . LYS A 1  1144 ? 439.252 8.521   571.234 1.00 77.41  ? 1144 LYS A CE    1 
ATOM   8566  N  NZ    . LYS A 1  1144 ? 440.463 7.780   571.682 1.00 77.89  ? 1144 LYS A NZ    1 
ATOM   8567  N  N     . SER A 1  1145 ? 440.461 4.129   567.306 1.00 70.65  ? 1145 SER A N     1 
ATOM   8568  C  CA    . SER A 1  1145 ? 441.764 3.545   567.610 1.00 72.41  ? 1145 SER A CA    1 
ATOM   8569  C  C     . SER A 1  1145 ? 442.678 3.450   566.391 1.00 70.67  ? 1145 SER A C     1 
ATOM   8570  O  O     . SER A 1  1145 ? 443.866 3.158   566.523 1.00 68.44  ? 1145 SER A O     1 
ATOM   8571  C  CB    . SER A 1  1145 ? 441.586 2.155   568.226 1.00 71.42  ? 1145 SER A CB    1 
ATOM   8572  O  OG    . SER A 1  1145 ? 440.937 1.279   567.321 1.00 69.85  ? 1145 SER A OG    1 
ATOM   8573  N  N     . VAL A 1  1146 ? 442.126 3.694   565.206 1.00 55.62  ? 1146 VAL A N     1 
ATOM   8574  C  CA    . VAL A 1  1146 ? 442.902 3.600   563.973 1.00 56.72  ? 1146 VAL A CA    1 
ATOM   8575  C  C     . VAL A 1  1146 ? 442.786 4.862   563.126 1.00 57.37  ? 1146 VAL A C     1 
ATOM   8576  O  O     . VAL A 1  1146 ? 443.127 4.857   561.944 1.00 58.38  ? 1146 VAL A O     1 
ATOM   8577  C  CB    . VAL A 1  1146 ? 442.462 2.393   563.118 1.00 57.16  ? 1146 VAL A CB    1 
ATOM   8578  C  CG1   . VAL A 1  1146 ? 442.793 1.089   563.827 1.00 56.72  ? 1146 VAL A CG1   1 
ATOM   8579  C  CG2   . VAL A 1  1146 ? 440.976 2.478   562.804 1.00 56.99  ? 1146 VAL A CG2   1 
ATOM   8580  N  N     . THR A 1  1147 ? 442.309 5.943   563.735 1.00 55.13  ? 1147 THR A N     1 
ATOM   8581  C  CA    . THR A 1  1147 ? 442.085 7.189   563.010 1.00 55.69  ? 1147 THR A CA    1 
ATOM   8582  C  C     . THR A 1  1147 ? 443.140 8.242   563.333 1.00 56.14  ? 1147 THR A C     1 
ATOM   8583  O  O     . THR A 1  1147 ? 443.307 8.630   564.490 1.00 55.74  ? 1147 THR A O     1 
ATOM   8584  C  CB    . THR A 1  1147 ? 440.692 7.770   563.320 1.00 55.19  ? 1147 THR A CB    1 
ATOM   8585  O  OG1   . THR A 1  1147 ? 439.681 6.832   562.932 1.00 55.07  ? 1147 THR A OG1   1 
ATOM   8586  C  CG2   . THR A 1  1147 ? 440.480 9.074   562.570 1.00 55.80  ? 1147 THR A CG2   1 
ATOM   8587  N  N     . ILE A 1  1148 ? 443.855 8.698   562.307 1.00 57.17  ? 1148 ILE A N     1 
ATOM   8588  C  CA    . ILE A 1  1148 ? 444.794 9.803   562.465 1.00 57.89  ? 1148 ILE A CA    1 
ATOM   8589  C  C     . ILE A 1  1148 ? 444.035 11.079  562.796 1.00 57.64  ? 1148 ILE A C     1 
ATOM   8590  O  O     . ILE A 1  1148 ? 444.293 11.719  563.816 1.00 57.60  ? 1148 ILE A O     1 
ATOM   8591  C  CB    . ILE A 1  1148 ? 445.642 10.036  561.196 1.00 59.23  ? 1148 ILE A CB    1 
ATOM   8592  C  CG1   . ILE A 1  1148 ? 446.673 8.922   561.021 1.00 59.89  ? 1148 ILE A CG1   1 
ATOM   8593  C  CG2   . ILE A 1  1148 ? 446.350 11.381  561.266 1.00 60.07  ? 1148 ILE A CG2   1 
ATOM   8594  C  CD1   . ILE A 1  1148 ? 447.780 8.944   562.052 1.00 60.17  ? 1148 ILE A CD1   1 
ATOM   8595  N  N     . ALA A 1  1149 ? 443.091 11.442  561.933 1.00 57.65  ? 1149 ALA A N     1 
ATOM   8596  C  CA    . ALA A 1  1149 ? 442.336 12.675  562.132 1.00 57.60  ? 1149 ALA A CA    1 
ATOM   8597  C  C     . ALA A 1  1149 ? 440.987 12.646  561.428 1.00 57.37  ? 1149 ALA A C     1 
ATOM   8598  O  O     . ALA A 1  1149 ? 440.714 11.761  560.622 1.00 57.44  ? 1149 ALA A O     1 
ATOM   8599  C  CB    . ALA A 1  1149 ? 443.149 13.869  561.655 1.00 58.60  ? 1149 ALA A CB    1 
ATOM   8600  N  N     . SER A 1  1150 ? 440.142 13.622  561.747 1.00 57.30  ? 1150 SER A N     1 
ATOM   8601  C  CA    . SER A 1  1150 ? 438.860 13.778  561.071 1.00 57.34  ? 1150 SER A CA    1 
ATOM   8602  C  C     . SER A 1  1150 ? 438.651 15.236  560.686 1.00 57.92  ? 1150 SER A C     1 
ATOM   8603  O  O     . SER A 1  1150 ? 439.039 16.144  561.420 1.00 58.09  ? 1150 SER A O     1 
ATOM   8604  C  CB    . SER A 1  1150 ? 437.710 13.291  561.955 1.00 56.76  ? 1150 SER A CB    1 
ATOM   8605  O  OG    . SER A 1  1150 ? 437.548 14.116  563.093 1.00 56.69  ? 1150 SER A OG    1 
ATOM   8606  N  N     . GLU A 1  1151 ? 438.042 15.455  559.527 1.00 58.33  ? 1151 GLU A N     1 
ATOM   8607  C  CA    . GLU A 1  1151 ? 437.813 16.803  559.028 1.00 58.90  ? 1151 GLU A CA    1 
ATOM   8608  C  C     . GLU A 1  1151 ? 436.397 16.964  558.491 1.00 59.08  ? 1151 GLU A C     1 
ATOM   8609  O  O     . GLU A 1  1151 ? 435.755 15.988  558.114 1.00 59.02  ? 1151 GLU A O     1 
ATOM   8610  C  CB    . GLU A 1  1151 ? 438.828 17.148  557.936 1.00 59.58  ? 1151 GLU A CB    1 
ATOM   8611  C  CG    . GLU A 1  1151 ? 440.253 17.318  558.436 1.00 59.81  ? 1151 GLU A CG    1 
ATOM   8612  C  CD    . GLU A 1  1151 ? 441.248 17.499  557.305 1.00 60.71  ? 1151 GLU A CD    1 
ATOM   8613  O  OE1   . GLU A 1  1151 ? 441.193 16.717  556.333 1.00 60.96  ? 1151 GLU A OE1   1 
ATOM   8614  O  OE2   . GLU A 1  1151 ? 442.082 18.426  557.386 1.00 61.36  ? 1151 GLU A OE2   1 
ATOM   8615  N  N     . ILE A 1  1152 ? 435.911 18.199  558.469 1.00 59.49  ? 1152 ILE A N     1 
ATOM   8616  C  CA    . ILE A 1  1152 ? 434.622 18.494  557.857 1.00 59.90  ? 1152 ILE A CA    1 
ATOM   8617  C  C     . ILE A 1  1152 ? 434.782 19.595  556.818 1.00 60.55  ? 1152 ILE A C     1 
ATOM   8618  O  O     . ILE A 1  1152 ? 434.935 20.769  557.156 1.00 60.81  ? 1152 ILE A O     1 
ATOM   8619  C  CB    . ILE A 1  1152 ? 433.566 18.915  558.896 1.00 59.96  ? 1152 ILE A CB    1 
ATOM   8620  C  CG1   . ILE A 1  1152 ? 433.313 17.778  559.888 1.00 59.40  ? 1152 ILE A CG1   1 
ATOM   8621  C  CG2   . ILE A 1  1152 ? 432.267 19.298  558.207 1.00 60.66  ? 1152 ILE A CG2   1 
ATOM   8622  C  CD1   . ILE A 1  1152 ? 432.222 18.076  560.894 1.00 59.68  ? 1152 ILE A CD1   1 
ATOM   8623  N  N     . TYR A 1  1153 ? 434.759 19.200  555.550 1.00 60.92  ? 1153 TYR A N     1 
ATOM   8624  C  CA    . TYR A 1  1153 ? 434.906 20.139  554.447 1.00 61.58  ? 1153 TYR A CA    1 
ATOM   8625  C  C     . TYR A 1  1153 ? 433.551 20.582  553.920 1.00 62.09  ? 1153 TYR A C     1 
ATOM   8626  O  O     . TYR A 1  1153 ? 432.531 19.958  554.204 1.00 62.11  ? 1153 TYR A O     1 
ATOM   8627  C  CB    . TYR A 1  1153 ? 435.714 19.513  553.309 1.00 61.97  ? 1153 TYR A CB    1 
ATOM   8628  C  CG    . TYR A 1  1153 ? 437.188 19.360  553.599 1.00 61.86  ? 1153 TYR A CG    1 
ATOM   8629  C  CD1   . TYR A 1  1153 ? 437.671 18.249  554.274 1.00 61.38  ? 1153 TYR A CD1   1 
ATOM   8630  C  CD2   . TYR A 1  1153 ? 438.098 20.325  553.189 1.00 62.40  ? 1153 TYR A CD2   1 
ATOM   8631  C  CE1   . TYR A 1  1153 ? 439.019 18.106  554.538 1.00 61.47  ? 1153 TYR A CE1   1 
ATOM   8632  C  CE2   . TYR A 1  1153 ? 439.448 20.190  553.448 1.00 62.59  ? 1153 TYR A CE2   1 
ATOM   8633  C  CZ    . TYR A 1  1153 ? 439.903 19.079  554.123 1.00 62.15  ? 1153 TYR A CZ    1 
ATOM   8634  O  OH    . TYR A 1  1153 ? 441.247 18.941  554.383 1.00 62.52  ? 1153 TYR A OH    1 
ATOM   8635  N  N     . TYR A 1  1154 ? 433.545 21.668  553.157 1.00 65.60  ? 1154 TYR A N     1 
ATOM   8636  C  CA    . TYR A 1  1154 ? 432.367 22.033  552.387 1.00 66.28  ? 1154 TYR A CA    1 
ATOM   8637  C  C     . TYR A 1  1154 ? 432.631 21.714  550.923 1.00 66.88  ? 1154 TYR A C     1 
ATOM   8638  O  O     . TYR A 1  1154 ? 433.218 22.516  550.199 1.00 67.22  ? 1154 TYR A O     1 
ATOM   8639  C  CB    . TYR A 1  1154 ? 432.012 23.510  552.564 1.00 66.61  ? 1154 TYR A CB    1 
ATOM   8640  C  CG    . TYR A 1  1154 ? 430.785 23.924  551.781 1.00 67.42  ? 1154 TYR A CG    1 
ATOM   8641  C  CD1   . TYR A 1  1154 ? 430.901 24.647  550.601 1.00 67.98  ? 1154 TYR A CD1   1 
ATOM   8642  C  CD2   . TYR A 1  1154 ? 429.512 23.577  552.213 1.00 67.77  ? 1154 TYR A CD2   1 
ATOM   8643  C  CE1   . TYR A 1  1154 ? 429.783 25.022  549.879 1.00 68.81  ? 1154 TYR A CE1   1 
ATOM   8644  C  CE2   . TYR A 1  1154 ? 428.387 23.947  551.497 1.00 68.73  ? 1154 TYR A CE2   1 
ATOM   8645  C  CZ    . TYR A 1  1154 ? 428.529 24.669  550.330 1.00 69.22  ? 1154 TYR A CZ    1 
ATOM   8646  O  OH    . TYR A 1  1154 ? 427.416 25.041  549.612 1.00 70.26  ? 1154 TYR A OH    1 
ATOM   8647  N  N     . ASP A 1  1155 ? 432.210 20.527  550.501 1.00 70.24  ? 1155 ASP A N     1 
ATOM   8648  C  CA    . ASP A 1  1155 ? 432.432 20.074  549.135 1.00 70.08  ? 1155 ASP A CA    1 
ATOM   8649  C  C     . ASP A 1  1155 ? 431.107 19.987  548.383 1.00 74.51  ? 1155 ASP A C     1 
ATOM   8650  O  O     . ASP A 1  1155 ? 430.405 18.979  548.468 1.00 73.60  ? 1155 ASP A O     1 
ATOM   8651  C  CB    . ASP A 1  1155 ? 433.145 18.720  549.133 1.00 69.59  ? 1155 ASP A CB    1 
ATOM   8652  C  CG    . ASP A 1  1155 ? 433.760 18.385  547.790 1.00 74.92  ? 1155 ASP A CG    1 
ATOM   8653  O  OD1   . ASP A 1  1155 ? 434.100 19.324  547.039 1.00 75.67  ? 1155 ASP A OD1   1 
ATOM   8654  O  OD2   . ASP A 1  1155 ? 433.908 17.182  547.489 1.00 77.29  ? 1155 ASP A OD2   1 
ATOM   8655  N  N     . PRO A 1  1156 ? 430.763 21.053  547.642 1.00 69.71  ? 1156 PRO A N     1 
ATOM   8656  C  CA    . PRO A 1  1156 ? 429.478 21.185  546.944 1.00 70.78  ? 1156 PRO A CA    1 
ATOM   8657  C  C     . PRO A 1  1156 ? 429.239 20.085  545.916 1.00 71.91  ? 1156 PRO A C     1 
ATOM   8658  O  O     . PRO A 1  1156 ? 428.343 19.261  546.094 1.00 72.45  ? 1156 PRO A O     1 
ATOM   8659  C  CB    . PRO A 1  1156 ? 429.592 22.548  546.251 1.00 71.63  ? 1156 PRO A CB    1 
ATOM   8660  C  CG    . PRO A 1  1156 ? 430.657 23.276  546.997 1.00 70.07  ? 1156 PRO A CG    1 
ATOM   8661  C  CD    . PRO A 1  1156 ? 431.626 22.225  547.426 1.00 69.49  ? 1156 PRO A CD    1 
ATOM   8662  N  N     . ASP A 1  1157 ? 430.035 20.085  544.853 1.00 111.28 ? 1157 ASP A N     1 
ATOM   8663  C  CA    . ASP A 1  1157 ? 429.880 19.122  543.769 1.00 113.80 ? 1157 ASP A CA    1 
ATOM   8664  C  C     . ASP A 1  1157 ? 430.403 17.749  544.184 1.00 113.77 ? 1157 ASP A C     1 
ATOM   8665  O  O     . ASP A 1  1157 ? 431.597 17.588  544.438 1.00 113.82 ? 1157 ASP A O     1 
ATOM   8666  C  CB    . ASP A 1  1157 ? 430.609 19.616  542.517 1.00 115.60 ? 1157 ASP A CB    1 
ATOM   8667  C  CG    . ASP A 1  1157 ? 430.115 18.948  541.247 1.00 118.14 ? 1157 ASP A CG    1 
ATOM   8668  O  OD1   . ASP A 1  1157 ? 429.466 17.886  541.338 1.00 118.56 ? 1157 ASP A OD1   1 
ATOM   8669  O  OD2   . ASP A 1  1157 ? 430.381 19.489  540.152 1.00 119.41 ? 1157 ASP A OD2   1 
ATOM   8670  N  N     . PRO A 1  1158 ? 429.505 16.754  544.256 1.00 100.52 ? 1158 PRO A N     1 
ATOM   8671  C  CA    . PRO A 1  1158 ? 429.873 15.395  544.670 1.00 100.20 ? 1158 PRO A CA    1 
ATOM   8672  C  C     . PRO A 1  1158 ? 430.820 14.710  543.690 1.00 101.10 ? 1158 PRO A C     1 
ATOM   8673  O  O     . PRO A 1  1158 ? 431.639 13.890  544.106 1.00 102.53 ? 1158 PRO A O     1 
ATOM   8674  C  CB    . PRO A 1  1158 ? 428.525 14.663  544.716 1.00 101.99 ? 1158 PRO A CB    1 
ATOM   8675  C  CG    . PRO A 1  1158 ? 427.499 15.743  544.816 1.00 101.07 ? 1158 PRO A CG    1 
ATOM   8676  C  CD    . PRO A 1  1158 ? 428.057 16.883  544.028 1.00 102.05 ? 1158 PRO A CD    1 
ATOM   8677  N  N     . ARG A 1  1159 ? 430.711 15.045  542.408 1.00 94.81  ? 1159 ARG A N     1 
ATOM   8678  C  CA    . ARG A 1  1159 ? 431.502 14.379  541.378 1.00 100.31 ? 1159 ARG A CA    1 
ATOM   8679  C  C     . ARG A 1  1159 ? 432.802 15.125  541.076 1.00 99.94  ? 1159 ARG A C     1 
ATOM   8680  O  O     . ARG A 1  1159 ? 433.535 14.762  540.156 1.00 101.67 ? 1159 ARG A O     1 
ATOM   8681  C  CB    . ARG A 1  1159 ? 430.675 14.214  540.100 1.00 102.50 ? 1159 ARG A CB    1 
ATOM   8682  C  CG    . ARG A 1  1159 ? 430.331 15.517  539.398 1.00 105.40 ? 1159 ARG A CG    1 
ATOM   8683  C  CD    . ARG A 1  1159 ? 429.108 15.373  538.497 1.00 109.90 ? 1159 ARG A CD    1 
ATOM   8684  N  NE    . ARG A 1  1159 ? 429.229 14.265  537.551 1.00 114.15 ? 1159 ARG A NE    1 
ATOM   8685  C  CZ    . ARG A 1  1159 ? 428.589 13.105  537.671 1.00 114.87 ? 1159 ARG A CZ    1 
ATOM   8686  N  NH1   . ARG A 1  1159 ? 427.778 12.896  538.699 1.00 110.81 ? 1159 ARG A NH1   1 
ATOM   8687  N  NH2   . ARG A 1  1159 ? 428.760 12.154  536.763 1.00 117.14 ? 1159 ARG A NH2   1 
ATOM   8688  N  N     . SER A 1  1160 ? 433.085 16.163  541.857 1.00 113.76 ? 1160 SER A N     1 
ATOM   8689  C  CA    . SER A 1  1160 ? 434.346 16.891  541.741 1.00 115.38 ? 1160 SER A CA    1 
ATOM   8690  C  C     . SER A 1  1160 ? 434.738 17.499  543.086 1.00 114.83 ? 1160 SER A C     1 
ATOM   8691  O  O     . SER A 1  1160 ? 434.144 18.478  543.536 1.00 111.00 ? 1160 SER A O     1 
ATOM   8692  C  CB    . SER A 1  1160 ? 434.251 17.979  540.668 1.00 115.35 ? 1160 SER A CB    1 
ATOM   8693  O  OG    . SER A 1  1160 ? 433.296 18.964  541.014 1.00 114.68 ? 1160 SER A OG    1 
ATOM   8694  N  N     . THR A 1  1161 ? 435.747 16.908  543.719 1.00 103.66 ? 1161 THR A N     1 
ATOM   8695  C  CA    . THR A 1  1161 ? 436.171 17.309  545.056 1.00 99.52  ? 1161 THR A CA    1 
ATOM   8696  C  C     . THR A 1  1161 ? 437.180 18.453  545.013 1.00 98.07  ? 1161 THR A C     1 
ATOM   8697  O  O     . THR A 1  1161 ? 438.057 18.487  544.149 1.00 98.82  ? 1161 THR A O     1 
ATOM   8698  C  CB    . THR A 1  1161 ? 436.787 16.115  545.822 1.00 102.04 ? 1161 THR A CB    1 
ATOM   8699  O  OG1   . THR A 1  1161 ? 435.871 15.013  545.811 1.00 103.98 ? 1161 THR A OG1   1 
ATOM   8700  C  CG2   . THR A 1  1161 ? 437.101 16.491  547.265 1.00 100.92 ? 1161 THR A CG2   1 
ATOM   8701  N  N     . VAL A 1  1162 ? 437.041 19.391  545.946 1.00 73.47  ? 1162 VAL A N     1 
ATOM   8702  C  CA    . VAL A 1  1162 ? 437.984 20.495  546.092 1.00 71.07  ? 1162 VAL A CA    1 
ATOM   8703  C  C     . VAL A 1  1162 ? 439.392 19.970  546.358 1.00 71.72  ? 1162 VAL A C     1 
ATOM   8704  O  O     . VAL A 1  1162 ? 440.367 20.450  545.781 1.00 72.45  ? 1162 VAL A O     1 
ATOM   8705  C  CB    . VAL A 1  1162 ? 437.569 21.441  547.235 1.00 69.96  ? 1162 VAL A CB    1 
ATOM   8706  C  CG1   . VAL A 1  1162 ? 438.574 22.572  547.386 1.00 70.11  ? 1162 VAL A CG1   1 
ATOM   8707  C  CG2   . VAL A 1  1162 ? 436.172 21.989  546.986 1.00 69.93  ? 1162 VAL A CG2   1 
ATOM   8708  N  N     . ILE A 1  1163 ? 439.486 18.976  547.233 1.00 78.60  ? 1163 ILE A N     1 
ATOM   8709  C  CA    . ILE A 1  1163 ? 440.762 18.351  547.554 1.00 79.31  ? 1163 ILE A CA    1 
ATOM   8710  C  C     . ILE A 1  1163 ? 441.290 17.557  546.362 1.00 83.59  ? 1163 ILE A C     1 
ATOM   8711  O  O     . ILE A 1  1163 ? 440.613 16.659  545.863 1.00 86.56  ? 1163 ILE A O     1 
ATOM   8712  C  CB    . ILE A 1  1163 ? 440.637 17.421  548.773 1.00 78.30  ? 1163 ILE A CB    1 
ATOM   8713  C  CG1   . ILE A 1  1163 ? 439.955 18.156  549.928 1.00 76.32  ? 1163 ILE A CG1   1 
ATOM   8714  C  CG2   . ILE A 1  1163 ? 442.003 16.895  549.189 1.00 79.73  ? 1163 ILE A CG2   1 
ATOM   8715  C  CD1   . ILE A 1  1163 ? 439.629 17.274  551.105 1.00 75.28  ? 1163 ILE A CD1   1 
ATOM   8716  N  N     . PRO A 1  1164 ? 442.506 17.890  545.903 1.00 116.02 ? 1164 PRO A N     1 
ATOM   8717  C  CA    . PRO A 1  1164 ? 443.119 17.238  544.740 1.00 121.23 ? 1164 PRO A CA    1 
ATOM   8718  C  C     . PRO A 1  1164 ? 443.561 15.803  545.020 1.00 121.60 ? 1164 PRO A C     1 
ATOM   8719  O  O     . PRO A 1  1164 ? 443.965 15.095  544.097 1.00 125.61 ? 1164 PRO A O     1 
ATOM   8720  C  CB    . PRO A 1  1164 ? 444.329 18.128  544.443 1.00 122.11 ? 1164 PRO A CB    1 
ATOM   8721  C  CG    . PRO A 1  1164 ? 444.680 18.722  545.761 1.00 116.81 ? 1164 PRO A CG    1 
ATOM   8722  C  CD    . PRO A 1  1164 ? 443.372 18.942  546.465 1.00 114.05 ? 1164 PRO A CD    1 
ATOM   8723  N  N     . GLU A 1  1165 ? 443.481 15.383  546.278 1.00 114.88 ? 1165 GLU A N     1 
ATOM   8724  C  CA    . GLU A 1  1165 ? 443.908 14.045  546.670 1.00 114.91 ? 1165 GLU A CA    1 
ATOM   8725  C  C     . GLU A 1  1165 ? 442.771 13.036  546.556 1.00 114.84 ? 1165 GLU A C     1 
ATOM   8726  O  O     . GLU A 1  1165 ? 443.004 11.829  546.493 1.00 116.48 ? 1165 GLU A O     1 
ATOM   8727  C  CB    . GLU A 1  1165 ? 444.449 14.059  548.100 1.00 113.49 ? 1165 GLU A CB    1 
ATOM   8728  C  CG    . GLU A 1  1165 ? 445.510 15.115  548.350 1.00 114.67 ? 1165 GLU A CG    1 
ATOM   8729  C  CD    . GLU A 1  1165 ? 445.957 15.158  549.797 1.00 113.52 ? 1165 GLU A CD    1 
ATOM   8730  O  OE1   . GLU A 1  1165 ? 446.647 16.127  550.178 1.00 114.75 ? 1165 GLU A OE1   1 
ATOM   8731  O  OE2   . GLU A 1  1165 ? 445.620 14.222  550.552 1.00 111.35 ? 1165 GLU A OE2   1 
ATOM   8732  N  N     . ASP A 1  1166 ? 441.540 13.537  546.532 1.00 98.35  ? 1166 ASP A N     1 
ATOM   8733  C  CA    . ASP A 1  1166 ? 440.364 12.677  546.481 1.00 98.90  ? 1166 ASP A CA    1 
ATOM   8734  C  C     . ASP A 1  1166 ? 439.746 12.642  545.085 1.00 102.21 ? 1166 ASP A C     1 
ATOM   8735  O  O     . ASP A 1  1166 ? 438.638 12.139  544.901 1.00 102.66 ? 1166 ASP A O     1 
ATOM   8736  C  CB    . ASP A 1  1166 ? 439.322 13.141  547.501 1.00 95.99  ? 1166 ASP A CB    1 
ATOM   8737  C  CG    . ASP A 1  1166 ? 439.821 13.044  548.931 1.00 90.90  ? 1166 ASP A CG    1 
ATOM   8738  O  OD1   . ASP A 1  1166 ? 441.053 13.062  549.137 1.00 88.37  ? 1166 ASP A OD1   1 
ATOM   8739  O  OD2   . ASP A 1  1166 ? 438.979 12.952  549.850 1.00 87.75  ? 1166 ASP A OD2   1 
ATOM   8740  N  N     . GLU A 1  1167 ? 440.470 13.176  544.107 1.00 114.30 ? 1167 GLU A N     1 
ATOM   8741  C  CA    . GLU A 1  1167 ? 439.984 13.218  542.733 1.00 116.93 ? 1167 GLU A CA    1 
ATOM   8742  C  C     . GLU A 1  1167 ? 439.946 11.823  542.119 1.00 119.01 ? 1167 GLU A C     1 
ATOM   8743  O  O     . GLU A 1  1167 ? 438.967 11.440  541.476 1.00 118.13 ? 1167 GLU A O     1 
ATOM   8744  C  CB    . GLU A 1  1167 ? 440.858 14.145  541.886 1.00 116.91 ? 1167 GLU A CB    1 
ATOM   8745  C  CG    . GLU A 1  1167 ? 440.397 14.291  540.446 1.00 121.11 ? 1167 GLU A CG    1 
ATOM   8746  C  CD    . GLU A 1  1167 ? 441.262 15.250  539.653 1.00 123.57 ? 1167 GLU A CD    1 
ATOM   8747  O  OE1   . GLU A 1  1167 ? 441.016 15.412  538.440 1.00 124.07 ? 1167 GLU A OE1   1 
ATOM   8748  O  OE2   . GLU A 1  1167 ? 442.188 15.844  540.246 1.00 122.61 ? 1167 GLU A OE2   1 
ATOM   8749  N  N     . GLU A 1  1168 ? 441.018 11.065  542.321 1.00 144.40 ? 1168 GLU A N     1 
ATOM   8750  C  CA    . GLU A 1  1168 ? 441.102 9.706   541.803 1.00 146.40 ? 1168 GLU A CA    1 
ATOM   8751  C  C     . GLU A 1  1168 ? 440.066 8.806   542.468 1.00 144.72 ? 1168 GLU A C     1 
ATOM   8752  O  O     . GLU A 1  1168 ? 439.489 7.926   541.828 1.00 147.80 ? 1168 GLU A O     1 
ATOM   8753  C  CB    . GLU A 1  1168 ? 442.507 9.139   542.015 1.00 148.09 ? 1168 GLU A CB    1 
ATOM   8754  C  CG    . GLU A 1  1168 ? 442.696 7.732   541.474 1.00 152.81 ? 1168 GLU A CG    1 
ATOM   8755  C  CD    . GLU A 1  1168 ? 444.057 7.159   541.810 1.00 156.80 ? 1168 GLU A CD    1 
ATOM   8756  O  OE1   . GLU A 1  1168 ? 444.850 7.858   542.476 1.00 155.20 ? 1168 GLU A OE1   1 
ATOM   8757  O  OE2   . GLU A 1  1168 ? 444.334 6.009   541.409 1.00 160.69 ? 1168 GLU A OE2   1 
ATOM   8758  N  N     . ILE A 1  1169 ? 439.832 9.042   543.755 1.00 88.59  ? 1169 ILE A N     1 
ATOM   8759  C  CA    . ILE A 1  1169 ? 438.883 8.249   544.530 1.00 89.23  ? 1169 ILE A CA    1 
ATOM   8760  C  C     . ILE A 1  1169 ? 437.466 8.394   543.981 1.00 90.36  ? 1169 ILE A C     1 
ATOM   8761  O  O     . ILE A 1  1169 ? 436.771 7.400   543.764 1.00 93.42  ? 1169 ILE A O     1 
ATOM   8762  C  CB    . ILE A 1  1169 ? 438.900 8.645   546.026 1.00 84.39  ? 1169 ILE A CB    1 
ATOM   8763  C  CG1   . ILE A 1  1169 ? 440.134 8.068   546.727 1.00 82.75  ? 1169 ILE A CG1   1 
ATOM   8764  C  CG2   . ILE A 1  1169 ? 437.643 8.155   546.729 1.00 79.76  ? 1169 ILE A CG2   1 
ATOM   8765  C  CD1   . ILE A 1  1169 ? 441.415 8.850   546.501 1.00 82.85  ? 1169 ILE A CD1   1 
ATOM   8766  N  N     . ILE A 1  1170 ? 437.045 9.633   543.747 1.00 101.40 ? 1170 ILE A N     1 
ATOM   8767  C  CA    . ILE A 1  1170 ? 435.716 9.891   543.205 1.00 102.71 ? 1170 ILE A CA    1 
ATOM   8768  C  C     . ILE A 1  1170 ? 435.662 9.562   541.715 1.00 105.23 ? 1170 ILE A C     1 
ATOM   8769  O  O     . ILE A 1  1170 ? 434.584 9.376   541.151 1.00 106.50 ? 1170 ILE A O     1 
ATOM   8770  C  CB    . ILE A 1  1170 ? 435.285 11.354  543.420 1.00 99.32  ? 1170 ILE A CB    1 
ATOM   8771  C  CG1   . ILE A 1  1170 ? 436.205 12.302  542.653 1.00 99.85  ? 1170 ILE A CG1   1 
ATOM   8772  C  CG2   . ILE A 1  1170 ? 435.276 11.696  544.903 1.00 94.48  ? 1170 ILE A CG2   1 
ATOM   8773  C  CD1   . ILE A 1  1170 ? 435.839 13.752  542.796 1.00 99.49  ? 1170 ILE A CD1   1 
ATOM   8774  N  N     . GLN A 1  1171 ? 436.830 9.489   541.082 1.00 123.06 ? 1171 GLN A N     1 
ATOM   8775  C  CA    . GLN A 1  1171 ? 436.908 9.097   539.680 1.00 127.56 ? 1171 GLN A CA    1 
ATOM   8776  C  C     . GLN A 1  1171 ? 436.651 7.601   539.525 1.00 131.27 ? 1171 GLN A C     1 
ATOM   8777  O  O     . GLN A 1  1171 ? 435.989 7.168   538.581 1.00 134.47 ? 1171 GLN A O     1 
ATOM   8778  C  CB    . GLN A 1  1171 ? 438.274 9.459   539.092 1.00 129.05 ? 1171 GLN A CB    1 
ATOM   8779  C  CG    . GLN A 1  1171 ? 438.453 9.049   537.639 1.00 132.56 ? 1171 GLN A CG    1 
ATOM   8780  C  CD    . GLN A 1  1171 ? 439.847 9.338   537.120 1.00 132.21 ? 1171 GLN A CD    1 
ATOM   8781  O  OE1   . GLN A 1  1171 ? 440.706 9.828   537.853 1.00 129.04 ? 1171 GLN A OE1   1 
ATOM   8782  N  NE2   . GLN A 1  1171 ? 440.080 9.035   535.848 1.00 135.51 ? 1171 GLN A NE2   1 
ATOM   8783  N  N     . LEU A 1  1172 ? 437.177 6.818   540.461 1.00 140.65 ? 1172 LEU A N     1 
ATOM   8784  C  CA    . LEU A 1  1172 ? 437.056 5.364   540.406 1.00 141.24 ? 1172 LEU A CA    1 
ATOM   8785  C  C     . LEU A 1  1172 ? 435.732 4.865   540.981 1.00 140.91 ? 1172 LEU A C     1 
ATOM   8786  O  O     . LEU A 1  1172 ? 435.300 3.753   540.679 1.00 142.61 ? 1172 LEU A O     1 
ATOM   8787  C  CB    . LEU A 1  1172 ? 438.223 4.703   541.145 1.00 137.12 ? 1172 LEU A CB    1 
ATOM   8788  C  CG    . LEU A 1  1172 ? 439.452 4.315   540.316 1.00 142.01 ? 1172 LEU A CG    1 
ATOM   8789  C  CD1   . LEU A 1  1172 ? 439.070 3.322   539.227 1.00 145.44 ? 1172 LEU A CD1   1 
ATOM   8790  C  CD2   . LEU A 1  1172 ? 440.132 5.538   539.716 1.00 141.64 ? 1172 LEU A CD2   1 
ATOM   8791  N  N     . HIS A 1  1173 ? 435.090 5.685   541.807 1.00 152.79 ? 1173 HIS A N     1 
ATOM   8792  C  CA    . HIS A 1  1173 ? 433.825 5.293   542.420 1.00 154.62 ? 1173 HIS A CA    1 
ATOM   8793  C  C     . HIS A 1  1173 ? 432.638 5.856   541.643 1.00 157.83 ? 1173 HIS A C     1 
ATOM   8794  O  O     . HIS A 1  1173 ? 431.608 6.201   542.221 1.00 158.39 ? 1173 HIS A O     1 
ATOM   8795  C  CB    . HIS A 1  1173 ? 433.766 5.751   543.879 1.00 151.59 ? 1173 HIS A CB    1 
ATOM   8796  C  CG    . HIS A 1  1173 ? 432.795 4.976   544.715 1.00 153.39 ? 1173 HIS A CG    1 
ATOM   8797  N  ND1   . HIS A 1  1173 ? 431.450 5.273   544.762 1.00 152.54 ? 1173 HIS A ND1   1 
ATOM   8798  C  CD2   . HIS A 1  1173 ? 432.973 3.912   545.533 1.00 153.47 ? 1173 HIS A CD2   1 
ATOM   8799  C  CE1   . HIS A 1  1173 ? 430.842 4.427   545.575 1.00 151.89 ? 1173 HIS A CE1   1 
ATOM   8800  N  NE2   . HIS A 1  1173 ? 431.744 3.591   546.056 1.00 151.88 ? 1173 HIS A NE2   1 
ATOM   8801  N  N     . PHE A 1  1174 ? 432.794 5.945   540.326 1.00 185.96 ? 1174 PHE A N     1 
ATOM   8802  C  CA    . PHE A 1  1174 ? 431.720 6.395   539.451 1.00 188.51 ? 1174 PHE A CA    1 
ATOM   8803  C  C     . PHE A 1  1174 ? 431.037 5.205   538.787 1.00 192.50 ? 1174 PHE A C     1 
ATOM   8804  O  O     . PHE A 1  1174 ? 429.810 5.113   538.760 1.00 191.61 ? 1174 PHE A O     1 
ATOM   8805  C  CB    . PHE A 1  1174 ? 432.258 7.360   538.391 1.00 187.36 ? 1174 PHE A CB    1 
ATOM   8806  C  CG    . PHE A 1  1174 ? 431.292 7.635   537.273 1.00 194.07 ? 1174 PHE A CG    1 
ATOM   8807  C  CD1   . PHE A 1  1174 ? 430.229 8.506   537.454 1.00 195.93 ? 1174 PHE A CD1   1 
ATOM   8808  C  CD2   . PHE A 1  1174 ? 431.451 7.029   536.037 1.00 195.63 ? 1174 PHE A CD2   1 
ATOM   8809  C  CE1   . PHE A 1  1174 ? 429.341 8.760   536.426 1.00 197.58 ? 1174 PHE A CE1   1 
ATOM   8810  C  CE2   . PHE A 1  1174 ? 430.567 7.280   535.006 1.00 197.44 ? 1174 PHE A CE2   1 
ATOM   8811  C  CZ    . PHE A 1  1174 ? 429.510 8.147   535.200 1.00 198.57 ? 1174 PHE A CZ    1 
ATOM   8812  N  N     . SER A 1  1175 ? 431.846 4.295   538.253 1.00 124.52 ? 1175 SER A N     1 
ATOM   8813  C  CA    . SER A 1  1175 ? 431.333 3.101   537.593 1.00 124.78 ? 1175 SER A CA    1 
ATOM   8814  C  C     . SER A 1  1175 ? 430.768 2.113   538.608 1.00 122.96 ? 1175 SER A C     1 
ATOM   8815  O  O     . SER A 1  1175 ? 431.160 2.116   539.775 1.00 119.54 ? 1175 SER A O     1 
ATOM   8816  C  CB    . SER A 1  1175 ? 432.433 2.433   536.766 1.00 123.34 ? 1175 SER A CB    1 
ATOM   8817  O  OG    . SER A 1  1175 ? 432.962 3.330   535.805 1.00 126.74 ? 1175 SER A OG    1 
ATOM   8818  N  N     . GLN A 1  1187 ? 420.339 15.360  546.053 1.00 128.70 ? 1187 GLN A N     1 
ATOM   8819  C  CA    . GLN A 1  1187 ? 420.206 14.013  546.596 1.00 131.80 ? 1187 GLN A CA    1 
ATOM   8820  C  C     . GLN A 1  1187 ? 421.117 13.805  547.802 1.00 130.99 ? 1187 GLN A C     1 
ATOM   8821  O  O     . GLN A 1  1187 ? 420.783 13.059  548.723 1.00 129.07 ? 1187 GLN A O     1 
ATOM   8822  C  CB    . GLN A 1  1187 ? 420.515 12.969  545.520 1.00 133.45 ? 1187 GLN A CB    1 
ATOM   8823  C  CG    . GLN A 1  1187 ? 421.879 13.134  544.866 1.00 131.62 ? 1187 GLN A CG    1 
ATOM   8824  C  CD    . GLN A 1  1187 ? 422.246 11.964  543.976 1.00 132.47 ? 1187 GLN A CD    1 
ATOM   8825  O  OE1   . GLN A 1  1187 ? 421.495 10.996  543.860 1.00 133.89 ? 1187 GLN A OE1   1 
ATOM   8826  N  NE2   . GLN A 1  1187 ? 423.410 12.047  543.342 1.00 128.55 ? 1187 GLN A NE2   1 
ATOM   8827  N  N     . GLN A 1  1188 ? 422.267 14.472  547.792 1.00 151.69 ? 1188 GLN A N     1 
ATOM   8828  C  CA    . GLN A 1  1188 ? 423.253 14.320  548.855 1.00 145.53 ? 1188 GLN A CA    1 
ATOM   8829  C  C     . GLN A 1  1188 ? 423.454 15.625  549.617 1.00 143.50 ? 1188 GLN A C     1 
ATOM   8830  O  O     . GLN A 1  1188 ? 422.732 16.599  549.404 1.00 146.57 ? 1188 GLN A O     1 
ATOM   8831  C  CB    . GLN A 1  1188 ? 424.588 13.840  548.282 1.00 143.54 ? 1188 GLN A CB    1 
ATOM   8832  C  CG    . GLN A 1  1188 ? 424.494 12.555  547.475 1.00 148.23 ? 1188 GLN A CG    1 
ATOM   8833  C  CD    . GLN A 1  1188 ? 425.815 12.170  546.838 1.00 148.75 ? 1188 GLN A CD    1 
ATOM   8834  O  OE1   . GLN A 1  1188 ? 426.846 12.790  547.097 1.00 148.27 ? 1188 GLN A OE1   1 
ATOM   8835  N  NE2   . GLN A 1  1188 ? 425.789 11.144  545.995 1.00 150.91 ? 1188 GLN A NE2   1 
ATOM   8836  N  N     . SER A 1  1189 ? 424.442 15.635  550.505 1.00 77.11  ? 1189 SER A N     1 
ATOM   8837  C  CA    . SER A 1  1189 ? 424.759 16.824  551.286 1.00 76.01  ? 1189 SER A CA    1 
ATOM   8838  C  C     . SER A 1  1189 ? 426.071 17.442  550.819 1.00 75.03  ? 1189 SER A C     1 
ATOM   8839  O  O     . SER A 1  1189 ? 427.023 16.726  550.508 1.00 74.56  ? 1189 SER A O     1 
ATOM   8840  C  CB    . SER A 1  1189 ? 424.839 16.486  552.777 1.00 75.02  ? 1189 SER A CB    1 
ATOM   8841  O  OG    . SER A 1  1189 ? 425.144 17.632  553.551 1.00 74.23  ? 1189 SER A OG    1 
ATOM   8842  N  N     . PRO A 1  1190 ? 426.122 18.781  550.764 1.00 70.45  ? 1190 PRO A N     1 
ATOM   8843  C  CA    . PRO A 1  1190 ? 427.349 19.484  550.380 1.00 69.67  ? 1190 PRO A CA    1 
ATOM   8844  C  C     . PRO A 1  1190 ? 428.441 19.334  551.436 1.00 68.29  ? 1190 PRO A C     1 
ATOM   8845  O  O     . PRO A 1  1190 ? 429.626 19.417  551.116 1.00 67.78  ? 1190 PRO A O     1 
ATOM   8846  C  CB    . PRO A 1  1190 ? 426.895 20.941  550.259 1.00 70.03  ? 1190 PRO A CB    1 
ATOM   8847  C  CG    . PRO A 1  1190 ? 425.713 21.039  551.161 1.00 70.51  ? 1190 PRO A CG    1 
ATOM   8848  C  CD    . PRO A 1  1190 ? 425.019 19.713  551.058 1.00 71.20  ? 1190 PRO A CD    1 
ATOM   8849  N  N     . TRP A 1  1191 ? 428.038 19.110  552.683 1.00 72.93  ? 1191 TRP A N     1 
ATOM   8850  C  CA    . TRP A 1  1191 ? 428.989 18.945  553.774 1.00 71.76  ? 1191 TRP A CA    1 
ATOM   8851  C  C     . TRP A 1  1191 ? 429.649 17.570  553.719 1.00 71.31  ? 1191 TRP A C     1 
ATOM   8852  O  O     . TRP A 1  1191 ? 428.972 16.546  553.619 1.00 71.76  ? 1191 TRP A O     1 
ATOM   8853  C  CB    . TRP A 1  1191 ? 428.297 19.152  555.122 1.00 71.65  ? 1191 TRP A CB    1 
ATOM   8854  C  CG    . TRP A 1  1191 ? 427.629 20.488  555.249 1.00 73.99  ? 1191 TRP A CG    1 
ATOM   8855  C  CD1   . TRP A 1  1191 ? 426.293 20.749  555.152 1.00 77.95  ? 1191 TRP A CD1   1 
ATOM   8856  C  CD2   . TRP A 1  1191 ? 428.268 21.748  555.488 1.00 72.38  ? 1191 TRP A CD2   1 
ATOM   8857  N  NE1   . TRP A 1  1191 ? 426.060 22.092  555.320 1.00 75.72  ? 1191 TRP A NE1   1 
ATOM   8858  C  CE2   . TRP A 1  1191 ? 427.256 22.728  555.527 1.00 73.05  ? 1191 TRP A CE2   1 
ATOM   8859  C  CE3   . TRP A 1  1191 ? 429.596 22.142  555.674 1.00 71.33  ? 1191 TRP A CE3   1 
ATOM   8860  C  CZ2   . TRP A 1  1191 ? 427.530 24.076  555.746 1.00 74.09  ? 1191 TRP A CZ2   1 
ATOM   8861  C  CZ3   . TRP A 1  1191 ? 429.866 23.481  555.890 1.00 71.58  ? 1191 TRP A CZ3   1 
ATOM   8862  C  CH2   . TRP A 1  1191 ? 428.839 24.432  555.924 1.00 72.89  ? 1191 TRP A CH2   1 
ATOM   8863  N  N     . LEU A 1  1192 ? 430.976 17.559  553.785 1.00 62.63  ? 1192 LEU A N     1 
ATOM   8864  C  CA    . LEU A 1  1192 ? 431.752 16.329  553.677 1.00 62.32  ? 1192 LEU A CA    1 
ATOM   8865  C  C     . LEU A 1  1192 ? 432.462 15.983  554.981 1.00 61.28  ? 1192 LEU A C     1 
ATOM   8866  O  O     . LEU A 1  1192 ? 433.047 16.851  555.627 1.00 60.82  ? 1192 LEU A O     1 
ATOM   8867  C  CB    . LEU A 1  1192 ? 432.778 16.452  552.549 1.00 62.70  ? 1192 LEU A CB    1 
ATOM   8868  C  CG    . LEU A 1  1192 ? 433.802 15.322  552.431 1.00 62.57  ? 1192 LEU A CG    1 
ATOM   8869  C  CD1   . LEU A 1  1192 ? 433.152 14.055  551.897 1.00 63.29  ? 1192 LEU A CD1   1 
ATOM   8870  C  CD2   . LEU A 1  1192 ? 434.975 15.743  551.562 1.00 63.02  ? 1192 LEU A CD2   1 
ATOM   8871  N  N     . LEU A 1  1193 ? 432.409 14.709  555.357 1.00 61.02  ? 1193 LEU A N     1 
ATOM   8872  C  CA    . LEU A 1  1193 ? 433.117 14.218  556.533 1.00 60.07  ? 1193 LEU A CA    1 
ATOM   8873  C  C     . LEU A 1  1193 ? 434.258 13.298  556.111 1.00 59.98  ? 1193 LEU A C     1 
ATOM   8874  O  O     . LEU A 1  1193 ? 434.029 12.200  555.611 1.00 60.38  ? 1193 LEU A O     1 
ATOM   8875  C  CB    . LEU A 1  1193 ? 432.156 13.489  557.470 1.00 59.85  ? 1193 LEU A CB    1 
ATOM   8876  C  CG    . LEU A 1  1193 ? 432.740 12.885  558.746 1.00 58.90  ? 1193 LEU A CG    1 
ATOM   8877  C  CD1   . LEU A 1  1193 ? 433.581 13.904  559.492 1.00 58.41  ? 1193 LEU A CD1   1 
ATOM   8878  C  CD2   . LEU A 1  1193 ? 431.613 12.380  559.626 1.00 58.90  ? 1193 LEU A CD2   1 
ATOM   8879  N  N     . ARG A 1  1194 ? 435.488 13.753  556.320 1.00 60.43  ? 1194 ARG A N     1 
ATOM   8880  C  CA    . ARG A 1  1194 ? 436.659 13.061  555.796 1.00 60.67  ? 1194 ARG A CA    1 
ATOM   8881  C  C     . ARG A 1  1194 ? 437.557 12.497  556.896 1.00 59.94  ? 1194 ARG A C     1 
ATOM   8882  O  O     . ARG A 1  1194 ? 438.165 13.245  557.660 1.00 59.58  ? 1194 ARG A O     1 
ATOM   8883  C  CB    . ARG A 1  1194 ? 437.459 14.009  554.901 1.00 61.34  ? 1194 ARG A CB    1 
ATOM   8884  C  CG    . ARG A 1  1194 ? 438.670 13.387  554.236 1.00 61.98  ? 1194 ARG A CG    1 
ATOM   8885  C  CD    . ARG A 1  1194 ? 439.206 14.297  553.144 1.00 62.93  ? 1194 ARG A CD    1 
ATOM   8886  N  NE    . ARG A 1  1194 ? 440.462 13.814  552.581 1.00 63.79  ? 1194 ARG A NE    1 
ATOM   8887  C  CZ    . ARG A 1  1194 ? 441.662 14.165  553.030 1.00 63.89  ? 1194 ARG A CZ    1 
ATOM   8888  N  NH1   . ARG A 1  1194 ? 441.771 15.005  554.051 1.00 63.18  ? 1194 ARG A NH1   1 
ATOM   8889  N  NH2   . ARG A 1  1194 ? 442.754 13.679  552.458 1.00 64.95  ? 1194 ARG A NH2   1 
ATOM   8890  N  N     . LEU A 1  1195 ? 437.634 11.171  556.960 1.00 59.08  ? 1195 LEU A N     1 
ATOM   8891  C  CA    . LEU A 1  1195 ? 438.484 10.484  557.925 1.00 58.45  ? 1195 LEU A CA    1 
ATOM   8892  C  C     . LEU A 1  1195 ? 439.841 10.122  557.331 1.00 59.11  ? 1195 LEU A C     1 
ATOM   8893  O  O     . LEU A 1  1195 ? 439.929 9.632   556.203 1.00 60.04  ? 1195 LEU A O     1 
ATOM   8894  C  CB    . LEU A 1  1195 ? 437.804 9.212   558.435 1.00 58.02  ? 1195 LEU A CB    1 
ATOM   8895  C  CG    . LEU A 1  1195 ? 436.547 9.337   559.292 1.00 57.46  ? 1195 LEU A CG    1 
ATOM   8896  C  CD1   . LEU A 1  1195 ? 436.028 7.952   559.636 1.00 57.27  ? 1195 LEU A CD1   1 
ATOM   8897  C  CD2   . LEU A 1  1195 ? 436.835 10.124  560.552 1.00 56.73  ? 1195 LEU A CD2   1 
ATOM   8898  N  N     . GLU A 1  1196 ? 440.892 10.366  558.106 1.00 75.37  ? 1196 GLU A N     1 
ATOM   8899  C  CA    . GLU A 1  1196 ? 442.240 9.946   557.752 1.00 75.61  ? 1196 GLU A CA    1 
ATOM   8900  C  C     . GLU A 1  1196 ? 442.734 8.940   558.783 1.00 76.00  ? 1196 GLU A C     1 
ATOM   8901  O  O     . GLU A 1  1196 ? 442.810 9.250   559.977 1.00 76.70  ? 1196 GLU A O     1 
ATOM   8902  C  CB    . GLU A 1  1196 ? 443.184 11.146  557.673 1.00 77.84  ? 1196 GLU A CB    1 
ATOM   8903  C  CG    . GLU A 1  1196 ? 444.616 10.791  557.306 1.00 78.55  ? 1196 GLU A CG    1 
ATOM   8904  C  CD    . GLU A 1  1196 ? 445.523 12.006  557.260 1.00 82.82  ? 1196 GLU A CD    1 
ATOM   8905  O  OE1   . GLU A 1  1196 ? 445.035 13.126  557.524 1.00 81.77  ? 1196 GLU A OE1   1 
ATOM   8906  O  OE2   . GLU A 1  1196 ? 446.724 11.840  556.959 1.00 85.20  ? 1196 GLU A OE2   1 
ATOM   8907  N  N     . LEU A 1  1197 ? 443.062 7.738   558.315 1.00 66.18  ? 1197 LEU A N     1 
ATOM   8908  C  CA    . LEU A 1  1197 ? 443.434 6.632   559.194 1.00 65.64  ? 1197 LEU A CA    1 
ATOM   8909  C  C     . LEU A 1  1197 ? 444.946 6.458   559.302 1.00 66.41  ? 1197 LEU A C     1 
ATOM   8910  O  O     . LEU A 1  1197 ? 445.705 7.021   558.513 1.00 67.60  ? 1197 LEU A O     1 
ATOM   8911  C  CB    . LEU A 1  1197 ? 442.802 5.328   558.698 1.00 65.85  ? 1197 LEU A CB    1 
ATOM   8912  C  CG    . LEU A 1  1197 ? 441.291 5.343   558.460 1.00 65.50  ? 1197 LEU A CG    1 
ATOM   8913  C  CD1   . LEU A 1  1197 ? 440.808 3.979   557.992 1.00 66.01  ? 1197 LEU A CD1   1 
ATOM   8914  C  CD2   . LEU A 1  1197 ? 440.554 5.777   559.716 1.00 64.17  ? 1197 LEU A CD2   1 
ATOM   8915  N  N     . ASP A 1  1198 ? 445.375 5.672   560.285 1.00 85.94  ? 1198 ASP A N     1 
ATOM   8916  C  CA    . ASP A 1  1198 ? 446.794 5.402   560.491 1.00 88.02  ? 1198 ASP A CA    1 
ATOM   8917  C  C     . ASP A 1  1198 ? 447.213 4.132   559.761 1.00 90.62  ? 1198 ASP A C     1 
ATOM   8918  O  O     . ASP A 1  1198 ? 446.706 3.048   560.045 1.00 91.35  ? 1198 ASP A O     1 
ATOM   8919  C  CB    . ASP A 1  1198 ? 447.110 5.285   561.984 1.00 87.05  ? 1198 ASP A CB    1 
ATOM   8920  C  CG    . ASP A 1  1198 ? 448.595 5.136   562.257 1.00 92.22  ? 1198 ASP A CG    1 
ATOM   8921  O  OD1   . ASP A 1  1198 ? 449.405 5.648   561.453 1.00 94.73  ? 1198 ASP A OD1   1 
ATOM   8922  O  OD2   . ASP A 1  1198 ? 448.954 4.511   563.277 1.00 94.33  ? 1198 ASP A OD2   1 
ATOM   8923  N  N     . ARG A 1  1199 ? 448.145 4.278   558.825 1.00 100.73 ? 1199 ARG A N     1 
ATOM   8924  C  CA    . ARG A 1  1199 ? 448.591 3.169   557.987 1.00 103.16 ? 1199 ARG A CA    1 
ATOM   8925  C  C     . ARG A 1  1199 ? 449.199 2.033   558.806 1.00 101.57 ? 1199 ARG A C     1 
ATOM   8926  O  O     . ARG A 1  1199 ? 449.044 0.860   558.465 1.00 99.71  ? 1199 ARG A O     1 
ATOM   8927  C  CB    . ARG A 1  1199 ? 449.603 3.668   556.955 1.00 106.14 ? 1199 ARG A CB    1 
ATOM   8928  C  CG    . ARG A 1  1199 ? 449.988 2.641   555.907 1.00 107.52 ? 1199 ARG A CG    1 
ATOM   8929  C  CD    . ARG A 1  1199 ? 450.953 3.233   554.896 1.00 109.97 ? 1199 ARG A CD    1 
ATOM   8930  N  NE    . ARG A 1  1199 ? 451.234 2.309   553.803 1.00 114.27 ? 1199 ARG A NE    1 
ATOM   8931  C  CZ    . ARG A 1  1199 ? 450.509 2.226   552.693 1.00 117.96 ? 1199 ARG A CZ    1 
ATOM   8932  N  NH1   . ARG A 1  1199 ? 449.455 3.013   552.527 1.00 115.36 ? 1199 ARG A NH1   1 
ATOM   8933  N  NH2   . ARG A 1  1199 ? 450.837 1.355   551.748 1.00 123.25 ? 1199 ARG A NH2   1 
ATOM   8934  N  N     . ALA A 1  1200 ? 449.887 2.386   559.887 1.00 77.26  ? 1200 ALA A N     1 
ATOM   8935  C  CA    . ALA A 1  1200 ? 450.530 1.394   560.742 1.00 75.85  ? 1200 ALA A CA    1 
ATOM   8936  C  C     . ALA A 1  1200 ? 449.520 0.694   561.646 1.00 73.01  ? 1200 ALA A C     1 
ATOM   8937  O  O     . ALA A 1  1200 ? 449.692 -0.474  561.993 1.00 72.81  ? 1200 ALA A O     1 
ATOM   8938  C  CB    . ALA A 1  1200 ? 451.621 2.046   561.576 1.00 76.77  ? 1200 ALA A CB    1 
ATOM   8939  N  N     . ALA A 1  1201 ? 448.467 1.413   562.022 1.00 74.47  ? 1201 ALA A N     1 
ATOM   8940  C  CA    . ALA A 1  1201 ? 447.443 0.868   562.906 1.00 71.87  ? 1201 ALA A CA    1 
ATOM   8941  C  C     . ALA A 1  1201 ? 446.519 -0.095  562.164 1.00 73.27  ? 1201 ALA A C     1 
ATOM   8942  O  O     . ALA A 1  1201 ? 445.892 -0.961  562.776 1.00 72.68  ? 1201 ALA A O     1 
ATOM   8943  C  CB    . ALA A 1  1201 ? 446.637 1.992   563.538 1.00 70.63  ? 1201 ALA A CB    1 
ATOM   8944  N  N     . MET A 1  1202 ? 446.436 0.062   560.847 1.00 90.16  ? 1202 MET A N     1 
ATOM   8945  C  CA    . MET A 1  1202 ? 445.620 -0.826  560.025 1.00 91.55  ? 1202 MET A CA    1 
ATOM   8946  C  C     . MET A 1  1202 ? 446.289 -2.190  559.881 1.00 93.10  ? 1202 MET A C     1 
ATOM   8947  O  O     . MET A 1  1202 ? 445.629 -3.190  559.598 1.00 92.88  ? 1202 MET A O     1 
ATOM   8948  C  CB    . MET A 1  1202 ? 445.369 -0.210  558.646 1.00 93.19  ? 1202 MET A CB    1 
ATOM   8949  C  CG    . MET A 1  1202 ? 444.625 1.117   558.680 1.00 90.71  ? 1202 MET A CG    1 
ATOM   8950  S  SD    . MET A 1  1202 ? 442.928 0.981   559.274 1.00 87.17  ? 1202 MET A SD    1 
ATOM   8951  C  CE    . MET A 1  1202 ? 442.135 0.209   557.865 1.00 91.58  ? 1202 MET A CE    1 
ATOM   8952  N  N     . ASN A 1  1203 ? 447.603 -2.222  560.078 1.00 82.89  ? 1203 ASN A N     1 
ATOM   8953  C  CA    . ASN A 1  1203 ? 448.362 -3.464  560.007 1.00 83.59  ? 1203 ASN A CA    1 
ATOM   8954  C  C     . ASN A 1  1203 ? 448.371 -4.195  561.346 1.00 82.37  ? 1203 ASN A C     1 
ATOM   8955  O  O     . ASN A 1  1203 ? 448.379 -5.426  561.392 1.00 84.49  ? 1203 ASN A O     1 
ATOM   8956  C  CB    . ASN A 1  1203 ? 449.795 -3.188  559.548 1.00 83.71  ? 1203 ASN A CB    1 
ATOM   8957  C  CG    . ASN A 1  1203 ? 449.853 -2.513  558.191 1.00 85.80  ? 1203 ASN A CG    1 
ATOM   8958  O  OD1   . ASN A 1  1203 ? 448.856 -1.975  557.709 1.00 85.41  ? 1203 ASN A OD1   1 
ATOM   8959  N  ND2   . ASN A 1  1203 ? 451.025 -2.536  557.567 1.00 88.19  ? 1203 ASN A ND2   1 
ATOM   8960  N  N     . ASP A 1  1204 ? 448.371 -3.428  562.432 1.00 116.90 ? 1204 ASP A N     1 
ATOM   8961  C  CA    . ASP A 1  1204 ? 448.348 -3.993  563.778 1.00 115.76 ? 1204 ASP A CA    1 
ATOM   8962  C  C     . ASP A 1  1204 ? 447.041 -4.731  564.043 1.00 114.52 ? 1204 ASP A C     1 
ATOM   8963  O  O     . ASP A 1  1204 ? 447.043 -5.864  564.525 1.00 114.53 ? 1204 ASP A O     1 
ATOM   8964  C  CB    . ASP A 1  1204 ? 448.553 -2.894  564.824 1.00 113.61 ? 1204 ASP A CB    1 
ATOM   8965  C  CG    . ASP A 1  1204 ? 448.426 -3.410  566.246 1.00 111.82 ? 1204 ASP A CG    1 
ATOM   8966  O  OD1   . ASP A 1  1204 ? 448.828 -4.565  566.503 1.00 110.50 ? 1204 ASP A OD1   1 
ATOM   8967  O  OD2   . ASP A 1  1204 ? 447.923 -2.659  567.108 1.00 110.41 ? 1204 ASP A OD2   1 
ATOM   8968  N  N     . LYS A 1  1205 ? 445.925 -4.081  563.726 1.00 107.96 ? 1205 LYS A N     1 
ATOM   8969  C  CA    . LYS A 1  1205 ? 444.610 -4.679  563.917 1.00 104.70 ? 1205 LYS A CA    1 
ATOM   8970  C  C     . LYS A 1  1205 ? 444.291 -5.653  562.787 1.00 108.24 ? 1205 LYS A C     1 
ATOM   8971  O  O     . LYS A 1  1205 ? 443.349 -6.442  562.884 1.00 106.77 ? 1205 LYS A O     1 
ATOM   8972  C  CB    . LYS A 1  1205 ? 443.534 -3.594  564.000 1.00 101.46 ? 1205 LYS A CB    1 
ATOM   8973  C  CG    . LYS A 1  1205 ? 443.823 -2.506  565.023 1.00 99.63  ? 1205 LYS A CG    1 
ATOM   8974  C  CD    . LYS A 1  1205 ? 443.915 -3.074  566.428 1.00 98.47  ? 1205 LYS A CD    1 
ATOM   8975  C  CE    . LYS A 1  1205 ? 444.184 -1.979  567.448 1.00 98.55  ? 1205 LYS A CE    1 
ATOM   8976  N  NZ    . LYS A 1  1205 ? 444.289 -2.521  568.831 1.00 99.52  ? 1205 LYS A NZ    1 
ATOM   8977  N  N     . ASP A 1  1206 ? 445.087 -5.582  561.722 1.00 128.83 ? 1206 ASP A N     1 
ATOM   8978  C  CA    . ASP A 1  1206 ? 444.938 -6.443  560.550 1.00 133.76 ? 1206 ASP A CA    1 
ATOM   8979  C  C     . ASP A 1  1206 ? 443.536 -6.351  559.951 1.00 133.66 ? 1206 ASP A C     1 
ATOM   8980  O  O     . ASP A 1  1206 ? 442.772 -7.316  559.978 1.00 134.41 ? 1206 ASP A O     1 
ATOM   8981  C  CB    . ASP A 1  1206 ? 445.267 -7.897  560.905 1.00 137.27 ? 1206 ASP A CB    1 
ATOM   8982  C  CG    . ASP A 1  1206 ? 445.445 -8.771  559.678 1.00 142.99 ? 1206 ASP A CG    1 
ATOM   8983  O  OD1   . ASP A 1  1206 ? 445.895 -8.250  558.635 1.00 141.71 ? 1206 ASP A OD1   1 
ATOM   8984  O  OD2   . ASP A 1  1206 ? 445.136 -9.979  559.757 1.00 144.40 ? 1206 ASP A OD2   1 
ATOM   8985  N  N     . LEU A 1  1207 ? 443.205 -5.180  559.416 1.00 75.77  ? 1207 LEU A N     1 
ATOM   8986  C  CA    . LEU A 1  1207 ? 441.915 -4.967  558.769 1.00 74.80  ? 1207 LEU A CA    1 
ATOM   8987  C  C     . LEU A 1  1207 ? 442.053 -4.039  557.565 1.00 75.88  ? 1207 LEU A C     1 
ATOM   8988  O  O     . LEU A 1  1207 ? 442.969 -3.219  557.502 1.00 73.18  ? 1207 LEU A O     1 
ATOM   8989  C  CB    . LEU A 1  1207 ? 440.895 -4.405  559.766 1.00 70.20  ? 1207 LEU A CB    1 
ATOM   8990  C  CG    . LEU A 1  1207 ? 441.408 -3.599  560.963 1.00 68.49  ? 1207 LEU A CG    1 
ATOM   8991  C  CD1   . LEU A 1  1207 ? 442.005 -2.269  560.534 1.00 68.71  ? 1207 LEU A CD1   1 
ATOM   8992  C  CD2   . LEU A 1  1207 ? 440.294 -3.383  561.975 1.00 67.09  ? 1207 LEU A CD2   1 
ATOM   8993  N  N     . THR A 1  1208 ? 441.139 -4.177  556.611 1.00 93.38  ? 1208 THR A N     1 
ATOM   8994  C  CA    . THR A 1  1208 ? 441.206 -3.417  555.368 1.00 92.23  ? 1208 THR A CA    1 
ATOM   8995  C  C     . THR A 1  1208 ? 440.303 -2.188  555.392 1.00 93.02  ? 1208 THR A C     1 
ATOM   8996  O  O     . THR A 1  1208 ? 439.511 -2.002  556.317 1.00 92.18  ? 1208 THR A O     1 
ATOM   8997  C  CB    . THR A 1  1208 ? 440.820 -4.289  554.159 1.00 93.92  ? 1208 THR A CB    1 
ATOM   8998  O  OG1   . THR A 1  1208 ? 439.473 -4.754  554.316 1.00 91.28  ? 1208 THR A OG1   1 
ATOM   8999  C  CG2   . THR A 1  1208 ? 441.754 -5.483  554.043 1.00 99.41  ? 1208 THR A CG2   1 
ATOM   9000  N  N     . MET A 1  1209 ? 440.430 -1.353  554.366 1.00 81.31  ? 1209 MET A N     1 
ATOM   9001  C  CA    . MET A 1  1209 ? 439.590 -0.170  554.226 1.00 79.49  ? 1209 MET A CA    1 
ATOM   9002  C  C     . MET A 1  1209 ? 438.142 -0.570  553.965 1.00 79.60  ? 1209 MET A C     1 
ATOM   9003  O  O     . MET A 1  1209 ? 437.211 0.113   554.395 1.00 76.89  ? 1209 MET A O     1 
ATOM   9004  C  CB    . MET A 1  1209 ? 440.102 0.726   553.096 1.00 78.76  ? 1209 MET A CB    1 
ATOM   9005  C  CG    . MET A 1  1209 ? 441.479 1.321   553.343 1.00 80.39  ? 1209 MET A CG    1 
ATOM   9006  S  SD    . MET A 1  1209 ? 441.500 2.510   554.698 1.00 80.88  ? 1209 MET A SD    1 
ATOM   9007  C  CE    . MET A 1  1209 ? 440.383 3.762   554.070 1.00 75.46  ? 1209 MET A CE    1 
ATOM   9008  N  N     . GLY A 1  1210 ? 437.963 -1.680  553.256 1.00 108.40 ? 1210 GLY A N     1 
ATOM   9009  C  CA    . GLY A 1  1210 ? 436.639 -2.191  552.950 1.00 109.02 ? 1210 GLY A CA    1 
ATOM   9010  C  C     . GLY A 1  1210 ? 435.890 -2.611  554.198 1.00 108.73 ? 1210 GLY A C     1 
ATOM   9011  O  O     . GLY A 1  1210 ? 434.680 -2.419  554.298 1.00 107.17 ? 1210 GLY A O     1 
ATOM   9012  N  N     . GLN A 1  1211 ? 436.615 -3.188  555.151 1.00 117.35 ? 1211 GLN A N     1 
ATOM   9013  C  CA    . GLN A 1  1211 ? 436.034 -3.598  556.424 1.00 115.82 ? 1211 GLN A CA    1 
ATOM   9014  C  C     . GLN A 1  1211 ? 435.478 -2.392  557.174 1.00 114.33 ? 1211 GLN A C     1 
ATOM   9015  O  O     . GLN A 1  1211 ? 434.344 -2.412  557.657 1.00 112.93 ? 1211 GLN A O     1 
ATOM   9016  C  CB    . GLN A 1  1211 ? 437.078 -4.321  557.279 1.00 118.30 ? 1211 GLN A CB    1 
ATOM   9017  C  CG    . GLN A 1  1211 ? 436.567 -4.807  558.628 1.00 118.33 ? 1211 GLN A CG    1 
ATOM   9018  C  CD    . GLN A 1  1211 ? 435.714 -6.057  558.521 1.00 120.56 ? 1211 GLN A CD    1 
ATOM   9019  O  OE1   . GLN A 1  1211 ? 435.600 -6.657  557.451 1.00 123.02 ? 1211 GLN A OE1   1 
ATOM   9020  N  NE2   . GLN A 1  1211 ? 435.112 -6.460  559.634 1.00 119.33 ? 1211 GLN A NE2   1 
ATOM   9021  N  N     . VAL A 1  1212 ? 436.288 -1.341  557.256 1.00 85.33  ? 1212 VAL A N     1 
ATOM   9022  C  CA    . VAL A 1  1212 ? 435.904 -0.113  557.940 1.00 82.54  ? 1212 VAL A CA    1 
ATOM   9023  C  C     . VAL A 1  1212 ? 434.721 0.562   557.252 1.00 82.54  ? 1212 VAL A C     1 
ATOM   9024  O  O     . VAL A 1  1212 ? 433.728 0.916   557.896 1.00 81.17  ? 1212 VAL A O     1 
ATOM   9025  C  CB    . VAL A 1  1212 ? 437.077 0.880   558.003 1.00 79.12  ? 1212 VAL A CB    1 
ATOM   9026  C  CG1   . VAL A 1  1212 ? 436.693 2.097   558.823 1.00 77.57  ? 1212 VAL A CG1   1 
ATOM   9027  C  CG2   . VAL A 1  1212 ? 438.311 0.205   558.584 1.00 75.93  ? 1212 VAL A CG2   1 
ATOM   9028  N  N     . GLY A 1  1213 ? 434.837 0.732   555.939 1.00 85.64  ? 1213 GLY A N     1 
ATOM   9029  C  CA    . GLY A 1  1213 ? 433.799 1.368   555.151 1.00 89.19  ? 1213 GLY A CA    1 
ATOM   9030  C  C     . GLY A 1  1213 ? 432.473 0.641   555.227 1.00 90.81  ? 1213 GLY A C     1 
ATOM   9031  O  O     . GLY A 1  1213 ? 431.422 1.267   555.355 1.00 89.36  ? 1213 GLY A O     1 
ATOM   9032  N  N     . GLU A 1  1214 ? 432.519 -0.686  555.153 1.00 75.27  ? 1214 GLU A N     1 
ATOM   9033  C  CA    . GLU A 1