data_6C0W
# 
_entry.id   6C0W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6C0W         
WWPDB D_1000230506 
EMDB  EMD-7326     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  .                                                                                                         6EQT     
unspecified            
EMDB 'Cryo-EM structure of human kinetochore protein CENP-N with the centromeric nucleosome containing CENP-A' EMD-7326 
'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6C0W 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhou, K.'      1 ? 
'Pentakota, S.' 2 ? 
'Vetter, I.R.'  3 ? 
'Morgan, G.P.'  4 ? 
'Petrovic, A.'  5 ? 
'Musacchio, A.' 6 ? 
'Luger, K.'     7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Decoding the centromeric nucleosome through CENP-N.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.33442 
_citation.pdbx_database_id_PubMed   29280735 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pentakota, S.' 1  ? 
primary 'Zhou, K.'      2  ? 
primary 'Smith, C.'     3  ? 
primary 'Maffini, S.'   4  ? 
primary 'Petrovic, A.'  5  ? 
primary 'Morgan, G.P.'  6  ? 
primary 'Weir, J.R.'    7  ? 
primary 'Vetter, I.R.'  8  ? 
primary 'Musacchio, A.' 9  ? 
primary 'Luger, K.'     10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6C0W 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6C0W 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3-like centromeric protein A' 16023.630 2 ? ? ? ? 
2 polymer man 'Histone H4'                            11337.374 2 ? ? ? ? 
3 polymer man 'Histone H2A'                           14135.523 2 ? ? ? ? 
4 polymer man 'Histone H2B'                           13937.213 2 ? ? ? ? 
5 polymer syn '147 mer DNA'                           45153.781 1 ? ? ? ? 
6 polymer syn '147 mer DNA'                           45594.043 1 ? ? ? ? 
7 polymer man 'Centromere protein N'                  34870.695 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Centromere autoantigen A,Centromere protein A,CENP-A'                                                                          
3 'Histone H2A/l'                                                                                                                 
4 'Histone H2B.1 A, Histone H2B.a, H2B/a, Histone H2B.g, H2B/g, Histone H2B.h, H2B/h, Histone H2B.k, H2B/k, Histone H2B.l, H2B/l' 
7 'CENP-N, Interphase centromere complex protein 32'                                                                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)
;
;ATCTGAGAATCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DA)(DT)(DT)
(DC)(DT)(DC)(DA)(DG)(DA)(DT)
;
;ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGATTCTCAGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQERSLGLDINMDSRIIHE
NIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEHHHHHH
;
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQERSLGLDINMDSRIIHE
NIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREEHHHHHH
;
K   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   PRO n 
1 4   ARG n 
1 5   ARG n 
1 6   ARG n 
1 7   SER n 
1 8   ARG n 
1 9   LYS n 
1 10  PRO n 
1 11  GLU n 
1 12  ALA n 
1 13  PRO n 
1 14  ARG n 
1 15  ARG n 
1 16  ARG n 
1 17  SER n 
1 18  PRO n 
1 19  SER n 
1 20  PRO n 
1 21  THR n 
1 22  PRO n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  PRO n 
1 27  SER n 
1 28  ARG n 
1 29  ARG n 
1 30  GLY n 
1 31  PRO n 
1 32  SER n 
1 33  LEU n 
1 34  GLY n 
1 35  ALA n 
1 36  SER n 
1 37  SER n 
1 38  HIS n 
1 39  GLN n 
1 40  HIS n 
1 41  SER n 
1 42  ARG n 
1 43  ARG n 
1 44  ARG n 
1 45  GLN n 
1 46  GLY n 
1 47  TRP n 
1 48  LEU n 
1 49  LYS n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  LYS n 
1 54  LEU n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  HIS n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  SER n 
1 69  ARG n 
1 70  LEU n 
1 71  ALA n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  CYS n 
1 76  VAL n 
1 77  LYS n 
1 78  PHE n 
1 79  THR n 
1 80  ARG n 
1 81  GLY n 
1 82  VAL n 
1 83  ASP n 
1 84  PHE n 
1 85  ASN n 
1 86  TRP n 
1 87  GLN n 
1 88  ALA n 
1 89  GLN n 
1 90  ALA n 
1 91  LEU n 
1 92  LEU n 
1 93  ALA n 
1 94  LEU n 
1 95  GLN n 
1 96  GLU n 
1 97  ALA n 
1 98  ALA n 
1 99  GLU n 
1 100 ALA n 
1 101 PHE n 
1 102 LEU n 
1 103 VAL n 
1 104 HIS n 
1 105 LEU n 
1 106 PHE n 
1 107 GLU n 
1 108 ASP n 
1 109 ALA n 
1 110 TYR n 
1 111 LEU n 
1 112 LEU n 
1 113 THR n 
1 114 LEU n 
1 115 HIS n 
1 116 ALA n 
1 117 GLY n 
1 118 ARG n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 PHE n 
1 123 PRO n 
1 124 LYS n 
1 125 ASP n 
1 126 VAL n 
1 127 GLN n 
1 128 LEU n 
1 129 ALA n 
1 130 ARG n 
1 131 ARG n 
1 132 ILE n 
1 133 ARG n 
1 134 GLY n 
1 135 LEU n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  ALA n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  SER n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  LEU n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  ILE n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 ARG n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 ALA n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 HIS n 
3 125 HIS n 
3 126 LYS n 
3 127 ALA n 
3 128 LYS n 
3 129 GLY n 
3 130 LYS n 
4 1   MET n 
4 2   PRO n 
4 3   GLU n 
4 4   PRO n 
4 5   ALA n 
4 6   LYS n 
4 7   SER n 
4 8   ALA n 
4 9   PRO n 
4 10  ALA n 
4 11  PRO n 
4 12  LYS n 
4 13  LYS n 
4 14  GLY n 
4 15  SER n 
4 16  LYS n 
4 17  LYS n 
4 18  ALA n 
4 19  VAL n 
4 20  THR n 
4 21  LYS n 
4 22  ALA n 
4 23  GLN n 
4 24  LYS n 
4 25  LYS n 
4 26  ASP n 
4 27  GLY n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  LYS n 
4 32  ARG n 
4 33  SER n 
4 34  ARG n 
4 35  LYS n 
4 36  GLU n 
4 37  SER n 
4 38  TYR n 
4 39  SER n 
4 40  VAL n 
4 41  TYR n 
4 42  VAL n 
4 43  TYR n 
4 44  LYS n 
4 45  VAL n 
4 46  LEU n 
4 47  LYS n 
4 48  GLN n 
4 49  VAL n 
4 50  HIS n 
4 51  PRO n 
4 52  ASP n 
4 53  THR n 
4 54  GLY n 
4 55  ILE n 
4 56  SER n 
4 57  SER n 
4 58  LYS n 
4 59  ALA n 
4 60  MET n 
4 61  GLY n 
4 62  ILE n 
4 63  MET n 
4 64  ASN n 
4 65  SER n 
4 66  PHE n 
4 67  VAL n 
4 68  ASN n 
4 69  ASP n 
4 70  ILE n 
4 71  PHE n 
4 72  GLU n 
4 73  ARG n 
4 74  ILE n 
4 75  ALA n 
4 76  GLY n 
4 77  GLU n 
4 78  ALA n 
4 79  SER n 
4 80  ARG n 
4 81  LEU n 
4 82  ALA n 
4 83  HIS n 
4 84  TYR n 
4 85  ASN n 
4 86  LYS n 
4 87  ARG n 
4 88  SER n 
4 89  THR n 
4 90  ILE n 
4 91  THR n 
4 92  SER n 
4 93  ARG n 
4 94  GLU n 
4 95  ILE n 
4 96  GLN n 
4 97  THR n 
4 98  ALA n 
4 99  VAL n 
4 100 ARG n 
4 101 LEU n 
4 102 LEU n 
4 103 LEU n 
4 104 PRO n 
4 105 GLY n 
4 106 GLU n 
4 107 LEU n 
4 108 ALA n 
4 109 LYS n 
4 110 HIS n 
4 111 ALA n 
4 112 VAL n 
4 113 SER n 
4 114 GLU n 
4 115 GLY n 
4 116 THR n 
4 117 LYS n 
4 118 ALA n 
4 119 VAL n 
4 120 THR n 
4 121 LYS n 
4 122 TYR n 
4 123 THR n 
4 124 SER n 
4 125 SER n 
4 126 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DG  n 
5 6   DA  n 
5 7   DG  n 
5 8   DA  n 
5 9   DA  n 
5 10  DT  n 
5 11  DC  n 
5 12  DC  n 
5 13  DG  n 
5 14  DG  n 
5 15  DT  n 
5 16  DG  n 
5 17  DC  n 
5 18  DC  n 
5 19  DG  n 
5 20  DA  n 
5 21  DG  n 
5 22  DG  n 
5 23  DC  n 
5 24  DC  n 
5 25  DG  n 
5 26  DC  n 
5 27  DT  n 
5 28  DC  n 
5 29  DA  n 
5 30  DA  n 
5 31  DT  n 
5 32  DT  n 
5 33  DG  n 
5 34  DG  n 
5 35  DT  n 
5 36  DC  n 
5 37  DG  n 
5 38  DT  n 
5 39  DA  n 
5 40  DG  n 
5 41  DA  n 
5 42  DC  n 
5 43  DA  n 
5 44  DG  n 
5 45  DC  n 
5 46  DT  n 
5 47  DC  n 
5 48  DT  n 
5 49  DA  n 
5 50  DG  n 
5 51  DC  n 
5 52  DA  n 
5 53  DC  n 
5 54  DC  n 
5 55  DG  n 
5 56  DC  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DC  n 
5 63  DG  n 
5 64  DC  n 
5 65  DA  n 
5 66  DC  n 
5 67  DG  n 
5 68  DT  n 
5 69  DA  n 
5 70  DC  n 
5 71  DG  n 
5 72  DC  n 
5 73  DG  n 
5 74  DC  n 
5 75  DT  n 
5 76  DG  n 
5 77  DT  n 
5 78  DC  n 
5 79  DC  n 
5 80  DC  n 
5 81  DC  n 
5 82  DC  n 
5 83  DG  n 
5 84  DC  n 
5 85  DG  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DC  n 
5 93  DC  n 
5 94  DG  n 
5 95  DC  n 
5 96  DC  n 
5 97  DA  n 
5 98  DA  n 
5 99  DG  n 
5 100 DG  n 
5 101 DG  n 
5 102 DG  n 
5 103 DA  n 
5 104 DT  n 
5 105 DT  n 
5 106 DA  n 
5 107 DC  n 
5 108 DT  n 
5 109 DC  n 
5 110 DC  n 
5 111 DC  n 
5 112 DT  n 
5 113 DA  n 
5 114 DG  n 
5 115 DT  n 
5 116 DC  n 
5 117 DT  n 
5 118 DC  n 
5 119 DC  n 
5 120 DA  n 
5 121 DG  n 
5 122 DG  n 
5 123 DC  n 
5 124 DA  n 
5 125 DC  n 
5 126 DG  n 
5 127 DT  n 
5 128 DG  n 
5 129 DT  n 
5 130 DC  n 
5 131 DA  n 
5 132 DG  n 
5 133 DA  n 
5 134 DT  n 
5 135 DA  n 
5 136 DT  n 
5 137 DA  n 
5 138 DT  n 
5 139 DA  n 
5 140 DC  n 
5 141 DA  n 
5 142 DT  n 
5 143 DC  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DG  n 
6 6   DA  n 
6 7   DT  n 
6 8   DG  n 
6 9   DT  n 
6 10  DA  n 
6 11  DT  n 
6 12  DA  n 
6 13  DT  n 
6 14  DA  n 
6 15  DT  n 
6 16  DC  n 
6 17  DT  n 
6 18  DG  n 
6 19  DA  n 
6 20  DC  n 
6 21  DA  n 
6 22  DC  n 
6 23  DG  n 
6 24  DT  n 
6 25  DG  n 
6 26  DC  n 
6 27  DC  n 
6 28  DT  n 
6 29  DG  n 
6 30  DG  n 
6 31  DA  n 
6 32  DG  n 
6 33  DA  n 
6 34  DC  n 
6 35  DT  n 
6 36  DA  n 
6 37  DG  n 
6 38  DG  n 
6 39  DG  n 
6 40  DA  n 
6 41  DG  n 
6 42  DT  n 
6 43  DA  n 
6 44  DA  n 
6 45  DT  n 
6 46  DC  n 
6 47  DC  n 
6 48  DC  n 
6 49  DC  n 
6 50  DT  n 
6 51  DT  n 
6 52  DG  n 
6 53  DG  n 
6 54  DC  n 
6 55  DG  n 
6 56  DG  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DA  n 
6 63  DC  n 
6 64  DG  n 
6 65  DC  n 
6 66  DG  n 
6 67  DG  n 
6 68  DG  n 
6 69  DG  n 
6 70  DG  n 
6 71  DA  n 
6 72  DC  n 
6 73  DA  n 
6 74  DG  n 
6 75  DC  n 
6 76  DG  n 
6 77  DC  n 
6 78  DG  n 
6 79  DT  n 
6 80  DA  n 
6 81  DC  n 
6 82  DG  n 
6 83  DT  n 
6 84  DG  n 
6 85  DC  n 
6 86  DG  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DG  n 
6 93  DC  n 
6 94  DG  n 
6 95  DG  n 
6 96  DT  n 
6 97  DG  n 
6 98  DC  n 
6 99  DT  n 
6 100 DA  n 
6 101 DG  n 
6 102 DA  n 
6 103 DG  n 
6 104 DC  n 
6 105 DT  n 
6 106 DG  n 
6 107 DT  n 
6 108 DC  n 
6 109 DT  n 
6 110 DA  n 
6 111 DC  n 
6 112 DG  n 
6 113 DA  n 
6 114 DC  n 
6 115 DC  n 
6 116 DA  n 
6 117 DA  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DA  n 
6 122 DG  n 
6 123 DC  n 
6 124 DG  n 
6 125 DG  n 
6 126 DC  n 
6 127 DC  n 
6 128 DT  n 
6 129 DC  n 
6 130 DG  n 
6 131 DG  n 
6 132 DC  n 
6 133 DA  n 
6 134 DC  n 
6 135 DC  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DT  n 
6 141 DC  n 
6 142 DT  n 
6 143 DC  n 
6 144 DA  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   MET n 
7 2   ASP n 
7 3   GLU n 
7 4   THR n 
7 5   VAL n 
7 6   ALA n 
7 7   GLU n 
7 8   PHE n 
7 9   ILE n 
7 10  LYS n 
7 11  ARG n 
7 12  THR n 
7 13  ILE n 
7 14  LEU n 
7 15  LYS n 
7 16  ILE n 
7 17  PRO n 
7 18  MET n 
7 19  ASN n 
7 20  GLU n 
7 21  LEU n 
7 22  THR n 
7 23  THR n 
7 24  ILE n 
7 25  LEU n 
7 26  LYS n 
7 27  ALA n 
7 28  TRP n 
7 29  ASP n 
7 30  PHE n 
7 31  LEU n 
7 32  SER n 
7 33  GLU n 
7 34  ASN n 
7 35  GLN n 
7 36  LEU n 
7 37  GLN n 
7 38  THR n 
7 39  VAL n 
7 40  ASN n 
7 41  PHE n 
7 42  ARG n 
7 43  GLN n 
7 44  ARG n 
7 45  LYS n 
7 46  GLU n 
7 47  SER n 
7 48  VAL n 
7 49  VAL n 
7 50  GLN n 
7 51  HIS n 
7 52  LEU n 
7 53  ILE n 
7 54  HIS n 
7 55  LEU n 
7 56  CYS n 
7 57  GLU n 
7 58  GLU n 
7 59  LYS n 
7 60  ARG n 
7 61  ALA n 
7 62  SER n 
7 63  ILE n 
7 64  SER n 
7 65  ASP n 
7 66  ALA n 
7 67  ALA n 
7 68  LEU n 
7 69  LEU n 
7 70  ASP n 
7 71  ILE n 
7 72  ILE n 
7 73  TYR n 
7 74  MET n 
7 75  GLN n 
7 76  PHE n 
7 77  HIS n 
7 78  GLN n 
7 79  HIS n 
7 80  GLN n 
7 81  LYS n 
7 82  VAL n 
7 83  TRP n 
7 84  ASP n 
7 85  VAL n 
7 86  PHE n 
7 87  GLN n 
7 88  MET n 
7 89  SER n 
7 90  LYS n 
7 91  GLY n 
7 92  PRO n 
7 93  GLY n 
7 94  GLU n 
7 95  ASP n 
7 96  VAL n 
7 97  ASP n 
7 98  LEU n 
7 99  PHE n 
7 100 ASP n 
7 101 MET n 
7 102 LYS n 
7 103 GLN n 
7 104 PHE n 
7 105 LYS n 
7 106 ASN n 
7 107 SER n 
7 108 PHE n 
7 109 LYS n 
7 110 LYS n 
7 111 ILE n 
7 112 LEU n 
7 113 GLN n 
7 114 ARG n 
7 115 ALA n 
7 116 LEU n 
7 117 LYS n 
7 118 ASN n 
7 119 VAL n 
7 120 THR n 
7 121 VAL n 
7 122 SER n 
7 123 PHE n 
7 124 ARG n 
7 125 GLU n 
7 126 THR n 
7 127 GLU n 
7 128 GLU n 
7 129 ASN n 
7 130 ALA n 
7 131 VAL n 
7 132 TRP n 
7 133 ILE n 
7 134 ARG n 
7 135 ILE n 
7 136 ALA n 
7 137 TRP n 
7 138 GLY n 
7 139 THR n 
7 140 GLN n 
7 141 TYR n 
7 142 THR n 
7 143 LYS n 
7 144 PRO n 
7 145 ASN n 
7 146 GLN n 
7 147 TYR n 
7 148 LYS n 
7 149 PRO n 
7 150 THR n 
7 151 TYR n 
7 152 VAL n 
7 153 VAL n 
7 154 TYR n 
7 155 TYR n 
7 156 SER n 
7 157 GLN n 
7 158 THR n 
7 159 PRO n 
7 160 TYR n 
7 161 ALA n 
7 162 PHE n 
7 163 THR n 
7 164 SER n 
7 165 SER n 
7 166 SER n 
7 167 MET n 
7 168 LEU n 
7 169 ARG n 
7 170 ARG n 
7 171 ASN n 
7 172 THR n 
7 173 PRO n 
7 174 LEU n 
7 175 LEU n 
7 176 GLY n 
7 177 GLN n 
7 178 ALA n 
7 179 LEU n 
7 180 THR n 
7 181 ILE n 
7 182 ALA n 
7 183 SER n 
7 184 LYS n 
7 185 HIS n 
7 186 HIS n 
7 187 GLN n 
7 188 ILE n 
7 189 VAL n 
7 190 LYS n 
7 191 MET n 
7 192 ASP n 
7 193 LEU n 
7 194 ARG n 
7 195 SER n 
7 196 ARG n 
7 197 TYR n 
7 198 LEU n 
7 199 ASP n 
7 200 SER n 
7 201 LEU n 
7 202 LYS n 
7 203 ALA n 
7 204 ILE n 
7 205 VAL n 
7 206 PHE n 
7 207 LYS n 
7 208 GLN n 
7 209 TYR n 
7 210 ASN n 
7 211 GLN n 
7 212 THR n 
7 213 PHE n 
7 214 GLU n 
7 215 THR n 
7 216 HIS n 
7 217 ASN n 
7 218 SER n 
7 219 THR n 
7 220 THR n 
7 221 PRO n 
7 222 LEU n 
7 223 GLN n 
7 224 GLU n 
7 225 ARG n 
7 226 SER n 
7 227 LEU n 
7 228 GLY n 
7 229 LEU n 
7 230 ASP n 
7 231 ILE n 
7 232 ASN n 
7 233 MET n 
7 234 ASP n 
7 235 SER n 
7 236 ARG n 
7 237 ILE n 
7 238 ILE n 
7 239 HIS n 
7 240 GLU n 
7 241 ASN n 
7 242 ILE n 
7 243 VAL n 
7 244 GLU n 
7 245 LYS n 
7 246 GLU n 
7 247 ARG n 
7 248 VAL n 
7 249 GLN n 
7 250 ARG n 
7 251 ILE n 
7 252 THR n 
7 253 GLN n 
7 254 GLU n 
7 255 THR n 
7 256 PHE n 
7 257 GLY n 
7 258 ASP n 
7 259 TYR n 
7 260 PRO n 
7 261 GLN n 
7 262 PRO n 
7 263 GLN n 
7 264 LEU n 
7 265 GLU n 
7 266 PHE n 
7 267 ALA n 
7 268 GLN n 
7 269 TYR n 
7 270 LYS n 
7 271 LEU n 
7 272 GLU n 
7 273 THR n 
7 274 LYS n 
7 275 PHE n 
7 276 LYS n 
7 277 SER n 
7 278 GLY n 
7 279 LEU n 
7 280 ASN n 
7 281 GLY n 
7 282 SER n 
7 283 ILE n 
7 284 LEU n 
7 285 ALA n 
7 286 GLU n 
7 287 ARG n 
7 288 GLU n 
7 289 GLU n 
7 290 HIS n 
7 291 HIS n 
7 292 HIS n 
7 293 HIS n 
7 294 HIS n 
7 295 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 140 Human ? CENPA ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 Human ? 'HIST1H2AC, H2AFL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli'                          562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 126 Human ? 
'HIST1H2BC, H2BFL, HIST1H2BE, H2BFH, HIST1H2BF, H2BFG, HIST1H2BG, H2BFA, HIST1H2BI, H2BFK' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? 
? ? ? ? 'Escherichia coli'                          562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 295 Human ? 'CENPN, C16orf60, ICEN32, BM-309' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Insect cell expression vector pTIE1'       266783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 147 'Escherichia coli' ? 885276 ? 
6 1 sample 1 147 'Escherichia coli' ? 885276 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CENPA_HUMAN P49450 ?        1 
;MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTR
GVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
;
1 
2 UNP H4_HUMAN    P62805 ?        2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFG
;
1 
3 UNP H2A1C_HUMAN Q93077 ?        3 
;MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
1 
4 UNP H2B1C_HUMAN P62807 ?        4 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
1 
5 PDB 6C0W        6C0W   ?        5 ? 1 
6 PDB 6C0W        6C0W   ?        6 ? 1 
7 UNP CENPN_HUMAN Q96H22 Q96H22-3 7 
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTFETHNSTTPLQERSLGLDINMDSRIIHE
NIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLNGSILAEREE
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6C0W A 1 ? 140 ? P49450 1   ? 140 ? 1   140 
2  2 6C0W B 1 ? 102 ? P62805 1   ? 102 ? 0   101 
3  3 6C0W C 1 ? 130 ? Q93077 1   ? 130 ? 0   129 
4  4 6C0W D 1 ? 126 ? P62807 1   ? 126 ? 0   125 
5  1 6C0W E 1 ? 140 ? P49450 1   ? 140 ? 1   140 
6  2 6C0W F 1 ? 102 ? P62805 1   ? 102 ? 0   101 
7  3 6C0W G 1 ? 130 ? Q93077 1   ? 130 ? 0   129 
8  4 6C0W H 1 ? 126 ? P62807 1   ? 126 ? 0   125 
9  5 6C0W I 1 ? 147 ? 6C0W   -73 ? 73  ? -73 73  
10 6 6C0W J 1 ? 147 ? 6C0W   -73 ? 73  ? -73 73  
11 7 6C0W K 1 ? 289 ? Q96H22 1   ? 289 ? 1   289 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
11 6C0W ASP K 84  ? UNP Q96H22 GLU 84 variant          84  1 
11 6C0W HIS K 290 ? UNP Q96H22 ?   ?  'expression tag' 290 2 
11 6C0W HIS K 291 ? UNP Q96H22 ?   ?  'expression tag' 291 3 
11 6C0W HIS K 292 ? UNP Q96H22 ?   ?  'expression tag' 292 4 
11 6C0W HIS K 293 ? UNP Q96H22 ?   ?  'expression tag' 293 5 
11 6C0W HIS K 294 ? UNP Q96H22 ?   ?  'expression tag' 294 6 
11 6C0W HIS K 295 ? UNP Q96H22 ?   ?  'expression tag' 295 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6C0W 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6C0W 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006  ? 13936 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.793  ? 20016 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 23.824 ? 7376  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.047  ? 2270  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006  ? 1559  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6C0W 
_struct.title                        
'Cryo-EM structure of human kinetochore protein CENP-N with the centromeric nucleosome containing CENP-A' 
_struct.pdbx_descriptor              
'Histone H3-like centromeric protein A, Histone H4, Histone H2A, Histone H2B, Centromere protein N/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6C0W 
_struct_keywords.text            'Nucleosome, CENP-A, kinetochore, CENP-N, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TRP A 47  ? GLN A 55  ? TRP A 47  GLN A 55  1 ? 9  
HELX_P HELX_P2  AA2 ARG A 63  ? VAL A 76  ? ARG A 63  VAL A 76  1 ? 14 
HELX_P HELX_P3  AA3 GLN A 89  ? LEU A 114 ? GLN A 89  LEU A 114 1 ? 26 
HELX_P HELX_P4  AA4 PHE A 122 ? GLN A 127 ? PHE A 122 GLN A 127 1 ? 6  
HELX_P HELX_P5  AA5 PRO B 33  ? GLY B 43  ? PRO B 32  GLY B 42  1 ? 11 
HELX_P HELX_P6  AA6 LEU B 50  ? ALA B 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P7  AA7 THR B 83  ? GLY B 95  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P8  AA8 SER C 17  ? GLY C 23  ? SER C 16  GLY C 22  1 ? 7  
HELX_P HELX_P9  AA9 VAL C 28  ? GLY C 38  ? VAL C 27  GLY C 37  1 ? 11 
HELX_P HELX_P10 AB1 GLY C 47  ? ASN C 74  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P11 AB2 ILE C 80  ? ASP C 91  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P12 AB3 ASP C 91  ? LEU C 98  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P13 AB4 TYR D 38  ? HIS D 50  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P14 AB5 LYS D 58  ? ASN D 68  ? LYS D 57  ASN D 67  1 ? 11 
HELX_P HELX_P15 AB6 ASP D 69  ? LEU D 81  ? ASP D 68  LEU D 80  1 ? 13 
HELX_P HELX_P16 AB7 THR D 91  ? LEU D 103 ? THR D 90  LEU D 102 1 ? 13 
HELX_P HELX_P17 AB8 PRO D 104 ? SER D 124 ? PRO D 103 SER D 123 1 ? 21 
HELX_P HELX_P18 AB9 GLY E 46  ? GLN E 55  ? GLY E 46  GLN E 55  1 ? 10 
HELX_P HELX_P19 AC1 ARG E 63  ? PHE E 78  ? ARG E 63  PHE E 78  1 ? 16 
HELX_P HELX_P20 AC2 GLN E 87  ? TYR E 110 ? GLN E 87  TYR E 110 1 ? 24 
HELX_P HELX_P21 AC3 LEU E 111 ? THR E 113 ? LEU E 111 THR E 113 5 ? 3  
HELX_P HELX_P22 AC4 PHE E 122 ? GLY E 134 ? PHE E 122 GLY E 134 1 ? 13 
HELX_P HELX_P23 AC5 THR F 31  ? GLY F 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P24 AC6 LEU F 50  ? ALA F 77  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P25 AC7 THR F 83  ? GLY F 95  ? THR F 82  GLY F 94  1 ? 13 
HELX_P HELX_P26 AC8 SER G 17  ? ALA G 22  ? SER G 16  ALA G 21  1 ? 6  
HELX_P HELX_P27 AC9 VAL G 28  ? LYS G 37  ? VAL G 27  LYS G 36  1 ? 10 
HELX_P HELX_P28 AD1 GLY G 47  ? ASN G 74  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P29 AD2 ILE G 80  ? ASP G 91  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P30 AD3 GLU G 92  ? LEU G 98  ? GLU G 91  LEU G 97  1 ? 7  
HELX_P HELX_P31 AD4 TYR H 38  ? HIS H 50  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P32 AD5 LYS H 58  ? ASN H 68  ? LYS H 57  ASN H 67  1 ? 11 
HELX_P HELX_P33 AD6 ASP H 69  ? ASN H 85  ? ASP H 68  ASN H 84  1 ? 17 
HELX_P HELX_P34 AD7 THR H 91  ? LEU H 103 ? THR H 90  LEU H 102 1 ? 13 
HELX_P HELX_P35 AD8 PRO H 104 ? SER H 124 ? PRO H 103 SER H 123 1 ? 21 
HELX_P HELX_P36 AD9 THR K 4   ? ILE K 16  ? THR K 4   ILE K 16  1 ? 13 
HELX_P HELX_P37 AE1 GLU K 20  ? ASP K 29  ? GLU K 20  ASP K 29  1 ? 10 
HELX_P HELX_P38 AE2 SER K 32  ? VAL K 39  ? SER K 32  VAL K 39  1 ? 8  
HELX_P HELX_P39 AE3 ARG K 44  ? LYS K 59  ? ARG K 44  LYS K 59  1 ? 16 
HELX_P HELX_P40 AE4 ILE K 63  ? GLN K 75  ? ILE K 63  GLN K 75  1 ? 13 
HELX_P HELX_P41 AE5 ASP K 100 ? LEU K 116 ? ASP K 100 LEU K 116 1 ? 17 
HELX_P HELX_P42 AE6 ASN K 171 ? SER K 183 ? ASN K 171 SER K 183 1 ? 13 
HELX_P HELX_P43 AE7 TYR K 197 ? ASN K 210 ? TYR K 197 ASN K 210 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 142 N3 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? I DA 6   N6 ? ? ? 1_555 J DT 142 O4 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DG 7   N1 ? ? ? 1_555 J DC 141 N3 ? ? I DG -67 J DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DG 7   N2 ? ? ? 1_555 J DC 141 O2 ? ? I DG -67 J DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DG 7   O6 ? ? ? 1_555 J DC 141 N4 ? ? I DG -67 J DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DA 8   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DA 8   N6 ? ? ? 1_555 J DT 140 O4 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DA 9   N1 ? ? ? 1_555 J DT 139 N3 ? ? I DA -65 J DT 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? I DA 9   N6 ? ? ? 1_555 J DT 139 O4 ? ? I DA -65 J DT 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DT 10  N3 ? ? ? 1_555 J DA 138 N1 ? ? I DT -64 J DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? I DT 10  O4 ? ? ? 1_555 J DA 138 N6 ? ? I DT -64 J DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DC 11  N3 ? ? ? 1_555 J DG 137 N1 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DC 11  N4 ? ? ? 1_555 J DG 137 O6 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 137 N2 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DC 12  N3 ? ? ? 1_555 J DG 136 N1 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DC 12  N4 ? ? ? 1_555 J DG 136 O6 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DC 12  O2 ? ? ? 1_555 J DG 136 N2 ? ? I DC -62 J DG 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 135 N3 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 135 O2 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 135 N4 ? ? I DG -61 J DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DG 14  N1 ? ? ? 1_555 J DC 134 N3 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 134 O2 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DG 14  O6 ? ? ? 1_555 J DC 134 N4 ? ? I DG -60 J DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 133 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 133 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DG 16  N1 ? ? ? 1_555 J DC 132 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? I DG 16  N2 ? ? ? 1_555 J DC 132 O2 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DG 16  O6 ? ? ? 1_555 J DC 132 N4 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 131 N1 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 131 O6 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 131 N2 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DC 18  N3 ? ? ? 1_555 J DG 130 N1 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DC 18  N4 ? ? ? 1_555 J DG 130 O6 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DC 18  O2 ? ? ? 1_555 J DG 130 N2 ? ? I DC -56 J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DG 19  N1 ? ? ? 1_555 J DC 129 N3 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 129 O2 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DG 19  O6 ? ? ? 1_555 J DC 129 N4 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DA 20  N1 ? ? ? 1_555 J DT 128 N3 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DA 20  N6 ? ? ? 1_555 J DT 128 O4 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 127 N3 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 127 O2 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 127 N4 ? ? I DG -53 J DC 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DG 22  N1 ? ? ? 1_555 J DC 126 N3 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DG 22  N2 ? ? ? 1_555 J DC 126 O2 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? I DG 22  O6 ? ? ? 1_555 J DC 126 N4 ? ? I DG -52 J DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 125 N1 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 125 O6 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 125 N2 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DC 24  N3 ? ? ? 1_555 J DG 124 N1 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DC 24  N4 ? ? ? 1_555 J DG 124 O6 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? I DC 24  O2 ? ? ? 1_555 J DG 124 N2 ? ? I DC -50 J DG 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? I DG 25  N1 ? ? ? 1_555 J DC 123 N3 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 123 O2 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? I DG 25  O6 ? ? ? 1_555 J DC 123 N4 ? ? I DG -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 122 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 122 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 122 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? I DT 27  N3 ? ? ? 1_555 J DA 121 N1 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? I DT 27  O4 ? ? ? 1_555 J DA 121 N6 ? ? I DT -47 J DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? I DC 28  N3 ? ? ? 1_555 J DG 120 N1 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? I DC 28  N4 ? ? ? 1_555 J DG 120 O6 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? I DC 28  O2 ? ? ? 1_555 J DG 120 N2 ? ? I DC -46 J DG 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 119 N3 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 119 O4 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 118 N3 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 118 O4 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 117 N1 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 117 N6 ? ? I DT -43 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? I DT 32  N3 ? ? ? 1_555 J DA 116 N1 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? I DT 32  O4 ? ? ? 1_555 J DA 116 N6 ? ? I DT -42 J DA 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 115 N3 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 115 O2 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 115 N4 ? ? I DG -41 J DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DC 114 N3 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? I DG 34  N2 ? ? ? 1_555 J DC 114 O2 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DC 114 N4 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 113 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? I DT 35  O4 ? ? ? 1_555 J DA 113 N6 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? I DC 36  N3 ? ? ? 1_555 J DG 112 N1 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? I DC 36  N4 ? ? ? 1_555 J DG 112 O6 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? I DC 36  O2 ? ? ? 1_555 J DG 112 N2 ? ? I DC -38 J DG 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 111 N3 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 111 O2 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 111 N4 ? ? I DG -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? I DT 38  N3 ? ? ? 1_555 J DA 110 N1 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? I DT 38  O4 ? ? ? 1_555 J DA 110 N6 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? I DA 39  N1 ? ? ? 1_555 J DT 109 N3 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? I DA 39  N6 ? ? ? 1_555 J DT 109 O4 ? ? I DA -35 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 108 N3 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 108 O2 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 108 N4 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? I DA 41  N1 ? ? ? 1_555 J DT 107 N3 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? I DA 41  N6 ? ? ? 1_555 J DT 107 O4 ? ? I DA -33 J DT 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? I DC 42  N3 ? ? ? 1_555 J DG 106 N1 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? I DC 42  N4 ? ? ? 1_555 J DG 106 O6 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? I DC 42  O2 ? ? ? 1_555 J DG 106 N2 ? ? I DC -32 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 105 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 105 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? I DG 44  N1 ? ? ? 1_555 J DC 104 N3 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 104 O2 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? I DG 44  O6 ? ? ? 1_555 J DC 104 N4 ? ? I DG -30 J DC 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? I DC 45  N3 ? ? ? 1_555 J DG 103 N1 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? I DC 45  N4 ? ? ? 1_555 J DG 103 O6 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? I DC 45  O2 ? ? ? 1_555 J DG 103 N2 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 102 N1 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 102 N6 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? I DC 47  N3 ? ? ? 1_555 J DG 101 N1 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? I DC 47  N4 ? ? ? 1_555 J DG 101 O6 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? I DC 47  O2 ? ? ? 1_555 J DG 101 N2 ? ? I DC -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? I DT 48  N3 ? ? ? 1_555 J DA 100 N1 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? I DT 48  O4 ? ? ? 1_555 J DA 100 N6 ? ? I DT -26 J DA 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? I DA 49  N1 ? ? ? 1_555 J DT 99  N3 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? I DA 49  N6 ? ? ? 1_555 J DT 99  O4 ? ? I DA -25 J DT 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? I DG 50  N1 ? ? ? 1_555 J DC 98  N3 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? I DG 50  N2 ? ? ? 1_555 J DC 98  O2 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? I DG 50  O6 ? ? ? 1_555 J DC 98  N4 ? ? I DG -24 J DC 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? I DC 51  N3 ? ? ? 1_555 J DG 97  N1 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? I DC 51  N4 ? ? ? 1_555 J DG 97  O6 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? I DC 51  O2 ? ? ? 1_555 J DG 97  N2 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? I DA 52  N1 ? ? ? 1_555 J DT 96  N3 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? I DA 52  N6 ? ? ? 1_555 J DT 96  O4 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 95  N1 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 95  O6 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 95  N2 ? ? I DC -21 J DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 94  N1 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 94  O6 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 94  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? I DG 55  N1 ? ? ? 1_555 J DC 93  N3 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 93  O2 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? I DG 55  O6 ? ? ? 1_555 J DC 93  N4 ? ? I DG -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? I DC 56  N3 ? ? ? 1_555 J DG 92  N1 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? I DC 56  N4 ? ? ? 1_555 J DG 92  O6 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? I DC 56  O2 ? ? ? 1_555 J DG 92  N2 ? ? I DC -18 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 90  N1 ? ? I DT -17 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 90  N6 ? ? I DT -17 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 91  N1 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 91  N6 ? ? I DT -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 90  N1 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 90  N6 ? ? I DT -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 89  N3 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 89  O4 ? ? I DA -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 88  N3 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 88  O4 ? ? I DA -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? I DA 61  N1 ? ? ? 1_555 J DT 87  N3 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? I DA 61  N6 ? ? ? 1_555 J DT 87  O4 ? ? I DA -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? I DC 62  N3 ? ? ? 1_555 J DG 86  N1 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? I DC 62  N4 ? ? ? 1_555 J DG 86  O6 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? I DC 62  O2 ? ? ? 1_555 J DG 86  N2 ? ? I DC -12 J DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 85  N3 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 85  O2 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 85  N4 ? ? I DG -11 J DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? I DC 64  N3 ? ? ? 1_555 J DG 84  N1 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? I DC 64  N4 ? ? ? 1_555 J DG 84  O6 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? I DC 64  O2 ? ? ? 1_555 J DG 84  N2 ? ? I DC -10 J DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? I DA 65  N1 ? ? ? 1_555 J DT 83  N3 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? I DA 65  N6 ? ? ? 1_555 J DT 83  O4 ? ? I DA -9  J DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? I DC 66  N3 ? ? ? 1_555 J DG 82  N1 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? I DC 66  N4 ? ? ? 1_555 J DG 82  O6 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? I DC 66  O2 ? ? ? 1_555 J DG 82  N2 ? ? I DC -8  J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DC 81  N3 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 81  O2 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DC 81  N4 ? ? I DG -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? I DT 68  N3 ? ? ? 1_555 J DA 80  N1 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? I DT 68  O4 ? ? ? 1_555 J DA 80  N6 ? ? I DT -6  J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? I DA 69  N1 ? ? ? 1_555 J DT 79  N3 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? I DA 69  N6 ? ? ? 1_555 J DT 79  O4 ? ? I DA -5  J DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? I DC 70  N3 ? ? ? 1_555 J DG 78  N1 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? I DC 70  N4 ? ? ? 1_555 J DG 78  O6 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? I DC 70  O2 ? ? ? 1_555 J DG 78  N2 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? I DG 71  N1 ? ? ? 1_555 J DC 77  N3 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? I DG 71  N2 ? ? ? 1_555 J DC 77  O2 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? I DG 71  O6 ? ? ? 1_555 J DC 77  N4 ? ? I DG -3  J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? I DC 72  N3 ? ? ? 1_555 J DG 76  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? I DC 72  N4 ? ? ? 1_555 J DG 76  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? I DC 72  O2 ? ? ? 1_555 J DG 76  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? I DG 73  N1 ? ? ? 1_555 J DC 75  N3 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? I DG 73  N2 ? ? ? 1_555 J DC 75  O2 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? I DG 73  O6 ? ? ? 1_555 J DC 75  N4 ? ? I DG -1  J DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? I DC 74  N3 ? ? ? 1_555 J DG 74  N1 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? I DC 74  N4 ? ? ? 1_555 J DG 74  O6 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? I DC 74  O2 ? ? ? 1_555 J DG 74  N2 ? ? I DC 0   J DG 0   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? I DT 75  N3 ? ? ? 1_555 J DA 73  N1 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? I DT 75  O4 ? ? ? 1_555 J DA 73  N6 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DA 71  N1 ? ? I DG 2   J DA -3  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog185 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DA 71  N6 ? ? I DG 2   J DA -3  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog186 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 72  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 72  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 72  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 71  N1 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 71  N6 ? ? I DT 3   J DA -3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? I DC 78  N3 ? ? ? 1_555 J DG 70  N1 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? I DC 78  N4 ? ? ? 1_555 J DG 70  O6 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? I DC 78  O2 ? ? ? 1_555 J DG 70  N2 ? ? I DC 4   J DG -4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 69  N1 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? I DC 79  N4 ? ? ? 1_555 J DG 69  O6 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 69  N2 ? ? I DC 5   J DG -5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? I DC 80  N3 ? ? ? 1_555 J DG 68  N1 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? I DC 80  N4 ? ? ? 1_555 J DG 68  O6 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? I DC 80  O2 ? ? ? 1_555 J DG 68  N2 ? ? I DC 6   J DG -6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 67  N1 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 67  O6 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 67  N2 ? ? I DC 7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? I DC 82  N3 ? ? ? 1_555 J DG 66  N1 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? I DC 82  N4 ? ? ? 1_555 J DG 66  O6 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? I DC 82  O2 ? ? ? 1_555 J DG 66  N2 ? ? I DC 8   J DG -8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? I DG 83  N1 ? ? ? 1_555 J DC 65  N3 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? I DG 83  N2 ? ? ? 1_555 J DC 65  O2 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? I DG 83  O6 ? ? ? 1_555 J DC 65  N4 ? ? I DG 9   J DC -9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? I DC 84  N3 ? ? ? 1_555 J DG 64  N1 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? I DC 84  N4 ? ? ? 1_555 J DG 64  O6 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? I DC 84  O2 ? ? ? 1_555 J DG 64  N2 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? I DG 85  N1 ? ? ? 1_555 J DC 63  N3 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? I DG 85  N2 ? ? ? 1_555 J DC 63  O2 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DC 63  N4 ? ? I DG 11  J DC -11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? I DT 86  N3 ? ? ? 1_555 J DA 62  N1 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? I DT 86  O4 ? ? ? 1_555 J DA 62  N6 ? ? I DT 12  J DA -12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 61  N1 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 61  N6 ? ? I DT 13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 60  N1 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 60  N6 ? ? I DT 14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 59  N1 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? I DT 89  O4 ? ? ? 1_555 J DA 59  N6 ? ? I DT 15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 58  N3 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 58  O4 ? ? I DA 16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DT 57  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DT 57  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? I DC 92  N3 ? ? ? 1_555 J DG 56  N1 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? I DC 92  N4 ? ? ? 1_555 J DG 56  O6 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? I DC 92  O2 ? ? ? 1_555 J DG 56  N2 ? ? I DC 18  J DG -18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? I DC 93  N3 ? ? ? 1_555 J DG 55  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? I DC 93  N4 ? ? ? 1_555 J DG 55  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? I DC 93  O2 ? ? ? 1_555 J DG 55  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? I DG 94  N1 ? ? ? 1_555 J DC 54  N3 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? I DG 94  N2 ? ? ? 1_555 J DC 54  O2 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? I DG 94  O6 ? ? ? 1_555 J DC 54  N4 ? ? I DG 20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 53  N1 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 53  O6 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 53  N2 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? I DC 96  N3 ? ? ? 1_555 J DG 52  N1 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? I DC 96  N4 ? ? ? 1_555 J DG 52  O6 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? I DC 96  O2 ? ? ? 1_555 J DG 52  N2 ? ? I DC 22  J DG -22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? I DA 97  N1 ? ? ? 1_555 J DT 51  N3 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? I DA 97  N6 ? ? ? 1_555 J DT 51  O4 ? ? I DA 23  J DT -23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? I DA 98  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? I DA 98  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 49  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 49  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 49  N4 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? I DG 100 N1 ? ? ? 1_555 J DC 48  N3 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 48  O2 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? I DG 100 O6 ? ? ? 1_555 J DC 48  N4 ? ? I DG 26  J DC -26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 47  O2 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? I DG 102 N1 ? ? ? 1_555 J DC 46  N3 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? I DG 102 N2 ? ? ? 1_555 J DC 46  O2 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? I DG 102 O6 ? ? ? 1_555 J DC 46  N4 ? ? I DG 28  J DC -28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? I DA 103 N1 ? ? ? 1_555 J DT 45  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? I DA 103 N6 ? ? ? 1_555 J DT 45  O4 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 44  N1 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 44  N6 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? I DT 105 N3 ? ? ? 1_555 J DA 43  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? I DT 105 O4 ? ? ? 1_555 J DA 43  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? I DA 106 N1 ? ? ? 1_555 J DT 42  N3 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? I DA 106 N6 ? ? ? 1_555 J DT 42  O4 ? ? I DA 32  J DT -32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? I DC 107 N3 ? ? ? 1_555 J DG 41  N1 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? I DC 107 N4 ? ? ? 1_555 J DG 41  O6 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? I DC 107 O2 ? ? ? 1_555 J DG 41  N2 ? ? I DC 33  J DG -33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? I DT 108 N3 ? ? ? 1_555 J DA 40  N1 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? I DT 108 O4 ? ? ? 1_555 J DA 40  N6 ? ? I DT 34  J DA -34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? I DC 109 N3 ? ? ? 1_555 J DG 39  N1 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? I DC 109 N4 ? ? ? 1_555 J DG 39  O6 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? I DC 109 O2 ? ? ? 1_555 J DG 39  N2 ? ? I DC 35  J DG -35 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? I DC 110 N3 ? ? ? 1_555 J DG 38  N1 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? I DC 110 N4 ? ? ? 1_555 J DG 38  O6 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? I DC 110 O2 ? ? ? 1_555 J DG 38  N2 ? ? I DC 36  J DG -36 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? I DC 111 N3 ? ? ? 1_555 J DG 37  N1 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? I DC 111 N4 ? ? ? 1_555 J DG 37  O6 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? I DC 111 O2 ? ? ? 1_555 J DG 37  N2 ? ? I DC 37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? I DT 112 N3 ? ? ? 1_555 J DA 36  N1 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? I DT 112 O4 ? ? ? 1_555 J DA 36  N6 ? ? I DT 38  J DA -38 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DT 35  N3 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? I DA 113 N6 ? ? ? 1_555 J DT 35  O4 ? ? I DA 39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? I DG 114 N1 ? ? ? 1_555 J DC 34  N3 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? I DG 114 N2 ? ? ? 1_555 J DC 34  O2 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? I DG 114 O6 ? ? ? 1_555 J DC 34  N4 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? I DT 115 N3 ? ? ? 1_555 J DA 33  N1 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? I DT 115 O4 ? ? ? 1_555 J DA 33  N6 ? ? I DT 41  J DA -41 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289 hydrog ? ? I DC 116 N3 ? ? ? 1_555 J DG 32  N1 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? I DC 116 N4 ? ? ? 1_555 J DG 32  O6 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? I DC 116 O2 ? ? ? 1_555 J DG 32  N2 ? ? I DC 42  J DG -42 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DA 31  N1 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DA 31  N6 ? ? I DT 43  J DA -43 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 30  N1 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 30  O6 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 30  N2 ? ? I DC 44  J DG -44 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297 hydrog ? ? I DC 119 N3 ? ? ? 1_555 J DG 29  N1 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? I DC 119 N4 ? ? ? 1_555 J DG 29  O6 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? I DC 119 O2 ? ? ? 1_555 J DG 29  N2 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300 hydrog ? ? I DA 120 N1 ? ? ? 1_555 J DT 28  N3 ? ? I DA 46  J DT -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? I DA 120 N6 ? ? ? 1_555 J DT 28  O4 ? ? I DA 46  J DT -46 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 27  N3 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 27  O2 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 27  N4 ? ? I DG 47  J DC -47 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 26  N3 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 26  O2 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 26  N4 ? ? I DG 48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308 hydrog ? ? I DC 123 N3 ? ? ? 1_555 J DG 25  N1 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? I DC 123 N4 ? ? ? 1_555 J DG 25  O6 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? I DC 123 O2 ? ? ? 1_555 J DG 25  N2 ? ? I DC 49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? I DA 124 N1 ? ? ? 1_555 J DT 24  N3 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312 hydrog ? ? I DA 124 N6 ? ? ? 1_555 J DT 24  O4 ? ? I DA 50  J DT -50 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? I DC 125 N3 ? ? ? 1_555 J DG 23  N1 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? I DC 125 N4 ? ? ? 1_555 J DG 23  O6 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? I DC 125 O2 ? ? ? 1_555 J DG 23  N2 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? I DG 126 N1 ? ? ? 1_555 J DC 22  N3 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? I DG 126 N2 ? ? ? 1_555 J DC 22  O2 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? I DG 126 O6 ? ? ? 1_555 J DC 22  N4 ? ? I DG 52  J DC -52 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? I DT 127 N3 ? ? ? 1_555 J DA 21  N1 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320 hydrog ? ? I DT 127 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? I DG 128 N1 ? ? ? 1_555 J DC 20  N3 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 20  O2 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? I DG 128 O6 ? ? ? 1_555 J DC 20  N4 ? ? I DG 54  J DC -54 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324 hydrog ? ? I DT 129 N3 ? ? ? 1_555 J DA 19  N1 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325 hydrog ? ? I DT 129 O4 ? ? ? 1_555 J DA 19  N6 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? I DC 130 N3 ? ? ? 1_555 J DG 18  N1 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327 hydrog ? ? I DC 130 N4 ? ? ? 1_555 J DG 18  O6 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? I DC 130 O2 ? ? ? 1_555 J DG 18  N2 ? ? I DC 56  J DG -56 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? I DA 131 N1 ? ? ? 1_555 J DT 17  N3 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? I DA 131 N6 ? ? ? 1_555 J DT 17  O4 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? I DG 132 N1 ? ? ? 1_555 J DC 16  N3 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? I DG 132 N2 ? ? ? 1_555 J DC 16  O2 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333 hydrog ? ? I DG 132 O6 ? ? ? 1_555 J DC 16  N4 ? ? I DG 58  J DC -58 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334 hydrog ? ? I DA 133 N1 ? ? ? 1_555 J DT 15  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335 hydrog ? ? I DA 133 N6 ? ? ? 1_555 J DT 15  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336 hydrog ? ? I DT 134 N3 ? ? ? 1_555 J DA 14  N1 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337 hydrog ? ? I DT 134 O4 ? ? ? 1_555 J DA 14  N6 ? ? I DT 60  J DA -60 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338 hydrog ? ? I DA 135 N1 ? ? ? 1_555 J DT 13  N3 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339 hydrog ? ? I DA 135 N6 ? ? ? 1_555 J DT 13  O4 ? ? I DA 61  J DT -61 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340 hydrog ? ? I DT 136 N3 ? ? ? 1_555 J DA 12  N1 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341 hydrog ? ? I DT 136 O4 ? ? ? 1_555 J DA 12  N6 ? ? I DT 62  J DA -62 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DT 11  N3 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DT 11  O4 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344 hydrog ? ? I DT 138 N3 ? ? ? 1_555 J DA 10  N1 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345 hydrog ? ? I DT 138 O4 ? ? ? 1_555 J DA 10  N6 ? ? I DT 64  J DA -64 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346 hydrog ? ? I DA 139 N1 ? ? ? 1_555 J DT 9   N3 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347 hydrog ? ? I DA 139 N6 ? ? ? 1_555 J DT 9   O4 ? ? I DA 65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348 hydrog ? ? I DC 140 N3 ? ? ? 1_555 J DG 8   N1 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349 hydrog ? ? I DC 140 N4 ? ? ? 1_555 J DG 8   O6 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350 hydrog ? ? I DC 140 O2 ? ? ? 1_555 J DG 8   N2 ? ? I DC 66  J DG -66 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351 hydrog ? ? I DA 141 N1 ? ? ? 1_555 J DT 7   N3 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352 hydrog ? ? I DA 141 N6 ? ? ? 1_555 J DT 7   O4 ? ? I DA 67  J DT -67 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 6   N1 ? ? I DT 68  J DA -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 6   N6 ? ? I DT 68  J DA -68 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355 hydrog ? ? I DC 143 N3 ? ? ? 1_555 J DG 5   N1 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356 hydrog ? ? I DC 143 N4 ? ? ? 1_555 J DG 5   O6 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog357 hydrog ? ? I DC 143 O2 ? ? ? 1_555 J DG 5   N2 ? ? I DC 69  J DG -69 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 85  ? TRP A 86  ? ASN A 85  TRP A 86  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR A 120 ? LEU A 121 ? THR A 120 LEU A 121 
AA2 2 ARG B 46  ? ILE B 47  ? ARG B 45  ILE B 46  
AA3 1 THR B 97  ? LEU B 98  ? THR B 96  LEU B 97  
AA3 2 VAL G 101 ? THR G 102 ? VAL G 100 THR G 101 
AA4 1 ARG C 78  ? ILE C 79  ? ARG C 77  ILE C 78  
AA4 2 GLY D 54  ? ILE D 55  ? GLY D 53  ILE D 54  
AA5 1 VAL C 101 ? THR C 102 ? VAL C 100 THR C 101 
AA5 2 THR F 97  ? LEU F 98  ? THR F 96  LEU F 97  
AA6 1 ASN E 85  ? TRP E 86  ? ASN E 85  TRP E 86  
AA6 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA7 1 ARG G 43  ? VAL G 44  ? ARG G 42  VAL G 43  
AA7 2 THR H 89  ? ILE H 90  ? THR H 88  ILE H 89  
AA8 1 ARG G 78  ? ILE G 79  ? ARG G 77  ILE G 78  
AA8 2 GLY H 54  ? ILE H 55  ? GLY H 53  ILE H 54  
AA9 1 THR K 120 ? SER K 122 ? THR K 120 SER K 122 
AA9 2 ALA K 130 ? ALA K 136 ? ALA K 130 ALA K 136 
AA9 3 GLU K 125 ? THR K 126 ? GLU K 125 THR K 126 
AB1 1 THR K 120 ? SER K 122 ? THR K 120 SER K 122 
AB1 2 ALA K 130 ? ALA K 136 ? ALA K 130 ALA K 136 
AB1 3 THR K 150 ? TYR K 155 ? THR K 150 TYR K 155 
AB1 4 TYR K 160 ? SER K 164 ? TYR K 160 SER K 164 
AB1 5 TRP K 83  ? SER K 89  ? TRP K 83  SER K 89  
AB1 6 GLN K 187 ? SER K 195 ? GLN K 187 SER K 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 85  ? N ASN A 85  O VAL B 82  ? O VAL B 81  
AA2 1 2 N LEU A 121 ? N LEU A 121 O ARG B 46  ? O ARG B 45  
AA3 1 2 N THR B 97  ? N THR B 96  O THR G 102 ? O THR G 101 
AA4 1 2 N ILE C 79  ? N ILE C 78  O GLY D 54  ? O GLY D 53  
AA5 1 2 N THR C 102 ? N THR C 101 O THR F 97  ? O THR F 96  
AA6 1 2 N ASN E 85  ? N ASN E 85  O VAL F 82  ? O VAL F 81  
AA7 1 2 N ARG G 43  ? N ARG G 42  O ILE H 90  ? O ILE H 89  
AA8 1 2 N ILE G 79  ? N ILE G 78  O GLY H 54  ? O GLY H 53  
AA9 1 2 N THR K 120 ? N THR K 120 O ALA K 136 ? O ALA K 136 
AA9 2 3 O ALA K 130 ? O ALA K 130 N THR K 126 ? N THR K 126 
AB1 1 2 N THR K 120 ? N THR K 120 O ALA K 136 ? O ALA K 136 
AB1 2 3 N ILE K 133 ? N ILE K 133 O VAL K 152 ? O VAL K 152 
AB1 3 4 N VAL K 153 ? N VAL K 153 O PHE K 162 ? O PHE K 162 
AB1 4 5 O THR K 163 ? O THR K 163 N ASP K 84  ? N ASP K 84  
AB1 5 6 N TRP K 83  ? N TRP K 83  O SER K 195 ? O SER K 195 
# 
_atom_sites.entry_id                    6C0W 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . GLY A 1 46  ? 68.807  75.431  116.141 1.00 65.68  ?  46  GLY A N     1 
ATOM 2     C CA    . GLY A 1 46  ? 70.089  76.107  116.209 1.00 65.68  ?  46  GLY A CA    1 
ATOM 3     C C     . GLY A 1 46  ? 70.434  76.866  114.944 1.00 65.68  ?  46  GLY A C     1 
ATOM 4     O O     . GLY A 1 46  ? 70.317  78.089  114.891 1.00 65.68  ?  46  GLY A O     1 
ATOM 5     N N     . TRP A 1 47  ? 70.864  76.132  113.916 1.00 63.54  ?  47  TRP A N     1 
ATOM 6     C CA    . TRP A 1 47  ? 71.203  76.750  112.640 1.00 63.54  ?  47  TRP A CA    1 
ATOM 7     C C     . TRP A 1 47  ? 69.974  77.143  111.841 1.00 63.54  ?  47  TRP A C     1 
ATOM 8     O O     . TRP A 1 47  ? 70.097  77.901  110.875 1.00 63.54  ?  47  TRP A O     1 
ATOM 9     C CB    . TRP A 1 47  ? 72.040  75.795  111.796 1.00 63.54  ?  47  TRP A CB    1 
ATOM 10    C CG    . TRP A 1 47  ? 71.299  74.550  111.438 1.00 63.54  ?  47  TRP A CG    1 
ATOM 11    C CD1   . TRP A 1 47  ? 70.549  74.324  110.317 1.00 63.54  ?  47  TRP A CD1   1 
ATOM 12    C CD2   . TRP A 1 47  ? 71.215  73.364  112.220 1.00 63.54  ?  47  TRP A CD2   1 
ATOM 13    N NE1   . TRP A 1 47  ? 70.013  73.064  110.354 1.00 63.54  ?  47  TRP A NE1   1 
ATOM 14    C CE2   . TRP A 1 47  ? 70.408  72.453  111.513 1.00 63.54  ?  47  TRP A CE2   1 
ATOM 15    C CE3   . TRP A 1 47  ? 71.751  72.978  113.450 1.00 63.54  ?  47  TRP A CE3   1 
ATOM 16    C CZ2   . TRP A 1 47  ? 70.125  71.181  111.995 1.00 63.54  ?  47  TRP A CZ2   1 
ATOM 17    C CZ3   . TRP A 1 47  ? 71.469  71.717  113.928 1.00 63.54  ?  47  TRP A CZ3   1 
ATOM 18    C CH2   . TRP A 1 47  ? 70.663  70.832  113.203 1.00 63.54  ?  47  TRP A CH2   1 
ATOM 19    N N     . LEU A 1 48  ? 68.806  76.611  112.197 1.00 67.45  ?  48  LEU A N     1 
ATOM 20    C CA    . LEU A 1 48  ? 67.637  76.716  111.338 1.00 67.45  ?  48  LEU A CA    1 
ATOM 21    C C     . LEU A 1 48  ? 67.048  78.117  111.349 1.00 67.45  ?  48  LEU A C     1 
ATOM 22    O O     . LEU A 1 48  ? 66.362  78.494  110.395 1.00 67.45  ?  48  LEU A O     1 
ATOM 23    C CB    . LEU A 1 48  ? 66.616  75.660  111.769 1.00 67.45  ?  48  LEU A CB    1 
ATOM 24    C CG    . LEU A 1 48  ? 65.416  75.236  110.915 1.00 67.45  ?  48  LEU A CG    1 
ATOM 25    C CD1   . LEU A 1 48  ? 64.189  76.116  111.093 1.00 67.45  ?  48  LEU A CD1   1 
ATOM 26    C CD2   . LEU A 1 48  ? 65.830  75.196  109.459 1.00 67.45  ?  48  LEU A CD2   1 
ATOM 27    N N     . LYS A 1 49  ? 67.320  78.904  112.386 1.00 79.81  ?  49  LYS A N     1 
ATOM 28    C CA    . LYS A 1 49  ? 66.963  80.315  112.366 1.00 79.81  ?  49  LYS A CA    1 
ATOM 29    C C     . LYS A 1 49  ? 67.968  81.153  111.592 1.00 79.81  ?  49  LYS A C     1 
ATOM 30    O O     . LYS A 1 49  ? 67.697  82.327  111.323 1.00 79.81  ?  49  LYS A O     1 
ATOM 31    C CB    . LYS A 1 49  ? 66.846  80.854  113.792 1.00 79.81  ?  49  LYS A CB    1 
ATOM 32    C CG    . LYS A 1 49  ? 65.859  80.094  114.651 1.00 79.81  ?  49  LYS A CG    1 
ATOM 33    C CD    . LYS A 1 49  ? 64.452  80.220  114.108 1.00 79.81  ?  49  LYS A CD    1 
ATOM 34    C CE    . LYS A 1 49  ? 63.446  79.557  115.031 1.00 79.81  ?  49  LYS A CE    1 
ATOM 35    N NZ    . LYS A 1 49  ? 63.577  78.074  115.036 1.00 79.81  1  49  LYS A NZ    1 
ATOM 36    N N     . GLU A 1 50  ? 69.114  80.578  111.233 1.00 69.45  ?  50  GLU A N     1 
ATOM 37    C CA    . GLU A 1 50  ? 70.162  81.288  110.516 1.00 69.45  ?  50  GLU A CA    1 
ATOM 38    C C     . GLU A 1 50  ? 70.014  81.153  109.007 1.00 69.45  ?  50  GLU A C     1 
ATOM 39    O O     . GLU A 1 50  ? 70.292  82.106  108.273 1.00 69.45  ?  50  GLU A O     1 
ATOM 40    C CB    . GLU A 1 50  ? 71.531  80.770  110.957 1.00 69.45  ?  50  GLU A CB    1 
ATOM 41    C CG    . GLU A 1 50  ? 72.710  81.556  110.417 1.00 69.45  ?  50  GLU A CG    1 
ATOM 42    C CD    . GLU A 1 50  ? 74.042  81.008  110.895 1.00 69.45  ?  50  GLU A CD    1 
ATOM 43    O OE1   . GLU A 1 50  ? 74.041  79.980  111.603 1.00 69.45  ?  50  GLU A OE1   1 
ATOM 44    O OE2   . GLU A 1 50  ? 75.089  81.606  110.570 1.00 69.45  -1 50  GLU A OE2   1 
ATOM 45    N N     . ILE A 1 51  ? 69.581  79.982  108.533 1.00 57.26  ?  51  ILE A N     1 
ATOM 46    C CA    . ILE A 1 51  ? 69.376  79.780  107.103 1.00 57.26  ?  51  ILE A CA    1 
ATOM 47    C C     . ILE A 1 51  ? 68.211  80.624  106.606 1.00 57.26  ?  51  ILE A C     1 
ATOM 48    O O     . ILE A 1 51  ? 68.342  81.384  105.639 1.00 57.26  ?  51  ILE A O     1 
ATOM 49    C CB    . ILE A 1 51  ? 69.155  78.291  106.799 1.00 57.26  ?  51  ILE A CB    1 
ATOM 50    C CG1   . ILE A 1 51  ? 70.408  77.493  107.127 1.00 57.26  ?  51  ILE A CG1   1 
ATOM 51    C CG2   . ILE A 1 51  ? 68.771  78.092  105.351 1.00 57.26  ?  51  ILE A CG2   1 
ATOM 52    C CD1   . ILE A 1 51  ? 70.182  76.011  107.097 1.00 57.26  ?  51  ILE A CD1   1 
ATOM 53    N N     . ARG A 1 52  ? 67.067  80.544  107.290 1.00 63.34  ?  52  ARG A N     1 
ATOM 54    C CA    . ARG A 1 52  ? 65.867  81.241  106.844 1.00 63.34  ?  52  ARG A CA    1 
ATOM 55    C C     . ARG A 1 52  ? 65.942  82.748  107.033 1.00 63.34  ?  52  ARG A C     1 
ATOM 56    O O     . ARG A 1 52  ? 65.026  83.451  106.596 1.00 63.34  ?  52  ARG A O     1 
ATOM 57    C CB    . ARG A 1 52  ? 64.635  80.702  107.567 1.00 63.34  ?  52  ARG A CB    1 
ATOM 58    C CG    . ARG A 1 52  ? 64.274  79.292  107.165 1.00 63.34  ?  52  ARG A CG    1 
ATOM 59    C CD    . ARG A 1 52  ? 62.941  78.848  107.749 1.00 63.34  ?  52  ARG A CD    1 
ATOM 60    N NE    . ARG A 1 52  ? 62.983  78.660  109.196 1.00 63.34  ?  52  ARG A NE    1 
ATOM 61    C CZ    . ARG A 1 52  ? 62.278  79.374  110.067 1.00 63.34  ?  52  ARG A CZ    1 
ATOM 62    N NH1   . ARG A 1 52  ? 61.464  80.329  109.639 1.00 63.34  1  52  ARG A NH1   1 
ATOM 63    N NH2   . ARG A 1 52  ? 62.378  79.129  111.363 1.00 63.34  ?  52  ARG A NH2   1 
ATOM 64    N N     . LYS A 1 53  ? 66.988  83.258  107.672 1.00 59.79  ?  53  LYS A N     1 
ATOM 65    C CA    . LYS A 1 53  ? 67.252  84.685  107.652 1.00 59.79  ?  53  LYS A CA    1 
ATOM 66    C C     . LYS A 1 53  ? 68.120  85.078  106.466 1.00 59.79  ?  53  LYS A C     1 
ATOM 67    O O     . LYS A 1 53  ? 67.958  86.176  105.924 1.00 59.79  ?  53  LYS A O     1 
ATOM 68    C CB    . LYS A 1 53  ? 67.910  85.106  108.972 1.00 59.79  ?  53  LYS A CB    1 
ATOM 69    C CG    . LYS A 1 53  ? 68.062  86.607  109.179 1.00 59.79  ?  53  LYS A CG    1 
ATOM 70    C CD    . LYS A 1 53  ? 69.488  87.073  108.944 1.00 59.79  ?  53  LYS A CD    1 
ATOM 71    C CE    . LYS A 1 53  ? 69.616  88.565  109.165 1.00 59.79  ?  53  LYS A CE    1 
ATOM 72    N NZ    . LYS A 1 53  ? 69.355  88.922  110.582 1.00 59.79  1  53  LYS A NZ    1 
ATOM 73    N N     . LEU A 1 54  ? 69.023  84.197  106.034 1.00 55.92  ?  54  LEU A N     1 
ATOM 74    C CA    . LEU A 1 54  ? 69.952  84.536  104.967 1.00 55.92  ?  54  LEU A CA    1 
ATOM 75    C C     . LEU A 1 54  ? 69.416  84.230  103.580 1.00 55.92  ?  54  LEU A C     1 
ATOM 76    O O     . LEU A 1 54  ? 69.886  84.829  102.607 1.00 55.92  ?  54  LEU A O     1 
ATOM 77    C CB    . LEU A 1 54  ? 71.283  83.814  105.172 1.00 55.92  ?  54  LEU A CB    1 
ATOM 78    C CG    . LEU A 1 54  ? 72.051  84.331  106.384 1.00 55.92  ?  54  LEU A CG    1 
ATOM 79    C CD1   . LEU A 1 54  ? 73.309  83.526  106.602 1.00 55.92  ?  54  LEU A CD1   1 
ATOM 80    C CD2   . LEU A 1 54  ? 72.378  85.799  106.206 1.00 55.92  ?  54  LEU A CD2   1 
ATOM 81    N N     . GLN A 1 55  ? 68.446  83.332  103.457 1.00 53.39  ?  55  GLN A N     1 
ATOM 82    C CA    . GLN A 1 55  ? 67.761  83.127  102.190 1.00 53.39  ?  55  GLN A CA    1 
ATOM 83    C C     . GLN A 1 55  ? 66.597  84.085  102.002 1.00 53.39  ?  55  GLN A C     1 
ATOM 84    O O     . GLN A 1 55  ? 65.767  83.871  101.115 1.00 53.39  ?  55  GLN A O     1 
ATOM 85    C CB    . GLN A 1 55  ? 67.276  81.685  102.077 1.00 53.39  ?  55  GLN A CB    1 
ATOM 86    C CG    . GLN A 1 55  ? 68.397  80.679  101.994 1.00 53.39  ?  55  GLN A CG    1 
ATOM 87    C CD    . GLN A 1 55  ? 67.897  79.259  101.879 1.00 53.39  ?  55  GLN A CD    1 
ATOM 88    O OE1   . GLN A 1 55  ? 66.696  79.007  101.910 1.00 53.39  ?  55  GLN A OE1   1 
ATOM 89    N NE2   . GLN A 1 55  ? 68.820  78.318  101.747 1.00 53.39  ?  55  GLN A NE2   1 
ATOM 90    N N     . LYS A 1 56  ? 66.512  85.125  102.822 1.00 52.53  ?  56  LYS A N     1 
ATOM 91    C CA    . LYS A 1 56  ? 65.529  86.186  102.677 1.00 52.53  ?  56  LYS A CA    1 
ATOM 92    C C     . LYS A 1 56  ? 66.145  87.497  102.227 1.00 52.53  ?  56  LYS A C     1 
ATOM 93    O O     . LYS A 1 56  ? 65.591  88.167  101.354 1.00 52.53  ?  56  LYS A O     1 
ATOM 94    C CB    . LYS A 1 56  ? 64.791  86.401  104.002 1.00 52.53  ?  56  LYS A CB    1 
ATOM 95    C CG    . LYS A 1 56  ? 63.647  87.393  103.935 1.00 52.53  ?  56  LYS A CG    1 
ATOM 96    C CD    . LYS A 1 56  ? 63.020  87.588  105.301 1.00 52.53  ?  56  LYS A CD    1 
ATOM 97    C CE    . LYS A 1 56  ? 62.208  86.370  105.705 1.00 52.53  ?  56  LYS A CE    1 
ATOM 98    N NZ    . LYS A 1 56  ? 61.491  86.584  106.990 1.00 52.53  1  56  LYS A NZ    1 
ATOM 99    N N     . SER A 1 57  ? 67.293  87.870  102.785 1.00 56.40  ?  57  SER A N     1 
ATOM 100   C CA    . SER A 1 57  ? 67.936  89.126  102.437 1.00 56.40  ?  57  SER A CA    1 
ATOM 101   C C     . SER A 1 57  ? 68.641  89.009  101.090 1.00 56.40  ?  57  SER A C     1 
ATOM 102   O O     . SER A 1 57  ? 68.646  87.960  100.443 1.00 56.40  ?  57  SER A O     1 
ATOM 103   C CB    . SER A 1 57  ? 68.920  89.539  103.527 1.00 56.40  ?  57  SER A CB    1 
ATOM 104   O OG    . SER A 1 57  ? 70.010  88.638  103.586 1.00 56.40  ?  57  SER A OG    1 
ATOM 105   N N     . THR A 1 58  ? 69.260  90.105  100.666 1.00 48.03  ?  58  THR A N     1 
ATOM 106   C CA    . THR A 1 58  ? 69.896  90.146  99.362  1.00 48.03  ?  58  THR A CA    1 
ATOM 107   C C     . THR A 1 58  ? 71.254  90.827  99.352  1.00 48.03  ?  58  THR A C     1 
ATOM 108   O O     . THR A 1 58  ? 71.872  90.896  98.287  1.00 48.03  ?  58  THR A O     1 
ATOM 109   C CB    . THR A 1 58  ? 68.982  90.850  98.355  1.00 48.03  ?  58  THR A CB    1 
ATOM 110   O OG1   . THR A 1 58  ? 69.577  90.797  97.055  1.00 48.03  ?  58  THR A OG1   1 
ATOM 111   C CG2   . THR A 1 58  ? 68.772  92.294  98.758  1.00 48.03  ?  58  THR A CG2   1 
ATOM 112   N N     . HIS A 1 59  ? 71.738  91.325  100.483 1.00 50.72  ?  59  HIS A N     1 
ATOM 113   C CA    . HIS A 1 59  ? 72.958  92.112  100.497 1.00 50.72  ?  59  HIS A CA    1 
ATOM 114   C C     . HIS A 1 59  ? 74.185  91.221  100.333 1.00 50.72  ?  59  HIS A C     1 
ATOM 115   O O     . HIS A 1 59  ? 74.111  89.991  100.378 1.00 50.72  ?  59  HIS A O     1 
ATOM 116   C CB    . HIS A 1 59  ? 73.061  92.911  101.791 1.00 50.72  ?  59  HIS A CB    1 
ATOM 117   C CG    . HIS A 1 59  ? 73.125  92.059  103.017 1.00 50.72  ?  59  HIS A CG    1 
ATOM 118   N ND1   . HIS A 1 59  ? 74.310  91.578  103.528 1.00 50.72  ?  59  HIS A ND1   1 
ATOM 119   C CD2   . HIS A 1 59  ? 72.148  91.591  103.827 1.00 50.72  ?  59  HIS A CD2   1 
ATOM 120   C CE1   . HIS A 1 59  ? 74.061  90.856  104.605 1.00 50.72  ?  59  HIS A CE1   1 
ATOM 121   N NE2   . HIS A 1 59  ? 72.756  90.848  104.808 1.00 50.72  ?  59  HIS A NE2   1 
ATOM 122   N N     . LEU A 1 60  ? 75.328  91.869  100.145 1.00 49.82  ?  60  LEU A N     1 
ATOM 123   C CA    . LEU A 1 60  ? 76.583  91.161  99.958  1.00 49.82  ?  60  LEU A CA    1 
ATOM 124   C C     . LEU A 1 60  ? 77.064  90.557  101.269 1.00 49.82  ?  60  LEU A C     1 
ATOM 125   O O     . LEU A 1 60  ? 76.796  91.075  102.355 1.00 49.82  ?  60  LEU A O     1 
ATOM 126   C CB    . LEU A 1 60  ? 77.639  92.108  99.403  1.00 49.82  ?  60  LEU A CB    1 
ATOM 127   C CG    . LEU A 1 60  ? 77.302  92.585  97.995  1.00 49.82  ?  60  LEU A CG    1 
ATOM 128   C CD1   . LEU A 1 60  ? 78.246  93.689  97.552  1.00 49.82  ?  60  LEU A CD1   1 
ATOM 129   C CD2   . LEU A 1 60  ? 77.359  91.414  97.043  1.00 49.82  ?  60  LEU A CD2   1 
ATOM 130   N N     . LEU A 1 61  ? 77.784  89.445  101.156 1.00 52.40  ?  61  LEU A N     1 
ATOM 131   C CA    . LEU A 1 61  ? 78.279  88.719  102.316 1.00 52.40  ?  61  LEU A CA    1 
ATOM 132   C C     . LEU A 1 61  ? 79.781  88.857  102.490 1.00 52.40  ?  61  LEU A C     1 
ATOM 133   O O     . LEU A 1 61  ? 80.255  89.123  103.597 1.00 52.40  ?  61  LEU A O     1 
ATOM 134   C CB    . LEU A 1 61  ? 77.894  87.242  102.204 1.00 52.40  ?  61  LEU A CB    1 
ATOM 135   C CG    . LEU A 1 61  ? 76.384  87.012  102.208 1.00 52.40  ?  61  LEU A CG    1 
ATOM 136   C CD1   . LEU A 1 61  ? 76.070  85.544  102.051 1.00 52.40  ?  61  LEU A CD1   1 
ATOM 137   C CD2   . LEU A 1 61  ? 75.765  87.556  103.473 1.00 52.40  ?  61  LEU A CD2   1 
ATOM 138   N N     . ILE A 1 62  ? 80.545  88.672  101.419 1.00 48.25  ?  62  ILE A N     1 
ATOM 139   C CA    . ILE A 1 62  ? 81.961  88.995  101.446 1.00 48.25  ?  62  ILE A CA    1 
ATOM 140   C C     . ILE A 1 62  ? 82.112  90.508  101.482 1.00 48.25  ?  62  ILE A C     1 
ATOM 141   O O     . ILE A 1 62  ? 81.490  91.222  100.687 1.00 48.25  ?  62  ILE A O     1 
ATOM 142   C CB    . ILE A 1 62  ? 82.665  88.386  100.227 1.00 48.25  ?  62  ILE A CB    1 
ATOM 143   C CG1   . ILE A 1 62  ? 82.574  86.864  100.277 1.00 48.25  ?  62  ILE A CG1   1 
ATOM 144   C CG2   . ILE A 1 62  ? 84.105  88.818  100.167 1.00 48.25  ?  62  ILE A CG2   1 
ATOM 145   C CD1   . ILE A 1 62  ? 83.014  86.192  99.005  1.00 48.25  ?  62  ILE A CD1   1 
ATOM 146   N N     . ARG A 1 63  ? 82.913  91.005  102.422 1.00 59.75  ?  63  ARG A N     1 
ATOM 147   C CA    . ARG A 1 63  ? 83.069  92.443  102.589 1.00 59.75  ?  63  ARG A CA    1 
ATOM 148   C C     . ARG A 1 63  ? 83.829  93.050  101.414 1.00 59.75  ?  63  ARG A C     1 
ATOM 149   O O     . ARG A 1 63  ? 84.640  92.388  100.764 1.00 59.75  ?  63  ARG A O     1 
ATOM 150   C CB    . ARG A 1 63  ? 83.787  92.749  103.899 1.00 59.75  ?  63  ARG A CB    1 
ATOM 151   C CG    . ARG A 1 63  ? 83.020  92.313  105.132 1.00 59.75  ?  63  ARG A CG    1 
ATOM 152   C CD    . ARG A 1 63  ? 81.760  93.134  105.307 1.00 59.75  ?  63  ARG A CD    1 
ATOM 153   N NE    . ARG A 1 63  ? 81.068  92.820  106.551 1.00 59.75  ?  63  ARG A NE    1 
ATOM 154   C CZ    . ARG A 1 63  ? 80.133  91.883  106.670 1.00 59.75  ?  63  ARG A CZ    1 
ATOM 155   N NH1   . ARG A 1 63  ? 79.778  91.159  105.619 1.00 59.75  1  63  ARG A NH1   1 
ATOM 156   N NH2   . ARG A 1 63  ? 79.555  91.666  107.842 1.00 59.75  ?  63  ARG A NH2   1 
ATOM 157   N N     . LYS A 1 64  ? 83.556  94.330  101.153 1.00 53.19  ?  64  LYS A N     1 
ATOM 158   C CA    . LYS A 1 64  ? 83.961  94.945  99.892  1.00 53.19  ?  64  LYS A CA    1 
ATOM 159   C C     . LYS A 1 64  ? 85.466  95.167  99.819  1.00 53.19  ?  64  LYS A C     1 
ATOM 160   O O     . LYS A 1 64  ? 86.083  94.920  98.778  1.00 53.19  ?  64  LYS A O     1 
ATOM 161   C CB    . LYS A 1 64  ? 83.228  96.269  99.702  1.00 53.19  ?  64  LYS A CB    1 
ATOM 162   C CG    . LYS A 1 64  ? 81.727  96.138  99.543  1.00 53.19  ?  64  LYS A CG    1 
ATOM 163   C CD    . LYS A 1 64  ? 81.087  97.505  99.353  1.00 53.19  ?  64  LYS A CD    1 
ATOM 164   C CE    . LYS A 1 64  ? 79.574  97.410  99.290  1.00 53.19  ?  64  LYS A CE    1 
ATOM 165   N NZ    . LYS A 1 64  ? 79.115  96.716  98.057  1.00 53.19  1  64  LYS A NZ    1 
ATOM 166   N N     . LEU A 1 65  ? 86.071  95.629  100.901 1.00 51.40  ?  65  LEU A N     1 
ATOM 167   C CA    . LEU A 1 65  ? 87.499  95.933  100.895 1.00 51.40  ?  65  LEU A CA    1 
ATOM 168   C C     . LEU A 1 65  ? 88.427  94.710  100.834 1.00 51.40  ?  65  LEU A C     1 
ATOM 169   O O     . LEU A 1 65  ? 89.437  94.785  100.115 1.00 51.40  ?  65  LEU A O     1 
ATOM 170   C CB    . LEU A 1 65  ? 87.847  96.814  102.098 1.00 51.40  ?  65  LEU A CB    1 
ATOM 171   C CG    . LEU A 1 65  ? 89.266  97.375  102.126 1.00 51.40  ?  65  LEU A CG    1 
ATOM 172   C CD1   . LEU A 1 65  ? 89.488  98.258  100.916 1.00 51.40  ?  65  LEU A CD1   1 
ATOM 173   C CD2   . LEU A 1 65  ? 89.521  98.151  103.404 1.00 51.40  ?  65  LEU A CD2   1 
ATOM 174   N N     . PRO A 1 66  ? 88.168  93.581  101.528 1.00 46.94  ?  66  PRO A N     1 
ATOM 175   C CA    . PRO A 1 66  ? 89.029  92.408  101.281 1.00 46.94  ?  66  PRO A CA    1 
ATOM 176   C C     . PRO A 1 66  ? 88.911  91.853  99.878  1.00 46.94  ?  66  PRO A C     1 
ATOM 177   O O     . PRO A 1 66  ? 89.920  91.431  99.296  1.00 46.94  ?  66  PRO A O     1 
ATOM 178   C CB    . PRO A 1 66  ? 88.547  91.390  102.320 1.00 46.94  ?  66  PRO A CB    1 
ATOM 179   C CG    . PRO A 1 66  ? 87.981  92.177  103.375 1.00 46.94  ?  66  PRO A CG    1 
ATOM 180   C CD    . PRO A 1 66  ? 87.311  93.317  102.703 1.00 46.94  ?  66  PRO A CD    1 
ATOM 181   N N     . PHE A 1 67  ? 87.711  91.868  99.305  1.00 40.75  ?  67  PHE A N     1 
ATOM 182   C CA    . PHE A 1 67  ? 87.551  91.395  97.940  1.00 40.75  ?  67  PHE A CA    1 
ATOM 183   C C     . PHE A 1 67  ? 88.202  92.340  96.944  1.00 40.75  ?  67  PHE A C     1 
ATOM 184   O O     . PHE A 1 67  ? 88.744  91.890  95.927  1.00 40.75  ?  67  PHE A O     1 
ATOM 185   C CB    . PHE A 1 67  ? 86.076  91.219  97.627  1.00 40.75  ?  67  PHE A CB    1 
ATOM 186   C CG    . PHE A 1 67  ? 85.824  90.615  96.301  1.00 40.75  ?  67  PHE A CG    1 
ATOM 187   C CD1   . PHE A 1 67  ? 86.073  89.275  96.092  1.00 40.75  ?  67  PHE A CD1   1 
ATOM 188   C CD2   . PHE A 1 67  ? 85.335  91.378  95.263  1.00 40.75  ?  67  PHE A CD2   1 
ATOM 189   C CE1   . PHE A 1 67  ? 85.844  88.705  94.870  1.00 40.75  ?  67  PHE A CE1   1 
ATOM 190   C CE2   . PHE A 1 67  ? 85.101  90.816  94.036  1.00 40.75  ?  67  PHE A CE2   1 
ATOM 191   C CZ    . PHE A 1 67  ? 85.356  89.475  93.839  1.00 40.75  ?  67  PHE A CZ    1 
ATOM 192   N N     . SER A 1 68  ? 88.201  93.641  97.238  1.00 39.65  ?  68  SER A N     1 
ATOM 193   C CA    . SER A 1 68  ? 88.905  94.587  96.383  1.00 39.65  ?  68  SER A CA    1 
ATOM 194   C C     . SER A 1 68  ? 90.411  94.381  96.447  1.00 39.65  ?  68  SER A C     1 
ATOM 195   O O     . SER A 1 68  ? 91.089  94.433  95.413  1.00 39.65  ?  68  SER A O     1 
ATOM 196   C CB    . SER A 1 68  ? 88.553  96.016  96.773  1.00 39.65  ?  68  SER A CB    1 
ATOM 197   O OG    . SER A 1 68  ? 89.284  96.937  95.985  1.00 39.65  ?  68  SER A OG    1 
ATOM 198   N N     . ARG A 1 69  ? 90.954  94.135  97.646  1.00 42.00  ?  69  ARG A N     1 
ATOM 199   C CA    . ARG A 1 69  ? 92.389  93.874  97.748  1.00 42.00  ?  69  ARG A CA    1 
ATOM 200   C C     . ARG A 1 69  ? 92.775  92.559  97.085  1.00 42.00  ?  69  ARG A C     1 
ATOM 201   O O     . ARG A 1 69  ? 93.847  92.470  96.475  1.00 42.00  ?  69  ARG A O     1 
ATOM 202   C CB    . ARG A 1 69  ? 92.844  93.884  99.206  1.00 42.00  ?  69  ARG A CB    1 
ATOM 203   C CG    . ARG A 1 69  ? 92.903  95.272  99.820  1.00 42.00  ?  69  ARG A CG    1 
ATOM 204   C CD    . ARG A 1 69  ? 93.535  95.248  101.203 1.00 42.00  ?  69  ARG A CD    1 
ATOM 205   N NE    . ARG A 1 69  ? 92.681  94.614  102.201 1.00 42.00  ?  69  ARG A NE    1 
ATOM 206   C CZ    . ARG A 1 69  ? 92.952  93.452  102.784 1.00 42.00  ?  69  ARG A CZ    1 
ATOM 207   N NH1   . ARG A 1 69  ? 94.052  92.790  102.460 1.00 42.00  1  69  ARG A NH1   1 
ATOM 208   N NH2   . ARG A 1 69  ? 92.121  92.950  103.685 1.00 42.00  ?  69  ARG A NH2   1 
ATOM 209   N N     . LEU A 1 70  ? 91.899  91.553  97.142  1.00 39.27  ?  70  LEU A N     1 
ATOM 210   C CA    . LEU A 1 70  ? 92.175  90.292  96.462  1.00 39.27  ?  70  LEU A CA    1 
ATOM 211   C C     . LEU A 1 70  ? 92.168  90.457  94.948  1.00 39.27  ?  70  LEU A C     1 
ATOM 212   O O     . LEU A 1 70  ? 93.025  89.894  94.252  1.00 39.27  ?  70  LEU A O     1 
ATOM 213   C CB    . LEU A 1 70  ? 91.157  89.243  96.886  1.00 39.27  ?  70  LEU A CB    1 
ATOM 214   C CG    . LEU A 1 70  ? 91.342  87.862  96.280  1.00 39.27  ?  70  LEU A CG    1 
ATOM 215   C CD1   . LEU A 1 70  ? 92.682  87.308  96.674  1.00 39.27  ?  70  LEU A CD1   1 
ATOM 216   C CD2   . LEU A 1 70  ? 90.253  86.966  96.780  1.00 39.27  ?  70  LEU A CD2   1 
ATOM 217   N N     . ALA A 1 71  ? 91.222  91.240  94.422  1.00 37.87  ?  71  ALA A N     1 
ATOM 218   C CA    . ALA A 1 71  ? 91.178  91.463  92.981  1.00 37.87  ?  71  ALA A CA    1 
ATOM 219   C C     . ALA A 1 71  ? 92.368  92.283  92.506  1.00 37.87  ?  71  ALA A C     1 
ATOM 220   O O     . ALA A 1 71  ? 92.940  91.991  91.451  1.00 37.87  ?  71  ALA A O     1 
ATOM 221   C CB    . ALA A 1 71  ? 89.871  92.144  92.592  1.00 37.87  ?  71  ALA A CB    1 
ATOM 222   N N     . ARG A 1 72  ? 92.777  93.292  93.277  1.00 39.10  ?  72  ARG A N     1 
ATOM 223   C CA    . ARG A 1 72  ? 93.954  94.066  92.893  1.00 39.10  ?  72  ARG A CA    1 
ATOM 224   C C     . ARG A 1 72  ? 95.244  93.278  93.065  1.00 39.10  ?  72  ARG A C     1 
ATOM 225   O O     . ARG A 1 72  ? 96.252  93.625  92.444  1.00 39.10  ?  72  ARG A O     1 
ATOM 226   C CB    . ARG A 1 72  ? 94.031  95.356  93.704  1.00 39.10  ?  72  ARG A CB    1 
ATOM 227   C CG    . ARG A 1 72  ? 92.886  96.307  93.443  1.00 39.10  ?  72  ARG A CG    1 
ATOM 228   C CD    . ARG A 1 72  ? 92.968  97.532  94.321  1.00 39.10  ?  72  ARG A CD    1 
ATOM 229   N NE    . ARG A 1 72  ? 91.741  98.308  94.242  1.00 39.10  ?  72  ARG A NE    1 
ATOM 230   C CZ    . ARG A 1 72  ? 91.514  99.243  93.332  1.00 39.10  ?  72  ARG A CZ    1 
ATOM 231   N NH1   . ARG A 1 72  ? 92.436  99.518  92.426  1.00 39.10  1  72  ARG A NH1   1 
ATOM 232   N NH2   . ARG A 1 72  ? 90.367  99.904  93.326  1.00 39.10  ?  72  ARG A NH2   1 
ATOM 233   N N     . GLU A 1 73  ? 95.240  92.239  93.901  1.00 49.40  ?  73  GLU A N     1 
ATOM 234   C CA    . GLU A 1 73  ? 96.395  91.353  93.975  1.00 49.40  ?  73  GLU A CA    1 
ATOM 235   C C     . GLU A 1 73  ? 96.475  90.449  92.754  1.00 49.40  ?  73  GLU A C     1 
ATOM 236   O O     . GLU A 1 73  ? 97.537  90.314  92.139  1.00 49.40  ?  73  GLU A O     1 
ATOM 237   C CB    . GLU A 1 73  ? 96.325  90.507  95.240  1.00 49.40  ?  73  GLU A CB    1 
ATOM 238   C CG    . GLU A 1 73  ? 97.501  89.573  95.415  1.00 49.40  ?  73  GLU A CG    1 
ATOM 239   C CD    . GLU A 1 73  ? 97.355  88.705  96.641  1.00 49.40  ?  73  GLU A CD    1 
ATOM 240   O OE1   . GLU A 1 73  ? 96.291  88.784  97.289  1.00 49.40  ?  73  GLU A OE1   1 
ATOM 241   O OE2   . GLU A 1 73  ? 98.299  87.953  96.965  1.00 49.40  -1 73  GLU A OE2   1 
ATOM 242   N N     . ILE A 1 74  ? 95.361  89.804  92.401  1.00 39.82  ?  74  ILE A N     1 
ATOM 243   C CA    . ILE A 1 74  ? 95.382  88.824  91.318  1.00 39.82  ?  74  ILE A CA    1 
ATOM 244   C C     . ILE A 1 74  ? 95.524  89.510  89.963  1.00 39.82  ?  74  ILE A C     1 
ATOM 245   O O     . ILE A 1 74  ? 96.155  88.967  89.047  1.00 39.82  ?  74  ILE A O     1 
ATOM 246   C CB    . ILE A 1 74  ? 94.126  87.937  91.414  1.00 39.82  ?  74  ILE A CB    1 
ATOM 247   C CG1   . ILE A 1 74  ? 94.169  87.133  92.707  1.00 39.82  ?  74  ILE A CG1   1 
ATOM 248   C CG2   . ILE A 1 74  ? 94.021  86.957  90.274  1.00 39.82  ?  74  ILE A CG2   1 
ATOM 249   C CD1   . ILE A 1 74  ? 92.907  86.361  92.987  1.00 39.82  ?  74  ILE A CD1   1 
ATOM 250   N N     . CYS A 1 75  ? 95.015  90.737  89.833  1.00 41.05  ?  75  CYS A N     1 
ATOM 251   C CA    . CYS A 1 75  ? 95.068  91.436  88.553  1.00 41.05  ?  75  CYS A CA    1 
ATOM 252   C C     . CYS A 1 75  ? 96.485  91.839  88.165  1.00 41.05  ?  75  CYS A C     1 
ATOM 253   O O     . CYS A 1 75  ? 96.812  91.845  86.976  1.00 41.05  ?  75  CYS A O     1 
ATOM 254   C CB    . CYS A 1 75  ? 94.174  92.672  88.596  1.00 41.05  ?  75  CYS A CB    1 
ATOM 255   S SG    . CYS A 1 75  ? 94.102  93.618  87.061  1.00 41.05  ?  75  CYS A SG    1 
ATOM 256   N N     . VAL A 1 76  ? 97.347  92.148  89.137  1.00 44.80  ?  76  VAL A N     1 
ATOM 257   C CA    . VAL A 1 76  ? 98.672  92.675  88.811  1.00 44.80  ?  76  VAL A CA    1 
ATOM 258   C C     . VAL A 1 76  ? 99.628  91.587  88.343  1.00 44.80  ?  76  VAL A C     1 
ATOM 259   O O     . VAL A 1 76  ? 100.701 91.894  87.812  1.00 44.80  ?  76  VAL A O     1 
ATOM 260   C CB    . VAL A 1 76  ? 99.240  93.433  90.027  1.00 44.80  ?  76  VAL A CB    1 
ATOM 261   C CG1   . VAL A 1 76  ? 99.815  92.472  91.055  1.00 44.80  ?  76  VAL A CG1   1 
ATOM 262   C CG2   . VAL A 1 76  ? 100.231 94.524  89.613  1.00 44.80  ?  76  VAL A CG2   1 
ATOM 263   N N     . LYS A 1 77  ? 99.261  90.321  88.493  1.00 44.48  ?  77  LYS A N     1 
ATOM 264   C CA    . LYS A 1 77  ? 100.092 89.227  88.016  1.00 44.48  ?  77  LYS A CA    1 
ATOM 265   C C     . LYS A 1 77  ? 99.837  88.906  86.548  1.00 44.48  ?  77  LYS A C     1 
ATOM 266   O O     . LYS A 1 77  ? 100.744 88.435  85.855  1.00 44.48  ?  77  LYS A O     1 
ATOM 267   C CB    . LYS A 1 77  ? 99.848  87.995  88.895  1.00 44.48  ?  77  LYS A CB    1 
ATOM 268   C CG    . LYS A 1 77  ? 100.733 86.797  88.628  1.00 44.48  ?  77  LYS A CG    1 
ATOM 269   C CD    . LYS A 1 77  ? 100.531 85.727  89.689  1.00 44.48  ?  77  LYS A CD    1 
ATOM 270   C CE    . LYS A 1 77  ? 99.368  84.812  89.351  1.00 44.48  ?  77  LYS A CE    1 
ATOM 271   N NZ    . LYS A 1 77  ? 98.072  85.375  89.813  1.00 44.48  1  77  LYS A NZ    1 
ATOM 272   N N     . PHE A 1 78  ? 98.636  89.191  86.043  1.00 41.82  ?  78  PHE A N     1 
ATOM 273   C CA    . PHE A 1 78  ? 98.256  88.870  84.674  1.00 41.82  ?  78  PHE A CA    1 
ATOM 274   C C     . PHE A 1 78  ? 98.332  90.067  83.743  1.00 41.82  ?  78  PHE A C     1 
ATOM 275   O O     . PHE A 1 78  ? 97.628  90.098  82.731  1.00 41.82  ?  78  PHE A O     1 
ATOM 276   C CB    . PHE A 1 78  ? 96.847  88.291  84.642  1.00 41.82  ?  78  PHE A CB    1 
ATOM 277   C CG    . PHE A 1 78  ? 96.746  86.940  85.251  1.00 41.82  ?  78  PHE A CG    1 
ATOM 278   C CD1   . PHE A 1 78  ? 97.059  85.813  84.514  1.00 41.82  ?  78  PHE A CD1   1 
ATOM 279   C CD2   . PHE A 1 78  ? 96.359  86.792  86.567  1.00 41.82  ?  78  PHE A CD2   1 
ATOM 280   C CE1   . PHE A 1 78  ? 96.970  84.556  85.075  1.00 41.82  ?  78  PHE A CE1   1 
ATOM 281   C CE2   . PHE A 1 78  ? 96.273  85.542  87.137  1.00 41.82  ?  78  PHE A CE2   1 
ATOM 282   C CZ    . PHE A 1 78  ? 96.577  84.421  86.390  1.00 41.82  ?  78  PHE A CZ    1 
ATOM 283   N N     . THR A 1 79  ? 99.151  91.060  84.070  1.00 49.59  ?  79  THR A N     1 
ATOM 284   C CA    . THR A 1 79  ? 99.285  92.227  83.209  1.00 49.59  ?  79  THR A CA    1 
ATOM 285   C C     . THR A 1 79  ? 100.717 92.738  83.138  1.00 49.59  ?  79  THR A C     1 
ATOM 286   O O     . THR A 1 79  ? 100.932 93.879  82.704  1.00 49.59  ?  79  THR A O     1 
ATOM 287   C CB    . THR A 1 79  ? 98.385  93.339  83.685  1.00 49.59  ?  79  THR A CB    1 
ATOM 288   O OG1   . THR A 1 79  ? 98.554  94.473  82.829  1.00 49.59  ?  79  THR A OG1   1 
ATOM 289   C CG2   . THR A 1 79  ? 98.741  93.706  85.099  1.00 49.59  ?  79  THR A CG2   1 
ATOM 290   N N     . ARG A 1 80  ? 101.680 91.922  83.575  1.00 61.45  ?  80  ARG A N     1 
ATOM 291   C CA    . ARG A 1 80  ? 103.113 92.230  83.567  1.00 61.45  ?  80  ARG A CA    1 
ATOM 292   C C     . ARG A 1 80  ? 103.426 93.453  84.425  1.00 61.45  ?  80  ARG A C     1 
ATOM 293   O O     . ARG A 1 80  ? 104.109 94.385  84.000  1.00 61.45  ?  80  ARG A O     1 
ATOM 294   C CB    . ARG A 1 80  ? 103.658 92.397  82.144  1.00 61.45  ?  80  ARG A CB    1 
ATOM 295   C CG    . ARG A 1 80  ? 103.936 91.098  81.425  1.00 61.45  ?  80  ARG A CG    1 
ATOM 296   C CD    . ARG A 1 80  ? 102.708 90.534  80.767  1.00 61.45  ?  80  ARG A CD    1 
ATOM 297   N NE    . ARG A 1 80  ? 102.116 91.510  79.868  1.00 61.45  ?  80  ARG A NE    1 
ATOM 298   C CZ    . ARG A 1 80  ? 102.531 91.713  78.626  1.00 61.45  ?  80  ARG A CZ    1 
ATOM 299   N NH1   . ARG A 1 80  ? 103.541 91.004  78.143  1.00 61.45  1  80  ARG A NH1   1 
ATOM 300   N NH2   . ARG A 1 80  ? 101.938 92.620  77.865  1.00 61.45  ?  80  ARG A NH2   1 
ATOM 301   N N     . GLY A 1 81  ? 102.916 93.435  85.650  1.00 56.86  ?  81  GLY A N     1 
ATOM 302   C CA    . GLY A 1 81  ? 103.314 94.407  86.652  1.00 56.86  ?  81  GLY A CA    1 
ATOM 303   C C     . GLY A 1 81  ? 102.805 95.813  86.429  1.00 56.86  ?  81  GLY A C     1 
ATOM 304   O O     . GLY A 1 81  ? 103.535 96.776  86.684  1.00 56.86  ?  81  GLY A O     1 
ATOM 305   N N     . VAL A 1 82  ? 101.569 95.954  85.961  1.00 55.77  ?  82  VAL A N     1 
ATOM 306   C CA    . VAL A 1 82  ? 100.961 97.248  85.685  1.00 55.77  ?  82  VAL A CA    1 
ATOM 307   C C     . VAL A 1 82  ? 99.761  97.411  86.607  1.00 55.77  ?  82  VAL A C     1 
ATOM 308   O O     . VAL A 1 82  ? 98.985  96.470  86.794  1.00 55.77  ?  82  VAL A O     1 
ATOM 309   C CB    . VAL A 1 82  ? 100.538 97.352  84.204  1.00 55.77  ?  82  VAL A CB    1 
ATOM 310   C CG1   . VAL A 1 82  ? 99.953  98.711  83.887  1.00 55.77  ?  82  VAL A CG1   1 
ATOM 311   C CG2   . VAL A 1 82  ? 101.710 97.070  83.301  1.00 55.77  ?  82  VAL A CG2   1 
ATOM 312   N N     . ASP A 1 83  ? 99.614  98.589  87.202  1.00 59.46  ?  83  ASP A N     1 
ATOM 313   C CA    . ASP A 1 83  ? 98.404  98.837  87.965  1.00 59.46  ?  83  ASP A CA    1 
ATOM 314   C C     . ASP A 1 83  ? 97.233  99.121  87.029  1.00 59.46  ?  83  ASP A C     1 
ATOM 315   O O     . ASP A 1 83  ? 97.397  99.352  85.832  1.00 59.46  ?  83  ASP A O     1 
ATOM 316   C CB    . ASP A 1 83  ? 98.597  100.000 88.934  1.00 59.46  ?  83  ASP A CB    1 
ATOM 317   C CG    . ASP A 1 83  ? 99.013  101.284 88.239  1.00 59.46  ?  83  ASP A CG    1 
ATOM 318   O OD1   . ASP A 1 83  ? 99.377  101.249 87.043  1.00 59.46  ?  83  ASP A OD1   1 
ATOM 319   O OD2   . ASP A 1 83  ? 98.946  102.344 88.890  1.00 59.46  -1 83  ASP A OD2   1 
ATOM 320   N N     . PHE A 1 84  ? 96.034  99.118  87.591  1.00 45.59  ?  84  PHE A N     1 
ATOM 321   C CA    . PHE A 1 84  ? 94.865  99.554  86.854  1.00 45.59  ?  84  PHE A CA    1 
ATOM 322   C C     . PHE A 1 84  ? 94.018  100.411 87.772  1.00 45.59  ?  84  PHE A C     1 
ATOM 323   O O     . PHE A 1 84  ? 94.402  100.719 88.902  1.00 45.59  ?  84  PHE A O     1 
ATOM 324   C CB    . PHE A 1 84  ? 94.089  98.363  86.287  1.00 45.59  ?  84  PHE A CB    1 
ATOM 325   C CG    . PHE A 1 84  ? 94.684  97.803  85.041  1.00 45.59  ?  84  PHE A CG    1 
ATOM 326   C CD1   . PHE A 1 84  ? 94.395  98.373  83.816  1.00 45.59  ?  84  PHE A CD1   1 
ATOM 327   C CD2   . PHE A 1 84  ? 95.542  96.728  85.090  1.00 45.59  ?  84  PHE A CD2   1 
ATOM 328   C CE1   . PHE A 1 84  ? 94.939  97.873  82.659  1.00 45.59  ?  84  PHE A CE1   1 
ATOM 329   C CE2   . PHE A 1 84  ? 96.091  96.222  83.937  1.00 45.59  ?  84  PHE A CE2   1 
ATOM 330   C CZ    . PHE A 1 84  ? 95.788  96.797  82.720  1.00 45.59  ?  84  PHE A CZ    1 
ATOM 331   N N     . ASN A 1 85  ? 92.860  100.802 87.272  1.00 49.03  ?  85  ASN A N     1 
ATOM 332   C CA    . ASN A 1 85  ? 91.923  101.626 88.022  1.00 49.03  ?  85  ASN A CA    1 
ATOM 333   C C     . ASN A 1 85  ? 90.545  101.029 87.768  1.00 49.03  ?  85  ASN A C     1 
ATOM 334   O O     . ASN A 1 85  ? 89.913  101.323 86.751  1.00 49.03  ?  85  ASN A O     1 
ATOM 335   C CB    . ASN A 1 85  ? 92.010  103.081 87.597  1.00 49.03  ?  85  ASN A CB    1 
ATOM 336   C CG    . ASN A 1 85  ? 93.296  103.738 88.043  1.00 49.03  ?  85  ASN A CG    1 
ATOM 337   O OD1   . ASN A 1 85  ? 93.758  103.529 89.162  1.00 49.03  ?  85  ASN A OD1   1 
ATOM 338   N ND2   . ASN A 1 85  ? 93.879  104.546 87.171  1.00 49.03  ?  85  ASN A ND2   1 
ATOM 339   N N     . TRP A 1 86  ? 90.113  100.160 88.674  1.00 38.38  ?  86  TRP A N     1 
ATOM 340   C CA    . TRP A 1 86  ? 88.768  99.613  88.609  1.00 38.38  ?  86  TRP A CA    1 
ATOM 341   C C     . TRP A 1 86  ? 87.758  100.722 88.843  1.00 38.38  ?  86  TRP A C     1 
ATOM 342   O O     . TRP A 1 86  ? 87.907  101.514 89.777  1.00 38.38  ?  86  TRP A O     1 
ATOM 343   C CB    . TRP A 1 86  ? 88.588  98.529  89.666  1.00 38.38  ?  86  TRP A CB    1 
ATOM 344   C CG    . TRP A 1 86  ? 89.423  97.321  89.472  1.00 38.38  ?  86  TRP A CG    1 
ATOM 345   C CD1   . TRP A 1 86  ? 90.664  97.113  89.968  1.00 38.38  ?  86  TRP A CD1   1 
ATOM 346   C CD2   . TRP A 1 86  ? 89.058  96.122  88.785  1.00 38.38  ?  86  TRP A CD2   1 
ATOM 347   N NE1   . TRP A 1 86  ? 91.116  95.872  89.608  1.00 38.38  ?  86  TRP A NE1   1 
ATOM 348   C CE2   . TRP A 1 86  ? 90.144  95.242  88.882  1.00 38.38  ?  86  TRP A CE2   1 
ATOM 349   C CE3   . TRP A 1 86  ? 87.923  95.714  88.082  1.00 38.38  ?  86  TRP A CE3   1 
ATOM 350   C CZ2   . TRP A 1 86  ? 90.133  93.980  88.306  1.00 38.38  ?  86  TRP A CZ2   1 
ATOM 351   C CZ3   . TRP A 1 86  ? 87.911  94.458  87.515  1.00 38.38  ?  86  TRP A CZ3   1 
ATOM 352   C CH2   . TRP A 1 86  ? 89.008  93.608  87.625  1.00 38.38  ?  86  TRP A CH2   1 
ATOM 353   N N     . GLN A 1 87  ? 86.750  100.804 87.985  1.00 42.01  ?  87  GLN A N     1 
ATOM 354   C CA    . GLN A 1 87  ? 85.586  101.600 88.328  1.00 42.01  ?  87  GLN A CA    1 
ATOM 355   C C     . GLN A 1 87  ? 84.895  101.006 89.542  1.00 42.01  ?  87  GLN A C     1 
ATOM 356   O O     . GLN A 1 87  ? 84.904  99.792  89.758  1.00 42.01  ?  87  GLN A O     1 
ATOM 357   C CB    . GLN A 1 87  ? 84.598  101.672 87.170  1.00 42.01  ?  87  GLN A CB    1 
ATOM 358   C CG    . GLN A 1 87  ? 84.991  102.600 86.053  1.00 42.01  ?  87  GLN A CG    1 
ATOM 359   C CD    . GLN A 1 87  ? 83.961  102.618 84.947  1.00 42.01  ?  87  GLN A CD    1 
ATOM 360   O OE1   . GLN A 1 87  ? 83.004  101.846 84.964  1.00 42.01  ?  87  GLN A OE1   1 
ATOM 361   N NE2   . GLN A 1 87  ? 84.140  103.515 83.987  1.00 42.01  ?  87  GLN A NE2   1 
ATOM 362   N N     . ALA A 1 88  ? 84.253  101.877 90.323  1.00 44.65  ?  88  ALA A N     1 
ATOM 363   C CA    . ALA A 1 88  ? 83.548  101.465 91.532  1.00 44.65  ?  88  ALA A CA    1 
ATOM 364   C C     . ALA A 1 88  ? 82.304  100.633 91.251  1.00 44.65  ?  88  ALA A C     1 
ATOM 365   O O     . ALA A 1 88  ? 81.688  100.139 92.198  1.00 44.65  ?  88  ALA A O     1 
ATOM 366   C CB    . ALA A 1 88  ? 83.162  102.695 92.352  1.00 44.65  ?  88  ALA A CB    1 
ATOM 367   N N     . GLN A 1 89  ? 81.917  100.475 89.988  1.00 42.74  ?  89  GLN A N     1 
ATOM 368   C CA    . GLN A 1 89  ? 80.796  99.634  89.613  1.00 42.74  ?  89  GLN A CA    1 
ATOM 369   C C     . GLN A 1 89  ? 81.224  98.207  89.284  1.00 42.74  ?  89  GLN A C     1 
ATOM 370   O O     . GLN A 1 89  ? 80.471  97.267  89.559  1.00 42.74  ?  89  GLN A O     1 
ATOM 371   C CB    . GLN A 1 89  ? 80.082  100.256 88.411  1.00 42.74  ?  89  GLN A CB    1 
ATOM 372   C CG    . GLN A 1 89  ? 78.741  99.664  88.081  1.00 42.74  ?  89  GLN A CG    1 
ATOM 373   C CD    . GLN A 1 89  ? 77.724  99.948  89.152  1.00 42.74  ?  89  GLN A CD    1 
ATOM 374   O OE1   . GLN A 1 89  ? 77.386  99.081  89.954  1.00 42.74  ?  89  GLN A OE1   1 
ATOM 375   N NE2   . GLN A 1 89  ? 77.223  101.184 89.173  1.00 42.74  ?  89  GLN A NE2   1 
ATOM 376   N N     . ALA A 1 90  ? 82.425  98.018  88.726  1.00 39.30  ?  90  ALA A N     1 
ATOM 377   C CA    . ALA A 1 90  ? 82.805  96.706  88.205  1.00 39.30  ?  90  ALA A CA    1 
ATOM 378   C C     . ALA A 1 90  ? 83.137  95.718  89.310  1.00 39.30  ?  90  ALA A C     1 
ATOM 379   O O     . ALA A 1 90  ? 82.958  94.505  89.128  1.00 39.30  ?  90  ALA A O     1 
ATOM 380   C CB    . ALA A 1 90  ? 83.997  96.838  87.264  1.00 39.30  ?  90  ALA A CB    1 
ATOM 381   N N     . LEU A 1 91  ? 83.639  96.209  90.444  1.00 37.66  ?  91  LEU A N     1 
ATOM 382   C CA    . LEU A 1 91  ? 83.929  95.327  91.568  1.00 37.66  ?  91  LEU A CA    1 
ATOM 383   C C     . LEU A 1 91  ? 82.660  94.702  92.118  1.00 37.66  ?  91  LEU A C     1 
ATOM 384   O O     . LEU A 1 91  ? 82.683  93.551  92.572  1.00 37.66  ?  91  LEU A O     1 
ATOM 385   C CB    . LEU A 1 91  ? 84.657  96.095  92.661  1.00 37.66  ?  91  LEU A CB    1 
ATOM 386   C CG    . LEU A 1 91  ? 86.033  96.600  92.251  1.00 37.66  ?  91  LEU A CG    1 
ATOM 387   C CD1   . LEU A 1 91  ? 86.611  97.459  93.349  1.00 37.66  ?  91  LEU A CD1   1 
ATOM 388   C CD2   . LEU A 1 91  ? 86.946  95.438  91.941  1.00 37.66  ?  91  LEU A CD2   1 
ATOM 389   N N     . LEU A 1 92  ? 81.543  95.430  92.041  1.00 39.85  ?  92  LEU A N     1 
ATOM 390   C CA    . LEU A 1 92  ? 80.249  94.843  92.360  1.00 39.85  ?  92  LEU A CA    1 
ATOM 391   C C     . LEU A 1 92  ? 79.902  93.719  91.398  1.00 39.85  ?  92  LEU A C     1 
ATOM 392   O O     . LEU A 1 92  ? 79.322  92.711  91.806  1.00 39.85  ?  92  LEU A O     1 
ATOM 393   C CB    . LEU A 1 92  ? 79.163  95.913  92.338  1.00 39.85  ?  92  LEU A CB    1 
ATOM 394   C CG    . LEU A 1 92  ? 79.234  96.940  93.460  1.00 39.85  ?  92  LEU A CG    1 
ATOM 395   C CD1   . LEU A 1 92  ? 78.180  98.006  93.253  1.00 39.85  ?  92  LEU A CD1   1 
ATOM 396   C CD2   . LEU A 1 92  ? 79.047  96.255  94.796  1.00 39.85  ?  92  LEU A CD2   1 
ATOM 397   N N     . ALA A 1 93  ? 80.284  93.852  90.127  1.00 37.74  ?  93  ALA A N     1 
ATOM 398   C CA    . ALA A 1 93  ? 79.972  92.805  89.160  1.00 37.74  ?  93  ALA A CA    1 
ATOM 399   C C     . ALA A 1 93  ? 80.795  91.550  89.418  1.00 37.74  ?  93  ALA A C     1 
ATOM 400   O O     . ALA A 1 93  ? 80.257  90.432  89.370  1.00 37.74  ?  93  ALA A O     1 
ATOM 401   C CB    . ALA A 1 93  ? 80.193  93.315  87.741  1.00 37.74  ?  93  ALA A CB    1 
ATOM 402   N N     . LEU A 1 94  ? 82.092  91.724  89.709  1.00 35.05  ?  94  LEU A N     1 
ATOM 403   C CA    . LEU A 1 94  ? 82.928  90.601  90.132  1.00 35.05  ?  94  LEU A CA    1 
ATOM 404   C C     . LEU A 1 94  ? 82.371  89.921  91.370  1.00 35.05  ?  94  LEU A C     1 
ATOM 405   O O     . LEU A 1 94  ? 82.294  88.689  91.426  1.00 35.05  ?  94  LEU A O     1 
ATOM 406   C CB    . LEU A 1 94  ? 84.352  91.062  90.423  1.00 35.05  ?  94  LEU A CB    1 
ATOM 407   C CG    . LEU A 1 94  ? 85.270  91.400  89.270  1.00 35.05  ?  94  LEU A CG    1 
ATOM 408   C CD1   . LEU A 1 94  ? 86.584  91.890  89.810  1.00 35.05  ?  94  LEU A CD1   1 
ATOM 409   C CD2   . LEU A 1 94  ? 85.470  90.151  88.489  1.00 35.05  ?  94  LEU A CD2   1 
ATOM 410   N N     . GLN A 1 95  ? 81.954  90.711  92.358  1.00 42.48  ?  95  GLN A N     1 
ATOM 411   C CA    . GLN A 1 95  ? 81.520  90.137  93.622  1.00 42.48  ?  95  GLN A CA    1 
ATOM 412   C C     . GLN A 1 95  ? 80.179  89.429  93.479  1.00 42.48  ?  95  GLN A C     1 
ATOM 413   O O     . GLN A 1 95  ? 79.964  88.378  94.091  1.00 42.48  ?  95  GLN A O     1 
ATOM 414   C CB    . GLN A 1 95  ? 81.464  91.230  94.678  1.00 42.48  ?  95  GLN A CB    1 
ATOM 415   C CG    . GLN A 1 95  ? 81.187  90.736  96.062  1.00 42.48  ?  95  GLN A CG    1 
ATOM 416   C CD    . GLN A 1 95  ? 81.266  91.847  97.072  1.00 42.48  ?  95  GLN A CD    1 
ATOM 417   O OE1   . GLN A 1 95  ? 81.524  92.998  96.723  1.00 42.48  ?  95  GLN A OE1   1 
ATOM 418   N NE2   . GLN A 1 95  ? 81.036  91.517  98.334  1.00 42.48  ?  95  GLN A NE2   1 
ATOM 419   N N     . GLU A 1 96  ? 79.289  89.955  92.633  1.00 41.76  ?  96  GLU A N     1 
ATOM 420   C CA    . GLU A 1 96  ? 78.012  89.289  92.405  1.00 41.76  ?  96  GLU A CA    1 
ATOM 421   C C     . GLU A 1 96  ? 78.190  87.991  91.634  1.00 41.76  ?  96  GLU A C     1 
ATOM 422   O O     . GLU A 1 96  ? 77.532  86.989  91.945  1.00 41.76  ?  96  GLU A O     1 
ATOM 423   C CB    . GLU A 1 96  ? 77.045  90.211  91.669  1.00 41.76  ?  96  GLU A CB    1 
ATOM 424   C CG    . GLU A 1 96  ? 76.482  91.334  92.513  1.00 41.76  ?  96  GLU A CG    1 
ATOM 425   C CD    . GLU A 1 96  ? 75.544  90.847  93.594  1.00 41.76  ?  96  GLU A CD    1 
ATOM 426   O OE1   . GLU A 1 96  ? 74.879  89.812  93.386  1.00 41.76  ?  96  GLU A OE1   1 
ATOM 427   O OE2   . GLU A 1 96  ? 75.456  91.510  94.647  1.00 41.76  -1 96  GLU A OE2   1 
ATOM 428   N N     . ALA A 1 97  ? 79.088  87.976  90.643  1.00 38.97  ?  97  ALA A N     1 
ATOM 429   C CA    . ALA A 1 97  ? 79.342  86.732  89.925  1.00 38.97  ?  97  ALA A CA    1 
ATOM 430   C C     . ALA A 1 97  ? 80.016  85.702  90.819  1.00 38.97  ?  97  ALA A C     1 
ATOM 431   O O     . ALA A 1 97  ? 79.696  84.509  90.745  1.00 38.97  ?  97  ALA A O     1 
ATOM 432   C CB    . ALA A 1 97  ? 80.196  86.998  88.694  1.00 38.97  ?  97  ALA A CB    1 
ATOM 433   N N     . ALA A 1 98  ? 80.915  86.150  91.699  1.00 39.78  ?  98  ALA A N     1 
ATOM 434   C CA    . ALA A 1 98  ? 81.594  85.226  92.599  1.00 39.78  ?  98  ALA A CA    1 
ATOM 435   C C     . ALA A 1 98  ? 80.632  84.645  93.627  1.00 39.78  ?  98  ALA A C     1 
ATOM 436   O O     . ALA A 1 98  ? 80.683  83.442  93.917  1.00 39.78  ?  98  ALA A O     1 
ATOM 437   C CB    . ALA A 1 98  ? 82.763  85.929  93.286  1.00 39.78  ?  98  ALA A CB    1 
ATOM 438   N N     . GLU A 1 99  ? 79.729  85.475  94.161  1.00 45.19  ?  99  GLU A N     1 
ATOM 439   C CA    . GLU A 1 99  ? 78.733  84.971  95.101  1.00 45.19  ?  99  GLU A CA    1 
ATOM 440   C C     . GLU A 1 99  ? 77.767  84.006  94.432  1.00 45.19  ?  99  GLU A C     1 
ATOM 441   O O     . GLU A 1 99  ? 77.446  82.963  95.009  1.00 45.19  ?  99  GLU A O     1 
ATOM 442   C CB    . GLU A 1 99  ? 77.962  86.116  95.754  1.00 45.19  ?  99  GLU A CB    1 
ATOM 443   C CG    . GLU A 1 99  ? 78.747  86.899  96.790  1.00 45.19  ?  99  GLU A CG    1 
ATOM 444   C CD    . GLU A 1 99  ? 77.877  87.892  97.543  1.00 45.19  ?  99  GLU A CD    1 
ATOM 445   O OE1   . GLU A 1 99  ? 76.692  88.037  97.180  1.00 45.19  ?  99  GLU A OE1   1 
ATOM 446   O OE2   . GLU A 1 99  ? 78.372  88.519  98.504  1.00 45.19  -1 99  GLU A OE2   1 
ATOM 447   N N     . ALA A 1 100 ? 77.315  84.317  93.212  1.00 40.97  ?  100 ALA A N     1 
ATOM 448   C CA    . ALA A 1 100 ? 76.388  83.420  92.529  1.00 40.97  ?  100 ALA A CA    1 
ATOM 449   C C     . ALA A 1 100 ? 77.046  82.089  92.184  1.00 40.97  ?  100 ALA A C     1 
ATOM 450   O O     . ALA A 1 100 ? 76.434  81.023  92.358  1.00 40.97  ?  100 ALA A O     1 
ATOM 451   C CB    . ALA A 1 100 ? 75.845  84.089  91.270  1.00 40.97  ?  100 ALA A CB    1 
ATOM 452   N N     . PHE A 1 101 ? 78.311  82.131  91.756  1.00 38.69  ?  101 PHE A N     1 
ATOM 453   C CA    . PHE A 1 101 ? 79.031  80.906  91.435  1.00 38.69  ?  101 PHE A CA    1 
ATOM 454   C C     . PHE A 1 101 ? 79.273  80.051  92.670  1.00 38.69  ?  101 PHE A C     1 
ATOM 455   O O     . PHE A 1 101 ? 79.067  78.833  92.628  1.00 38.69  ?  101 PHE A O     1 
ATOM 456   C CB    . PHE A 1 101 ? 80.347  81.241  90.748  1.00 38.69  ?  101 PHE A CB    1 
ATOM 457   C CG    . PHE A 1 101 ? 81.219  80.054  90.522  1.00 38.69  ?  101 PHE A CG    1 
ATOM 458   C CD1   . PHE A 1 101 ? 80.850  79.070  89.625  1.00 38.69  ?  101 PHE A CD1   1 
ATOM 459   C CD2   . PHE A 1 101 ? 82.421  79.933  91.190  1.00 38.69  ?  101 PHE A CD2   1 
ATOM 460   C CE1   . PHE A 1 101 ? 81.658  77.972  89.415  1.00 38.69  ?  101 PHE A CE1   1 
ATOM 461   C CE2   . PHE A 1 101 ? 83.234  78.845  90.983  1.00 38.69  ?  101 PHE A CE2   1 
ATOM 462   C CZ    . PHE A 1 101 ? 82.853  77.863  90.094  1.00 38.69  ?  101 PHE A CZ    1 
ATOM 463   N N     . LEU A 1 102 ? 79.666  80.668  93.789  1.00 37.62  ?  102 LEU A N     1 
ATOM 464   C CA    . LEU A 1 102 ? 79.902  79.884  94.998  1.00 37.62  ?  102 LEU A CA    1 
ATOM 465   C C     . LEU A 1 102 ? 78.613  79.335  95.588  1.00 37.62  ?  102 LEU A C     1 
ATOM 466   O O     . LEU A 1 102 ? 78.611  78.224  96.130  1.00 37.62  ?  102 LEU A O     1 
ATOM 467   C CB    . LEU A 1 102 ? 80.637  80.707  96.041  1.00 37.62  ?  102 LEU A CB    1 
ATOM 468   C CG    . LEU A 1 102 ? 82.110  80.897  95.759  1.00 37.62  ?  102 LEU A CG    1 
ATOM 469   C CD1   . LEU A 1 102 ? 82.650  81.804  96.805  1.00 37.62  ?  102 LEU A CD1   1 
ATOM 470   C CD2   . LEU A 1 102 ? 82.798  79.564  95.827  1.00 37.62  ?  102 LEU A CD2   1 
ATOM 471   N N     . VAL A 1 103 ? 77.509  80.080  95.495  1.00 39.44  ?  103 VAL A N     1 
ATOM 472   C CA    . VAL A 1 103 ? 76.259  79.580  96.057  1.00 39.44  ?  103 VAL A CA    1 
ATOM 473   C C     . VAL A 1 103 ? 75.727  78.414  95.234  1.00 39.44  ?  103 VAL A C     1 
ATOM 474   O O     . VAL A 1 103 ? 75.305  77.391  95.792  1.00 39.44  ?  103 VAL A O     1 
ATOM 475   C CB    . VAL A 1 103 ? 75.239  80.722  96.188  1.00 39.44  ?  103 VAL A CB    1 
ATOM 476   C CG1   . VAL A 1 103 ? 73.851  80.188  96.452  1.00 39.44  ?  103 VAL A CG1   1 
ATOM 477   C CG2   . VAL A 1 103 ? 75.634  81.608  97.344  1.00 39.44  ?  103 VAL A CG2   1 
ATOM 478   N N     . HIS A 1 104 ? 75.802  78.512  93.902  1.00 41.72  ?  104 HIS A N     1 
ATOM 479   C CA    . HIS A 1 104 ? 75.395  77.388  93.064  1.00 41.72  ?  104 HIS A CA    1 
ATOM 480   C C     . HIS A 1 104 ? 76.319  76.184  93.254  1.00 41.72  ?  104 HIS A C     1 
ATOM 481   O O     . HIS A 1 104 ? 75.860  75.030  93.270  1.00 41.72  ?  104 HIS A O     1 
ATOM 482   C CB    . HIS A 1 104 ? 75.366  77.833  91.608  1.00 41.72  ?  104 HIS A CB    1 
ATOM 483   C CG    . HIS A 1 104 ? 74.872  76.786  90.666  1.00 41.72  ?  104 HIS A CG    1 
ATOM 484   N ND1   . HIS A 1 104 ? 73.537  76.474  90.536  1.00 41.72  ?  104 HIS A ND1   1 
ATOM 485   C CD2   . HIS A 1 104 ? 75.534  75.974  89.811  1.00 41.72  ?  104 HIS A CD2   1 
ATOM 486   C CE1   . HIS A 1 104 ? 73.398  75.517  89.635  1.00 41.72  ?  104 HIS A CE1   1 
ATOM 487   N NE2   . HIS A 1 104 ? 74.595  75.194  89.182  1.00 41.72  ?  104 HIS A NE2   1 
ATOM 488   N N     . LEU A 1 105 ? 77.613  76.442  93.475  1.00 38.03  ?  105 LEU A N     1 
ATOM 489   C CA    . LEU A 1 105 ? 78.568  75.363  93.700  1.00 38.03  ?  105 LEU A CA    1 
ATOM 490   C C     . LEU A 1 105 ? 78.306  74.644  95.015  1.00 38.03  ?  105 LEU A C     1 
ATOM 491   O O     . LEU A 1 105 ? 78.318  73.409  95.058  1.00 38.03  ?  105 LEU A O     1 
ATOM 492   C CB    . LEU A 1 105 ? 79.988  75.914  93.674  1.00 38.03  ?  105 LEU A CB    1 
ATOM 493   C CG    . LEU A 1 105 ? 81.068  74.861  93.858  1.00 38.03  ?  105 LEU A CG    1 
ATOM 494   C CD1   . LEU A 1 105 ? 81.002  73.877  92.724  1.00 38.03  ?  105 LEU A CD1   1 
ATOM 495   C CD2   . LEU A 1 105 ? 82.422  75.513  93.914  1.00 38.03  ?  105 LEU A CD2   1 
ATOM 496   N N     . PHE A 1 106 ? 78.060  75.388  96.095  1.00 40.33  ?  106 PHE A N     1 
ATOM 497   C CA    . PHE A 1 106 ? 77.788  74.725  97.364  1.00 40.33  ?  106 PHE A CA    1 
ATOM 498   C C     . PHE A 1 106 ? 76.419  74.068  97.391  1.00 40.33  ?  106 PHE A C     1 
ATOM 499   O O     . PHE A 1 106 ? 76.248  73.069  98.094  1.00 40.33  ?  106 PHE A O     1 
ATOM 500   C CB    . PHE A 1 106 ? 77.932  75.680  98.544  1.00 40.33  ?  106 PHE A CB    1 
ATOM 501   C CG    . PHE A 1 106 ? 79.342  75.874  98.986  1.00 40.33  ?  106 PHE A CG    1 
ATOM 502   C CD1   . PHE A 1 106 ? 80.017  74.843  99.613  1.00 40.33  ?  106 PHE A CD1   1 
ATOM 503   C CD2   . PHE A 1 106 ? 79.978  77.087  98.830  1.00 40.33  ?  106 PHE A CD2   1 
ATOM 504   C CE1   . PHE A 1 106 ? 81.314  75.008  100.035 1.00 40.33  ?  106 PHE A CE1   1 
ATOM 505   C CE2   . PHE A 1 106 ? 81.276  77.259  99.251  1.00 40.33  ?  106 PHE A CE2   1 
ATOM 506   C CZ    . PHE A 1 106 ? 81.946  76.219  99.858  1.00 40.33  ?  106 PHE A CZ    1 
ATOM 507   N N     . GLU A 1 107 ? 75.449  74.576  96.622  1.00 47.56  ?  107 GLU A N     1 
ATOM 508   C CA    . GLU A 1 107 ? 74.195  73.841  96.481  1.00 47.56  ?  107 GLU A CA    1 
ATOM 509   C C     . GLU A 1 107 ? 74.411  72.498  95.803  1.00 47.56  ?  107 GLU A C     1 
ATOM 510   O O     . GLU A 1 107 ? 73.874  71.479  96.254  1.00 47.56  ?  107 GLU A O     1 
ATOM 511   C CB    . GLU A 1 107 ? 73.154  74.638  95.704  1.00 47.56  ?  107 GLU A CB    1 
ATOM 512   C CG    . GLU A 1 107 ? 72.417  75.669  96.511  1.00 47.56  ?  107 GLU A CG    1 
ATOM 513   C CD    . GLU A 1 107 ? 71.282  76.296  95.728  1.00 47.56  ?  107 GLU A CD    1 
ATOM 514   O OE1   . GLU A 1 107 ? 71.186  76.037  94.510  1.00 47.56  ?  107 GLU A OE1   1 
ATOM 515   O OE2   . GLU A 1 107 ? 70.472  77.031  96.331  1.00 47.56  -1 107 GLU A OE2   1 
ATOM 516   N N     . ASP A 1 108 ? 75.219  72.463  94.743  1.00 46.28  ?  108 ASP A N     1 
ATOM 517   C CA    . ASP A 1 108 ? 75.416  71.184  94.070  1.00 46.28  ?  108 ASP A CA    1 
ATOM 518   C C     . ASP A 1 108 ? 76.275  70.239  94.904  1.00 46.28  ?  108 ASP A C     1 
ATOM 519   O O     . ASP A 1 108 ? 76.046  69.021  94.915  1.00 46.28  ?  108 ASP A O     1 
ATOM 520   C CB    . ASP A 1 108 ? 76.047  71.392  92.710  1.00 46.28  ?  108 ASP A CB    1 
ATOM 521   C CG    . ASP A 1 108 ? 75.931  70.173  91.858  1.00 46.28  ?  108 ASP A CG    1 
ATOM 522   O OD1   . ASP A 1 108 ? 74.817  69.959  91.350  1.00 46.28  ?  108 ASP A OD1   1 
ATOM 523   O OD2   . ASP A 1 108 ? 76.917  69.418  91.724  1.00 46.28  -1 108 ASP A OD2   1 
ATOM 524   N N     . ALA A 1 109 ? 77.250  70.788  95.630  1.00 41.54  ?  109 ALA A N     1 
ATOM 525   C CA    . ALA A 1 109 ? 78.064  69.968  96.514  1.00 41.54  ?  109 ALA A CA    1 
ATOM 526   C C     . ALA A 1 109 ? 77.233  69.389  97.650  1.00 41.54  ?  109 ALA A C     1 
ATOM 527   O O     . ALA A 1 109 ? 77.397  68.218  98.008  1.00 41.54  ?  109 ALA A O     1 
ATOM 528   C CB    . ALA A 1 109 ? 79.227  70.789  97.060  1.00 41.54  ?  109 ALA A CB    1 
ATOM 529   N N     . TYR A 1 110 ? 76.301  70.174  98.194  1.00 49.13  ?  110 TYR A N     1 
ATOM 530   C CA    . TYR A 1 110 ? 75.441  69.642  99.238  1.00 49.13  ?  110 TYR A CA    1 
ATOM 531   C C     . TYR A 1 110 ? 74.448  68.634  98.682  1.00 49.13  ?  110 TYR A C     1 
ATOM 532   O O     . TYR A 1 110 ? 74.036  67.719  99.403  1.00 49.13  ?  110 TYR A O     1 
ATOM 533   C CB    . TYR A 1 110 ? 74.698  70.763  99.954  1.00 49.13  ?  110 TYR A CB    1 
ATOM 534   C CG    . TYR A 1 110 ? 73.947  70.270  101.162 1.00 49.13  ?  110 TYR A CG    1 
ATOM 535   C CD1   . TYR A 1 110 ? 74.615  69.996  102.346 1.00 49.13  ?  110 TYR A CD1   1 
ATOM 536   C CD2   . TYR A 1 110 ? 72.579  70.049  101.110 1.00 49.13  ?  110 TYR A CD2   1 
ATOM 537   C CE1   . TYR A 1 110 ? 73.941  69.533  103.448 1.00 49.13  ?  110 TYR A CE1   1 
ATOM 538   C CE2   . TYR A 1 110 ? 71.897  69.583  102.204 1.00 49.13  ?  110 TYR A CE2   1 
ATOM 539   C CZ    . TYR A 1 110 ? 72.581  69.326  103.370 1.00 49.13  ?  110 TYR A CZ    1 
ATOM 540   O OH    . TYR A 1 110 ? 71.892  68.864  104.465 1.00 49.13  ?  110 TYR A OH    1 
ATOM 541   N N     . LEU A 1 111 ? 74.045  68.786  97.417  1.00 45.47  ?  111 LEU A N     1 
ATOM 542   C CA    . LEU A 1 111 ? 73.280  67.728  96.766  1.00 45.47  ?  111 LEU A CA    1 
ATOM 543   C C     . LEU A 1 111 ? 74.091  66.450  96.648  1.00 45.47  ?  111 LEU A C     1 
ATOM 544   O O     . LEU A 1 111 ? 73.527  65.353  96.683  1.00 45.47  ?  111 LEU A O     1 
ATOM 545   C CB    . LEU A 1 111 ? 72.810  68.173  95.387  1.00 45.47  ?  111 LEU A CB    1 
ATOM 546   C CG    . LEU A 1 111 ? 71.671  69.180  95.363  1.00 45.47  ?  111 LEU A CG    1 
ATOM 547   C CD1   . LEU A 1 111 ? 71.441  69.670  93.950  1.00 45.47  ?  111 LEU A CD1   1 
ATOM 548   C CD2   . LEU A 1 111 ? 70.423  68.530  95.911  1.00 45.47  ?  111 LEU A CD2   1 
ATOM 549   N N     . LEU A 1 112 ? 75.408  66.567  96.504  1.00 44.54  ?  112 LEU A N     1 
ATOM 550   C CA    . LEU A 1 112 ? 76.227  65.361  96.533  1.00 44.54  ?  112 LEU A CA    1 
ATOM 551   C C     . LEU A 1 112 ? 76.345  64.776  97.934  1.00 44.54  ?  112 LEU A C     1 
ATOM 552   O O     . LEU A 1 112 ? 76.435  63.552  98.077  1.00 44.54  ?  112 LEU A O     1 
ATOM 553   C CB    . LEU A 1 112 ? 77.615  65.631  95.971  1.00 44.54  ?  112 LEU A CB    1 
ATOM 554   C CG    . LEU A 1 112 ? 77.612  65.943  94.487  1.00 44.54  ?  112 LEU A CG    1 
ATOM 555   C CD1   . LEU A 1 112 ? 79.026  66.137  94.016  1.00 44.54  ?  112 LEU A CD1   1 
ATOM 556   C CD2   . LEU A 1 112 ? 76.928  64.834  93.727  1.00 44.54  ?  112 LEU A CD2   1 
ATOM 557   N N     . THR A 1 113 ? 76.365  65.619  98.972  1.00 49.83  ?  113 THR A N     1 
ATOM 558   C CA    . THR A 1 113 ? 76.596  65.104  100.322 1.00 49.83  ?  113 THR A CA    1 
ATOM 559   C C     . THR A 1 113 ? 75.423  64.285  100.845 1.00 49.83  ?  113 THR A C     1 
ATOM 560   O O     . THR A 1 113 ? 75.629  63.350  101.624 1.00 49.83  ?  113 THR A O     1 
ATOM 561   C CB    . THR A 1 113 ? 76.876  66.237  101.302 1.00 49.83  ?  113 THR A CB    1 
ATOM 562   O OG1   . THR A 1 113 ? 75.759  67.131  101.326 1.00 49.83  ?  113 THR A OG1   1 
ATOM 563   C CG2   . THR A 1 113 ? 78.125  66.986  100.922 1.00 49.83  ?  113 THR A CG2   1 
ATOM 564   N N     . LEU A 1 114 ? 74.196  64.608  100.440 1.00 53.20  ?  114 LEU A N     1 
ATOM 565   C CA    . LEU A 1 114 ? 73.053  63.821  100.887 1.00 53.20  ?  114 LEU A CA    1 
ATOM 566   C C     . LEU A 1 114 ? 72.936  62.493  100.163 1.00 53.20  ?  114 LEU A C     1 
ATOM 567   O O     . LEU A 1 114 ? 72.107  61.665  100.554 1.00 53.20  ?  114 LEU A O     1 
ATOM 568   C CB    . LEU A 1 114 ? 71.752  64.590  100.696 1.00 53.20  ?  114 LEU A CB    1 
ATOM 569   C CG    . LEU A 1 114 ? 71.536  65.829  101.549 1.00 53.20  ?  114 LEU A CG    1 
ATOM 570   C CD1   . LEU A 1 114 ? 70.222  66.474  101.162 1.00 53.20  ?  114 LEU A CD1   1 
ATOM 571   C CD2   . LEU A 1 114 ? 71.549  65.467  103.016 1.00 53.20  ?  114 LEU A CD2   1 
ATOM 572   N N     . HIS A 1 115 ? 73.722  62.280  99.113  1.00 52.75  ?  115 HIS A N     1 
ATOM 573   C CA    . HIS A 1 115 ? 73.669  61.018  98.398  1.00 52.75  ?  115 HIS A CA    1 
ATOM 574   C C     . HIS A 1 115 ? 74.396  59.923  99.162  1.00 52.75  ?  115 HIS A C     1 
ATOM 575   O O     . HIS A 1 115 ? 73.920  58.786  99.226  1.00 52.75  ?  115 HIS A O     1 
ATOM 576   C CB    . HIS A 1 115 ? 74.272  61.198  97.012  1.00 52.75  ?  115 HIS A CB    1 
ATOM 577   C CG    . HIS A 1 115 ? 74.076  60.025  96.112  1.00 52.75  ?  115 HIS A CG    1 
ATOM 578   N ND1   . HIS A 1 115 ? 74.792  59.862  94.949  1.00 52.75  ?  115 HIS A ND1   1 
ATOM 579   C CD2   . HIS A 1 115 ? 73.237  58.967  96.192  1.00 52.75  ?  115 HIS A CD2   1 
ATOM 580   C CE1   . HIS A 1 115 ? 74.414  58.744  94.359  1.00 52.75  ?  115 HIS A CE1   1 
ATOM 581   N NE2   . HIS A 1 115 ? 73.470  58.183  95.090  1.00 52.75  ?  115 HIS A NE2   1 
ATOM 582   N N     . ALA A 1 116 ? 75.536  60.251  99.764  1.00 52.50  ?  116 ALA A N     1 
ATOM 583   C CA    . ALA A 1 116 ? 76.391  59.271  100.414 1.00 52.50  ?  116 ALA A CA    1 
ATOM 584   C C     . ALA A 1 116 ? 76.068  59.085  101.889 1.00 52.50  ?  116 ALA A C     1 
ATOM 585   O O     . ALA A 1 116 ? 76.897  58.547  102.630 1.00 52.50  ?  116 ALA A O     1 
ATOM 586   C CB    . ALA A 1 116 ? 77.858  59.665  100.247 1.00 52.50  ?  116 ALA A CB    1 
ATOM 587   N N     . GLY A 1 117 ? 74.894  59.521  102.335 1.00 52.94  ?  117 GLY A N     1 
ATOM 588   C CA    . GLY A 1 117 ? 74.512  59.387  103.724 1.00 52.94  ?  117 GLY A CA    1 
ATOM 589   C C     . GLY A 1 117 ? 75.076  60.438  104.650 1.00 52.94  ?  117 GLY A C     1 
ATOM 590   O O     . GLY A 1 117 ? 74.698  60.467  105.827 1.00 52.94  ?  117 GLY A O     1 
ATOM 591   N N     . ARG A 1 118 ? 75.958  61.301  104.166 1.00 56.68  ?  118 ARG A N     1 
ATOM 592   C CA    . ARG A 1 118 ? 76.550  62.330  104.996 1.00 56.68  ?  118 ARG A CA    1 
ATOM 593   C C     . ARG A 1 118 ? 75.549  63.446  105.264 1.00 56.68  ?  118 ARG A C     1 
ATOM 594   O O     . ARG A 1 118 ? 74.471  63.515  104.669 1.00 56.68  ?  118 ARG A O     1 
ATOM 595   C CB    . ARG A 1 118 ? 77.775  62.932  104.318 1.00 56.68  ?  118 ARG A CB    1 
ATOM 596   C CG    . ARG A 1 118 ? 78.925  61.996  104.064 1.00 56.68  ?  118 ARG A CG    1 
ATOM 597   C CD    . ARG A 1 118 ? 80.020  62.777  103.378 1.00 56.68  ?  118 ARG A CD    1 
ATOM 598   N NE    . ARG A 1 118 ? 81.165  61.966  103.000 1.00 56.68  ?  118 ARG A NE    1 
ATOM 599   C CZ    . ARG A 1 118 ? 82.197  62.435  102.312 1.00 56.68  ?  118 ARG A CZ    1 
ATOM 600   N NH1   . ARG A 1 118 ? 82.214  63.710  101.955 1.00 56.68  1  118 ARG A NH1   1 
ATOM 601   N NH2   . ARG A 1 118 ? 83.209  61.645  101.991 1.00 56.68  ?  118 ARG A NH2   1 
ATOM 602   N N     . VAL A 1 119 ? 75.923  64.327  106.189 1.00 59.38  ?  119 VAL A N     1 
ATOM 603   C CA    . VAL A 1 119 ? 75.325  65.651  106.314 1.00 59.38  ?  119 VAL A CA    1 
ATOM 604   C C     . VAL A 1 119 ? 76.487  66.633  106.235 1.00 59.38  ?  119 VAL A C     1 
ATOM 605   O O     . VAL A 1 119 ? 76.353  67.751  105.727 1.00 59.38  ?  119 VAL A O     1 
ATOM 606   C CB    . VAL A 1 119 ? 74.529  65.791  107.626 1.00 59.38  ?  119 VAL A CB    1 
ATOM 607   C CG1   . VAL A 1 119 ? 73.944  67.183  107.776 1.00 59.38  ?  119 VAL A CG1   1 
ATOM 608   C CG2   . VAL A 1 119 ? 73.419  64.752  107.699 1.00 59.38  ?  119 VAL A CG2   1 
ATOM 609   N N     . THR A 1 120 ? 77.657  66.177  106.665 1.00 61.04  ?  120 THR A N     1 
ATOM 610   C CA    . THR A 1 120 ? 78.856  66.996  106.678 1.00 61.04  ?  120 THR A CA    1 
ATOM 611   C C     . THR A 1 120 ? 79.388  67.148  105.258 1.00 61.04  ?  120 THR A C     1 
ATOM 612   O O     . THR A 1 120 ? 79.306  66.218  104.453 1.00 61.04  ?  120 THR A O     1 
ATOM 613   C CB    . THR A 1 120 ? 79.903  66.340  107.578 1.00 61.04  ?  120 THR A CB    1 
ATOM 614   O OG1   . THR A 1 120 ? 79.283  65.952  108.808 1.00 61.04  ?  120 THR A OG1   1 
ATOM 615   C CG2   . THR A 1 120 ? 81.016  67.305  107.910 1.00 61.04  ?  120 THR A CG2   1 
ATOM 616   N N     . LEU A 1 121 ? 79.933  68.324  104.947 1.00 52.59  ?  121 LEU A N     1 
ATOM 617   C CA    . LEU A 1 121 ? 80.406  68.653  103.601 1.00 52.59  ?  121 LEU A CA    1 
ATOM 618   C C     . LEU A 1 121 ? 81.931  68.582  103.580 1.00 52.59  ?  121 LEU A C     1 
ATOM 619   O O     . LEU A 1 121 ? 82.608  69.546  103.930 1.00 52.59  ?  121 LEU A O     1 
ATOM 620   C CB    . LEU A 1 121 ? 79.886  70.029  103.199 1.00 52.59  ?  121 LEU A CB    1 
ATOM 621   C CG    . LEU A 1 121 ? 80.113  70.595  101.800 1.00 52.59  ?  121 LEU A CG    1 
ATOM 622   C CD1   . LEU A 1 121 ? 78.880  71.326  101.379 1.00 52.59  ?  121 LEU A CD1   1 
ATOM 623   C CD2   . LEU A 1 121 ? 81.249  71.580  101.784 1.00 52.59  ?  121 LEU A CD2   1 
ATOM 624   N N     . PHE A 1 122 ? 82.472  67.439  103.167 1.00 51.94  ?  122 PHE A N     1 
ATOM 625   C CA    . PHE A 1 122 ? 83.910  67.219  103.149 1.00 51.94  ?  122 PHE A CA    1 
ATOM 626   C C     . PHE A 1 122 ? 84.549  67.808  101.892 1.00 51.94  ?  122 PHE A C     1 
ATOM 627   O O     . PHE A 1 122 ? 83.857  68.108  100.924 1.00 51.94  ?  122 PHE A O     1 
ATOM 628   C CB    . PHE A 1 122 ? 84.200  65.720  103.251 1.00 51.94  ?  122 PHE A CB    1 
ATOM 629   C CG    . PHE A 1 122 ? 84.020  65.155  104.625 1.00 51.94  ?  122 PHE A CG    1 
ATOM 630   C CD1   . PHE A 1 122 ? 84.971  65.370  105.599 1.00 51.94  ?  122 PHE A CD1   1 
ATOM 631   C CD2   . PHE A 1 122 ? 82.909  64.385  104.940 1.00 51.94  ?  122 PHE A CD2   1 
ATOM 632   C CE1   . PHE A 1 122 ? 84.816  64.848  106.865 1.00 51.94  ?  122 PHE A CE1   1 
ATOM 633   C CE2   . PHE A 1 122 ? 82.755  63.854  106.204 1.00 51.94  ?  122 PHE A CE2   1 
ATOM 634   C CZ    . PHE A 1 122 ? 83.706  64.085  107.169 1.00 51.94  ?  122 PHE A CZ    1 
ATOM 635   N N     . PRO A 1 123 ? 85.875  68.002  101.887 1.00 49.60  ?  123 PRO A N     1 
ATOM 636   C CA    . PRO A 1 123 ? 86.544  68.459  100.656 1.00 49.60  ?  123 PRO A CA    1 
ATOM 637   C C     . PRO A 1 123 ? 86.606  67.431  99.545  1.00 49.60  ?  123 PRO A C     1 
ATOM 638   O O     . PRO A 1 123 ? 86.996  67.788  98.427  1.00 49.60  ?  123 PRO A O     1 
ATOM 639   C CB    . PRO A 1 123 ? 87.951  68.823  101.131 1.00 49.60  ?  123 PRO A CB    1 
ATOM 640   C CG    . PRO A 1 123 ? 87.785  69.150  102.550 1.00 49.60  ?  123 PRO A CG    1 
ATOM 641   C CD    . PRO A 1 123 ? 86.734  68.221  103.062 1.00 49.60  ?  123 PRO A CD    1 
ATOM 642   N N     . LYS A 1 124 ? 86.253  66.174  99.801  1.00 45.13  ?  124 LYS A N     1 
ATOM 643   C CA    . LYS A 1 124 ? 86.047  65.238  98.707  1.00 45.13  ?  124 LYS A CA    1 
ATOM 644   C C     . LYS A 1 124 ? 84.824  65.612  97.880  1.00 45.13  ?  124 LYS A C     1 
ATOM 645   O O     . LYS A 1 124 ? 84.756  65.275  96.695  1.00 45.13  ?  124 LYS A O     1 
ATOM 646   C CB    . LYS A 1 124 ? 85.901  63.824  99.270  1.00 45.13  ?  124 LYS A CB    1 
ATOM 647   C CG    . LYS A 1 124 ? 85.923  62.706  98.251  1.00 45.13  ?  124 LYS A CG    1 
ATOM 648   C CD    . LYS A 1 124 ? 85.650  61.375  98.920  1.00 45.13  ?  124 LYS A CD    1 
ATOM 649   C CE    . LYS A 1 124 ? 86.938  60.688  99.306  1.00 45.13  ?  124 LYS A CE    1 
ATOM 650   N NZ    . LYS A 1 124 ? 87.521  61.316  100.519 1.00 45.13  1  124 LYS A NZ    1 
ATOM 651   N N     . ASP A 1 125 ? 83.875  66.335  98.473  1.00 47.89  ?  125 ASP A N     1 
ATOM 652   C CA    . ASP A 1 125 ? 82.627  66.656  97.798  1.00 47.89  ?  125 ASP A CA    1 
ATOM 653   C C     . ASP A 1 125 ? 82.787  67.828  96.838  1.00 47.89  ?  125 ASP A C     1 
ATOM 654   O O     . ASP A 1 125 ? 82.180  67.835  95.764  1.00 47.89  ?  125 ASP A O     1 
ATOM 655   C CB    . ASP A 1 125 ? 81.557  66.970  98.840  1.00 47.89  ?  125 ASP A CB    1 
ATOM 656   C CG    . ASP A 1 125 ? 81.289  65.802  99.763  1.00 47.89  ?  125 ASP A CG    1 
ATOM 657   O OD1   . ASP A 1 125 ? 81.395  64.648  99.308  1.00 47.89  ?  125 ASP A OD1   1 
ATOM 658   O OD2   . ASP A 1 125 ? 81.007  66.033  100.956 1.00 47.89  -1 125 ASP A OD2   1 
ATOM 659   N N     . VAL A 1 126 ? 83.590  68.827  97.201  1.00 40.62  ?  126 VAL A N     1 
ATOM 660   C CA    . VAL A 1 126 ? 83.717  70.006  96.354  1.00 40.62  ?  126 VAL A CA    1 
ATOM 661   C C     . VAL A 1 126 ? 84.583  69.707  95.140  1.00 40.62  ?  126 VAL A C     1 
ATOM 662   O O     . VAL A 1 126 ? 84.267  70.124  94.022  1.00 40.62  ?  126 VAL A O     1 
ATOM 663   C CB    . VAL A 1 126 ? 84.264  71.185  97.176  1.00 40.62  ?  126 VAL A CB    1 
ATOM 664   C CG1   . VAL A 1 126 ? 84.462  72.413  96.308  1.00 40.62  ?  126 VAL A CG1   1 
ATOM 665   C CG2   . VAL A 1 126 ? 83.321  71.500  98.308  1.00 40.62  ?  126 VAL A CG2   1 
ATOM 666   N N     . GLN A 1 127 ? 85.650  68.929  95.315  1.00 44.97  ?  127 GLN A N     1 
ATOM 667   C CA    . GLN A 1 127 ? 86.502  68.582  94.183  1.00 44.97  ?  127 GLN A CA    1 
ATOM 668   C C     . GLN A 1 127 ? 85.887  67.544  93.256  1.00 44.97  ?  127 GLN A C     1 
ATOM 669   O O     . GLN A 1 127 ? 86.529  67.176  92.269  1.00 44.97  ?  127 GLN A O     1 
ATOM 670   C CB    . GLN A 1 127 ? 87.857  68.075  94.671  1.00 44.97  ?  127 GLN A CB    1 
ATOM 671   C CG    . GLN A 1 127 ? 88.724  69.135  95.310  1.00 44.97  ?  127 GLN A CG    1 
ATOM 672   C CD    . GLN A 1 127 ? 90.055  68.584  95.768  1.00 44.97  ?  127 GLN A CD    1 
ATOM 673   O OE1   . GLN A 1 127 ? 90.305  67.384  95.675  1.00 44.97  ?  127 GLN A OE1   1 
ATOM 674   N NE2   . GLN A 1 127 ? 90.921  69.458  96.263  1.00 44.97  ?  127 GLN A NE2   1 
ATOM 675   N N     . LEU A 1 128 ? 84.683  67.055  93.538  1.00 37.67  ?  128 LEU A N     1 
ATOM 676   C CA    . LEU A 1 128 ? 83.987  66.159  92.632  1.00 37.67  ?  128 LEU A CA    1 
ATOM 677   C C     . LEU A 1 128 ? 82.863  66.850  91.881  1.00 37.67  ?  128 LEU A C     1 
ATOM 678   O O     . LEU A 1 128 ? 82.571  66.479  90.742  1.00 37.67  ?  128 LEU A O     1 
ATOM 679   C CB    . LEU A 1 128 ? 83.437  64.961  93.405  1.00 37.67  ?  128 LEU A CB    1 
ATOM 680   C CG    . LEU A 1 128 ? 82.847  63.828  92.583  1.00 37.67  ?  128 LEU A CG    1 
ATOM 681   C CD1   . LEU A 1 128 ? 83.907  63.303  91.654  1.00 37.67  ?  128 LEU A CD1   1 
ATOM 682   C CD2   . LEU A 1 128 ? 82.371  62.742  93.502  1.00 37.67  ?  128 LEU A CD2   1 
ATOM 683   N N     . ALA A 1 129 ? 82.262  67.882  92.463  1.00 37.35  ?  129 ALA A N     1 
ATOM 684   C CA    . ALA A 1 129 ? 81.227  68.649  91.784  1.00 37.35  ?  129 ALA A CA    1 
ATOM 685   C C     . ALA A 1 129 ? 81.784  69.670  90.807  1.00 37.35  ?  129 ALA A C     1 
ATOM 686   O O     . ALA A 1 129 ? 81.018  70.488  90.292  1.00 37.35  ?  129 ALA A O     1 
ATOM 687   C CB    . ALA A 1 129 ? 80.338  69.363  92.798  1.00 37.35  ?  129 ALA A CB    1 
ATOM 688   N N     . ARG A 1 130 ? 83.088  69.663  90.553  1.00 34.92  ?  130 ARG A N     1 
ATOM 689   C CA    . ARG A 1 130 ? 83.657  70.440  89.466  1.00 34.92  ?  130 ARG A CA    1 
ATOM 690   C C     . ARG A 1 130 ? 84.042  69.583  88.273  1.00 34.92  ?  130 ARG A C     1 
ATOM 691   O O     . ARG A 1 130 ? 84.011  70.072  87.141  1.00 34.92  ?  130 ARG A O     1 
ATOM 692   C CB    . ARG A 1 130 ? 84.888  71.206  89.945  1.00 34.92  ?  130 ARG A CB    1 
ATOM 693   C CG    . ARG A 1 130 ? 84.591  72.266  90.967  1.00 34.92  ?  130 ARG A CG    1 
ATOM 694   C CD    . ARG A 1 130 ? 85.872  72.935  91.383  1.00 34.92  ?  130 ARG A CD    1 
ATOM 695   N NE    . ARG A 1 130 ? 86.447  73.685  90.277  1.00 34.92  ?  130 ARG A NE    1 
ATOM 696   C CZ    . ARG A 1 130 ? 87.677  74.179  90.275  1.00 34.92  ?  130 ARG A CZ    1 
ATOM 697   N NH1   . ARG A 1 130 ? 88.467  73.986  91.321  1.00 34.92  1  130 ARG A NH1   1 
ATOM 698   N NH2   . ARG A 1 130 ? 88.120  74.854  89.225  1.00 34.92  ?  130 ARG A NH2   1 
ATOM 699   N N     . ARG A 1 131 ? 84.401  68.320  88.493  1.00 39.18  ?  131 ARG A N     1 
ATOM 700   C CA    . ARG A 1 131 ? 84.739  67.454  87.372  1.00 39.18  ?  131 ARG A CA    1 
ATOM 701   C C     . ARG A 1 131 ? 83.489  66.958  86.655  1.00 39.18  ?  131 ARG A C     1 
ATOM 702   O O     . ARG A 1 131 ? 83.539  66.678  85.454  1.00 39.18  ?  131 ARG A O     1 
ATOM 703   C CB    . ARG A 1 131 ? 85.608  66.291  87.862  1.00 39.18  ?  131 ARG A CB    1 
ATOM 704   C CG    . ARG A 1 131 ? 86.230  65.425  86.769  1.00 39.18  ?  131 ARG A CG    1 
ATOM 705   C CD    . ARG A 1 131 ? 85.463  64.127  86.579  1.00 39.18  ?  131 ARG A CD    1 
ATOM 706   N NE    . ARG A 1 131 ? 86.009  63.298  85.506  1.00 39.18  ?  131 ARG A NE    1 
ATOM 707   C CZ    . ARG A 1 131 ? 85.636  63.383  84.233  1.00 39.18  ?  131 ARG A CZ    1 
ATOM 708   N NH1   . ARG A 1 131 ? 84.707  64.254  83.867  1.00 39.18  1  131 ARG A NH1   1 
ATOM 709   N NH2   . ARG A 1 131 ? 86.184  62.588  83.325  1.00 39.18  ?  131 ARG A NH2   1 
ATOM 710   N N     . ILE A 1 132 ? 82.367  66.849  87.362  1.00 31.17  ?  132 ILE A N     1 
ATOM 711   C CA    . ILE A 1 132 ? 81.117  66.490  86.705  1.00 31.17  ?  132 ILE A CA    1 
ATOM 712   C C     . ILE A 1 132 ? 80.624  67.639  85.842  1.00 31.17  ?  132 ILE A C     1 
ATOM 713   O O     . ILE A 1 132 ? 80.198  67.438  84.699  1.00 31.17  ?  132 ILE A O     1 
ATOM 714   C CB    . ILE A 1 132 ? 80.071  66.074  87.752  1.00 31.17  ?  132 ILE A CB    1 
ATOM 715   C CG1   . ILE A 1 132 ? 80.496  64.780  88.429  1.00 31.17  ?  132 ILE A CG1   1 
ATOM 716   C CG2   . ILE A 1 132 ? 78.709  65.900  87.134  1.00 31.17  ?  132 ILE A CG2   1 
ATOM 717   C CD1   . ILE A 1 132 ? 79.632  64.418  89.586  1.00 31.17  ?  132 ILE A CD1   1 
ATOM 718   N N     . ARG A 1 133 ? 80.703  68.862  86.357  1.00 33.78  ?  133 ARG A N     1 
ATOM 719   C CA    . ARG A 1 133 ? 80.197  70.007  85.615  1.00 33.78  ?  133 ARG A CA    1 
ATOM 720   C C     . ARG A 1 133 ? 81.115  70.378  84.457  1.00 33.78  ?  133 ARG A C     1 
ATOM 721   O O     . ARG A 1 133 ? 80.642  70.848  83.417  1.00 33.78  ?  133 ARG A O     1 
ATOM 722   C CB    . ARG A 1 133 ? 80.012  71.188  86.564  1.00 33.78  ?  133 ARG A CB    1 
ATOM 723   C CG    . ARG A 1 133 ? 79.328  72.396  85.958  1.00 33.78  ?  133 ARG A CG    1 
ATOM 724   C CD    . ARG A 1 133 ? 79.131  73.469  86.998  1.00 33.78  ?  133 ARG A CD    1 
ATOM 725   N NE    . ARG A 1 133 ? 78.207  73.024  88.032  1.00 33.78  ?  133 ARG A NE    1 
ATOM 726   C CZ    . ARG A 1 133 ? 77.987  73.679  89.163  1.00 33.78  ?  133 ARG A CZ    1 
ATOM 727   N NH1   . ARG A 1 133 ? 78.624  74.813  89.408  1.00 33.78  1  133 ARG A NH1   1 
ATOM 728   N NH2   . ARG A 1 133 ? 77.130  73.199  90.049  1.00 33.78  ?  133 ARG A NH2   1 
ATOM 729   N N     . GLY A 1 134 ? 82.416  70.159  84.602  1.00 30.54  ?  134 GLY A N     1 
ATOM 730   C CA    . GLY A 1 134 ? 83.351  70.428  83.525  1.00 30.54  ?  134 GLY A CA    1 
ATOM 731   C C     . GLY A 1 134 ? 83.633  71.899  83.297  1.00 30.54  ?  134 GLY A C     1 
ATOM 732   O O     . GLY A 1 134 ? 84.282  72.268  82.320  1.00 30.54  ?  134 GLY A O     1 
ATOM 733   N N     . ARG B 2 24  ? 99.264  90.826  105.021 1.00 77.40  ?  23  ARG B N     1 
ATOM 734   C CA    . ARG B 2 24  ? 100.341 89.920  104.645 1.00 77.40  ?  23  ARG B CA    1 
ATOM 735   C C     . ARG B 2 24  ? 99.792  88.547  104.281 1.00 77.40  ?  23  ARG B C     1 
ATOM 736   O O     . ARG B 2 24  ? 100.501 87.715  103.719 1.00 77.40  ?  23  ARG B O     1 
ATOM 737   C CB    . ARG B 2 24  ? 101.354 89.785  105.781 1.00 77.40  ?  23  ARG B CB    1 
ATOM 738   C CG    . ARG B 2 24  ? 100.822 89.025  106.979 1.00 77.40  ?  23  ARG B CG    1 
ATOM 739   C CD    . ARG B 2 24  ? 101.827 88.996  108.107 1.00 77.40  ?  23  ARG B CD    1 
ATOM 740   N NE    . ARG B 2 24  ? 101.999 90.310  108.713 1.00 77.40  ?  23  ARG B NE    1 
ATOM 741   C CZ    . ARG B 2 24  ? 102.926 90.592  109.619 1.00 77.40  ?  23  ARG B CZ    1 
ATOM 742   N NH1   . ARG B 2 24  ? 103.767 89.650  110.022 1.00 77.40  1  23  ARG B NH1   1 
ATOM 743   N NH2   . ARG B 2 24  ? 103.014 91.815  110.121 1.00 77.40  ?  23  ARG B NH2   1 
ATOM 744   N N     . ASP B 2 25  ? 98.521  88.316  104.605 1.00 72.89  ?  24  ASP B N     1 
ATOM 745   C CA    . ASP B 2 25  ? 97.895  87.020  104.374 1.00 72.89  ?  24  ASP B CA    1 
ATOM 746   C C     . ASP B 2 25  ? 97.258  86.934  102.993 1.00 72.89  ?  24  ASP B C     1 
ATOM 747   O O     . ASP B 2 25  ? 97.310  85.875  102.355 1.00 72.89  ?  24  ASP B O     1 
ATOM 748   C CB    . ASP B 2 25  ? 96.853  86.751  105.459 1.00 72.89  ?  24  ASP B CB    1 
ATOM 749   C CG    . ASP B 2 25  ? 97.473  86.591  106.835 1.00 72.89  ?  24  ASP B CG    1 
ATOM 750   O OD1   . ASP B 2 25  ? 98.636  86.145  106.916 1.00 72.89  ?  24  ASP B OD1   1 
ATOM 751   O OD2   . ASP B 2 25  ? 96.802  86.916  107.837 1.00 72.89  -1 24  ASP B OD2   1 
ATOM 752   N N     . ASN B 2 26  ? 96.586  88.013  102.572 1.00 59.33  ?  25  ASN B N     1 
ATOM 753   C CA    . ASN B 2 26  ? 96.231  88.348  101.191 1.00 59.33  ?  25  ASN B CA    1 
ATOM 754   C C     . ASN B 2 26  ? 95.141  87.487  100.566 1.00 59.33  ?  25  ASN B C     1 
ATOM 755   O O     . ASN B 2 26  ? 94.661  87.803  99.476  1.00 59.33  ?  25  ASN B O     1 
ATOM 756   C CB    . ASN B 2 26  ? 97.473  88.308  100.299 1.00 59.33  ?  25  ASN B CB    1 
ATOM 757   C CG    . ASN B 2 26  ? 98.401  89.465  100.554 1.00 59.33  ?  25  ASN B CG    1 
ATOM 758   O OD1   . ASN B 2 26  ? 97.961  90.606  100.692 1.00 59.33  ?  25  ASN B OD1   1 
ATOM 759   N ND2   . ASN B 2 26  ? 99.696  89.182  100.631 1.00 59.33  ?  25  ASN B ND2   1 
ATOM 760   N N     . ILE B 2 27  ? 94.734  86.409  101.224 1.00 52.24  ?  26  ILE B N     1 
ATOM 761   C CA    . ILE B 2 27  ? 93.580  85.659  100.753 1.00 52.24  ?  26  ILE B CA    1 
ATOM 762   C C     . ILE B 2 27  ? 92.718  85.362  101.970 1.00 52.24  ?  26  ILE B C     1 
ATOM 763   O O     . ILE B 2 27  ? 91.569  84.922  101.851 1.00 52.24  ?  26  ILE B O     1 
ATOM 764   C CB    . ILE B 2 27  ? 94.002  84.385  100.003 1.00 52.24  ?  26  ILE B CB    1 
ATOM 765   C CG1   . ILE B 2 27  ? 92.883  83.912  99.076  1.00 52.24  ?  26  ILE B CG1   1 
ATOM 766   C CG2   . ILE B 2 27  ? 94.363  83.282  100.980 1.00 52.24  ?  26  ILE B CG2   1 
ATOM 767   C CD1   . ILE B 2 27  ? 93.342  82.935  98.037  1.00 52.24  ?  26  ILE B CD1   1 
ATOM 768   N N     . GLN B 2 28  ? 93.257  85.641  103.154 1.00 53.43  ?  27  GLN B N     1 
ATOM 769   C CA    . GLN B 2 28  ? 92.504  85.481  104.389 1.00 53.43  ?  27  GLN B CA    1 
ATOM 770   C C     . GLN B 2 28  ? 91.564  86.644  104.661 1.00 53.43  ?  27  GLN B C     1 
ATOM 771   O O     . GLN B 2 28  ? 90.939  86.675  105.725 1.00 53.43  ?  27  GLN B O     1 
ATOM 772   C CB    . GLN B 2 28  ? 93.454  85.300  105.571 1.00 53.43  ?  27  GLN B CB    1 
ATOM 773   C CG    . GLN B 2 28  ? 94.303  84.055  105.470 1.00 53.43  ?  27  GLN B CG    1 
ATOM 774   C CD    . GLN B 2 28  ? 93.476  82.793  105.490 1.00 53.43  ?  27  GLN B CD    1 
ATOM 775   O OE1   . GLN B 2 28  ? 92.496  82.689  106.227 1.00 53.43  ?  27  GLN B OE1   1 
ATOM 776   N NE2   . GLN B 2 28  ? 93.861  81.824  104.672 1.00 53.43  ?  27  GLN B NE2   1 
ATOM 777   N N     . GLY B 2 29  ? 91.463  87.606  103.740 1.00 53.90  ?  28  GLY B N     1 
ATOM 778   C CA    . GLY B 2 29  ? 90.350  88.534  103.773 1.00 53.90  ?  28  GLY B CA    1 
ATOM 779   C C     . GLY B 2 29  ? 89.022  87.830  103.594 1.00 53.90  ?  28  GLY B C     1 
ATOM 780   O O     . GLY B 2 29  ? 88.007  88.260  104.146 1.00 53.90  ?  28  GLY B O     1 
ATOM 781   N N     . ILE B 2 30  ? 89.007  86.755  102.812 1.00 51.48  ?  29  ILE B N     1 
ATOM 782   C CA    . ILE B 2 30  ? 87.959  85.750  102.926 1.00 51.48  ?  29  ILE B CA    1 
ATOM 783   C C     . ILE B 2 30  ? 88.115  85.108  104.299 1.00 51.48  ?  29  ILE B C     1 
ATOM 784   O O     . ILE B 2 30  ? 89.144  84.493  104.589 1.00 51.48  ?  29  ILE B O     1 
ATOM 785   C CB    . ILE B 2 30  ? 88.060  84.709  101.810 1.00 51.48  ?  29  ILE B CB    1 
ATOM 786   C CG1   . ILE B 2 30  ? 87.988  85.399  100.454 1.00 51.48  ?  29  ILE B CG1   1 
ATOM 787   C CG2   . ILE B 2 30  ? 86.963  83.679  101.942 1.00 51.48  ?  29  ILE B CG2   1 
ATOM 788   C CD1   . ILE B 2 30  ? 86.711  86.151  100.237 1.00 51.48  ?  29  ILE B CD1   1 
ATOM 789   N N     . THR B 2 31  ? 87.114  85.259  105.154 1.00 55.03  ?  30  THR B N     1 
ATOM 790   C CA    . THR B 2 31  ? 87.284  84.883  106.544 1.00 55.03  ?  30  THR B CA    1 
ATOM 791   C C     . THR B 2 31  ? 86.805  83.459  106.786 1.00 55.03  ?  30  THR B C     1 
ATOM 792   O O     . THR B 2 31  ? 86.298  82.777  105.896 1.00 55.03  ?  30  THR B O     1 
ATOM 793   C CB    . THR B 2 31  ? 86.533  85.841  107.454 1.00 55.03  ?  30  THR B CB    1 
ATOM 794   O OG1   . THR B 2 31  ? 85.128  85.672  107.256 1.00 55.03  ?  30  THR B OG1   1 
ATOM 795   C CG2   . THR B 2 31  ? 86.897  87.262  107.116 1.00 55.03  ?  30  THR B CG2   1 
ATOM 796   N N     . LYS B 2 32  ? 86.976  83.008  108.011 1.00 54.74  ?  31  LYS B N     1 
ATOM 797   C CA    . LYS B 2 32  ? 86.427  81.732  108.441 1.00 54.74  ?  31  LYS B CA    1 
ATOM 798   C C     . LYS B 2 32  ? 84.896  81.725  108.553 1.00 54.74  ?  31  LYS B C     1 
ATOM 799   O O     . LYS B 2 32  ? 84.313  80.661  108.319 1.00 54.74  ?  31  LYS B O     1 
ATOM 800   C CB    . LYS B 2 32  ? 87.056  81.296  109.769 1.00 54.74  ?  31  LYS B CB    1 
ATOM 801   C CG    . LYS B 2 32  ? 88.567  81.151  109.734 1.00 54.74  ?  31  LYS B CG    1 
ATOM 802   C CD    . LYS B 2 32  ? 89.006  79.951  108.921 1.00 54.74  ?  31  LYS B CD    1 
ATOM 803   C CE    . LYS B 2 32  ? 90.523  79.845  108.873 1.00 54.74  ?  31  LYS B CE    1 
ATOM 804   N NZ    . LYS B 2 32  ? 91.106  79.524  110.203 1.00 54.74  1  31  LYS B NZ    1 
ATOM 805   N N     . PRO B 2 33  ? 84.187  82.808  108.916 1.00 55.38  ?  32  PRO B N     1 
ATOM 806   C CA    . PRO B 2 33  ? 82.725  82.763  108.786 1.00 55.38  ?  32  PRO B CA    1 
ATOM 807   C C     . PRO B 2 33  ? 82.114  83.330  107.512 1.00 55.38  ?  32  PRO B C     1 
ATOM 808   O O     . PRO B 2 33  ? 80.894  83.177  107.346 1.00 55.38  ?  32  PRO B O     1 
ATOM 809   C CB    . PRO B 2 33  ? 82.251  83.583  109.988 1.00 55.38  ?  32  PRO B CB    1 
ATOM 810   C CG    . PRO B 2 33  ? 83.286  84.545  110.190 1.00 55.38  ?  32  PRO B CG    1 
ATOM 811   C CD    . PRO B 2 33  ? 84.557  83.838  109.913 1.00 55.38  ?  32  PRO B CD    1 
ATOM 812   N N     . ALA B 2 34  ? 82.864  83.999  106.632 1.00 48.61  ?  33  ALA B N     1 
ATOM 813   C CA    . ALA B 2 34  ? 82.253  84.433  105.377 1.00 48.61  ?  33  ALA B CA    1 
ATOM 814   C C     . ALA B 2 34  ? 81.939  83.244  104.488 1.00 48.61  ?  33  ALA B C     1 
ATOM 815   O O     . ALA B 2 34  ? 80.895  83.211  103.823 1.00 48.61  ?  33  ALA B O     1 
ATOM 816   C CB    . ALA B 2 34  ? 83.173  85.411  104.645 1.00 48.61  ?  33  ALA B CB    1 
ATOM 817   N N     . ILE B 2 35  ? 82.821  82.244  104.501 1.00 45.71  ?  34  ILE B N     1 
ATOM 818   C CA    . ILE B 2 35  ? 82.532  80.969  103.866 1.00 45.71  ?  34  ILE B CA    1 
ATOM 819   C C     . ILE B 2 35  ? 81.352  80.303  104.549 1.00 45.71  ?  34  ILE B C     1 
ATOM 820   O O     . ILE B 2 35  ? 80.528  79.648  103.897 1.00 45.71  ?  34  ILE B O     1 
ATOM 821   C CB    . ILE B 2 35  ? 83.786  80.084  103.898 1.00 45.71  ?  34  ILE B CB    1 
ATOM 822   C CG1   . ILE B 2 35  ? 84.935  80.814  103.218 1.00 45.71  ?  34  ILE B CG1   1 
ATOM 823   C CG2   . ILE B 2 35  ? 83.558  78.790  103.166 1.00 45.71  ?  34  ILE B CG2   1 
ATOM 824   C CD1   . ILE B 2 35  ? 86.267  80.161  103.440 1.00 45.71  ?  34  ILE B CD1   1 
ATOM 825   N N     . ARG B 2 36  ? 81.212  80.509  105.857 1.00 48.90  ?  35  ARG B N     1 
ATOM 826   C CA    . ARG B 2 36  ? 80.060  79.964  106.557 1.00 48.90  ?  35  ARG B CA    1 
ATOM 827   C C     . ARG B 2 36  ? 78.776  80.666  106.141 1.00 48.90  ?  35  ARG B C     1 
ATOM 828   O O     . ARG B 2 36  ? 77.749  80.008  105.975 1.00 48.90  ?  35  ARG B O     1 
ATOM 829   C CB    . ARG B 2 36  ? 80.272  80.044  108.065 1.00 48.90  ?  35  ARG B CB    1 
ATOM 830   C CG    . ARG B 2 36  ? 79.210  79.347  108.888 1.00 48.90  ?  35  ARG B CG    1 
ATOM 831   C CD    . ARG B 2 36  ? 79.587  79.369  110.354 1.00 48.90  ?  35  ARG B CD    1 
ATOM 832   N NE    . ARG B 2 36  ? 80.795  78.589  110.591 1.00 48.90  ?  35  ARG B NE    1 
ATOM 833   C CZ    . ARG B 2 36  ? 80.804  77.277  110.788 1.00 48.90  ?  35  ARG B CZ    1 
ATOM 834   N NH1   . ARG B 2 36  ? 79.667  76.600  110.787 1.00 48.90  1  35  ARG B NH1   1 
ATOM 835   N NH2   . ARG B 2 36  ? 81.947  76.641  110.991 1.00 48.90  ?  35  ARG B NH2   1 
ATOM 836   N N     . ARG B 2 37  ? 78.820  81.984  105.914 1.00 47.31  ?  36  ARG B N     1 
ATOM 837   C CA    . ARG B 2 37  ? 77.627  82.673  105.422 1.00 47.31  ?  36  ARG B CA    1 
ATOM 838   C C     . ARG B 2 37  ? 77.254  82.230  104.013 1.00 47.31  ?  36  ARG B C     1 
ATOM 839   O O     . ARG B 2 37  ? 76.065  82.070  103.708 1.00 47.31  ?  36  ARG B O     1 
ATOM 840   C CB    . ARG B 2 37  ? 77.796  84.192  105.462 1.00 47.31  ?  36  ARG B CB    1 
ATOM 841   C CG    . ARG B 2 37  ? 77.246  84.880  106.706 1.00 47.31  ?  36  ARG B CG    1 
ATOM 842   C CD    . ARG B 2 37  ? 78.238  85.036  107.826 1.00 47.31  ?  36  ARG B CD    1 
ATOM 843   N NE    . ARG B 2 37  ? 79.416  85.784  107.402 1.00 47.31  ?  36  ARG B NE    1 
ATOM 844   C CZ    . ARG B 2 37  ? 79.456  87.107  107.277 1.00 47.31  ?  36  ARG B CZ    1 
ATOM 845   N NH1   . ARG B 2 37  ? 78.377  87.832  107.525 1.00 47.31  1  36  ARG B NH1   1 
ATOM 846   N NH2   . ARG B 2 37  ? 80.573  87.705  106.900 1.00 47.31  ?  36  ARG B NH2   1 
ATOM 847   N N     . LEU B 2 38  ? 78.247  82.001  103.149 1.00 41.36  ?  37  LEU B N     1 
ATOM 848   C CA    . LEU B 2 38  ? 77.927  81.503  101.815 1.00 41.36  ?  37  LEU B CA    1 
ATOM 849   C C     . LEU B 2 38  ? 77.386  80.082  101.857 1.00 41.36  ?  37  LEU B C     1 
ATOM 850   O O     . LEU B 2 38  ? 76.502  79.734  101.068 1.00 41.36  ?  37  LEU B O     1 
ATOM 851   C CB    . LEU B 2 38  ? 79.149  81.582  100.911 1.00 41.36  ?  37  LEU B CB    1 
ATOM 852   C CG    . LEU B 2 38  ? 79.536  83.020  100.597 1.00 41.36  ?  37  LEU B CG    1 
ATOM 853   C CD1   . LEU B 2 38  ? 80.831  83.078  99.830  1.00 41.36  ?  37  LEU B CD1   1 
ATOM 854   C CD2   . LEU B 2 38  ? 78.434  83.673  99.811  1.00 41.36  ?  37  LEU B CD2   1 
ATOM 855   N N     . ALA B 2 39  ? 77.857  79.266  102.794 1.00 41.32  ?  38  ALA B N     1 
ATOM 856   C CA    . ALA B 2 39  ? 77.313  77.922  102.904 1.00 41.32  ?  38  ALA B CA    1 
ATOM 857   C C     . ALA B 2 39  ? 75.922  77.921  103.520 1.00 41.32  ?  38  ALA B C     1 
ATOM 858   O O     . ALA B 2 39  ? 75.125  77.022  103.233 1.00 41.32  ?  38  ALA B O     1 
ATOM 859   C CB    . ALA B 2 39  ? 78.249  77.040  103.718 1.00 41.32  ?  38  ALA B CB    1 
ATOM 860   N N     . ARG B 2 40  ? 75.609  78.900  104.372 1.00 49.11  ?  39  ARG B N     1 
ATOM 861   C CA    . ARG B 2 40  ? 74.246  78.980  104.888 1.00 49.11  ?  39  ARG B CA    1 
ATOM 862   C C     . ARG B 2 40  ? 73.290  79.472  103.816 1.00 49.11  ?  39  ARG B C     1 
ATOM 863   O O     . ARG B 2 40  ? 72.130  79.047  103.778 1.00 49.11  ?  39  ARG B O     1 
ATOM 864   C CB    . ARG B 2 40  ? 74.158  79.888  106.111 1.00 49.11  ?  39  ARG B CB    1 
ATOM 865   C CG    . ARG B 2 40  ? 74.944  79.429  107.311 1.00 49.11  ?  39  ARG B CG    1 
ATOM 866   C CD    . ARG B 2 40  ? 74.488  78.106  107.846 1.00 49.11  ?  39  ARG B CD    1 
ATOM 867   N NE    . ARG B 2 40  ? 75.257  77.763  109.032 1.00 49.11  ?  39  ARG B NE    1 
ATOM 868   C CZ    . ARG B 2 40  ? 75.177  76.601  109.665 1.00 49.11  ?  39  ARG B CZ    1 
ATOM 869   N NH1   . ARG B 2 40  ? 74.363  75.657  109.220 1.00 49.11  1  39  ARG B NH1   1 
ATOM 870   N NH2   . ARG B 2 40  ? 75.918  76.383  110.739 1.00 49.11  ?  39  ARG B NH2   1 
ATOM 871   N N     . ARG B 2 41  ? 73.746  80.385  102.954 1.00 42.28  ?  40  ARG B N     1 
ATOM 872   C CA    . ARG B 2 41  ? 72.913  80.784  101.825 1.00 42.28  ?  40  ARG B CA    1 
ATOM 873   C C     . ARG B 2 41  ? 72.705  79.620  100.867 1.00 42.28  ?  40  ARG B C     1 
ATOM 874   O O     . ARG B 2 41  ? 71.604  79.428  100.341 1.00 42.28  ?  40  ARG B O     1 
ATOM 875   C CB    . ARG B 2 41  ? 73.521  81.984  101.100 1.00 42.28  ?  40  ARG B CB    1 
ATOM 876   C CG    . ARG B 2 41  ? 72.696  82.428  99.912  1.00 42.28  ?  40  ARG B CG    1 
ATOM 877   C CD    . ARG B 2 41  ? 73.178  83.705  99.284  1.00 42.28  ?  40  ARG B CD    1 
ATOM 878   N NE    . ARG B 2 41  ? 72.883  84.857  100.122 1.00 42.28  ?  40  ARG B NE    1 
ATOM 879   C CZ    . ARG B 2 41  ? 73.286  86.090  99.849  1.00 42.28  ?  40  ARG B CZ    1 
ATOM 880   N NH1   . ARG B 2 41  ? 73.994  86.329  98.756  1.00 42.28  1  40  ARG B NH1   1 
ATOM 881   N NH2   . ARG B 2 41  ? 72.977  87.084  100.667 1.00 42.28  ?  40  ARG B NH2   1 
ATOM 882   N N     . GLY B 2 42  ? 73.736  78.798  100.674 1.00 41.89  ?  41  GLY B N     1 
ATOM 883   C CA    . GLY B 2 42  ? 73.569  77.609  99.862  1.00 41.89  ?  41  GLY B CA    1 
ATOM 884   C C     . GLY B 2 42  ? 72.681  76.564  100.503 1.00 41.89  ?  41  GLY B C     1 
ATOM 885   O O     . GLY B 2 42  ? 72.057  75.763  99.803  1.00 41.89  ?  41  GLY B O     1 
ATOM 886   N N     . GLY B 2 43  ? 72.595  76.560  101.826 1.00 42.59  ?  42  GLY B N     1 
ATOM 887   C CA    . GLY B 2 43  ? 71.761  75.587  102.498 1.00 42.59  ?  42  GLY B CA    1 
ATOM 888   C C     . GLY B 2 43  ? 72.505  74.338  102.913 1.00 42.59  ?  42  GLY B C     1 
ATOM 889   O O     . GLY B 2 43  ? 72.096  73.223  102.584 1.00 42.59  ?  42  GLY B O     1 
ATOM 890   N N     . VAL B 2 44  ? 73.606  74.515  103.633 1.00 47.00  ?  43  VAL B N     1 
ATOM 891   C CA    . VAL B 2 44  ? 74.409  73.413  104.145 1.00 47.00  ?  43  VAL B CA    1 
ATOM 892   C C     . VAL B 2 44  ? 74.359  73.469  105.663 1.00 47.00  ?  43  VAL B C     1 
ATOM 893   O O     . VAL B 2 44  ? 74.606  74.525  106.256 1.00 47.00  ?  43  VAL B O     1 
ATOM 894   C CB    . VAL B 2 44  ? 75.859  73.493  103.645 1.00 47.00  ?  43  VAL B CB    1 
ATOM 895   C CG1   . VAL B 2 44  ? 76.672  72.350  104.198 1.00 47.00  ?  43  VAL B CG1   1 
ATOM 896   C CG2   . VAL B 2 44  ? 75.888  73.489  102.144 1.00 47.00  ?  43  VAL B CG2   1 
ATOM 897   N N     . LYS B 2 45  ? 74.050  72.338  106.289 1.00 54.13  ?  44  LYS B N     1 
ATOM 898   C CA    . LYS B 2 45  ? 73.808  72.346  107.723 1.00 54.13  ?  44  LYS B CA    1 
ATOM 899   C C     . LYS B 2 45  ? 75.101  72.390  108.525 1.00 54.13  ?  44  LYS B C     1 
ATOM 900   O O     . LYS B 2 45  ? 75.163  73.062  109.558 1.00 54.13  ?  44  LYS B O     1 
ATOM 901   C CB    . LYS B 2 45  ? 72.971  71.131  108.108 1.00 54.13  ?  44  LYS B CB    1 
ATOM 902   C CG    . LYS B 2 45  ? 71.576  71.194  107.518 1.00 54.13  ?  44  LYS B CG    1 
ATOM 903   C CD    . LYS B 2 45  ? 70.743  69.973  107.849 1.00 54.13  ?  44  LYS B CD    1 
ATOM 904   C CE    . LYS B 2 45  ? 69.386  70.047  107.161 1.00 54.13  ?  44  LYS B CE    1 
ATOM 905   N NZ    . LYS B 2 45  ? 68.553  68.841  107.415 1.00 54.13  1  44  LYS B NZ    1 
ATOM 906   N N     . ARG B 2 46  ? 76.146  71.701  108.075 1.00 65.00  ?  45  ARG B N     1 
ATOM 907   C CA    . ARG B 2 46  ? 77.324  71.527  108.922 1.00 65.00  ?  45  ARG B CA    1 
ATOM 908   C C     . ARG B 2 46  ? 78.563  71.392  108.042 1.00 65.00  ?  45  ARG B C     1 
ATOM 909   O O     . ARG B 2 46  ? 78.823  70.321  107.489 1.00 65.00  ?  45  ARG B O     1 
ATOM 910   C CB    . ARG B 2 46  ? 77.149  70.318  109.823 1.00 65.00  ?  45  ARG B CB    1 
ATOM 911   C CG    . ARG B 2 46  ? 78.260  70.120  110.807 1.00 65.00  ?  45  ARG B CG    1 
ATOM 912   C CD    . ARG B 2 46  ? 77.964  68.915  111.657 1.00 65.00  ?  45  ARG B CD    1 
ATOM 913   N NE    . ARG B 2 46  ? 79.022  68.655  112.618 1.00 65.00  ?  45  ARG B NE    1 
ATOM 914   C CZ    . ARG B 2 46  ? 79.016  67.630  113.458 1.00 65.00  ?  45  ARG B CZ    1 
ATOM 915   N NH1   . ARG B 2 46  ? 78.009  66.768  113.439 1.00 65.00  1  45  ARG B NH1   1 
ATOM 916   N NH2   . ARG B 2 46  ? 80.018  67.462  114.309 1.00 65.00  ?  45  ARG B NH2   1 
ATOM 917   N N     . ILE B 2 47  ? 79.319  72.482  107.934 1.00 60.99  ?  46  ILE B N     1 
ATOM 918   C CA    . ILE B 2 47  ? 80.575  72.481  107.201 1.00 60.99  ?  46  ILE B CA    1 
ATOM 919   C C     . ILE B 2 47  ? 81.585  71.605  107.931 1.00 60.99  ?  46  ILE B C     1 
ATOM 920   O O     . ILE B 2 47  ? 81.582  71.510  109.162 1.00 60.99  ?  46  ILE B O     1 
ATOM 921   C CB    . ILE B 2 47  ? 81.087  73.927  107.074 1.00 60.99  ?  46  ILE B CB    1 
ATOM 922   C CG1   . ILE B 2 47  ? 79.992  74.827  106.536 1.00 60.99  ?  46  ILE B CG1   1 
ATOM 923   C CG2   . ILE B 2 47  ? 82.256  74.040  106.118 1.00 60.99  ?  46  ILE B CG2   1 
ATOM 924   C CD1   . ILE B 2 47  ? 80.332  76.269  106.694 1.00 60.99  ?  46  ILE B CD1   1 
ATOM 925   N N     . SER B 2 48  ? 82.450  70.947  107.166 1.00 61.86  ?  47  SER B N     1 
ATOM 926   C CA    . SER B 2 48  ? 83.621  70.273  107.708 1.00 61.86  ?  47  SER B CA    1 
ATOM 927   C C     . SER B 2 48  ? 84.759  71.254  107.957 1.00 61.86  ?  47  SER B C     1 
ATOM 928   O O     . SER B 2 48  ? 84.550  72.465  108.068 1.00 61.86  ?  47  SER B O     1 
ATOM 929   C CB    . SER B 2 48  ? 84.095  69.158  106.781 1.00 61.86  ?  47  SER B CB    1 
ATOM 930   O OG    . SER B 2 48  ? 85.249  68.528  107.302 1.00 61.86  ?  47  SER B OG    1 
ATOM 931   N N     . GLY B 2 49  ? 85.971  70.723  108.023 1.00 62.63  ?  48  GLY B N     1 
ATOM 932   C CA    . GLY B 2 49  ? 87.169  71.418  108.444 1.00 62.63  ?  48  GLY B CA    1 
ATOM 933   C C     . GLY B 2 49  ? 87.849  72.040  107.249 1.00 62.63  ?  48  GLY B C     1 
ATOM 934   O O     . GLY B 2 49  ? 87.640  73.223  106.971 1.00 62.63  ?  48  GLY B O     1 
ATOM 935   N N     . LEU B 2 50  ? 88.684  71.270  106.549 1.00 55.65  ?  49  LEU B N     1 
ATOM 936   C CA    . LEU B 2 50  ? 89.562  71.743  105.479 1.00 55.65  ?  49  LEU B CA    1 
ATOM 937   C C     . LEU B 2 50  ? 88.899  72.428  104.277 1.00 55.65  ?  49  LEU B C     1 
ATOM 938   O O     . LEU B 2 50  ? 89.606  72.840  103.351 1.00 55.65  ?  49  LEU B O     1 
ATOM 939   C CB    . LEU B 2 50  ? 90.379  70.559  104.968 1.00 55.65  ?  49  LEU B CB    1 
ATOM 940   C CG    . LEU B 2 50  ? 91.290  69.924  106.017 1.00 55.65  ?  49  LEU B CG    1 
ATOM 941   C CD1   . LEU B 2 50  ? 91.946  68.668  105.472 1.00 55.65  ?  49  LEU B CD1   1 
ATOM 942   C CD2   . LEU B 2 50  ? 92.336  70.920  106.485 1.00 55.65  ?  49  LEU B CD2   1 
ATOM 943   N N     . ILE B 2 51  ? 87.561  72.544  104.274 1.00 53.62  ?  50  ILE B N     1 
ATOM 944   C CA    . ILE B 2 51  ? 86.826  73.385  103.324 1.00 53.62  ?  50  ILE B CA    1 
ATOM 945   C C     . ILE B 2 51  ? 87.347  74.815  103.339 1.00 53.62  ?  50  ILE B C     1 
ATOM 946   O O     . ILE B 2 51  ? 87.456  75.466  102.291 1.00 53.62  ?  50  ILE B O     1 
ATOM 947   C CB    . ILE B 2 51  ? 85.323  73.334  103.649 1.00 53.62  ?  50  ILE B CB    1 
ATOM 948   C CG1   . ILE B 2 51  ? 84.813  71.918  103.461 1.00 53.62  ?  50  ILE B CG1   1 
ATOM 949   C CG2   . ILE B 2 51  ? 84.518  74.282  102.782 1.00 53.62  ?  50  ILE B CG2   1 
ATOM 950   C CD1   . ILE B 2 51  ? 84.930  71.445  102.047 1.00 53.62  ?  50  ILE B CD1   1 
ATOM 951   N N     . TYR B 2 52  ? 87.718  75.302  104.525 1.00 53.73  ?  51  TYR B N     1 
ATOM 952   C CA    . TYR B 2 52  ? 88.310  76.627  104.670 1.00 53.73  ?  51  TYR B CA    1 
ATOM 953   C C     . TYR B 2 52  ? 89.622  76.759  103.903 1.00 53.73  ?  51  TYR B C     1 
ATOM 954   O O     . TYR B 2 52  ? 89.986  77.864  103.490 1.00 53.73  ?  51  TYR B O     1 
ATOM 955   C CB    . TYR B 2 52  ? 88.523  76.917  106.153 1.00 53.73  ?  51  TYR B CB    1 
ATOM 956   C CG    . TYR B 2 52  ? 87.242  77.105  106.932 1.00 53.73  ?  51  TYR B CG    1 
ATOM 957   C CD1   . TYR B 2 52  ? 86.061  77.450  106.294 1.00 53.73  ?  51  TYR B CD1   1 
ATOM 958   C CD2   . TYR B 2 52  ? 87.208  76.911  108.304 1.00 53.73  ?  51  TYR B CD2   1 
ATOM 959   C CE1   . TYR B 2 52  ? 84.893  77.618  106.999 1.00 53.73  ?  51  TYR B CE1   1 
ATOM 960   C CE2   . TYR B 2 52  ? 86.042  77.081  109.019 1.00 53.73  ?  51  TYR B CE2   1 
ATOM 961   C CZ    . TYR B 2 52  ? 84.888  77.432  108.360 1.00 53.73  ?  51  TYR B CZ    1 
ATOM 962   O OH    . TYR B 2 52  ? 83.720  77.596  109.065 1.00 53.73  ?  51  TYR B OH    1 
ATOM 963   N N     . GLU B 2 53  ? 90.331  75.652  103.684 1.00 57.48  ?  52  GLU B N     1 
ATOM 964   C CA    . GLU B 2 53  ? 91.515  75.660  102.838 1.00 57.48  ?  52  GLU B CA    1 
ATOM 965   C C     . GLU B 2 53  ? 91.227  75.254  101.402 1.00 57.48  ?  52  GLU B C     1 
ATOM 966   O O     . GLU B 2 53  ? 92.116  75.373  100.555 1.00 57.48  ?  52  GLU B O     1 
ATOM 967   C CB    . GLU B 2 53  ? 92.589  74.732  103.411 1.00 57.48  ?  52  GLU B CB    1 
ATOM 968   C CG    . GLU B 2 53  ? 93.155  75.184  104.744 1.00 57.48  ?  52  GLU B CG    1 
ATOM 969   C CD    . GLU B 2 53  ? 93.948  76.471  104.641 1.00 57.48  ?  52  GLU B CD    1 
ATOM 970   O OE1   . GLU B 2 53  ? 94.591  76.702  103.595 1.00 57.48  ?  52  GLU B OE1   1 
ATOM 971   O OE2   . GLU B 2 53  ? 93.925  77.256  105.611 1.00 57.48  -1 52  GLU B OE2   1 
ATOM 972   N N     . GLU B 2 54  ? 90.019  74.776  101.106 1.00 53.23  ?  53  GLU B N     1 
ATOM 973   C CA    . GLU B 2 54  ? 89.684  74.345  99.755  1.00 53.23  ?  53  GLU B CA    1 
ATOM 974   C C     . GLU B 2 54  ? 89.040  75.455  98.936  1.00 53.23  ?  53  GLU B C     1 
ATOM 975   O O     . GLU B 2 54  ? 89.434  75.686  97.789  1.00 53.23  ?  53  GLU B O     1 
ATOM 976   C CB    . GLU B 2 54  ? 88.750  73.135  99.800  1.00 53.23  ?  53  GLU B CB    1 
ATOM 977   C CG    . GLU B 2 54  ? 88.319  72.648  98.436  1.00 53.23  ?  53  GLU B CG    1 
ATOM 978   C CD    . GLU B 2 54  ? 89.462  72.062  97.638  1.00 53.23  ?  53  GLU B CD    1 
ATOM 979   O OE1   . GLU B 2 54  ? 90.407  71.521  98.250  1.00 53.23  ?  53  GLU B OE1   1 
ATOM 980   O OE2   . GLU B 2 54  ? 89.419  72.147  96.394  1.00 53.23  -1 53  GLU B OE2   1 
ATOM 981   N N     . THR B 2 55  ? 88.048  76.137  99.520  1.00 50.44  ?  54  THR B N     1 
ATOM 982   C CA    . THR B 2 55  ? 87.306  77.170  98.803  1.00 50.44  ?  54  THR B CA    1 
ATOM 983   C C     . THR B 2 55  ? 88.205  78.342  98.444  1.00 50.44  ?  54  THR B C     1 
ATOM 984   O O     . THR B 2 55  ? 88.099  78.902  97.345  1.00 50.44  ?  54  THR B O     1 
ATOM 985   C CB    . THR B 2 55  ? 86.125  77.629  99.652  1.00 50.44  ?  54  THR B CB    1 
ATOM 986   O OG1   . THR B 2 55  ? 85.310  76.497  99.969  1.00 50.44  ?  54  THR B OG1   1 
ATOM 987   C CG2   . THR B 2 55  ? 85.278  78.633  98.904  1.00 50.44  ?  54  THR B CG2   1 
ATOM 988   N N     . ARG B 2 56  ? 89.156  78.664  99.325  1.00 50.70  ?  55  ARG B N     1 
ATOM 989   C CA    . ARG B 2 56  ? 90.167  79.675  99.040  1.00 50.70  ?  55  ARG B CA    1 
ATOM 990   C C     . ARG B 2 56  ? 91.023  79.329  97.831  1.00 50.70  ?  55  ARG B C     1 
ATOM 991   O O     . ARG B 2 56  ? 91.599  80.232  97.219  1.00 50.70  ?  55  ARG B O     1 
ATOM 992   C CB    . ARG B 2 56  ? 91.072  79.873  100.252 1.00 50.70  ?  55  ARG B CB    1 
ATOM 993   C CG    . ARG B 2 56  ? 90.415  80.565  101.424 1.00 50.70  ?  55  ARG B CG    1 
ATOM 994   C CD    . ARG B 2 56  ? 91.407  80.735  102.553 1.00 50.70  ?  55  ARG B CD    1 
ATOM 995   N NE    . ARG B 2 56  ? 90.837  81.475  103.669 1.00 50.70  ?  55  ARG B NE    1 
ATOM 996   C CZ    . ARG B 2 56  ? 90.174  80.910  104.669 1.00 50.70  ?  55  ARG B CZ    1 
ATOM 997   N NH1   . ARG B 2 56  ? 89.994  79.601  104.683 1.00 50.70  1  55  ARG B NH1   1 
ATOM 998   N NH2   . ARG B 2 56  ? 89.686  81.654  105.649 1.00 50.70  ?  55  ARG B NH2   1 
ATOM 999   N N     . GLY B 2 57  ? 91.125  78.052  97.470  1.00 45.97  ?  56  GLY B N     1 
ATOM 1000  C CA    . GLY B 2 57  ? 91.689  77.722  96.175  1.00 45.97  ?  56  GLY B CA    1 
ATOM 1001  C C     . GLY B 2 57  ? 90.748  78.083  95.041  1.00 45.97  ?  56  GLY B C     1 
ATOM 1002  O O     . GLY B 2 57  ? 91.100  78.876  94.159  1.00 45.97  ?  56  GLY B O     1 
ATOM 1003  N N     . VAL B 2 58  ? 89.509  77.574  95.110  1.00 38.93  ?  57  VAL B N     1 
ATOM 1004  C CA    . VAL B 2 58  ? 88.629  77.481  93.943  1.00 38.93  ?  57  VAL B CA    1 
ATOM 1005  C C     . VAL B 2 58  ? 88.239  78.860  93.438  1.00 38.93  ?  57  VAL B C     1 
ATOM 1006  O O     . VAL B 2 58  ? 88.390  79.155  92.242  1.00 38.93  ?  57  VAL B O     1 
ATOM 1007  C CB    . VAL B 2 58  ? 87.390  76.639  94.283  1.00 38.93  ?  57  VAL B CB    1 
ATOM 1008  C CG1   . VAL B 2 58  ? 86.373  76.718  93.170  1.00 38.93  ?  57  VAL B CG1   1 
ATOM 1009  C CG2   . VAL B 2 58  ? 87.799  75.205  94.517  1.00 38.93  ?  57  VAL B CG2   1 
ATOM 1010  N N     . LEU B 2 59  ? 87.764  79.718  94.355  1.00 36.27  ?  58  LEU B N     1 
ATOM 1011  C CA    . LEU B 2 59  ? 87.472  81.125  94.082  1.00 36.27  ?  58  LEU B CA    1 
ATOM 1012  C C     . LEU B 2 59  ? 88.616  81.810  93.358  1.00 36.27  ?  58  LEU B C     1 
ATOM 1013  O O     . LEU B 2 59  ? 88.398  82.483  92.341  1.00 36.27  ?  58  LEU B O     1 
ATOM 1014  C CB    . LEU B 2 59  ? 87.169  81.849  95.396  1.00 36.27  ?  58  LEU B CB    1 
ATOM 1015  C CG    . LEU B 2 59  ? 86.811  83.337  95.443  1.00 36.27  ?  58  LEU B CG    1 
ATOM 1016  C CD1   . LEU B 2 59  ? 85.840  83.579  96.553  1.00 36.27  ?  58  LEU B CD1   1 
ATOM 1017  C CD2   . LEU B 2 59  ? 88.022  84.183  95.731  1.00 36.27  ?  58  LEU B CD2   1 
ATOM 1018  N N     . LYS B 2 60  ? 89.846  81.580  93.840  1.00 40.26  ?  59  LYS B N     1 
ATOM 1019  C CA    . LYS B 2 60  ? 91.029  82.198  93.251  1.00 40.26  ?  59  LYS B CA    1 
ATOM 1020  C C     . LYS B 2 60  ? 91.166  81.819  91.789  1.00 40.26  ?  59  LYS B C     1 
ATOM 1021  O O     . LYS B 2 60  ? 91.302  82.701  90.927  1.00 40.26  ?  59  LYS B O     1 
ATOM 1022  C CB    . LYS B 2 60  ? 92.274  81.786  94.028  1.00 40.26  ?  59  LYS B CB    1 
ATOM 1023  C CG    . LYS B 2 60  ? 93.539  82.443  93.541  1.00 40.26  ?  59  LYS B CG    1 
ATOM 1024  C CD    . LYS B 2 60  ? 94.707  82.065  94.423  1.00 40.26  ?  59  LYS B CD    1 
ATOM 1025  C CE    . LYS B 2 60  ? 95.988  82.715  93.942  1.00 40.26  ?  59  LYS B CE    1 
ATOM 1026  N NZ    . LYS B 2 60  ? 97.142  82.365  94.810  1.00 40.26  1  59  LYS B NZ    1 
ATOM 1027  N N     . VAL B 2 61  ? 90.979  80.525  91.490  1.00 37.63  ?  60  VAL B N     1 
ATOM 1028  C CA    . VAL B 2 61  ? 91.054  80.035  90.117  1.00 37.63  ?  60  VAL B CA    1 
ATOM 1029  C C     . VAL B 2 61  ? 89.998  80.706  89.260  1.00 37.63  ?  60  VAL B C     1 
ATOM 1030  O O     . VAL B 2 61  ? 90.308  81.230  88.178  1.00 37.63  ?  60  VAL B O     1 
ATOM 1031  C CB    . VAL B 2 61  ? 90.919  78.504  90.083  1.00 37.63  ?  60  VAL B CB    1 
ATOM 1032  C CG1   . VAL B 2 61  ? 90.792  78.015  88.656  1.00 37.63  ?  60  VAL B CG1   1 
ATOM 1033  C CG2   . VAL B 2 61  ? 92.119  77.865  90.742  1.00 37.63  ?  60  VAL B CG2   1 
ATOM 1034  N N     . PHE B 2 62  ? 88.777  80.835  89.802  1.00 33.51  ?  61  PHE B N     1 
ATOM 1035  C CA    . PHE B 2 62  ? 87.698  81.438  89.032  1.00 33.51  ?  61  PHE B CA    1 
ATOM 1036  C C     . PHE B 2 62  ? 87.988  82.895  88.740  1.00 33.51  ?  61  PHE B C     1 
ATOM 1037  O O     . PHE B 2 62  ? 87.762  83.351  87.611  1.00 33.51  ?  61  PHE B O     1 
ATOM 1038  C CB    . PHE B 2 62  ? 86.362  81.310  89.749  1.00 33.51  ?  61  PHE B CB    1 
ATOM 1039  C CG    . PHE B 2 62  ? 85.236  81.958  89.006  1.00 33.51  ?  61  PHE B CG    1 
ATOM 1040  C CD1   . PHE B 2 62  ? 84.748  81.388  87.846  1.00 33.51  ?  61  PHE B CD1   1 
ATOM 1041  C CD2   . PHE B 2 62  ? 84.677  83.142  89.450  1.00 33.51  ?  61  PHE B CD2   1 
ATOM 1042  C CE1   . PHE B 2 62  ? 83.718  81.982  87.144  1.00 33.51  ?  61  PHE B CE1   1 
ATOM 1043  C CE2   . PHE B 2 62  ? 83.649  83.740  88.755  1.00 33.51  ?  61  PHE B CE2   1 
ATOM 1044  C CZ    . PHE B 2 62  ? 83.169  83.158  87.601  1.00 33.51  ?  61  PHE B CZ    1 
ATOM 1045  N N     . LEU B 2 63  ? 88.605  83.601  89.699  1.00 35.18  ?  62  LEU B N     1 
ATOM 1046  C CA    . LEU B 2 63  ? 88.866  85.013  89.465  1.00 35.18  ?  62  LEU B CA    1 
ATOM 1047  C C     . LEU B 2 63  ? 89.912  85.204  88.390  1.00 35.18  ?  62  LEU B C     1 
ATOM 1048  O O     . LEU B 2 63  ? 89.805  86.155  87.604  1.00 35.18  ?  62  LEU B O     1 
ATOM 1049  C CB    . LEU B 2 63  ? 89.291  85.718  90.742  1.00 35.18  ?  62  LEU B CB    1 
ATOM 1050  C CG    . LEU B 2 63  ? 88.145  85.889  91.723  1.00 35.18  ?  62  LEU B CG    1 
ATOM 1051  C CD1   . LEU B 2 63  ? 88.643  86.600  92.951  1.00 35.18  ?  62  LEU B CD1   1 
ATOM 1052  C CD2   . LEU B 2 63  ? 87.007  86.650  91.082  1.00 35.18  ?  62  LEU B CD2   1 
ATOM 1053  N N     . GLU B 2 64  ? 90.848  84.254  88.270  1.00 37.62  ?  63  GLU B N     1 
ATOM 1054  C CA    . GLU B 2 64  ? 91.814  84.338  87.188  1.00 37.62  ?  63  GLU B CA    1 
ATOM 1055  C C     . GLU B 2 64  ? 91.110  84.218  85.851  1.00 37.62  ?  63  GLU B C     1 
ATOM 1056  O O     . GLU B 2 64  ? 91.251  85.098  84.991  1.00 37.62  ?  63  GLU B O     1 
ATOM 1057  C CB    . GLU B 2 64  ? 92.886  83.270  87.350  1.00 37.62  ?  63  GLU B CB    1 
ATOM 1058  C CG    . GLU B 2 64  ? 93.728  83.474  88.582  1.00 37.62  ?  63  GLU B CG    1 
ATOM 1059  C CD    . GLU B 2 64  ? 94.842  82.464  88.692  1.00 37.62  ?  63  GLU B CD    1 
ATOM 1060  O OE1   . GLU B 2 64  ? 94.903  81.554  87.842  1.00 37.62  ?  63  GLU B OE1   1 
ATOM 1061  O OE2   . GLU B 2 64  ? 95.657  82.574  89.630  1.00 37.62  -1 63  GLU B OE2   1 
ATOM 1062  N N     . ASN B 2 65  ? 90.178  83.274  85.745  1.00 35.33  ?  64  ASN B N     1 
ATOM 1063  C CA    . ASN B 2 65  ? 89.481  83.116  84.483  1.00 35.33  ?  64  ASN B CA    1 
ATOM 1064  C C     . ASN B 2 65  ? 88.388  84.148  84.276  1.00 35.33  ?  64  ASN B C     1 
ATOM 1065  O O     . ASN B 2 65  ? 87.618  84.022  83.321  1.00 35.33  ?  64  ASN B O     1 
ATOM 1066  C CB    . ASN B 2 65  ? 88.914  81.707  84.364  1.00 35.33  ?  64  ASN B CB    1 
ATOM 1067  C CG    . ASN B 2 65  ? 89.993  80.678  84.161  1.00 35.33  ?  64  ASN B CG    1 
ATOM 1068  O OD1   . ASN B 2 65  ? 90.981  80.932  83.478  1.00 35.33  ?  64  ASN B OD1   1 
ATOM 1069  N ND2   . ASN B 2 65  ? 89.804  79.500  84.733  1.00 35.33  ?  64  ASN B ND2   1 
ATOM 1070  N N     . VAL B 2 66  ? 88.297  85.164  85.126  1.00 29.38  ?  65  VAL B N     1 
ATOM 1071  C CA    . VAL B 2 66  ? 87.630  86.388  84.752  1.00 29.38  ?  65  VAL B CA    1 
ATOM 1072  C C     . VAL B 2 66  ? 88.639  87.472  84.443  1.00 29.38  ?  65  VAL B C     1 
ATOM 1073  O O     . VAL B 2 66  ? 88.575  88.104  83.389  1.00 29.38  ?  65  VAL B O     1 
ATOM 1074  C CB    . VAL B 2 66  ? 86.650  86.838  85.853  1.00 29.38  ?  65  VAL B CB    1 
ATOM 1075  C CG1   . VAL B 2 66  ? 85.980  88.111  85.434  1.00 29.38  ?  65  VAL B CG1   1 
ATOM 1076  C CG2   . VAL B 2 66  ? 85.630  85.764  86.110  1.00 29.38  ?  65  VAL B CG2   1 
ATOM 1077  N N     . ILE B 2 67  ? 89.630  87.643  85.318  1.00 31.97  ?  66  ILE B N     1 
ATOM 1078  C CA    . ILE B 2 67  ? 90.422  88.865  85.280  1.00 31.97  ?  66  ILE B CA    1 
ATOM 1079  C C     . ILE B 2 67  ? 91.411  88.832  84.127  1.00 31.97  ?  66  ILE B C     1 
ATOM 1080  O O     . ILE B 2 67  ? 91.546  89.820  83.397  1.00 31.97  ?  66  ILE B O     1 
ATOM 1081  C CB    . ILE B 2 67  ? 91.105  89.100  86.636  1.00 31.97  ?  66  ILE B CB    1 
ATOM 1082  C CG1   . ILE B 2 67  ? 90.049  89.395  87.689  1.00 31.97  ?  66  ILE B CG1   1 
ATOM 1083  C CG2   . ILE B 2 67  ? 92.038  90.277  86.577  1.00 31.97  ?  66  ILE B CG2   1 
ATOM 1084  C CD1   . ILE B 2 67  ? 90.579  89.377  89.084  1.00 31.97  ?  66  ILE B CD1   1 
ATOM 1085  N N     . ARG B 2 68  ? 92.051  87.679  83.896  1.00 32.00  ?  67  ARG B N     1 
ATOM 1086  C CA    . ARG B 2 68  ? 92.844  87.493  82.683  1.00 32.00  ?  67  ARG B CA    1 
ATOM 1087  C C     . ARG B 2 68  ? 91.980  87.607  81.434  1.00 32.00  ?  67  ARG B C     1 
ATOM 1088  O O     . ARG B 2 68  ? 92.449  88.067  80.388  1.00 32.00  ?  67  ARG B O     1 
ATOM 1089  C CB    . ARG B 2 68  ? 93.556  86.137  82.713  1.00 32.00  ?  67  ARG B CB    1 
ATOM 1090  C CG    . ARG B 2 68  ? 94.540  85.934  81.570  1.00 32.00  ?  67  ARG B CG    1 
ATOM 1091  C CD    . ARG B 2 68  ? 95.269  84.612  81.631  1.00 32.00  ?  67  ARG B CD    1 
ATOM 1092  N NE    . ARG B 2 68  ? 94.369  83.482  81.469  1.00 32.00  ?  67  ARG B NE    1 
ATOM 1093  C CZ    . ARG B 2 68  ? 94.168  82.563  82.403  1.00 32.00  ?  67  ARG B CZ    1 
ATOM 1094  N NH1   . ARG B 2 68  ? 94.816  82.644  83.554  1.00 32.00  1  67  ARG B NH1   1 
ATOM 1095  N NH2   . ARG B 2 68  ? 93.330  81.560  82.185  1.00 32.00  ?  67  ARG B NH2   1 
ATOM 1096  N N     . ASP B 2 69  ? 90.706  87.250  81.535  1.00 31.23  ?  68  ASP B N     1 
ATOM 1097  C CA    . ASP B 2 69  ? 89.807  87.442  80.414  1.00 31.23  ?  68  ASP B CA    1 
ATOM 1098  C C     . ASP B 2 69  ? 89.232  88.851  80.371  1.00 31.23  ?  68  ASP B C     1 
ATOM 1099  O O     . ASP B 2 69  ? 88.685  89.246  79.340  1.00 31.23  ?  68  ASP B O     1 
ATOM 1100  C CB    . ASP B 2 69  ? 88.686  86.408  80.488  1.00 31.23  ?  68  ASP B CB    1 
ATOM 1101  C CG    . ASP B 2 69  ? 87.947  86.254  79.187  1.00 31.23  ?  68  ASP B CG    1 
ATOM 1102  O OD1   . ASP B 2 69  ? 88.471  85.568  78.287  1.00 31.23  ?  68  ASP B OD1   1 
ATOM 1103  O OD2   . ASP B 2 69  ? 86.848  86.829  79.056  1.00 31.23  -1 68  ASP B OD2   1 
ATOM 1104  N N     . ALA B 2 70  ? 89.347  89.624  81.451  1.00 26.73  ?  69  ALA B N     1 
ATOM 1105  C CA    . ALA B 2 70  ? 88.825  90.984  81.453  1.00 26.73  ?  69  ALA B CA    1 
ATOM 1106  C C     . ALA B 2 70  ? 89.903  92.042  81.326  1.00 26.73  ?  69  ALA B C     1 
ATOM 1107  O O     . ALA B 2 70  ? 89.591  93.179  80.964  1.00 26.73  ?  69  ALA B O     1 
ATOM 1108  C CB    . ALA B 2 70  ? 88.024  91.262  82.725  1.00 26.73  ?  69  ALA B CB    1 
ATOM 1109  N N     . VAL B 2 71  ? 91.156  91.703  81.622  1.00 31.35  ?  70  VAL B N     1 
ATOM 1110  C CA    . VAL B 2 71  ? 92.243  92.639  81.385  1.00 31.35  ?  70  VAL B CA    1 
ATOM 1111  C C     . VAL B 2 71  ? 92.603  92.685  79.905  1.00 31.35  ?  70  VAL B C     1 
ATOM 1112  O O     . VAL B 2 71  ? 93.269  93.626  79.460  1.00 31.35  ?  70  VAL B O     1 
ATOM 1113  C CB    . VAL B 2 71  ? 93.449  92.260  82.261  1.00 31.35  ?  70  VAL B CB    1 
ATOM 1114  C CG1   . VAL B 2 71  ? 94.152  91.033  81.716  1.00 31.35  ?  70  VAL B CG1   1 
ATOM 1115  C CG2   . VAL B 2 71  ? 94.402  93.419  82.448  1.00 31.35  ?  70  VAL B CG2   1 
ATOM 1116  N N     . THR B 2 72  ? 92.145  91.711  79.117  1.00 32.97  ?  71  THR B N     1 
ATOM 1117  C CA    . THR B 2 72  ? 92.469  91.692  77.697  1.00 32.97  ?  71  THR B CA    1 
ATOM 1118  C C     . THR B 2 72  ? 91.684  92.751  76.938  1.00 32.97  ?  71  THR B C     1 
ATOM 1119  O O     . THR B 2 72  ? 92.267  93.524  76.167  1.00 32.97  ?  71  THR B O     1 
ATOM 1120  C CB    . THR B 2 72  ? 92.203  90.308  77.119  1.00 32.97  ?  71  THR B CB    1 
ATOM 1121  O OG1   . THR B 2 72  ? 93.030  89.354  77.790  1.00 32.97  ?  71  THR B OG1   1 
ATOM 1122  C CG2   . THR B 2 72  ? 92.520  90.281  75.646  1.00 32.97  ?  71  THR B CG2   1 
ATOM 1123  N N     . TYR B 2 73  ? 90.363  92.808  77.162  1.00 31.53  ?  72  TYR B N     1 
ATOM 1124  C CA    . TYR B 2 73  ? 89.504  93.755  76.452  1.00 31.53  ?  72  TYR B CA    1 
ATOM 1125  C C     . TYR B 2 73  ? 89.912  95.193  76.731  1.00 31.53  ?  72  TYR B C     1 
ATOM 1126  O O     . TYR B 2 73  ? 90.071  95.996  75.804  1.00 31.53  ?  72  TYR B O     1 
ATOM 1127  C CB    . TYR B 2 73  ? 88.044  93.552  76.841  1.00 31.53  ?  72  TYR B CB    1 
ATOM 1128  C CG    . TYR B 2 73  ? 87.414  92.296  76.319  1.00 31.53  ?  72  TYR B CG    1 
ATOM 1129  C CD1   . TYR B 2 73  ? 86.988  92.210  75.010  1.00 31.53  ?  72  TYR B CD1   1 
ATOM 1130  C CD2   . TYR B 2 73  ? 87.210  91.210  77.144  1.00 31.53  ?  72  TYR B CD2   1 
ATOM 1131  C CE1   . TYR B 2 73  ? 86.400  91.067  74.530  1.00 31.53  ?  72  TYR B CE1   1 
ATOM 1132  C CE2   . TYR B 2 73  ? 86.620  90.065  76.675  1.00 31.53  ?  72  TYR B CE2   1 
ATOM 1133  C CZ    . TYR B 2 73  ? 86.218  90.000  75.368  1.00 31.53  ?  72  TYR B CZ    1 
ATOM 1134  O OH    . TYR B 2 73  ? 85.632  88.855  74.891  1.00 31.53  ?  72  TYR B OH    1 
ATOM 1135  N N     . THR B 2 74  ? 90.155  95.519  78.000  1.00 35.28  ?  73  THR B N     1 
ATOM 1136  C CA    . THR B 2 74  ? 90.617  96.858  78.328  1.00 35.28  ?  73  THR B CA    1 
ATOM 1137  C C     . THR B 2 74  ? 92.045  97.112  77.873  1.00 35.28  ?  73  THR B C     1 
ATOM 1138  O O     . THR B 2 74  ? 92.453  98.273  77.797  1.00 35.28  ?  73  THR B O     1 
ATOM 1139  C CB    . THR B 2 74  ? 90.510  97.118  79.822  1.00 35.28  ?  73  THR B CB    1 
ATOM 1140  O OG1   . THR B 2 74  ? 90.897  98.469  80.089  1.00 35.28  ?  73  THR B OG1   1 
ATOM 1141  C CG2   . THR B 2 74  ? 91.414  96.189  80.584  1.00 35.28  ?  73  THR B CG2   1 
ATOM 1142  N N     . GLU B 2 75  ? 92.812  96.070  77.557  1.00 40.33  ?  74  GLU B N     1 
ATOM 1143  C CA    . GLU B 2 75  ? 94.099  96.320  76.932  1.00 40.33  ?  74  GLU B CA    1 
ATOM 1144  C C     . GLU B 2 75  ? 93.917  96.708  75.477  1.00 40.33  ?  74  GLU B C     1 
ATOM 1145  O O     . GLU B 2 75  ? 94.703  97.495  74.942  1.00 40.33  ?  74  GLU B O     1 
ATOM 1146  C CB    . GLU B 2 75  ? 94.994  95.089  77.058  1.00 40.33  ?  74  GLU B CB    1 
ATOM 1147  C CG    . GLU B 2 75  ? 96.423  95.291  76.594  1.00 40.33  ?  74  GLU B CG    1 
ATOM 1148  C CD    . GLU B 2 75  ? 97.276  94.056  76.796  1.00 40.33  ?  74  GLU B CD    1 
ATOM 1149  O OE1   . GLU B 2 75  ? 96.747  93.042  77.294  1.00 40.33  ?  74  GLU B OE1   1 
ATOM 1150  O OE2   . GLU B 2 75  ? 98.475  94.096  76.451  1.00 40.33  -1 74  GLU B OE2   1 
ATOM 1151  N N     . HIS B 2 76  ? 92.860  96.206  74.843  1.00 36.73  ?  75  HIS B N     1 
ATOM 1152  C CA    . HIS B 2 76  ? 92.685  96.437  73.419  1.00 36.73  ?  75  HIS B CA    1 
ATOM 1153  C C     . HIS B 2 76  ? 92.187  97.841  73.115  1.00 36.73  ?  75  HIS B C     1 
ATOM 1154  O O     . HIS B 2 76  ? 92.537  98.401  72.073  1.00 36.73  ?  75  HIS B O     1 
ATOM 1155  C CB    . HIS B 2 76  ? 91.736  95.393  72.840  1.00 36.73  ?  75  HIS B CB    1 
ATOM 1156  C CG    . HIS B 2 76  ? 91.450  95.584  71.389  1.00 36.73  ?  75  HIS B CG    1 
ATOM 1157  N ND1   . HIS B 2 76  ? 90.405  96.356  70.941  1.00 36.73  ?  75  HIS B ND1   1 
ATOM 1158  C CD2   . HIS B 2 76  ? 92.085  95.136  70.283  1.00 36.73  ?  75  HIS B CD2   1 
ATOM 1159  C CE1   . HIS B 2 76  ? 90.395  96.362  69.621  1.00 36.73  ?  75  HIS B CE1   1 
ATOM 1160  N NE2   . HIS B 2 76  ? 91.404  95.627  69.196  1.00 36.73  ?  75  HIS B NE2   1 
ATOM 1161  N N     . ALA B 2 77  ? 91.398  98.435  73.999  1.00 40.39  ?  76  ALA B N     1 
ATOM 1162  C CA    . ALA B 2 77  ? 90.824  99.741  73.726  1.00 40.39  ?  76  ALA B CA    1 
ATOM 1163  C C     . ALA B 2 77  ? 91.675  100.889 74.252  1.00 40.39  ?  76  ALA B C     1 
ATOM 1164  O O     . ALA B 2 77  ? 91.169  102.013 74.337  1.00 40.39  ?  76  ALA B O     1 
ATOM 1165  C CB    . ALA B 2 77  ? 89.417  99.828  74.311  1.00 40.39  ?  76  ALA B CB    1 
ATOM 1166  N N     . LYS B 2 78  ? 92.945  100.624 74.589  1.00 41.95  ?  77  LYS B N     1 
ATOM 1167  C CA    . LYS B 2 78  ? 93.911  101.616 75.091  1.00 41.95  ?  77  LYS B CA    1 
ATOM 1168  C C     . LYS B 2 78  ? 93.398  102.351 76.328  1.00 41.95  ?  77  LYS B C     1 
ATOM 1169  O O     . LYS B 2 78  ? 93.513  103.571 76.445  1.00 41.95  ?  77  LYS B O     1 
ATOM 1170  C CB    . LYS B 2 78  ? 94.319  102.620 74.008  1.00 41.95  ?  77  LYS B CB    1 
ATOM 1171  C CG    . LYS B 2 78  ? 95.485  102.195 73.138  1.00 41.95  ?  77  LYS B CG    1 
ATOM 1172  C CD    . LYS B 2 78  ? 95.053  101.269 72.031  1.00 41.95  ?  77  LYS B CD    1 
ATOM 1173  C CE    . LYS B 2 78  ? 94.225  102.023 71.008  1.00 41.95  ?  77  LYS B CE    1 
ATOM 1174  N NZ    . LYS B 2 78  ? 93.854  101.167 69.850  1.00 41.95  1  77  LYS B NZ    1 
ATOM 1175  N N     . ARG B 2 79  ? 92.827  101.598 77.260  1.00 46.90  ?  78  ARG B N     1 
ATOM 1176  C CA    . ARG B 2 79  ? 92.257  102.178 78.466  1.00 46.90  ?  78  ARG B CA    1 
ATOM 1177  C C     . ARG B 2 79  ? 92.881  101.519 79.685  1.00 46.90  ?  78  ARG B C     1 
ATOM 1178  O O     . ARG B 2 79  ? 92.888  100.291 79.790  1.00 46.90  ?  78  ARG B O     1 
ATOM 1179  C CB    . ARG B 2 79  ? 90.732  102.017 78.489  1.00 46.90  ?  78  ARG B CB    1 
ATOM 1180  C CG    . ARG B 2 79  ? 90.014  102.834 77.427  1.00 46.90  ?  78  ARG B CG    1 
ATOM 1181  C CD    . ARG B 2 79  ? 88.509  102.775 77.585  1.00 46.90  ?  78  ARG B CD    1 
ATOM 1182  N NE    . ARG B 2 79  ? 87.970  101.463 77.265  1.00 46.90  ?  78  ARG B NE    1 
ATOM 1183  C CZ    . ARG B 2 79  ? 87.424  100.653 78.162  1.00 46.90  ?  78  ARG B CZ    1 
ATOM 1184  N NH1   . ARG B 2 79  ? 87.356  101.031 79.426  1.00 46.90  1  78  ARG B NH1   1 
ATOM 1185  N NH2   . ARG B 2 79  ? 86.950  99.470  77.798  1.00 46.90  ?  78  ARG B NH2   1 
ATOM 1186  N N     . LYS B 2 80  ? 93.402  102.332 80.603  1.00 53.82  ?  79  LYS B N     1 
ATOM 1187  C CA    . LYS B 2 80  ? 93.873  101.819 81.884  1.00 53.82  ?  79  LYS B CA    1 
ATOM 1188  C C     . LYS B 2 80  ? 92.746  101.614 82.885  1.00 53.82  ?  79  LYS B C     1 
ATOM 1189  O O     . LYS B 2 80  ? 93.019  101.240 84.029  1.00 53.82  ?  79  LYS B O     1 
ATOM 1190  C CB    . LYS B 2 80  ? 94.901  102.758 82.519  1.00 53.82  ?  79  LYS B CB    1 
ATOM 1191  C CG    . LYS B 2 80  ? 96.334  102.650 82.030  1.00 53.82  ?  79  LYS B CG    1 
ATOM 1192  C CD    . LYS B 2 80  ? 96.558  103.435 80.753  1.00 53.82  ?  79  LYS B CD    1 
ATOM 1193  C CE    . LYS B 2 80  ? 98.036  103.525 80.410  1.00 53.82  ?  79  LYS B CE    1 
ATOM 1194  N NZ    . LYS B 2 80  ? 98.268  104.242 79.126  1.00 53.82  1  79  LYS B NZ    1 
ATOM 1195  N N     . THR B 2 81  ? 91.503  101.875 82.505  1.00 50.58  ?  80  THR B N     1 
ATOM 1196  C CA    . THR B 2 81  ? 90.360  101.760 83.398  1.00 50.58  ?  80  THR B CA    1 
ATOM 1197  C C     . THR B 2 81  ? 89.565  100.526 83.015  1.00 50.58  ?  80  THR B C     1 
ATOM 1198  O O     . THR B 2 81  ? 89.160  100.382 81.859  1.00 50.58  ?  80  THR B O     1 
ATOM 1199  C CB    . THR B 2 81  ? 89.476  103.000 83.312  1.00 50.58  ?  80  THR B CB    1 
ATOM 1200  O OG1   . THR B 2 81  ? 90.239  104.156 83.674  1.00 50.58  ?  80  THR B OG1   1 
ATOM 1201  C CG2   . THR B 2 81  ? 88.290  102.873 84.235  1.00 50.58  ?  80  THR B CG2   1 
ATOM 1202  N N     . VAL B 2 82  ? 89.335  99.645  83.980  1.00 38.84  ?  81  VAL B N     1 
ATOM 1203  C CA    . VAL B 2 82  ? 88.614  98.405  83.739  1.00 38.84  ?  81  VAL B CA    1 
ATOM 1204  C C     . VAL B 2 82  ? 87.153  98.667  84.082  1.00 38.84  ?  81  VAL B C     1 
ATOM 1205  O O     . VAL B 2 82  ? 86.756  98.602  85.243  1.00 38.84  ?  81  VAL B O     1 
ATOM 1206  C CB    . VAL B 2 82  ? 89.197  97.258  84.557  1.00 38.84  ?  81  VAL B CB    1 
ATOM 1207  C CG1   . VAL B 2 82  ? 88.461  95.971  84.263  1.00 38.84  ?  81  VAL B CG1   1 
ATOM 1208  C CG2   . VAL B 2 82  ? 90.671  97.131  84.268  1.00 38.84  ?  81  VAL B CG2   1 
ATOM 1209  N N     . THR B 2 83  ? 86.349  98.969  83.069  1.00 40.28  ?  82  THR B N     1 
ATOM 1210  C CA    . THR B 2 83  ? 84.964  99.347  83.296  1.00 40.28  ?  82  THR B CA    1 
ATOM 1211  C C     . THR B 2 83  ? 84.109  98.125  83.604  1.00 40.28  ?  82  THR B C     1 
ATOM 1212  O O     . THR B 2 83  ? 84.567  96.983  83.561  1.00 40.28  ?  82  THR B O     1 
ATOM 1213  C CB    . THR B 2 83  ? 84.392  100.062 82.080  1.00 40.28  ?  82  THR B CB    1 
ATOM 1214  O OG1   . THR B 2 83  ? 84.372  99.158  80.970  1.00 40.28  ?  82  THR B OG1   1 
ATOM 1215  C CG2   . THR B 2 83  ? 85.244  101.267 81.735  1.00 40.28  ?  82  THR B CG2   1 
ATOM 1216  N N     . ALA B 2 84  ? 82.834  98.383  83.901  1.00 40.88  ?  83  ALA B N     1 
ATOM 1217  C CA    . ALA B 2 84  ? 81.911  97.297  84.207  1.00 40.88  ?  83  ALA B CA    1 
ATOM 1218  C C     . ALA B 2 84  ? 81.553  96.498  82.967  1.00 40.88  ?  83  ALA B C     1 
ATOM 1219  O O     . ALA B 2 84  ? 81.344  95.281  83.060  1.00 40.88  ?  83  ALA B O     1 
ATOM 1220  C CB    . ALA B 2 84  ? 80.643  97.846  84.854  1.00 40.88  ?  83  ALA B CB    1 
ATOM 1221  N N     . MET B 2 85  ? 81.492  97.161  81.807  1.00 42.11  ?  84  MET B N     1 
ATOM 1222  C CA    . MET B 2 85  ? 81.141  96.486  80.562  1.00 42.11  ?  84  MET B CA    1 
ATOM 1223  C C     . MET B 2 85  ? 82.168  95.434  80.179  1.00 42.11  ?  84  MET B C     1 
ATOM 1224  O O     . MET B 2 85  ? 81.816  94.418  79.571  1.00 42.11  ?  84  MET B O     1 
ATOM 1225  C CB    . MET B 2 85  ? 81.001  97.505  79.437  1.00 42.11  ?  84  MET B CB    1 
ATOM 1226  C CG    . MET B 2 85  ? 79.864  98.469  79.631  1.00 42.11  ?  84  MET B CG    1 
ATOM 1227  S SD    . MET B 2 85  ? 78.299  97.601  79.771  1.00 42.11  ?  84  MET B SD    1 
ATOM 1228  C CE    . MET B 2 85  ? 78.137  96.938  78.122  1.00 42.11  ?  84  MET B CE    1 
ATOM 1229  N N     . ASP B 2 86  ? 83.427  95.639  80.564  1.00 38.33  ?  85  ASP B N     1 
ATOM 1230  C CA    . ASP B 2 86  ? 84.468  94.670  80.260  1.00 38.33  ?  85  ASP B CA    1 
ATOM 1231  C C     . ASP B 2 86  ? 84.269  93.385  81.052  1.00 38.33  ?  85  ASP B C     1 
ATOM 1232  O O     . ASP B 2 86  ? 84.395  92.284  80.504  1.00 38.33  ?  85  ASP B O     1 
ATOM 1233  C CB    . ASP B 2 86  ? 85.825  95.286  80.561  1.00 38.33  ?  85  ASP B CB    1 
ATOM 1234  C CG    . ASP B 2 86  ? 86.056  96.565  79.789  1.00 38.33  ?  85  ASP B CG    1 
ATOM 1235  O OD1   . ASP B 2 86  ? 85.452  96.732  78.710  1.00 38.33  ?  85  ASP B OD1   1 
ATOM 1236  O OD2   . ASP B 2 86  ? 86.840  97.409  80.262  1.00 38.33  -1 85  ASP B OD2   1 
ATOM 1237  N N     . VAL B 2 87  ? 83.918  93.508  82.331  1.00 31.27  ?  86  VAL B N     1 
ATOM 1238  C CA    . VAL B 2 87  ? 83.668  92.325  83.141  1.00 31.27  ?  86  VAL B CA    1 
ATOM 1239  C C     . VAL B 2 87  ? 82.381  91.644  82.703  1.00 31.27  ?  86  VAL B C     1 
ATOM 1240  O O     . VAL B 2 87  ? 82.300  90.409  82.701  1.00 31.27  ?  86  VAL B O     1 
ATOM 1241  C CB    . VAL B 2 87  ? 83.643  92.712  84.627  1.00 31.27  ?  86  VAL B CB    1 
ATOM 1242  C CG1   . VAL B 2 87  ? 83.387  91.512  85.504  1.00 31.27  ?  86  VAL B CG1   1 
ATOM 1243  C CG2   . VAL B 2 87  ? 84.948  93.350  85.006  1.00 31.27  ?  86  VAL B CG2   1 
ATOM 1244  N N     . VAL B 2 88  ? 81.382  92.422  82.275  1.00 31.78  ?  87  VAL B N     1 
ATOM 1245  C CA    . VAL B 2 88  ? 80.146  91.832  81.763  1.00 31.78  ?  87  VAL B CA    1 
ATOM 1246  C C     . VAL B 2 88  ? 80.409  91.046  80.482  1.00 31.78  ?  87  VAL B C     1 
ATOM 1247  O O     . VAL B 2 88  ? 79.908  89.928  80.313  1.00 31.78  ?  87  VAL B O     1 
ATOM 1248  C CB    . VAL B 2 88  ? 79.081  92.925  81.565  1.00 31.78  ?  87  VAL B CB    1 
ATOM 1249  C CG1   . VAL B 2 88  ? 77.870  92.382  80.847  1.00 31.78  ?  87  VAL B CG1   1 
ATOM 1250  C CG2   . VAL B 2 88  ? 78.649  93.455  82.902  1.00 31.78  ?  87  VAL B CG2   1 
ATOM 1251  N N     . TYR B 2 89  ? 81.257  91.578  79.599  1.00 36.59  ?  88  TYR B N     1 
ATOM 1252  C CA    . TYR B 2 89  ? 81.603  90.870  78.370  1.00 36.59  ?  88  TYR B CA    1 
ATOM 1253  C C     . TYR B 2 89  ? 82.424  89.619  78.649  1.00 36.59  ?  88  TYR B C     1 
ATOM 1254  O O     . TYR B 2 89  ? 82.216  88.584  78.005  1.00 36.59  ?  88  TYR B O     1 
ATOM 1255  C CB    . TYR B 2 89  ? 82.358  91.805  77.435  1.00 36.59  ?  88  TYR B CB    1 
ATOM 1256  C CG    . TYR B 2 89  ? 81.490  92.859  76.808  1.00 36.59  ?  88  TYR B CG    1 
ATOM 1257  C CD1   . TYR B 2 89  ? 80.126  92.665  76.668  1.00 36.59  ?  88  TYR B CD1   1 
ATOM 1258  C CD2   . TYR B 2 89  ? 82.027  94.068  76.399  1.00 36.59  ?  88  TYR B CD2   1 
ATOM 1259  C CE1   . TYR B 2 89  ? 79.326  93.631  76.104  1.00 36.59  ?  88  TYR B CE1   1 
ATOM 1260  C CE2   . TYR B 2 89  ? 81.233  95.044  75.841  1.00 36.59  ?  88  TYR B CE2   1 
ATOM 1261  C CZ    . TYR B 2 89  ? 79.885  94.819  75.697  1.00 36.59  ?  88  TYR B CZ    1 
ATOM 1262  O OH    . TYR B 2 89  ? 79.091  95.787  75.133  1.00 36.59  ?  88  TYR B OH    1 
ATOM 1263  N N     . ALA B 2 90  ? 83.344  89.684  79.615  1.00 31.77  ?  89  ALA B N     1 
ATOM 1264  C CA    . ALA B 2 90  ? 84.143  88.508  79.947  1.00 31.77  ?  89  ALA B CA    1 
ATOM 1265  C C     . ALA B 2 90  ? 83.290  87.411  80.568  1.00 31.77  ?  89  ALA B C     1 
ATOM 1266  O O     . ALA B 2 90  ? 83.461  86.229  80.250  1.00 31.77  ?  89  ALA B O     1 
ATOM 1267  C CB    . ALA B 2 90  ? 85.280  88.892  80.884  1.00 31.77  ?  89  ALA B CB    1 
ATOM 1268  N N     . LEU B 2 91  ? 82.351  87.785  81.434  1.00 31.02  ?  90  LEU B N     1 
ATOM 1269  C CA    . LEU B 2 91  ? 81.441  86.803  82.009  1.00 31.02  ?  90  LEU B CA    1 
ATOM 1270  C C     . LEU B 2 91  ? 80.472  86.252  80.976  1.00 31.02  ?  90  LEU B C     1 
ATOM 1271  O O     . LEU B 2 91  ? 80.046  85.099  81.089  1.00 31.02  ?  90  LEU B O     1 
ATOM 1272  C CB    . LEU B 2 91  ? 80.677  87.425  83.167  1.00 31.02  ?  90  LEU B CB    1 
ATOM 1273  C CG    . LEU B 2 91  ? 81.543  87.644  84.392  1.00 31.02  ?  90  LEU B CG    1 
ATOM 1274  C CD1   . LEU B 2 91  ? 80.830  88.524  85.379  1.00 31.02  ?  90  LEU B CD1   1 
ATOM 1275  C CD2   . LEU B 2 91  ? 81.822  86.297  84.994  1.00 31.02  ?  90  LEU B CD2   1 
ATOM 1276  N N     . LYS B 2 92  ? 80.104  87.052  79.975  1.00 33.61  ?  91  LYS B N     1 
ATOM 1277  C CA    . LYS B 2 92  ? 79.272  86.531  78.897  1.00 33.61  ?  91  LYS B CA    1 
ATOM 1278  C C     . LYS B 2 92  ? 80.051  85.549  78.038  1.00 33.61  ?  91  LYS B C     1 
ATOM 1279  O O     . LYS B 2 92  ? 79.499  84.555  77.554  1.00 33.61  ?  91  LYS B O     1 
ATOM 1280  C CB    . LYS B 2 92  ? 78.735  87.685  78.054  1.00 33.61  ?  91  LYS B CB    1 
ATOM 1281  C CG    . LYS B 2 92  ? 77.866  87.273  76.885  1.00 33.61  ?  91  LYS B CG    1 
ATOM 1282  C CD    . LYS B 2 92  ? 77.277  88.482  76.195  1.00 33.61  ?  91  LYS B CD    1 
ATOM 1283  C CE    . LYS B 2 92  ? 76.615  88.081  74.896  1.00 33.61  ?  91  LYS B CE    1 
ATOM 1284  N NZ    . LYS B 2 92  ? 75.475  87.156  75.130  1.00 33.61  1  91  LYS B NZ    1 
ATOM 1285  N N     . ARG B 2 93  ? 81.344  85.799  77.863  1.00 34.90  ?  92  ARG B N     1 
ATOM 1286  C CA    . ARG B 2 93  ? 82.158  84.911  77.048  1.00 34.90  ?  92  ARG B CA    1 
ATOM 1287  C C     . ARG B 2 93  ? 82.451  83.601  77.773  1.00 34.90  ?  92  ARG B C     1 
ATOM 1288  O O     . ARG B 2 93  ? 82.519  82.540  77.143  1.00 34.90  ?  92  ARG B O     1 
ATOM 1289  C CB    . ARG B 2 93  ? 83.449  85.620  76.664  1.00 34.90  ?  92  ARG B CB    1 
ATOM 1290  C CG    . ARG B 2 93  ? 84.305  84.824  75.756  1.00 34.90  ?  92  ARG B CG    1 
ATOM 1291  C CD    . ARG B 2 93  ? 85.631  85.461  75.562  1.00 34.90  ?  92  ARG B CD    1 
ATOM 1292  N NE    . ARG B 2 93  ? 86.461  84.533  74.824  1.00 34.90  ?  92  ARG B NE    1 
ATOM 1293  C CZ    . ARG B 2 93  ? 87.070  83.502  75.394  1.00 34.90  ?  92  ARG B CZ    1 
ATOM 1294  N NH1   . ARG B 2 93  ? 86.914  83.286  76.693  1.00 34.90  1  92  ARG B NH1   1 
ATOM 1295  N NH2   . ARG B 2 93  ? 87.811  82.679  74.672  1.00 34.90  ?  92  ARG B NH2   1 
ATOM 1296  N N     . GLN B 2 94  ? 82.621  83.654  79.098  1.00 37.22  ?  93  GLN B N     1 
ATOM 1297  C CA    . GLN B 2 94  ? 82.796  82.431  79.880  1.00 37.22  ?  93  GLN B CA    1 
ATOM 1298  C C     . GLN B 2 94  ? 81.571  81.534  79.817  1.00 37.22  ?  93  GLN B C     1 
ATOM 1299  O O     . GLN B 2 94  ? 81.698  80.308  79.872  1.00 37.22  ?  93  GLN B O     1 
ATOM 1300  C CB    . GLN B 2 94  ? 83.093  82.767  81.338  1.00 37.22  ?  93  GLN B CB    1 
ATOM 1301  C CG    . GLN B 2 94  ? 84.438  83.382  81.587  1.00 37.22  ?  93  GLN B CG    1 
ATOM 1302  C CD    . GLN B 2 94  ? 85.546  82.397  81.378  1.00 37.22  ?  93  GLN B CD    1 
ATOM 1303  O OE1   . GLN B 2 94  ? 85.413  81.224  81.719  1.00 37.22  ?  93  GLN B OE1   1 
ATOM 1304  N NE2   . GLN B 2 94  ? 86.656  82.861  80.820  1.00 37.22  ?  93  GLN B NE2   1 
ATOM 1305  N N     . GLY B 2 95  ? 80.386  82.121  79.704  1.00 37.32  ?  94  GLY B N     1 
ATOM 1306  C CA    . GLY B 2 95  ? 79.138  81.387  79.674  1.00 37.32  ?  94  GLY B CA    1 
ATOM 1307  C C     . GLY B 2 95  ? 78.171  81.772  80.768  1.00 37.32  ?  94  GLY B C     1 
ATOM 1308  O O     . GLY B 2 95  ? 76.972  81.489  80.649  1.00 37.32  ?  94  GLY B O     1 
ATOM 1309  N N     . ARG B 2 96  ? 78.647  82.416  81.826  1.00 39.73  ?  95  ARG B N     1 
ATOM 1310  C CA    . ARG B 2 96  ? 77.817  82.785  82.970  1.00 39.73  ?  95  ARG B CA    1 
ATOM 1311  C C     . ARG B 2 96  ? 77.400  84.235  82.760  1.00 39.73  ?  95  ARG B C     1 
ATOM 1312  O O     . ARG B 2 96  ? 78.081  85.161  83.194  1.00 39.73  ?  95  ARG B O     1 
ATOM 1313  C CB    . ARG B 2 96  ? 78.567  82.603  84.288  1.00 39.73  ?  95  ARG B CB    1 
ATOM 1314  C CG    . ARG B 2 96  ? 78.666  81.171  84.816  1.00 39.73  ?  95  ARG B CG    1 
ATOM 1315  C CD    . ARG B 2 96  ? 79.780  80.396  84.134  1.00 39.73  ?  95  ARG B CD    1 
ATOM 1316  N NE    . ARG B 2 96  ? 79.935  79.043  84.646  1.00 39.73  ?  95  ARG B NE    1 
ATOM 1317  C CZ    . ARG B 2 96  ? 80.699  78.726  85.683  1.00 39.73  ?  95  ARG B CZ    1 
ATOM 1318  N NH1   . ARG B 2 96  ? 81.367  79.672  86.324  1.00 39.73  1  95  ARG B NH1   1 
ATOM 1319  N NH2   . ARG B 2 96  ? 80.791  77.465  86.079  1.00 39.73  ?  95  ARG B NH2   1 
ATOM 1320  N N     . THR B 2 97  ? 76.267  84.426  82.091  1.00 35.47  ?  96  THR B N     1 
ATOM 1321  C CA    . THR B 2 97  ? 75.821  85.760  81.711  1.00 35.47  ?  96  THR B CA    1 
ATOM 1322  C C     . THR B 2 97  ? 75.347  86.537  82.930  1.00 35.47  ?  96  THR B C     1 
ATOM 1323  O O     . THR B 2 97  ? 74.588  86.018  83.752  1.00 35.47  ?  96  THR B O     1 
ATOM 1324  C CB    . THR B 2 97  ? 74.699  85.651  80.681  1.00 35.47  ?  96  THR B CB    1 
ATOM 1325  O OG1   . THR B 2 97  ? 75.181  84.950  79.531  1.00 35.47  ?  96  THR B OG1   1 
ATOM 1326  C CG2   . THR B 2 97  ? 74.210  87.017  80.246  1.00 35.47  ?  96  THR B CG2   1 
ATOM 1327  N N     . LEU B 2 98  ? 75.813  87.774  83.060  1.00 31.68  ?  97  LEU B N     1 
ATOM 1328  C CA    . LEU B 2 98  ? 75.394  88.665  84.130  1.00 31.68  ?  97  LEU B CA    1 
ATOM 1329  C C     . LEU B 2 98  ? 74.564  89.786  83.529  1.00 31.68  ?  97  LEU B C     1 
ATOM 1330  O O     . LEU B 2 98  ? 74.960  90.376  82.521  1.00 31.68  ?  97  LEU B O     1 
ATOM 1331  C CB    . LEU B 2 98  ? 76.610  89.220  84.870  1.00 31.68  ?  97  LEU B CB    1 
ATOM 1332  C CG    . LEU B 2 98  ? 76.424  89.983  86.177  1.00 31.68  ?  97  LEU B CG    1 
ATOM 1333  C CD1   . LEU B 2 98  ? 77.613  89.710  87.047  1.00 31.68  ?  97  LEU B CD1   1 
ATOM 1334  C CD2   . LEU B 2 98  ? 76.319  91.469  85.952  1.00 31.68  ?  97  LEU B CD2   1 
ATOM 1335  N N     . TYR B 2 99  ? 73.427  90.090  84.153  1.00 33.53  ?  98  TYR B N     1 
ATOM 1336  C CA    . TYR B 2 99  ? 72.546  91.125  83.626  1.00 33.53  ?  98  TYR B CA    1 
ATOM 1337  C C     . TYR B 2 99  ? 72.718  92.462  84.328  1.00 33.53  ?  98  TYR B C     1 
ATOM 1338  O O     . TYR B 2 99  ? 73.068  93.455  83.687  1.00 33.53  ?  98  TYR B O     1 
ATOM 1339  C CB    . TYR B 2 99  ? 71.086  90.688  83.722  1.00 33.53  ?  98  TYR B CB    1 
ATOM 1340  C CG    . TYR B 2 99  ? 70.651  89.771  82.621  1.00 33.53  ?  98  TYR B CG    1 
ATOM 1341  C CD1   . TYR B 2 99  ? 71.417  89.620  81.482  1.00 33.53  ?  98  TYR B CD1   1 
ATOM 1342  C CD2   . TYR B 2 99  ? 69.463  89.080  82.703  1.00 33.53  ?  98  TYR B CD2   1 
ATOM 1343  C CE1   . TYR B 2 99  ? 71.019  88.785  80.464  1.00 33.53  ?  98  TYR B CE1   1 
ATOM 1344  C CE2   . TYR B 2 99  ? 69.061  88.236  81.696  1.00 33.53  ?  98  TYR B CE2   1 
ATOM 1345  C CZ    . TYR B 2 99  ? 69.840  88.099  80.582  1.00 33.53  ?  98  TYR B CZ    1 
ATOM 1346  O OH    . TYR B 2 99  ? 69.432  87.265  79.571  1.00 33.53  ?  98  TYR B OH    1 
ATOM 1347  N N     . GLY B 2 100 ? 72.524  92.485  85.642  1.00 40.68  ?  99  GLY B N     1 
ATOM 1348  C CA    . GLY B 2 100 ? 72.175  93.680  86.394  1.00 40.68  ?  99  GLY B CA    1 
ATOM 1349  C C     . GLY B 2 100 ? 72.997  94.948  86.272  1.00 40.68  ?  99  GLY B C     1 
ATOM 1350  O O     . GLY B 2 100 ? 72.535  96.014  86.681  1.00 40.68  ?  99  GLY B O     1 
ATOM 1351  N N     . PHE B 2 101 ? 74.194  94.874  85.708  1.00 42.59  ?  100 PHE B N     1 
ATOM 1352  C CA    . PHE B 2 101 ? 75.024  96.058  85.593  1.00 42.59  ?  100 PHE B CA    1 
ATOM 1353  C C     . PHE B 2 101 ? 75.211  96.427  84.132  1.00 42.59  ?  100 PHE B C     1 
ATOM 1354  O O     . PHE B 2 101 ? 74.810  95.701  83.222  1.00 42.59  ?  100 PHE B O     1 
ATOM 1355  C CB    . PHE B 2 101 ? 76.375  95.847  86.268  1.00 42.59  ?  100 PHE B CB    1 
ATOM 1356  C CG    . PHE B 2 101 ? 76.261  95.534  87.716  1.00 42.59  ?  100 PHE B CG    1 
ATOM 1357  C CD1   . PHE B 2 101 ? 75.906  96.516  88.625  1.00 42.59  ?  100 PHE B CD1   1 
ATOM 1358  C CD2   . PHE B 2 101 ? 76.519  94.263  88.173  1.00 42.59  ?  100 PHE B CD2   1 
ATOM 1359  C CE1   . PHE B 2 101 ? 75.796  96.221  89.968  1.00 42.59  ?  100 PHE B CE1   1 
ATOM 1360  C CE2   . PHE B 2 101 ? 76.422  93.961  89.507  1.00 42.59  ?  100 PHE B CE2   1 
ATOM 1361  C CZ    . PHE B 2 101 ? 76.055  94.941  90.411  1.00 42.59  ?  100 PHE B CZ    1 
ATOM 1362  N N     . GLY B 2 102 ? 75.838  97.575  83.920  1.00 58.05  ?  101 GLY B N     1 
ATOM 1363  C CA    . GLY B 2 102 ? 76.029  98.095  82.584  1.00 58.05  ?  101 GLY B CA    1 
ATOM 1364  C C     . GLY B 2 102 ? 76.320  99.580  82.581  1.00 58.05  ?  101 GLY B C     1 
ATOM 1365  O O     . GLY B 2 102 ? 76.262  100.243 81.545  1.00 58.05  ?  101 GLY B O     1 
ATOM 1366  O OXT   . GLY B 2 102 ? 76.615  100.153 83.627  1.00 58.05  -1 101 GLY B OXT   1 
ATOM 1367  N N     . ALA C 3 15  ? 101.096 86.030  39.007  1.00 67.19  ?  14  ALA C N     1 
ATOM 1368  C CA    . ALA C 3 15  ? 102.488 85.765  38.672  1.00 67.19  ?  14  ALA C CA    1 
ATOM 1369  C C     . ALA C 3 15  ? 103.301 85.505  39.932  1.00 67.19  ?  14  ALA C C     1 
ATOM 1370  O O     . ALA C 3 15  ? 104.472 85.140  39.861  1.00 67.19  ?  14  ALA C O     1 
ATOM 1371  C CB    . ALA C 3 15  ? 103.076 86.926  37.889  1.00 67.19  ?  14  ALA C CB    1 
ATOM 1372  N N     . LYS C 3 16  ? 102.666 85.695  41.085  1.00 70.30  ?  15  LYS C N     1 
ATOM 1373  C CA    . LYS C 3 16  ? 103.321 85.506  42.372  1.00 70.30  ?  15  LYS C CA    1 
ATOM 1374  C C     . LYS C 3 16  ? 102.259 85.186  43.412  1.00 70.30  ?  15  LYS C C     1 
ATOM 1375  O O     . LYS C 3 16  ? 101.231 85.866  43.478  1.00 70.30  ?  15  LYS C O     1 
ATOM 1376  C CB    . LYS C 3 16  ? 104.118 86.752  42.774  1.00 70.30  ?  15  LYS C CB    1 
ATOM 1377  C CG    . LYS C 3 16  ? 104.854 86.632  44.097  1.00 70.30  ?  15  LYS C CG    1 
ATOM 1378  C CD    . LYS C 3 16  ? 106.002 85.645  44.012  1.00 70.30  ?  15  LYS C CD    1 
ATOM 1379  C CE    . LYS C 3 16  ? 106.796 85.618  45.305  1.00 70.30  ?  15  LYS C CE    1 
ATOM 1380  N NZ    . LYS C 3 16  ? 107.868 84.590  45.266  1.00 70.30  1  15  LYS C NZ    1 
ATOM 1381  N N     . SER C 3 17  ? 102.510 84.161  44.215  1.00 63.29  ?  16  SER C N     1 
ATOM 1382  C CA    . SER C 3 17  ? 101.513 83.649  45.140  1.00 63.29  ?  16  SER C CA    1 
ATOM 1383  C C     . SER C 3 17  ? 101.531 84.422  46.453  1.00 63.29  ?  16  SER C C     1 
ATOM 1384  O O     . SER C 3 17  ? 102.552 84.969  46.872  1.00 63.29  ?  16  SER C O     1 
ATOM 1385  C CB    . SER C 3 17  ? 101.747 82.163  45.404  1.00 63.29  ?  16  SER C CB    1 
ATOM 1386  O OG    . SER C 3 17  ? 101.586 81.410  44.216  1.00 63.29  ?  16  SER C OG    1 
ATOM 1387  N N     . ARG C 3 18  ? 100.370 84.450  47.109  1.00 62.72  ?  17  ARG C N     1 
ATOM 1388  C CA    . ARG C 3 18  ? 100.235 85.151  48.380  1.00 62.72  ?  17  ARG C CA    1 
ATOM 1389  C C     . ARG C 3 18  ? 100.848 84.358  49.523  1.00 62.72  ?  17  ARG C C     1 
ATOM 1390  O O     . ARG C 3 18  ? 101.507 84.933  50.397  1.00 62.72  ?  17  ARG C O     1 
ATOM 1391  C CB    . ARG C 3 18  ? 98.763  85.427  48.661  1.00 62.72  ?  17  ARG C CB    1 
ATOM 1392  C CG    . ARG C 3 18  ? 98.109  86.304  47.622  1.00 62.72  ?  17  ARG C CG    1 
ATOM 1393  C CD    . ARG C 3 18  ? 98.536  87.741  47.743  1.00 62.72  ?  17  ARG C CD    1 
ATOM 1394  N NE    . ARG C 3 18  ? 97.947  88.342  48.932  1.00 62.72  ?  17  ARG C NE    1 
ATOM 1395  C CZ    . ARG C 3 18  ? 98.357  89.478  49.472  1.00 62.72  ?  17  ARG C CZ    1 
ATOM 1396  N NH1   . ARG C 3 18  ? 99.376  90.140  48.946  1.00 62.72  1  17  ARG C NH1   1 
ATOM 1397  N NH2   . ARG C 3 18  ? 97.761  89.947  50.558  1.00 62.72  ?  17  ARG C NH2   1 
ATOM 1398  N N     . SER C 3 19  ? 100.645 83.039  49.530  1.00 62.48  ?  18  SER C N     1 
ATOM 1399  C CA    . SER C 3 19  ? 101.254 82.196  50.553  1.00 62.48  ?  18  SER C CA    1 
ATOM 1400  C C     . SER C 3 19  ? 102.770 82.142  50.412  1.00 62.48  ?  18  SER C C     1 
ATOM 1401  O O     . SER C 3 19  ? 103.473 81.904  51.401  1.00 62.48  ?  18  SER C O     1 
ATOM 1402  C CB    . SER C 3 19  ? 100.673 80.787  50.487  1.00 62.48  ?  18  SER C CB    1 
ATOM 1403  O OG    . SER C 3 19  ? 99.291  80.792  50.784  1.00 62.48  ?  18  SER C OG    1 
ATOM 1404  N N     . SER C 3 20  ? 103.288 82.363  49.202  1.00 67.00  ?  19  SER C N     1 
ATOM 1405  C CA    . SER C 3 20  ? 104.730 82.382  49.002  1.00 67.00  ?  19  SER C CA    1 
ATOM 1406  C C     . SER C 3 20  ? 105.364 83.644  49.565  1.00 67.00  ?  19  SER C C     1 
ATOM 1407  O O     . SER C 3 20  ? 106.490 83.589  50.066  1.00 67.00  ?  19  SER C O     1 
ATOM 1408  C CB    . SER C 3 20  ? 105.053 82.243  47.517  1.00 67.00  ?  19  SER C CB    1 
ATOM 1409  O OG    . SER C 3 20  ? 104.603 80.992  47.025  1.00 67.00  ?  19  SER C OG    1 
ATOM 1410  N N     . ARG C 3 21  ? 104.675 84.783  49.483  1.00 66.20  ?  20  ARG C N     1 
ATOM 1411  C CA    . ARG C 3 21  ? 105.114 85.942  50.251  1.00 66.20  ?  20  ARG C CA    1 
ATOM 1412  C C     . ARG C 3 21  ? 104.939 85.692  51.738  1.00 66.20  ?  20  ARG C C     1 
ATOM 1413  O O     . ARG C 3 21  ? 105.762 86.126  52.551  1.00 66.20  ?  20  ARG C O     1 
ATOM 1414  C CB    . ARG C 3 21  ? 104.338 87.192  49.847  1.00 66.20  ?  20  ARG C CB    1 
ATOM 1415  C CG    . ARG C 3 21  ? 104.647 87.756  48.482  1.00 66.20  ?  20  ARG C CG    1 
ATOM 1416  C CD    . ARG C 3 21  ? 103.839 89.025  48.269  1.00 66.20  ?  20  ARG C CD    1 
ATOM 1417  N NE    . ARG C 3 21  ? 104.066 89.616  46.958  1.00 66.20  ?  20  ARG C NE    1 
ATOM 1418  C CZ    . ARG C 3 21  ? 103.354 89.317  45.878  1.00 66.20  ?  20  ARG C CZ    1 
ATOM 1419  N NH1   . ARG C 3 21  ? 102.374 88.429  45.958  1.00 66.20  1  20  ARG C NH1   1 
ATOM 1420  N NH2   . ARG C 3 21  ? 103.622 89.899  44.718  1.00 66.20  ?  20  ARG C NH2   1 
ATOM 1421  N N     . ALA C 3 22  ? 103.869 84.990  52.108  1.00 61.75  ?  21  ALA C N     1 
ATOM 1422  C CA    . ALA C 3 22  ? 103.588 84.739  53.512  1.00 61.75  ?  21  ALA C CA    1 
ATOM 1423  C C     . ALA C 3 22  ? 104.530 83.714  54.122  1.00 61.75  ?  21  ALA C C     1 
ATOM 1424  O O     . ALA C 3 22  ? 104.665 83.676  55.349  1.00 61.75  ?  21  ALA C O     1 
ATOM 1425  C CB    . ALA C 3 22  ? 102.143 84.275  53.675  1.00 61.75  ?  21  ALA C CB    1 
ATOM 1426  N N     . GLY C 3 23  ? 105.183 82.894  53.305  1.00 61.75  ?  22  GLY C N     1 
ATOM 1427  C CA    . GLY C 3 23  ? 106.011 81.829  53.834  1.00 61.75  ?  22  GLY C CA    1 
ATOM 1428  C C     . GLY C 3 23  ? 105.222 80.760  54.547  1.00 61.75  ?  22  GLY C C     1 
ATOM 1429  O O     . GLY C 3 23  ? 105.736 80.126  55.471  1.00 61.75  ?  22  GLY C O     1 
ATOM 1430  N N     . LEU C 3 24  ? 103.980 80.552  54.145  1.00 54.46  ?  23  LEU C N     1 
ATOM 1431  C CA    . LEU C 3 24  ? 103.053 79.676  54.837  1.00 54.46  ?  23  LEU C CA    1 
ATOM 1432  C C     . LEU C 3 24  ? 102.646 78.543  53.903  1.00 54.46  ?  23  LEU C C     1 
ATOM 1433  O O     . LEU C 3 24  ? 103.233 78.348  52.836  1.00 54.46  ?  23  LEU C O     1 
ATOM 1434  C CB    . LEU C 3 24  ? 101.838 80.467  55.318  1.00 54.46  ?  23  LEU C CB    1 
ATOM 1435  C CG    . LEU C 3 24  ? 102.119 81.601  56.298  1.00 54.46  ?  23  LEU C CG    1 
ATOM 1436  C CD1   . LEU C 3 24  ? 100.824 82.312  56.629  1.00 54.46  ?  23  LEU C CD1   1 
ATOM 1437  C CD2   . LEU C 3 24  ? 102.804 81.105  57.555  1.00 54.46  ?  23  LEU C CD2   1 
ATOM 1438  N N     . GLN C 3 25  ? 101.645 77.779  54.323  1.00 54.81  ?  24  GLN C N     1 
ATOM 1439  C CA    . GLN C 3 25  ? 101.079 76.741  53.479  1.00 54.81  ?  24  GLN C CA    1 
ATOM 1440  C C     . GLN C 3 25  ? 99.574  76.846  53.303  1.00 54.81  ?  24  GLN C C     1 
ATOM 1441  O O     . GLN C 3 25  ? 99.076  76.488  52.236  1.00 54.81  ?  24  GLN C O     1 
ATOM 1442  C CB    . GLN C 3 25  ? 101.421 75.353  54.030  1.00 54.81  ?  24  GLN C CB    1 
ATOM 1443  C CG    . GLN C 3 25  ? 102.908 75.043  54.026  1.00 54.81  ?  24  GLN C CG    1 
ATOM 1444  C CD    . GLN C 3 25  ? 103.489 74.973  52.628  1.00 54.81  ?  24  GLN C CD    1 
ATOM 1445  O OE1   . GLN C 3 25  ? 102.845 74.488  51.699  1.00 54.81  ?  24  GLN C OE1   1 
ATOM 1446  N NE2   . GLN C 3 25  ? 104.720 75.446  52.475  1.00 54.81  ?  24  GLN C NE2   1 
ATOM 1447  N N     . PHE C 3 26  ? 98.840  77.310  54.311  1.00 50.31  ?  25  PHE C N     1 
ATOM 1448  C CA    . PHE C 3 26  ? 97.424  77.584  54.132  1.00 50.31  ?  25  PHE C CA    1 
ATOM 1449  C C     . PHE C 3 26  ? 97.232  78.789  53.211  1.00 50.31  ?  25  PHE C C     1 
ATOM 1450  O O     . PHE C 3 26  ? 98.101  79.659  53.134  1.00 50.31  ?  25  PHE C O     1 
ATOM 1451  C CB    . PHE C 3 26  ? 96.750  77.827  55.482  1.00 50.31  ?  25  PHE C CB    1 
ATOM 1452  C CG    . PHE C 3 26  ? 96.406  76.571  56.215  1.00 50.31  ?  25  PHE C CG    1 
ATOM 1453  C CD1   . PHE C 3 26  ? 96.481  75.351  55.585  1.00 50.31  ?  25  PHE C CD1   1 
ATOM 1454  C CD2   . PHE C 3 26  ? 95.978  76.614  57.524  1.00 50.31  ?  25  PHE C CD2   1 
ATOM 1455  C CE1   . PHE C 3 26  ? 96.155  74.188  56.242  1.00 50.31  ?  25  PHE C CE1   1 
ATOM 1456  C CE2   . PHE C 3 26  ? 95.643  75.452  58.191  1.00 50.31  ?  25  PHE C CE2   1 
ATOM 1457  C CZ    . PHE C 3 26  ? 95.737  74.236  57.547  1.00 50.31  ?  25  PHE C CZ    1 
ATOM 1458  N N     . PRO C 3 27  ? 96.118  78.851  52.478  1.00 50.39  ?  26  PRO C N     1 
ATOM 1459  C CA    . PRO C 3 27  ? 95.919  79.959  51.540  1.00 50.39  ?  26  PRO C CA    1 
ATOM 1460  C C     . PRO C 3 27  ? 95.612  81.258  52.263  1.00 50.39  ?  26  PRO C C     1 
ATOM 1461  O O     . PRO C 3 27  ? 95.306  81.299  53.453  1.00 50.39  ?  26  PRO C O     1 
ATOM 1462  C CB    . PRO C 3 27  ? 94.731  79.501  50.697  1.00 50.39  ?  26  PRO C CB    1 
ATOM 1463  C CG    . PRO C 3 27  ? 93.989  78.588  51.580  1.00 50.39  ?  26  PRO C CG    1 
ATOM 1464  C CD    . PRO C 3 27  ? 95.019  77.872  52.381  1.00 50.39  ?  26  PRO C CD    1 
ATOM 1465  N N     . VAL C 3 28  ? 95.711  82.345  51.504  1.00 47.77  ?  27  VAL C N     1 
ATOM 1466  C CA    . VAL C 3 28  ? 95.459  83.683  52.006  1.00 47.77  ?  27  VAL C CA    1 
ATOM 1467  C C     . VAL C 3 28  ? 94.284  84.335  51.296  1.00 47.77  ?  27  VAL C C     1 
ATOM 1468  O O     . VAL C 3 28  ? 93.424  84.946  51.939  1.00 47.77  ?  27  VAL C O     1 
ATOM 1469  C CB    . VAL C 3 28  ? 96.723  84.553  51.884  1.00 47.77  ?  27  VAL C CB    1 
ATOM 1470  C CG1   . VAL C 3 28  ? 96.447  85.981  52.275  1.00 47.77  ?  27  VAL C CG1   1 
ATOM 1471  C CG2   . VAL C 3 28  ? 97.817  83.987  52.752  1.00 47.77  ?  27  VAL C CG2   1 
ATOM 1472  N N     . GLY C 3 29  ? 94.205  84.183  49.975  1.00 50.13  ?  28  GLY C N     1 
ATOM 1473  C CA    . GLY C 3 29  ? 93.106  84.767  49.232  1.00 50.13  ?  28  GLY C CA    1 
ATOM 1474  C C     . GLY C 3 29  ? 91.769  84.125  49.532  1.00 50.13  ?  28  GLY C C     1 
ATOM 1475  O O     . GLY C 3 29  ? 90.736  84.800  49.506  1.00 50.13  ?  28  GLY C O     1 
ATOM 1476  N N     . ARG C 3 30  ? 91.767  82.832  49.854  1.00 51.17  ?  29  ARG C N     1 
ATOM 1477  C CA    . ARG C 3 30  ? 90.512  82.159  50.164  1.00 51.17  ?  29  ARG C CA    1 
ATOM 1478  C C     . ARG C 3 30  ? 89.973  82.597  51.519  1.00 51.17  ?  29  ARG C C     1 
ATOM 1479  O O     . ARG C 3 30  ? 88.763  82.804  51.677  1.00 51.17  ?  29  ARG C O     1 
ATOM 1480  C CB    . ARG C 3 30  ? 90.707  80.648  50.121  1.00 51.17  ?  29  ARG C CB    1 
ATOM 1481  C CG    . ARG C 3 30  ? 89.425  79.890  50.296  1.00 51.17  ?  29  ARG C CG    1 
ATOM 1482  C CD    . ARG C 3 30  ? 89.620  78.423  50.084  1.00 51.17  ?  29  ARG C CD    1 
ATOM 1483  N NE    . ARG C 3 30  ? 89.958  78.102  48.708  1.00 51.17  ?  29  ARG C NE    1 
ATOM 1484  C CZ    . ARG C 3 30  ? 90.273  76.882  48.297  1.00 51.17  ?  29  ARG C CZ    1 
ATOM 1485  N NH1   . ARG C 3 30  ? 90.271  75.876  49.158  1.00 51.17  1  29  ARG C NH1   1 
ATOM 1486  N NH2   . ARG C 3 30  ? 90.570  76.664  47.027  1.00 51.17  ?  29  ARG C NH2   1 
ATOM 1487  N N     . VAL C 3 31  ? 90.862  82.763  52.497  1.00 41.83  ?  30  VAL C N     1 
ATOM 1488  C CA    . VAL C 3 31  ? 90.460  83.240  53.814  1.00 41.83  ?  30  VAL C CA    1 
ATOM 1489  C C     . VAL C 3 31  ? 89.959  84.675  53.734  1.00 41.83  ?  30  VAL C C     1 
ATOM 1490  O O     . VAL C 3 31  ? 88.957  85.030  54.362  1.00 41.83  ?  30  VAL C O     1 
ATOM 1491  C CB    . VAL C 3 31  ? 91.639  83.090  54.788  1.00 41.83  ?  30  VAL C CB    1 
ATOM 1492  C CG1   . VAL C 3 31  ? 91.335  83.717  56.112  1.00 41.83  ?  30  VAL C CG1   1 
ATOM 1493  C CG2   . VAL C 3 31  ? 91.946  81.629  54.976  1.00 41.83  ?  30  VAL C CG2   1 
ATOM 1494  N N     . HIS C 3 32  ? 90.613  85.503  52.921  1.00 41.90  ?  31  HIS C N     1 
ATOM 1495  C CA    . HIS C 3 32  ? 90.167  86.877  52.719  1.00 41.90  ?  31  HIS C CA    1 
ATOM 1496  C C     . HIS C 3 32  ? 88.824  86.922  52.004  1.00 41.90  ?  31  HIS C C     1 
ATOM 1497  O O     . HIS C 3 32  ? 87.973  87.766  52.317  1.00 41.90  ?  31  HIS C O     1 
ATOM 1498  C CB    . HIS C 3 32  ? 91.230  87.634  51.933  1.00 41.90  ?  31  HIS C CB    1 
ATOM 1499  C CG    . HIS C 3 32  ? 91.006  89.107  51.856  1.00 41.90  ?  31  HIS C CG    1 
ATOM 1500  N ND1   . HIS C 3 32  ? 91.718  89.915  50.996  1.00 41.90  ?  31  HIS C ND1   1 
ATOM 1501  C CD2   . HIS C 3 32  ? 90.171  89.924  52.536  1.00 41.90  ?  31  HIS C CD2   1 
ATOM 1502  C CE1   . HIS C 3 32  ? 91.330  91.167  51.148  1.00 41.90  ?  31  HIS C CE1   1 
ATOM 1503  N NE2   . HIS C 3 32  ? 90.384  91.198  52.069  1.00 41.90  ?  31  HIS C NE2   1 
ATOM 1504  N N     . ARG C 3 33  ? 88.596  85.989  51.076  1.00 48.93  ?  32  ARG C N     1 
ATOM 1505  C CA    . ARG C 3 33  ? 87.313  85.926  50.386  1.00 48.93  ?  32  ARG C CA    1 
ATOM 1506  C C     . ARG C 3 33  ? 86.201  85.528  51.345  1.00 48.93  ?  32  ARG C C     1 
ATOM 1507  O O     . ARG C 3 33  ? 85.112  86.112  51.310  1.00 48.93  ?  32  ARG C O     1 
ATOM 1508  C CB    . ARG C 3 33  ? 87.403  84.945  49.213  1.00 48.93  ?  32  ARG C CB    1 
ATOM 1509  C CG    . ARG C 3 33  ? 86.281  85.014  48.173  1.00 48.93  ?  32  ARG C CG    1 
ATOM 1510  C CD    . ARG C 3 33  ? 85.116  84.078  48.460  1.00 48.93  ?  32  ARG C CD    1 
ATOM 1511  N NE    . ARG C 3 33  ? 85.559  82.717  48.732  1.00 48.93  ?  32  ARG C NE    1 
ATOM 1512  C CZ    . ARG C 3 33  ? 85.905  81.848  47.793  1.00 48.93  ?  32  ARG C CZ    1 
ATOM 1513  N NH1   . ARG C 3 33  ? 85.878  82.206  46.519  1.00 48.93  1  32  ARG C NH1   1 
ATOM 1514  N NH2   . ARG C 3 33  ? 86.292  80.628  48.127  1.00 48.93  ?  32  ARG C NH2   1 
ATOM 1515  N N     . LEU C 3 34  ? 86.459  84.542  52.210  1.00 38.54  ?  33  LEU C N     1 
ATOM 1516  C CA    . LEU C 3 34  ? 85.452  84.153  53.192  1.00 38.54  ?  33  LEU C CA    1 
ATOM 1517  C C     . LEU C 3 34  ? 85.224  85.241  54.226  1.00 38.54  ?  33  LEU C C     1 
ATOM 1518  O O     . LEU C 3 34  ? 84.098  85.422  54.698  1.00 38.54  ?  33  LEU C O     1 
ATOM 1519  C CB    . LEU C 3 34  ? 85.845  82.862  53.897  1.00 38.54  ?  33  LEU C CB    1 
ATOM 1520  C CG    . LEU C 3 34  ? 85.863  81.614  53.031  1.00 38.54  ?  33  LEU C CG    1 
ATOM 1521  C CD1   . LEU C 3 34  ? 86.251  80.415  53.865  1.00 38.54  ?  33  LEU C CD1   1 
ATOM 1522  C CD2   . LEU C 3 34  ? 84.523  81.401  52.367  1.00 38.54  ?  33  LEU C CD2   1 
ATOM 1523  N N     . LEU C 3 35  ? 86.264  85.981  54.579  1.00 35.63  ?  34  LEU C N     1 
ATOM 1524  C CA    . LEU C 3 35  ? 86.100  86.991  55.603  1.00 35.63  ?  34  LEU C CA    1 
ATOM 1525  C C     . LEU C 3 35  ? 85.447  88.248  55.049  1.00 35.63  ?  34  LEU C C     1 
ATOM 1526  O O     . LEU C 3 35  ? 84.924  89.048  55.825  1.00 35.63  ?  34  LEU C O     1 
ATOM 1527  C CB    . LEU C 3 35  ? 87.458  87.278  56.240  1.00 35.63  ?  34  LEU C CB    1 
ATOM 1528  C CG    . LEU C 3 35  ? 87.530  87.837  57.654  1.00 35.63  ?  34  LEU C CG    1 
ATOM 1529  C CD1   . LEU C 3 35  ? 88.751  87.246  58.303  1.00 35.63  ?  34  LEU C CD1   1 
ATOM 1530  C CD2   . LEU C 3 35  ? 87.644  89.333  57.677  1.00 35.63  ?  34  LEU C CD2   1 
ATOM 1531  N N     . ARG C 3 36  ? 85.439  88.434  53.726  1.00 40.98  ?  35  ARG C N     1 
ATOM 1532  C CA    . ARG C 3 36  ? 84.564  89.463  53.171  1.00 40.98  ?  35  ARG C CA    1 
ATOM 1533  C C     . ARG C 3 36  ? 83.141  88.948  53.002  1.00 40.98  ?  35  ARG C C     1 
ATOM 1534  O O     . ARG C 3 36  ? 82.184  89.615  53.403  1.00 40.98  ?  35  ARG C O     1 
ATOM 1535  C CB    . ARG C 3 36  ? 85.088  89.982  51.832  1.00 40.98  ?  35  ARG C CB    1 
ATOM 1536  C CG    . ARG C 3 36  ? 86.334  90.829  51.925  1.00 40.98  ?  35  ARG C CG    1 
ATOM 1537  C CD    . ARG C 3 36  ? 86.580  91.584  50.627  1.00 40.98  ?  35  ARG C CD    1 
ATOM 1538  N NE    . ARG C 3 36  ? 86.721  90.693  49.474  1.00 40.98  ?  35  ARG C NE    1 
ATOM 1539  C CZ    . ARG C 3 36  ? 87.861  90.114  49.121  1.00 40.98  ?  35  ARG C CZ    1 
ATOM 1540  N NH1   . ARG C 3 36  ? 88.946  90.316  49.837  1.00 40.98  1  35  ARG C NH1   1 
ATOM 1541  N NH2   . ARG C 3 36  ? 87.913  89.322  48.058  1.00 40.98  ?  35  ARG C NH2   1 
ATOM 1542  N N     . LYS C 3 37  ? 82.977  87.762  52.414  1.00 42.81  ?  36  LYS C N     1 
ATOM 1543  C CA    . LYS C 3 37  ? 81.646  87.248  52.110  1.00 42.81  ?  36  LYS C CA    1 
ATOM 1544  C C     . LYS C 3 37  ? 80.900  86.733  53.331  1.00 42.81  ?  36  LYS C C     1 
ATOM 1545  O O     . LYS C 3 37  ? 79.699  86.469  53.232  1.00 42.81  ?  36  LYS C O     1 
ATOM 1546  C CB    . LYS C 3 37  ? 81.727  86.127  51.071  1.00 42.81  ?  36  LYS C CB    1 
ATOM 1547  C CG    . LYS C 3 37  ? 82.224  86.578  49.715  1.00 42.81  ?  36  LYS C CG    1 
ATOM 1548  C CD    . LYS C 3 37  ? 81.247  87.537  49.071  1.00 42.81  ?  36  LYS C CD    1 
ATOM 1549  C CE    . LYS C 3 37  ? 80.002  86.805  48.615  1.00 42.81  ?  36  LYS C CE    1 
ATOM 1550  N NZ    . LYS C 3 37  ? 79.059  87.709  47.908  1.00 42.81  1  36  LYS C NZ    1 
ATOM 1551  N N     . GLY C 3 38  ? 81.564  86.580  54.468  1.00 44.48  ?  37  GLY C N     1 
ATOM 1552  C CA    . GLY C 3 38  ? 80.865  86.104  55.642  1.00 44.48  ?  37  GLY C CA    1 
ATOM 1553  C C     . GLY C 3 38  ? 80.065  87.149  56.382  1.00 44.48  ?  37  GLY C C     1 
ATOM 1554  O O     . GLY C 3 38  ? 79.293  86.782  57.274  1.00 44.48  ?  37  GLY C O     1 
ATOM 1555  N N     . ASN C 3 39  ? 80.221  88.422  56.010  1.00 47.17  ?  38  ASN C N     1 
ATOM 1556  C CA    . ASN C 3 39  ? 79.653  89.577  56.708  1.00 47.17  ?  38  ASN C CA    1 
ATOM 1557  C C     . ASN C 3 39  ? 80.031  89.576  58.186  1.00 47.17  ?  38  ASN C C     1 
ATOM 1558  O O     . ASN C 3 39  ? 79.189  89.476  59.076  1.00 47.17  ?  38  ASN C O     1 
ATOM 1559  C CB    . ASN C 3 39  ? 78.135  89.660  56.525  1.00 47.17  ?  38  ASN C CB    1 
ATOM 1560  C CG    . ASN C 3 39  ? 77.746  90.179  55.163  1.00 47.17  ?  38  ASN C CG    1 
ATOM 1561  O OD1   . ASN C 3 39  ? 78.324  91.148  54.669  1.00 47.17  ?  38  ASN C OD1   1 
ATOM 1562  N ND2   . ASN C 3 39  ? 76.765  89.535  54.541  1.00 47.17  ?  38  ASN C ND2   1 
ATOM 1563  N N     . TYR C 3 40  ? 81.332  89.677  58.432  1.00 38.80  ?  39  TYR C N     1 
ATOM 1564  C CA    . TYR C 3 40  ? 81.830  89.863  59.783  1.00 38.80  ?  39  TYR C CA    1 
ATOM 1565  C C     . TYR C 3 40  ? 82.124  91.314  60.100  1.00 38.80  ?  39  TYR C C     1 
ATOM 1566  O O     . TYR C 3 40  ? 81.886  91.749  61.227  1.00 38.80  ?  39  TYR C O     1 
ATOM 1567  C CB    . TYR C 3 40  ? 83.086  89.027  60.003  1.00 38.80  ?  39  TYR C CB    1 
ATOM 1568  C CG    . TYR C 3 40  ? 82.808  87.552  59.942  1.00 38.80  ?  39  TYR C CG    1 
ATOM 1569  C CD1   . TYR C 3 40  ? 82.218  86.900  61.010  1.00 38.80  ?  39  TYR C CD1   1 
ATOM 1570  C CD2   . TYR C 3 40  ? 83.126  86.814  58.816  1.00 38.80  ?  39  TYR C CD2   1 
ATOM 1571  C CE1   . TYR C 3 40  ? 81.960  85.552  60.962  1.00 38.80  ?  39  TYR C CE1   1 
ATOM 1572  C CE2   . TYR C 3 40  ? 82.871  85.465  58.759  1.00 38.80  ?  39  TYR C CE2   1 
ATOM 1573  C CZ    . TYR C 3 40  ? 82.287  84.842  59.835  1.00 38.80  ?  39  TYR C CZ    1 
ATOM 1574  O OH    . TYR C 3 40  ? 82.027  83.496  59.785  1.00 38.80  ?  39  TYR C OH    1 
ATOM 1575  N N     . ALA C 3 41  ? 82.622  92.071  59.131  1.00 42.74  ?  40  ALA C N     1 
ATOM 1576  C CA    . ALA C 3 41  ? 82.704  93.518  59.250  1.00 42.74  ?  40  ALA C CA    1 
ATOM 1577  C C     . ALA C 3 41  ? 82.644  94.103  57.851  1.00 42.74  ?  40  ALA C C     1 
ATOM 1578  O O     . ALA C 3 41  ? 82.927  93.425  56.863  1.00 42.74  ?  40  ALA C O     1 
ATOM 1579  C CB    . ALA C 3 41  ? 83.974  93.964  59.973  1.00 42.74  ?  40  ALA C CB    1 
ATOM 1580  N N     . GLU C 3 42  ? 82.287  95.379  57.777  1.00 52.91  ?  41  GLU C N     1 
ATOM 1581  C CA    . GLU C 3 42  ? 82.141  96.055  56.498  1.00 52.91  ?  41  GLU C CA    1 
ATOM 1582  C C     . GLU C 3 42  ? 83.467  96.497  55.901  1.00 52.91  ?  41  GLU C C     1 
ATOM 1583  O O     . GLU C 3 42  ? 83.477  97.061  54.804  1.00 52.91  ?  41  GLU C O     1 
ATOM 1584  C CB    . GLU C 3 42  ? 81.221  97.264  56.647  1.00 52.91  ?  41  GLU C CB    1 
ATOM 1585  C CG    . GLU C 3 42  ? 79.788  96.893  56.942  1.00 52.91  ?  41  GLU C CG    1 
ATOM 1586  C CD    . GLU C 3 42  ? 78.898  98.100  57.101  1.00 52.91  ?  41  GLU C CD    1 
ATOM 1587  O OE1   . GLU C 3 42  ? 79.428  99.229  57.118  1.00 52.91  ?  41  GLU C OE1   1 
ATOM 1588  O OE2   . GLU C 3 42  ? 77.668  97.925  57.206  1.00 52.91  -1 41  GLU C OE2   1 
ATOM 1589  N N     . ARG C 3 43  ? 84.578  96.255  56.583  1.00 56.64  ?  42  ARG C N     1 
ATOM 1590  C CA    . ARG C 3 43  ? 85.881  96.658  56.086  1.00 56.64  ?  42  ARG C CA    1 
ATOM 1591  C C     . ARG C 3 43  ? 86.900  95.669  56.619  1.00 56.64  ?  42  ARG C C     1 
ATOM 1592  O O     . ARG C 3 43  ? 86.925  95.398  57.821  1.00 56.64  ?  42  ARG C O     1 
ATOM 1593  C CB    . ARG C 3 43  ? 86.219  98.079  56.534  1.00 56.64  ?  42  ARG C CB    1 
ATOM 1594  C CG    . ARG C 3 43  ? 87.492  98.623  55.957  1.00 56.64  ?  42  ARG C CG    1 
ATOM 1595  C CD    . ARG C 3 43  ? 87.317  98.928  54.502  1.00 56.64  ?  42  ARG C CD    1 
ATOM 1596  N NE    . ARG C 3 43  ? 86.302  99.950  54.306  1.00 56.64  ?  42  ARG C NE    1 
ATOM 1597  C CZ    . ARG C 3 43  ? 86.540  101.249 54.413  1.00 56.64  ?  42  ARG C CZ    1 
ATOM 1598  N NH1   . ARG C 3 43  ? 87.758  101.675 54.714  1.00 56.64  1  42  ARG C NH1   1 
ATOM 1599  N NH2   . ARG C 3 43  ? 85.563  102.121 54.218  1.00 56.64  ?  42  ARG C NH2   1 
ATOM 1600  N N     . VAL C 3 44  ? 87.727  95.125  55.734  1.00 52.63  ?  43  VAL C N     1 
ATOM 1601  C CA    . VAL C 3 44  ? 88.680  94.081  56.086  1.00 52.63  ?  43  VAL C CA    1 
ATOM 1602  C C     . VAL C 3 44  ? 90.084  94.621  55.889  1.00 52.63  ?  43  VAL C C     1 
ATOM 1603  O O     . VAL C 3 44  ? 90.454  94.995  54.771  1.00 52.63  ?  43  VAL C O     1 
ATOM 1604  C CB    . VAL C 3 44  ? 88.475  92.822  55.240  1.00 52.63  ?  43  VAL C CB    1 
ATOM 1605  C CG1   . VAL C 3 44  ? 89.530  91.798  55.582  1.00 52.63  ?  43  VAL C CG1   1 
ATOM 1606  C CG2   . VAL C 3 44  ? 87.086  92.284  55.457  1.00 52.63  ?  43  VAL C CG2   1 
ATOM 1607  N N     . GLY C 3 45  ? 90.863  94.656  56.965  1.00 49.89  ?  44  GLY C N     1 
ATOM 1608  C CA    . GLY C 3 45  ? 92.247  95.065  56.853  1.00 49.89  ?  44  GLY C CA    1 
ATOM 1609  C C     . GLY C 3 45  ? 93.067  94.043  56.092  1.00 49.89  ?  44  GLY C C     1 
ATOM 1610  O O     . GLY C 3 45  ? 92.747  92.858  56.055  1.00 49.89  ?  44  GLY C O     1 
ATOM 1611  N N     . ALA C 3 46  ? 94.141  94.520  55.463  1.00 53.13  ?  45  ALA C N     1 
ATOM 1612  C CA    . ALA C 3 46  ? 94.905  93.667  54.560  1.00 53.13  ?  45  ALA C CA    1 
ATOM 1613  C C     . ALA C 3 46  ? 95.772  92.665  55.310  1.00 53.13  ?  45  ALA C C     1 
ATOM 1614  O O     . ALA C 3 46  ? 95.895  91.512  54.884  1.00 53.13  ?  45  ALA C O     1 
ATOM 1615  C CB    . ALA C 3 46  ? 95.768  94.522  53.634  1.00 53.13  ?  45  ALA C CB    1 
ATOM 1616  N N     . GLY C 3 47  ? 96.381  93.078  56.421  1.00 50.09  ?  46  GLY C N     1 
ATOM 1617  C CA    . GLY C 3 47  ? 97.275  92.201  57.155  1.00 50.09  ?  46  GLY C CA    1 
ATOM 1618  C C     . GLY C 3 47  ? 96.604  91.126  57.982  1.00 50.09  ?  46  GLY C C     1 
ATOM 1619  O O     . GLY C 3 47  ? 97.297  90.250  58.505  1.00 50.09  ?  46  GLY C O     1 
ATOM 1620  N N     . ALA C 3 48  ? 95.275  91.167  58.103  1.00 44.91  ?  47  ALA C N     1 
ATOM 1621  C CA    . ALA C 3 48  ? 94.577  90.233  58.989  1.00 44.91  ?  47  ALA C CA    1 
ATOM 1622  C C     . ALA C 3 48  ? 94.589  88.777  58.522  1.00 44.91  ?  47  ALA C C     1 
ATOM 1623  O O     . ALA C 3 48  ? 94.960  87.910  59.335  1.00 44.91  ?  47  ALA C O     1 
ATOM 1624  C CB    . ALA C 3 48  ? 93.151  90.731  59.246  1.00 44.91  ?  47  ALA C CB    1 
ATOM 1625  N N     . PRO C 3 49  ? 94.181  88.415  57.288  1.00 42.04  ?  48  PRO C N     1 
ATOM 1626  C CA    . PRO C 3 49  ? 94.045  86.981  56.998  1.00 42.04  ?  48  PRO C CA    1 
ATOM 1627  C C     . PRO C 3 49  ? 95.364  86.249  56.880  1.00 42.04  ?  48  PRO C C     1 
ATOM 1628  O O     . PRO C 3 49  ? 95.368  85.025  57.032  1.00 42.04  ?  48  PRO C O     1 
ATOM 1629  C CB    . PRO C 3 49  ? 93.287  86.956  55.669  1.00 42.04  ?  48  PRO C CB    1 
ATOM 1630  C CG    . PRO C 3 49  ? 93.700  88.161  55.015  1.00 42.04  ?  48  PRO C CG    1 
ATOM 1631  C CD    . PRO C 3 49  ? 93.834  89.189  56.078  1.00 42.04  ?  48  PRO C CD    1 
ATOM 1632  N N     . VAL C 3 50  ? 96.479  86.953  56.668  1.00 41.04  ?  49  VAL C N     1 
ATOM 1633  C CA    . VAL C 3 50  ? 97.789  86.308  56.703  1.00 41.04  ?  49  VAL C CA    1 
ATOM 1634  C C     . VAL C 3 50  ? 98.091  85.804  58.107  1.00 41.04  ?  49  VAL C C     1 
ATOM 1635  O O     . VAL C 3 50  ? 98.481  84.645  58.303  1.00 41.04  ?  49  VAL C O     1 
ATOM 1636  C CB    . VAL C 3 50  ? 98.872  87.286  56.221  1.00 41.04  ?  49  VAL C CB    1 
ATOM 1637  C CG1   . VAL C 3 50  ? 100.231 86.629  56.273  1.00 41.04  ?  49  VAL C CG1   1 
ATOM 1638  C CG2   . VAL C 3 50  ? 98.557  87.772  54.831  1.00 41.04  ?  49  VAL C CG2   1 
ATOM 1639  N N     . TYR C 3 51  ? 97.891  86.678  59.099  1.00 41.27  ?  50  TYR C N     1 
ATOM 1640  C CA    . TYR C 3 51  ? 98.028  86.321  60.507  1.00 41.27  ?  50  TYR C CA    1 
ATOM 1641  C C     . TYR C 3 51  ? 97.084  85.188  60.883  1.00 41.27  ?  50  TYR C C     1 
ATOM 1642  O O     . TYR C 3 51  ? 97.481  84.237  61.572  1.00 41.27  ?  50  TYR C O     1 
ATOM 1643  C CB    . TYR C 3 51  ? 97.740  87.559  61.354  1.00 41.27  ?  50  TYR C CB    1 
ATOM 1644  C CG    . TYR C 3 51  ? 97.975  87.419  62.834  1.00 41.27  ?  50  TYR C CG    1 
ATOM 1645  C CD1   . TYR C 3 51  ? 99.233  87.601  63.378  1.00 41.27  ?  50  TYR C CD1   1 
ATOM 1646  C CD2   . TYR C 3 51  ? 96.935  87.110  63.689  1.00 41.27  ?  50  TYR C CD2   1 
ATOM 1647  C CE1   . TYR C 3 51  ? 99.442  87.488  64.736  1.00 41.27  ?  50  TYR C CE1   1 
ATOM 1648  C CE2   . TYR C 3 51  ? 97.133  86.984  65.042  1.00 41.27  ?  50  TYR C CE2   1 
ATOM 1649  C CZ    . TYR C 3 51  ? 98.389  87.173  65.561  1.00 41.27  ?  50  TYR C CZ    1 
ATOM 1650  O OH    . TYR C 3 51  ? 98.592  87.051  66.914  1.00 41.27  ?  50  TYR C OH    1 
ATOM 1651  N N     . LEU C 3 52  ? 95.838  85.261  60.409  1.00 36.92  ?  51  LEU C N     1 
ATOM 1652  C CA    . LEU C 3 52  ? 94.854  84.241  60.751  1.00 36.92  ?  51  LEU C CA    1 
ATOM 1653  C C     . LEU C 3 52  ? 95.208  82.894  60.134  1.00 36.92  ?  51  LEU C C     1 
ATOM 1654  O O     . LEU C 3 52  ? 95.065  81.848  60.784  1.00 36.92  ?  51  LEU C O     1 
ATOM 1655  C CB    . LEU C 3 52  ? 93.475  84.696  60.301  1.00 36.92  ?  51  LEU C CB    1 
ATOM 1656  C CG    . LEU C 3 52  ? 92.327  83.778  60.670  1.00 36.92  ?  51  LEU C CG    1 
ATOM 1657  C CD1   . LEU C 3 52  ? 92.259  83.630  62.165  1.00 36.92  ?  51  LEU C CD1   1 
ATOM 1658  C CD2   . LEU C 3 52  ? 91.070  84.397  60.149  1.00 36.92  ?  51  LEU C CD2   1 
ATOM 1659  N N     . ALA C 3 53  ? 95.711  82.904  58.900  1.00 40.07  ?  52  ALA C N     1 
ATOM 1660  C CA    . ALA C 3 53  ? 96.125  81.669  58.254  1.00 40.07  ?  52  ALA C CA    1 
ATOM 1661  C C     . ALA C 3 53  ? 97.352  81.078  58.923  1.00 40.07  ?  52  ALA C C     1 
ATOM 1662  O O     . ALA C 3 53  ? 97.474  79.852  59.004  1.00 40.07  ?  52  ALA C O     1 
ATOM 1663  C CB    . ALA C 3 53  ? 96.395  81.918  56.775  1.00 40.07  ?  52  ALA C CB    1 
ATOM 1664  N N     . ALA C 3 54  ? 98.248  81.924  59.433  1.00 44.43  ?  53  ALA C N     1 
ATOM 1665  C CA    . ALA C 3 54  ? 99.393  81.407  60.174  1.00 44.43  ?  53  ALA C CA    1 
ATOM 1666  C C     . ALA C 3 54  ? 98.960  80.758  61.484  1.00 44.43  ?  53  ALA C C     1 
ATOM 1667  O O     . ALA C 3 54  ? 99.516  79.724  61.882  1.00 44.43  ?  53  ALA C O     1 
ATOM 1668  C CB    . ALA C 3 54  ? 100.396 82.525  60.434  1.00 44.43  ?  53  ALA C CB    1 
ATOM 1669  N N     . VAL C 3 55  ? 97.955  81.337  62.151  1.00 40.46  ?  54  VAL C N     1 
ATOM 1670  C CA    . VAL C 3 55  ? 97.428  80.744  63.382  1.00 40.46  ?  54  VAL C CA    1 
ATOM 1671  C C     . VAL C 3 55  ? 96.786  79.391  63.099  1.00 40.46  ?  54  VAL C C     1 
ATOM 1672  O O     . VAL C 3 55  ? 97.016  78.410  63.827  1.00 40.46  ?  54  VAL C O     1 
ATOM 1673  C CB    . VAL C 3 55  ? 96.437  81.712  64.053  1.00 40.46  ?  54  VAL C CB    1 
ATOM 1674  C CG1   . VAL C 3 55  ? 95.710  81.038  65.194  1.00 40.46  ?  54  VAL C CG1   1 
ATOM 1675  C CG2   . VAL C 3 55  ? 97.173  82.923  64.572  1.00 40.46  ?  54  VAL C CG2   1 
ATOM 1676  N N     . LEU C 3 56  ? 96.004  79.309  62.018  1.00 42.20  ?  55  LEU C N     1 
ATOM 1677  C CA    . LEU C 3 56  ? 95.377  78.042  61.647  1.00 42.20  ?  55  LEU C CA    1 
ATOM 1678  C C     . LEU C 3 56  ? 96.414  76.995  61.263  1.00 42.20  ?  55  LEU C C     1 
ATOM 1679  O O     . LEU C 3 56  ? 96.267  75.811  61.605  1.00 42.20  ?  55  LEU C O     1 
ATOM 1680  C CB    . LEU C 3 56  ? 94.399  78.255  60.499  1.00 42.20  ?  55  LEU C CB    1 
ATOM 1681  C CG    . LEU C 3 56  ? 93.181  79.098  60.846  1.00 42.20  ?  55  LEU C CG    1 
ATOM 1682  C CD1   . LEU C 3 56  ? 92.312  79.290  59.624  1.00 42.20  ?  55  LEU C CD1   1 
ATOM 1683  C CD2   . LEU C 3 56  ? 92.406  78.443  61.959  1.00 42.20  ?  55  LEU C CD2   1 
ATOM 1684  N N     . GLU C 3 57  ? 97.480  77.421  60.578  1.00 48.99  ?  56  GLU C N     1 
ATOM 1685  C CA    . GLU C 3 57  ? 98.550  76.503  60.213  1.00 48.99  ?  56  GLU C CA    1 
ATOM 1686  C C     . GLU C 3 57  ? 99.261  75.969  61.442  1.00 48.99  ?  56  GLU C C     1 
ATOM 1687  O O     . GLU C 3 57  ? 99.567  74.775  61.510  1.00 48.99  ?  56  GLU C O     1 
ATOM 1688  C CB    . GLU C 3 57  ? 99.552  77.186  59.287  1.00 48.99  ?  56  GLU C CB    1 
ATOM 1689  C CG    . GLU C 3 57  ? 100.674 76.267  58.829  1.00 48.99  ?  56  GLU C CG    1 
ATOM 1690  C CD    . GLU C 3 57  ? 101.614 76.929  57.853  1.00 48.99  ?  56  GLU C CD    1 
ATOM 1691  O OE1   . GLU C 3 57  ? 101.410 78.120  57.556  1.00 48.99  ?  56  GLU C OE1   1 
ATOM 1692  O OE2   . GLU C 3 57  ? 102.553 76.260  57.372  1.00 48.99  -1 56  GLU C OE2   1 
ATOM 1693  N N     . TYR C 3 58  ? 99.496  76.825  62.441  1.00 46.56  ?  57  TYR C N     1 
ATOM 1694  C CA    . TYR C 3 58  ? 100.162 76.345  63.648  1.00 46.56  ?  57  TYR C CA    1 
ATOM 1695  C C     . TYR C 3 58  ? 99.278  75.387  64.435  1.00 46.56  ?  57  TYR C C     1 
ATOM 1696  O O     . TYR C 3 58  ? 99.778  74.402  64.992  1.00 46.56  ?  57  TYR C O     1 
ATOM 1697  C CB    . TYR C 3 58  ? 100.601 77.500  64.539  1.00 46.56  ?  57  TYR C CB    1 
ATOM 1698  C CG    . TYR C 3 58  ? 101.300 76.993  65.774  1.00 46.56  ?  57  TYR C CG    1 
ATOM 1699  C CD1   . TYR C 3 58  ? 102.564 76.433  65.687  1.00 46.56  ?  57  TYR C CD1   1 
ATOM 1700  C CD2   . TYR C 3 58  ? 100.691 77.048  67.018  1.00 46.56  ?  57  TYR C CD2   1 
ATOM 1701  C CE1   . TYR C 3 58  ? 103.208 75.949  66.802  1.00 46.56  ?  57  TYR C CE1   1 
ATOM 1702  C CE2   . TYR C 3 58  ? 101.327 76.565  68.140  1.00 46.56  ?  57  TYR C CE2   1 
ATOM 1703  C CZ    . TYR C 3 58  ? 102.586 76.019  68.025  1.00 46.56  ?  57  TYR C CZ    1 
ATOM 1704  O OH    . TYR C 3 58  ? 103.228 75.539  69.140  1.00 46.56  ?  57  TYR C OH    1 
ATOM 1705  N N     . LEU C 3 59  ? 97.966  75.636  64.470  1.00 45.88  ?  58  LEU C N     1 
ATOM 1706  C CA    . LEU C 3 59  ? 97.074  74.727  65.192  1.00 45.88  ?  58  LEU C CA    1 
ATOM 1707  C C     . LEU C 3 59  ? 96.998  73.359  64.520  1.00 45.88  ?  58  LEU C C     1 
ATOM 1708  O O     . LEU C 3 59  ? 97.112  72.320  65.193  1.00 45.88  ?  58  LEU C O     1 
ATOM 1709  C CB    . LEU C 3 59  ? 95.683  75.338  65.322  1.00 45.88  ?  58  LEU C CB    1 
ATOM 1710  C CG    . LEU C 3 59  ? 95.637  76.518  66.281  1.00 45.88  ?  58  LEU C CG    1 
ATOM 1711  C CD1   . LEU C 3 59  ? 94.266  77.135  66.284  1.00 45.88  ?  58  LEU C CD1   1 
ATOM 1712  C CD2   . LEU C 3 59  ? 96.003  76.048  67.659  1.00 45.88  ?  58  LEU C CD2   1 
ATOM 1713  N N     . THR C 3 60  ? 96.827  73.338  63.192  1.00 47.63  ?  59  THR C N     1 
ATOM 1714  C CA    . THR C 3 60  ? 96.780  72.063  62.480  1.00 47.63  ?  59  THR C CA    1 
ATOM 1715  C C     . THR C 3 60  ? 98.120  71.345  62.537  1.00 47.63  ?  59  THR C C     1 
ATOM 1716  O O     . THR C 3 60  ? 98.160  70.113  62.647  1.00 47.63  ?  59  THR C O     1 
ATOM 1717  C CB    . THR C 3 60  ? 96.357  72.270  61.030  1.00 47.63  ?  59  THR C CB    1 
ATOM 1718  O OG1   . THR C 3 60  ? 97.253  73.194  60.404  1.00 47.63  ?  59  THR C OG1   1 
ATOM 1719  C CG2   . THR C 3 60  ? 94.944  72.799  60.957  1.00 47.63  ?  59  THR C CG2   1 
ATOM 1720  N N     . ALA C 3 61  ? 99.222  72.101  62.518  1.00 52.72  ?  60  ALA C N     1 
ATOM 1721  C CA    . ALA C 3 61  ? 100.543 71.498  62.621  1.00 52.72  ?  60  ALA C CA    1 
ATOM 1722  C C     . ALA C 3 61  ? 100.757 70.874  63.988  1.00 52.72  ?  60  ALA C C     1 
ATOM 1723  O O     . ALA C 3 61  ? 101.313 69.777  64.087  1.00 52.72  ?  60  ALA C O     1 
ATOM 1724  C CB    . ALA C 3 61  ? 101.620 72.542  62.336  1.00 52.72  ?  60  ALA C CB    1 
ATOM 1725  N N     . GLU C 3 62  ? 100.278 71.537  65.044  1.00 59.05  ?  61  GLU C N     1 
ATOM 1726  C CA    . GLU C 3 62  ? 100.397 70.988  66.389  1.00 59.05  ?  61  GLU C CA    1 
ATOM 1727  C C     . GLU C 3 62  ? 99.586  69.710  66.546  1.00 59.05  ?  61  GLU C C     1 
ATOM 1728  O O     . GLU C 3 62  ? 100.091 68.712  67.083  1.00 59.05  ?  61  GLU C O     1 
ATOM 1729  C CB    . GLU C 3 62  ? 99.957  72.028  67.417  1.00 59.05  ?  61  GLU C CB    1 
ATOM 1730  C CG    . GLU C 3 62  ? 100.027 71.551  68.856  1.00 59.05  ?  61  GLU C CG    1 
ATOM 1731  C CD    . GLU C 3 62  ? 101.446 71.310  69.336  1.00 59.05  ?  61  GLU C CD    1 
ATOM 1732  O OE1   . GLU C 3 62  ? 102.375 71.975  68.830  1.00 59.05  ?  61  GLU C OE1   1 
ATOM 1733  O OE2   . GLU C 3 62  ? 101.635 70.450  70.221  1.00 59.05  -1 61  GLU C OE2   1 
ATOM 1734  N N     . ILE C 3 63  ? 98.347  69.699  66.048  1.00 54.81  ?  62  ILE C N     1 
ATOM 1735  C CA    . ILE C 3 63  ? 97.540  68.512  66.307  1.00 54.81  ?  62  ILE C CA    1 
ATOM 1736  C C     . ILE C 3 63  ? 97.968  67.350  65.404  1.00 54.81  ?  62  ILE C C     1 
ATOM 1737  O O     . ILE C 3 63  ? 97.926  66.191  65.829  1.00 54.81  ?  62  ILE C O     1 
ATOM 1738  C CB    . ILE C 3 63  ? 96.034  68.834  66.219  1.00 54.81  ?  62  ILE C CB    1 
ATOM 1739  C CG1   . ILE C 3 63  ? 95.561  69.173  64.813  1.00 54.81  ?  62  ILE C CG1   1 
ATOM 1740  C CG2   . ILE C 3 63  ? 95.696  69.994  67.121  1.00 54.81  ?  62  ILE C CG2   1 
ATOM 1741  C CD1   . ILE C 3 63  ? 94.869  68.018  64.139  1.00 54.81  ?  62  ILE C CD1   1 
ATOM 1742  N N     . LEU C 3 64  ? 98.463  67.621  64.190  1.00 54.87  ?  63  LEU C N     1 
ATOM 1743  C CA    . LEU C 3 64  ? 98.970  66.522  63.373  1.00 54.87  ?  63  LEU C CA    1 
ATOM 1744  C C     . LEU C 3 64  ? 100.328 66.033  63.856  1.00 54.87  ?  63  LEU C C     1 
ATOM 1745  O O     . LEU C 3 64  ? 100.635 64.841  63.728  1.00 54.87  ?  63  LEU C O     1 
ATOM 1746  C CB    . LEU C 3 64  ? 99.045  66.935  61.909  1.00 54.87  ?  63  LEU C CB    1 
ATOM 1747  C CG    . LEU C 3 64  ? 97.680  67.071  61.248  1.00 54.87  ?  63  LEU C CG    1 
ATOM 1748  C CD1   . LEU C 3 64  ? 97.823  67.597  59.838  1.00 54.87  ?  63  LEU C CD1   1 
ATOM 1749  C CD2   . LEU C 3 64  ? 96.978  65.730  61.249  1.00 54.87  ?  63  LEU C CD2   1 
ATOM 1750  N N     . GLU C 3 65  ? 101.141 66.925  64.426  1.00 64.52  ?  64  GLU C N     1 
ATOM 1751  C CA    . GLU C 3 65  ? 102.403 66.517  65.022  1.00 64.52  ?  64  GLU C CA    1 
ATOM 1752  C C     . GLU C 3 65  ? 102.177 65.647  66.247  1.00 64.52  ?  64  GLU C C     1 
ATOM 1753  O O     . GLU C 3 65  ? 102.958 64.725  66.506  1.00 64.52  ?  64  GLU C O     1 
ATOM 1754  C CB    . GLU C 3 65  ? 103.211 67.762  65.381  1.00 64.52  ?  64  GLU C CB    1 
ATOM 1755  C CG    . GLU C 3 65  ? 104.610 67.513  65.896  1.00 64.52  ?  64  GLU C CG    1 
ATOM 1756  C CD    . GLU C 3 65  ? 105.337 68.806  66.211  1.00 64.52  ?  64  GLU C CD    1 
ATOM 1757  O OE1   . GLU C 3 65  ? 104.723 69.886  66.070  1.00 64.52  ?  64  GLU C OE1   1 
ATOM 1758  O OE2   . GLU C 3 65  ? 106.522 68.744  66.595  1.00 64.52  -1 64  GLU C OE2   1 
ATOM 1759  N N     . LEU C 3 66  ? 101.111 65.909  67.001  1.00 59.07  ?  65  LEU C N     1 
ATOM 1760  C CA    . LEU C 3 66  ? 100.779 65.011  68.099  1.00 59.07  ?  65  LEU C CA    1 
ATOM 1761  C C     . LEU C 3 66  ? 100.111 63.732  67.613  1.00 59.07  ?  65  LEU C C     1 
ATOM 1762  O O     . LEU C 3 66  ? 100.211 62.698  68.280  1.00 59.07  ?  65  LEU C O     1 
ATOM 1763  C CB    . LEU C 3 66  ? 99.887  65.723  69.112  1.00 59.07  ?  65  LEU C CB    1 
ATOM 1764  C CG    . LEU C 3 66  ? 100.596 66.851  69.858  1.00 59.07  ?  65  LEU C CG    1 
ATOM 1765  C CD1   . LEU C 3 66  ? 99.637  67.580  70.776  1.00 59.07  ?  65  LEU C CD1   1 
ATOM 1766  C CD2   . LEU C 3 66  ? 101.778 66.302  70.636  1.00 59.07  ?  65  LEU C CD2   1 
ATOM 1767  N N     . ALA C 3 67  ? 99.437  63.774  66.465  1.00 61.60  ?  66  ALA C N     1 
ATOM 1768  C CA    . ALA C 3 67  ? 98.758  62.580  65.978  1.00 61.60  ?  66  ALA C CA    1 
ATOM 1769  C C     . ALA C 3 67  ? 99.726  61.572  65.375  1.00 61.60  ?  66  ALA C C     1 
ATOM 1770  O O     . ALA C 3 67  ? 99.541  60.361  65.544  1.00 61.60  ?  66  ALA C O     1 
ATOM 1771  C CB    . ALA C 3 67  ? 97.699  62.964  64.949  1.00 61.60  ?  66  ALA C CB    1 
ATOM 1772  N N     . GLY C 3 68  ? 100.749 62.048  64.659  1.00 70.07  ?  67  GLY C N     1 
ATOM 1773  C CA    . GLY C 3 68  ? 101.650 61.140  63.964  1.00 70.07  ?  67  GLY C CA    1 
ATOM 1774  C C     . GLY C 3 68  ? 102.501 60.292  64.888  1.00 70.07  ?  67  GLY C C     1 
ATOM 1775  O O     . GLY C 3 68  ? 102.857 59.159  64.546  1.00 70.07  ?  67  GLY C O     1 
ATOM 1776  N N     . ASN C 3 69  ? 102.817 60.814  66.074  1.00 77.89  ?  68  ASN C N     1 
ATOM 1777  C CA    . ASN C 3 69  ? 103.574 60.040  67.049  1.00 77.89  ?  68  ASN C CA    1 
ATOM 1778  C C     . ASN C 3 69  ? 102.754 58.870  67.572  1.00 77.89  ?  68  ASN C C     1 
ATOM 1779  O O     . ASN C 3 69  ? 103.266 57.753  67.700  1.00 77.89  ?  68  ASN C O     1 
ATOM 1780  C CB    . ASN C 3 69  ? 104.014 60.944  68.195  1.00 77.89  ?  68  ASN C CB    1 
ATOM 1781  C CG    . ASN C 3 69  ? 104.963 62.028  67.741  1.00 77.89  ?  68  ASN C CG    1 
ATOM 1782  O OD1   . ASN C 3 69  ? 105.841 61.791  66.915  1.00 77.89  ?  68  ASN C OD1   1 
ATOM 1783  N ND2   . ASN C 3 69  ? 104.788 63.229  68.276  1.00 77.89  ?  68  ASN C ND2   1 
ATOM 1784  N N     . ALA C 3 70  ? 101.469 59.102  67.847  1.00 74.81  ?  69  ALA C N     1 
ATOM 1785  C CA    . ALA C 3 70  ? 100.593 58.009  68.249  1.00 74.81  ?  69  ALA C CA    1 
ATOM 1786  C C     . ALA C 3 70  ? 100.294 57.078  67.084  1.00 74.81  ?  69  ALA C C     1 
ATOM 1787  O O     . ALA C 3 70  ? 99.983  55.902  67.299  1.00 74.81  ?  69  ALA C O     1 
ATOM 1788  C CB    . ALA C 3 70  ? 99.295  58.562  68.832  1.00 74.81  ?  69  ALA C CB    1 
ATOM 1789  N N     . ALA C 3 71  ? 100.375 57.586  65.853  1.00 76.93  ?  70  ALA C N     1 
ATOM 1790  C CA    . ALA C 3 71  ? 100.208 56.724  64.688  1.00 76.93  ?  70  ALA C CA    1 
ATOM 1791  C C     . ALA C 3 71  ? 101.372 55.752  64.552  1.00 76.93  ?  70  ALA C C     1 
ATOM 1792  O O     . ALA C 3 71  ? 101.168 54.563  64.284  1.00 76.93  ?  70  ALA C O     1 
ATOM 1793  C CB    . ALA C 3 71  ? 100.066 57.570  63.425  1.00 76.93  ?  70  ALA C CB    1 
ATOM 1794  N N     . ARG C 3 72  ? 102.601 56.238  64.736  1.00 84.34  ?  71  ARG C N     1 
ATOM 1795  C CA    . ARG C 3 72  ? 103.751 55.339  64.746  1.00 84.34  ?  71  ARG C CA    1 
ATOM 1796  C C     . ARG C 3 72  ? 103.803 54.483  66.003  1.00 84.34  ?  71  ARG C C     1 
ATOM 1797  O O     . ARG C 3 72  ? 104.464 53.439  65.999  1.00 84.34  ?  71  ARG C O     1 
ATOM 1798  C CB    . ARG C 3 72  ? 105.057 56.119  64.618  1.00 84.34  ?  71  ARG C CB    1 
ATOM 1799  C CG    . ARG C 3 72  ? 105.281 56.764  63.268  1.00 84.34  ?  71  ARG C CG    1 
ATOM 1800  C CD    . ARG C 3 72  ? 106.624 57.462  63.244  1.00 84.34  ?  71  ARG C CD    1 
ATOM 1801  N NE    . ARG C 3 72  ? 106.662 58.572  64.188  1.00 84.34  ?  71  ARG C NE    1 
ATOM 1802  C CZ    . ARG C 3 72  ? 107.754 59.266  64.482  1.00 84.34  ?  71  ARG C CZ    1 
ATOM 1803  N NH1   . ARG C 3 72  ? 108.908 58.966  63.904  1.00 84.34  1  71  ARG C NH1   1 
ATOM 1804  N NH2   . ARG C 3 72  ? 107.693 60.261  65.355  1.00 84.34  ?  71  ARG C NH2   1 
ATOM 1805  N N     . ASP C 3 73  ? 103.139 54.913  67.078  1.00 90.75  ?  72  ASP C N     1 
ATOM 1806  C CA    . ASP C 3 73  ? 103.073 54.113  68.294  1.00 90.75  ?  72  ASP C CA    1 
ATOM 1807  C C     . ASP C 3 73  ? 102.261 52.841  68.093  1.00 90.75  ?  72  ASP C C     1 
ATOM 1808  O O     . ASP C 3 73  ? 102.543 51.821  68.730  1.00 90.75  ?  72  ASP C O     1 
ATOM 1809  C CB    . ASP C 3 73  ? 102.472 54.949  69.422  1.00 90.75  ?  72  ASP C CB    1 
ATOM 1810  C CG    . ASP C 3 73  ? 102.484 54.230  70.750  1.00 90.75  ?  72  ASP C CG    1 
ATOM 1811  O OD1   . ASP C 3 73  ? 103.568 54.131  71.360  1.00 90.75  ?  72  ASP C OD1   1 
ATOM 1812  O OD2   . ASP C 3 73  ? 101.409 53.761  71.182  1.00 90.75  -1 72  ASP C OD2   1 
ATOM 1813  N N     . ASN C 3 74  ? 101.255 52.882  67.220  1.00 95.90  ?  73  ASN C N     1 
ATOM 1814  C CA    . ASN C 3 74  ? 100.423 51.725  66.924  1.00 95.90  ?  73  ASN C CA    1 
ATOM 1815  C C     . ASN C 3 74  ? 100.898 51.002  65.661  1.00 95.90  ?  73  ASN C C     1 
ATOM 1816  O O     . ASN C 3 74  ? 100.143 50.214  65.078  1.00 95.90  ?  73  ASN C O     1 
ATOM 1817  C CB    . ASN C 3 74  ? 98.960  52.166  66.806  1.00 95.90  ?  73  ASN C CB    1 
ATOM 1818  C CG    . ASN C 3 74  ? 97.968  51.028  67.023  1.00 95.90  ?  73  ASN C CG    1 
ATOM 1819  O OD1   . ASN C 3 74  ? 98.353  49.884  67.259  1.00 95.90  ?  73  ASN C OD1   1 
ATOM 1820  N ND2   . ASN C 3 74  ? 96.681  51.346  66.945  1.00 95.90  ?  73  ASN C ND2   1 
ATOM 1821  N N     . LYS C 3 75  ? 102.142 51.272  65.237  1.00 98.15  ?  74  LYS C N     1 
ATOM 1822  C CA    . LYS C 3 75  ? 102.795 50.644  64.080  1.00 98.15  ?  74  LYS C CA    1 
ATOM 1823  C C     . LYS C 3 75  ? 101.991 50.839  62.795  1.00 98.15  ?  74  LYS C C     1 
ATOM 1824  O O     . LYS C 3 75  ? 101.842 49.923  61.985  1.00 98.15  ?  74  LYS C O     1 
ATOM 1825  C CB    . LYS C 3 75  ? 103.076 49.160  64.335  1.00 98.15  ?  74  LYS C CB    1 
ATOM 1826  C CG    . LYS C 3 75  ? 104.097 48.915  65.429  1.00 98.15  ?  74  LYS C CG    1 
ATOM 1827  C CD    . LYS C 3 75  ? 104.319 47.433  65.654  1.00 98.15  ?  74  LYS C CD    1 
ATOM 1828  C CE    . LYS C 3 75  ? 105.316 47.189  66.774  1.00 98.15  ?  74  LYS C CE    1 
ATOM 1829  N NZ    . LYS C 3 75  ? 105.508 45.735  67.032  1.00 98.15  1  74  LYS C NZ    1 
ATOM 1830  N N     . LYS C 3 76  ? 101.461 52.045  62.617  1.00 98.71  ?  75  LYS C N     1 
ATOM 1831  C CA    . LYS C 3 76  ? 100.658 52.391  61.458  1.00 98.71  ?  75  LYS C CA    1 
ATOM 1832  C C     . LYS C 3 76  ? 101.224 53.645  60.811  1.00 98.71  ?  75  LYS C C     1 
ATOM 1833  O O     . LYS C 3 76  ? 101.935 54.429  61.442  1.00 98.71  ?  75  LYS C O     1 
ATOM 1834  C CB    . LYS C 3 76  ? 99.190  52.622  61.838  1.00 98.71  ?  75  LYS C CB    1 
ATOM 1835  C CG    . LYS C 3 76  ? 98.498  51.417  62.440  1.00 98.71  ?  75  LYS C CG    1 
ATOM 1836  C CD    . LYS C 3 76  ? 98.329  50.322  61.414  1.00 98.71  ?  75  LYS C CD    1 
ATOM 1837  C CE    . LYS C 3 76  ? 97.547  49.154  61.981  1.00 98.71  ?  75  LYS C CE    1 
ATOM 1838  N NZ    . LYS C 3 76  ? 97.407  48.058  60.980  1.00 98.71  1  75  LYS C NZ    1 
ATOM 1839  N N     . THR C 3 77  ? 100.896 53.827  59.535  1.00 94.44  ?  76  THR C N     1 
ATOM 1840  C CA    . THR C 3 77  ? 101.279 55.027  58.812  1.00 94.44  ?  76  THR C CA    1 
ATOM 1841  C C     . THR C 3 77  ? 100.093 55.764  58.209  1.00 94.44  ?  76  THR C C     1 
ATOM 1842  O O     . THR C 3 77  ? 100.290 56.798  57.562  1.00 94.44  ?  76  THR C O     1 
ATOM 1843  C CB    . THR C 3 77  ? 102.281 54.690  57.700  1.00 94.44  ?  76  THR C CB    1 
ATOM 1844  O OG1   . THR C 3 77  ? 102.730 55.900  57.076  1.00 94.44  ?  76  THR C OG1   1 
ATOM 1845  C CG2   . THR C 3 77  ? 101.635 53.796  56.663  1.00 94.44  ?  76  THR C CG2   1 
ATOM 1846  N N     . ARG C 3 78  ? 98.876  55.272  58.404  1.00 91.07  ?  77  ARG C N     1 
ATOM 1847  C CA    . ARG C 3 78  ? 97.679  55.889  57.859  1.00 91.07  ?  77  ARG C CA    1 
ATOM 1848  C C     . ARG C 3 78  ? 96.811  56.356  59.016  1.00 91.07  ?  77  ARG C C     1 
ATOM 1849  O O     . ARG C 3 78  ? 96.417  55.549  59.863  1.00 91.07  ?  77  ARG C O     1 
ATOM 1850  C CB    . ARG C 3 78  ? 96.926  54.913  56.962  1.00 91.07  ?  77  ARG C CB    1 
ATOM 1851  C CG    . ARG C 3 78  ? 95.733  55.517  56.279  1.00 91.07  ?  77  ARG C CG    1 
ATOM 1852  C CD    . ARG C 3 78  ? 95.153  54.547  55.281  1.00 91.07  ?  77  ARG C CD    1 
ATOM 1853  N NE    . ARG C 3 78  ? 96.072  54.335  54.172  1.00 91.07  ?  77  ARG C NE    1 
ATOM 1854  C CZ    . ARG C 3 78  ? 95.903  53.414  53.233  1.00 91.07  ?  77  ARG C CZ    1 
ATOM 1855  N NH1   . ARG C 3 78  ? 94.844  52.618  53.269  1.00 91.07  1  77  ARG C NH1   1 
ATOM 1856  N NH2   . ARG C 3 78  ? 96.793  53.289  52.260  1.00 91.07  ?  77  ARG C NH2   1 
ATOM 1857  N N     . ILE C 3 79  ? 96.522  57.654  59.053  1.00 69.22  ?  78  ILE C N     1 
ATOM 1858  C CA    . ILE C 3 79  ? 95.824  58.264  60.181  1.00 69.22  ?  78  ILE C CA    1 
ATOM 1859  C C     . ILE C 3 79  ? 94.344  57.902  60.130  1.00 69.22  ?  78  ILE C C     1 
ATOM 1860  O O     . ILE C 3 79  ? 93.655  58.185  59.145  1.00 69.22  ?  78  ILE C O     1 
ATOM 1861  C CB    . ILE C 3 79  ? 96.021  59.784  60.192  1.00 69.22  ?  78  ILE C CB    1 
ATOM 1862  C CG1   . ILE C 3 79  ? 97.479  60.121  60.475  1.00 69.22  ?  78  ILE C CG1   1 
ATOM 1863  C CG2   . ILE C 3 79  ? 95.137  60.429  61.223  1.00 69.22  ?  78  ILE C CG2   1 
ATOM 1864  C CD1   . ILE C 3 79  ? 97.794  61.572  60.309  1.00 69.22  ?  78  ILE C CD1   1 
ATOM 1865  N N     . ILE C 3 80  ? 93.861  57.269  61.193  1.00 61.81  ?  79  ILE C N     1 
ATOM 1866  C CA    . ILE C 3 80  ? 92.451  56.943  61.382  1.00 61.81  ?  79  ILE C CA    1 
ATOM 1867  C C     . ILE C 3 80  ? 91.933  57.902  62.451  1.00 61.81  ?  79  ILE C C     1 
ATOM 1868  O O     . ILE C 3 80  ? 92.757  58.527  63.132  1.00 61.81  ?  79  ILE C O     1 
ATOM 1869  C CB    . ILE C 3 80  ? 92.286  55.460  61.759  1.00 61.81  ?  79  ILE C CB    1 
ATOM 1870  C CG1   . ILE C 3 80  ? 93.089  55.131  63.014  1.00 61.81  ?  79  ILE C CG1   1 
ATOM 1871  C CG2   . ILE C 3 80  ? 92.688  54.571  60.603  1.00 61.81  ?  79  ILE C CG2   1 
ATOM 1872  C CD1   . ILE C 3 80  ? 92.802  53.751  63.560  1.00 61.81  ?  79  ILE C CD1   1 
ATOM 1873  N N     . PRO C 3 81  ? 90.616  58.096  62.617  1.00 53.00  ?  80  PRO C N     1 
ATOM 1874  C CA    . PRO C 3 81  ? 90.140  59.069  63.618  1.00 53.00  ?  80  PRO C CA    1 
ATOM 1875  C C     . PRO C 3 81  ? 90.460  58.725  65.063  1.00 53.00  ?  80  PRO C C     1 
ATOM 1876  O O     . PRO C 3 81  ? 90.464  59.636  65.901  1.00 53.00  ?  80  PRO C O     1 
ATOM 1877  C CB    . PRO C 3 81  ? 88.628  59.089  63.383  1.00 53.00  ?  80  PRO C CB    1 
ATOM 1878  C CG    . PRO C 3 81  ? 88.477  58.732  61.982  1.00 53.00  ?  80  PRO C CG    1 
ATOM 1879  C CD    . PRO C 3 81  ? 89.522  57.718  61.704  1.00 53.00  ?  80  PRO C CD    1 
ATOM 1880  N N     . ARG C 3 82  ? 90.719  57.453  65.380  1.00 53.91  ?  81  ARG C N     1 
ATOM 1881  C CA    . ARG C 3 82  ? 91.098  57.072  66.738  1.00 53.91  ?  81  ARG C CA    1 
ATOM 1882  C C     . ARG C 3 82  ? 92.401  57.732  67.162  1.00 53.91  ?  81  ARG C C     1 
ATOM 1883  O O     . ARG C 3 82  ? 92.555  58.118  68.328  1.00 53.91  ?  81  ARG C O     1 
ATOM 1884  C CB    . ARG C 3 82  ? 91.203  55.549  66.827  1.00 53.91  ?  81  ARG C CB    1 
ATOM 1885  C CG    . ARG C 3 82  ? 91.676  54.992  68.158  1.00 53.91  ?  81  ARG C CG    1 
ATOM 1886  C CD    . ARG C 3 82  ? 90.725  55.372  69.265  1.00 53.91  ?  81  ARG C CD    1 
ATOM 1887  N NE    . ARG C 3 82  ? 91.077  54.772  70.547  1.00 53.91  ?  81  ARG C NE    1 
ATOM 1888  C CZ    . ARG C 3 82  ? 90.547  53.647  71.008  1.00 53.91  ?  81  ARG C CZ    1 
ATOM 1889  N NH1   . ARG C 3 82  ? 89.630  53.007  70.298  1.00 53.91  1  81  ARG C NH1   1 
ATOM 1890  N NH2   . ARG C 3 82  ? 90.919  53.166  72.184  1.00 53.91  ?  81  ARG C NH2   1 
ATOM 1891  N N     . HIS C 3 83  ? 93.318  57.925  66.216  1.00 57.92  ?  82  HIS C N     1 
ATOM 1892  C CA    . HIS C 3 83  ? 94.579  58.588  66.520  1.00 57.92  ?  82  HIS C CA    1 
ATOM 1893  C C     . HIS C 3 83  ? 94.361  60.059  66.841  1.00 57.92  ?  82  HIS C C     1 
ATOM 1894  O O     . HIS C 3 83  ? 94.991  60.598  67.758  1.00 57.92  ?  82  HIS C O     1 
ATOM 1895  C CB    . HIS C 3 83  ? 95.535  58.421  65.346  1.00 57.92  ?  82  HIS C CB    1 
ATOM 1896  C CG    . HIS C 3 83  ? 95.918  56.999  65.084  1.00 57.92  ?  82  HIS C CG    1 
ATOM 1897  N ND1   . HIS C 3 83  ? 96.570  56.603  63.938  1.00 57.92  ?  82  HIS C ND1   1 
ATOM 1898  C CD2   . HIS C 3 83  ? 95.743  55.880  65.823  1.00 57.92  ?  82  HIS C CD2   1 
ATOM 1899  C CE1   . HIS C 3 83  ? 96.776  55.300  63.980  1.00 57.92  ?  82  HIS C CE1   1 
ATOM 1900  N NE2   . HIS C 3 83  ? 96.284  54.837  65.114  1.00 57.92  ?  82  HIS C NE2   1 
ATOM 1901  N N     . LEU C 3 84  ? 93.448  60.713  66.120  1.00 50.66  ?  83  LEU C N     1 
ATOM 1902  C CA    . LEU C 3 84  ? 93.111  62.099  66.426  1.00 50.66  ?  83  LEU C CA    1 
ATOM 1903  C C     . LEU C 3 84  ? 92.406  62.216  67.768  1.00 50.66  ?  83  LEU C C     1 
ATOM 1904  O O     . LEU C 3 84  ? 92.649  63.170  68.513  1.00 50.66  ?  83  LEU C O     1 
ATOM 1905  C CB    . LEU C 3 84  ? 92.245  62.689  65.319  1.00 50.66  ?  83  LEU C CB    1 
ATOM 1906  C CG    . LEU C 3 84  ? 92.978  62.963  64.015  1.00 50.66  ?  83  LEU C CG    1 
ATOM 1907  C CD1   . LEU C 3 84  ? 91.999  63.333  62.935  1.00 50.66  ?  83  LEU C CD1   1 
ATOM 1908  C CD2   . LEU C 3 84  ? 93.958  64.085  64.232  1.00 50.66  ?  83  LEU C CD2   1 
ATOM 1909  N N     . GLN C 3 85  ? 91.544  61.247  68.091  1.00 51.41  ?  84  GLN C N     1 
ATOM 1910  C CA    . GLN C 3 85  ? 90.875  61.214  69.390  1.00 51.41  ?  84  GLN C CA    1 
ATOM 1911  C C     . GLN C 3 85  ? 91.884  61.125  70.526  1.00 51.41  ?  84  GLN C C     1 
ATOM 1912  O O     . GLN C 3 85  ? 91.804  61.877  71.505  1.00 51.41  ?  84  GLN C O     1 
ATOM 1913  C CB    . GLN C 3 85  ? 89.919  60.025  69.444  1.00 51.41  ?  84  GLN C CB    1 
ATOM 1914  C CG    . GLN C 3 85  ? 89.102  59.912  70.710  1.00 51.41  ?  84  GLN C CG    1 
ATOM 1915  C CD    . GLN C 3 85  ? 88.045  60.978  70.813  1.00 51.41  ?  84  GLN C CD    1 
ATOM 1916  O OE1   . GLN C 3 85  ? 88.178  61.934  71.573  1.00 51.41  ?  84  GLN C OE1   1 
ATOM 1917  N NE2   . GLN C 3 85  ? 86.974  60.815  70.050  1.00 51.41  ?  84  GLN C NE2   1 
ATOM 1918  N N     . LEU C 3 86  ? 92.866  60.231  70.390  1.00 53.86  ?  85  LEU C N     1 
ATOM 1919  C CA    . LEU C 3 86  ? 93.879  60.080  71.429  1.00 53.86  ?  85  LEU C CA    1 
ATOM 1920  C C     . LEU C 3 86  ? 94.788  61.299  71.511  1.00 53.86  ?  85  LEU C C     1 
ATOM 1921  O O     . LEU C 3 86  ? 95.154  61.730  72.610  1.00 53.86  ?  85  LEU C O     1 
ATOM 1922  C CB    . LEU C 3 86  ? 94.705  58.823  71.182  1.00 53.86  ?  85  LEU C CB    1 
ATOM 1923  C CG    . LEU C 3 86  ? 93.952  57.500  71.285  1.00 53.86  ?  85  LEU C CG    1 
ATOM 1924  C CD1   . LEU C 3 86  ? 94.870  56.350  70.926  1.00 53.86  ?  85  LEU C CD1   1 
ATOM 1925  C CD2   . LEU C 3 86  ? 93.368  57.317  72.667  1.00 53.86  ?  85  LEU C CD2   1 
ATOM 1926  N N     . ALA C 3 87  ? 95.145  61.884  70.365  1.00 56.76  ?  86  ALA C N     1 
ATOM 1927  C CA    . ALA C 3 87  ? 96.039  63.036  70.386  1.00 56.76  ?  86  ALA C CA    1 
ATOM 1928  C C     . ALA C 3 87  ? 95.345  64.282  70.913  1.00 56.76  ?  86  ALA C C     1 
ATOM 1929  O O     . ALA C 3 87  ? 96.010  65.188  71.423  1.00 56.76  ?  86  ALA C O     1 
ATOM 1930  C CB    . ALA C 3 87  ? 96.597  63.296  68.991  1.00 56.76  ?  86  ALA C CB    1 
ATOM 1931  N N     . ILE C 3 88  ? 94.022  64.350  70.804  1.00 51.52  ?  87  ILE C N     1 
ATOM 1932  C CA    . ILE C 3 88  ? 93.295  65.423  71.467  1.00 51.52  ?  87  ILE C CA    1 
ATOM 1933  C C     . ILE C 3 88  ? 93.202  65.166  72.964  1.00 51.52  ?  87  ILE C C     1 
ATOM 1934  O O     . ILE C 3 88  ? 93.544  66.032  73.775  1.00 51.52  ?  87  ILE C O     1 
ATOM 1935  C CB    . ILE C 3 88  ? 91.906  65.600  70.831  1.00 51.52  ?  87  ILE C CB    1 
ATOM 1936  C CG1   . ILE C 3 88  ? 92.031  66.203  69.435  1.00 51.52  ?  87  ILE C CG1   1 
ATOM 1937  C CG2   . ILE C 3 88  ? 91.026  66.474  71.687  1.00 51.52  ?  87  ILE C CG2   1 
ATOM 1938  C CD1   . ILE C 3 88  ? 90.743  66.164  68.650  1.00 51.52  ?  87  ILE C CD1   1 
ATOM 1939  N N     . ARG C 3 89  ? 92.768  63.966  73.358  1.00 49.12  ?  88  ARG C N     1 
ATOM 1940  C CA    . ARG C 3 89  ? 92.419  63.748  74.758  1.00 49.12  ?  88  ARG C CA    1 
ATOM 1941  C C     . ARG C 3 89  ? 93.628  63.577  75.671  1.00 49.12  ?  88  ARG C C     1 
ATOM 1942  O O     . ARG C 3 89  ? 93.521  63.851  76.870  1.00 49.12  ?  88  ARG C O     1 
ATOM 1943  C CB    . ARG C 3 89  ? 91.508  62.534  74.889  1.00 49.12  ?  88  ARG C CB    1 
ATOM 1944  C CG    . ARG C 3 89  ? 90.161  62.706  74.238  1.00 49.12  ?  88  ARG C CG    1 
ATOM 1945  C CD    . ARG C 3 89  ? 89.341  63.753  74.948  1.00 49.12  ?  88  ARG C CD    1 
ATOM 1946  N NE    . ARG C 3 89  ? 87.964  63.756  74.469  1.00 49.12  ?  88  ARG C NE    1 
ATOM 1947  C CZ    . ARG C 3 89  ? 87.524  64.492  73.457  1.00 49.12  ?  88  ARG C CZ    1 
ATOM 1948  N NH1   . ARG C 3 89  ? 88.351  65.294  72.808  1.00 49.12  1  88  ARG C NH1   1 
ATOM 1949  N NH2   . ARG C 3 89  ? 86.253  64.421  73.096  1.00 49.12  ?  88  ARG C NH2   1 
ATOM 1950  N N     . ASN C 3 90  ? 94.774  63.125  75.155  1.00 59.43  ?  89  ASN C N     1 
ATOM 1951  C CA    . ASN C 3 90  ? 95.928  62.976  76.039  1.00 59.43  ?  89  ASN C CA    1 
ATOM 1952  C C     . ASN C 3 90  ? 96.594  64.311  76.339  1.00 59.43  ?  89  ASN C C     1 
ATOM 1953  O O     . ASN C 3 90  ? 97.069  64.525  77.459  1.00 59.43  ?  89  ASN C O     1 
ATOM 1954  C CB    . ASN C 3 90  ? 96.946  62.001  75.451  1.00 59.43  ?  89  ASN C CB    1 
ATOM 1955  C CG    . ASN C 3 90  ? 96.478  60.566  75.513  1.00 59.43  ?  89  ASN C CG    1 
ATOM 1956  O OD1   . ASN C 3 90  ? 96.309  59.906  74.490  1.00 59.43  ?  89  ASN C OD1   1 
ATOM 1957  N ND2   . ASN C 3 90  ? 96.262  60.073  76.724  1.00 59.43  ?  89  ASN C ND2   1 
ATOM 1958  N N     . ASP C 3 91  ? 96.647  65.213  75.365  1.00 69.14  ?  90  ASP C N     1 
ATOM 1959  C CA    . ASP C 3 91  ? 97.236  66.521  75.605  1.00 69.14  ?  90  ASP C CA    1 
ATOM 1960  C C     . ASP C 3 91  ? 96.300  67.374  76.454  1.00 69.14  ?  90  ASP C C     1 
ATOM 1961  O O     . ASP C 3 91  ? 95.076  67.295  76.338  1.00 69.14  ?  90  ASP C O     1 
ATOM 1962  C CB    . ASP C 3 91  ? 97.537  67.221  74.283  1.00 69.14  ?  90  ASP C CB    1 
ATOM 1963  C CG    . ASP C 3 91  ? 98.332  68.496  74.468  1.00 69.14  ?  90  ASP C CG    1 
ATOM 1964  O OD1   . ASP C 3 91  ? 99.550  68.408  74.725  1.00 69.14  ?  90  ASP C OD1   1 
ATOM 1965  O OD2   . ASP C 3 91  ? 97.735  69.587  74.371  1.00 69.14  -1 90  ASP C OD2   1 
ATOM 1966  N N     . GLU C 3 92  ? 96.890  68.197  77.321  1.00 75.27  ?  91  GLU C N     1 
ATOM 1967  C CA    . GLU C 3 92  ? 96.103  68.955  78.288  1.00 75.27  ?  91  GLU C CA    1 
ATOM 1968  C C     . GLU C 3 92  ? 95.457  70.181  77.657  1.00 75.27  ?  91  GLU C C     1 
ATOM 1969  O O     . GLU C 3 92  ? 94.253  70.414  77.821  1.00 75.27  ?  91  GLU C O     1 
ATOM 1970  C CB    . GLU C 3 92  ? 96.989  69.373  79.460  1.00 75.27  ?  91  GLU C CB    1 
ATOM 1971  C CG    . GLU C 3 92  ? 96.263  70.138  80.552  1.00 75.27  ?  91  GLU C CG    1 
ATOM 1972  C CD    . GLU C 3 92  ? 97.177  70.508  81.709  1.00 75.27  ?  91  GLU C CD    1 
ATOM 1973  O OE1   . GLU C 3 92  ? 98.385  70.196  81.639  1.00 75.27  ?  91  GLU C OE1   1 
ATOM 1974  O OE2   . GLU C 3 92  ? 96.687  71.108  82.689  1.00 75.27  -1 91  GLU C OE2   1 
ATOM 1975  N N     . GLU C 3 93  ? 96.243  70.975  76.934  1.00 66.85  ?  92  GLU C N     1 
ATOM 1976  C CA    . GLU C 3 93  ? 95.764  72.261  76.449  1.00 66.85  ?  92  GLU C CA    1 
ATOM 1977  C C     . GLU C 3 93  ? 94.795  72.117  75.284  1.00 66.85  ?  92  GLU C C     1 
ATOM 1978  O O     . GLU C 3 93  ? 93.858  72.915  75.156  1.00 66.85  ?  92  GLU C O     1 
ATOM 1979  C CB    . GLU C 3 93  ? 96.961  73.125  76.074  1.00 66.85  ?  92  GLU C CB    1 
ATOM 1980  C CG    . GLU C 3 93  ? 97.803  73.474  77.291  1.00 66.85  ?  92  GLU C CG    1 
ATOM 1981  C CD    . GLU C 3 93  ? 99.036  74.288  76.959  1.00 66.85  ?  92  GLU C CD    1 
ATOM 1982  O OE1   . GLU C 3 93  ? 99.349  74.439  75.760  1.00 66.85  ?  92  GLU C OE1   1 
ATOM 1983  O OE2   . GLU C 3 93  ? 99.688  74.789  77.901  1.00 66.85  -1 92  GLU C OE2   1 
ATOM 1984  N N     . LEU C 3 94  ? 94.978  71.099  74.446  1.00 57.13  ?  93  LEU C N     1 
ATOM 1985  C CA    . LEU C 3 94  ? 93.987  70.830  73.412  1.00 57.13  ?  93  LEU C CA    1 
ATOM 1986  C C     . LEU C 3 94  ? 92.700  70.280  74.005  1.00 57.13  ?  93  LEU C C     1 
ATOM 1987  O O     . LEU C 3 94  ? 91.618  70.542  73.472  1.00 57.13  ?  93  LEU C O     1 
ATOM 1988  C CB    . LEU C 3 94  ? 94.560  69.871  72.380  1.00 57.13  ?  93  LEU C CB    1 
ATOM 1989  C CG    . LEU C 3 94  ? 95.690  70.515  71.587  1.00 57.13  ?  93  LEU C CG    1 
ATOM 1990  C CD1   . LEU C 3 94  ? 96.369  69.486  70.723  1.00 57.13  ?  93  LEU C CD1   1 
ATOM 1991  C CD2   . LEU C 3 94  ? 95.143  71.648  70.743  1.00 57.13  ?  93  LEU C CD2   1 
ATOM 1992  N N     . ASN C 3 95  ? 92.795  69.527  75.105  1.00 55.63  ?  94  ASN C N     1 
ATOM 1993  C CA    . ASN C 3 95  ? 91.597  69.121  75.829  1.00 55.63  ?  94  ASN C CA    1 
ATOM 1994  C C     . ASN C 3 95  ? 90.891  70.322  76.435  1.00 55.63  ?  94  ASN C C     1 
ATOM 1995  O O     . ASN C 3 95  ? 89.665  70.307  76.579  1.00 55.63  ?  94  ASN C O     1 
ATOM 1996  C CB    . ASN C 3 95  ? 91.951  68.127  76.931  1.00 55.63  ?  94  ASN C CB    1 
ATOM 1997  C CG    . ASN C 3 95  ? 90.787  67.232  77.319  1.00 55.63  ?  94  ASN C CG    1 
ATOM 1998  O OD1   . ASN C 3 95  ? 90.962  66.278  78.074  1.00 55.63  ?  94  ASN C OD1   1 
ATOM 1999  N ND2   . ASN C 3 95  ? 89.608  67.502  76.777  1.00 55.63  ?  94  ASN C ND2   1 
ATOM 2000  N N     . LYS C 3 96  ? 91.644  71.351  76.819  1.00 55.05  ?  95  LYS C N     1 
ATOM 2001  C CA    . LYS C 3 96  ? 91.012  72.599  77.229  1.00 55.05  ?  95  LYS C CA    1 
ATOM 2002  C C     . LYS C 3 96  ? 90.326  73.270  76.047  1.00 55.05  ?  95  LYS C C     1 
ATOM 2003  O O     . LYS C 3 96  ? 89.241  73.841  76.195  1.00 55.05  ?  95  LYS C O     1 
ATOM 2004  C CB    . LYS C 3 96  ? 92.047  73.532  77.859  1.00 55.05  ?  95  LYS C CB    1 
ATOM 2005  C CG    . LYS C 3 96  ? 91.495  74.867  78.323  1.00 55.05  ?  95  LYS C CG    1 
ATOM 2006  C CD    . LYS C 3 96  ? 90.551  74.692  79.492  1.00 55.05  ?  95  LYS C CD    1 
ATOM 2007  C CE    . LYS C 3 96  ? 90.101  76.033  80.038  1.00 55.05  ?  95  LYS C CE    1 
ATOM 2008  N NZ    . LYS C 3 96  ? 89.257  76.763  79.056  1.00 55.05  1  95  LYS C NZ    1 
ATOM 2009  N N     . LEU C 3 97  ? 90.924  73.181  74.860  1.00 49.83  ?  96  LEU C N     1 
ATOM 2010  C CA    . LEU C 3 97  ? 90.333  73.845  73.703  1.00 49.83  ?  96  LEU C CA    1 
ATOM 2011  C C     . LEU C 3 97  ? 89.158  73.060  73.133  1.00 49.83  ?  96  LEU C C     1 
ATOM 2012  O O     . LEU C 3 97  ? 88.060  73.602  72.974  1.00 49.83  ?  96  LEU C O     1 
ATOM 2013  C CB    . LEU C 3 97  ? 91.392  74.067  72.628  1.00 49.83  ?  96  LEU C CB    1 
ATOM 2014  C CG    . LEU C 3 97  ? 90.895  74.789  71.381  1.00 49.83  ?  96  LEU C CG    1 
ATOM 2015  C CD1   . LEU C 3 97  ? 90.384  76.159  71.747  1.00 49.83  ?  96  LEU C CD1   1 
ATOM 2016  C CD2   . LEU C 3 97  ? 92.010  74.896  70.367  1.00 49.83  ?  96  LEU C CD2   1 
ATOM 2017  N N     . LEU C 3 98  ? 89.368  71.792  72.810  1.00 45.56  ?  97  LEU C N     1 
ATOM 2018  C CA    . LEU C 3 98  ? 88.341  70.977  72.163  1.00 45.56  ?  97  LEU C CA    1 
ATOM 2019  C C     . LEU C 3 98  ? 87.566  70.167  73.198  1.00 45.56  ?  97  LEU C C     1 
ATOM 2020  O O     . LEU C 3 98  ? 87.517  68.939  73.168  1.00 45.56  ?  97  LEU C O     1 
ATOM 2021  C CB    . LEU C 3 98  ? 88.978  70.074  71.119  1.00 45.56  ?  97  LEU C CB    1 
ATOM 2022  C CG    . LEU C 3 98  ? 89.671  70.866  70.020  1.00 45.56  ?  97  LEU C CG    1 
ATOM 2023  C CD1   . LEU C 3 98  ? 90.401  69.932  69.091  1.00 45.56  ?  97  LEU C CD1   1 
ATOM 2024  C CD2   . LEU C 3 98  ? 88.660  71.697  69.270  1.00 45.56  ?  97  LEU C CD2   1 
ATOM 2025  N N     . GLY C 3 99  ? 86.952  70.886  74.129  1.00 46.11  ?  98  GLY C N     1 
ATOM 2026  C CA    . GLY C 3 99  ? 86.231  70.244  75.207  1.00 46.11  ?  98  GLY C CA    1 
ATOM 2027  C C     . GLY C 3 99  ? 84.893  69.683  74.784  1.00 46.11  ?  98  GLY C C     1 
ATOM 2028  O O     . GLY C 3 99  ? 84.622  68.497  74.984  1.00 46.11  ?  98  GLY C O     1 
ATOM 2029  N N     . ARG C 3 100 ? 84.047  70.522  74.199  1.00 41.11  ?  99  ARG C N     1 
ATOM 2030  C CA    . ARG C 3 100 ? 82.699  70.114  73.810  1.00 41.11  ?  99  ARG C CA    1 
ATOM 2031  C C     . ARG C 3 100 ? 82.659  69.706  72.341  1.00 41.11  ?  99  ARG C C     1 
ATOM 2032  O O     . ARG C 3 100 ? 81.925  70.267  71.534  1.00 41.11  ?  99  ARG C O     1 
ATOM 2033  C CB    . ARG C 3 100 ? 81.712  71.237  74.094  1.00 41.11  ?  99  ARG C CB    1 
ATOM 2034  C CG    . ARG C 3 100 ? 81.578  71.552  75.558  1.00 41.11  ?  99  ARG C CG    1 
ATOM 2035  C CD    . ARG C 3 100 ? 80.565  72.642  75.789  1.00 41.11  ?  99  ARG C CD    1 
ATOM 2036  N NE    . ARG C 3 100 ? 80.487  73.001  77.199  1.00 41.11  ?  99  ARG C NE    1 
ATOM 2037  C CZ    . ARG C 3 100 ? 79.697  73.952  77.680  1.00 41.11  ?  99  ARG C CZ    1 
ATOM 2038  N NH1   . ARG C 3 100 ? 78.909  74.633  76.859  1.00 41.11  1  99  ARG C NH1   1 
ATOM 2039  N NH2   . ARG C 3 100 ? 79.690  74.220  78.978  1.00 41.11  ?  99  ARG C NH2   1 
ATOM 2040  N N     . VAL C 3 101 ? 83.476  68.715  71.992  1.00 37.77  ?  100 VAL C N     1 
ATOM 2041  C CA    . VAL C 3 101 ? 83.541  68.189  70.633  1.00 37.77  ?  100 VAL C CA    1 
ATOM 2042  C C     . VAL C 3 101 ? 83.601  66.673  70.712  1.00 37.77  ?  100 VAL C C     1 
ATOM 2043  O O     . VAL C 3 101 ? 84.491  66.120  71.364  1.00 37.77  ?  100 VAL C O     1 
ATOM 2044  C CB    . VAL C 3 101 ? 84.751  68.723  69.849  1.00 37.77  ?  100 VAL C CB    1 
ATOM 2045  C CG1   . VAL C 3 101 ? 84.940  67.936  68.587  1.00 37.77  ?  100 VAL C CG1   1 
ATOM 2046  C CG2   . VAL C 3 101 ? 84.566  70.181  69.486  1.00 37.77  ?  100 VAL C CG2   1 
ATOM 2047  N N     . THR C 3 102 ? 82.668  66.004  70.050  1.00 42.44  ?  101 THR C N     1 
ATOM 2048  C CA    . THR C 3 102 ? 82.679  64.554  69.928  1.00 42.44  ?  101 THR C CA    1 
ATOM 2049  C C     . THR C 3 102 ? 83.210  64.198  68.546  1.00 42.44  ?  101 THR C C     1 
ATOM 2050  O O     . THR C 3 102 ? 82.506  64.365  67.548  1.00 42.44  ?  101 THR C O     1 
ATOM 2051  C CB    . THR C 3 102 ? 81.281  63.987  70.139  1.00 42.44  ?  101 THR C CB    1 
ATOM 2052  O OG1   . THR C 3 102 ? 80.404  64.520  69.141  1.00 42.44  ?  101 THR C OG1   1 
ATOM 2053  C CG2   . THR C 3 102 ? 80.758  64.368  71.512  1.00 42.44  ?  101 THR C CG2   1 
ATOM 2054  N N     . ILE C 3 103 ? 84.456  63.731  68.489  1.00 45.70  ?  102 ILE C N     1 
ATOM 2055  C CA    . ILE C 3 103 ? 85.046  63.291  67.231  1.00 45.70  ?  102 ILE C CA    1 
ATOM 2056  C C     . ILE C 3 103 ? 84.308  62.058  66.735  1.00 45.70  ?  102 ILE C C     1 
ATOM 2057  O O     . ILE C 3 103 ? 84.087  61.107  67.493  1.00 45.70  ?  102 ILE C O     1 
ATOM 2058  C CB    . ILE C 3 103 ? 86.541  62.998  67.416  1.00 45.70  ?  102 ILE C CB    1 
ATOM 2059  C CG1   . ILE C 3 103 ? 87.272  64.245  67.904  1.00 45.70  ?  102 ILE C CG1   1 
ATOM 2060  C CG2   . ILE C 3 103 ? 87.154  62.493  66.128  1.00 45.70  ?  102 ILE C CG2   1 
ATOM 2061  C CD1   . ILE C 3 103 ? 87.212  65.399  66.945  1.00 45.70  ?  102 ILE C CD1   1 
ATOM 2062  N N     . ALA C 3 104 ? 83.901  62.081  65.470  1.00 44.88  ?  103 ALA C N     1 
ATOM 2063  C CA    . ALA C 3 104 ? 83.188  60.956  64.886  1.00 44.88  ?  103 ALA C CA    1 
ATOM 2064  C C     . ALA C 3 104 ? 84.102  59.746  64.761  1.00 44.88  ?  103 ALA C C     1 
ATOM 2065  O O     . ALA C 3 104 ? 85.307  59.878  64.532  1.00 44.88  ?  103 ALA C O     1 
ATOM 2066  C CB    . ALA C 3 104 ? 82.633  61.331  63.516  1.00 44.88  ?  103 ALA C CB    1 
ATOM 2067  N N     . GLN C 3 105 ? 83.503  58.561  64.945  1.00 49.12  ?  104 GLN C N     1 
ATOM 2068  C CA    . GLN C 3 105 ? 84.179  57.258  64.900  1.00 49.12  ?  104 GLN C CA    1 
ATOM 2069  C C     . GLN C 3 105 ? 85.332  57.175  65.896  1.00 49.12  ?  104 GLN C C     1 
ATOM 2070  O O     . GLN C 3 105 ? 86.338  56.512  65.642  1.00 49.12  ?  104 GLN C O     1 
ATOM 2071  C CB    . GLN C 3 105 ? 84.670  56.931  63.487  1.00 49.12  ?  104 GLN C CB    1 
ATOM 2072  C CG    . GLN C 3 105 ? 83.569  56.873  62.457  1.00 49.12  ?  104 GLN C CG    1 
ATOM 2073  C CD    . GLN C 3 105 ? 82.635  55.713  62.686  1.00 49.12  ?  104 GLN C CD    1 
ATOM 2074  O OE1   . GLN C 3 105 ? 83.068  54.616  63.033  1.00 49.12  ?  104 GLN C OE1   1 
ATOM 2075  N NE2   . GLN C 3 105 ? 81.342  55.946  62.499  1.00 49.12  ?  104 GLN C NE2   1 
ATOM 2076  N N     . GLY C 3 106 ? 85.191  57.835  67.039  1.00 53.68  ?  105 GLY C N     1 
ATOM 2077  C CA    . GLY C 3 106 ? 86.330  58.092  67.893  1.00 53.68  ?  105 GLY C CA    1 
ATOM 2078  C C     . GLY C 3 106 ? 86.565  57.116  69.023  1.00 53.68  ?  105 GLY C C     1 
ATOM 2079  O O     . GLY C 3 106 ? 87.698  56.687  69.240  1.00 53.68  ?  105 GLY C O     1 
ATOM 2080  N N     . GLY C 3 107 ? 85.526  56.768  69.759  1.00 57.11  ?  106 GLY C N     1 
ATOM 2081  C CA    . GLY C 3 107 ? 85.724  55.986  70.956  1.00 57.11  ?  106 GLY C CA    1 
ATOM 2082  C C     . GLY C 3 107 ? 86.235  56.846  72.096  1.00 57.11  ?  106 GLY C C     1 
ATOM 2083  O O     . GLY C 3 107 ? 86.236  58.077  72.038  1.00 57.11  ?  106 GLY C O     1 
ATOM 2084  N N     . VAL C 3 108 ? 86.679  56.176  73.158  1.00 57.45  ?  107 VAL C N     1 
ATOM 2085  C CA    . VAL C 3 108 ? 87.093  56.845  74.382  1.00 57.45  ?  107 VAL C CA    1 
ATOM 2086  C C     . VAL C 3 108 ? 88.503  56.402  74.755  1.00 57.45  ?  107 VAL C C     1 
ATOM 2087  O O     . VAL C 3 108 ? 89.055  55.457  74.192  1.00 57.45  ?  107 VAL C O     1 
ATOM 2088  C CB    . VAL C 3 108 ? 86.125  56.571  75.549  1.00 57.45  ?  107 VAL C CB    1 
ATOM 2089  C CG1   . VAL C 3 108 ? 84.745  57.117  75.242  1.00 57.45  ?  107 VAL C CG1   1 
ATOM 2090  C CG2   . VAL C 3 108 ? 86.056  55.088  75.822  1.00 57.45  ?  107 VAL C CG2   1 
ATOM 2091  N N     . LEU C 3 109 ? 89.079  57.115  75.723  1.00 61.97  ?  108 LEU C N     1 
ATOM 2092  C CA    . LEU C 3 109 ? 90.371  56.769  76.289  1.00 61.97  ?  108 LEU C CA    1 
ATOM 2093  C C     . LEU C 3 109 ? 90.290  55.460  77.065  1.00 61.97  ?  108 LEU C C     1 
ATOM 2094  O O     . LEU C 3 109 ? 89.220  55.078  77.541  1.00 61.97  ?  108 LEU C O     1 
ATOM 2095  C CB    . LEU C 3 109 ? 90.843  57.867  77.235  1.00 61.97  ?  108 LEU C CB    1 
ATOM 2096  C CG    . LEU C 3 109 ? 91.277  59.211  76.676  1.00 61.97  ?  108 LEU C CG    1 
ATOM 2097  C CD1   . LEU C 3 109 ? 91.485  60.186  77.815  1.00 61.97  ?  108 LEU C CD1   1 
ATOM 2098  C CD2   . LEU C 3 109 ? 92.561  59.034  75.903  1.00 61.97  ?  108 LEU C CD2   1 
ATOM 2099  N N     . PRO C 3 110 ? 91.410  54.754  77.214  1.00 66.15  ?  109 PRO C N     1 
ATOM 2100  C CA    . PRO C 3 110 ? 91.441  53.659  78.190  1.00 66.15  ?  109 PRO C CA    1 
ATOM 2101  C C     . PRO C 3 110 ? 91.453  54.200  79.610  1.00 66.15  ?  109 PRO C C     1 
ATOM 2102  O O     . PRO C 3 110 ? 92.469  54.707  80.093  1.00 66.15  ?  109 PRO C O     1 
ATOM 2103  C CB    . PRO C 3 110 ? 92.730  52.906  77.840  1.00 66.15  ?  109 PRO C CB    1 
ATOM 2104  C CG    . PRO C 3 110 ? 93.575  53.902  77.136  1.00 66.15  ?  109 PRO C CG    1 
ATOM 2105  C CD    . PRO C 3 110 ? 92.631  54.794  76.391  1.00 66.15  ?  109 PRO C CD    1 
ATOM 2106  N N     . ASN C 3 111 ? 90.313  54.098  80.288  1.00 71.65  ?  110 ASN C N     1 
ATOM 2107  C CA    . ASN C 3 111 ? 90.128  54.708  81.601  1.00 71.65  ?  110 ASN C CA    1 
ATOM 2108  C C     . ASN C 3 111 ? 89.398  53.706  82.480  1.00 71.65  ?  110 ASN C C     1 
ATOM 2109  O O     . ASN C 3 111 ? 88.232  53.392  82.227  1.00 71.65  ?  110 ASN C O     1 
ATOM 2110  C CB    . ASN C 3 111 ? 89.339  56.010  81.491  1.00 71.65  ?  110 ASN C CB    1 
ATOM 2111  C CG    . ASN C 3 111 ? 89.612  56.960  82.637  1.00 71.65  ?  110 ASN C CG    1 
ATOM 2112  O OD1   . ASN C 3 111 ? 89.218  58.124  82.593  1.00 71.65  ?  110 ASN C OD1   1 
ATOM 2113  N ND2   . ASN C 3 111 ? 90.318  56.483  83.656  1.00 71.65  ?  110 ASN C ND2   1 
ATOM 2114  N N     . ILE C 3 112 ? 90.076  53.210  83.510  1.00 72.38  ?  111 ILE C N     1 
ATOM 2115  C CA    . ILE C 3 112 ? 89.531  52.201  84.409  1.00 72.38  ?  111 ILE C CA    1 
ATOM 2116  C C     . ILE C 3 112 ? 89.617  52.739  85.830  1.00 72.38  ?  111 ILE C C     1 
ATOM 2117  O O     . ILE C 3 112 ? 90.663  53.265  86.228  1.00 72.38  ?  111 ILE C O     1 
ATOM 2118  C CB    . ILE C 3 112 ? 90.290  50.866  84.284  1.00 72.38  ?  111 ILE C CB    1 
ATOM 2119  C CG1   . ILE C 3 112 ? 90.241  50.347  82.850  1.00 72.38  ?  111 ILE C CG1   1 
ATOM 2120  C CG2   . ILE C 3 112 ? 89.692  49.816  85.198  1.00 72.38  ?  111 ILE C CG2   1 
ATOM 2121  C CD1   . ILE C 3 112 ? 91.198  49.210  82.589  1.00 72.38  ?  111 ILE C CD1   1 
ATOM 2122  N N     . GLN C 3 113 ? 88.509  52.629  86.570  1.00 77.96  ?  112 GLN C N     1 
ATOM 2123  C CA    . GLN C 3 113 ? 88.403  52.916  88.010  1.00 77.96  ?  112 GLN C CA    1 
ATOM 2124  C C     . GLN C 3 113 ? 88.715  54.374  88.351  1.00 77.96  ?  112 GLN C C     1 
ATOM 2125  O O     . GLN C 3 113 ? 89.869  54.755  88.544  1.00 77.96  ?  112 GLN C O     1 
ATOM 2126  C CB    . GLN C 3 113 ? 89.303  51.957  88.813  1.00 77.96  ?  112 GLN C CB    1 
ATOM 2127  C CG    . GLN C 3 113 ? 89.067  51.926  90.321  1.00 77.96  ?  112 GLN C CG    1 
ATOM 2128  C CD    . GLN C 3 113 ? 89.966  52.869  91.092  1.00 77.96  ?  112 GLN C CD    1 
ATOM 2129  O OE1   . GLN C 3 113 ? 91.092  53.147  90.682  1.00 77.96  ?  112 GLN C OE1   1 
ATOM 2130  N NE2   . GLN C 3 113 ? 89.475  53.361  92.222  1.00 77.96  ?  112 GLN C NE2   1 
ATOM 2131  N N     . ARG D 4 34  ? 83.564  72.375  42.290  1.00 79.00  ?  33  ARG D N     1 
ATOM 2132  C CA    . ARG D 4 34  ? 82.746  73.572  42.424  1.00 79.00  ?  33  ARG D CA    1 
ATOM 2133  C C     . ARG D 4 34  ? 82.424  73.836  43.888  1.00 79.00  ?  33  ARG D C     1 
ATOM 2134  O O     . ARG D 4 34  ? 81.976  74.922  44.247  1.00 79.00  ?  33  ARG D O     1 
ATOM 2135  C CB    . ARG D 4 34  ? 81.458  73.437  41.610  1.00 79.00  ?  33  ARG D CB    1 
ATOM 2136  C CG    . ARG D 4 34  ? 80.492  72.390  42.139  1.00 79.00  ?  33  ARG D CG    1 
ATOM 2137  C CD    . ARG D 4 34  ? 79.301  72.218  41.210  1.00 79.00  ?  33  ARG D CD    1 
ATOM 2138  N NE    . ARG D 4 34  ? 79.684  71.600  39.944  1.00 79.00  ?  33  ARG D NE    1 
ATOM 2139  C CZ    . ARG D 4 34  ? 78.869  71.462  38.903  1.00 79.00  ?  33  ARG D CZ    1 
ATOM 2140  N NH1   . ARG D 4 34  ? 77.621  71.900  38.973  1.00 79.00  1  33  ARG D NH1   1 
ATOM 2141  N NH2   . ARG D 4 34  ? 79.302  70.886  37.790  1.00 79.00  ?  33  ARG D NH2   1 
ATOM 2142  N N     . LYS D 4 35  ? 82.657  72.834  44.731  1.00 69.61  ?  34  LYS D N     1 
ATOM 2143  C CA    . LYS D 4 35  ? 82.432  72.933  46.169  1.00 69.61  ?  34  LYS D CA    1 
ATOM 2144  C C     . LYS D 4 35  ? 83.770  72.711  46.858  1.00 69.61  ?  34  LYS D C     1 
ATOM 2145  O O     . LYS D 4 35  ? 84.228  71.571  46.977  1.00 69.61  ?  34  LYS D O     1 
ATOM 2146  C CB    . LYS D 4 35  ? 81.395  71.914  46.631  1.00 69.61  ?  34  LYS D CB    1 
ATOM 2147  C CG    . LYS D 4 35  ? 80.011  72.170  46.066  1.00 69.61  ?  34  LYS D CG    1 
ATOM 2148  C CD    . LYS D 4 35  ? 79.030  71.074  46.449  1.00 69.61  ?  34  LYS D CD    1 
ATOM 2149  C CE    . LYS D 4 35  ? 78.651  71.157  47.918  1.00 69.61  ?  34  LYS D CE    1 
ATOM 2150  N NZ    . LYS D 4 35  ? 77.575  70.189  48.272  1.00 69.61  1  34  LYS D NZ    1 
ATOM 2151  N N     . GLU D 4 36  ? 84.389  73.794  47.314  1.00 62.12  ?  35  GLU D N     1 
ATOM 2152  C CA    . GLU D 4 36  ? 85.771  73.732  47.753  1.00 62.12  ?  35  GLU D CA    1 
ATOM 2153  C C     . GLU D 4 36  ? 85.883  73.144  49.155  1.00 62.12  ?  35  GLU D C     1 
ATOM 2154  O O     . GLU D 4 36  ? 84.897  72.963  49.872  1.00 62.12  ?  35  GLU D O     1 
ATOM 2155  C CB    . GLU D 4 36  ? 86.405  75.116  47.729  1.00 62.12  ?  35  GLU D CB    1 
ATOM 2156  C CG    . GLU D 4 36  ? 85.860  76.047  48.783  1.00 62.12  ?  35  GLU D CG    1 
ATOM 2157  C CD    . GLU D 4 36  ? 86.478  77.425  48.702  1.00 62.12  ?  35  GLU D CD    1 
ATOM 2158  O OE1   . GLU D 4 36  ? 87.305  77.650  47.796  1.00 62.12  ?  35  GLU D OE1   1 
ATOM 2159  O OE2   . GLU D 4 36  ? 86.141  78.280  49.545  1.00 62.12  -1 35  GLU D OE2   1 
ATOM 2160  N N     . SER D 4 37  ? 87.121  72.858  49.541  1.00 54.30  ?  36  SER D N     1 
ATOM 2161  C CA    . SER D 4 37  ? 87.443  72.281  50.837  1.00 54.30  ?  36  SER D CA    1 
ATOM 2162  C C     . SER D 4 37  ? 88.890  72.632  51.159  1.00 54.30  ?  36  SER D C     1 
ATOM 2163  O O     . SER D 4 37  ? 89.534  73.401  50.440  1.00 54.30  ?  36  SER D O     1 
ATOM 2164  C CB    . SER D 4 37  ? 87.211  70.769  50.838  1.00 54.30  ?  36  SER D CB    1 
ATOM 2165  O OG    . SER D 4 37  ? 87.608  70.206  52.073  1.00 54.30  ?  36  SER D OG    1 
ATOM 2166  N N     . TYR D 4 38  ? 89.405  72.055  52.237  1.00 45.02  ?  37  TYR D N     1 
ATOM 2167  C CA    . TYR D 4 38  ? 90.741  72.337  52.740  1.00 45.02  ?  37  TYR D CA    1 
ATOM 2168  C C     . TYR D 4 38  ? 91.584  71.073  52.809  1.00 45.02  ?  37  TYR D C     1 
ATOM 2169  O O     . TYR D 4 38  ? 92.414  70.916  53.700  1.00 45.02  ?  37  TYR D O     1 
ATOM 2170  C CB    . TYR D 4 38  ? 90.670  72.983  54.118  1.00 45.02  ?  37  TYR D CB    1 
ATOM 2171  C CG    . TYR D 4 38  ? 90.177  74.404  54.127  1.00 45.02  ?  37  TYR D CG    1 
ATOM 2172  C CD1   . TYR D 4 38  ? 90.258  75.196  53.003  1.00 45.02  ?  37  TYR D CD1   1 
ATOM 2173  C CD2   . TYR D 4 38  ? 89.600  74.943  55.261  1.00 45.02  ?  37  TYR D CD2   1 
ATOM 2174  C CE1   . TYR D 4 38  ? 89.802  76.490  53.022  1.00 45.02  ?  37  TYR D CE1   1 
ATOM 2175  C CE2   . TYR D 4 38  ? 89.144  76.231  55.290  1.00 45.02  ?  37  TYR D CE2   1 
ATOM 2176  C CZ    . TYR D 4 38  ? 89.243  77.000  54.168  1.00 45.02  ?  37  TYR D CZ    1 
ATOM 2177  O OH    . TYR D 4 38  ? 88.781  78.290  54.196  1.00 45.02  ?  37  TYR D OH    1 
ATOM 2178  N N     . SER D 4 39  ? 91.388  70.150  51.871  1.00 49.56  ?  38  SER D N     1 
ATOM 2179  C CA    . SER D 4 39  ? 92.089  68.875  51.964  1.00 49.56  ?  38  SER D CA    1 
ATOM 2180  C C     . SER D 4 39  ? 93.532  68.986  51.494  1.00 49.56  ?  38  SER D C     1 
ATOM 2181  O O     . SER D 4 39  ? 94.434  68.406  52.114  1.00 49.56  ?  38  SER D O     1 
ATOM 2182  C CB    . SER D 4 39  ? 91.358  67.814  51.150  1.00 49.56  ?  38  SER D CB    1 
ATOM 2183  O OG    . SER D 4 39  ? 91.453  68.100  49.768  1.00 49.56  ?  38  SER D OG    1 
ATOM 2184  N N     . VAL D 4 40  ? 93.755  69.729  50.406  1.00 52.50  ?  39  VAL D N     1 
ATOM 2185  C CA    . VAL D 4 40  ? 95.069  69.804  49.775  1.00 52.50  ?  39  VAL D CA    1 
ATOM 2186  C C     . VAL D 4 40  ? 96.071  70.476  50.701  1.00 52.50  ?  39  VAL D C     1 
ATOM 2187  O O     . VAL D 4 40  ? 97.228  70.049  50.812  1.00 52.50  ?  39  VAL D O     1 
ATOM 2188  C CB    . VAL D 4 40  ? 94.954  70.545  48.430  1.00 52.50  ?  39  VAL D CB    1 
ATOM 2189  C CG1   . VAL D 4 40  ? 96.305  70.673  47.751  1.00 52.50  ?  39  VAL D CG1   1 
ATOM 2190  C CG2   . VAL D 4 40  ? 93.968  69.836  47.531  1.00 52.50  ?  39  VAL D CG2   1 
ATOM 2191  N N     . TYR D 4 41  ? 95.623  71.489  51.434  1.00 54.71  ?  40  TYR D N     1 
ATOM 2192  C CA    . TYR D 4 41  ? 96.537  72.246  52.274  1.00 54.71  ?  40  TYR D CA    1 
ATOM 2193  C C     . TYR D 4 41  ? 96.930  71.460  53.521  1.00 54.71  ?  40  TYR D C     1 
ATOM 2194  O O     . TYR D 4 41  ? 98.093  71.497  53.944  1.00 54.71  ?  40  TYR D O     1 
ATOM 2195  C CB    . TYR D 4 41  ? 95.891  73.571  52.636  1.00 54.71  ?  40  TYR D CB    1 
ATOM 2196  C CG    . TYR D 4 41  ? 95.584  74.420  51.436  1.00 54.71  ?  40  TYR D CG    1 
ATOM 2197  C CD1   . TYR D 4 41  ? 96.591  75.097  50.773  1.00 54.71  ?  40  TYR D CD1   1 
ATOM 2198  C CD2   . TYR D 4 41  ? 94.286  74.555  50.971  1.00 54.71  ?  40  TYR D CD2   1 
ATOM 2199  C CE1   . TYR D 4 41  ? 96.319  75.880  49.675  1.00 54.71  ?  40  TYR D CE1   1 
ATOM 2200  C CE2   . TYR D 4 41  ? 94.002  75.339  49.876  1.00 54.71  ?  40  TYR D CE2   1 
ATOM 2201  C CZ    . TYR D 4 41  ? 95.024  75.999  49.233  1.00 54.71  ?  40  TYR D CZ    1 
ATOM 2202  O OH    . TYR D 4 41  ? 94.760  76.784  48.137  1.00 54.71  ?  40  TYR D OH    1 
ATOM 2203  N N     . VAL D 4 42  ? 95.975  70.736  54.110  1.00 52.40  ?  41  VAL D N     1 
ATOM 2204  C CA    . VAL D 4 42  ? 96.279  69.851  55.231  1.00 52.40  ?  41  VAL D CA    1 
ATOM 2205  C C     . VAL D 4 42  ? 97.212  68.735  54.784  1.00 52.40  ?  41  VAL D C     1 
ATOM 2206  O O     . VAL D 4 42  ? 98.135  68.347  55.513  1.00 52.40  ?  41  VAL D O     1 
ATOM 2207  C CB    . VAL D 4 42  ? 94.971  69.308  55.834  1.00 52.40  ?  41  VAL D CB    1 
ATOM 2208  C CG1   . VAL D 4 42  ? 95.236  68.257  56.889  1.00 52.40  ?  41  VAL D CG1   1 
ATOM 2209  C CG2   . VAL D 4 42  ? 94.191  70.441  56.443  1.00 52.40  ?  41  VAL D CG2   1 
ATOM 2210  N N     . TYR D 4 43  ? 97.028  68.251  53.553  1.00 61.00  ?  42  TYR D N     1 
ATOM 2211  C CA    . TYR D 4 43  ? 97.928  67.235  53.019  1.00 61.00  ?  42  TYR D CA    1 
ATOM 2212  C C     . TYR D 4 43  ? 99.340  67.781  52.825  1.00 61.00  ?  42  TYR D C     1 
ATOM 2213  O O     . TYR D 4 43  ? 100.323 67.077  53.090  1.00 61.00  ?  42  TYR D O     1 
ATOM 2214  C CB    . TYR D 4 43  ? 97.375  66.699  51.705  1.00 61.00  ?  42  TYR D CB    1 
ATOM 2215  C CG    . TYR D 4 43  ? 98.170  65.558  51.143  1.00 61.00  ?  42  TYR D CG    1 
ATOM 2216  C CD1   . TYR D 4 43  ? 98.049  64.283  51.671  1.00 61.00  ?  42  TYR D CD1   1 
ATOM 2217  C CD2   . TYR D 4 43  ? 99.051  65.755  50.090  1.00 61.00  ?  42  TYR D CD2   1 
ATOM 2218  C CE1   . TYR D 4 43  ? 98.779  63.232  51.163  1.00 61.00  ?  42  TYR D CE1   1 
ATOM 2219  C CE2   . TYR D 4 43  ? 99.786  64.714  49.574  1.00 61.00  ?  42  TYR D CE2   1 
ATOM 2220  C CZ    . TYR D 4 43  ? 99.647  63.455  50.117  1.00 61.00  ?  42  TYR D CZ    1 
ATOM 2221  O OH    . TYR D 4 43  ? 100.379 62.416  49.601  1.00 61.00  ?  42  TYR D OH    1 
ATOM 2222  N N     . LYS D 4 44  ? 99.459  69.043  52.402  1.00 58.14  ?  43  LYS D N     1 
ATOM 2223  C CA    . LYS D 4 44  ? 100.781 69.647  52.241  1.00 58.14  ?  43  LYS D CA    1 
ATOM 2224  C C     . LYS D 4 44  ? 101.469 69.864  53.582  1.00 58.14  ?  43  LYS D C     1 
ATOM 2225  O O     . LYS D 4 44  ? 102.679 69.644  53.701  1.00 58.14  ?  43  LYS D O     1 
ATOM 2226  C CB    . LYS D 4 44  ? 100.679 70.969  51.486  1.00 58.14  ?  43  LYS D CB    1 
ATOM 2227  C CG    . LYS D 4 44  ? 100.353 70.820  50.019  1.00 58.14  ?  43  LYS D CG    1 
ATOM 2228  C CD    . LYS D 4 44  ? 100.291 72.170  49.339  1.00 58.14  ?  43  LYS D CD    1 
ATOM 2229  C CE    . LYS D 4 44  ? 99.921  72.025  47.878  1.00 58.14  ?  43  LYS D CE    1 
ATOM 2230  N NZ    . LYS D 4 44  ? 99.821  73.347  47.206  1.00 58.14  1  43  LYS D NZ    1 
ATOM 2231  N N     . VAL D 4 45  ? 100.716 70.280  54.603  1.00 56.38  ?  44  VAL D N     1 
ATOM 2232  C CA    . VAL D 4 45  ? 101.305 70.464  55.929  1.00 56.38  ?  44  VAL D CA    1 
ATOM 2233  C C     . VAL D 4 45  ? 101.733 69.124  56.519  1.00 56.38  ?  44  VAL D C     1 
ATOM 2234  O O     . VAL D 4 45  ? 102.799 69.013  57.143  1.00 56.38  ?  44  VAL D O     1 
ATOM 2235  C CB    . VAL D 4 45  ? 100.317 71.212  56.842  1.00 56.38  ?  44  VAL D CB    1 
ATOM 2236  C CG1   . VAL D 4 45  ? 100.819 71.276  58.270  1.00 56.38  ?  44  VAL D CG1   1 
ATOM 2237  C CG2   . VAL D 4 45  ? 100.108 72.611  56.323  1.00 56.38  ?  44  VAL D CG2   1 
ATOM 2238  N N     . LEU D 4 46  ? 100.943 68.076  56.277  1.00 60.33  ?  45  LEU D N     1 
ATOM 2239  C CA    . LEU D 4 46  ? 101.290 66.753  56.781  1.00 60.33  ?  45  LEU D CA    1 
ATOM 2240  C C     . LEU D 4 46  ? 102.518 66.189  56.080  1.00 60.33  ?  45  LEU D C     1 
ATOM 2241  O O     . LEU D 4 46  ? 103.378 65.579  56.725  1.00 60.33  ?  45  LEU D O     1 
ATOM 2242  C CB    . LEU D 4 46  ? 100.102 65.811  56.623  1.00 60.33  ?  45  LEU D CB    1 
ATOM 2243  C CG    . LEU D 4 46  ? 100.314 64.400  57.154  1.00 60.33  ?  45  LEU D CG    1 
ATOM 2244  C CD1   . LEU D 4 46  ? 100.629 64.443  58.631  1.00 60.33  ?  45  LEU D CD1   1 
ATOM 2245  C CD2   . LEU D 4 46  ? 99.082  63.569  56.902  1.00 60.33  ?  45  LEU D CD2   1 
ATOM 2246  N N     . LYS D 4 47  ? 102.640 66.400  54.767  1.00 64.84  ?  46  LYS D N     1 
ATOM 2247  C CA    . LYS D 4 47  ? 103.862 65.984  54.088  1.00 64.84  ?  46  LYS D CA    1 
ATOM 2248  C C     . LYS D 4 47  ? 105.045 66.883  54.413  1.00 64.84  ?  46  LYS D C     1 
ATOM 2249  O O     . LYS D 4 47  ? 106.188 66.484  54.177  1.00 64.84  ?  46  LYS D O     1 
ATOM 2250  C CB    . LYS D 4 47  ? 103.648 65.926  52.577  1.00 64.84  ?  46  LYS D CB    1 
ATOM 2251  C CG    . LYS D 4 47  ? 102.739 64.795  52.154  1.00 64.84  ?  46  LYS D CG    1 
ATOM 2252  C CD    . LYS D 4 47  ? 103.425 63.465  52.421  1.00 64.84  ?  46  LYS D CD    1 
ATOM 2253  C CE    . LYS D 4 47  ? 102.544 62.289  52.050  1.00 64.84  ?  46  LYS D CE    1 
ATOM 2254  N NZ    . LYS D 4 47  ? 102.327 62.211  50.581  1.00 64.84  1  46  LYS D NZ    1 
ATOM 2255  N N     . GLN D 4 48  ? 104.802 68.083  54.937  1.00 61.87  ?  47  GLN D N     1 
ATOM 2256  C CA    . GLN D 4 48  ? 105.907 68.903  55.417  1.00 61.87  ?  47  GLN D CA    1 
ATOM 2257  C C     . GLN D 4 48  ? 106.453 68.385  56.742  1.00 61.87  ?  47  GLN D C     1 
ATOM 2258  O O     . GLN D 4 48  ? 107.649 68.099  56.855  1.00 61.87  ?  47  GLN D O     1 
ATOM 2259  C CB    . GLN D 4 48  ? 105.465 70.358  55.557  1.00 61.87  ?  47  GLN D CB    1 
ATOM 2260  C CG    . GLN D 4 48  ? 106.567 71.285  56.030  1.00 61.87  ?  47  GLN D CG    1 
ATOM 2261  C CD    . GLN D 4 48  ? 106.119 72.730  56.108  1.00 61.87  ?  47  GLN D CD    1 
ATOM 2262  O OE1   . GLN D 4 48  ? 104.970 73.051  55.812  1.00 61.87  ?  47  GLN D OE1   1 
ATOM 2263  N NE2   . GLN D 4 48  ? 107.023 73.608  56.519  1.00 61.87  ?  47  GLN D NE2   1 
ATOM 2264  N N     . VAL D 4 49  ? 105.595 68.254  57.760  1.00 63.00  ?  48  VAL D N     1 
ATOM 2265  C CA    . VAL D 4 49  ? 106.080 67.900  59.094  1.00 63.00  ?  48  VAL D CA    1 
ATOM 2266  C C     . VAL D 4 49  ? 106.193 66.399  59.312  1.00 63.00  ?  48  VAL D C     1 
ATOM 2267  O O     . VAL D 4 49  ? 106.528 65.971  60.424  1.00 63.00  ?  48  VAL D O     1 
ATOM 2268  C CB    . VAL D 4 49  ? 105.189 68.490  60.203  1.00 63.00  ?  48  VAL D CB    1 
ATOM 2269  C CG1   . VAL D 4 49  ? 105.154 70.001  60.100  1.00 63.00  ?  48  VAL D CG1   1 
ATOM 2270  C CG2   . VAL D 4 49  ? 103.797 67.903  60.132  1.00 63.00  ?  48  VAL D CG2   1 
ATOM 2271  N N     . HIS D 4 50  ? 105.918 65.584  58.293  1.00 68.95  ?  49  HIS D N     1 
ATOM 2272  C CA    . HIS D 4 50  ? 106.087 64.139  58.357  1.00 68.95  ?  49  HIS D CA    1 
ATOM 2273  C C     . HIS D 4 50  ? 106.456 63.624  56.977  1.00 68.95  ?  49  HIS D C     1 
ATOM 2274  O O     . HIS D 4 50  ? 105.924 64.127  55.977  1.00 68.95  ?  49  HIS D O     1 
ATOM 2275  C CB    . HIS D 4 50  ? 104.832 63.428  58.868  1.00 68.95  ?  49  HIS D CB    1 
ATOM 2276  C CG    . HIS D 4 50  ? 104.679 63.480  60.352  1.00 68.95  ?  49  HIS D CG    1 
ATOM 2277  N ND1   . HIS D 4 50  ? 104.106 64.547  61.010  1.00 68.95  ?  49  HIS D ND1   1 
ATOM 2278  C CD2   . HIS D 4 50  ? 105.026 62.591  61.313  1.00 68.95  ?  49  HIS D CD2   1 
ATOM 2279  C CE1   . HIS D 4 50  ? 104.110 64.314  62.309  1.00 68.95  ?  49  HIS D CE1   1 
ATOM 2280  N NE2   . HIS D 4 50  ? 104.662 63.132  62.519  1.00 68.95  ?  49  HIS D NE2   1 
ATOM 2281  N N     . PRO D 4 51  ? 107.370 62.655  56.887  1.00 77.51  ?  50  PRO D N     1 
ATOM 2282  C CA    . PRO D 4 51  ? 107.884 62.235  55.577  1.00 77.51  ?  50  PRO D CA    1 
ATOM 2283  C C     . PRO D 4 51  ? 106.873 61.510  54.706  1.00 77.51  ?  50  PRO D C     1 
ATOM 2284  O O     . PRO D 4 51  ? 106.663 61.888  53.550  1.00 77.51  ?  50  PRO D O     1 
ATOM 2285  C CB    . PRO D 4 51  ? 109.045 61.302  55.945  1.00 77.51  ?  50  PRO D CB    1 
ATOM 2286  C CG    . PRO D 4 51  ? 109.408 61.671  57.344  1.00 77.51  ?  50  PRO D CG    1 
ATOM 2287  C CD    . PRO D 4 51  ? 108.118 62.035  57.991  1.00 77.51  ?  50  PRO D CD    1 
ATOM 2288  N N     . ASP D 4 52  ? 106.241 60.464  55.239  1.00 84.36  ?  51  ASP D N     1 
ATOM 2289  C CA    . ASP D 4 52  ? 105.379 59.639  54.402  1.00 84.36  ?  51  ASP D CA    1 
ATOM 2290  C C     . ASP D 4 52  ? 104.123 59.156  55.119  1.00 84.36  ?  51  ASP D C     1 
ATOM 2291  O O     . ASP D 4 52  ? 103.526 58.161  54.693  1.00 84.36  ?  51  ASP D O     1 
ATOM 2292  C CB    . ASP D 4 52  ? 106.164 58.442  53.855  1.00 84.36  ?  51  ASP D CB    1 
ATOM 2293  C CG    . ASP D 4 52  ? 106.818 57.613  54.951  1.00 84.36  ?  51  ASP D CG    1 
ATOM 2294  O OD1   . ASP D 4 52  ? 106.758 58.002  56.137  1.00 84.36  ?  51  ASP D OD1   1 
ATOM 2295  O OD2   . ASP D 4 52  ? 107.401 56.561  54.619  1.00 84.36  -1 51  ASP D OD2   1 
ATOM 2296  N N     . THR D 4 53  ? 103.710 59.823  56.191  1.00 82.34  ?  52  THR D N     1 
ATOM 2297  C CA    . THR D 4 53  ? 102.550 59.380  56.954  1.00 82.34  ?  52  THR D CA    1 
ATOM 2298  C C     . THR D 4 53  ? 101.280 59.712  56.183  1.00 82.34  ?  52  THR D C     1 
ATOM 2299  O O     . THR D 4 53  ? 100.904 60.881  56.063  1.00 82.34  ?  52  THR D O     1 
ATOM 2300  C CB    . THR D 4 53  ? 102.541 60.036  58.328  1.00 82.34  ?  52  THR D CB    1 
ATOM 2301  O OG1   . THR D 4 53  ? 103.737 59.681  59.032  1.00 82.34  ?  52  THR D OG1   1 
ATOM 2302  C CG2   . THR D 4 53  ? 101.339 59.570  59.122  1.00 82.34  ?  52  THR D CG2   1 
ATOM 2303  N N     . GLY D 4 54  ? 100.629 58.687  55.646  1.00 79.81  ?  53  GLY D N     1 
ATOM 2304  C CA    . GLY D 4 54  ? 99.402  58.897  54.917  1.00 79.81  ?  53  GLY D CA    1 
ATOM 2305  C C     . GLY D 4 54  ? 98.234  59.210  55.826  1.00 79.81  ?  53  GLY D C     1 
ATOM 2306  O O     . GLY D 4 54  ? 98.274  58.986  57.034  1.00 79.81  ?  53  GLY D O     1 
ATOM 2307  N N     . ILE D 4 55  ? 97.176  59.743  55.223  1.00 70.49  ?  54  ILE D N     1 
ATOM 2308  C CA    . ILE D 4 55  ? 95.964  60.120  55.939  1.00 70.49  ?  54  ILE D CA    1 
ATOM 2309  C C     . ILE D 4 55  ? 94.762  59.633  55.141  1.00 70.49  ?  54  ILE D C     1 
ATOM 2310  O O     . ILE D 4 55  ? 94.727  59.749  53.912  1.00 70.49  ?  54  ILE D O     1 
ATOM 2311  C CB    . ILE D 4 55  ? 95.925  61.643  56.203  1.00 70.49  ?  54  ILE D CB    1 
ATOM 2312  C CG1   . ILE D 4 55  ? 94.685  62.038  56.998  1.00 70.49  ?  54  ILE D CG1   1 
ATOM 2313  C CG2   . ILE D 4 55  ? 96.085  62.458  54.926  1.00 70.49  ?  54  ILE D CG2   1 
ATOM 2314  C CD1   . ILE D 4 55  ? 94.732  63.449  57.512  1.00 70.49  ?  54  ILE D CD1   1 
ATOM 2315  N N     . SER D 4 56  ? 93.800  59.030  55.833  1.00 65.91  ?  55  SER D N     1 
ATOM 2316  C CA    . SER D 4 56  ? 92.664  58.447  55.143  1.00 65.91  ?  55  SER D CA    1 
ATOM 2317  C C     . SER D 4 56  ? 91.719  59.540  54.660  1.00 65.91  ?  55  SER D C     1 
ATOM 2318  O O     . SER D 4 56  ? 91.800  60.698  55.069  1.00 65.91  ?  55  SER D O     1 
ATOM 2319  C CB    . SER D 4 56  ? 91.921  57.475  56.051  1.00 65.91  ?  55  SER D CB    1 
ATOM 2320  O OG    . SER D 4 56  ? 91.310  58.166  57.119  1.00 65.91  ?  55  SER D OG    1 
ATOM 2321  N N     . SER D 4 57  ? 90.807  59.157  53.770  1.00 65.75  ?  56  SER D N     1 
ATOM 2322  C CA    . SER D 4 57  ? 89.863  60.115  53.215  1.00 65.75  ?  56  SER D CA    1 
ATOM 2323  C C     . SER D 4 57  ? 88.723  60.445  54.163  1.00 65.75  ?  56  SER D C     1 
ATOM 2324  O O     . SER D 4 57  ? 87.926  61.335  53.855  1.00 65.75  ?  56  SER D O     1 
ATOM 2325  C CB    . SER D 4 57  ? 89.284  59.593  51.901  1.00 65.75  ?  56  SER D CB    1 
ATOM 2326  O OG    . SER D 4 57  ? 88.487  58.444  52.122  1.00 65.75  ?  56  SER D OG    1 
ATOM 2327  N N     . LYS D 4 58  ? 88.611  59.752  55.292  1.00 50.34  ?  57  LYS D N     1 
ATOM 2328  C CA    . LYS D 4 58  ? 87.584  60.109  56.256  1.00 50.34  ?  57  LYS D CA    1 
ATOM 2329  C C     . LYS D 4 58  ? 88.119  61.072  57.305  1.00 50.34  ?  57  LYS D C     1 
ATOM 2330  O O     . LYS D 4 58  ? 87.465  62.071  57.619  1.00 50.34  ?  57  LYS D O     1 
ATOM 2331  C CB    . LYS D 4 58  ? 87.024  58.856  56.922  1.00 50.34  ?  57  LYS D CB    1 
ATOM 2332  C CG    . LYS D 4 58  ? 85.828  59.129  57.805  1.00 50.34  ?  57  LYS D CG    1 
ATOM 2333  C CD    . LYS D 4 58  ? 85.290  57.844  58.396  1.00 50.34  ?  57  LYS D CD    1 
ATOM 2334  C CE    . LYS D 4 58  ? 84.159  57.288  57.547  1.00 50.34  ?  57  LYS D CE    1 
ATOM 2335  N NZ    . LYS D 4 58  ? 84.668  56.629  56.313  1.00 50.34  1  57  LYS D NZ    1 
ATOM 2336  N N     . ALA D 4 59  ? 89.315  60.793  57.830  1.00 49.13  ?  58  ALA D N     1 
ATOM 2337  C CA    . ALA D 4 59  ? 89.901  61.633  58.867  1.00 49.13  ?  58  ALA D CA    1 
ATOM 2338  C C     . ALA D 4 59  ? 90.237  63.018  58.347  1.00 49.13  ?  58  ALA D C     1 
ATOM 2339  O O     . ALA D 4 59  ? 90.135  63.995  59.098  1.00 49.13  ?  58  ALA D O     1 
ATOM 2340  C CB    . ALA D 4 59  ? 91.152  60.975  59.438  1.00 49.13  ?  58  ALA D CB    1 
ATOM 2341  N N     . MET D 4 60  ? 90.617  63.113  57.068  1.00 48.19  ?  59  MET D N     1 
ATOM 2342  C CA    . MET D 4 60  ? 90.776  64.401  56.401  1.00 48.19  ?  59  MET D CA    1 
ATOM 2343  C C     . MET D 4 60  ? 89.504  65.229  56.474  1.00 48.19  ?  59  MET D C     1 
ATOM 2344  O O     . MET D 4 60  ? 89.564  66.449  56.684  1.00 48.19  ?  59  MET D O     1 
ATOM 2345  C CB    . MET D 4 60  ? 91.178  64.180  54.945  1.00 48.19  ?  59  MET D CB    1 
ATOM 2346  C CG    . MET D 4 60  ? 91.344  65.447  54.144  1.00 48.19  ?  59  MET D CG    1 
ATOM 2347  S SD    . MET D 4 60  ? 92.629  66.508  54.812  1.00 48.19  ?  59  MET D SD    1 
ATOM 2348  C CE    . MET D 4 60  ? 94.085  65.582  54.351  1.00 48.19  ?  59  MET D CE    1 
ATOM 2349  N N     . GLY D 4 61  ? 88.344  64.568  56.357  1.00 43.57  ?  60  GLY D N     1 
ATOM 2350  C CA    . GLY D 4 61  ? 87.073  65.254  56.530  1.00 43.57  ?  60  GLY D CA    1 
ATOM 2351  C C     . GLY D 4 61  ? 86.931  65.893  57.897  1.00 43.57  ?  60  GLY D C     1 
ATOM 2352  O O     . GLY D 4 61  ? 86.442  67.023  58.008  1.00 43.57  ?  60  GLY D O     1 
ATOM 2353  N N     . ILE D 4 62  ? 87.425  65.205  58.940  1.00 39.76  ?  61  ILE D N     1 
ATOM 2354  C CA    . ILE D 4 62  ? 87.468  65.766  60.290  1.00 39.76  ?  61  ILE D CA    1 
ATOM 2355  C C     . ILE D 4 62  ? 88.253  67.062  60.302  1.00 39.76  ?  61  ILE D C     1 
ATOM 2356  O O     . ILE D 4 62  ? 87.788  68.075  60.845  1.00 39.76  ?  61  ILE D O     1 
ATOM 2357  C CB    . ILE D 4 62  ? 88.061  64.748  61.278  1.00 39.76  ?  61  ILE D CB    1 
ATOM 2358  C CG1   . ILE D 4 62  ? 87.093  63.597  61.494  1.00 39.76  ?  61  ILE D CG1   1 
ATOM 2359  C CG2   . ILE D 4 62  ? 88.408  65.395  62.600  1.00 39.76  ?  61  ILE D CG2   1 
ATOM 2360  C CD1   . ILE D 4 62  ? 87.671  62.506  62.325  1.00 39.76  ?  61  ILE D CD1   1 
ATOM 2361  N N     . MET D 4 63  ? 89.392  67.079  59.601  1.00 40.68  ?  62  MET D N     1 
ATOM 2362  C CA    . MET D 4 63  ? 90.213  68.278  59.547  1.00 40.68  ?  62  MET D CA    1 
ATOM 2363  C C     . MET D 4 63  ? 89.483  69.423  58.872  1.00 40.68  ?  62  MET D C     1 
ATOM 2364  O O     . MET D 4 63  ? 89.616  70.568  59.323  1.00 40.68  ?  62  MET D O     1 
ATOM 2365  C CB    . MET D 4 63  ? 91.525  67.989  58.837  1.00 40.68  ?  62  MET D CB    1 
ATOM 2366  C CG    . MET D 4 63  ? 92.389  67.028  59.598  1.00 40.68  ?  62  MET D CG    1 
ATOM 2367  S SD    . MET D 4 63  ? 92.679  67.662  61.246  1.00 40.68  ?  62  MET D SD    1 
ATOM 2368  C CE    . MET D 4 63  ? 93.647  69.106  60.847  1.00 40.68  ?  62  MET D CE    1 
ATOM 2369  N N     . ASN D 4 64  ? 88.636  69.118  57.878  1.00 44.89  ?  63  ASN D N     1 
ATOM 2370  C CA    . ASN D 4 64  ? 87.790  70.149  57.286  1.00 44.89  ?  63  ASN D CA    1 
ATOM 2371  C C     . ASN D 4 64  ? 86.871  70.744  58.336  1.00 44.89  ?  63  ASN D C     1 
ATOM 2372  O O     . ASN D 4 64  ? 86.925  71.951  58.613  1.00 44.89  ?  63  ASN D O     1 
ATOM 2373  C CB    . ASN D 4 64  ? 86.978  69.574  56.134  1.00 44.89  ?  63  ASN D CB    1 
ATOM 2374  C CG    . ASN D 4 64  ? 87.841  69.118  55.000  1.00 44.89  ?  63  ASN D CG    1 
ATOM 2375  O OD1   . ASN D 4 64  ? 87.884  67.934  54.673  1.00 44.89  ?  63  ASN D OD1   1 
ATOM 2376  N ND2   . ASN D 4 64  ? 88.549  70.054  54.390  1.00 44.89  ?  63  ASN D ND2   1 
ATOM 2377  N N     . SER D 4 65  ? 86.150  69.884  59.054  1.00 40.84  ?  64  SER D N     1 
ATOM 2378  C CA    . SER D 4 65  ? 85.270  70.393  60.088  1.00 40.84  ?  64  SER D CA    1 
ATOM 2379  C C     . SER D 4 65  ? 86.028  70.846  61.319  1.00 40.84  ?  64  SER D C     1 
ATOM 2380  O O     . SER D 4 65  ? 85.406  71.382  62.238  1.00 40.84  ?  64  SER D O     1 
ATOM 2381  C CB    . SER D 4 65  ? 84.236  69.341  60.469  1.00 40.84  ?  64  SER D CB    1 
ATOM 2382  O OG    . SER D 4 65  ? 83.375  69.068  59.378  1.00 40.84  ?  64  SER D OG    1 
ATOM 2383  N N     . PHE D 4 66  ? 87.348  70.669  61.363  1.00 38.80  ?  65  PHE D N     1 
ATOM 2384  C CA    . PHE D 4 66  ? 88.078  71.401  62.377  1.00 38.80  ?  65  PHE D CA    1 
ATOM 2385  C C     . PHE D 4 66  ? 88.297  72.831  61.925  1.00 38.80  ?  65  PHE D C     1 
ATOM 2386  O O     . PHE D 4 66  ? 87.944  73.777  62.635  1.00 38.80  ?  65  PHE D O     1 
ATOM 2387  C CB    . PHE D 4 66  ? 89.408  70.728  62.684  1.00 38.80  ?  65  PHE D CB    1 
ATOM 2388  C CG    . PHE D 4 66  ? 90.179  71.412  63.758  1.00 38.80  ?  65  PHE D CG    1 
ATOM 2389  C CD1   . PHE D 4 66  ? 89.801  71.281  65.077  1.00 38.80  ?  65  PHE D CD1   1 
ATOM 2390  C CD2   . PHE D 4 66  ? 91.271  72.198  63.451  1.00 38.80  ?  65  PHE D CD2   1 
ATOM 2391  C CE1   . PHE D 4 66  ? 90.501  71.918  66.072  1.00 38.80  ?  65  PHE D CE1   1 
ATOM 2392  C CE2   . PHE D 4 66  ? 91.975  72.837  64.442  1.00 38.80  ?  65  PHE D CE2   1 
ATOM 2393  C CZ    . PHE D 4 66  ? 91.587  72.699  65.754  1.00 38.80  ?  65  PHE D CZ    1 
ATOM 2394  N N     . VAL D 4 67  ? 88.830  73.013  60.719  1.00 39.92  ?  66  VAL D N     1 
ATOM 2395  C CA    . VAL D 4 67  ? 89.369  74.311  60.355  1.00 39.92  ?  66  VAL D CA    1 
ATOM 2396  C C     . VAL D 4 67  ? 88.390  75.109  59.503  1.00 39.92  ?  66  VAL D C     1 
ATOM 2397  O O     . VAL D 4 67  ? 88.716  76.204  59.031  1.00 39.92  ?  66  VAL D O     1 
ATOM 2398  C CB    . VAL D 4 67  ? 90.757  74.113  59.704  1.00 39.92  ?  66  VAL D CB    1 
ATOM 2399  C CG1   . VAL D 4 67  ? 90.645  73.569  58.319  1.00 39.92  ?  66  VAL D CG1   1 
ATOM 2400  C CG2   . VAL D 4 67  ? 91.664  75.346  59.814  1.00 39.92  ?  66  VAL D CG2   1 
ATOM 2401  N N     . ASN D 4 68  ? 87.174  74.605  59.326  1.00 44.67  ?  67  ASN D N     1 
ATOM 2402  C CA    . ASN D 4 68  ? 86.021  75.452  59.063  1.00 44.67  ?  67  ASN D CA    1 
ATOM 2403  C C     . ASN D 4 68  ? 85.290  75.810  60.340  1.00 44.67  ?  67  ASN D C     1 
ATOM 2404  O O     . ASN D 4 68  ? 84.178  76.338  60.278  1.00 44.67  ?  67  ASN D O     1 
ATOM 2405  C CB    . ASN D 4 68  ? 85.046  74.776  58.100  1.00 44.67  ?  67  ASN D CB    1 
ATOM 2406  C CG    . ASN D 4 68  ? 85.530  74.798  56.675  1.00 44.67  ?  67  ASN D CG    1 
ATOM 2407  O OD1   . ASN D 4 68  ? 86.079  75.795  56.214  1.00 44.67  ?  67  ASN D OD1   1 
ATOM 2408  N ND2   . ASN D 4 68  ? 85.314  73.702  55.959  1.00 44.67  ?  67  ASN D ND2   1 
ATOM 2409  N N     . ASP D 4 69  ? 85.880  75.512  61.494  1.00 41.58  ?  68  ASP D N     1 
ATOM 2410  C CA    . ASP D 4 69  ? 85.275  75.782  62.787  1.00 41.58  ?  68  ASP D CA    1 
ATOM 2411  C C     . ASP D 4 69  ? 86.050  76.806  63.595  1.00 41.58  ?  68  ASP D C     1 
ATOM 2412  O O     . ASP D 4 69  ? 85.451  77.742  64.131  1.00 41.58  ?  68  ASP D O     1 
ATOM 2413  C CB    . ASP D 4 69  ? 85.157  74.484  63.587  1.00 41.58  ?  68  ASP D CB    1 
ATOM 2414  C CG    . ASP D 4 69  ? 84.527  74.697  64.935  1.00 41.58  ?  68  ASP D CG    1 
ATOM 2415  O OD1   . ASP D 4 69  ? 83.301  74.913  64.992  1.00 41.58  ?  68  ASP D OD1   1 
ATOM 2416  O OD2   . ASP D 4 69  ? 85.260  74.648  65.943  1.00 41.58  -1 68  ASP D OD2   1 
ATOM 2417  N N     . ILE D 4 70  ? 87.370  76.634  63.705  1.00 36.64  ?  69  ILE D N     1 
ATOM 2418  C CA    . ILE D 4 70  ? 88.207  77.598  64.412  1.00 36.64  ?  69  ILE D CA    1 
ATOM 2419  C C     . ILE D 4 70  ? 88.164  78.947  63.713  1.00 36.64  ?  69  ILE D C     1 
ATOM 2420  O O     . ILE D 4 70  ? 88.038  79.994  64.361  1.00 36.64  ?  69  ILE D O     1 
ATOM 2421  C CB    . ILE D 4 70  ? 89.640  77.058  64.532  1.00 36.64  ?  69  ILE D CB    1 
ATOM 2422  C CG1   . ILE D 4 70  ? 89.630  75.759  65.325  1.00 36.64  ?  69  ILE D CG1   1 
ATOM 2423  C CG2   . ILE D 4 70  ? 90.539  78.056  65.202  1.00 36.64  ?  69  ILE D CG2   1 
ATOM 2424  C CD1   . ILE D 4 70  ? 89.104  75.917  66.726  1.00 36.64  ?  69  ILE D CD1   1 
ATOM 2425  N N     . PHE D 4 71  ? 88.197  78.935  62.379  1.00 39.49  ?  70  PHE D N     1 
ATOM 2426  C CA    . PHE D 4 71  ? 87.974  80.146  61.598  1.00 39.49  ?  70  PHE D CA    1 
ATOM 2427  C C     . PHE D 4 71  ? 86.595  80.740  61.838  1.00 39.49  ?  70  PHE D C     1 
ATOM 2428  O O     . PHE D 4 71  ? 86.425  81.959  61.743  1.00 39.49  ?  70  PHE D O     1 
ATOM 2429  C CB    . PHE D 4 71  ? 88.177  79.844  60.117  1.00 39.49  ?  70  PHE D CB    1 
ATOM 2430  C CG    . PHE D 4 71  ? 87.750  80.946  59.212  1.00 39.49  ?  70  PHE D CG    1 
ATOM 2431  C CD1   . PHE D 4 71  ? 88.466  82.119  59.145  1.00 39.49  ?  70  PHE D CD1   1 
ATOM 2432  C CD2   . PHE D 4 71  ? 86.620  80.803  58.426  1.00 39.49  ?  70  PHE D CD2   1 
ATOM 2433  C CE1   . PHE D 4 71  ? 88.062  83.139  58.310  1.00 39.49  ?  70  PHE D CE1   1 
ATOM 2434  C CE2   . PHE D 4 71  ? 86.210  81.812  57.587  1.00 39.49  ?  70  PHE D CE2   1 
ATOM 2435  C CZ    . PHE D 4 71  ? 86.935  82.985  57.529  1.00 39.49  ?  70  PHE D CZ    1 
ATOM 2436  N N     . GLU D 4 72  ? 85.606  79.915  62.179  1.00 42.93  ?  71  GLU D N     1 
ATOM 2437  C CA    . GLU D 4 72  ? 84.314  80.482  62.535  1.00 42.93  ?  71  GLU D CA    1 
ATOM 2438  C C     . GLU D 4 72  ? 84.360  81.135  63.908  1.00 42.93  ?  71  GLU D C     1 
ATOM 2439  O O     . GLU D 4 72  ? 83.646  82.114  64.145  1.00 42.93  ?  71  GLU D O     1 
ATOM 2440  C CB    . GLU D 4 72  ? 83.230  79.408  62.478  1.00 42.93  ?  71  GLU D CB    1 
ATOM 2441  C CG    . GLU D 4 72  ? 81.801  79.935  62.485  1.00 42.93  ?  71  GLU D CG    1 
ATOM 2442  C CD    . GLU D 4 72  ? 81.245  80.129  63.882  1.00 42.93  ?  71  GLU D CD    1 
ATOM 2443  O OE1   . GLU D 4 72  ? 81.672  79.396  64.797  1.00 42.93  ?  71  GLU D OE1   1 
ATOM 2444  O OE2   . GLU D 4 72  ? 80.391  81.021  64.067  1.00 42.93  -1 71  GLU D OE2   1 
ATOM 2445  N N     . ARG D 4 73  ? 85.189  80.624  64.820  1.00 32.57  ?  72  ARG D N     1 
ATOM 2446  C CA    . ARG D 4 73  ? 85.261  81.242  66.137  1.00 32.57  ?  72  ARG D CA    1 
ATOM 2447  C C     . ARG D 4 73  ? 86.021  82.556  66.083  1.00 32.57  ?  72  ARG D C     1 
ATOM 2448  O O     . ARG D 4 73  ? 85.438  83.619  66.318  1.00 32.57  ?  72  ARG D O     1 
ATOM 2449  C CB    . ARG D 4 73  ? 85.914  80.303  67.145  1.00 32.57  ?  72  ARG D CB    1 
ATOM 2450  C CG    . ARG D 4 73  ? 85.070  79.129  67.552  1.00 32.57  ?  72  ARG D CG    1 
ATOM 2451  C CD    . ARG D 4 73  ? 85.812  78.316  68.584  1.00 32.57  ?  72  ARG D CD    1 
ATOM 2452  N NE    . ARG D 4 73  ? 85.088  77.119  68.982  1.00 32.57  ?  72  ARG D NE    1 
ATOM 2453  C CZ    . ARG D 4 73  ? 85.571  76.212  69.820  1.00 32.57  ?  72  ARG D CZ    1 
ATOM 2454  N NH1   . ARG D 4 73  ? 86.776  76.377  70.342  1.00 32.57  1  72  ARG D NH1   1 
ATOM 2455  N NH2   . ARG D 4 73  ? 84.855  75.144  70.137  1.00 32.57  ?  72  ARG D NH2   1 
ATOM 2456  N N     . ILE D 4 74  ? 87.309  82.490  65.722  1.00 32.87  ?  73  ILE D N     1 
ATOM 2457  C CA    . ILE D 4 74  ? 88.221  83.631  65.843  1.00 32.87  ?  73  ILE D CA    1 
ATOM 2458  C C     . ILE D 4 74  ? 87.767  84.779  64.957  1.00 32.87  ?  73  ILE D C     1 
ATOM 2459  O O     . ILE D 4 74  ? 87.421  85.862  65.441  1.00 32.87  ?  73  ILE D O     1 
ATOM 2460  C CB    . ILE D 4 74  ? 89.657  83.209  65.501  1.00 32.87  ?  73  ILE D CB    1 
ATOM 2461  C CG1   . ILE D 4 74  ? 90.163  82.189  66.509  1.00 32.87  ?  73  ILE D CG1   1 
ATOM 2462  C CG2   . ILE D 4 74  ? 90.561  84.409  65.479  1.00 32.87  ?  73  ILE D CG2   1 
ATOM 2463  C CD1   . ILE D 4 74  ? 91.474  81.576  66.108  1.00 32.87  ?  73  ILE D CD1   1 
ATOM 2464  N N     . ALA D 4 75  ? 87.652  84.521  63.659  1.00 38.08  ?  74  ALA D N     1 
ATOM 2465  C CA    . ALA D 4 75  ? 87.140  85.532  62.747  1.00 38.08  ?  74  ALA D CA    1 
ATOM 2466  C C     . ALA D 4 75  ? 85.653  85.800  62.920  1.00 38.08  ?  74  ALA D C     1 
ATOM 2467  O O     . ALA D 4 75  ? 85.122  86.674  62.232  1.00 38.08  ?  74  ALA D O     1 
ATOM 2468  C CB    . ALA D 4 75  ? 87.419  85.124  61.306  1.00 38.08  ?  74  ALA D CB    1 
ATOM 2469  N N     . GLY D 4 76  ? 84.965  85.074  63.795  1.00 37.18  ?  75  GLY D N     1 
ATOM 2470  C CA    . GLY D 4 76  ? 83.674  85.526  64.252  1.00 37.18  ?  75  GLY D CA    1 
ATOM 2471  C C     . GLY D 4 76  ? 83.864  86.461  65.424  1.00 37.18  ?  75  GLY D C     1 
ATOM 2472  O O     . GLY D 4 76  ? 83.390  87.603  65.405  1.00 37.18  ?  75  GLY D O     1 
ATOM 2473  N N     . GLU D 4 77  ? 84.622  85.998  66.423  1.00 35.81  ?  76  GLU D N     1 
ATOM 2474  C CA    . GLU D 4 77  ? 84.665  86.679  67.712  1.00 35.81  ?  76  GLU D CA    1 
ATOM 2475  C C     . GLU D 4 77  ? 85.400  88.005  67.625  1.00 35.81  ?  76  GLU D C     1 
ATOM 2476  O O     . GLU D 4 77  ? 85.020  88.961  68.311  1.00 35.81  ?  76  GLU D O     1 
ATOM 2477  C CB    . GLU D 4 77  ? 85.311  85.766  68.752  1.00 35.81  ?  76  GLU D CB    1 
ATOM 2478  C CG    . GLU D 4 77  ? 85.147  86.182  70.193  1.00 35.81  ?  76  GLU D CG    1 
ATOM 2479  C CD    . GLU D 4 77  ? 86.227  87.126  70.646  1.00 35.81  ?  76  GLU D CD    1 
ATOM 2480  O OE1   . GLU D 4 77  ? 87.326  87.086  70.057  1.00 35.81  ?  76  GLU D OE1   1 
ATOM 2481  O OE2   . GLU D 4 77  ? 85.979  87.907  71.585  1.00 35.81  -1 76  GLU D OE2   1 
ATOM 2482  N N     . ALA D 4 78  ? 86.424  88.091  66.774  1.00 33.01  ?  77  ALA D N     1 
ATOM 2483  C CA    . ALA D 4 78  ? 87.105  89.361  66.558  1.00 33.01  ?  77  ALA D CA    1 
ATOM 2484  C C     . ALA D 4 78  ? 86.184  90.386  65.923  1.00 33.01  ?  77  ALA D C     1 
ATOM 2485  O O     . ALA D 4 78  ? 86.346  91.587  66.169  1.00 33.01  ?  77  ALA D O     1 
ATOM 2486  C CB    . ALA D 4 78  ? 88.338  89.167  65.686  1.00 33.01  ?  77  ALA D CB    1 
ATOM 2487  N N     . SER D 4 79  ? 85.203  89.927  65.136  1.00 33.15  ?  78  SER D N     1 
ATOM 2488  C CA    . SER D 4 79  ? 84.166  90.815  64.623  1.00 33.15  ?  78  SER D CA    1 
ATOM 2489  C C     . SER D 4 79  ? 83.401  91.488  65.748  1.00 33.15  ?  78  SER D C     1 
ATOM 2490  O O     . SER D 4 79  ? 83.043  92.667  65.638  1.00 33.15  ?  78  SER D O     1 
ATOM 2491  C CB    . SER D 4 79  ? 83.203  90.034  63.738  1.00 33.15  ?  78  SER D CB    1 
ATOM 2492  O OG    . SER D 4 79  ? 82.136  90.858  63.318  1.00 33.15  ?  78  SER D OG    1 
ATOM 2493  N N     . ARG D 4 80  ? 83.188  90.766  66.849  1.00 31.52  ?  79  ARG D N     1 
ATOM 2494  C CA    . ARG D 4 80  ? 82.558  91.350  68.023  1.00 31.52  ?  79  ARG D CA    1 
ATOM 2495  C C     . ARG D 4 80  ? 83.409  92.461  68.614  1.00 31.52  ?  79  ARG D C     1 
ATOM 2496  O O     . ARG D 4 80  ? 82.874  93.482  69.058  1.00 31.52  ?  79  ARG D O     1 
ATOM 2497  C CB    . ARG D 4 80  ? 82.309  90.251  69.045  1.00 31.52  ?  79  ARG D CB    1 
ATOM 2498  C CG    . ARG D 4 80  ? 81.499  90.651  70.237  1.00 31.52  ?  79  ARG D CG    1 
ATOM 2499  C CD    . ARG D 4 80  ? 81.265  89.425  71.087  1.00 31.52  ?  79  ARG D CD    1 
ATOM 2500  N NE    . ARG D 4 80  ? 80.481  88.438  70.353  1.00 31.52  ?  79  ARG D NE    1 
ATOM 2501  C CZ    . ARG D 4 80  ? 80.308  87.183  70.745  1.00 31.52  ?  79  ARG D CZ    1 
ATOM 2502  N NH1   . ARG D 4 80  ? 80.867  86.754  71.866  1.00 31.52  1  79  ARG D NH1   1 
ATOM 2503  N NH2   . ARG D 4 80  ? 79.580  86.355  70.010  1.00 31.52  ?  79  ARG D NH2   1 
ATOM 2504  N N     . LEU D 4 81  ? 84.733  92.323  68.560  1.00 32.99  ?  80  LEU D N     1 
ATOM 2505  C CA    . LEU D 4 81  ? 85.582  93.404  69.036  1.00 32.99  ?  80  LEU D CA    1 
ATOM 2506  C C     . LEU D 4 81  ? 85.670  94.558  68.054  1.00 32.99  ?  80  LEU D C     1 
ATOM 2507  O O     . LEU D 4 81  ? 86.272  95.582  68.385  1.00 32.99  ?  80  LEU D O     1 
ATOM 2508  C CB    . LEU D 4 81  ? 86.990  92.908  69.350  1.00 32.99  ?  80  LEU D CB    1 
ATOM 2509  C CG    . LEU D 4 81  ? 87.260  92.301  70.723  1.00 32.99  ?  80  LEU D CG    1 
ATOM 2510  C CD1   . LEU D 4 81  ? 86.736  90.891  70.835  1.00 32.99  ?  80  LEU D CD1   1 
ATOM 2511  C CD2   . LEU D 4 81  ? 88.740  92.339  71.007  1.00 32.99  ?  80  LEU D CD2   1 
ATOM 2512  N N     . ALA D 4 82  ? 85.099  94.426  66.864  1.00 39.36  ?  81  ALA D N     1 
ATOM 2513  C CA    . ALA D 4 82  ? 84.917  95.578  66.001  1.00 39.36  ?  81  ALA D CA    1 
ATOM 2514  C C     . ALA D 4 82  ? 83.634  96.320  66.319  1.00 39.36  ?  81  ALA D C     1 
ATOM 2515  O O     . ALA D 4 82  ? 83.367  97.363  65.716  1.00 39.36  ?  81  ALA D O     1 
ATOM 2516  C CB    . ALA D 4 82  ? 84.913  95.151  64.535  1.00 39.36  ?  81  ALA D CB    1 
ATOM 2517  N N     . HIS D 4 83  ? 82.840  95.807  67.252  1.00 36.45  ?  82  HIS D N     1 
ATOM 2518  C CA    . HIS D 4 83  ? 81.549  96.382  67.583  1.00 36.45  ?  82  HIS D CA    1 
ATOM 2519  C C     . HIS D 4 83  ? 81.511  97.009  68.965  1.00 36.45  ?  82  HIS D C     1 
ATOM 2520  O O     . HIS D 4 83  ? 80.777  97.975  69.170  1.00 36.45  ?  82  HIS D O     1 
ATOM 2521  C CB    . HIS D 4 83  ? 80.466  95.304  67.482  1.00 36.45  ?  82  HIS D CB    1 
ATOM 2522  C CG    . HIS D 4 83  ? 79.073  95.825  67.597  1.00 36.45  ?  82  HIS D CG    1 
ATOM 2523  N ND1   . HIS D 4 83  ? 78.435  95.984  68.808  1.00 36.45  ?  82  HIS D ND1   1 
ATOM 2524  C CD2   . HIS D 4 83  ? 78.185  96.211  66.651  1.00 36.45  ?  82  HIS D CD2   1 
ATOM 2525  C CE1   . HIS D 4 83  ? 77.218  96.452  68.603  1.00 36.45  ?  82  HIS D CE1   1 
ATOM 2526  N NE2   . HIS D 4 83  ? 77.041  96.599  67.302  1.00 36.45  ?  82  HIS D NE2   1 
ATOM 2527  N N     . TYR D 4 84  ? 82.292  96.488  69.910  1.00 35.85  ?  83  TYR D N     1 
ATOM 2528  C CA    . TYR D 4 84  ? 82.317  97.056  71.252  1.00 35.85  ?  83  TYR D CA    1 
ATOM 2529  C C     . TYR D 4 84  ? 83.097  98.356  71.294  1.00 35.85  ?  83  TYR D C     1 
ATOM 2530  O O     . TYR D 4 84  ? 82.787  99.236  72.101  1.00 35.85  ?  83  TYR D O     1 
ATOM 2531  C CB    . TYR D 4 84  ? 82.926  96.059  72.232  1.00 35.85  ?  83  TYR D CB    1 
ATOM 2532  C CG    . TYR D 4 84  ? 82.064  94.855  72.511  1.00 35.85  ?  83  TYR D CG    1 
ATOM 2533  C CD1   . TYR D 4 84  ? 80.698  94.875  72.259  1.00 35.85  ?  83  TYR D CD1   1 
ATOM 2534  C CD2   . TYR D 4 84  ? 82.623  93.685  72.997  1.00 35.85  ?  83  TYR D CD2   1 
ATOM 2535  C CE1   . TYR D 4 84  ? 79.913  93.768  72.506  1.00 35.85  ?  83  TYR D CE1   1 
ATOM 2536  C CE2   . TYR D 4 84  ? 81.846  92.578  73.255  1.00 35.85  ?  83  TYR D CE2   1 
ATOM 2537  C CZ    . TYR D 4 84  ? 80.493  92.626  73.008  1.00 35.85  ?  83  TYR D CZ    1 
ATOM 2538  O OH    . TYR D 4 84  ? 79.718  91.519  73.256  1.00 35.85  ?  83  TYR D OH    1 
ATOM 2539  N N     . ASN D 4 85  ? 84.111  98.494  70.449  1.00 41.08  ?  84  ASN D N     1 
ATOM 2540  C CA    . ASN D 4 85  ? 84.933  99.691  70.414  1.00 41.08  ?  84  ASN D CA    1 
ATOM 2541  C C     . ASN D 4 85  ? 84.458  100.685 69.376  1.00 41.08  ?  84  ASN D C     1 
ATOM 2542  O O     . ASN D 4 85  ? 85.113  101.715 69.181  1.00 41.08  ?  84  ASN D O     1 
ATOM 2543  C CB    . ASN D 4 85  ? 86.380  99.315  70.150  1.00 41.08  ?  84  ASN D CB    1 
ATOM 2544  C CG    . ASN D 4 85  ? 86.970  98.538  71.281  1.00 41.08  ?  84  ASN D CG    1 
ATOM 2545  O OD1   . ASN D 4 85  ? 86.796  98.890  72.443  1.00 41.08  ?  84  ASN D OD1   1 
ATOM 2546  N ND2   . ASN D 4 85  ? 87.637  97.446  70.958  1.00 41.08  ?  84  ASN D ND2   1 
ATOM 2547  N N     . LYS D 4 86  ? 83.343  100.377 68.706  1.00 50.54  ?  85  LYS D N     1 
ATOM 2548  C CA    . LYS D 4 86  ? 82.680  101.230 67.719  1.00 50.54  ?  85  LYS D CA    1 
ATOM 2549  C C     . LYS D 4 86  ? 83.627  101.546 66.557  1.00 50.54  ?  85  LYS D C     1 
ATOM 2550  O O     . LYS D 4 86  ? 83.981  102.693 66.285  1.00 50.54  ?  85  LYS D O     1 
ATOM 2551  C CB    . LYS D 4 86  ? 82.122  102.494 68.385  1.00 50.54  ?  85  LYS D CB    1 
ATOM 2552  C CG    . LYS D 4 86  ? 81.069  103.232 67.592  1.00 50.54  ?  85  LYS D CG    1 
ATOM 2553  C CD    . LYS D 4 86  ? 80.633  104.468 68.349  1.00 50.54  ?  85  LYS D CD    1 
ATOM 2554  C CE    . LYS D 4 86  ? 79.817  104.090 69.572  1.00 50.54  ?  85  LYS D CE    1 
ATOM 2555  N NZ    . LYS D 4 86  ? 79.289  105.295 70.268  1.00 50.54  1  85  LYS D NZ    1 
ATOM 2556  N N     . ARG D 4 87  ? 84.063  100.481 65.900  1.00 59.49  ?  86  ARG D N     1 
ATOM 2557  C CA    . ARG D 4 87  ? 84.940  100.533 64.744  1.00 59.49  ?  86  ARG D CA    1 
ATOM 2558  C C     . ARG D 4 87  ? 84.231  99.904  63.555  1.00 59.49  ?  86  ARG D C     1 
ATOM 2559  O O     . ARG D 4 87  ? 83.059  99.538  63.624  1.00 59.49  ?  86  ARG D O     1 
ATOM 2560  C CB    . ARG D 4 87  ? 86.254  99.805  65.022  1.00 59.49  ?  86  ARG D CB    1 
ATOM 2561  C CG    . ARG D 4 87  ? 87.039  100.362 66.180  1.00 59.49  ?  86  ARG D CG    1 
ATOM 2562  C CD    . ARG D 4 87  ? 87.680  101.679 65.837  1.00 59.49  ?  86  ARG D CD    1 
ATOM 2563  N NE    . ARG D 4 87  ? 88.422  102.194 66.979  1.00 59.49  ?  86  ARG D NE    1 
ATOM 2564  C CZ    . ARG D 4 87  ? 89.675  101.861 67.260  1.00 59.49  ?  86  ARG D CZ    1 
ATOM 2565  N NH1   . ARG D 4 87  ? 90.324  101.007 66.482  1.00 59.49  1  86  ARG D NH1   1 
ATOM 2566  N NH2   . ARG D 4 87  ? 90.278  102.374 68.322  1.00 59.49  ?  86  ARG D NH2   1 
ATOM 2567  N N     . SER D 4 88  ? 84.955  99.777  62.454  1.00 63.50  ?  87  SER D N     1 
ATOM 2568  C CA    . SER D 4 88  ? 84.415  99.083  61.300  1.00 63.50  ?  87  SER D CA    1 
ATOM 2569  C C     . SER D 4 88  ? 85.435  98.220  60.576  1.00 63.50  ?  87  SER D C     1 
ATOM 2570  O O     . SER D 4 88  ? 85.091  97.633  59.547  1.00 63.50  ?  87  SER D O     1 
ATOM 2571  C CB    . SER D 4 88  ? 83.806  100.088 60.316  1.00 63.50  ?  87  SER D CB    1 
ATOM 2572  O OG    . SER D 4 88  ? 84.803  100.940 59.791  1.00 63.50  ?  87  SER D OG    1 
ATOM 2573  N N     . THR D 4 89  ? 86.661  98.108  61.074  1.00 63.57  ?  88  THR D N     1 
ATOM 2574  C CA    . THR D 4 89  ? 87.705  97.345  60.410  1.00 63.57  ?  88  THR D CA    1 
ATOM 2575  C C     . THR D 4 89  ? 88.096  96.129  61.235  1.00 63.57  ?  88  THR D C     1 
ATOM 2576  O O     . THR D 4 89  ? 87.789  96.028  62.424  1.00 63.57  ?  88  THR D O     1 
ATOM 2577  C CB    . THR D 4 89  ? 88.948  98.202  60.170  1.00 63.57  ?  88  THR D CB    1 
ATOM 2578  O OG1   . THR D 4 89  ? 89.492  98.608  61.431  1.00 63.57  ?  88  THR D OG1   1 
ATOM 2579  C CG2   . THR D 4 89  ? 88.596  99.430  59.370  1.00 63.57  ?  88  THR D CG2   1 
ATOM 2580  N N     . ILE D 4 90  ? 88.786  95.200  60.582  1.00 48.87  ?  89  ILE D N     1 
ATOM 2581  C CA    . ILE D 4 90  ? 89.421  94.067  61.242  1.00 48.87  ?  89  ILE D CA    1 
ATOM 2582  C C     . ILE D 4 90  ? 90.882  94.097  60.820  1.00 48.87  ?  89  ILE D C     1 
ATOM 2583  O O     . ILE D 4 90  ? 91.224  93.680  59.709  1.00 48.87  ?  89  ILE D O     1 
ATOM 2584  C CB    . ILE D 4 90  ? 88.770  92.730  60.886  1.00 48.87  ?  89  ILE D CB    1 
ATOM 2585  C CG1   . ILE D 4 90  ? 87.328  92.700  61.359  1.00 48.87  ?  89  ILE D CG1   1 
ATOM 2586  C CG2   . ILE D 4 90  ? 89.496  91.596  61.549  1.00 48.87  ?  89  ILE D CG2   1 
ATOM 2587  C CD1   . ILE D 4 90  ? 86.588  91.500  60.868  1.00 48.87  ?  89  ILE D CD1   1 
ATOM 2588  N N     . THR D 4 91  ? 91.739  94.614  61.682  1.00 47.77  ?  90  THR D N     1 
ATOM 2589  C CA    . THR D 4 91  ? 93.163  94.638  61.420  1.00 47.77  ?  90  THR D CA    1 
ATOM 2590  C C     . THR D 4 91  ? 93.809  93.432  62.084  1.00 47.77  ?  90  THR D C     1 
ATOM 2591  O O     . THR D 4 91  ? 93.128  92.535  62.584  1.00 47.77  ?  90  THR D O     1 
ATOM 2592  C CB    . THR D 4 91  ? 93.769  95.943  61.920  1.00 47.77  ?  90  THR D CB    1 
ATOM 2593  O OG1   . THR D 4 91  ? 93.609  96.020  63.340  1.00 47.77  ?  90  THR D OG1   1 
ATOM 2594  C CG2   . THR D 4 91  ? 93.069  97.121  61.277  1.00 47.77  ?  90  THR D CG2   1 
ATOM 2595  N N     . SER D 4 92  ? 95.141  93.406  62.100  1.00 46.82  ?  91  SER D N     1 
ATOM 2596  C CA    . SER D 4 92  ? 95.840  92.284  62.712  1.00 46.82  ?  91  SER D CA    1 
ATOM 2597  C C     . SER D 4 92  ? 95.728  92.310  64.227  1.00 46.82  ?  91  SER D C     1 
ATOM 2598  O O     . SER D 4 92  ? 95.832  91.262  64.872  1.00 46.82  ?  91  SER D O     1 
ATOM 2599  C CB    . SER D 4 92  ? 97.308  92.291  62.306  1.00 46.82  ?  91  SER D CB    1 
ATOM 2600  O OG    . SER D 4 92  ? 97.971  93.402  62.879  1.00 46.82  ?  91  SER D OG    1 
ATOM 2601  N N     . ARG D 4 93  ? 95.507  93.489  64.806  1.00 44.53  ?  92  ARG D N     1 
ATOM 2602  C CA    . ARG D 4 93  ? 95.492  93.613  66.258  1.00 44.53  ?  92  ARG D CA    1 
ATOM 2603  C C     . ARG D 4 93  ? 94.251  92.958  66.854  1.00 44.53  ?  92  ARG D C     1 
ATOM 2604  O O     . ARG D 4 93  ? 94.321  92.328  67.919  1.00 44.53  ?  92  ARG D O     1 
ATOM 2605  C CB    . ARG D 4 93  ? 95.584  95.091  66.632  1.00 44.53  ?  92  ARG D CB    1 
ATOM 2606  C CG    . ARG D 4 93  ? 95.789  95.384  68.098  1.00 44.53  ?  92  ARG D CG    1 
ATOM 2607  C CD    . ARG D 4 93  ? 96.055  96.869  68.280  1.00 44.53  ?  92  ARG D CD    1 
ATOM 2608  N NE    . ARG D 4 93  ? 96.344  97.226  69.664  1.00 44.53  ?  92  ARG D NE    1 
ATOM 2609  C CZ    . ARG D 4 93  ? 95.429  97.634  70.536  1.00 44.53  ?  92  ARG D CZ    1 
ATOM 2610  N NH1   . ARG D 4 93  ? 94.161  97.743  70.168  1.00 44.53  1  92  ARG D NH1   1 
ATOM 2611  N NH2   . ARG D 4 93  ? 95.786  97.939  71.776  1.00 44.53  ?  92  ARG D NH2   1 
ATOM 2612  N N     . GLU D 4 94  ? 93.119  93.048  66.153  1.00 45.44  ?  93  GLU D N     1 
ATOM 2613  C CA    . GLU D 4 94  ? 91.896  92.425  66.643  1.00 45.44  ?  93  GLU D CA    1 
ATOM 2614  C C     . GLU D 4 94  ? 91.976  90.908  66.558  1.00 45.44  ?  93  GLU D C     1 
ATOM 2615  O O     . GLU D 4 94  ? 91.512  90.207  67.465  1.00 45.44  ?  93  GLU D O     1 
ATOM 2616  C CB    . GLU D 4 94  ? 90.700  92.945  65.858  1.00 45.44  ?  93  GLU D CB    1 
ATOM 2617  C CG    . GLU D 4 94  ? 90.455  94.417  66.070  1.00 45.44  ?  93  GLU D CG    1 
ATOM 2618  C CD    . GLU D 4 94  ? 89.271  94.926  65.288  1.00 45.44  ?  93  GLU D CD    1 
ATOM 2619  O OE1   . GLU D 4 94  ? 88.719  94.148  64.485  1.00 45.44  ?  93  GLU D OE1   1 
ATOM 2620  O OE2   . GLU D 4 94  ? 88.892  96.101  65.474  1.00 45.44  -1 93  GLU D OE2   1 
ATOM 2621  N N     . ILE D 4 95  ? 92.586  90.385  65.491  1.00 36.93  ?  94  ILE D N     1 
ATOM 2622  C CA    . ILE D 4 95  ? 92.795  88.946  65.386  1.00 36.93  ?  94  ILE D CA    1 
ATOM 2623  C C     . ILE D 4 95  ? 93.783  88.479  66.443  1.00 36.93  ?  94  ILE D C     1 
ATOM 2624  O O     . ILE D 4 95  ? 93.633  87.384  66.999  1.00 36.93  ?  94  ILE D O     1 
ATOM 2625  C CB    . ILE D 4 95  ? 93.261  88.579  63.969  1.00 36.93  ?  94  ILE D CB    1 
ATOM 2626  C CG1   . ILE D 4 95  ? 92.269  89.096  62.941  1.00 36.93  ?  94  ILE D CG1   1 
ATOM 2627  C CG2   . ILE D 4 95  ? 93.351  87.083  63.801  1.00 36.93  ?  94  ILE D CG2   1 
ATOM 2628  C CD1   . ILE D 4 95  ? 90.911  88.481  63.067  1.00 36.93  ?  94  ILE D CD1   1 
ATOM 2629  N N     . GLN D 4 96  ? 94.775  89.314  66.770  1.00 38.44  ?  95  GLN D N     1 
ATOM 2630  C CA    . GLN D 4 96  ? 95.720  88.983  67.832  1.00 38.44  ?  95  GLN D CA    1 
ATOM 2631  C C     . GLN D 4 96  ? 95.028  88.867  69.183  1.00 38.44  ?  95  GLN D C     1 
ATOM 2632  O O     . GLN D 4 96  ? 95.268  87.911  69.930  1.00 38.44  ?  95  GLN D O     1 
ATOM 2633  C CB    . GLN D 4 96  ? 96.823  90.032  67.894  1.00 38.44  ?  95  GLN D CB    1 
ATOM 2634  C CG    . GLN D 4 96  ? 97.839  89.769  68.970  1.00 38.44  ?  95  GLN D CG    1 
ATOM 2635  C CD    . GLN D 4 96  ? 98.944  90.791  68.974  1.00 38.44  ?  95  GLN D CD    1 
ATOM 2636  O OE1   . GLN D 4 96  ? 98.965  91.698  68.148  1.00 38.44  ?  95  GLN D OE1   1 
ATOM 2637  N NE2   . GLN D 4 96  ? 99.860  90.666  69.922  1.00 38.44  ?  95  GLN D NE2   1 
ATOM 2638  N N     . THR D 4 97  ? 94.137  89.807  69.498  1.00 35.17  ?  96  THR D N     1 
ATOM 2639  C CA    . THR D 4 97  ? 93.403  89.708  70.756  1.00 35.17  ?  96  THR D CA    1 
ATOM 2640  C C     . THR D 4 97  ? 92.410  88.553  70.753  1.00 35.17  ?  96  THR D C     1 
ATOM 2641  O O     . THR D 4 97  ? 92.181  87.935  71.801  1.00 35.17  ?  96  THR D O     1 
ATOM 2642  C CB    . THR D 4 97  ? 92.679  91.009  71.058  1.00 35.17  ?  96  THR D CB    1 
ATOM 2643  O OG1   . THR D 4 97  ? 91.775  91.306  69.990  1.00 35.17  ?  96  THR D OG1   1 
ATOM 2644  C CG2   . THR D 4 97  ? 93.679  92.133  71.217  1.00 35.17  ?  96  THR D CG2   1 
ATOM 2645  N N     . ALA D 4 98  ? 91.829  88.229  69.595  1.00 34.22  ?  97  ALA D N     1 
ATOM 2646  C CA    . ALA D 4 98  ? 90.936  87.076  69.532  1.00 34.22  ?  97  ALA D CA    1 
ATOM 2647  C C     . ALA D 4 98  ? 91.688  85.770  69.739  1.00 34.22  ?  97  ALA D C     1 
ATOM 2648  O O     . ALA D 4 98  ? 91.142  84.831  70.323  1.00 34.22  ?  97  ALA D O     1 
ATOM 2649  C CB    . ALA D 4 98  ? 90.193  87.052  68.202  1.00 34.22  ?  97  ALA D CB    1 
ATOM 2650  N N     . VAL D 4 99  ? 92.938  85.697  69.287  1.00 35.39  ?  98  VAL D N     1 
ATOM 2651  C CA    . VAL D 4 99  ? 93.749  84.515  69.558  1.00 35.39  ?  98  VAL D CA    1 
ATOM 2652  C C     . VAL D 4 99  ? 94.166  84.479  71.024  1.00 35.39  ?  98  VAL D C     1 
ATOM 2653  O O     . VAL D 4 99  ? 94.214  83.406  71.640  1.00 35.39  ?  98  VAL D O     1 
ATOM 2654  C CB    . VAL D 4 99  ? 94.947  84.475  68.592  1.00 35.39  ?  98  VAL D CB    1 
ATOM 2655  C CG1   . VAL D 4 99  ? 95.940  83.402  68.960  1.00 35.39  ?  98  VAL D CG1   1 
ATOM 2656  C CG2   . VAL D 4 99  ? 94.453  84.203  67.197  1.00 35.39  ?  98  VAL D CG2   1 
ATOM 2657  N N     . ARG D 4 100 ? 94.425  85.650  71.622  1.00 38.93  ?  99  ARG D N     1 
ATOM 2658  C CA    . ARG D 4 100 ? 94.701  85.707  73.060  1.00 38.93  ?  99  ARG D CA    1 
ATOM 2659  C C     . ARG D 4 100 ? 93.508  85.251  73.892  1.00 38.93  ?  99  ARG D C     1 
ATOM 2660  O O     . ARG D 4 100 ? 93.688  84.730  74.996  1.00 38.93  ?  99  ARG D O     1 
ATOM 2661  C CB    . ARG D 4 100 ? 95.093  87.121  73.489  1.00 38.93  ?  99  ARG D CB    1 
ATOM 2662  C CG    . ARG D 4 100 ? 96.411  87.632  72.958  1.00 38.93  ?  99  ARG D CG    1 
ATOM 2663  C CD    . ARG D 4 100 ? 97.587  86.926  73.586  1.00 38.93  ?  99  ARG D CD    1 
ATOM 2664  N NE    . ARG D 4 100 ? 97.691  87.198  75.013  1.00 38.93  ?  99  ARG D NE    1 
ATOM 2665  C CZ    . ARG D 4 100 ? 98.453  86.499  75.847  1.00 38.93  ?  99  ARG D CZ    1 
ATOM 2666  N NH1   . ARG D 4 100 ? 99.184  85.491  75.393  1.00 38.93  1  99  ARG D NH1   1 
ATOM 2667  N NH2   . ARG D 4 100 ? 98.491  86.809  77.135  1.00 38.93  ?  99  ARG D NH2   1 
ATOM 2668  N N     . LEU D 4 101 ? 92.292  85.440  73.387  1.00 33.04  ?  100 LEU D N     1 
ATOM 2669  C CA    . LEU D 4 101 ? 91.120  84.982  74.126  1.00 33.04  ?  100 LEU D CA    1 
ATOM 2670  C C     . LEU D 4 101 ? 90.779  83.517  73.867  1.00 33.04  ?  100 LEU D C     1 
ATOM 2671  O O     . LEU D 4 101 ? 90.566  82.756  74.814  1.00 33.04  ?  100 LEU D O     1 
ATOM 2672  C CB    . LEU D 4 101 ? 89.910  85.850  73.793  1.00 33.04  ?  100 LEU D CB    1 
ATOM 2673  C CG    . LEU D 4 101 ? 89.993  87.268  74.326  1.00 33.04  ?  100 LEU D CG    1 
ATOM 2674  C CD1   . LEU D 4 101 ? 88.790  88.062  73.879  1.00 33.04  ?  100 LEU D CD1   1 
ATOM 2675  C CD2   . LEU D 4 101 ? 90.084  87.231  75.829  1.00 33.04  ?  100 LEU D CD2   1 
ATOM 2676  N N     . LEU D 4 102 ? 90.711  83.106  72.603  1.00 36.99  ?  101 LEU D N     1 
ATOM 2677  C CA    . LEU D 4 102 ? 90.147  81.808  72.245  1.00 36.99  ?  101 LEU D CA    1 
ATOM 2678  C C     . LEU D 4 102 ? 91.075  80.628  72.474  1.00 36.99  ?  101 LEU D C     1 
ATOM 2679  O O     . LEU D 4 102 ? 90.685  79.503  72.155  1.00 36.99  ?  101 LEU D O     1 
ATOM 2680  C CB    . LEU D 4 102 ? 89.704  81.798  70.783  1.00 36.99  ?  101 LEU D CB    1 
ATOM 2681  C CG    . LEU D 4 102 ? 88.221  82.026  70.504  1.00 36.99  ?  101 LEU D CG    1 
ATOM 2682  C CD1   . LEU D 4 102 ? 87.451  80.846  71.054  1.00 36.99  ?  101 LEU D CD1   1 
ATOM 2683  C CD2   . LEU D 4 102 ? 87.702  83.316  71.107  1.00 36.99  ?  101 LEU D CD2   1 
ATOM 2684  N N     . LEU D 4 103 ? 92.275  80.828  72.996  1.00 42.48  ?  102 LEU D N     1 
ATOM 2685  C CA    . LEU D 4 103 ? 93.173  79.702  73.176  1.00 42.48  ?  102 LEU D CA    1 
ATOM 2686  C C     . LEU D 4 103 ? 93.689  79.664  74.604  1.00 42.48  ?  102 LEU D C     1 
ATOM 2687  O O     . LEU D 4 103 ? 93.859  80.711  75.232  1.00 42.48  ?  102 LEU D O     1 
ATOM 2688  C CB    . LEU D 4 103 ? 94.359  79.782  72.206  1.00 42.48  ?  102 LEU D CB    1 
ATOM 2689  C CG    . LEU D 4 103 ? 94.011  79.688  70.724  1.00 42.48  ?  102 LEU D CG    1 
ATOM 2690  C CD1   . LEU D 4 103 ? 95.251  79.841  69.870  1.00 42.48  ?  102 LEU D CD1   1 
ATOM 2691  C CD2   . LEU D 4 103 ? 93.314  78.383  70.427  1.00 42.48  ?  102 LEU D CD2   1 
ATOM 2692  N N     . PRO D 4 104 ? 93.944  78.475  75.145  1.00 54.31  ?  103 PRO D N     1 
ATOM 2693  C CA    . PRO D 4 104 ? 94.618  78.387  76.443  1.00 54.31  ?  103 PRO D CA    1 
ATOM 2694  C C     . PRO D 4 104 ? 96.079  78.794  76.324  1.00 54.31  ?  103 PRO D C     1 
ATOM 2695  O O     . PRO D 4 104 ? 96.630  78.913  75.230  1.00 54.31  ?  103 PRO D O     1 
ATOM 2696  C CB    . PRO D 4 104 ? 94.473  76.913  76.819  1.00 54.31  ?  103 PRO D CB    1 
ATOM 2697  C CG    . PRO D 4 104 ? 94.341  76.219  75.524  1.00 54.31  ?  103 PRO D CG    1 
ATOM 2698  C CD    . PRO D 4 104 ? 93.581  77.148  74.630  1.00 54.31  ?  103 PRO D CD    1 
ATOM 2699  N N     . GLY D 4 105 ? 96.711  78.955  77.488  1.00 54.82  ?  104 GLY D N     1 
ATOM 2700  C CA    . GLY D 4 105 ? 97.950  79.698  77.672  1.00 54.82  ?  104 GLY D CA    1 
ATOM 2701  C C     . GLY D 4 105 ? 99.138  79.467  76.757  1.00 54.82  ?  104 GLY D C     1 
ATOM 2702  O O     . GLY D 4 105 ? 99.485  80.357  75.972  1.00 54.82  ?  104 GLY D O     1 
ATOM 2703  N N     . GLU D 4 106 ? 99.759  78.287  76.837  1.00 57.79  ?  105 GLU D N     1 
ATOM 2704  C CA    . GLU D 4 106 ? 101.007 78.052  76.114  1.00 57.79  ?  105 GLU D CA    1 
ATOM 2705  C C     . GLU D 4 106 ? 100.778 77.991  74.610  1.00 57.79  ?  105 GLU D C     1 
ATOM 2706  O O     . GLU D 4 106 ? 101.599 78.490  73.824  1.00 57.79  ?  105 GLU D O     1 
ATOM 2707  C CB    . GLU D 4 106 ? 101.663 76.763  76.613  1.00 57.79  ?  105 GLU D CB    1 
ATOM 2708  C CG    . GLU D 4 106 ? 102.974 76.414  75.926  1.00 57.79  ?  105 GLU D CG    1 
ATOM 2709  C CD    . GLU D 4 106 ? 104.077 77.415  76.208  1.00 57.79  ?  105 GLU D CD    1 
ATOM 2710  O OE1   . GLU D 4 106 ? 104.074 78.025  77.299  1.00 57.79  ?  105 GLU D OE1   1 
ATOM 2711  O OE2   . GLU D 4 106 ? 104.945 77.601  75.331  1.00 57.79  -1 105 GLU D OE2   1 
ATOM 2712  N N     . LEU D 4 107 ? 99.651  77.410  74.202  1.00 52.34  ?  106 LEU D N     1 
ATOM 2713  C CA    . LEU D 4 107 ? 99.308  77.349  72.789  1.00 52.34  ?  106 LEU D CA    1 
ATOM 2714  C C     . LEU D 4 107 ? 99.046  78.742  72.235  1.00 52.34  ?  106 LEU D C     1 
ATOM 2715  O O     . LEU D 4 107 ? 99.452  79.056  71.108  1.00 52.34  ?  106 LEU D O     1 
ATOM 2716  C CB    . LEU D 4 107 ? 98.095  76.443  72.612  1.00 52.34  ?  106 LEU D CB    1 
ATOM 2717  C CG    . LEU D 4 107 ? 97.689  76.034  71.208  1.00 52.34  ?  106 LEU D CG    1 
ATOM 2718  C CD1   . LEU D 4 107 ? 98.809  75.240  70.598  1.00 52.34  ?  106 LEU D CD1   1 
ATOM 2719  C CD2   . LEU D 4 107 ? 96.435  75.196  71.287  1.00 52.34  ?  106 LEU D CD2   1 
ATOM 2720  N N     . ALA D 4 108 ? 98.430  79.610  73.043  1.00 52.50  ?  107 ALA D N     1 
ATOM 2721  C CA    . ALA D 4 108 ? 98.205  80.989  72.626  1.00 52.50  ?  107 ALA D CA    1 
ATOM 2722  C C     . ALA D 4 108 ? 99.511  81.760  72.529  1.00 52.50  ?  107 ALA D C     1 
ATOM 2723  O O     . ALA D 4 108 ? 99.675  82.588  71.627  1.00 52.50  ?  107 ALA D O     1 
ATOM 2724  C CB    . ALA D 4 108 ? 97.257  81.689  73.594  1.00 52.50  ?  107 ALA D CB    1 
ATOM 2725  N N     . LYS D 4 109 ? 100.447 81.499  73.448  1.00 56.79  ?  108 LYS D N     1 
ATOM 2726  C CA    . LYS D 4 109 ? 101.745 82.169  73.403  1.00 56.79  ?  108 LYS D CA    1 
ATOM 2727  C C     . LYS D 4 109 ? 102.528 81.773  72.161  1.00 56.79  ?  108 LYS D C     1 
ATOM 2728  O O     . LYS D 4 109 ? 103.110 82.633  71.486  1.00 56.79  ?  108 LYS D O     1 
ATOM 2729  C CB    . LYS D 4 109 ? 102.552 81.846  74.658  1.00 56.79  ?  108 LYS D CB    1 
ATOM 2730  C CG    . LYS D 4 109 ? 102.009 82.469  75.925  1.00 56.79  ?  108 LYS D CG    1 
ATOM 2731  C CD    . LYS D 4 109 ? 102.860 82.095  77.122  1.00 56.79  ?  108 LYS D CD    1 
ATOM 2732  C CE    . LYS D 4 109 ? 102.292 82.681  78.400  1.00 56.79  ?  108 LYS D CE    1 
ATOM 2733  N NZ    . LYS D 4 109 ? 103.109 82.315  79.587  1.00 56.79  1  108 LYS D NZ    1 
ATOM 2734  N N     . HIS D 4 110 ? 102.523 80.481  71.823  1.00 55.09  ?  109 HIS D N     1 
ATOM 2735  C CA    . HIS D 4 110 ? 103.203 80.041  70.609  1.00 55.09  ?  109 HIS D CA    1 
ATOM 2736  C C     . HIS D 4 110 ? 102.524 80.585  69.357  1.00 55.09  ?  109 HIS D C     1 
ATOM 2737  O O     . HIS D 4 110 ? 103.204 80.970  68.397  1.00 55.09  ?  109 HIS D O     1 
ATOM 2738  C CB    . HIS D 4 110 ? 103.264 78.519  70.554  1.00 55.09  ?  109 HIS D CB    1 
ATOM 2739  C CG    . HIS D 4 110 ? 104.173 77.913  71.574  1.00 55.09  ?  109 HIS D CG    1 
ATOM 2740  N ND1   . HIS D 4 110 ? 104.271 76.553  71.764  1.00 55.09  ?  109 HIS D ND1   1 
ATOM 2741  C CD2   . HIS D 4 110 ? 105.017 78.481  72.467  1.00 55.09  ?  109 HIS D CD2   1 
ATOM 2742  C CE1   . HIS D 4 110 ? 105.143 76.307  72.725  1.00 55.09  ?  109 HIS D CE1   1 
ATOM 2743  N NE2   . HIS D 4 110 ? 105.608 77.460  73.169  1.00 55.09  ?  109 HIS D NE2   1 
ATOM 2744  N N     . ALA D 4 111 ? 101.190 80.668  69.365  1.00 49.15  ?  110 ALA D N     1 
ATOM 2745  C CA    . ALA D 4 111 ? 100.477 81.163  68.192  1.00 49.15  ?  110 ALA D CA    1 
ATOM 2746  C C     . ALA D 4 111 ? 100.715 82.651  67.971  1.00 49.15  ?  110 ALA D C     1 
ATOM 2747  O O     . ALA D 4 111 ? 100.932 83.085  66.833  1.00 49.15  ?  110 ALA D O     1 
ATOM 2748  C CB    . ALA D 4 111 ? 98.986  80.875  68.329  1.00 49.15  ?  110 ALA D CB    1 
ATOM 2749  N N     . VAL D 4 112 ? 100.693 83.448  69.043  1.00 50.22  ?  111 VAL D N     1 
ATOM 2750  C CA    . VAL D 4 112 ? 100.939 84.875  68.880  1.00 50.22  ?  111 VAL D CA    1 
ATOM 2751  C C     . VAL D 4 112 ? 102.411 85.129  68.567  1.00 50.22  ?  111 VAL D C     1 
ATOM 2752  O O     . VAL D 4 112 ? 102.745 86.108  67.890  1.00 50.22  ?  111 VAL D O     1 
ATOM 2753  C CB    . VAL D 4 112 ? 100.451 85.659  70.120  1.00 50.22  ?  111 VAL D CB    1 
ATOM 2754  C CG1   . VAL D 4 112 ? 101.317 85.410  71.344  1.00 50.22  ?  111 VAL D CG1   1 
ATOM 2755  C CG2   . VAL D 4 112 ? 100.360 87.147  69.834  1.00 50.22  ?  111 VAL D CG2   1 
ATOM 2756  N N     . SER D 4 113 ? 103.311 84.235  68.993  1.00 51.21  ?  112 SER D N     1 
ATOM 2757  C CA    . SER D 4 113 ? 104.709 84.398  68.620  1.00 51.21  ?  112 SER D CA    1 
ATOM 2758  C C     . SER D 4 113 ? 104.954 84.024  67.167  1.00 51.21  ?  112 SER D C     1 
ATOM 2759  O O     . SER D 4 113 ? 105.867 84.568  66.539  1.00 51.21  ?  112 SER D O     1 
ATOM 2760  C CB    . SER D 4 113 ? 105.598 83.559  69.536  1.00 51.21  ?  112 SER D CB    1 
ATOM 2761  O OG    . SER D 4 113 ? 106.958 83.677  69.164  1.00 51.21  ?  112 SER D OG    1 
ATOM 2762  N N     . GLU D 4 114 ? 104.154 83.117  66.617  1.00 51.15  ?  113 GLU D N     1 
ATOM 2763  C CA    . GLU D 4 114 ? 104.342 82.703  65.234  1.00 51.15  ?  113 GLU D CA    1 
ATOM 2764  C C     . GLU D 4 114 ? 103.656 83.639  64.246  1.00 51.15  ?  113 GLU D C     1 
ATOM 2765  O O     . GLU D 4 114 ? 104.162 83.841  63.130  1.00 51.15  ?  113 GLU D O     1 
ATOM 2766  C CB    . GLU D 4 114 ? 103.827 81.271  65.064  1.00 51.15  ?  113 GLU D CB    1 
ATOM 2767  C CG    . GLU D 4 114 ? 104.301 80.534  63.823  1.00 51.15  ?  113 GLU D CG    1 
ATOM 2768  C CD    . GLU D 4 114 ? 103.429 80.789  62.621  1.00 51.15  ?  113 GLU D CD    1 
ATOM 2769  O OE1   . GLU D 4 114 ? 102.244 81.127  62.817  1.00 51.15  ?  113 GLU D OE1   1 
ATOM 2770  O OE2   . GLU D 4 114 ? 103.922 80.642  61.484  1.00 51.15  -1 113 GLU D OE2   1 
ATOM 2771  N N     . GLY D 4 115 ? 102.524 84.227  64.633  1.00 46.92  ?  114 GLY D N     1 
ATOM 2772  C CA    . GLY D 4 115 ? 101.763 85.028  63.688  1.00 46.92  ?  114 GLY D CA    1 
ATOM 2773  C C     . GLY D 4 115 ? 102.442 86.331  63.309  1.00 46.92  ?  114 GLY D C     1 
ATOM 2774  O O     . GLY D 4 115 ? 102.474 86.701  62.132  1.00 46.92  ?  114 GLY D O     1 
ATOM 2775  N N     . THR D 4 116 ? 103.001 87.040  64.292  1.00 50.21  ?  115 THR D N     1 
ATOM 2776  C CA    . THR D 4 116 ? 103.724 88.269  63.986  1.00 50.21  ?  115 THR D CA    1 
ATOM 2777  C C     . THR D 4 116 ? 105.009 87.972  63.229  1.00 50.21  ?  115 THR D C     1 
ATOM 2778  O O     . THR D 4 116 ? 105.463 88.789  62.421  1.00 50.21  ?  115 THR D O     1 
ATOM 2779  C CB    . THR D 4 116 ? 104.034 89.035  65.267  1.00 50.21  ?  115 THR D CB    1 
ATOM 2780  O OG1   . THR D 4 116 ? 104.873 88.235  66.107  1.00 50.21  ?  115 THR D OG1   1 
ATOM 2781  C CG2   . THR D 4 116 ? 102.756 89.372  66.007  1.00 50.21  ?  115 THR D CG2   1 
ATOM 2782  N N     . LYS D 4 117 ? 105.595 86.797  63.470  1.00 49.07  ?  116 LYS D N     1 
ATOM 2783  C CA    . LYS D 4 117 ? 106.729 86.339  62.677  1.00 49.07  ?  116 LYS D CA    1 
ATOM 2784  C C     . LYS D 4 117 ? 106.336 86.129  61.222  1.00 49.07  ?  116 LYS D C     1 
ATOM 2785  O O     . LYS D 4 117 ? 107.151 86.354  60.321  1.00 49.07  ?  116 LYS D O     1 
ATOM 2786  C CB    . LYS D 4 117 ? 107.291 85.059  63.301  1.00 49.07  ?  116 LYS D CB    1 
ATOM 2787  C CG    . LYS D 4 117 ? 108.584 84.527  62.709  1.00 49.07  ?  116 LYS D CG    1 
ATOM 2788  C CD    . LYS D 4 117 ? 108.339 83.359  61.768  1.00 49.07  ?  116 LYS D CD    1 
ATOM 2789  C CE    . LYS D 4 117 ? 109.646 82.772  61.279  1.00 49.07  ?  116 LYS D CE    1 
ATOM 2790  N NZ    . LYS D 4 117 ? 109.426 81.644  60.337  1.00 49.07  1  116 LYS D NZ    1 
ATOM 2791  N N     . ALA D 4 118 ? 105.097 85.707  60.973  1.00 48.89  ?  117 ALA D N     1 
ATOM 2792  C CA    . ALA D 4 118 ? 104.617 85.634  59.594  1.00 48.89  ?  117 ALA D CA    1 
ATOM 2793  C C     . ALA D 4 118 ? 104.357 87.022  59.012  1.00 48.89  ?  117 ALA D C     1 
ATOM 2794  O O     . ALA D 4 118 ? 104.681 87.288  57.847  1.00 48.89  ?  117 ALA D O     1 
ATOM 2795  C CB    . ALA D 4 118 ? 103.353 84.784  59.519  1.00 48.89  ?  117 ALA D CB    1 
ATOM 2796  N N     . VAL D 4 119 ? 103.773 87.917  59.811  1.00 48.52  ?  118 VAL D N     1 
ATOM 2797  C CA    . VAL D 4 119 ? 103.403 89.248  59.325  1.00 48.52  ?  118 VAL D CA    1 
ATOM 2798  C C     . VAL D 4 119 ? 104.625 90.100  58.981  1.00 48.52  ?  118 VAL D C     1 
ATOM 2799  O O     . VAL D 4 119 ? 104.622 90.794  57.954  1.00 48.52  ?  118 VAL D O     1 
ATOM 2800  C CB    . VAL D 4 119 ? 102.502 89.947  60.360  1.00 48.52  ?  118 VAL D CB    1 
ATOM 2801  C CG1   . VAL D 4 119 ? 102.230 91.395  59.991  1.00 48.52  ?  118 VAL D CG1   1 
ATOM 2802  C CG2   . VAL D 4 119 ? 101.189 89.220  60.466  1.00 48.52  ?  118 VAL D CG2   1 
ATOM 2803  N N     . THR D 4 120 ? 105.685 90.034  59.794  1.00 51.79  ?  119 THR D N     1 
ATOM 2804  C CA    . THR D 4 120 ? 106.870 90.859  59.558  1.00 51.79  ?  119 THR D CA    1 
ATOM 2805  C C     . THR D 4 120 ? 107.591 90.479  58.271  1.00 51.79  ?  119 THR D C     1 
ATOM 2806  O O     . THR D 4 120 ? 108.160 91.345  57.598  1.00 51.79  ?  119 THR D O     1 
ATOM 2807  C CB    . THR D 4 120 ? 107.826 90.767  60.746  1.00 51.79  ?  119 THR D CB    1 
ATOM 2808  O OG1   . THR D 4 120 ? 108.083 89.391  61.052  1.00 51.79  ?  119 THR D OG1   1 
ATOM 2809  C CG2   . THR D 4 120 ? 107.260 91.489  61.957  1.00 51.79  ?  119 THR D CG2   1 
ATOM 2810  N N     . LYS D 4 121 ? 107.566 89.204  57.899  1.00 53.04  ?  120 LYS D N     1 
ATOM 2811  C CA    . LYS D 4 121 ? 108.152 88.821  56.618  1.00 53.04  ?  120 LYS D CA    1 
ATOM 2812  C C     . LYS D 4 121 ? 107.131 88.922  55.496  1.00 53.04  ?  120 LYS D C     1 
ATOM 2813  O O     . LYS D 4 121 ? 107.473 88.740  54.327  1.00 53.04  ?  120 LYS D O     1 
ATOM 2814  C CB    . LYS D 4 121 ? 108.744 87.421  56.697  1.00 53.04  ?  120 LYS D CB    1 
ATOM 2815  C CG    . LYS D 4 121 ? 107.727 86.319  56.814  1.00 53.04  ?  120 LYS D CG    1 
ATOM 2816  C CD    . LYS D 4 121 ? 108.426 84.992  57.017  1.00 53.04  ?  120 LYS D CD    1 
ATOM 2817  C CE    . LYS D 4 121 ? 109.156 84.574  55.760  1.00 53.04  ?  120 LYS D CE    1 
ATOM 2818  N NZ    . LYS D 4 121 ? 109.777 83.233  55.910  1.00 53.04  1  120 LYS D NZ    1 
ATOM 2819  N N     . TYR D 4 122 ? 105.870 89.199  55.829  1.00 52.81  ?  121 TYR D N     1 
ATOM 2820  C CA    . TYR D 4 122 ? 104.932 89.611  54.791  1.00 52.81  ?  121 TYR D CA    1 
ATOM 2821  C C     . TYR D 4 122 ? 105.053 91.087  54.438  1.00 52.81  ?  121 TYR D C     1 
ATOM 2822  O O     . TYR D 4 122 ? 104.828 91.451  53.279  1.00 52.81  ?  121 TYR D O     1 
ATOM 2823  C CB    . TYR D 4 122 ? 103.492 89.303  55.215  1.00 52.81  ?  121 TYR D CB    1 
ATOM 2824  C CG    . TYR D 4 122 ? 102.446 89.805  54.246  1.00 52.81  ?  121 TYR D CG    1 
ATOM 2825  C CD1   . TYR D 4 122 ? 102.222 89.164  53.039  1.00 52.81  ?  121 TYR D CD1   1 
ATOM 2826  C CD2   . TYR D 4 122 ? 101.688 90.933  54.540  1.00 52.81  ?  121 TYR D CD2   1 
ATOM 2827  C CE1   . TYR D 4 122 ? 101.269 89.627  52.156  1.00 52.81  ?  121 TYR D CE1   1 
ATOM 2828  C CE2   . TYR D 4 122 ? 100.745 91.402  53.664  1.00 52.81  ?  121 TYR D CE2   1 
ATOM 2829  C CZ    . TYR D 4 122 ? 100.537 90.745  52.476  1.00 52.81  ?  121 TYR D CZ    1 
ATOM 2830  O OH    . TYR D 4 122 ? 99.588  91.232  51.615  1.00 52.81  ?  121 TYR D OH    1 
ATOM 2831  N N     . THR D 4 123 ? 105.408 91.945  55.398  1.00 60.01  ?  122 THR D N     1 
ATOM 2832  C CA    . THR D 4 123 ? 105.390 93.386  55.161  1.00 60.01  ?  122 THR D CA    1 
ATOM 2833  C C     . THR D 4 123 ? 106.507 93.811  54.216  1.00 60.01  ?  122 THR D C     1 
ATOM 2834  O O     . THR D 4 123 ? 106.259 94.500  53.220  1.00 60.01  ?  122 THR D O     1 
ATOM 2835  C CB    . THR D 4 123 ? 105.500 94.133  56.488  1.00 60.01  ?  122 THR D CB    1 
ATOM 2836  O OG1   . THR D 4 123 ? 104.411 93.754  57.337  1.00 60.01  ?  122 THR D OG1   1 
ATOM 2837  C CG2   . THR D 4 123 ? 105.454 95.634  56.257  1.00 60.01  ?  122 THR D CG2   1 
ATOM 2838  N N     . SER D 4 124 ? 107.741 93.407  54.503  1.00 63.55  ?  123 SER D N     1 
ATOM 2839  C CA    . SER D 4 124 ? 108.864 93.651  53.598  1.00 63.55  ?  123 SER D CA    1 
ATOM 2840  C C     . SER D 4 124 ? 108.835 92.632  52.464  1.00 63.55  ?  123 SER D C     1 
ATOM 2841  O O     . SER D 4 124 ? 109.627 91.689  52.411  1.00 63.55  ?  123 SER D O     1 
ATOM 2842  C CB    . SER D 4 124 ? 110.185 93.598  54.354  1.00 63.55  ?  123 SER D CB    1 
ATOM 2843  O OG    . SER D 4 124 ? 110.454 92.286  54.814  1.00 63.55  ?  123 SER D OG    1 
ATOM 2844  N N     . SER D 4 125 ? 107.895 92.831  51.545  1.00 63.72  ?  124 SER D N     1 
ATOM 2845  C CA    . SER D 4 125 ? 107.648 91.894  50.459  1.00 63.72  ?  124 SER D CA    1 
ATOM 2846  C C     . SER D 4 125 ? 108.777 91.897  49.437  1.00 63.72  ?  124 SER D C     1 
ATOM 2847  O O     . SER D 4 125 ? 109.474 90.897  49.271  1.00 63.72  ?  124 SER D O     1 
ATOM 2848  C CB    . SER D 4 125 ? 106.325 92.224  49.772  1.00 63.72  ?  124 SER D CB    1 
ATOM 2849  O OG    . SER D 4 125 ? 106.391 93.482  49.126  1.00 63.72  ?  124 SER D OG    1 
ATOM 2850  N N     . GLN E 1 45  ? 85.527  36.662  86.411  1.00 87.04  ?  45  GLN E N     1 
ATOM 2851  C CA    . GLN E 1 45  ? 85.960  37.889  85.754  1.00 87.04  ?  45  GLN E CA    1 
ATOM 2852  C C     . GLN E 1 45  ? 85.084  38.203  84.549  1.00 87.04  ?  45  GLN E C     1 
ATOM 2853  O O     . GLN E 1 45  ? 83.898  38.488  84.696  1.00 87.04  ?  45  GLN E O     1 
ATOM 2854  C CB    . GLN E 1 45  ? 87.424  37.781  85.333  1.00 87.04  ?  45  GLN E CB    1 
ATOM 2855  C CG    . GLN E 1 45  ? 88.378  37.702  86.500  1.00 87.04  ?  45  GLN E CG    1 
ATOM 2856  C CD    . GLN E 1 45  ? 88.316  38.938  87.371  1.00 87.04  ?  45  GLN E CD    1 
ATOM 2857  O OE1   . GLN E 1 45  ? 87.824  38.895  88.497  1.00 87.04  ?  45  GLN E OE1   1 
ATOM 2858  N NE2   . GLN E 1 45  ? 88.812  40.052  86.849  1.00 87.04  ?  45  GLN E NE2   1 
ATOM 2859  N N     . GLY E 1 46  ? 85.670  38.157  83.362  1.00 83.47  ?  46  GLY E N     1 
ATOM 2860  C CA    . GLY E 1 46  ? 84.922  38.446  82.141  1.00 83.47  ?  46  GLY E CA    1 
ATOM 2861  C C     . GLY E 1 46  ? 84.744  39.907  81.802  1.00 83.47  ?  46  GLY E C     1 
ATOM 2862  O O     . GLY E 1 46  ? 85.044  40.320  80.679  1.00 83.47  ?  46  GLY E O     1 
ATOM 2863  N N     . TRP E 1 47  ? 84.254  40.704  82.755  1.00 74.56  ?  47  TRP E N     1 
ATOM 2864  C CA    . TRP E 1 47  ? 84.052  42.129  82.526  1.00 74.56  ?  47  TRP E CA    1 
ATOM 2865  C C     . TRP E 1 47  ? 85.371  42.866  82.345  1.00 74.56  ?  47  TRP E C     1 
ATOM 2866  O O     . TRP E 1 47  ? 85.425  43.866  81.618  1.00 74.56  ?  47  TRP E O     1 
ATOM 2867  C CB    . TRP E 1 47  ? 83.269  42.726  83.691  1.00 74.56  ?  47  TRP E CB    1 
ATOM 2868  C CG    . TRP E 1 47  ? 83.977  42.583  84.993  1.00 74.56  ?  47  TRP E CG    1 
ATOM 2869  C CD1   . TRP E 1 47  ? 83.918  41.523  85.844  1.00 74.56  ?  47  TRP E CD1   1 
ATOM 2870  C CD2   . TRP E 1 47  ? 84.858  43.533  85.596  1.00 74.56  ?  47  TRP E CD2   1 
ATOM 2871  N NE1   . TRP E 1 47  ? 84.709  41.753  86.941  1.00 74.56  ?  47  TRP E NE1   1 
ATOM 2872  C CE2   . TRP E 1 47  ? 85.296  42.983  86.811  1.00 74.56  ?  47  TRP E CE2   1 
ATOM 2873  C CE3   . TRP E 1 47  ? 85.317  44.795  85.226  1.00 74.56  ?  47  TRP E CE3   1 
ATOM 2874  C CZ2   . TRP E 1 47  ? 86.173  43.651  87.655  1.00 74.56  ?  47  TRP E CZ2   1 
ATOM 2875  C CZ3   . TRP E 1 47  ? 86.181  45.458  86.064  1.00 74.56  ?  47  TRP E CZ3   1 
ATOM 2876  C CH2   . TRP E 1 47  ? 86.600  44.888  87.265  1.00 74.56  ?  47  TRP E CH2   1 
ATOM 2877  N N     . LEU E 1 48  ? 86.438  42.382  82.986  1.00 75.72  ?  48  LEU E N     1 
ATOM 2878  C CA    . LEU E 1 48  ? 87.740  43.025  82.865  1.00 75.72  ?  48  LEU E CA    1 
ATOM 2879  C C     . LEU E 1 48  ? 88.310  42.856  81.466  1.00 75.72  ?  48  LEU E C     1 
ATOM 2880  O O     . LEU E 1 48  ? 89.110  43.685  81.019  1.00 75.72  ?  48  LEU E O     1 
ATOM 2881  C CB    . LEU E 1 48  ? 88.687  42.463  83.927  1.00 75.72  ?  48  LEU E CB    1 
ATOM 2882  C CG    . LEU E 1 48  ? 90.030  43.133  84.232  1.00 75.72  ?  48  LEU E CG    1 
ATOM 2883  C CD1   . LEU E 1 48  ? 90.339  42.971  85.708  1.00 75.72  ?  48  LEU E CD1   1 
ATOM 2884  C CD2   . LEU E 1 48  ? 91.171  42.543  83.415  1.00 75.72  ?  48  LEU E CD2   1 
ATOM 2885  N N     . LYS E 1 49  ? 87.912  41.799  80.762  1.00 87.24  ?  49  LYS E N     1 
ATOM 2886  C CA    . LYS E 1 49  ? 88.281  41.669  79.361  1.00 87.24  ?  49  LYS E CA    1 
ATOM 2887  C C     . LYS E 1 49  ? 87.388  42.519  78.469  1.00 87.24  ?  49  LYS E C     1 
ATOM 2888  O O     . LYS E 1 49  ? 87.859  43.064  77.466  1.00 87.24  ?  49  LYS E O     1 
ATOM 2889  C CB    . LYS E 1 49  ? 88.209  40.205  78.930  1.00 87.24  ?  49  LYS E CB    1 
ATOM 2890  C CG    . LYS E 1 49  ? 89.060  39.273  79.775  1.00 87.24  ?  49  LYS E CG    1 
ATOM 2891  C CD    . LYS E 1 49  ? 90.543  39.542  79.607  1.00 87.24  ?  49  LYS E CD    1 
ATOM 2892  C CE    . LYS E 1 49  ? 91.359  38.584  80.458  1.00 87.24  ?  49  LYS E CE    1 
ATOM 2893  N NZ    . LYS E 1 49  ? 92.819  38.851  80.362  1.00 87.24  1  49  LYS E NZ    1 
ATOM 2894  N N     . GLU E 1 50  ? 86.109  42.659  78.827  1.00 74.13  ?  50  GLU E N     1 
ATOM 2895  C CA    . GLU E 1 50  ? 85.176  43.382  77.971  1.00 74.13  ?  50  GLU E CA    1 
ATOM 2896  C C     . GLU E 1 50  ? 85.417  44.883  78.009  1.00 74.13  ?  50  GLU E C     1 
ATOM 2897  O O     . GLU E 1 50  ? 85.210  45.562  76.997  1.00 74.13  ?  50  GLU E O     1 
ATOM 2898  C CB    . GLU E 1 50  ? 83.739  43.072  78.377  1.00 74.13  ?  50  GLU E CB    1 
ATOM 2899  C CG    . GLU E 1 50  ? 83.340  41.625  78.172  1.00 74.13  ?  50  GLU E CG    1 
ATOM 2900  C CD    . GLU E 1 50  ? 83.298  41.226  76.713  1.00 74.13  ?  50  GLU E CD    1 
ATOM 2901  O OE1   . GLU E 1 50  ? 82.944  42.074  75.868  1.00 74.13  ?  50  GLU E OE1   1 
ATOM 2902  O OE2   . GLU E 1 50  ? 83.624  40.061  76.409  1.00 74.13  -1 50  GLU E OE2   1 
ATOM 2903  N N     . ILE E 1 51  ? 85.845  45.417  79.154  1.00 66.52  ?  51  ILE E N     1 
ATOM 2904  C CA    . ILE E 1 51  ? 86.177  46.837  79.217  1.00 66.52  ?  51  ILE E CA    1 
ATOM 2905  C C     . ILE E 1 51  ? 87.435  47.122  78.405  1.00 66.52  ?  51  ILE E C     1 
ATOM 2906  O O     . ILE E 1 51  ? 87.528  48.145  77.716  1.00 66.52  ?  51  ILE E O     1 
ATOM 2907  C CB    . ILE E 1 51  ? 86.314  47.289  80.682  1.00 66.52  ?  51  ILE E CB    1 
ATOM 2908  C CG1   . ILE E 1 51  ? 84.977  47.159  81.395  1.00 66.52  ?  51  ILE E CG1   1 
ATOM 2909  C CG2   . ILE E 1 51  ? 86.770  48.730  80.789  1.00 66.52  ?  51  ILE E CG2   1 
ATOM 2910  C CD1   . ILE E 1 51  ? 85.063  47.459  82.858  1.00 66.52  ?  51  ILE E CD1   1 
ATOM 2911  N N     . ARG E 1 52  ? 88.400  46.203  78.434  1.00 74.92  ?  52  ARG E N     1 
ATOM 2912  C CA    . ARG E 1 52  ? 89.598  46.366  77.620  1.00 74.92  ?  52  ARG E CA    1 
ATOM 2913  C C     . ARG E 1 52  ? 89.289  46.217  76.135  1.00 74.92  ?  52  ARG E C     1 
ATOM 2914  O O     . ARG E 1 52  ? 89.903  46.894  75.303  1.00 74.92  ?  52  ARG E O     1 
ATOM 2915  C CB    . ARG E 1 52  ? 90.661  45.357  78.058  1.00 74.92  ?  52  ARG E CB    1 
ATOM 2916  C CG    . ARG E 1 52  ? 92.007  45.512  77.366  1.00 74.92  ?  52  ARG E CG    1 
ATOM 2917  C CD    . ARG E 1 52  ? 93.033  44.498  77.857  1.00 74.92  ?  52  ARG E CD    1 
ATOM 2918  N NE    . ARG E 1 52  ? 93.406  44.718  79.250  1.00 74.92  ?  52  ARG E NE    1 
ATOM 2919  C CZ    . ARG E 1 52  ? 93.134  43.872  80.236  1.00 74.92  ?  52  ARG E CZ    1 
ATOM 2920  N NH1   . ARG E 1 52  ? 92.486  42.744  79.983  1.00 74.92  1  52  ARG E NH1   1 
ATOM 2921  N NH2   . ARG E 1 52  ? 93.512  44.153  81.475  1.00 74.92  ?  52  ARG E NH2   1 
ATOM 2922  N N     . LYS E 1 53  ? 88.322  45.371  75.785  1.00 69.57  ?  53  LYS E N     1 
ATOM 2923  C CA    . LYS E 1 53  ? 88.003  45.159  74.379  1.00 69.57  ?  53  LYS E CA    1 
ATOM 2924  C C     . LYS E 1 53  ? 87.187  46.307  73.798  1.00 69.57  ?  53  LYS E C     1 
ATOM 2925  O O     . LYS E 1 53  ? 87.513  46.822  72.723  1.00 69.57  ?  53  LYS E O     1 
ATOM 2926  C CB    . LYS E 1 53  ? 87.254  43.841  74.202  1.00 69.57  ?  53  LYS E CB    1 
ATOM 2927  C CG    . LYS E 1 53  ? 86.942  43.510  72.758  1.00 69.57  ?  53  LYS E CG    1 
ATOM 2928  C CD    . LYS E 1 53  ? 86.186  42.202  72.650  1.00 69.57  ?  53  LYS E CD    1 
ATOM 2929  C CE    . LYS E 1 53  ? 87.111  41.026  72.918  1.00 69.57  ?  53  LYS E CE    1 
ATOM 2930  N NZ    . LYS E 1 53  ? 86.443  39.714  72.701  1.00 69.57  1  53  LYS E NZ    1 
ATOM 2931  N N     . LEU E 1 54  ? 86.121  46.718  74.487  1.00 66.14  ?  54  LEU E N     1 
ATOM 2932  C CA    . LEU E 1 54  ? 85.221  47.718  73.925  1.00 66.14  ?  54  LEU E CA    1 
ATOM 2933  C C     . LEU E 1 54  ? 85.821  49.115  73.920  1.00 66.14  ?  54  LEU E C     1 
ATOM 2934  O O     . LEU E 1 54  ? 85.415  49.943  73.100  1.00 66.14  ?  54  LEU E O     1 
ATOM 2935  C CB    . LEU E 1 54  ? 83.899  47.718  74.686  1.00 66.14  ?  54  LEU E CB    1 
ATOM 2936  C CG    . LEU E 1 54  ? 83.090  46.440  74.485  1.00 66.14  ?  54  LEU E CG    1 
ATOM 2937  C CD1   . LEU E 1 54  ? 81.850  46.430  75.357  1.00 66.14  ?  54  LEU E CD1   1 
ATOM 2938  C CD2   . LEU E 1 54  ? 82.719  46.285  73.023  1.00 66.14  ?  54  LEU E CD2   1 
ATOM 2939  N N     . GLN E 1 55  ? 86.776  49.398  74.800  1.00 62.46  ?  55  GLN E N     1 
ATOM 2940  C CA    . GLN E 1 55  ? 87.451  50.685  74.756  1.00 62.46  ?  55  GLN E CA    1 
ATOM 2941  C C     . GLN E 1 55  ? 88.548  50.736  73.707  1.00 62.46  ?  55  GLN E C     1 
ATOM 2942  O O     . GLN E 1 55  ? 89.107  51.812  73.473  1.00 62.46  ?  55  GLN E O     1 
ATOM 2943  C CB    . GLN E 1 55  ? 88.032  51.025  76.124  1.00 62.46  ?  55  GLN E CB    1 
ATOM 2944  C CG    . GLN E 1 55  ? 86.983  51.331  77.160  1.00 62.46  ?  55  GLN E CG    1 
ATOM 2945  C CD    . GLN E 1 55  ? 87.580  51.590  78.515  1.00 62.46  ?  55  GLN E CD    1 
ATOM 2946  O OE1   . GLN E 1 55  ? 88.786  51.478  78.700  1.00 62.46  ?  55  GLN E OE1   1 
ATOM 2947  N NE2   . GLN E 1 55  ? 86.740  51.936  79.476  1.00 62.46  ?  55  GLN E NE2   1 
ATOM 2948  N N     . LYS E 1 56  ? 88.867  49.613  73.071  1.00 68.79  ?  56  LYS E N     1 
ATOM 2949  C CA    . LYS E 1 56  ? 89.871  49.617  72.018  1.00 68.79  ?  56  LYS E CA    1 
ATOM 2950  C C     . LYS E 1 56  ? 89.258  49.903  70.653  1.00 68.79  ?  56  LYS E C     1 
ATOM 2951  O O     . LYS E 1 56  ? 89.690  50.827  69.960  1.00 68.79  ?  56  LYS E O     1 
ATOM 2952  C CB    . LYS E 1 56  ? 90.618  48.283  71.991  1.00 68.79  ?  56  LYS E CB    1 
ATOM 2953  C CG    . LYS E 1 56  ? 91.779  48.261  71.018  1.00 68.79  ?  56  LYS E CG    1 
ATOM 2954  C CD    . LYS E 1 56  ? 92.544  46.956  71.105  1.00 68.79  ?  56  LYS E CD    1 
ATOM 2955  C CE    . LYS E 1 56  ? 93.721  46.943  70.145  1.00 68.79  ?  56  LYS E CE    1 
ATOM 2956  N NZ    . LYS E 1 56  ? 94.479  45.662  70.217  1.00 68.79  1  56  LYS E NZ    1 
ATOM 2957  N N     . SER E 1 57  ? 88.254  49.133  70.254  1.00 73.54  ?  57  SER E N     1 
ATOM 2958  C CA    . SER E 1 57  ? 87.666  49.340  68.943  1.00 73.54  ?  57  SER E CA    1 
ATOM 2959  C C     . SER E 1 57  ? 86.719  50.536  68.960  1.00 73.54  ?  57  SER E C     1 
ATOM 2960  O O     . SER E 1 57  ? 86.308  51.025  70.014  1.00 73.54  ?  57  SER E O     1 
ATOM 2961  C CB    . SER E 1 57  ? 86.929  48.087  68.480  1.00 73.54  ?  57  SER E CB    1 
ATOM 2962  O OG    . SER E 1 57  ? 85.780  47.850  69.271  1.00 73.54  ?  57  SER E OG    1 
ATOM 2963  N N     . THR E 1 58  ? 86.386  51.016  67.765  1.00 67.81  ?  58  THR E N     1 
ATOM 2964  C CA    . THR E 1 58  ? 85.603  52.232  67.570  1.00 67.81  ?  58  THR E CA    1 
ATOM 2965  C C     . THR E 1 58  ? 84.396  51.955  66.686  1.00 67.81  ?  58  THR E C     1 
ATOM 2966  O O     . THR E 1 58  ? 84.111  52.684  65.734  1.00 67.81  ?  58  THR E O     1 
ATOM 2967  C CB    . THR E 1 58  ? 86.441  53.348  66.948  1.00 67.81  ?  58  THR E CB    1 
ATOM 2968  O OG1   . THR E 1 58  ? 86.901  52.936  65.657  1.00 67.81  ?  58  THR E OG1   1 
ATOM 2969  C CG2   . THR E 1 58  ? 87.641  53.689  67.818  1.00 67.81  ?  58  THR E CG2   1 
ATOM 2970  N N     . HIS E 1 59  ? 83.663  50.892  66.989  1.00 66.52  ?  59  HIS E N     1 
ATOM 2971  C CA    . HIS E 1 59  ? 82.523  50.499  66.172  1.00 66.52  ?  59  HIS E CA    1 
ATOM 2972  C C     . HIS E 1 59  ? 81.288  51.319  66.530  1.00 66.52  ?  59  HIS E C     1 
ATOM 2973  O O     . HIS E 1 59  ? 81.347  52.329  67.235  1.00 66.52  ?  59  HIS E O     1 
ATOM 2974  C CB    . HIS E 1 59  ? 82.236  49.013  66.335  1.00 66.52  ?  59  HIS E CB    1 
ATOM 2975  C CG    . HIS E 1 59  ? 83.311  48.130  65.798  1.00 66.52  ?  59  HIS E CG    1 
ATOM 2976  N ND1   . HIS E 1 59  ? 83.533  47.967  64.448  1.00 66.52  ?  59  HIS E ND1   1 
ATOM 2977  C CD2   . HIS E 1 59  ? 84.214  47.344  66.427  1.00 66.52  ?  59  HIS E CD2   1 
ATOM 2978  C CE1   . HIS E 1 59  ? 84.537  47.128  64.269  1.00 66.52  ?  59  HIS E CE1   1 
ATOM 2979  N NE2   . HIS E 1 59  ? 84.969  46.736  65.454  1.00 66.52  ?  59  HIS E NE2   1 
ATOM 2980  N N     . LEU E 1 60  ? 80.146  50.879  66.020  1.00 62.65  ?  60  LEU E N     1 
ATOM 2981  C CA    . LEU E 1 60  ? 78.844  51.395  66.409  1.00 62.65  ?  60  LEU E CA    1 
ATOM 2982  C C     . LEU E 1 60  ? 78.206  50.383  67.347  1.00 62.65  ?  60  LEU E C     1 
ATOM 2983  O O     . LEU E 1 60  ? 77.968  49.236  66.954  1.00 62.65  ?  60  LEU E O     1 
ATOM 2984  C CB    . LEU E 1 60  ? 77.954  51.621  65.189  1.00 62.65  ?  60  LEU E CB    1 
ATOM 2985  C CG    . LEU E 1 60  ? 78.048  52.883  64.333  1.00 62.65  ?  60  LEU E CG    1 
ATOM 2986  C CD1   . LEU E 1 60  ? 79.326  52.950  63.517  1.00 62.65  ?  60  LEU E CD1   1 
ATOM 2987  C CD2   . LEU E 1 60  ? 76.849  52.909  63.413  1.00 62.65  ?  60  LEU E CD2   1 
ATOM 2988  N N     . LEU E 1 61  ? 77.928  50.799  68.578  1.00 54.19  ?  61  LEU E N     1 
ATOM 2989  C CA    . LEU E 1 61  ? 77.404  49.866  69.563  1.00 54.19  ?  61  LEU E CA    1 
ATOM 2990  C C     . LEU E 1 61  ? 75.902  49.664  69.458  1.00 54.19  ?  61  LEU E C     1 
ATOM 2991  O O     . LEU E 1 61  ? 75.359  48.819  70.175  1.00 54.19  ?  61  LEU E O     1 
ATOM 2992  C CB    . LEU E 1 61  ? 77.758  50.340  70.967  1.00 54.19  ?  61  LEU E CB    1 
ATOM 2993  C CG    . LEU E 1 61  ? 79.257  50.368  71.253  1.00 54.19  ?  61  LEU E CG    1 
ATOM 2994  C CD1   . LEU E 1 61  ? 79.521  50.891  72.653  1.00 54.19  ?  61  LEU E CD1   1 
ATOM 2995  C CD2   . LEU E 1 61  ? 79.852  48.992  71.064  1.00 54.19  ?  61  LEU E CD2   1 
ATOM 2996  N N     . ILE E 1 62  ? 75.223  50.406  68.593  1.00 54.33  ?  62  ILE E N     1 
ATOM 2997  C CA    . ILE E 1 62  ? 73.784  50.292  68.401  1.00 54.33  ?  62  ILE E CA    1 
ATOM 2998  C C     . ILE E 1 62  ? 73.531  49.897  66.953  1.00 54.33  ?  62  ILE E C     1 
ATOM 2999  O O     . ILE E 1 62  ? 74.166  50.431  66.039  1.00 54.33  ?  62  ILE E O     1 
ATOM 3000  C CB    . ILE E 1 62  ? 73.072  51.613  68.757  1.00 54.33  ?  62  ILE E CB    1 
ATOM 3001  C CG1   . ILE E 1 62  ? 73.314  51.963  70.221  1.00 54.33  ?  62  ILE E CG1   1 
ATOM 3002  C CG2   . ILE E 1 62  ? 71.589  51.514  68.539  1.00 54.33  ?  62  ILE E CG2   1 
ATOM 3003  C CD1   . ILE E 1 62  ? 72.827  53.335  70.591  1.00 54.33  ?  62  ILE E CD1   1 
ATOM 3004  N N     . ARG E 1 63  ? 72.622  48.946  66.750  1.00 70.26  ?  63  ARG E N     1 
ATOM 3005  C CA    . ARG E 1 63  ? 72.288  48.471  65.419  1.00 70.26  ?  63  ARG E CA    1 
ATOM 3006  C C     . ARG E 1 63  ? 71.594  49.564  64.606  1.00 70.26  ?  63  ARG E C     1 
ATOM 3007  O O     . ARG E 1 63  ? 71.010  50.503  65.151  1.00 70.26  ?  63  ARG E O     1 
ATOM 3008  C CB    . ARG E 1 63  ? 71.401  47.237  65.523  1.00 70.26  ?  63  ARG E CB    1 
ATOM 3009  C CG    . ARG E 1 63  ? 72.070  46.099  66.263  1.00 70.26  ?  63  ARG E CG    1 
ATOM 3010  C CD    . ARG E 1 63  ? 73.218  45.533  65.454  1.00 70.26  ?  63  ARG E CD    1 
ATOM 3011  N NE    . ARG E 1 63  ? 73.840  44.398  66.122  1.00 70.26  ?  63  ARG E NE    1 
ATOM 3012  C CZ    . ARG E 1 63  ? 74.880  44.499  66.939  1.00 70.26  ?  63  ARG E CZ    1 
ATOM 3013  N NH1   . ARG E 1 63  ? 75.418  45.684  67.181  1.00 70.26  1  63  ARG E NH1   1 
ATOM 3014  N NH2   . ARG E 1 63  ? 75.389  43.420  67.511  1.00 70.26  ?  63  ARG E NH2   1 
ATOM 3015  N N     . LYS E 1 64  ? 71.660  49.425  63.279  1.00 70.36  ?  64  LYS E N     1 
ATOM 3016  C CA    . LYS E 1 64  ? 71.270  50.511  62.381  1.00 70.36  ?  64  LYS E CA    1 
ATOM 3017  C C     . LYS E 1 64  ? 69.756  50.677  62.287  1.00 70.36  ?  64  LYS E C     1 
ATOM 3018  O O     . LYS E 1 64  ? 69.218  51.737  62.624  1.00 70.36  ?  64  LYS E O     1 
ATOM 3019  C CB    . LYS E 1 64  ? 71.843  50.280  60.980  1.00 70.36  ?  64  LYS E CB    1 
ATOM 3020  C CG    . LYS E 1 64  ? 73.258  50.780  60.747  1.00 70.36  ?  64  LYS E CG    1 
ATOM 3021  C CD    . LYS E 1 64  ? 74.313  49.839  61.284  1.00 70.36  ?  64  LYS E CD    1 
ATOM 3022  C CE    . LYS E 1 64  ? 75.698  50.304  60.869  1.00 70.36  ?  64  LYS E CE    1 
ATOM 3023  N NZ    . LYS E 1 64  ? 76.777  49.466  61.458  1.00 70.36  1  64  LYS E NZ    1 
ATOM 3024  N N     . LEU E 1 65  ? 69.062  49.646  61.805  1.00 67.98  ?  65  LEU E N     1 
ATOM 3025  C CA    . LEU E 1 65  ? 67.640  49.784  61.489  1.00 67.98  ?  65  LEU E CA    1 
ATOM 3026  C C     . LEU E 1 65  ? 66.702  50.037  62.671  1.00 67.98  ?  65  LEU E C     1 
ATOM 3027  O O     . LEU E 1 65  ? 65.725  50.779  62.469  1.00 67.98  ?  65  LEU E O     1 
ATOM 3028  C CB    . LEU E 1 65  ? 67.156  48.568  60.686  1.00 67.98  ?  65  LEU E CB    1 
ATOM 3029  C CG    . LEU E 1 65  ? 67.197  48.674  59.156  1.00 67.98  ?  65  LEU E CG    1 
ATOM 3030  C CD1   . LEU E 1 65  ? 68.603  48.598  58.585  1.00 67.98  ?  65  LEU E CD1   1 
ATOM 3031  C CD2   . LEU E 1 65  ? 66.303  47.619  58.513  1.00 67.98  ?  65  LEU E CD2   1 
ATOM 3032  N N     . PRO E 1 66  ? 66.889  49.475  63.883  1.00 64.69  ?  66  PRO E N     1 
ATOM 3033  C CA    . PRO E 1 66  ? 66.037  49.937  64.996  1.00 64.69  ?  66  PRO E CA    1 
ATOM 3034  C C     . PRO E 1 66  ? 66.228  51.400  65.345  1.00 64.69  ?  66  PRO E C     1 
ATOM 3035  O O     . PRO E 1 66  ? 65.244  52.100  65.623  1.00 64.69  ?  66  PRO E O     1 
ATOM 3036  C CB    . PRO E 1 66  ? 66.446  49.020  66.153  1.00 64.69  ?  66  PRO E CB    1 
ATOM 3037  C CG    . PRO E 1 66  ? 66.888  47.802  65.507  1.00 64.69  ?  66  PRO E CG    1 
ATOM 3038  C CD    . PRO E 1 66  ? 67.593  48.236  64.270  1.00 64.69  ?  66  PRO E CD    1 
ATOM 3039  N N     . PHE E 1 67  ? 67.466  51.890  65.288  1.00 56.11  ?  67  PHE E N     1 
ATOM 3040  C CA    . PHE E 1 67  ? 67.705  53.301  65.556  1.00 56.11  ?  67  PHE E CA    1 
ATOM 3041  C C     . PHE E 1 67  ? 67.110  54.173  64.464  1.00 56.11  ?  67  PHE E C     1 
ATOM 3042  O O     . PHE E 1 67  ? 66.582  55.256  64.743  1.00 56.11  ?  67  PHE E O     1 
ATOM 3043  C CB    . PHE E 1 67  ? 69.197  53.561  65.680  1.00 56.11  ?  67  PHE E CB    1 
ATOM 3044  C CG    . PHE E 1 67  ? 69.520  54.931  66.139  1.00 56.11  ?  67  PHE E CG    1 
ATOM 3045  C CD1   . PHE E 1 67  ? 69.403  55.256  67.475  1.00 56.11  ?  67  PHE E CD1   1 
ATOM 3046  C CD2   . PHE E 1 67  ? 69.926  55.901  65.244  1.00 56.11  ?  67  PHE E CD2   1 
ATOM 3047  C CE1   . PHE E 1 67  ? 69.691  56.514  67.911  1.00 56.11  ?  67  PHE E CE1   1 
ATOM 3048  C CE2   . PHE E 1 67  ? 70.207  57.161  65.681  1.00 56.11  ?  67  PHE E CE2   1 
ATOM 3049  C CZ    . PHE E 1 67  ? 70.102  57.468  67.020  1.00 56.11  ?  67  PHE E CZ    1 
ATOM 3050  N N     . SER E 1 68  ? 67.155  53.698  63.220  1.00 63.01  ?  68  SER E N     1 
ATOM 3051  C CA    . SER E 1 68  ? 66.570  54.454  62.121  1.00 63.01  ?  68  SER E CA    1 
ATOM 3052  C C     . SER E 1 68  ? 65.051  54.493  62.219  1.00 63.01  ?  68  SER E C     1 
ATOM 3053  O O     . SER E 1 68  ? 64.437  55.535  61.965  1.00 63.01  ?  68  SER E O     1 
ATOM 3054  C CB    . SER E 1 68  ? 67.007  53.852  60.789  1.00 63.01  ?  68  SER E CB    1 
ATOM 3055  O OG    . SER E 1 68  ? 66.411  54.535  59.703  1.00 63.01  ?  68  SER E OG    1 
ATOM 3056  N N     . ARG E 1 69  ? 64.430  53.376  62.604  1.00 61.40  ?  69  ARG E N     1 
ATOM 3057  C CA    . ARG E 1 69  ? 62.982  53.365  62.764  1.00 61.40  ?  69  ARG E CA    1 
ATOM 3058  C C     . ARG E 1 69  ? 62.544  54.215  63.947  1.00 61.40  ?  69  ARG E C     1 
ATOM 3059  O O     . ARG E 1 69  ? 61.492  54.861  63.883  1.00 61.40  ?  69  ARG E O     1 
ATOM 3060  C CB    . ARG E 1 69  ? 62.484  51.930  62.904  1.00 61.40  ?  69  ARG E CB    1 
ATOM 3061  C CG    . ARG E 1 69  ? 62.575  51.143  61.608  1.00 61.40  ?  69  ARG E CG    1 
ATOM 3062  C CD    . ARG E 1 69  ? 62.052  49.735  61.766  1.00 61.40  ?  69  ARG E CD    1 
ATOM 3063  N NE    . ARG E 1 69  ? 62.938  48.915  62.581  1.00 61.40  ?  69  ARG E NE    1 
ATOM 3064  C CZ    . ARG E 1 69  ? 62.637  48.492  63.802  1.00 61.40  ?  69  ARG E CZ    1 
ATOM 3065  N NH1   . ARG E 1 69  ? 61.479  48.827  64.348  1.00 61.40  1  69  ARG E NH1   1 
ATOM 3066  N NH2   . ARG E 1 69  ? 63.493  47.743  64.479  1.00 61.40  ?  69  ARG E NH2   1 
ATOM 3067  N N     . LEU E 1 70  ? 63.360  54.278  65.004  1.00 60.34  ?  70  LEU E N     1 
ATOM 3068  C CA    . LEU E 1 70  ? 63.055  55.169  66.120  1.00 60.34  ?  70  LEU E CA    1 
ATOM 3069  C C     . LEU E 1 70  ? 63.154  56.635  65.717  1.00 60.34  ?  70  LEU E C     1 
ATOM 3070  O O     . LEU E 1 70  ? 62.286  57.443  66.082  1.00 60.34  ?  70  LEU E O     1 
ATOM 3071  C CB    . LEU E 1 70  ? 63.989  54.877  67.288  1.00 60.34  ?  70  LEU E CB    1 
ATOM 3072  C CG    . LEU E 1 70  ? 63.798  55.772  68.505  1.00 60.34  ?  70  LEU E CG    1 
ATOM 3073  C CD1   . LEU E 1 70  ? 62.385  55.653  69.018  1.00 60.34  ?  70  LEU E CD1   1 
ATOM 3074  C CD2   . LEU E 1 70  ? 64.788  55.396  69.584  1.00 60.34  ?  70  LEU E CD2   1 
ATOM 3075  N N     . ALA E 1 71  ? 64.198  56.994  64.962  1.00 59.49  ?  71  ALA E N     1 
ATOM 3076  C CA    . ALA E 1 71  ? 64.348  58.373  64.509  1.00 59.49  ?  71  ALA E CA    1 
ATOM 3077  C C     . ALA E 1 71  ? 63.226  58.776  63.563  1.00 59.49  ?  71  ALA E C     1 
ATOM 3078  O O     . ALA E 1 71  ? 62.718  59.901  63.640  1.00 59.49  ?  71  ALA E O     1 
ATOM 3079  C CB    . ALA E 1 71  ? 65.703  58.560  63.836  1.00 59.49  ?  71  ALA E CB    1 
ATOM 3080  N N     . ARG E 1 72  ? 62.791  57.857  62.698  1.00 64.15  ?  72  ARG E N     1 
ATOM 3081  C CA    . ARG E 1 72  ? 61.672  58.163  61.813  1.00 64.15  ?  72  ARG E CA    1 
ATOM 3082  C C     . ARG E 1 72  ? 60.362  58.278  62.585  1.00 64.15  ?  72  ARG E C     1 
ATOM 3083  O O     . ARG E 1 72  ? 59.524  59.124  62.256  1.00 64.15  ?  72  ARG E O     1 
ATOM 3084  C CB    . ARG E 1 72  ? 61.564  57.113  60.711  1.00 64.15  ?  72  ARG E CB    1 
ATOM 3085  C CG    . ARG E 1 72  ? 62.705  57.167  59.709  1.00 64.15  ?  72  ARG E CG    1 
ATOM 3086  C CD    . ARG E 1 72  ? 62.559  56.110  58.632  1.00 64.15  ?  72  ARG E CD    1 
ATOM 3087  N NE    . ARG E 1 72  ? 63.727  56.052  57.759  1.00 64.15  ?  72  ARG E NE    1 
ATOM 3088  C CZ    . ARG E 1 72  ? 63.867  56.768  56.650  1.00 64.15  ?  72  ARG E CZ    1 
ATOM 3089  N NH1   . ARG E 1 72  ? 62.908  57.601  56.274  1.00 64.15  1  72  ARG E NH1   1 
ATOM 3090  N NH2   . ARG E 1 72  ? 64.964  56.650  55.914  1.00 64.15  ?  72  ARG E NH2   1 
ATOM 3091  N N     . GLU E 1 73  ? 60.179  57.461  63.631  1.00 70.33  ?  73  GLU E N     1 
ATOM 3092  C CA    . GLU E 1 73  ? 58.971  57.558  64.449  1.00 70.33  ?  73  GLU E CA    1 
ATOM 3093  C C     . GLU E 1 73  ? 58.901  58.889  65.187  1.00 70.33  ?  73  GLU E C     1 
ATOM 3094  O O     . GLU E 1 73  ? 57.821  59.476  65.314  1.00 70.33  ?  73  GLU E O     1 
ATOM 3095  C CB    . GLU E 1 73  ? 58.922  56.417  65.460  1.00 70.33  ?  73  GLU E CB    1 
ATOM 3096  C CG    . GLU E 1 73  ? 57.624  56.352  66.246  1.00 70.33  ?  73  GLU E CG    1 
ATOM 3097  C CD    . GLU E 1 73  ? 57.707  55.392  67.410  1.00 70.33  ?  73  GLU E CD    1 
ATOM 3098  O OE1   . GLU E 1 73  ? 58.821  54.908  67.691  1.00 70.33  ?  73  GLU E OE1   1 
ATOM 3099  O OE2   . GLU E 1 73  ? 56.663  55.106  68.041  1.00 70.33  -1 73  GLU E OE2   1 
ATOM 3100  N N     . ILE E 1 74  ? 60.042  59.375  65.680  1.00 63.14  ?  74  ILE E N     1 
ATOM 3101  C CA    . ILE E 1 74  ? 60.061  60.683  66.329  1.00 63.14  ?  74  ILE E CA    1 
ATOM 3102  C C     . ILE E 1 74  ? 59.831  61.792  65.307  1.00 63.14  ?  74  ILE E C     1 
ATOM 3103  O O     . ILE E 1 74  ? 59.120  62.767  65.579  1.00 63.14  ?  74  ILE E O     1 
ATOM 3104  C CB    . ILE E 1 74  ? 61.377  60.870  67.107  1.00 63.14  ?  74  ILE E CB    1 
ATOM 3105  C CG1   . ILE E 1 74  ? 61.440  59.894  68.276  1.00 63.14  ?  74  ILE E CG1   1 
ATOM 3106  C CG2   . ILE E 1 74  ? 61.522  62.271  67.648  1.00 63.14  ?  74  ILE E CG2   1 
ATOM 3107  C CD1   . ILE E 1 74  ? 62.781  59.872  68.959  1.00 63.14  ?  74  ILE E CD1   1 
ATOM 3108  N N     . CYS E 1 75  ? 60.375  61.636  64.098  1.00 68.41  ?  75  CYS E N     1 
ATOM 3109  C CA    . CYS E 1 75  ? 60.225  62.680  63.088  1.00 68.41  ?  75  CYS E CA    1 
ATOM 3110  C C     . CYS E 1 75  ? 58.803  62.753  62.535  1.00 68.41  ?  75  CYS E C     1 
ATOM 3111  O O     . CYS E 1 75  ? 58.387  63.813  62.055  1.00 68.41  ?  75  CYS E O     1 
ATOM 3112  C CB    . CYS E 1 75  ? 61.227  62.452  61.958  1.00 68.41  ?  75  CYS E CB    1 
ATOM 3113  S SG    . CYS E 1 75  ? 61.295  63.747  60.699  1.00 68.41  ?  75  CYS E SG    1 
ATOM 3114  N N     . VAL E 1 76  ? 58.049  61.651  62.590  1.00 68.12  ?  76  VAL E N     1 
ATOM 3115  C CA    . VAL E 1 76  ? 56.666  61.678  62.108  1.00 68.12  ?  76  VAL E CA    1 
ATOM 3116  C C     . VAL E 1 76  ? 55.788  62.549  63.008  1.00 68.12  ?  76  VAL E C     1 
ATOM 3117  O O     . VAL E 1 76  ? 54.963  63.330  62.516  1.00 68.12  ?  76  VAL E O     1 
ATOM 3118  C CB    . VAL E 1 76  ? 56.122  60.240  61.965  1.00 68.12  ?  76  VAL E CB    1 
ATOM 3119  C CG1   . VAL E 1 76  ? 54.606  60.213  61.832  1.00 68.12  ?  76  VAL E CG1   1 
ATOM 3120  C CG2   . VAL E 1 76  ? 56.712  59.589  60.728  1.00 68.12  ?  76  VAL E CG2   1 
ATOM 3121  N N     . LYS E 1 77  ? 56.003  62.490  64.327  1.00 67.12  ?  77  LYS E N     1 
ATOM 3122  C CA    . LYS E 1 77  ? 55.131  63.172  65.284  1.00 67.12  ?  77  LYS E CA    1 
ATOM 3123  C C     . LYS E 1 77  ? 55.205  64.693  65.206  1.00 67.12  ?  77  LYS E C     1 
ATOM 3124  O O     . LYS E 1 77  ? 54.307  65.367  65.718  1.00 67.12  ?  77  LYS E O     1 
ATOM 3125  C CB    . LYS E 1 77  ? 55.465  62.733  66.707  1.00 67.12  ?  77  LYS E CB    1 
ATOM 3126  C CG    . LYS E 1 77  ? 55.127  61.292  67.005  1.00 67.12  ?  77  LYS E CG    1 
ATOM 3127  C CD    . LYS E 1 77  ? 55.468  60.945  68.443  1.00 67.12  ?  77  LYS E CD    1 
ATOM 3128  C CE    . LYS E 1 77  ? 55.173  59.485  68.742  1.00 67.12  ?  77  LYS E CE    1 
ATOM 3129  N NZ    . LYS E 1 77  ? 55.524  59.119  70.142  1.00 67.12  1  77  LYS E NZ    1 
ATOM 3130  N N     . PHE E 1 78  ? 56.241  65.248  64.589  1.00 63.65  ?  78  PHE E N     1 
ATOM 3131  C CA    . PHE E 1 78  ? 56.369  66.688  64.416  1.00 63.65  ?  78  PHE E CA    1 
ATOM 3132  C C     . PHE E 1 78  ? 56.018  67.058  62.986  1.00 63.65  ?  78  PHE E C     1 
ATOM 3133  O O     . PHE E 1 78  ? 56.579  66.486  62.043  1.00 63.65  ?  78  PHE E O     1 
ATOM 3134  C CB    . PHE E 1 78  ? 57.786  67.151  64.744  1.00 63.65  ?  78  PHE E CB    1 
ATOM 3135  C CG    . PHE E 1 78  ? 58.115  67.088  66.197  1.00 63.65  ?  78  PHE E CG    1 
ATOM 3136  C CD1   . PHE E 1 78  ? 57.110  67.091  67.147  1.00 63.65  ?  78  PHE E CD1   1 
ATOM 3137  C CD2   . PHE E 1 78  ? 59.426  66.988  66.613  1.00 63.65  ?  78  PHE E CD2   1 
ATOM 3138  C CE1   . PHE E 1 78  ? 57.410  67.023  68.487  1.00 63.65  ?  78  PHE E CE1   1 
ATOM 3139  C CE2   . PHE E 1 78  ? 59.733  66.919  67.953  1.00 63.65  ?  78  PHE E CE2   1 
ATOM 3140  C CZ    . PHE E 1 78  ? 58.723  66.936  68.891  1.00 63.65  ?  78  PHE E CZ    1 
ATOM 3141  N N     . THR E 1 79  ? 55.111  68.032  62.840  1.00 76.17  ?  79  THR E N     1 
ATOM 3142  C CA    . THR E 1 79  ? 54.633  68.573  61.562  1.00 76.17  ?  79  THR E CA    1 
ATOM 3143  C C     . THR E 1 79  ? 54.083  67.455  60.671  1.00 76.17  ?  79  THR E C     1 
ATOM 3144  O O     . THR E 1 79  ? 54.669  67.068  59.658  1.00 76.17  ?  79  THR E O     1 
ATOM 3145  C CB    . THR E 1 79  ? 55.722  69.386  60.852  1.00 76.17  ?  79  THR E CB    1 
ATOM 3146  O OG1   . THR E 1 79  ? 56.777  68.519  60.421  1.00 76.17  ?  79  THR E OG1   1 
ATOM 3147  C CG2   . THR E 1 79  ? 56.286  70.420  61.815  1.00 76.17  ?  79  THR E CG2   1 
ATOM 3148  N N     . ARG E 1 80  ? 52.940  66.933  61.119  1.00 89.38  ?  80  ARG E N     1 
ATOM 3149  C CA    . ARG E 1 80  ? 52.376  65.672  60.660  1.00 89.38  ?  80  ARG E CA    1 
ATOM 3150  C C     . ARG E 1 80  ? 51.964  65.722  59.188  1.00 89.38  ?  80  ARG E C     1 
ATOM 3151  O O     . ARG E 1 80  ? 52.027  66.753  58.514  1.00 89.38  ?  80  ARG E O     1 
ATOM 3152  C CB    . ARG E 1 80  ? 51.166  65.295  61.525  1.00 89.38  ?  80  ARG E CB    1 
ATOM 3153  C CG    . ARG E 1 80  ? 49.986  66.283  61.464  1.00 89.38  ?  80  ARG E CG    1 
ATOM 3154  C CD    . ARG E 1 80  ? 48.850  65.821  60.534  1.00 89.38  ?  80  ARG E CD    1 
ATOM 3155  N NE    . ARG E 1 80  ? 47.790  66.817  60.415  1.00 89.38  ?  80  ARG E NE    1 
ATOM 3156  C CZ    . ARG E 1 80  ? 46.702  66.844  61.175  1.00 89.38  ?  80  ARG E CZ    1 
ATOM 3157  N NH1   . ARG E 1 80  ? 46.524  65.924  62.113  1.00 89.38  1  80  ARG E NH1   1 
ATOM 3158  N NH2   . ARG E 1 80  ? 45.791  67.789  60.995  1.00 89.38  ?  80  ARG E NH2   1 
ATOM 3159  N N     . GLY E 1 81  ? 51.491  64.576  58.713  1.00 86.79  ?  81  GLY E N     1 
ATOM 3160  C CA    . GLY E 1 81  ? 50.972  64.460  57.369  1.00 86.79  ?  81  GLY E CA    1 
ATOM 3161  C C     . GLY E 1 81  ? 52.041  64.057  56.381  1.00 86.79  ?  81  GLY E C     1 
ATOM 3162  O O     . GLY E 1 81  ? 52.009  62.952  55.832  1.00 86.79  ?  81  GLY E O     1 
ATOM 3163  N N     . VAL E 1 82  ? 52.994  64.945  56.154  1.00 81.72  ?  82  VAL E N     1 
ATOM 3164  C CA    . VAL E 1 82  ? 54.064  64.676  55.206  1.00 81.72  ?  82  VAL E CA    1 
ATOM 3165  C C     . VAL E 1 82  ? 55.062  63.712  55.828  1.00 81.72  ?  82  VAL E C     1 
ATOM 3166  O O     . VAL E 1 82  ? 55.218  63.638  57.052  1.00 81.72  ?  82  VAL E O     1 
ATOM 3167  C CB    . VAL E 1 82  ? 54.739  65.988  54.762  1.00 81.72  ?  82  VAL E CB    1 
ATOM 3168  C CG1   . VAL E 1 82  ? 53.749  66.858  54.015  1.00 81.72  ?  82  VAL E CG1   1 
ATOM 3169  C CG2   . VAL E 1 82  ? 55.293  66.738  55.959  1.00 81.72  ?  82  VAL E CG2   1 
ATOM 3170  N N     . ASP E 1 83  ? 55.719  62.936  54.975  1.00 74.23  ?  83  ASP E N     1 
ATOM 3171  C CA    . ASP E 1 83  ? 56.872  62.167  55.401  1.00 74.23  ?  83  ASP E CA    1 
ATOM 3172  C C     . ASP E 1 83  ? 58.109  63.061  55.375  1.00 74.23  ?  83  ASP E C     1 
ATOM 3173  O O     . ASP E 1 83  ? 58.046  64.245  55.036  1.00 74.23  ?  83  ASP E O     1 
ATOM 3174  C CB    . ASP E 1 83  ? 57.037  60.927  54.523  1.00 74.23  ?  83  ASP E CB    1 
ATOM 3175  C CG    . ASP E 1 83  ? 57.090  61.257  53.038  1.00 74.23  ?  83  ASP E CG    1 
ATOM 3176  O OD1   . ASP E 1 83  ? 56.834  62.420  52.662  1.00 74.23  ?  83  ASP E OD1   1 
ATOM 3177  O OD2   . ASP E 1 83  ? 57.400  60.346  52.241  1.00 74.23  -1 83  ASP E OD2   1 
ATOM 3178  N N     . PHE E 1 84  ? 59.255  62.498  55.736  1.00 63.10  ?  84  PHE E N     1 
ATOM 3179  C CA    . PHE E 1 84  ? 60.504  63.239  55.654  1.00 63.10  ?  84  PHE E CA    1 
ATOM 3180  C C     . PHE E 1 84  ? 61.606  62.320  55.171  1.00 63.10  ?  84  PHE E C     1 
ATOM 3181  O O     . PHE E 1 84  ? 61.883  61.290  55.789  1.00 63.10  ?  84  PHE E O     1 
ATOM 3182  C CB    . PHE E 1 84  ? 60.872  63.868  56.993  1.00 63.10  ?  84  PHE E CB    1 
ATOM 3183  C CG    . PHE E 1 84  ? 60.069  65.081  57.318  1.00 63.10  ?  84  PHE E CG    1 
ATOM 3184  C CD1   . PHE E 1 84  ? 60.400  66.305  56.765  1.00 63.10  ?  84  PHE E CD1   1 
ATOM 3185  C CD2   . PHE E 1 84  ? 58.977  65.001  58.162  1.00 63.10  ?  84  PHE E CD2   1 
ATOM 3186  C CE1   . PHE E 1 84  ? 59.665  67.431  57.055  1.00 63.10  ?  84  PHE E CE1   1 
ATOM 3187  C CE2   . PHE E 1 84  ? 58.233  66.125  58.460  1.00 63.10  ?  84  PHE E CE2   1 
ATOM 3188  C CZ    . PHE E 1 84  ? 58.578  67.342  57.904  1.00 63.10  ?  84  PHE E CZ    1 
ATOM 3189  N N     . ASN E 1 85  ? 62.218  62.702  54.060  1.00 63.20  ?  85  ASN E N     1 
ATOM 3190  C CA    . ASN E 1 85  ? 63.385  62.006  53.556  1.00 63.20  ?  85  ASN E CA    1 
ATOM 3191  C C     . ASN E 1 85  ? 64.569  62.227  54.488  1.00 63.20  ?  85  ASN E C     1 
ATOM 3192  O O     . ASN E 1 85  ? 64.762  63.314  55.035  1.00 63.20  ?  85  ASN E O     1 
ATOM 3193  C CB    . ASN E 1 85  ? 63.696  62.506  52.146  1.00 63.20  ?  85  ASN E CB    1 
ATOM 3194  C CG    . ASN E 1 85  ? 64.780  61.708  51.447  1.00 63.20  ?  85  ASN E CG    1 
ATOM 3195  O OD1   . ASN E 1 85  ? 65.382  60.804  52.014  1.00 63.20  ?  85  ASN E OD1   1 
ATOM 3196  N ND2   . ASN E 1 85  ? 65.028  62.048  50.189  1.00 63.20  ?  85  ASN E ND2   1 
ATOM 3197  N N     . TRP E 1 86  ? 65.370  61.181  54.647  1.00 53.78  ?  86  TRP E N     1 
ATOM 3198  C CA    . TRP E 1 86  ? 66.615  61.225  55.395  1.00 53.78  ?  86  TRP E CA    1 
ATOM 3199  C C     . TRP E 1 86  ? 67.741  60.805  54.472  1.00 53.78  ?  86  TRP E C     1 
ATOM 3200  O O     . TRP E 1 86  ? 67.652  59.757  53.829  1.00 53.78  ?  86  TRP E O     1 
ATOM 3201  C CB    . TRP E 1 86  ? 66.574  60.280  56.591  1.00 53.78  ?  86  TRP E CB    1 
ATOM 3202  C CG    . TRP E 1 86  ? 65.647  60.693  57.656  1.00 53.78  ?  86  TRP E CG    1 
ATOM 3203  C CD1   . TRP E 1 86  ? 64.353  60.312  57.799  1.00 53.78  ?  86  TRP E CD1   1 
ATOM 3204  C CD2   . TRP E 1 86  ? 65.943  61.541  58.768  1.00 53.78  ?  86  TRP E CD2   1 
ATOM 3205  N NE1   . TRP E 1 86  ? 63.813  60.886  58.921  1.00 53.78  ?  86  TRP E NE1   1 
ATOM 3206  C CE2   . TRP E 1 86  ? 64.773  61.644  59.534  1.00 53.78  ?  86  TRP E CE2   1 
ATOM 3207  C CE3   . TRP E 1 86  ? 67.082  62.228  59.185  1.00 53.78  ?  86  TRP E CE3   1 
ATOM 3208  C CZ2   . TRP E 1 86  ? 64.709  62.404  60.688  1.00 53.78  ?  86  TRP E CZ2   1 
ATOM 3209  C CZ3   . TRP E 1 86  ? 67.016  62.976  60.331  1.00 53.78  ?  86  TRP E CZ3   1 
ATOM 3210  C CH2   . TRP E 1 86  ? 65.840  63.064  61.067  1.00 53.78  ?  86  TRP E CH2   1 
ATOM 3211  N N     . GLN E 1 87  ? 68.793  61.610  54.398  1.00 53.07  ?  87  GLN E N     1 
ATOM 3212  C CA    . GLN E 1 87  ? 69.995  61.122  53.749  1.00 53.07  ?  87  GLN E CA    1 
ATOM 3213  C C     . GLN E 1 87  ? 70.639  60.046  54.606  1.00 53.07  ?  87  GLN E C     1 
ATOM 3214  O O     . GLN E 1 87  ? 70.496  60.028  55.829  1.00 53.07  ?  87  GLN E O     1 
ATOM 3215  C CB    . GLN E 1 87  ? 70.988  62.246  53.481  1.00 53.07  ?  87  GLN E CB    1 
ATOM 3216  C CG    . GLN E 1 87  ? 70.581  63.169  52.360  1.00 53.07  ?  87  GLN E CG    1 
ATOM 3217  C CD    . GLN E 1 87  ? 71.663  64.167  52.017  1.00 53.07  ?  87  GLN E CD    1 
ATOM 3218  O OE1   . GLN E 1 87  ? 72.704  64.217  52.667  1.00 53.07  ?  87  GLN E OE1   1 
ATOM 3219  N NE2   . GLN E 1 87  ? 71.428  64.960  50.981  1.00 53.07  ?  87  GLN E NE2   1 
ATOM 3220  N N     . ALA E 1 88  ? 71.352  59.135  53.946  1.00 55.64  ?  88  ALA E N     1 
ATOM 3221  C CA    . ALA E 1 88  ? 71.902  57.975  54.634  1.00 55.64  ?  88  ALA E CA    1 
ATOM 3222  C C     . ALA E 1 88  ? 73.071  58.334  55.534  1.00 55.64  ?  88  ALA E C     1 
ATOM 3223  O O     . ALA E 1 88  ? 73.450  57.526  56.385  1.00 55.64  ?  88  ALA E O     1 
ATOM 3224  C CB    . ALA E 1 88  ? 72.335  56.918  53.621  1.00 55.64  ?  88  ALA E CB    1 
ATOM 3225  N N     . GLN E 1 89  ? 73.647  59.516  55.371  1.00 53.29  ?  89  GLN E N     1 
ATOM 3226  C CA    . GLN E 1 89  ? 74.729  59.949  56.237  1.00 53.29  ?  89  GLN E CA    1 
ATOM 3227  C C     . GLN E 1 89  ? 74.213  60.666  57.481  1.00 53.29  ?  89  GLN E C     1 
ATOM 3228  O O     . GLN E 1 89  ? 74.880  60.647  58.524  1.00 53.29  ?  89  GLN E O     1 
ATOM 3229  C CB    . GLN E 1 89  ? 75.671  60.850  55.439  1.00 53.29  ?  89  GLN E CB    1 
ATOM 3230  C CG    . GLN E 1 89  ? 76.995  61.152  56.084  1.00 53.29  ?  89  GLN E CG    1 
ATOM 3231  C CD    . GLN E 1 89  ? 77.864  61.992  55.181  1.00 53.29  ?  89  GLN E CD    1 
ATOM 3232  O OE1   . GLN E 1 89  ? 77.438  62.398  54.101  1.00 53.29  ?  89  GLN E OE1   1 
ATOM 3233  N NE2   . GLN E 1 89  ? 79.090  62.254  55.610  1.00 53.29  ?  89  GLN E NE2   1 
ATOM 3234  N N     . ALA E 1 90  ? 73.017  61.257  57.405  1.00 49.61  ?  90  ALA E N     1 
ATOM 3235  C CA    . ALA E 1 90  ? 72.488  62.033  58.523  1.00 49.61  ?  90  ALA E CA    1 
ATOM 3236  C C     . ALA E 1 90  ? 72.091  61.143  59.688  1.00 49.61  ?  90  ALA E C     1 
ATOM 3237  O O     . ALA E 1 90  ? 72.292  61.511  60.853  1.00 49.61  ?  90  ALA E O     1 
ATOM 3238  C CB    . ALA E 1 90  ? 71.289  62.856  58.071  1.00 49.61  ?  90  ALA E CB    1 
ATOM 3239  N N     . LEU E 1 91  ? 71.518  59.976  59.399  1.00 50.78  ?  91  LEU E N     1 
ATOM 3240  C CA    . LEU E 1 91  ? 71.185  59.050  60.471  1.00 50.78  ?  91  LEU E CA    1 
ATOM 3241  C C     . LEU E 1 91  ? 72.434  58.505  61.141  1.00 50.78  ?  91  LEU E C     1 
ATOM 3242  O O     . LEU E 1 91  ? 72.444  58.322  62.363  1.00 50.78  ?  91  LEU E O     1 
ATOM 3243  C CB    . LEU E 1 91  ? 70.326  57.913  59.937  1.00 50.78  ?  91  LEU E CB    1 
ATOM 3244  C CG    . LEU E 1 91  ? 68.959  58.393  59.465  1.00 50.78  ?  91  LEU E CG    1 
ATOM 3245  C CD1   . LEU E 1 91  ? 68.157  57.243  58.888  1.00 50.78  ?  91  LEU E CD1   1 
ATOM 3246  C CD2   . LEU E 1 91  ? 68.215  59.064  60.602  1.00 50.78  ?  91  LEU E CD2   1 
ATOM 3247  N N     . LEU E 1 92  ? 73.502  58.288  60.371  1.00 47.63  ?  92  LEU E N     1 
ATOM 3248  C CA    . LEU E 1 92  ? 74.778  57.896  60.960  1.00 47.63  ?  92  LEU E CA    1 
ATOM 3249  C C     . LEU E 1 92  ? 75.346  59.007  61.832  1.00 47.63  ?  92  LEU E C     1 
ATOM 3250  O O     . LEU E 1 92  ? 75.929  58.735  62.890  1.00 47.63  ?  92  LEU E O     1 
ATOM 3251  C CB    . LEU E 1 92  ? 75.770  57.521  59.861  1.00 47.63  ?  92  LEU E CB    1 
ATOM 3252  C CG    . LEU E 1 92  ? 75.853  56.066  59.386  1.00 47.63  ?  92  LEU E CG    1 
ATOM 3253  C CD1   . LEU E 1 92  ? 76.338  55.200  60.520  1.00 47.63  ?  92  LEU E CD1   1 
ATOM 3254  C CD2   . LEU E 1 92  ? 74.545  55.521  58.827  1.00 47.63  ?  92  LEU E CD2   1 
ATOM 3255  N N     . ALA E 1 93  ? 75.150  60.261  61.418  1.00 45.91  ?  93  ALA E N     1 
ATOM 3256  C CA    . ALA E 1 93  ? 75.615  61.400  62.204  1.00 45.91  ?  93  ALA E CA    1 
ATOM 3257  C C     . ALA E 1 93  ? 74.891  61.487  63.538  1.00 45.91  ?  93  ALA E C     1 
ATOM 3258  O O     . ALA E 1 93  ? 75.519  61.640  64.598  1.00 45.91  ?  93  ALA E O     1 
ATOM 3259  C CB    . ALA E 1 93  ? 75.419  62.691  61.413  1.00 45.91  ?  93  ALA E CB    1 
ATOM 3260  N N     . LEU E 1 94  ? 73.569  61.359  63.501  1.00 44.10  ?  94  LEU E N     1 
ATOM 3261  C CA    . LEU E 1 94  ? 72.788  61.426  64.725  1.00 44.10  ?  94  LEU E CA    1 
ATOM 3262  C C     . LEU E 1 94  ? 73.056  60.218  65.618  1.00 44.10  ?  94  LEU E C     1 
ATOM 3263  O O     . LEU E 1 94  ? 73.048  60.349  66.848  1.00 44.10  ?  94  LEU E O     1 
ATOM 3264  C CB    . LEU E 1 94  ? 71.313  61.556  64.362  1.00 44.10  ?  94  LEU E CB    1 
ATOM 3265  C CG    . LEU E 1 94  ? 70.289  62.007  65.393  1.00 44.10  ?  94  LEU E CG    1 
ATOM 3266  C CD1   . LEU E 1 94  ? 69.242  62.814  64.682  1.00 44.10  ?  94  LEU E CD1   1 
ATOM 3267  C CD2   . LEU E 1 94  ? 69.627  60.832  66.020  1.00 44.10  ?  94  LEU E CD2   1 
ATOM 3268  N N     . GLN E 1 95  ? 73.366  59.061  65.025  1.00 50.90  ?  95  GLN E N     1 
ATOM 3269  C CA    . GLN E 1 95  ? 73.697  57.888  65.826  1.00 50.90  ?  95  GLN E CA    1 
ATOM 3270  C C     . GLN E 1 95  ? 75.040  58.046  66.520  1.00 50.90  ?  95  GLN E C     1 
ATOM 3271  O O     . GLN E 1 95  ? 75.187  57.646  67.682  1.00 50.90  ?  95  GLN E O     1 
ATOM 3272  C CB    . GLN E 1 95  ? 73.687  56.635  64.954  1.00 50.90  ?  95  GLN E CB    1 
ATOM 3273  C CG    . GLN E 1 95  ? 73.956  55.352  65.715  1.00 50.90  ?  95  GLN E CG    1 
ATOM 3274  C CD    . GLN E 1 95  ? 73.817  54.121  64.850  1.00 50.90  ?  95  GLN E CD    1 
ATOM 3275  O OE1   . GLN E 1 95  ? 73.493  54.211  63.668  1.00 50.90  ?  95  GLN E OE1   1 
ATOM 3276  N NE2   . GLN E 1 95  ? 74.076  52.960  65.433  1.00 50.90  ?  95  GLN E NE2   1 
ATOM 3277  N N     . GLU E 1 96  ? 76.022  58.643  65.840  1.00 48.27  ?  96  GLU E N     1 
ATOM 3278  C CA    . GLU E 1 96  ? 77.310  58.890  66.485  1.00 48.27  ?  96  GLU E CA    1 
ATOM 3279  C C     . GLU E 1 96  ? 77.185  59.902  67.615  1.00 48.27  ?  96  GLU E C     1 
ATOM 3280  O O     . GLU E 1 96  ? 77.806  59.732  68.675  1.00 48.27  ?  96  GLU E O     1 
ATOM 3281  C CB    . GLU E 1 96  ? 78.340  59.365  65.467  1.00 48.27  ?  96  GLU E CB    1 
ATOM 3282  C CG    . GLU E 1 96  ? 78.794  58.291  64.502  1.00 48.27  ?  96  GLU E CG    1 
ATOM 3283  C CD    . GLU E 1 96  ? 79.588  57.189  65.177  1.00 48.27  ?  96  GLU E CD    1 
ATOM 3284  O OE1   . GLU E 1 96  ? 80.281  57.472  66.178  1.00 48.27  ?  96  GLU E OE1   1 
ATOM 3285  O OE2   . GLU E 1 96  ? 79.531  56.039  64.696  1.00 48.27  -1 96  GLU E OE2   1 
ATOM 3286  N N     . ALA E 1 97  ? 76.362  60.936  67.421  1.00 41.89  ?  97  ALA E N     1 
ATOM 3287  C CA    . ALA E 1 97  ? 76.146  61.902  68.495  1.00 41.89  ?  97  ALA E CA    1 
ATOM 3288  C C     . ALA E 1 97  ? 75.443  61.271  69.691  1.00 41.89  ?  97  ALA E C     1 
ATOM 3289  O O     . ALA E 1 97  ? 75.828  61.521  70.839  1.00 41.89  ?  97  ALA E O     1 
ATOM 3290  C CB    . ALA E 1 97  ? 75.345  63.088  67.986  1.00 41.89  ?  97  ALA E CB    1 
ATOM 3291  N N     . ALA E 1 98  ? 74.438  60.425  69.441  1.00 42.84  ?  98  ALA E N     1 
ATOM 3292  C CA    . ALA E 1 98  ? 73.711  59.800  70.542  1.00 42.84  ?  98  ALA E CA    1 
ATOM 3293  C C     . ALA E 1 98  ? 74.576  58.795  71.293  1.00 42.84  ?  98  ALA E C     1 
ATOM 3294  O O     . ALA E 1 98  ? 74.503  58.713  72.526  1.00 42.84  ?  98  ALA E O     1 
ATOM 3295  C CB    . ALA E 1 98  ? 72.445  59.127  70.021  1.00 42.84  ?  98  ALA E CB    1 
ATOM 3296  N N     . GLU E 1 99  ? 75.420  58.046  70.579  1.00 48.54  ?  99  GLU E N     1 
ATOM 3297  C CA    . GLU E 1 99  ? 76.304  57.106  71.259  1.00 48.54  ?  99  GLU E CA    1 
ATOM 3298  C C     . GLU E 1 99  ? 77.357  57.828  72.086  1.00 48.54  ?  99  GLU E C     1 
ATOM 3299  O O     . GLU E 1 99  ? 77.631  57.423  73.223  1.00 48.54  ?  99  GLU E O     1 
ATOM 3300  C CB    . GLU E 1 99  ? 76.968  56.161  70.260  1.00 48.54  ?  99  GLU E CB    1 
ATOM 3301  C CG    . GLU E 1 99  ? 76.030  55.131  69.659  1.00 48.54  ?  99  GLU E CG    1 
ATOM 3302  C CD    . GLU E 1 99  ? 76.734  54.172  68.713  1.00 48.54  ?  99  GLU E CD    1 
ATOM 3303  O OE1   . GLU E 1 99  ? 77.932  54.382  68.424  1.00 48.54  ?  99  GLU E OE1   1 
ATOM 3304  O OE2   . GLU E 1 99  ? 76.087  53.202  68.263  1.00 48.54  -1 99  GLU E OE2   1 
ATOM 3305  N N     . ALA E 1 100 ? 77.934  58.914  71.553  1.00 41.58  ?  100 ALA E N     1 
ATOM 3306  C CA    . ALA E 1 100 ? 78.933  59.659  72.317  1.00 41.58  ?  100 ALA E CA    1 
ATOM 3307  C C     . ALA E 1 100 ? 78.315  60.323  73.544  1.00 41.58  ?  100 ALA E C     1 
ATOM 3308  O O     . ALA E 1 100 ? 78.917  60.321  74.627  1.00 41.58  ?  100 ALA E O     1 
ATOM 3309  C CB    . ALA E 1 100 ? 79.607  60.702  71.430  1.00 41.58  ?  100 ALA E CB    1 
ATOM 3310  N N     . PHE E 1 101 ? 77.084  60.826  73.407  1.00 37.29  ?  101 PHE E N     1 
ATOM 3311  C CA    . PHE E 1 101 ? 76.382  61.420  74.538  1.00 37.29  ?  101 PHE E CA    1 
ATOM 3312  C C     . PHE E 1 101 ? 76.064  60.398  75.620  1.00 37.29  ?  101 PHE E C     1 
ATOM 3313  O O     . PHE E 1 101 ? 76.265  60.677  76.806  1.00 37.29  ?  101 PHE E O     1 
ATOM 3314  C CB    . PHE E 1 101 ? 75.108  62.098  74.061  1.00 37.29  ?  101 PHE E CB    1 
ATOM 3315  C CG    . PHE E 1 101 ? 74.237  62.575  75.174  1.00 37.29  ?  101 PHE E CG    1 
ATOM 3316  C CD1   . PHE E 1 101 ? 74.609  63.642  75.961  1.00 37.29  ?  101 PHE E CD1   1 
ATOM 3317  C CD2   . PHE E 1 101 ? 73.021  61.950  75.417  1.00 37.29  ?  101 PHE E CD2   1 
ATOM 3318  C CE1   . PHE E 1 101 ? 73.800  64.075  76.987  1.00 37.29  ?  101 PHE E CE1   1 
ATOM 3319  C CE2   . PHE E 1 101 ? 72.211  62.382  76.432  1.00 37.29  ?  101 PHE E CE2   1 
ATOM 3320  C CZ    . PHE E 1 101 ? 72.594  63.447  77.217  1.00 37.29  ?  101 PHE E CZ    1 
ATOM 3321  N N     . LEU E 1 102 ? 75.579  59.212  75.247  1.00 35.90  ?  102 LEU E N     1 
ATOM 3322  C CA    . LEU E 1 102 ? 75.228  58.231  76.272  1.00 35.90  ?  102 LEU E CA    1 
ATOM 3323  C C     . LEU E 1 102 ? 76.458  57.647  76.953  1.00 35.90  ?  102 LEU E C     1 
ATOM 3324  O O     . LEU E 1 102 ? 76.428  57.387  78.164  1.00 35.90  ?  102 LEU E O     1 
ATOM 3325  C CB    . LEU E 1 102 ? 74.378  57.117  75.685  1.00 35.90  ?  102 LEU E CB    1 
ATOM 3326  C CG    . LEU E 1 102 ? 72.970  57.552  75.328  1.00 35.90  ?  102 LEU E CG    1 
ATOM 3327  C CD1   . LEU E 1 102 ? 72.236  56.388  74.714  1.00 35.90  ?  102 LEU E CD1   1 
ATOM 3328  C CD2   . LEU E 1 102 ? 72.264  58.048  76.567  1.00 35.90  ?  102 LEU E CD2   1 
ATOM 3329  N N     . VAL E 1 103 ? 77.548  57.439  76.205  1.00 39.72  ?  103 VAL E N     1 
ATOM 3330  C CA    . VAL E 1 103 ? 78.771  56.934  76.824  1.00 39.72  ?  103 VAL E CA    1 
ATOM 3331  C C     . VAL E 1 103 ? 79.349  57.964  77.784  1.00 39.72  ?  103 VAL E C     1 
ATOM 3332  O O     . VAL E 1 103 ? 79.757  57.624  78.905  1.00 39.72  ?  103 VAL E O     1 
ATOM 3333  C CB    . VAL E 1 103 ? 79.787  56.521  75.746  1.00 39.72  ?  103 VAL E CB    1 
ATOM 3334  C CG1   . VAL E 1 103 ? 81.146  56.234  76.357  1.00 39.72  ?  103 VAL E CG1   1 
ATOM 3335  C CG2   . VAL E 1 103 ? 79.294  55.286  75.032  1.00 39.72  ?  103 VAL E CG2   1 
ATOM 3336  N N     . HIS E 1 104 ? 79.332  59.241  77.392  1.00 39.08  ?  104 HIS E N     1 
ATOM 3337  C CA    . HIS E 1 104 ? 79.806  60.285  78.289  1.00 39.08  ?  104 HIS E CA    1 
ATOM 3338  C C     . HIS E 1 104 ? 78.905  60.439  79.509  1.00 39.08  ?  104 HIS E C     1 
ATOM 3339  O O     . HIS E 1 104 ? 79.401  60.702  80.609  1.00 39.08  ?  104 HIS E O     1 
ATOM 3340  C CB    . HIS E 1 104 ? 79.907  61.595  77.526  1.00 39.08  ?  104 HIS E CB    1 
ATOM 3341  C CG    . HIS E 1 104 ? 80.600  62.673  78.284  1.00 39.08  ?  104 HIS E CG    1 
ATOM 3342  N ND1   . HIS E 1 104 ? 79.944  63.493  79.173  1.00 39.08  ?  104 HIS E ND1   1 
ATOM 3343  C CD2   . HIS E 1 104 ? 81.893  63.069  78.286  1.00 39.08  ?  104 HIS E CD2   1 
ATOM 3344  C CE1   . HIS E 1 104 ? 80.805  64.350  79.692  1.00 39.08  ?  104 HIS E CE1   1 
ATOM 3345  N NE2   . HIS E 1 104 ? 81.995  64.114  79.169  1.00 39.08  ?  104 HIS E NE2   1 
ATOM 3346  N N     . LEU E 1 105 ? 77.598  60.209  79.350  1.00 34.83  ?  105 LEU E N     1 
ATOM 3347  C CA    . LEU E 1 105 ? 76.683  60.282  80.485  1.00 34.83  ?  105 LEU E CA    1 
ATOM 3348  C C     . LEU E 1 105 ? 76.919  59.156  81.479  1.00 34.83  ?  105 LEU E C     1 
ATOM 3349  O O     . LEU E 1 105 ? 76.932  59.397  82.689  1.00 34.83  ?  105 LEU E O     1 
ATOM 3350  C CB    . LEU E 1 105 ? 75.237  60.253  80.005  1.00 34.83  ?  105 LEU E CB    1 
ATOM 3351  C CG    . LEU E 1 105 ? 74.192  60.313  81.117  1.00 34.83  ?  105 LEU E CG    1 
ATOM 3352  C CD1   . LEU E 1 105 ? 74.317  61.612  81.867  1.00 34.83  ?  105 LEU E CD1   1 
ATOM 3353  C CD2   . LEU E 1 105 ? 72.799  60.154  80.556  1.00 34.83  ?  105 LEU E CD2   1 
ATOM 3354  N N     . PHE E 1 106 ? 77.099  57.922  81.001  1.00 38.61  ?  106 PHE E N     1 
ATOM 3355  C CA    . PHE E 1 106 ? 77.357  56.832  81.942  1.00 38.61  ?  106 PHE E CA    1 
ATOM 3356  C C     . PHE E 1 106 ? 78.720  56.962  82.602  1.00 38.61  ?  106 PHE E C     1 
ATOM 3357  O O     . PHE E 1 106 ? 78.855  56.684  83.799  1.00 38.61  ?  106 PHE E O     1 
ATOM 3358  C CB    . PHE E 1 106 ? 77.240  55.471  81.271  1.00 38.61  ?  106 PHE E CB    1 
ATOM 3359  C CG    . PHE E 1 106 ? 75.841  55.010  81.101  1.00 38.61  ?  106 PHE E CG    1 
ATOM 3360  C CD1   . PHE E 1 106 ? 75.105  54.624  82.201  1.00 38.61  ?  106 PHE E CD1   1 
ATOM 3361  C CD2   . PHE E 1 106 ? 75.275  54.906  79.850  1.00 38.61  ?  106 PHE E CD2   1 
ATOM 3362  C CE1   . PHE E 1 106 ? 73.817  54.187  82.055  1.00 38.61  ?  106 PHE E CE1   1 
ATOM 3363  C CE2   . PHE E 1 106 ? 73.987  54.470  79.703  1.00 38.61  ?  106 PHE E CE2   1 
ATOM 3364  C CZ    . PHE E 1 106 ? 73.259  54.105  80.804  1.00 38.61  ?  106 PHE E CZ    1 
ATOM 3365  N N     . GLU E 1 107 ? 79.734  57.402  81.853  1.00 43.98  ?  107 GLU E N     1 
ATOM 3366  C CA    . GLU E 1 107 ? 81.054  57.579  82.449  1.00 43.98  ?  107 GLU E CA    1 
ATOM 3367  C C     . GLU E 1 107 ? 81.069  58.734  83.442  1.00 43.98  ?  107 GLU E C     1 
ATOM 3368  O O     . GLU E 1 107 ? 81.842  58.711  84.404  1.00 43.98  ?  107 GLU E O     1 
ATOM 3369  C CB    . GLU E 1 107 ? 82.094  57.789  81.348  1.00 43.98  ?  107 GLU E CB    1 
ATOM 3370  C CG    . GLU E 1 107 ? 83.551  57.693  81.786  1.00 43.98  ?  107 GLU E CG    1 
ATOM 3371  C CD    . GLU E 1 107 ? 84.123  59.017  82.255  1.00 43.98  ?  107 GLU E CD    1 
ATOM 3372  O OE1   . GLU E 1 107 ? 83.660  60.072  81.774  1.00 43.98  ?  107 GLU E OE1   1 
ATOM 3373  O OE2   . GLU E 1 107 ? 85.033  59.003  83.110  1.00 43.98  -1 107 GLU E OE2   1 
ATOM 3374  N N     . ASP E 1 108 ? 80.214  59.735  83.246  1.00 42.67  ?  108 ASP E N     1 
ATOM 3375  C CA    . ASP E 1 108 ? 80.144  60.820  84.211  1.00 42.67  ?  108 ASP E CA    1 
ATOM 3376  C C     . ASP E 1 108 ? 79.327  60.416  85.430  1.00 42.67  ?  108 ASP E C     1 
ATOM 3377  O O     . ASP E 1 108 ? 79.676  60.771  86.558  1.00 42.67  ?  108 ASP E O     1 
ATOM 3378  C CB    . ASP E 1 108 ? 79.553  62.055  83.539  1.00 42.67  ?  108 ASP E CB    1 
ATOM 3379  C CG    . ASP E 1 108 ? 79.858  63.332  84.284  1.00 42.67  ?  108 ASP E CG    1 
ATOM 3380  O OD1   . ASP E 1 108 ? 80.523  63.272  85.337  1.00 42.67  ?  108 ASP E OD1   1 
ATOM 3381  O OD2   . ASP E 1 108 ? 79.444  64.408  83.802  1.00 42.67  -1 108 ASP E OD2   1 
ATOM 3382  N N     . ALA E 1 109 ? 78.249  59.664  85.229  1.00 41.75  ?  109 ALA E N     1 
ATOM 3383  C CA    . ALA E 1 109 ? 77.387  59.260  86.327  1.00 41.75  ?  109 ALA E CA    1 
ATOM 3384  C C     . ALA E 1 109 ? 77.954  58.115  87.145  1.00 41.75  ?  109 ALA E C     1 
ATOM 3385  O O     . ALA E 1 109 ? 77.442  57.854  88.238  1.00 41.75  ?  109 ALA E O     1 
ATOM 3386  C CB    . ALA E 1 109 ? 76.012  58.858  85.797  1.00 41.75  ?  109 ALA E CB    1 
ATOM 3387  N N     . TYR E 1 110 ? 78.970  57.413  86.644  1.00 43.98  ?  110 TYR E N     1 
ATOM 3388  C CA    . TYR E 1 110 ? 79.550  56.336  87.434  1.00 43.98  ?  110 TYR E CA    1 
ATOM 3389  C C     . TYR E 1 110 ? 80.335  56.866  88.622  1.00 43.98  ?  110 TYR E C     1 
ATOM 3390  O O     . TYR E 1 110 ? 80.414  56.193  89.654  1.00 43.98  ?  110 TYR E O     1 
ATOM 3391  C CB    . TYR E 1 110 ? 80.446  55.460  86.570  1.00 43.98  ?  110 TYR E CB    1 
ATOM 3392  C CG    . TYR E 1 110 ? 80.976  54.271  87.311  1.00 43.98  ?  110 TYR E CG    1 
ATOM 3393  C CD1   . TYR E 1 110 ? 80.155  53.197  87.599  1.00 43.98  ?  110 TYR E CD1   1 
ATOM 3394  C CD2   . TYR E 1 110 ? 82.291  54.226  87.738  1.00 43.98  ?  110 TYR E CD2   1 
ATOM 3395  C CE1   . TYR E 1 110 ? 80.627  52.105  88.283  1.00 43.98  ?  110 TYR E CE1   1 
ATOM 3396  C CE2   . TYR E 1 110 ? 82.775  53.139  88.426  1.00 43.98  ?  110 TYR E CE2   1 
ATOM 3397  C CZ    . TYR E 1 110 ? 81.938  52.081  88.695  1.00 43.98  ?  110 TYR E CZ    1 
ATOM 3398  O OH    . TYR E 1 110 ? 82.418  50.991  89.381  1.00 43.98  ?  110 TYR E OH    1 
ATOM 3399  N N     . LEU E 1 111 ? 80.885  58.079  88.519  1.00 41.05  ?  111 LEU E N     1 
ATOM 3400  C CA    . LEU E 1 111 ? 81.675  58.652  89.604  1.00 41.05  ?  111 LEU E CA    1 
ATOM 3401  C C     . LEU E 1 111 ? 80.851  59.025  90.825  1.00 41.05  ?  111 LEU E C     1 
ATOM 3402  O O     . LEU E 1 111 ? 81.436  59.399  91.844  1.00 41.05  ?  111 LEU E O     1 
ATOM 3403  C CB    . LEU E 1 111 ? 82.430  59.883  89.122  1.00 41.05  ?  111 LEU E CB    1 
ATOM 3404  C CG    . LEU E 1 111 ? 83.571  59.563  88.171  1.00 41.05  ?  111 LEU E CG    1 
ATOM 3405  C CD1   . LEU E 1 111 ? 84.179  60.835  87.635  1.00 41.05  ?  111 LEU E CD1   1 
ATOM 3406  C CD2   . LEU E 1 111 ? 84.607  58.736  88.900  1.00 41.05  ?  111 LEU E CD2   1 
ATOM 3407  N N     . LEU E 1 112 ? 79.527  58.945  90.759  1.00 42.12  ?  112 LEU E N     1 
ATOM 3408  C CA    . LEU E 1 112 ? 78.699  59.114  91.937  1.00 42.12  ?  112 LEU E CA    1 
ATOM 3409  C C     . LEU E 1 112 ? 78.247  57.783  92.514  1.00 42.12  ?  112 LEU E C     1 
ATOM 3410  O O     . LEU E 1 112 ? 77.284  57.740  93.284  1.00 42.12  ?  112 LEU E O     1 
ATOM 3411  C CB    . LEU E 1 112 ? 77.504  60.003  91.616  1.00 42.12  ?  112 LEU E CB    1 
ATOM 3412  C CG    . LEU E 1 112 ? 77.975  61.400  91.223  1.00 42.12  ?  112 LEU E CG    1 
ATOM 3413  C CD1   . LEU E 1 112 ? 76.804  62.299  90.884  1.00 42.12  ?  112 LEU E CD1   1 
ATOM 3414  C CD2   . LEU E 1 112 ? 78.832  61.998  92.319  1.00 42.12  ?  112 LEU E CD2   1 
ATOM 3415  N N     . THR E 1 113 ? 78.925  56.698  92.158  1.00 49.26  ?  113 THR E N     1 
ATOM 3416  C CA    . THR E 1 113 ? 78.738  55.417  92.816  1.00 49.26  ?  113 THR E CA    1 
ATOM 3417  C C     . THR E 1 113 ? 79.978  54.935  93.539  1.00 49.26  ?  113 THR E C     1 
ATOM 3418  O O     . THR E 1 113 ? 79.858  54.220  94.532  1.00 49.26  ?  113 THR E O     1 
ATOM 3419  C CB    . THR E 1 113 ? 78.315  54.354  91.806  1.00 49.26  ?  113 THR E CB    1 
ATOM 3420  O OG1   . THR E 1 113 ? 79.314  54.250  90.787  1.00 49.26  ?  113 THR E OG1   1 
ATOM 3421  C CG2   . THR E 1 113 ? 77.000  54.733  91.188  1.00 49.26  ?  113 THR E CG2   1 
ATOM 3422  N N     . LEU E 1 114 ? 81.163  55.308  93.062  1.00 49.42  ?  114 LEU E N     1 
ATOM 3423  C CA    . LEU E 1 114 ? 82.363  55.127  93.865  1.00 49.42  ?  114 LEU E CA    1 
ATOM 3424  C C     . LEU E 1 114 ? 82.387  56.106  95.026  1.00 49.42  ?  114 LEU E C     1 
ATOM 3425  O O     . LEU E 1 114 ? 83.012  55.838  96.057  1.00 49.42  ?  114 LEU E O     1 
ATOM 3426  C CB    . LEU E 1 114 ? 83.604  55.318  93.004  1.00 49.42  ?  114 LEU E CB    1 
ATOM 3427  C CG    . LEU E 1 114 ? 83.778  54.326  91.864  1.00 49.42  ?  114 LEU E CG    1 
ATOM 3428  C CD1   . LEU E 1 114 ? 84.992  54.697  91.041  1.00 49.42  ?  114 LEU E CD1   1 
ATOM 3429  C CD2   . LEU E 1 114 ? 83.902  52.924  92.407  1.00 49.42  ?  114 LEU E CD2   1 
ATOM 3430  N N     . HIS E 1 115 ? 81.717  57.244  94.867  1.00 47.59  ?  115 HIS E N     1 
ATOM 3431  C CA    . HIS E 1 115 ? 81.719  58.270  95.895  1.00 47.59  ?  115 HIS E CA    1 
ATOM 3432  C C     . HIS E 1 115 ? 80.864  57.875  97.086  1.00 47.59  ?  115 HIS E C     1 
ATOM 3433  O O     . HIS E 1 115 ? 81.165  58.263  98.218  1.00 47.59  ?  115 HIS E O     1 
ATOM 3434  C CB    . HIS E 1 115 ? 81.221  59.579  95.303  1.00 47.59  ?  115 HIS E CB    1 
ATOM 3435  C CG    . HIS E 1 115 ? 81.280  60.724  96.252  1.00 47.59  ?  115 HIS E CG    1 
ATOM 3436  N ND1   . HIS E 1 115 ? 82.463  61.338  96.595  1.00 47.59  ?  115 HIS E ND1   1 
ATOM 3437  C CD2   . HIS E 1 115 ? 80.306  61.367  96.936  1.00 47.59  ?  115 HIS E CD2   1 
ATOM 3438  C CE1   . HIS E 1 115 ? 82.216  62.316  97.446  1.00 47.59  ?  115 HIS E CE1   1 
ATOM 3439  N NE2   . HIS E 1 115 ? 80.915  62.355  97.670  1.00 47.59  ?  115 HIS E NE2   1 
ATOM 3440  N N     . ALA E 1 116 ? 79.802  57.113  96.855  1.00 54.25  ?  116 ALA E N     1 
ATOM 3441  C CA    . ALA E 1 116 ? 78.931  56.651  97.923  1.00 54.25  ?  116 ALA E CA    1 
ATOM 3442  C C     . ALA E 1 116 ? 79.387  55.331  98.519  1.00 54.25  ?  116 ALA E C     1 
ATOM 3443  O O     . ALA E 1 116 ? 78.681  54.767  99.359  1.00 54.25  ?  116 ALA E O     1 
ATOM 3444  C CB    . ALA E 1 116 ? 77.497  56.514  97.415  1.00 54.25  ?  116 ALA E CB    1 
ATOM 3445  N N     . GLY E 1 117 ? 80.543  54.822  98.102  1.00 56.49  ?  117 GLY E N     1 
ATOM 3446  C CA    . GLY E 1 117 ? 81.012  53.533  98.551  1.00 56.49  ?  117 GLY E CA    1 
ATOM 3447  C C     . GLY E 1 117 ? 80.469  52.356  97.778  1.00 56.49  ?  117 GLY E C     1 
ATOM 3448  O O     . GLY E 1 117 ? 81.002  51.249  97.918  1.00 56.49  ?  117 GLY E O     1 
ATOM 3449  N N     . ARG E 1 118 ? 79.446  52.553  96.950  1.00 65.14  ?  118 ARG E N     1 
ATOM 3450  C CA    . ARG E 1 118 ? 78.844  51.459  96.210  1.00 65.14  ?  118 ARG E CA    1 
ATOM 3451  C C     . ARG E 1 118 ? 79.738  51.038  95.049  1.00 65.14  ?  118 ARG E C     1 
ATOM 3452  O O     . ARG E 1 118 ? 80.846  51.539  94.853  1.00 65.14  ?  118 ARG E O     1 
ATOM 3453  C CB    . ARG E 1 118 ? 77.476  51.860  95.676  1.00 65.14  ?  118 ARG E CB    1 
ATOM 3454  C CG    . ARG E 1 118 ? 76.441  52.109  96.725  1.00 65.14  ?  118 ARG E CG    1 
ATOM 3455  C CD    . ARG E 1 118 ? 75.126  52.421  96.062  1.00 65.14  ?  118 ARG E CD    1 
ATOM 3456  N NE    . ARG E 1 118 ? 74.076  52.660  97.037  1.00 65.14  ?  118 ARG E NE    1 
ATOM 3457  C CZ    . ARG E 1 118 ? 73.749  53.863  97.489  1.00 65.14  ?  118 ARG E CZ    1 
ATOM 3458  N NH1   . ARG E 1 118 ? 74.387  54.933  97.038  1.00 65.14  1  118 ARG E NH1   1 
ATOM 3459  N NH2   . ARG E 1 118 ? 72.780  53.997  98.383  1.00 65.14  ?  118 ARG E NH2   1 
ATOM 3460  N N     . VAL E 1 119 ? 79.243  50.082  94.270  1.00 63.94  ?  119 VAL E N     1 
ATOM 3461  C CA    . VAL E 1 119 ? 79.927  49.654  93.059  1.00 63.94  ?  119 VAL E CA    1 
ATOM 3462  C C     . VAL E 1 119 ? 78.955  49.859  91.903  1.00 63.94  ?  119 VAL E C     1 
ATOM 3463  O O     . VAL E 1 119 ? 79.356  50.168  90.775  1.00 63.94  ?  119 VAL E O     1 
ATOM 3464  C CB    . VAL E 1 119 ? 80.384  48.187  93.173  1.00 63.94  ?  119 VAL E CB    1 
ATOM 3465  C CG1   . VAL E 1 119 ? 81.150  47.760  91.950  1.00 63.94  ?  119 VAL E CG1   1 
ATOM 3466  C CG2   . VAL E 1 119 ? 81.229  47.970  94.415  1.00 63.94  ?  119 VAL E CG2   1 
ATOM 3467  N N     . THR E 1 120 ? 77.665  49.768  92.201  1.00 61.31  ?  120 THR E N     1 
ATOM 3468  C CA    . THR E 1 120 ? 76.622  49.617  91.199  1.00 61.31  ?  120 THR E CA    1 
ATOM 3469  C C     . THR E 1 120 ? 75.903  50.939  90.952  1.00 61.31  ?  120 THR E C     1 
ATOM 3470  O O     . THR E 1 120 ? 75.660  51.705  91.887  1.00 61.31  ?  120 THR E O     1 
ATOM 3471  C CB    . THR E 1 120 ? 75.634  48.549  91.670  1.00 61.31  ?  120 THR E CB    1 
ATOM 3472  O OG1   . THR E 1 120 ? 76.364  47.368  92.015  1.00 61.31  ?  120 THR E OG1   1 
ATOM 3473  C CG2   . THR E 1 120 ? 74.642  48.182  90.584  1.00 61.31  ?  120 THR E CG2   1 
ATOM 3474  N N     . LEU E 1 121 ? 75.569  51.206  89.688  1.00 51.46  ?  121 LEU E N     1 
ATOM 3475  C CA    . LEU E 1 121 ? 74.743  52.350  89.329  1.00 51.46  ?  121 LEU E CA    1 
ATOM 3476  C C     . LEU E 1 121 ? 73.318  52.200  89.863  1.00 51.46  ?  121 LEU E C     1 
ATOM 3477  O O     . LEU E 1 121 ? 72.879  51.123  90.271  1.00 51.46  ?  121 LEU E O     1 
ATOM 3478  C CB    . LEU E 1 121 ? 74.677  52.516  87.817  1.00 51.46  ?  121 LEU E CB    1 
ATOM 3479  C CG    . LEU E 1 121 ? 75.921  52.970  87.080  1.00 51.46  ?  121 LEU E CG    1 
ATOM 3480  C CD1   . LEU E 1 121 ? 75.651  52.885  85.605  1.00 51.46  ?  121 LEU E CD1   1 
ATOM 3481  C CD2   . LEU E 1 121 ? 76.244  54.389  87.468  1.00 51.46  ?  121 LEU E CD2   1 
ATOM 3482  N N     . PHE E 1 122 ? 72.589  53.309  89.828  1.00 50.67  ?  122 PHE E N     1 
ATOM 3483  C CA    . PHE E 1 122 ? 71.174  53.372  90.161  1.00 50.67  ?  122 PHE E CA    1 
ATOM 3484  C C     . PHE E 1 122 ? 70.558  54.501  89.354  1.00 50.67  ?  122 PHE E C     1 
ATOM 3485  O O     . PHE E 1 122 ? 71.280  55.372  88.859  1.00 50.67  ?  122 PHE E O     1 
ATOM 3486  C CB    . PHE E 1 122 ? 70.956  53.597  91.664  1.00 50.67  ?  122 PHE E CB    1 
ATOM 3487  C CG    . PHE E 1 122 ? 71.172  52.375  92.490  1.00 50.67  ?  122 PHE E CG    1 
ATOM 3488  C CD1   . PHE E 1 122 ? 70.215  51.383  92.522  1.00 50.67  ?  122 PHE E CD1   1 
ATOM 3489  C CD2   . PHE E 1 122 ? 72.321  52.217  93.237  1.00 50.67  ?  122 PHE E CD2   1 
ATOM 3490  C CE1   . PHE E 1 122 ? 70.397  50.249  93.277  1.00 50.67  ?  122 PHE E CE1   1 
ATOM 3491  C CE2   . PHE E 1 122 ? 72.512  51.084  93.993  1.00 50.67  ?  122 PHE E CE2   1 
ATOM 3492  C CZ    . PHE E 1 122 ? 71.546  50.104  94.014  1.00 50.67  ?  122 PHE E CZ    1 
ATOM 3493  N N     . PRO E 1 123 ? 69.236  54.491  89.155  1.00 49.74  ?  123 PRO E N     1 
ATOM 3494  C CA    . PRO E 1 123 ? 68.598  55.638  88.486  1.00 49.74  ?  123 PRO E CA    1 
ATOM 3495  C C     . PRO E 1 123 ? 68.696  56.930  89.268  1.00 49.74  ?  123 PRO E C     1 
ATOM 3496  O O     . PRO E 1 123 ? 68.605  58.009  88.662  1.00 49.74  ?  123 PRO E O     1 
ATOM 3497  C CB    . PRO E 1 123 ? 67.142  55.187  88.331  1.00 49.74  ?  123 PRO E CB    1 
ATOM 3498  C CG    . PRO E 1 123 ? 67.217  53.725  88.310  1.00 49.74  ?  123 PRO E CG    1 
ATOM 3499  C CD    . PRO E 1 123 ? 68.311  53.350  89.253  1.00 49.74  ?  123 PRO E CD    1 
ATOM 3500  N N     . LYS E 1 124 ? 68.886  56.850  90.589  1.00 48.60  ?  124 LYS E N     1 
ATOM 3501  C CA    . LYS E 1 124 ? 69.181  58.034  91.386  1.00 48.60  ?  124 LYS E CA    1 
ATOM 3502  C C     . LYS E 1 124 ? 70.476  58.684  90.928  1.00 48.60  ?  124 LYS E C     1 
ATOM 3503  O O     . LYS E 1 124 ? 70.576  59.915  90.873  1.00 48.60  ?  124 LYS E O     1 
ATOM 3504  C CB    . LYS E 1 124 ? 69.275  57.667  92.867  1.00 48.60  ?  124 LYS E CB    1 
ATOM 3505  C CG    . LYS E 1 124 ? 67.978  57.783  93.665  1.00 48.60  ?  124 LYS E CG    1 
ATOM 3506  C CD    . LYS E 1 124 ? 66.929  56.761  93.242  1.00 48.60  ?  124 LYS E CD    1 
ATOM 3507  C CE    . LYS E 1 124 ? 65.591  57.017  93.915  1.00 48.60  ?  124 LYS E CE    1 
ATOM 3508  N NZ    . LYS E 1 124 ? 65.674  56.932  95.398  1.00 48.60  1  124 LYS E NZ    1 
ATOM 3509  N N     . ASP E 1 125 ? 71.457  57.862  90.542  1.00 49.41  ?  125 ASP E N     1 
ATOM 3510  C CA    . ASP E 1 125 ? 72.752  58.365  90.100  1.00 49.41  ?  125 ASP E CA    1 
ATOM 3511  C C     . ASP E 1 125 ? 72.622  59.125  88.787  1.00 49.41  ?  125 ASP E C     1 
ATOM 3512  O O     . ASP E 1 125 ? 73.176  60.219  88.639  1.00 49.41  ?  125 ASP E O     1 
ATOM 3513  C CB    . ASP E 1 125 ? 73.717  57.199  89.929  1.00 49.41  ?  125 ASP E CB    1 
ATOM 3514  C CG    . ASP E 1 125 ? 73.729  56.274  91.122  1.00 49.41  ?  125 ASP E CG    1 
ATOM 3515  O OD1   . ASP E 1 125 ? 73.484  56.738  92.247  1.00 49.41  ?  125 ASP E OD1   1 
ATOM 3516  O OD2   . ASP E 1 125 ? 73.951  55.060  90.928  1.00 49.41  -1 125 ASP E OD2   1 
ATOM 3517  N N     . VAL E 1 126 ? 71.866  58.567  87.838  1.00 45.68  ?  126 VAL E N     1 
ATOM 3518  C CA    . VAL E 1 126 ? 71.701  59.186  86.528  1.00 45.68  ?  126 VAL E CA    1 
ATOM 3519  C C     . VAL E 1 126 ? 70.874  60.460  86.634  1.00 45.68  ?  126 VAL E C     1 
ATOM 3520  O O     . VAL E 1 126 ? 71.209  61.487  86.024  1.00 45.68  ?  126 VAL E O     1 
ATOM 3521  C CB    . VAL E 1 126 ? 71.073  58.171  85.556  1.00 45.68  ?  126 VAL E CB    1 
ATOM 3522  C CG1   . VAL E 1 126 ? 70.807  58.800  84.210  1.00 45.68  ?  126 VAL E CG1   1 
ATOM 3523  C CG2   . VAL E 1 126 ? 71.983  56.983  85.396  1.00 45.68  ?  126 VAL E CG2   1 
ATOM 3524  N N     . GLN E 1 127 ? 69.792  60.424  87.421  1.00 51.44  ?  127 GLN E N     1 
ATOM 3525  C CA    . GLN E 1 127 ? 68.978  61.623  87.591  1.00 51.44  ?  127 GLN E CA    1 
ATOM 3526  C C     . GLN E 1 127 ? 69.728  62.712  88.345  1.00 51.44  ?  127 GLN E C     1 
ATOM 3527  O O     . GLN E 1 127 ? 69.573  63.894  88.026  1.00 51.44  ?  127 GLN E O     1 
ATOM 3528  C CB    . GLN E 1 127 ? 67.669  61.284  88.298  1.00 51.44  ?  127 GLN E CB    1 
ATOM 3529  C CG    . GLN E 1 127 ? 66.704  60.480  87.443  1.00 51.44  ?  127 GLN E CG    1 
ATOM 3530  C CD    . GLN E 1 127 ? 65.423  60.132  88.173  1.00 51.44  ?  127 GLN E CD    1 
ATOM 3531  O OE1   . GLN E 1 127 ? 65.274  60.415  89.361  1.00 51.44  ?  127 GLN E OE1   1 
ATOM 3532  N NE2   . GLN E 1 127 ? 64.485  59.519  87.461  1.00 51.44  ?  127 GLN E NE2   1 
ATOM 3533  N N     . LEU E 1 128 ? 70.594  62.340  89.290  1.00 46.12  ?  128 LEU E N     1 
ATOM 3534  C CA    . LEU E 1 128 ? 71.406  63.345  89.962  1.00 46.12  ?  128 LEU E CA    1 
ATOM 3535  C C     . LEU E 1 128 ? 72.479  63.898  89.033  1.00 46.12  ?  128 LEU E C     1 
ATOM 3536  O O     . LEU E 1 128 ? 72.796  65.092  89.086  1.00 46.12  ?  128 LEU E O     1 
ATOM 3537  C CB    . LEU E 1 128 ? 72.026  62.753  91.223  1.00 46.12  ?  128 LEU E CB    1 
ATOM 3538  C CG    . LEU E 1 128 ? 72.829  63.712  92.097  1.00 46.12  ?  128 LEU E CG    1 
ATOM 3539  C CD1   . LEU E 1 128 ? 71.947  64.845  92.572  1.00 46.12  ?  128 LEU E CD1   1 
ATOM 3540  C CD2   . LEU E 1 128 ? 73.414  62.970  93.277  1.00 46.12  ?  128 LEU E CD2   1 
ATOM 3541  N N     . ALA E 1 129 ? 73.031  63.050  88.159  1.00 44.91  ?  129 ALA E N     1 
ATOM 3542  C CA    . ALA E 1 129 ? 74.036  63.511  87.209  1.00 44.91  ?  129 ALA E CA    1 
ATOM 3543  C C     . ALA E 1 129 ? 73.446  64.470  86.190  1.00 44.91  ?  129 ALA E C     1 
ATOM 3544  O O     . ALA E 1 129 ? 74.132  65.391  85.737  1.00 44.91  ?  129 ALA E O     1 
ATOM 3545  C CB    . ALA E 1 129 ? 74.674  62.323  86.499  1.00 44.91  ?  129 ALA E CB    1 
ATOM 3546  N N     . ARG E 1 130 ? 72.183  64.276  85.823  1.00 43.74  ?  130 ARG E N     1 
ATOM 3547  C CA    . ARG E 1 130 ? 71.529  65.273  84.988  1.00 43.74  ?  130 ARG E CA    1 
ATOM 3548  C C     . ARG E 1 130 ? 71.118  66.501  85.788  1.00 43.74  ?  130 ARG E C     1 
ATOM 3549  O O     . ARG E 1 130 ? 71.030  67.599  85.229  1.00 43.74  ?  130 ARG E O     1 
ATOM 3550  C CB    . ARG E 1 130 ? 70.315  64.666  84.294  1.00 43.74  ?  130 ARG E CB    1 
ATOM 3551  C CG    . ARG E 1 130 ? 70.672  63.584  83.315  1.00 43.74  ?  130 ARG E CG    1 
ATOM 3552  C CD    . ARG E 1 130 ? 69.442  63.035  82.642  1.00 43.74  ?  130 ARG E CD    1 
ATOM 3553  N NE    . ARG E 1 130 ? 68.818  64.015  81.760  1.00 43.74  ?  130 ARG E NE    1 
ATOM 3554  C CZ    . ARG E 1 130 ? 67.624  64.555  81.970  1.00 43.74  ?  130 ARG E CZ    1 
ATOM 3555  N NH1   . ARG E 1 130 ? 66.914  64.204  83.030  1.00 43.74  1  130 ARG E NH1   1 
ATOM 3556  N NH2   . ARG E 1 130 ? 67.136  65.440  81.114  1.00 43.74  ?  130 ARG E NH2   1 
ATOM 3557  N N     . ARG E 1 131 ? 70.864  66.335  87.087  1.00 42.04  ?  131 ARG E N     1 
ATOM 3558  C CA    . ARG E 1 131 ? 70.518  67.469  87.937  1.00 42.04  ?  131 ARG E CA    1 
ATOM 3559  C C     . ARG E 1 131 ? 71.700  68.409  88.133  1.00 42.04  ?  131 ARG E C     1 
ATOM 3560  O O     . ARG E 1 131 ? 71.509  69.624  88.258  1.00 42.04  ?  131 ARG E O     1 
ATOM 3561  C CB    . ARG E 1 131 ? 70.005  66.942  89.279  1.00 42.04  ?  131 ARG E CB    1 
ATOM 3562  C CG    . ARG E 1 131 ? 69.649  67.981  90.319  1.00 42.04  ?  131 ARG E CG    1 
ATOM 3563  C CD    . ARG E 1 131 ? 68.487  68.826  89.880  1.00 42.04  ?  131 ARG E CD    1 
ATOM 3564  N NE    . ARG E 1 131 ? 68.127  69.787  90.912  1.00 42.04  ?  131 ARG E NE    1 
ATOM 3565  C CZ    . ARG E 1 131 ? 68.739  70.954  91.084  1.00 42.04  ?  131 ARG E CZ    1 
ATOM 3566  N NH1   . ARG E 1 131 ? 69.749  71.295  90.295  1.00 42.04  1  131 ARG E NH1   1 
ATOM 3567  N NH2   . ARG E 1 131 ? 68.348  71.775  92.048  1.00 42.04  ?  131 ARG E NH2   1 
ATOM 3568  N N     . ILE E 1 132 ? 72.919  67.868  88.150  1.00 37.69  ?  132 ILE E N     1 
ATOM 3569  C CA    . ILE E 1 132 ? 74.103  68.696  88.372  1.00 37.69  ?  132 ILE E CA    1 
ATOM 3570  C C     . ILE E 1 132 ? 74.358  69.616  87.184  1.00 37.69  ?  132 ILE E C     1 
ATOM 3571  O O     . ILE E 1 132 ? 74.648  70.807  87.354  1.00 37.69  ?  132 ILE E O     1 
ATOM 3572  C CB    . ILE E 1 132 ? 75.325  67.812  88.671  1.00 37.69  ?  132 ILE E CB    1 
ATOM 3573  C CG1   . ILE E 1 132 ? 75.144  67.076  89.990  1.00 37.69  ?  132 ILE E CG1   1 
ATOM 3574  C CG2   . ILE E 1 132 ? 76.590  68.631  88.738  1.00 37.69  ?  132 ILE E CG2   1 
ATOM 3575  C CD1   . ILE E 1 132 ? 76.177  66.028  90.235  1.00 37.69  ?  132 ILE E CD1   1 
ATOM 3576  N N     . ARG E 1 133 ? 74.224  69.093  85.966  1.00 38.41  ?  133 ARG E N     1 
ATOM 3577  C CA    . ARG E 1 133 ? 74.573  69.865  84.777  1.00 38.41  ?  133 ARG E CA    1 
ATOM 3578  C C     . ARG E 1 133 ? 73.548  70.957  84.498  1.00 38.41  ?  133 ARG E C     1 
ATOM 3579  O O     . ARG E 1 133 ? 73.878  72.148  84.485  1.00 38.41  ?  133 ARG E O     1 
ATOM 3580  C CB    . ARG E 1 133 ? 74.691  68.932  83.578  1.00 38.41  ?  133 ARG E CB    1 
ATOM 3581  C CG    . ARG E 1 133 ? 75.835  67.959  83.656  1.00 38.41  ?  133 ARG E CG    1 
ATOM 3582  C CD    . ARG E 1 133 ? 75.802  67.062  82.447  1.00 38.41  ?  133 ARG E CD    1 
ATOM 3583  N NE    . ARG E 1 133 ? 76.905  66.115  82.424  1.00 38.41  ?  133 ARG E NE    1 
ATOM 3584  C CZ    . ARG E 1 133 ? 77.060  65.190  81.487  1.00 38.41  ?  133 ARG E CZ    1 
ATOM 3585  N NH1   . ARG E 1 133 ? 76.179  65.085  80.503  1.00 38.41  1  133 ARG E NH1   1 
ATOM 3586  N NH2   . ARG E 1 133 ? 78.095  64.367  81.533  1.00 38.41  ?  133 ARG E NH2   1 
ATOM 3587  N N     . GLY E 1 134 ? 72.297  70.568  84.265  1.00 42.69  ?  134 GLY E N     1 
ATOM 3588  C CA    . GLY E 1 134 ? 71.246  71.523  83.971  1.00 42.69  ?  134 GLY E CA    1 
ATOM 3589  C C     . GLY E 1 134 ? 70.592  71.290  82.625  1.00 42.69  ?  134 GLY E C     1 
ATOM 3590  O O     . GLY E 1 134 ? 70.010  72.207  82.038  1.00 42.69  ?  134 GLY E O     1 
ATOM 3591  N N     . LEU E 1 135 ? 70.678  70.057  82.134  1.00 42.51  ?  135 LEU E N     1 
ATOM 3592  C CA    . LEU E 1 135 ? 70.185  69.707  80.805  1.00 42.51  ?  135 LEU E CA    1 
ATOM 3593  C C     . LEU E 1 135 ? 68.667  69.571  80.780  1.00 42.51  ?  135 LEU E C     1 
ATOM 3594  O O     . LEU E 1 135 ? 68.111  68.880  79.926  1.00 42.51  ?  135 LEU E O     1 
ATOM 3595  C CB    . LEU E 1 135 ? 70.834  68.405  80.330  1.00 42.51  ?  135 LEU E CB    1 
ATOM 3596  C CG    . LEU E 1 135 ? 72.352  68.459  80.150  1.00 42.51  ?  135 LEU E CG    1 
ATOM 3597  C CD1   . LEU E 1 135 ? 72.908  67.085  79.833  1.00 42.51  ?  135 LEU E CD1   1 
ATOM 3598  C CD2   . LEU E 1 135 ? 72.735  69.455  79.072  1.00 42.51  ?  135 LEU E CD2   1 
ATOM 3599  N N     . ASP F 2 25  ? 56.197  48.118  69.032  1.00 77.25  ?  24  ASP F N     1 
ATOM 3600  C CA    . ASP F 2 25  ? 57.334  48.489  69.865  1.00 77.25  ?  24  ASP F CA    1 
ATOM 3601  C C     . ASP F 2 25  ? 57.961  49.799  69.421  1.00 77.25  ?  24  ASP F C     1 
ATOM 3602  O O     . ASP F 2 25  ? 57.582  50.874  69.893  1.00 77.25  ?  24  ASP F O     1 
ATOM 3603  C CB    . ASP F 2 25  ? 58.397  47.391  69.847  1.00 77.25  ?  24  ASP F CB    1 
ATOM 3604  C CG    . ASP F 2 25  ? 57.994  46.174  70.642  1.00 77.25  ?  24  ASP F CG    1 
ATOM 3605  O OD1   . ASP F 2 25  ? 57.259  46.330  71.641  1.00 77.25  ?  24  ASP F OD1   1 
ATOM 3606  O OD2   . ASP F 2 25  ? 58.411  45.057  70.275  1.00 77.25  -1 24  ASP F OD2   1 
ATOM 3607  N N     . ASN F 2 26  ? 58.966  49.675  68.547  1.00 67.90  ?  25  ASN F N     1 
ATOM 3608  C CA    . ASN F 2 26  ? 59.778  50.760  67.988  1.00 67.90  ?  25  ASN F CA    1 
ATOM 3609  C C     . ASN F 2 26  ? 60.544  51.547  69.050  1.00 67.90  ?  25  ASN F C     1 
ATOM 3610  O O     . ASN F 2 26  ? 61.023  52.648  68.782  1.00 67.90  ?  25  ASN F O     1 
ATOM 3611  C CB    . ASN F 2 26  ? 58.935  51.705  67.124  1.00 67.90  ?  25  ASN F CB    1 
ATOM 3612  C CG    . ASN F 2 26  ? 58.519  51.078  65.814  1.00 67.90  ?  25  ASN F CG    1 
ATOM 3613  O OD1   . ASN F 2 26  ? 59.314  50.408  65.156  1.00 67.90  ?  25  ASN F OD1   1 
ATOM 3614  N ND2   . ASN F 2 26  ? 57.267  51.286  65.428  1.00 67.90  ?  25  ASN F ND2   1 
ATOM 3615  N N     . ILE F 2 27  ? 60.666  51.006  70.260  1.00 58.50  ?  26  ILE F N     1 
ATOM 3616  C CA    . ILE F 2 27  ? 61.619  51.499  71.249  1.00 58.50  ?  26  ILE F CA    1 
ATOM 3617  C C     . ILE F 2 27  ? 62.444  50.379  71.858  1.00 58.50  ?  26  ILE F C     1 
ATOM 3618  O O     . ILE F 2 27  ? 63.564  50.622  72.343  1.00 58.50  ?  26  ILE F O     1 
ATOM 3619  C CB    . ILE F 2 27  ? 60.879  52.304  72.348  1.00 58.50  ?  26  ILE F CB    1 
ATOM 3620  C CG1   . ILE F 2 27  ? 61.836  53.146  73.195  1.00 58.50  ?  26  ILE F CG1   1 
ATOM 3621  C CG2   . ILE F 2 27  ? 60.049  51.395  73.238  1.00 58.50  ?  26  ILE F CG2   1 
ATOM 3622  C CD1   . ILE F 2 27  ? 62.546  54.214  72.430  1.00 58.50  ?  26  ILE F CD1   1 
ATOM 3623  N N     . GLN F 2 28  ? 61.997  49.129  71.768  1.00 64.61  ?  27  GLN F N     1 
ATOM 3624  C CA    . GLN F 2 28  ? 62.708  47.980  72.301  1.00 64.61  ?  27  GLN F CA    1 
ATOM 3625  C C     . GLN F 2 28  ? 63.823  47.497  71.388  1.00 64.61  ?  27  GLN F C     1 
ATOM 3626  O O     . GLN F 2 28  ? 64.407  46.443  71.656  1.00 64.61  ?  27  GLN F O     1 
ATOM 3627  C CB    . GLN F 2 28  ? 61.724  46.840  72.552  1.00 64.61  ?  27  GLN F CB    1 
ATOM 3628  C CG    . GLN F 2 28  ? 60.641  47.205  73.534  1.00 64.61  ?  27  GLN F CG    1 
ATOM 3629  C CD    . GLN F 2 28  ? 61.202  47.558  74.883  1.00 64.61  ?  27  GLN F CD    1 
ATOM 3630  O OE1   . GLN F 2 28  ? 61.185  48.717  75.292  1.00 64.61  ?  27  GLN F OE1   1 
ATOM 3631  N NE2   . GLN F 2 28  ? 61.716  46.557  75.586  1.00 64.61  ?  27  GLN F NE2   1 
ATOM 3632  N N     . GLY F 2 29  ? 64.117  48.223  70.308  1.00 64.73  ?  28  GLY F N     1 
ATOM 3633  C CA    . GLY F 2 29  ? 65.302  47.925  69.530  1.00 64.73  ?  28  GLY F CA    1 
ATOM 3634  C C     . GLY F 2 29  ? 66.581  48.242  70.274  1.00 64.73  ?  28  GLY F C     1 
ATOM 3635  O O     . GLY F 2 29  ? 67.625  47.639  70.007  1.00 64.73  ?  28  GLY F O     1 
ATOM 3636  N N     . ILE F 2 30  ? 66.523  49.176  71.220  1.00 59.41  ?  29  ILE F N     1 
ATOM 3637  C CA    . ILE F 2 30  ? 67.661  49.461  72.081  1.00 59.41  ?  29  ILE F CA    1 
ATOM 3638  C C     . ILE F 2 30  ? 67.611  48.439  73.204  1.00 59.41  ?  29  ILE F C     1 
ATOM 3639  O O     . ILE F 2 30  ? 67.046  48.696  74.273  1.00 59.41  ?  29  ILE F O     1 
ATOM 3640  C CB    . ILE F 2 30  ? 67.610  50.896  72.628  1.00 59.41  ?  29  ILE F CB    1 
ATOM 3641  C CG1   . ILE F 2 30  ? 67.374  51.884  71.493  1.00 59.41  ?  29  ILE F CG1   1 
ATOM 3642  C CG2   . ILE F 2 30  ? 68.905  51.239  73.327  1.00 59.41  ?  29  ILE F CG2   1 
ATOM 3643  C CD1   . ILE F 2 30  ? 68.443  51.871  70.453  1.00 59.41  ?  29  ILE F CD1   1 
ATOM 3644  N N     . THR F 2 31  ? 68.192  47.270  72.968  1.00 65.00  ?  30  THR F N     1 
ATOM 3645  C CA    . THR F 2 31  ? 67.968  46.132  73.841  1.00 65.00  ?  30  THR F CA    1 
ATOM 3646  C C     . THR F 2 31  ? 68.855  46.215  75.078  1.00 65.00  ?  30  THR F C     1 
ATOM 3647  O O     . THR F 2 31  ? 69.611  47.169  75.277  1.00 65.00  ?  30  THR F O     1 
ATOM 3648  C CB    . THR F 2 31  ? 68.216  44.833  73.083  1.00 65.00  ?  30  THR F CB    1 
ATOM 3649  O OG1   . THR F 2 31  ? 69.586  44.779  72.675  1.00 65.00  ?  30  THR F OG1   1 
ATOM 3650  C CG2   . THR F 2 31  ? 67.338  44.770  71.849  1.00 65.00  ?  30  THR F CG2   1 
ATOM 3651  N N     . LYS F 2 32  ? 68.739  45.196  75.928  1.00 57.81  ?  31  LYS F N     1 
ATOM 3652  C CA    . LYS F 2 32  ? 69.579  45.109  77.122  1.00 57.81  ?  31  LYS F CA    1 
ATOM 3653  C C     . LYS F 2 32  ? 71.077  44.999  76.831  1.00 57.81  ?  31  LYS F C     1 
ATOM 3654  O O     . LYS F 2 32  ? 71.843  45.749  77.461  1.00 57.81  ?  31  LYS F O     1 
ATOM 3655  C CB    . LYS F 2 32  ? 69.089  43.965  78.018  1.00 57.81  ?  31  LYS F CB    1 
ATOM 3656  C CG    . LYS F 2 32  ? 67.795  44.247  78.748  1.00 57.81  ?  31  LYS F CG    1 
ATOM 3657  C CD    . LYS F 2 32  ? 67.284  42.980  79.406  1.00 57.81  ?  31  LYS F CD    1 
ATOM 3658  C CE    . LYS F 2 32  ? 68.209  42.529  80.519  1.00 57.81  ?  31  LYS F CE    1 
ATOM 3659  N NZ    . LYS F 2 32  ? 67.674  41.336  81.225  1.00 57.81  1  31  LYS F NZ    1 
ATOM 3660  N N     . PRO F 2 33  ? 71.581  44.130  75.929  1.00 59.16  ?  32  PRO F N     1 
ATOM 3661  C CA    . PRO F 2 33  ? 73.036  44.138  75.698  1.00 59.16  ?  32  PRO F CA    1 
ATOM 3662  C C     . PRO F 2 33  ? 73.541  45.376  74.982  1.00 59.16  ?  32  PRO F C     1 
ATOM 3663  O O     . PRO F 2 33  ? 74.731  45.685  75.105  1.00 59.16  ?  32  PRO F O     1 
ATOM 3664  C CB    . PRO F 2 33  ? 73.275  42.878  74.862  1.00 59.16  ?  32  PRO F CB    1 
ATOM 3665  C CG    . PRO F 2 33  ? 72.027  42.642  74.188  1.00 59.16  ?  32  PRO F CG    1 
ATOM 3666  C CD    . PRO F 2 33  ? 70.967  43.031  75.152  1.00 59.16  ?  32  PRO F CD    1 
ATOM 3667  N N     . ALA F 2 34  ? 72.680  46.114  74.282  1.00 53.37  ?  33  ALA F N     1 
ATOM 3668  C CA    . ALA F 2 34  ? 73.100  47.379  73.690  1.00 53.37  ?  33  ALA F CA    1 
ATOM 3669  C C     . ALA F 2 34  ? 73.439  48.400  74.767  1.00 53.37  ?  33  ALA F C     1 
ATOM 3670  O O     . ALA F 2 34  ? 74.524  48.998  74.754  1.00 53.37  ?  33  ALA F O     1 
ATOM 3671  C CB    . ALA F 2 34  ? 72.008  47.911  72.769  1.00 53.37  ?  33  ALA F CB    1 
ATOM 3672  N N     . ILE F 2 35  ? 72.534  48.585  75.731  1.00 49.83  ?  34  ILE F N     1 
ATOM 3673  C CA    . ILE F 2 35  ? 72.787  49.507  76.832  1.00 49.83  ?  34  ILE F CA    1 
ATOM 3674  C C     . ILE F 2 35  ? 73.895  48.970  77.723  1.00 49.83  ?  34  ILE F C     1 
ATOM 3675  O O     . ILE F 2 35  ? 74.670  49.742  78.302  1.00 49.83  ?  34  ILE F O     1 
ATOM 3676  C CB    . ILE F 2 35  ? 71.485  49.745  77.612  1.00 49.83  ?  34  ILE F CB    1 
ATOM 3677  C CG1   . ILE F 2 35  ? 70.396  50.203  76.655  1.00 49.83  ?  34  ILE F CG1   1 
ATOM 3678  C CG2   . ILE F 2 35  ? 71.656  50.829  78.643  1.00 49.83  ?  34  ILE F CG2   1 
ATOM 3679  C CD1   . ILE F 2 35  ? 69.029  50.235  77.275  1.00 49.83  ?  34  ILE F CD1   1 
ATOM 3680  N N     . ARG F 2 36  ? 74.030  47.644  77.796  1.00 52.62  ?  35  ARG F N     1 
ATOM 3681  C CA    . ARG F 2 36  ? 75.110  47.050  78.571  1.00 52.62  ?  35  ARG F CA    1 
ATOM 3682  C C     . ARG F 2 36  ? 76.468  47.366  77.960  1.00 52.62  ?  35  ARG F C     1 
ATOM 3683  O O     . ARG F 2 36  ? 77.396  47.726  78.683  1.00 52.62  ?  35  ARG F O     1 
ATOM 3684  C CB    . ARG F 2 36  ? 74.905  45.544  78.684  1.00 52.62  ?  35  ARG F CB    1 
ATOM 3685  C CG    . ARG F 2 36  ? 75.902  44.854  79.582  1.00 52.62  ?  35  ARG F CG    1 
ATOM 3686  C CD    . ARG F 2 36  ? 75.651  43.363  79.605  1.00 52.62  ?  35  ARG F CD    1 
ATOM 3687  N NE    . ARG F 2 36  ? 75.811  42.781  78.276  1.00 52.62  ?  35  ARG F NE    1 
ATOM 3688  C CZ    . ARG F 2 36  ? 76.980  42.436  77.742  1.00 52.62  ?  35  ARG F CZ    1 
ATOM 3689  N NH1   . ARG F 2 36  ? 78.103  42.609  78.425  1.00 52.62  1  35  ARG F NH1   1 
ATOM 3690  N NH2   . ARG F 2 36  ? 77.026  41.917  76.523  1.00 52.62  ?  35  ARG F NH2   1 
ATOM 3691  N N     . ARG F 2 37  ? 76.596  47.277  76.633  1.00 53.00  ?  36  ARG F N     1 
ATOM 3692  C CA    . ARG F 2 37  ? 77.856  47.649  75.997  1.00 53.00  ?  36  ARG F CA    1 
ATOM 3693  C C     . ARG F 2 37  ? 78.106  49.146  76.074  1.00 53.00  ?  36  ARG F C     1 
ATOM 3694  O O     . ARG F 2 37  ? 79.261  49.568  76.222  1.00 53.00  ?  36  ARG F O     1 
ATOM 3695  C CB    . ARG F 2 37  ? 77.887  47.195  74.541  1.00 53.00  ?  36  ARG F CB    1 
ATOM 3696  C CG    . ARG F 2 37  ? 78.016  45.702  74.356  1.00 53.00  ?  36  ARG F CG    1 
ATOM 3697  C CD    . ARG F 2 37  ? 78.275  45.375  72.904  1.00 53.00  ?  36  ARG F CD    1 
ATOM 3698  N NE    . ARG F 2 37  ? 77.184  45.848  72.063  1.00 53.00  ?  36  ARG F NE    1 
ATOM 3699  C CZ    . ARG F 2 37  ? 76.080  45.153  71.825  1.00 53.00  ?  36  ARG F CZ    1 
ATOM 3700  N NH1   . ARG F 2 37  ? 75.925  43.955  72.370  1.00 53.00  1  36  ARG F NH1   1 
ATOM 3701  N NH2   . ARG F 2 37  ? 75.131  45.654  71.049  1.00 53.00  ?  36  ARG F NH2   1 
ATOM 3702  N N     . LEU F 2 38  ? 77.044  49.956  75.997  1.00 45.56  ?  37  LEU F N     1 
ATOM 3703  C CA    . LEU F 2 38  ? 77.194  51.394  76.199  1.00 45.56  ?  37  LEU F CA    1 
ATOM 3704  C C     . LEU F 2 38  ? 77.684  51.721  77.601  1.00 45.56  ?  37  LEU F C     1 
ATOM 3705  O O     . LEU F 2 38  ? 78.397  52.710  77.794  1.00 45.56  ?  37  LEU F O     1 
ATOM 3706  C CB    . LEU F 2 38  ? 75.874  52.108  75.938  1.00 45.56  ?  37  LEU F CB    1 
ATOM 3707  C CG    . LEU F 2 38  ? 75.428  52.185  74.486  1.00 45.56  ?  37  LEU F CG    1 
ATOM 3708  C CD1   . LEU F 2 38  ? 74.040  52.782  74.396  1.00 45.56  ?  37  LEU F CD1   1 
ATOM 3709  C CD2   . LEU F 2 38  ? 76.424  53.011  73.708  1.00 45.56  ?  37  LEU F CD2   1 
ATOM 3710  N N     . ALA F 2 39  ? 77.327  50.904  78.584  1.00 47.67  ?  38  ALA F N     1 
ATOM 3711  C CA    . ALA F 2 39  ? 77.838  51.132  79.927  1.00 47.67  ?  38  ALA F CA    1 
ATOM 3712  C C     . ALA F 2 39  ? 79.258  50.603  80.090  1.00 47.67  ?  38  ALA F C     1 
ATOM 3713  O O     . ALA F 2 39  ? 80.094  51.267  80.713  1.00 47.67  ?  38  ALA F O     1 
ATOM 3714  C CB    . ALA F 2 39  ? 76.910  50.494  80.956  1.00 47.67  ?  38  ALA F CB    1 
ATOM 3715  N N     . ARG F 2 40  ? 79.551  49.419  79.537  1.00 47.73  ?  39  ARG F N     1 
ATOM 3716  C CA    . ARG F 2 40  ? 80.883  48.836  79.669  1.00 47.73  ?  39  ARG F CA    1 
ATOM 3717  C C     . ARG F 2 40  ? 81.940  49.633  78.927  1.00 47.73  ?  39  ARG F C     1 
ATOM 3718  O O     . ARG F 2 40  ? 83.122  49.517  79.261  1.00 47.73  ?  39  ARG F O     1 
ATOM 3719  C CB    . ARG F 2 40  ? 80.929  47.399  79.155  1.00 47.73  ?  39  ARG F CB    1 
ATOM 3720  C CG    . ARG F 2 40  ? 80.051  46.404  79.867  1.00 47.73  ?  39  ARG F CG    1 
ATOM 3721  C CD    . ARG F 2 40  ? 80.484  46.087  81.266  1.00 47.73  ?  39  ARG F CD    1 
ATOM 3722  N NE    . ARG F 2 40  ? 79.619  45.046  81.807  1.00 47.73  ?  39  ARG F NE    1 
ATOM 3723  C CZ    . ARG F 2 40  ? 79.677  44.587  83.050  1.00 47.73  ?  39  ARG F CZ    1 
ATOM 3724  N NH1   . ARG F 2 40  ? 80.566  45.081  83.897  1.00 47.73  1  39  ARG F NH1   1 
ATOM 3725  N NH2   . ARG F 2 40  ? 78.843  43.638  83.447  1.00 47.73  ?  39  ARG F NH2   1 
ATOM 3726  N N     . ARG F 2 41  ? 81.558  50.412  77.915  1.00 48.34  ?  40  ARG F N     1 
ATOM 3727  C CA    . ARG F 2 41  ? 82.515  51.366  77.375  1.00 48.34  ?  40  ARG F CA    1 
ATOM 3728  C C     . ARG F 2 41  ? 82.819  52.454  78.394  1.00 48.34  ?  40  ARG F C     1 
ATOM 3729  O O     . ARG F 2 41  ? 83.971  52.878  78.535  1.00 48.34  ?  40  ARG F O     1 
ATOM 3730  C CB    . ARG F 2 41  ? 82.004  51.971  76.070  1.00 48.34  ?  40  ARG F CB    1 
ATOM 3731  C CG    . ARG F 2 41  ? 82.981  52.965  75.476  1.00 48.34  ?  40  ARG F CG    1 
ATOM 3732  C CD    . ARG F 2 41  ? 82.598  53.484  74.112  1.00 48.34  ?  40  ARG F CD    1 
ATOM 3733  N NE    . ARG F 2 41  ? 82.761  52.474  73.075  1.00 48.34  ?  40  ARG F NE    1 
ATOM 3734  C CZ    . ARG F 2 41  ? 82.465  52.674  71.799  1.00 48.34  ?  40  ARG F CZ    1 
ATOM 3735  N NH1   . ARG F 2 41  ? 82.007  53.850  71.399  1.00 48.34  1  40  ARG F NH1   1 
ATOM 3736  N NH2   . ARG F 2 41  ? 82.641  51.702  70.919  1.00 48.34  ?  40  ARG F NH2   1 
ATOM 3737  N N     . GLY F 2 42  ? 81.820  52.868  79.158  1.00 43.12  ?  41  GLY F N     1 
ATOM 3738  C CA    . GLY F 2 42  ? 82.001  53.951  80.101  1.00 43.12  ?  41  GLY F CA    1 
ATOM 3739  C C     . GLY F 2 42  ? 82.736  53.621  81.378  1.00 43.12  ?  41  GLY F C     1 
ATOM 3740  O O     . GLY F 2 42  ? 82.872  54.494  82.237  1.00 43.12  ?  41  GLY F O     1 
ATOM 3741  N N     . GLY F 2 43  ? 83.216  52.396  81.541  1.00 45.57  ?  42  GLY F N     1 
ATOM 3742  C CA    . GLY F 2 43  ? 83.938  52.029  82.736  1.00 45.57  ?  42  GLY F CA    1 
ATOM 3743  C C     . GLY F 2 43  ? 83.085  51.521  83.871  1.00 45.57  ?  42  GLY F C     1 
ATOM 3744  O O     . GLY F 2 43  ? 83.615  51.285  84.961  1.00 45.57  ?  42  GLY F O     1 
ATOM 3745  N N     . VAL F 2 44  ? 81.785  51.347  83.655  1.00 44.18  ?  43  VAL F N     1 
ATOM 3746  C CA    . VAL F 2 44  ? 80.894  50.871  84.705  1.00 44.18  ?  43  VAL F CA    1 
ATOM 3747  C C     . VAL F 2 44  ? 81.166  49.398  84.961  1.00 44.18  ?  43  VAL F C     1 
ATOM 3748  O O     . VAL F 2 44  ? 81.105  48.574  84.043  1.00 44.18  ?  43  VAL F O     1 
ATOM 3749  C CB    . VAL F 2 44  ? 79.433  51.093  84.313  1.00 44.18  ?  43  VAL F CB    1 
ATOM 3750  C CG1   . VAL F 2 44  ? 78.519  50.489  85.347  1.00 44.18  ?  43  VAL F CG1   1 
ATOM 3751  C CG2   . VAL F 2 44  ? 79.163  52.565  84.153  1.00 44.18  ?  43  VAL F CG2   1 
ATOM 3752  N N     . LYS F 2 45  ? 81.457  49.056  86.213  1.00 55.91  ?  44  LYS F N     1 
ATOM 3753  C CA    . LYS F 2 45  ? 81.731  47.665  86.550  1.00 55.91  ?  44  LYS F CA    1 
ATOM 3754  C C     . LYS F 2 45  ? 80.451  46.839  86.620  1.00 55.91  ?  44  LYS F C     1 
ATOM 3755  O O     . LYS F 2 45  ? 80.281  45.875  85.869  1.00 55.91  ?  44  LYS F O     1 
ATOM 3756  C CB    . LYS F 2 45  ? 82.490  47.587  87.874  1.00 55.91  ?  44  LYS F CB    1 
ATOM 3757  C CG    . LYS F 2 45  ? 82.814  46.173  88.313  1.00 55.91  ?  44  LYS F CG    1 
ATOM 3758  C CD    . LYS F 2 45  ? 83.563  46.171  89.631  1.00 55.91  ?  44  LYS F CD    1 
ATOM 3759  C CE    . LYS F 2 45  ? 83.762  44.761  90.152  1.00 55.91  ?  44  LYS F CE    1 
ATOM 3760  N NZ    . LYS F 2 45  ? 84.435  44.753  91.479  1.00 55.91  1  44  LYS F NZ    1 
ATOM 3761  N N     . ARG F 2 46  ? 79.537  47.204  87.512  1.00 63.70  ?  45  ARG F N     1 
ATOM 3762  C CA    . ARG F 2 46  ? 78.371  46.385  87.817  1.00 63.70  ?  45  ARG F CA    1 
ATOM 3763  C C     . ARG F 2 46  ? 77.119  47.233  87.664  1.00 63.70  ?  45  ARG F C     1 
ATOM 3764  O O     . ARG F 2 46  ? 77.041  48.328  88.224  1.00 63.70  ?  45  ARG F O     1 
ATOM 3765  C CB    . ARG F 2 46  ? 78.492  45.813  89.231  1.00 63.70  ?  45  ARG F CB    1 
ATOM 3766  C CG    . ARG F 2 46  ? 77.434  44.815  89.630  1.00 63.70  ?  45  ARG F CG    1 
ATOM 3767  C CD    . ARG F 2 46  ? 77.794  44.182  90.969  1.00 63.70  ?  45  ARG F CD    1 
ATOM 3768  N NE    . ARG F 2 46  ? 76.840  43.157  91.380  1.00 63.70  ?  45  ARG F NE    1 
ATOM 3769  C CZ    . ARG F 2 46  ? 75.794  43.380  92.167  1.00 63.70  ?  45  ARG F CZ    1 
ATOM 3770  N NH1   . ARG F 2 46  ? 75.567  44.594  92.644  1.00 63.70  1  45  ARG F NH1   1 
ATOM 3771  N NH2   . ARG F 2 46  ? 74.977  42.387  92.484  1.00 63.70  ?  45  ARG F NH2   1 
ATOM 3772  N N     . ILE F 2 47  ? 76.147  46.734  86.907  1.00 56.66  ?  46  ILE F N     1 
ATOM 3773  C CA    . ILE F 2 47  ? 74.996  47.518  86.473  1.00 56.66  ?  46  ILE F CA    1 
ATOM 3774  C C     . ILE F 2 47  ? 73.758  47.018  87.198  1.00 56.66  ?  46  ILE F C     1 
ATOM 3775  O O     . ILE F 2 47  ? 73.583  45.810  87.367  1.00 56.66  ?  46  ILE F O     1 
ATOM 3776  C CB    . ILE F 2 47  ? 74.818  47.401  84.950  1.00 56.66  ?  46  ILE F CB    1 
ATOM 3777  C CG1   . ILE F 2 47  ? 76.109  47.775  84.248  1.00 56.66  ?  46  ILE F CG1   1 
ATOM 3778  C CG2   . ILE F 2 47  ? 73.739  48.330  84.448  1.00 56.66  ?  46  ILE F CG2   1 
ATOM 3779  C CD1   . ILE F 2 47  ? 76.116  47.367  82.808  1.00 56.66  ?  46  ILE F CD1   1 
ATOM 3780  N N     . SER F 2 48  ? 72.892  47.938  87.616  1.00 54.99  ?  47  SER F N     1 
ATOM 3781  C CA    . SER F 2 48  ? 71.617  47.560  88.210  1.00 54.99  ?  47  SER F CA    1 
ATOM 3782  C C     . SER F 2 48  ? 70.610  47.219  87.117  1.00 54.99  ?  47  SER F C     1 
ATOM 3783  O O     . SER F 2 48  ? 70.951  47.076  85.942  1.00 54.99  ?  47  SER F O     1 
ATOM 3784  C CB    . SER F 2 48  ? 71.084  48.666  89.107  1.00 54.99  ?  47  SER F CB    1 
ATOM 3785  O OG    . SER F 2 48  ? 69.811  48.311  89.611  1.00 54.99  ?  47  SER F OG    1 
ATOM 3786  N N     . GLY F 2 49  ? 69.343  47.098  87.495  1.00 56.17  ?  48  GLY F N     1 
ATOM 3787  C CA    . GLY F 2 49  ? 68.341  46.625  86.563  1.00 56.17  ?  48  GLY F CA    1 
ATOM 3788  C C     . GLY F 2 49  ? 67.388  47.681  86.051  1.00 56.17  ?  48  GLY F C     1 
ATOM 3789  O O     . GLY F 2 49  ? 66.881  47.569  84.932  1.00 56.17  ?  48  GLY F O     1 
ATOM 3790  N N     . LEU F 2 50  ? 67.129  48.713  86.850  1.00 56.22  ?  49  LEU F N     1 
ATOM 3791  C CA    . LEU F 2 50  ? 66.152  49.720  86.458  1.00 56.22  ?  49  LEU F CA    1 
ATOM 3792  C C     . LEU F 2 50  ? 66.699  50.707  85.438  1.00 56.22  ?  49  LEU F C     1 
ATOM 3793  O O     . LEU F 2 50  ? 65.901  51.413  84.801  1.00 56.22  ?  49  LEU F O     1 
ATOM 3794  C CB    . LEU F 2 50  ? 65.659  50.474  87.688  1.00 56.22  ?  49  LEU F CB    1 
ATOM 3795  C CG    . LEU F 2 50  ? 64.892  49.632  88.700  1.00 56.22  ?  49  LEU F CG    1 
ATOM 3796  C CD1   . LEU F 2 50  ? 64.557  50.460  89.926  1.00 56.22  ?  49  LEU F CD1   1 
ATOM 3797  C CD2   . LEU F 2 50  ? 63.637  49.071  88.062  1.00 56.22  ?  49  LEU F CD2   1 
ATOM 3798  N N     . ILE F 2 51  ? 68.030  50.739  85.269  1.00 54.59  ?  50  ILE F N     1 
ATOM 3799  C CA    . ILE F 2 51  ? 68.716  51.630  84.330  1.00 54.59  ?  50  ILE F CA    1 
ATOM 3800  C C     . ILE F 2 51  ? 68.158  51.470  82.928  1.00 54.59  ?  50  ILE F C     1 
ATOM 3801  O O     . ILE F 2 51  ? 67.880  52.457  82.232  1.00 54.59  ?  50  ILE F O     1 
ATOM 3802  C CB    . ILE F 2 51  ? 70.227  51.341  84.354  1.00 54.59  ?  50  ILE F CB    1 
ATOM 3803  C CG1   . ILE F 2 51  ? 70.765  51.483  85.766  1.00 54.59  ?  50  ILE F CG1   1 
ATOM 3804  C CG2   . ILE F 2 51  ? 70.967  52.272  83.437  1.00 54.59  ?  50  ILE F CG2   1 
ATOM 3805  C CD1   . ILE F 2 51  ? 70.578  52.847  86.308  1.00 54.59  ?  50  ILE F CD1   1 
ATOM 3806  N N     . TYR F 2 52  ? 67.860  50.222  82.553  1.00 53.00  ?  51  TYR F N     1 
ATOM 3807  C CA    . TYR F 2 52  ? 67.342  49.851  81.244  1.00 53.00  ?  51  TYR F CA    1 
ATOM 3808  C C     . TYR F 2 52  ? 65.983  50.456  80.923  1.00 53.00  ?  51  TYR F C     1 
ATOM 3809  O O     . TYR F 2 52  ? 65.512  50.286  79.795  1.00 53.00  ?  51  TYR F O     1 
ATOM 3810  C CB    . TYR F 2 52  ? 67.231  48.335  81.149  1.00 53.00  ?  51  TYR F CB    1 
ATOM 3811  C CG    . TYR F 2 52  ? 68.543  47.616  81.288  1.00 53.00  ?  51  TYR F CG    1 
ATOM 3812  C CD1   . TYR F 2 52  ? 69.423  47.528  80.225  1.00 53.00  ?  51  TYR F CD1   1 
ATOM 3813  C CD2   . TYR F 2 52  ? 68.893  47.013  82.482  1.00 53.00  ?  51  TYR F CD2   1 
ATOM 3814  C CE1   . TYR F 2 52  ? 70.619  46.866  80.353  1.00 53.00  ?  51  TYR F CE1   1 
ATOM 3815  C CE2   . TYR F 2 52  ? 70.085  46.348  82.619  1.00 53.00  ?  51  TYR F CE2   1 
ATOM 3816  C CZ    . TYR F 2 52  ? 70.944  46.277  81.553  1.00 53.00  ?  51  TYR F CZ    1 
ATOM 3817  O OH    . TYR F 2 52  ? 72.136  45.612  81.691  1.00 53.00  ?  51  TYR F OH    1 
ATOM 3818  N N     . GLU F 2 53  ? 65.324  51.128  81.866  1.00 61.66  ?  52  GLU F N     1 
ATOM 3819  C CA    . GLU F 2 53  ? 64.203  51.973  81.485  1.00 61.66  ?  52  GLU F CA    1 
ATOM 3820  C C     . GLU F 2 53  ? 64.608  53.434  81.360  1.00 61.66  ?  52  GLU F C     1 
ATOM 3821  O O     . GLU F 2 53  ? 64.352  54.057  80.320  1.00 61.66  ?  52  GLU F O     1 
ATOM 3822  C CB    . GLU F 2 53  ? 63.054  51.826  82.483  1.00 61.66  ?  52  GLU F CB    1 
ATOM 3823  C CG    . GLU F 2 53  ? 62.416  50.454  82.453  1.00 61.66  ?  52  GLU F CG    1 
ATOM 3824  C CD    . GLU F 2 53  ? 61.741  50.150  81.126  1.00 61.66  ?  52  GLU F CD    1 
ATOM 3825  O OE1   . GLU F 2 53  ? 61.202  51.084  80.491  1.00 61.66  ?  52  GLU F OE1   1 
ATOM 3826  O OE2   . GLU F 2 53  ? 61.755  48.971  80.714  1.00 61.66  -1 52  GLU F OE2   1 
ATOM 3827  N N     . GLU F 2 54  ? 65.292  53.961  82.383  1.00 57.01  ?  53  GLU F N     1 
ATOM 3828  C CA    . GLU F 2 54  ? 65.531  55.398  82.483  1.00 57.01  ?  53  GLU F CA    1 
ATOM 3829  C C     . GLU F 2 54  ? 66.428  55.888  81.360  1.00 57.01  ?  53  GLU F C     1 
ATOM 3830  O O     . GLU F 2 54  ? 66.170  56.949  80.774  1.00 57.01  ?  53  GLU F O     1 
ATOM 3831  C CB    . GLU F 2 54  ? 66.145  55.725  83.843  1.00 57.01  ?  53  GLU F CB    1 
ATOM 3832  C CG    . GLU F 2 54  ? 66.469  57.194  84.067  1.00 57.01  ?  53  GLU F CG    1 
ATOM 3833  C CD    . GLU F 2 54  ? 65.238  58.073  84.186  1.00 57.01  ?  53  GLU F CD    1 
ATOM 3834  O OE1   . GLU F 2 54  ? 64.171  57.566  84.592  1.00 57.01  ?  53  GLU F OE1   1 
ATOM 3835  O OE2   . GLU F 2 54  ? 65.342  59.280  83.883  1.00 57.01  -1 53  GLU F OE2   1 
ATOM 3836  N N     . THR F 2 55  ? 67.439  55.084  81.013  1.00 52.55  ?  54  THR F N     1 
ATOM 3837  C CA    . THR F 2 55  ? 68.305  55.375  79.876  1.00 52.55  ?  54  THR F CA    1 
ATOM 3838  C C     . THR F 2 55  ? 67.509  55.490  78.588  1.00 52.55  ?  54  THR F C     1 
ATOM 3839  O O     . THR F 2 55  ? 67.683  56.460  77.838  1.00 52.55  ?  54  THR F O     1 
ATOM 3840  C CB    . THR F 2 55  ? 69.367  54.293  79.748  1.00 52.55  ?  54  THR F CB    1 
ATOM 3841  O OG1   . THR F 2 55  ? 70.117  54.247  80.960  1.00 52.55  ?  54  THR F OG1   1 
ATOM 3842  C CG2   . THR F 2 55  ? 70.302  54.595  78.597  1.00 52.55  ?  54  THR F CG2   1 
ATOM 3843  N N     . ARG F 2 56  ? 66.579  54.550  78.357  1.00 55.91  ?  55  ARG F N     1 
ATOM 3844  C CA    . ARG F 2 56  ? 65.707  54.649  77.192  1.00 55.91  ?  55  ARG F CA    1 
ATOM 3845  C C     . ARG F 2 56  ? 64.901  55.929  77.246  1.00 55.91  ?  55  ARG F C     1 
ATOM 3846  O O     . ARG F 2 56  ? 64.859  56.677  76.258  1.00 55.91  ?  55  ARG F O     1 
ATOM 3847  C CB    . ARG F 2 56  ? 64.777  53.447  77.112  1.00 55.91  ?  55  ARG F CB    1 
ATOM 3848  C CG    . ARG F 2 56  ? 65.464  52.154  76.785  1.00 55.91  ?  55  ARG F CG    1 
ATOM 3849  C CD    . ARG F 2 56  ? 64.460  51.032  76.775  1.00 55.91  ?  55  ARG F CD    1 
ATOM 3850  N NE    . ARG F 2 56  ? 65.099  49.749  76.537  1.00 55.91  ?  55  ARG F NE    1 
ATOM 3851  C CZ    . ARG F 2 56  ? 64.462  48.589  76.597  1.00 55.91  ?  55  ARG F CZ    1 
ATOM 3852  N NH1   . ARG F 2 56  ? 63.173  48.563  76.896  1.00 55.91  1  55  ARG F NH1   1 
ATOM 3853  N NH2   . ARG F 2 56  ? 65.113  47.458  76.367  1.00 55.91  ?  55  ARG F NH2   1 
ATOM 3854  N N     . GLY F 2 57  ? 64.401  56.260  78.443  1.00 50.74  ?  56  GLY F N     1 
ATOM 3855  C CA    . GLY F 2 57  ? 63.702  57.516  78.639  1.00 50.74  ?  56  GLY F CA    1 
ATOM 3856  C C     . GLY F 2 57  ? 64.570  58.711  78.312  1.00 50.74  ?  56  GLY F C     1 
ATOM 3857  O O     . GLY F 2 57  ? 64.177  59.566  77.507  1.00 50.74  ?  56  GLY F O     1 
ATOM 3858  N N     . VAL F 2 58  ? 65.817  58.706  78.808  1.00 46.35  ?  57  VAL F N     1 
ATOM 3859  C CA    . VAL F 2 58  ? 66.633  59.889  78.578  1.00 46.35  ?  57  VAL F CA    1 
ATOM 3860  C C     . VAL F 2 58  ? 67.080  59.917  77.129  1.00 46.35  ?  57  VAL F C     1 
ATOM 3861  O O     . VAL F 2 58  ? 67.183  61.004  76.537  1.00 46.35  ?  57  VAL F O     1 
ATOM 3862  C CB    . VAL F 2 58  ? 67.805  60.007  79.580  1.00 46.35  ?  57  VAL F CB    1 
ATOM 3863  C CG1   . VAL F 2 58  ? 68.877  58.994  79.358  1.00 46.35  ?  57  VAL F CG1   1 
ATOM 3864  C CG2   . VAL F 2 58  ? 68.408  61.392  79.519  1.00 46.35  ?  57  VAL F CG2   1 
ATOM 3865  N N     . LEU F 2 59  ? 67.164  58.734  76.493  1.00 46.41  ?  58  LEU F N     1 
ATOM 3866  C CA    . LEU F 2 59  ? 67.493  58.683  75.075  1.00 46.41  ?  58  LEU F CA    1 
ATOM 3867  C C     . LEU F 2 59  ? 66.426  59.381  74.258  1.00 46.41  ?  58  LEU F C     1 
ATOM 3868  O O     . LEU F 2 59  ? 66.748  60.229  73.416  1.00 46.41  ?  58  LEU F O     1 
ATOM 3869  C CB    . LEU F 2 59  ? 67.667  57.241  74.613  1.00 46.41  ?  58  LEU F CB    1 
ATOM 3870  C CG    . LEU F 2 59  ? 68.030  57.087  73.140  1.00 46.41  ?  58  LEU F CG    1 
ATOM 3871  C CD1   . LEU F 2 59  ? 69.309  57.825  72.848  1.00 46.41  ?  58  LEU F CD1   1 
ATOM 3872  C CD2   . LEU F 2 59  ? 68.191  55.622  72.793  1.00 46.41  ?  58  LEU F CD2   1 
ATOM 3873  N N     . LYS F 2 60  ? 65.155  59.163  74.618  1.00 47.36  ?  59  LYS F N     1 
ATOM 3874  C CA    . LYS F 2 60  ? 64.075  59.827  73.904  1.00 47.36  ?  59  LYS F CA    1 
ATOM 3875  C C     . LYS F 2 60  ? 64.117  61.325  74.152  1.00 47.36  ?  59  LYS F C     1 
ATOM 3876  O O     . LYS F 2 60  ? 64.074  62.114  73.198  1.00 47.36  ?  59  LYS F O     1 
ATOM 3877  C CB    . LYS F 2 60  ? 62.730  59.240  74.313  1.00 47.36  ?  59  LYS F CB    1 
ATOM 3878  C CG    . LYS F 2 60  ? 61.559  59.789  73.533  1.00 47.36  ?  59  LYS F CG    1 
ATOM 3879  C CD    . LYS F 2 60  ? 60.267  59.116  73.955  1.00 47.36  ?  59  LYS F CD    1 
ATOM 3880  C CE    . LYS F 2 60  ? 59.087  59.618  73.139  1.00 47.36  ?  59  LYS F CE    1 
ATOM 3881  N NZ    . LYS F 2 60  ? 58.769  61.046  73.426  1.00 47.36  1  59  LYS F NZ    1 
ATOM 3882  N N     . VAL F 2 61  ? 64.386  61.733  75.399  1.00 45.73  ?  60  VAL F N     1 
ATOM 3883  C CA    . VAL F 2 61  ? 64.380  63.165  75.686  1.00 45.73  ?  60  VAL F CA    1 
ATOM 3884  C C     . VAL F 2 61  ? 65.672  63.804  75.214  1.00 45.73  ?  60  VAL F C     1 
ATOM 3885  O O     . VAL F 2 61  ? 65.804  65.034  75.255  1.00 45.73  ?  60  VAL F O     1 
ATOM 3886  C CB    . VAL F 2 61  ? 64.098  63.432  77.182  1.00 45.73  ?  60  VAL F CB    1 
ATOM 3887  C CG1   . VAL F 2 61  ? 65.340  63.287  78.022  1.00 45.73  ?  60  VAL F CG1   1 
ATOM 3888  C CG2   . VAL F 2 61  ? 63.412  64.784  77.407  1.00 45.73  ?  60  VAL F CG2   1 
ATOM 3889  N N     . PHE F 2 62  ? 66.623  63.008  74.717  1.00 44.30  ?  61  PHE F N     1 
ATOM 3890  C CA    . PHE F 2 62  ? 67.675  63.623  73.930  1.00 44.30  ?  61  PHE F CA    1 
ATOM 3891  C C     . PHE F 2 62  ? 67.214  63.848  72.501  1.00 44.30  ?  61  PHE F C     1 
ATOM 3892  O O     . PHE F 2 62  ? 67.254  64.981  72.006  1.00 44.30  ?  61  PHE F O     1 
ATOM 3893  C CB    . PHE F 2 62  ? 68.937  62.771  73.949  1.00 44.30  ?  61  PHE F CB    1 
ATOM 3894  C CG    . PHE F 2 62  ? 70.043  63.343  73.130  1.00 44.30  ?  61  PHE F CG    1 
ATOM 3895  C CD1   . PHE F 2 62  ? 70.702  64.483  73.543  1.00 44.30  ?  61  PHE F CD1   1 
ATOM 3896  C CD2   . PHE F 2 62  ? 70.428  62.743  71.951  1.00 44.30  ?  61  PHE F CD2   1 
ATOM 3897  C CE1   . PHE F 2 62  ? 71.722  65.018  72.790  1.00 44.30  ?  61  PHE F CE1   1 
ATOM 3898  C CE2   . PHE F 2 62  ? 71.447  63.268  71.195  1.00 44.30  ?  61  PHE F CE2   1 
ATOM 3899  C CZ    . PHE F 2 62  ? 72.095  64.407  71.615  1.00 44.30  ?  61  PHE F CZ    1 
ATOM 3900  N N     . LEU F 2 63  ? 66.717  62.784  71.853  1.00 47.06  ?  62  LEU F N     1 
ATOM 3901  C CA    . LEU F 2 63  ? 66.641  62.775  70.396  1.00 47.06  ?  62  LEU F CA    1 
ATOM 3902  C C     . LEU F 2 63  ? 65.605  63.751  69.887  1.00 47.06  ?  62  LEU F C     1 
ATOM 3903  O O     . LEU F 2 63  ? 65.807  64.353  68.829  1.00 47.06  ?  62  LEU F O     1 
ATOM 3904  C CB    . LEU F 2 63  ? 66.322  61.380  69.868  1.00 47.06  ?  62  LEU F CB    1 
ATOM 3905  C CG    . LEU F 2 63  ? 67.346  60.280  70.125  1.00 47.06  ?  62  LEU F CG    1 
ATOM 3906  C CD1   . LEU F 2 63  ? 66.874  58.974  69.519  1.00 47.06  ?  62  LEU F CD1   1 
ATOM 3907  C CD2   . LEU F 2 63  ? 68.700  60.665  69.596  1.00 47.06  ?  62  LEU F CD2   1 
ATOM 3908  N N     . GLU F 2 64  ? 64.536  63.951  70.663  1.00 53.17  ?  63  GLU F N     1 
ATOM 3909  C CA    . GLU F 2 64  ? 63.517  64.944  70.344  1.00 53.17  ?  63  GLU F CA    1 
ATOM 3910  C C     . GLU F 2 64  ? 64.127  66.331  70.194  1.00 53.17  ?  63  GLU F C     1 
ATOM 3911  O O     . GLU F 2 64  ? 63.914  67.005  69.178  1.00 53.17  ?  63  GLU F O     1 
ATOM 3912  C CB    . GLU F 2 64  ? 62.444  64.940  71.429  1.00 53.17  ?  63  GLU F CB    1 
ATOM 3913  C CG    . GLU F 2 64  ? 61.335  65.932  71.197  1.00 53.17  ?  63  GLU F CG    1 
ATOM 3914  C CD    . GLU F 2 64  ? 60.282  65.887  72.283  1.00 53.17  ?  63  GLU F CD    1 
ATOM 3915  O OE1   . GLU F 2 64  ? 60.417  65.059  73.208  1.00 53.17  ?  63  GLU F OE1   1 
ATOM 3916  O OE2   . GLU F 2 64  ? 59.327  66.689  72.220  1.00 53.17  -1 63  GLU F OE2   1 
ATOM 3917  N N     . ASN F 2 65  ? 65.002  66.716  71.127  1.00 49.33  ?  64  ASN F N     1 
ATOM 3918  C CA    . ASN F 2 65  ? 65.633  68.028  71.039  1.00 49.33  ?  64  ASN F CA    1 
ATOM 3919  C C     . ASN F 2 65  ? 66.684  68.123  69.945  1.00 49.33  ?  64  ASN F C     1 
ATOM 3920  O O     . ASN F 2 65  ? 67.245  69.206  69.753  1.00 49.33  ?  64  ASN F O     1 
ATOM 3921  C CB    . ASN F 2 65  ? 66.263  68.402  72.374  1.00 49.33  ?  64  ASN F CB    1 
ATOM 3922  C CG    . ASN F 2 65  ? 65.244  68.570  73.460  1.00 49.33  ?  64  ASN F CG    1 
ATOM 3923  O OD1   . ASN F 2 65  ? 65.230  67.823  74.434  1.00 49.33  ?  64  ASN F OD1   1 
ATOM 3924  N ND2   . ASN F 2 65  ? 64.371  69.552  73.299  1.00 49.33  ?  64  ASN F ND2   1 
ATOM 3925  N N     . VAL F 2 66  ? 66.973  67.038  69.234  1.00 45.53  ?  65  VAL F N     1 
ATOM 3926  C CA    . VAL F 2 66  ? 67.847  67.105  68.077  1.00 45.53  ?  65  VAL F CA    1 
ATOM 3927  C C     . VAL F 2 66  ? 66.967  67.106  66.837  1.00 45.53  ?  65  VAL F C     1 
ATOM 3928  O O     . VAL F 2 66  ? 67.306  67.736  65.830  1.00 45.53  ?  65  VAL F O     1 
ATOM 3929  C CB    . VAL F 2 66  ? 68.853  65.942  68.088  1.00 45.53  ?  65  VAL F CB    1 
ATOM 3930  C CG1   . VAL F 2 66  ? 69.761  65.974  66.883  1.00 45.53  ?  65  VAL F CG1   1 
ATOM 3931  C CG2   . VAL F 2 66  ? 69.680  66.005  69.347  1.00 45.53  ?  65  VAL F CG2   1 
ATOM 3932  N N     . ILE F 2 67  ? 65.800  66.456  66.916  1.00 47.22  ?  66  ILE F N     1 
ATOM 3933  C CA    . ILE F 2 67  ? 64.992  66.263  65.712  1.00 47.22  ?  66  ILE F CA    1 
ATOM 3934  C C     . ILE F 2 67  ? 64.344  67.566  65.276  1.00 47.22  ?  66  ILE F C     1 
ATOM 3935  O O     . ILE F 2 67  ? 64.533  68.003  64.135  1.00 47.22  ?  66  ILE F O     1 
ATOM 3936  C CB    . ILE F 2 67  ? 63.945  65.153  65.903  1.00 47.22  ?  66  ILE F CB    1 
ATOM 3937  C CG1   . ILE F 2 67  ? 64.626  63.794  65.915  1.00 47.22  ?  66  ILE F CG1   1 
ATOM 3938  C CG2   . ILE F 2 67  ? 62.928  65.177  64.784  1.00 47.22  ?  66  ILE F CG2   1 
ATOM 3939  C CD1   . ILE F 2 67  ? 65.410  63.511  64.666  1.00 47.22  ?  66  ILE F CD1   1 
ATOM 3940  N N     . ARG F 2 68  ? 63.585  68.211  66.171  1.00 48.51  ?  67  ARG F N     1 
ATOM 3941  C CA    . ARG F 2 68  ? 62.851  69.395  65.736  1.00 48.51  ?  67  ARG F CA    1 
ATOM 3942  C C     . ARG F 2 68  ? 63.795  70.564  65.481  1.00 48.51  ?  67  ARG F C     1 
ATOM 3943  O O     . ARG F 2 68  ? 63.626  71.289  64.491  1.00 48.51  ?  67  ARG F O     1 
ATOM 3944  C CB    . ARG F 2 68  ? 61.744  69.759  66.727  1.00 48.51  ?  67  ARG F CB    1 
ATOM 3945  C CG    . ARG F 2 68  ? 62.154  70.218  68.094  1.00 48.51  ?  67  ARG F CG    1 
ATOM 3946  C CD    . ARG F 2 68  ? 60.912  70.578  68.877  1.00 48.51  ?  67  ARG F CD    1 
ATOM 3947  N NE    . ARG F 2 68  ? 61.232  71.178  70.162  1.00 48.51  ?  67  ARG F NE    1 
ATOM 3948  C CZ    . ARG F 2 68  ? 61.403  70.488  71.282  1.00 48.51  ?  67  ARG F CZ    1 
ATOM 3949  N NH1   . ARG F 2 68  ? 61.276  69.169  71.277  1.00 48.51  1  67  ARG F NH1   1 
ATOM 3950  N NH2   . ARG F 2 68  ? 61.694  71.119  72.410  1.00 48.51  ?  67  ARG F NH2   1 
ATOM 3951  N N     . ASP F 2 69  ? 64.867  70.675  66.275  1.00 44.80  ?  68  ASP F N     1 
ATOM 3952  C CA    . ASP F 2 69  ? 65.934  71.626  65.987  1.00 44.80  ?  68  ASP F CA    1 
ATOM 3953  C C     . ASP F 2 69  ? 66.643  71.329  64.677  1.00 44.80  ?  68  ASP F C     1 
ATOM 3954  O O     . ASP F 2 69  ? 67.288  72.222  64.129  1.00 44.80  ?  68  ASP F O     1 
ATOM 3955  C CB    . ASP F 2 69  ? 66.971  71.645  67.108  1.00 44.80  ?  68  ASP F CB    1 
ATOM 3956  C CG    . ASP F 2 69  ? 66.479  72.349  68.346  1.00 44.80  ?  68  ASP F CG    1 
ATOM 3957  O OD1   . ASP F 2 69  ? 65.631  73.254  68.211  1.00 44.80  ?  68  ASP F OD1   1 
ATOM 3958  O OD2   . ASP F 2 69  ? 66.949  72.007  69.451  1.00 44.80  -1 68  ASP F OD2   1 
ATOM 3959  N N     . ALA F 2 70  ? 66.563  70.098  64.173  1.00 41.28  ?  69  ALA F N     1 
ATOM 3960  C CA    . ALA F 2 70  ? 66.982  69.853  62.802  1.00 41.28  ?  69  ALA F CA    1 
ATOM 3961  C C     . ALA F 2 70  ? 65.913  70.305  61.822  1.00 41.28  ?  69  ALA F C     1 
ATOM 3962  O O     . ALA F 2 70  ? 66.192  71.088  60.905  1.00 41.28  ?  69  ALA F O     1 
ATOM 3963  C CB    . ALA F 2 70  ? 67.291  68.374  62.594  1.00 41.28  ?  69  ALA F CB    1 
ATOM 3964  N N     . VAL F 2 71  ? 64.671  69.866  62.039  1.00 40.53  ?  70  VAL F N     1 
ATOM 3965  C CA    . VAL F 2 71  ? 63.712  69.836  60.942  1.00 40.53  ?  70  VAL F CA    1 
ATOM 3966  C C     . VAL F 2 71  ? 63.183  71.227  60.624  1.00 40.53  ?  70  VAL F C     1 
ATOM 3967  O O     . VAL F 2 71  ? 62.695  71.451  59.508  1.00 40.53  ?  70  VAL F O     1 
ATOM 3968  C CB    . VAL F 2 71  ? 62.582  68.840  61.265  1.00 40.53  ?  70  VAL F CB    1 
ATOM 3969  C CG1   . VAL F 2 71  ? 61.604  69.416  62.255  1.00 40.53  ?  70  VAL F CG1   1 
ATOM 3970  C CG2   . VAL F 2 71  ? 61.884  68.350  60.008  1.00 40.53  ?  70  VAL F CG2   1 
ATOM 3971  N N     . THR F 2 72  ? 63.338  72.177  61.554  1.00 39.75  ?  71  THR F N     1 
ATOM 3972  C CA    . THR F 2 72  ? 63.011  73.570  61.276  1.00 39.75  ?  71  THR F CA    1 
ATOM 3973  C C     . THR F 2 72  ? 63.867  74.119  60.146  1.00 39.75  ?  71  THR F C     1 
ATOM 3974  O O     . THR F 2 72  ? 63.350  74.791  59.243  1.00 39.75  ?  71  THR F O     1 
ATOM 3975  C CB    . THR F 2 72  ? 63.185  74.402  62.541  1.00 39.75  ?  71  THR F CB    1 
ATOM 3976  O OG1   . THR F 2 72  ? 62.308  73.901  63.553  1.00 39.75  ?  71  THR F OG1   1 
ATOM 3977  C CG2   . THR F 2 72  ? 62.858  75.856  62.283  1.00 39.75  ?  71  THR F CG2   1 
ATOM 3978  N N     . TYR F 2 73  ? 65.164  73.780  60.142  1.00 36.80  ?  72  TYR F N     1 
ATOM 3979  C CA    . TYR F 2 73  ? 66.017  74.115  59.006  1.00 36.80  ?  72  TYR F CA    1 
ATOM 3980  C C     . TYR F 2 73  ? 65.504  73.459  57.736  1.00 36.80  ?  72  TYR F C     1 
ATOM 3981  O O     . TYR F 2 73  ? 65.462  74.091  56.674  1.00 36.80  ?  72  TYR F O     1 
ATOM 3982  C CB    . TYR F 2 73  ? 67.453  73.676  59.269  1.00 36.80  ?  72  TYR F CB    1 
ATOM 3983  C CG    . TYR F 2 73  ? 68.143  74.413  60.379  1.00 36.80  ?  72  TYR F CG    1 
ATOM 3984  C CD1   . TYR F 2 73  ? 68.698  75.659  60.168  1.00 36.80  ?  72  TYR F CD1   1 
ATOM 3985  C CD2   . TYR F 2 73  ? 68.259  73.853  61.632  1.00 36.80  ?  72  TYR F CD2   1 
ATOM 3986  C CE1   . TYR F 2 73  ? 69.339  76.327  61.182  1.00 36.80  ?  72  TYR F CE1   1 
ATOM 3987  C CE2   . TYR F 2 73  ? 68.897  74.515  62.651  1.00 36.80  ?  72  TYR F CE2   1 
ATOM 3988  C CZ    . TYR F 2 73  ? 69.433  75.750  62.420  1.00 36.80  ?  72  TYR F CZ    1 
ATOM 3989  O OH    . TYR F 2 73  ? 70.071  76.414  63.437  1.00 36.80  ?  72  TYR F OH    1 
ATOM 3990  N N     . THR F 2 74  ? 65.034  72.215  57.854  1.00 44.27  ?  73  THR F N     1 
ATOM 3991  C CA    . THR F 2 74  ? 64.447  71.522  56.719  1.00 44.27  ?  73  THR F CA    1 
ATOM 3992  C C     . THR F 2 74  ? 63.152  72.188  56.284  1.00 44.27  ?  73  THR F C     1 
ATOM 3993  O O     . THR F 2 74  ? 62.836  72.213  55.091  1.00 44.27  ?  73  THR F O     1 
ATOM 3994  C CB    . THR F 2 74  ? 64.225  70.059  57.090  1.00 44.27  ?  73  THR F CB    1 
ATOM 3995  O OG1   . THR F 2 74  ? 65.462  69.511  57.554  1.00 44.27  ?  73  THR F OG1   1 
ATOM 3996  C CG2   . THR F 2 74  ? 63.771  69.242  55.896  1.00 44.27  ?  73  THR F CG2   1 
ATOM 3997  N N     . GLU F 2 75  ? 62.420  72.793  57.214  1.00 44.06  ?  74  GLU F N     1 
ATOM 3998  C CA    . GLU F 2 75  ? 61.244  73.520  56.775  1.00 44.06  ?  74  GLU F CA    1 
ATOM 3999  C C     . GLU F 2 75  ? 61.576  74.915  56.288  1.00 44.06  ?  74  GLU F C     1 
ATOM 4000  O O     . GLU F 2 75  ? 60.704  75.575  55.718  1.00 44.06  ?  74  GLU F O     1 
ATOM 4001  C CB    . GLU F 2 75  ? 60.202  73.595  57.884  1.00 44.06  ?  74  GLU F CB    1 
ATOM 4002  C CG    . GLU F 2 75  ? 59.498  72.285  58.120  1.00 44.06  ?  74  GLU F CG    1 
ATOM 4003  C CD    . GLU F 2 75  ? 58.436  72.393  59.176  1.00 44.06  ?  74  GLU F CD    1 
ATOM 4004  O OE1   . GLU F 2 75  ? 58.366  73.441  59.849  1.00 44.06  ?  74  GLU F OE1   1 
ATOM 4005  O OE2   . GLU F 2 75  ? 57.653  71.437  59.317  1.00 44.06  -1 74  GLU F OE2   1 
ATOM 4006  N N     . HIS F 2 76  ? 62.804  75.387  56.493  1.00 42.97  ?  75  HIS F N     1 
ATOM 4007  C CA    . HIS F 2 76  ? 63.105  76.725  56.008  1.00 42.97  ?  75  HIS F CA    1 
ATOM 4008  C C     . HIS F 2 76  ? 63.480  76.698  54.534  1.00 42.97  ?  75  HIS F C     1 
ATOM 4009  O O     . HIS F 2 76  ? 62.792  77.288  53.696  1.00 42.97  ?  75  HIS F O     1 
ATOM 4010  C CB    . HIS F 2 76  ? 64.219  77.359  56.824  1.00 42.97  ?  75  HIS F CB    1 
ATOM 4011  C CG    . HIS F 2 76  ? 64.386  78.810  56.538  1.00 42.97  ?  75  HIS F CG    1 
ATOM 4012  N ND1   . HIS F 2 76  ? 65.142  79.278  55.487  1.00 42.97  ?  75  HIS F ND1   1 
ATOM 4013  C CD2   . HIS F 2 76  ? 63.860  79.898  57.141  1.00 42.97  ?  75  HIS F CD2   1 
ATOM 4014  C CE1   . HIS F 2 76  ? 65.092  80.596  55.468  1.00 42.97  ?  75  HIS F CE1   1 
ATOM 4015  N NE2   . HIS F 2 76  ? 64.318  80.997  56.460  1.00 42.97  ?  75  HIS F NE2   1 
ATOM 4016  N N     . ALA F 2 77  ? 64.576  76.026  54.204  1.00 45.68  ?  76  ALA F N     1 
ATOM 4017  C CA    . ALA F 2 77  ? 64.868  75.709  52.815  1.00 45.68  ?  76  ALA F CA    1 
ATOM 4018  C C     . ALA F 2 77  ? 63.874  74.652  52.370  1.00 45.68  ?  76  ALA F C     1 
ATOM 4019  O O     . ALA F 2 77  ? 63.970  73.495  52.784  1.00 45.68  ?  76  ALA F O     1 
ATOM 4020  C CB    . ALA F 2 77  ? 66.301  75.216  52.665  1.00 45.68  ?  76  ALA F CB    1 
ATOM 4021  N N     . LYS F 2 78  ? 62.926  75.043  51.518  1.00 48.95  ?  77  LYS F N     1 
ATOM 4022  C CA    . LYS F 2 78  ? 61.688  74.291  51.316  1.00 48.95  ?  77  LYS F CA    1 
ATOM 4023  C C     . LYS F 2 78  ? 61.974  73.006  50.546  1.00 48.95  ?  77  LYS F C     1 
ATOM 4024  O O     . LYS F 2 78  ? 61.741  72.891  49.341  1.00 48.95  ?  77  LYS F O     1 
ATOM 4025  C CB    . LYS F 2 78  ? 60.669  75.148  50.583  1.00 48.95  ?  77  LYS F CB    1 
ATOM 4026  C CG    . LYS F 2 78  ? 60.216  76.361  51.356  1.00 48.95  ?  77  LYS F CG    1 
ATOM 4027  C CD    . LYS F 2 78  ? 59.104  77.056  50.612  1.00 48.95  ?  77  LYS F CD    1 
ATOM 4028  C CE    . LYS F 2 78  ? 59.641  77.732  49.367  1.00 48.95  ?  77  LYS F CE    1 
ATOM 4029  N NZ    . LYS F 2 78  ? 58.583  78.490  48.652  1.00 48.95  1  77  LYS F NZ    1 
ATOM 4030  N N     . ARG F 2 79  ? 62.485  72.018  51.272  1.00 54.50  ?  78  ARG F N     1 
ATOM 4031  C CA    . ARG F 2 79  ? 62.740  70.702  50.718  1.00 54.50  ?  78  ARG F CA    1 
ATOM 4032  C C     . ARG F 2 79  ? 62.277  69.654  51.716  1.00 54.50  ?  78  ARG F C     1 
ATOM 4033  O O     . ARG F 2 79  ? 62.210  69.909  52.919  1.00 54.50  ?  78  ARG F O     1 
ATOM 4034  C CB    . ARG F 2 79  ? 64.220  70.506  50.372  1.00 54.50  ?  78  ARG F CB    1 
ATOM 4035  C CG    . ARG F 2 79  ? 65.175  70.547  51.544  1.00 54.50  ?  78  ARG F CG    1 
ATOM 4036  C CD    . ARG F 2 79  ? 66.592  70.313  51.057  1.00 54.50  ?  78  ARG F CD    1 
ATOM 4037  N NE    . ARG F 2 79  ? 67.562  70.266  52.143  1.00 54.50  ?  78  ARG F NE    1 
ATOM 4038  C CZ    . ARG F 2 79  ? 68.226  71.324  52.590  1.00 54.50  ?  78  ARG F CZ    1 
ATOM 4039  N NH1   . ARG F 2 79  ? 68.030  72.509  52.033  1.00 54.50  1  78  ARG F NH1   1 
ATOM 4040  N NH2   . ARG F 2 79  ? 69.092  71.197  53.583  1.00 54.50  ?  78  ARG F NH2   1 
ATOM 4041  N N     . LYS F 2 80  ? 61.942  68.474  51.201  1.00 66.97  ?  79  LYS F N     1 
ATOM 4042  C CA    . LYS F 2 80  ? 61.421  67.389  52.017  1.00 66.97  ?  79  LYS F CA    1 
ATOM 4043  C C     . LYS F 2 80  ? 62.511  66.464  52.537  1.00 66.97  ?  79  LYS F C     1 
ATOM 4044  O O     . LYS F 2 80  ? 62.204  65.354  52.983  1.00 66.97  ?  79  LYS F O     1 
ATOM 4045  C CB    . LYS F 2 80  ? 60.396  66.569  51.227  1.00 66.97  ?  79  LYS F CB    1 
ATOM 4046  C CG    . LYS F 2 80  ? 58.960  67.077  51.277  1.00 66.97  ?  79  LYS F CG    1 
ATOM 4047  C CD    . LYS F 2 80  ? 58.708  68.240  50.333  1.00 66.97  ?  79  LYS F CD    1 
ATOM 4048  C CE    . LYS F 2 80  ? 58.726  67.788  48.881  1.00 66.97  ?  79  LYS F CE    1 
ATOM 4049  N NZ    . LYS F 2 80  ? 58.405  68.901  47.941  1.00 66.97  1  79  LYS F NZ    1 
ATOM 4050  N N     . THR F 2 81  ? 63.770  66.888  52.501  1.00 61.83  ?  80  THR F N     1 
ATOM 4051  C CA    . THR F 2 81  ? 64.886  65.994  52.769  1.00 61.83  ?  80  THR F CA    1 
ATOM 4052  C C     . THR F 2 81  ? 65.790  66.590  53.834  1.00 61.83  ?  80  THR F C     1 
ATOM 4053  O O     . THR F 2 81  ? 66.271  67.716  53.683  1.00 61.83  ?  80  THR F O     1 
ATOM 4054  C CB    . THR F 2 81  ? 65.686  65.732  51.494  1.00 61.83  ?  80  THR F CB    1 
ATOM 4055  O OG1   . THR F 2 81  ? 64.817  65.204  50.487  1.00 61.83  ?  80  THR F OG1   1 
ATOM 4056  C CG2   . THR F 2 81  ? 66.791  64.732  51.759  1.00 61.83  ?  80  THR F CG2   1 
ATOM 4057  N N     . VAL F 2 82  ? 66.029  65.832  54.897  1.00 45.80  ?  81  VAL F N     1 
ATOM 4058  C CA    . VAL F 2 82  ? 66.924  66.246  55.968  1.00 45.80  ?  81  VAL F CA    1 
ATOM 4059  C C     . VAL F 2 82  ? 68.344  65.883  55.561  1.00 45.80  ?  81  VAL F C     1 
ATOM 4060  O O     . VAL F 2 82  ? 68.693  64.705  55.486  1.00 45.80  ?  81  VAL F O     1 
ATOM 4061  C CB    . VAL F 2 82  ? 66.551  65.581  57.292  1.00 45.80  ?  81  VAL F CB    1 
ATOM 4062  C CG1   . VAL F 2 82  ? 67.542  65.962  58.350  1.00 45.80  ?  81  VAL F CG1   1 
ATOM 4063  C CG2   . VAL F 2 82  ? 65.158  65.979  57.694  1.00 45.80  ?  81  VAL F CG2   1 
ATOM 4064  N N     . THR F 2 83  ? 69.168  66.887  55.297  1.00 45.45  ?  82  THR F N     1 
ATOM 4065  C CA    . THR F 2 83  ? 70.552  66.600  54.966  1.00 45.45  ?  82  THR F CA    1 
ATOM 4066  C C     . THR F 2 83  ? 71.357  66.382  56.239  1.00 45.45  ?  82  THR F C     1 
ATOM 4067  O O     . THR F 2 83  ? 70.885  66.625  57.350  1.00 45.45  ?  82  THR F O     1 
ATOM 4068  C CB    . THR F 2 83  ? 71.163  67.736  54.159  1.00 45.45  ?  82  THR F CB    1 
ATOM 4069  O OG1   . THR F 2 83  ? 71.192  68.918  54.963  1.00 45.45  ?  82  THR F OG1   1 
ATOM 4070  C CG2   . THR F 2 83  ? 70.336  68.001  52.923  1.00 45.45  ?  82  THR F CG2   1 
ATOM 4071  N N     . ALA F 2 84  ? 72.597  65.920  56.068  1.00 43.84  ?  83  ALA F N     1 
ATOM 4072  C CA    . ALA F 2 84  ? 73.465  65.711  57.222  1.00 43.84  ?  83  ALA F CA    1 
ATOM 4073  C C     . ALA F 2 84  ? 73.916  67.031  57.822  1.00 43.84  ?  83  ALA F C     1 
ATOM 4074  O O     . ALA F 2 84  ? 74.130  67.121  59.041  1.00 43.84  ?  83  ALA F O     1 
ATOM 4075  C CB    . ALA F 2 84  ? 74.671  64.863  56.829  1.00 43.84  ?  83  ALA F CB    1 
ATOM 4076  N N     . MET F 2 85  ? 74.029  68.067  56.989  1.00 42.04  ?  84  MET F N     1 
ATOM 4077  C CA    . MET F 2 85  ? 74.408  69.383  57.480  1.00 42.04  ?  84  MET F CA    1 
ATOM 4078  C C     . MET F 2 85  ? 73.351  69.960  58.406  1.00 42.04  ?  84  MET F C     1 
ATOM 4079  O O     . MET F 2 85  ? 73.685  70.713  59.322  1.00 42.04  ?  84  MET F O     1 
ATOM 4080  C CB    . MET F 2 85  ? 74.651  70.329  56.310  1.00 42.04  ?  84  MET F CB    1 
ATOM 4081  C CG    . MET F 2 85  ? 75.777  69.890  55.408  1.00 42.04  ?  84  MET F CG    1 
ATOM 4082  S SD    . MET F 2 85  ? 77.305  69.681  56.319  1.00 42.04  ?  84  MET F SD    1 
ATOM 4083  C CE    . MET F 2 85  ? 77.621  71.369  56.797  1.00 42.04  ?  84  MET F CE    1 
ATOM 4084  N N     . ASP F 2 86  ? 72.086  69.585  58.213  1.00 41.87  ?  85  ASP F N     1 
ATOM 4085  C CA    . ASP F 2 86  ? 71.032  70.055  59.102  1.00 41.87  ?  85  ASP F CA    1 
ATOM 4086  C C     . ASP F 2 86  ? 71.191  69.480  60.501  1.00 41.87  ?  85  ASP F C     1 
ATOM 4087  O O     . ASP F 2 86  ? 71.020  70.196  61.494  1.00 41.87  ?  85  ASP F O     1 
ATOM 4088  C CB    . ASP F 2 86  ? 69.672  69.688  58.530  1.00 41.87  ?  85  ASP F CB    1 
ATOM 4089  C CG    . ASP F 2 86  ? 69.402  70.368  57.218  1.00 41.87  ?  85  ASP F CG    1 
ATOM 4090  O OD1   . ASP F 2 86  ? 69.954  71.466  56.998  1.00 41.87  ?  85  ASP F OD1   1 
ATOM 4091  O OD2   . ASP F 2 86  ? 68.644  69.804  56.401  1.00 41.87  -1 85  ASP F OD2   1 
ATOM 4092  N N     . VAL F 2 87  ? 71.551  68.202  60.602  1.00 33.92  ?  86  VAL F N     1 
ATOM 4093  C CA    . VAL F 2 87  ? 71.741  67.599  61.915  1.00 33.92  ?  86  VAL F CA    1 
ATOM 4094  C C     . VAL F 2 87  ? 73.004  68.142  62.570  1.00 33.92  ?  86  VAL F C     1 
ATOM 4095  O O     . VAL F 2 87  ? 73.031  68.389  63.786  1.00 33.92  ?  86  VAL F O     1 
ATOM 4096  C CB    . VAL F 2 87  ? 71.760  66.069  61.783  1.00 33.92  ?  86  VAL F CB    1 
ATOM 4097  C CG1   . VAL F 2 87  ? 72.002  65.406  63.113  1.00 33.92  ?  86  VAL F CG1   1 
ATOM 4098  C CG2   . VAL F 2 87  ? 70.450  65.609  61.224  1.00 33.92  ?  86  VAL F CG2   1 
ATOM 4099  N N     . VAL F 2 88  ? 74.046  68.397  61.770  1.00 33.76  ?  87  VAL F N     1 
ATOM 4100  C CA    . VAL F 2 88  ? 75.265  68.998  62.311  1.00 33.76  ?  87  VAL F CA    1 
ATOM 4101  C C     . VAL F 2 88  ? 74.991  70.407  62.826  1.00 33.76  ?  87  VAL F C     1 
ATOM 4102  O O     . VAL F 2 88  ? 75.470  70.792  63.896  1.00 33.76  ?  87  VAL F O     1 
ATOM 4103  C CB    . VAL F 2 88  ? 76.382  68.977  61.254  1.00 33.76  ?  87  VAL F CB    1 
ATOM 4104  C CG1   . VAL F 2 88  ? 77.599  69.737  61.725  1.00 33.76  ?  87  VAL F CG1   1 
ATOM 4105  C CG2   . VAL F 2 88  ? 76.775  67.553  60.963  1.00 33.76  ?  87  VAL F CG2   1 
ATOM 4106  N N     . TYR F 2 89  ? 74.146  71.162  62.127  1.00 34.82  ?  88  TYR F N     1 
ATOM 4107  C CA    . TYR F 2 89  ? 73.819  72.510  62.580  1.00 34.82  ?  88  TYR F CA    1 
ATOM 4108  C C     . TYR F 2 89  ? 72.905  72.499  63.798  1.00 34.82  ?  88  TYR F C     1 
ATOM 4109  O O     . TYR F 2 89  ? 73.015  73.384  64.657  1.00 34.82  ?  88  TYR F O     1 
ATOM 4110  C CB    . TYR F 2 89  ? 73.193  73.295  61.435  1.00 34.82  ?  88  TYR F CB    1 
ATOM 4111  C CG    . TYR F 2 89  ? 74.184  73.651  60.358  1.00 34.82  ?  88  TYR F CG    1 
ATOM 4112  C CD1   . TYR F 2 89  ? 75.539  73.741  60.641  1.00 34.82  ?  88  TYR F CD1   1 
ATOM 4113  C CD2   . TYR F 2 89  ? 73.775  73.845  59.047  1.00 34.82  ?  88  TYR F CD2   1 
ATOM 4114  C CE1   . TYR F 2 89  ? 76.454  74.052  59.659  1.00 34.82  ?  88  TYR F CE1   1 
ATOM 4115  C CE2   . TYR F 2 89  ? 74.682  74.155  58.058  1.00 34.82  ?  88  TYR F CE2   1 
ATOM 4116  C CZ    . TYR F 2 89  ? 76.022  74.254  58.369  1.00 34.82  ?  88  TYR F CZ    1 
ATOM 4117  O OH    . TYR F 2 89  ? 76.933  74.561  57.387  1.00 34.82  ?  88  TYR F OH    1 
ATOM 4118  N N     . ALA F 2 90  ? 72.021  71.504  63.907  1.00 31.45  ?  89  ALA F N     1 
ATOM 4119  C CA    . ALA F 2 90  ? 71.195  71.390  65.104  1.00 31.45  ?  89  ALA F CA    1 
ATOM 4120  C C     . ALA F 2 90  ? 72.035  71.045  66.323  1.00 31.45  ?  89  ALA F C     1 
ATOM 4121  O O     . ALA F 2 90  ? 71.805  71.578  67.413  1.00 31.45  ?  89  ALA F O     1 
ATOM 4122  C CB    . ALA F 2 90  ? 70.107  70.345  64.900  1.00 31.45  ?  89  ALA F CB    1 
ATOM 4123  N N     . LEU F 2 91  ? 73.033  70.180  66.155  1.00 28.13  ?  90  LEU F N     1 
ATOM 4124  C CA    . LEU F 2 91  ? 73.926  69.878  67.269  1.00 28.13  ?  90  LEU F CA    1 
ATOM 4125  C C     . LEU F 2 91  ? 74.879  71.030  67.563  1.00 28.13  ?  90  LEU F C     1 
ATOM 4126  O O     . LEU F 2 91  ? 75.339  71.173  68.699  1.00 28.13  ?  90  LEU F O     1 
ATOM 4127  C CB    . LEU F 2 91  ? 74.704  68.610  66.969  1.00 28.13  ?  90  LEU F CB    1 
ATOM 4128  C CG    . LEU F 2 91  ? 73.797  67.399  66.849  1.00 28.13  ?  90  LEU F CG    1 
ATOM 4129  C CD1   . LEU F 2 91  ? 74.591  66.253  66.315  1.00 28.13  ?  90  LEU F CD1   1 
ATOM 4130  C CD2   . LEU F 2 91  ? 73.205  67.067  68.191  1.00 28.13  ?  90  LEU F CD2   1 
ATOM 4131  N N     . LYS F 2 92  ? 75.206  71.831  66.547  1.00 34.60  ?  91  LYS F N     1 
ATOM 4132  C CA    . LYS F 2 92  ? 75.974  73.057  66.746  1.00 34.60  ?  91  LYS F CA    1 
ATOM 4133  C C     . LYS F 2 92  ? 75.225  74.028  67.639  1.00 34.60  ?  91  LYS F C     1 
ATOM 4134  O O     . LYS F 2 92  ? 75.788  74.582  68.589  1.00 34.60  ?  91  LYS F O     1 
ATOM 4135  C CB    . LYS F 2 92  ? 76.253  73.712  65.394  1.00 34.60  ?  91  LYS F CB    1 
ATOM 4136  C CG    . LYS F 2 92  ? 76.954  75.058  65.458  1.00 34.60  ?  91  LYS F CG    1 
ATOM 4137  C CD    . LYS F 2 92  ? 78.397  74.924  65.860  1.00 34.60  ?  91  LYS F CD    1 
ATOM 4138  C CE    . LYS F 2 92  ? 79.172  74.210  64.768  1.00 34.60  ?  91  LYS F CE    1 
ATOM 4139  N NZ    . LYS F 2 92  ? 79.226  75.020  63.522  1.00 34.60  1  91  LYS F NZ    1 
ATOM 4140  N N     . ARG F 2 93  ? 73.950  74.255  67.333  1.00 38.85  ?  92  ARG F N     1 
ATOM 4141  C CA    . ARG F 2 93  ? 73.145  75.158  68.145  1.00 38.85  ?  92  ARG F CA    1 
ATOM 4142  C C     . ARG F 2 93  ? 72.847  74.555  69.514  1.00 38.85  ?  92  ARG F C     1 
ATOM 4143  O O     . ARG F 2 93  ? 72.672  75.293  70.488  1.00 38.85  ?  92  ARG F O     1 
ATOM 4144  C CB    . ARG F 2 93  ? 71.862  75.512  67.379  1.00 38.85  ?  92  ARG F CB    1 
ATOM 4145  C CG    . ARG F 2 93  ? 70.965  76.559  68.013  1.00 38.85  ?  92  ARG F CG    1 
ATOM 4146  C CD    . ARG F 2 93  ? 69.819  75.900  68.739  1.00 38.85  ?  92  ARG F CD    1 
ATOM 4147  N NE    . ARG F 2 93  ? 68.942  76.854  69.391  1.00 38.85  ?  92  ARG F NE    1 
ATOM 4148  C CZ    . ARG F 2 93  ? 68.015  76.501  70.271  1.00 38.85  ?  92  ARG F CZ    1 
ATOM 4149  N NH1   . ARG F 2 93  ? 67.860  75.223  70.591  1.00 38.85  1  92  ARG F NH1   1 
ATOM 4150  N NH2   . ARG F 2 93  ? 67.250  77.416  70.838  1.00 38.85  ?  92  ARG F NH2   1 
ATOM 4151  N N     . GLN F 2 94  ? 72.802  73.225  69.608  1.00 36.62  ?  93  GLN F N     1 
ATOM 4152  C CA    . GLN F 2 94  ? 72.476  72.575  70.873  1.00 36.62  ?  93  GLN F CA    1 
ATOM 4153  C C     . GLN F 2 94  ? 73.611  72.705  71.880  1.00 36.62  ?  93  GLN F C     1 
ATOM 4154  O O     . GLN F 2 94  ? 73.366  72.885  73.078  1.00 36.62  ?  93  GLN F O     1 
ATOM 4155  C CB    . GLN F 2 94  ? 72.149  71.107  70.617  1.00 36.62  ?  93  GLN F CB    1 
ATOM 4156  C CG    . GLN F 2 94  ? 71.739  70.325  71.835  1.00 36.62  ?  93  GLN F CG    1 
ATOM 4157  C CD    . GLN F 2 94  ? 70.436  70.807  72.396  1.00 36.62  ?  93  GLN F CD    1 
ATOM 4158  O OE1   . GLN F 2 94  ? 69.523  71.162  71.654  1.00 36.62  ?  93  GLN F OE1   1 
ATOM 4159  N NE2   . GLN F 2 94  ? 70.329  70.812  73.716  1.00 36.62  ?  93  GLN F NE2   1 
ATOM 4160  N N     . GLY F 2 95  ? 74.855  72.626  71.419  1.00 37.14  ?  94  GLY F N     1 
ATOM 4161  C CA    . GLY F 2 95  ? 75.993  72.781  72.301  1.00 37.14  ?  94  GLY F CA    1 
ATOM 4162  C C     . GLY F 2 95  ? 77.097  71.777  72.052  1.00 37.14  ?  94  GLY F C     1 
ATOM 4163  O O     . GLY F 2 95  ? 78.277  72.083  72.239  1.00 37.14  ?  94  GLY F O     1 
ATOM 4164  N N     . ARG F 2 96  ? 76.727  70.578  71.616  1.00 37.39  ?  95  ARG F N     1 
ATOM 4165  C CA    . ARG F 2 96  ? 77.677  69.493  71.385  1.00 37.39  ?  95  ARG F CA    1 
ATOM 4166  C C     . ARG F 2 96  ? 78.126  69.556  69.935  1.00 37.39  ?  95  ARG F C     1 
ATOM 4167  O O     . ARG F 2 96  ? 77.448  69.041  69.048  1.00 37.39  ?  95  ARG F O     1 
ATOM 4168  C CB    . ARG F 2 96  ? 77.020  68.159  71.696  1.00 37.39  ?  95  ARG F CB    1 
ATOM 4169  C CG    . ARG F 2 96  ? 76.606  68.060  73.126  1.00 37.39  ?  95  ARG F CG    1 
ATOM 4170  C CD    . ARG F 2 96  ? 75.817  66.815  73.406  1.00 37.39  ?  95  ARG F CD    1 
ATOM 4171  N NE    . ARG F 2 96  ? 75.482  66.767  74.820  1.00 37.39  ?  95  ARG F NE    1 
ATOM 4172  C CZ    . ARG F 2 96  ? 74.437  67.389  75.347  1.00 37.39  ?  95  ARG F CZ    1 
ATOM 4173  N NH1   . ARG F 2 96  ? 73.639  68.110  74.578  1.00 37.39  1  95  ARG F NH1   1 
ATOM 4174  N NH2   . ARG F 2 96  ? 74.200  67.306  76.648  1.00 37.39  ?  95  ARG F NH2   1 
ATOM 4175  N N     . THR F 2 97  ? 79.271  70.184  69.687  1.00 38.82  ?  96  THR F N     1 
ATOM 4176  C CA    . THR F 2 97  ? 79.741  70.355  68.319  1.00 38.82  ?  96  THR F CA    1 
ATOM 4177  C C     . THR F 2 97  ? 80.249  69.031  67.770  1.00 38.82  ?  96  THR F C     1 
ATOM 4178  O O     . THR F 2 97  ? 81.024  68.332  68.426  1.00 38.82  ?  96  THR F O     1 
ATOM 4179  C CB    . THR F 2 97  ? 80.842  71.410  68.265  1.00 38.82  ?  96  THR F CB    1 
ATOM 4180  O OG1   . THR F 2 97  ? 80.342  72.642  68.793  1.00 38.82  ?  96  THR F OG1   1 
ATOM 4181  C CG2   . THR F 2 97  ? 81.289  71.647  66.836  1.00 38.82  ?  96  THR F CG2   1 
ATOM 4182  N N     . LEU F 2 98  ? 79.793  68.679  66.575  1.00 38.03  ?  97  LEU F N     1 
ATOM 4183  C CA    . LEU F 2 98  ? 80.165  67.438  65.915  1.00 38.03  ?  97  LEU F CA    1 
ATOM 4184  C C     . LEU F 2 98  ? 81.092  67.749  64.752  1.00 38.03  ?  97  LEU F C     1 
ATOM 4185  O O     . LEU F 2 98  ? 80.832  68.676  63.981  1.00 38.03  ?  97  LEU F O     1 
ATOM 4186  C CB    . LEU F 2 98  ? 78.924  66.707  65.414  1.00 38.03  ?  97  LEU F CB    1 
ATOM 4187  C CG    . LEU F 2 98  ? 79.180  65.342  64.802  1.00 38.03  ?  97  LEU F CG    1 
ATOM 4188  C CD1   . LEU F 2 98  ? 79.690  64.432  65.871  1.00 38.03  ?  97  LEU F CD1   1 
ATOM 4189  C CD2   . LEU F 2 98  ? 77.918  64.786  64.195  1.00 38.03  ?  97  LEU F CD2   1 
ATOM 4190  N N     . TYR F 2 99  ? 82.170  66.982  64.628  1.00 39.05  ?  98  TYR F N     1 
ATOM 4191  C CA    . TYR F 2 99  ? 83.096  67.140  63.522  1.00 39.05  ?  98  TYR F CA    1 
ATOM 4192  C C     . TYR F 2 99  ? 82.919  66.004  62.526  1.00 39.05  ?  98  TYR F C     1 
ATOM 4193  O O     . TYR F 2 99  ? 82.074  65.124  62.686  1.00 39.05  ?  98  TYR F O     1 
ATOM 4194  C CB    . TYR F 2 99  ? 84.544  67.187  64.007  1.00 39.05  ?  98  TYR F CB    1 
ATOM 4195  C CG    . TYR F 2 99  ? 84.948  68.468  64.684  1.00 39.05  ?  98  TYR F CG    1 
ATOM 4196  C CD1   . TYR F 2 99  ? 84.116  69.573  64.674  1.00 39.05  ?  98  TYR F CD1   1 
ATOM 4197  C CD2   . TYR F 2 99  ? 86.186  68.587  65.293  1.00 39.05  ?  98  TYR F CD2   1 
ATOM 4198  C CE1   . TYR F 2 99  ? 84.486  70.747  65.285  1.00 39.05  ?  98  TYR F CE1   1 
ATOM 4199  C CE2   . TYR F 2 99  ? 86.566  69.761  65.906  1.00 39.05  ?  98  TYR F CE2   1 
ATOM 4200  C CZ    . TYR F 2 99  ? 85.709  70.836  65.898  1.00 39.05  ?  98  TYR F CZ    1 
ATOM 4201  O OH    . TYR F 2 99  ? 86.069  72.015  66.498  1.00 39.05  ?  98  TYR F OH    1 
ATOM 4202  N N     . GLY F 2 100 ? 83.731  66.031  61.478  1.00 43.67  ?  99  GLY F N     1 
ATOM 4203  C CA    . GLY F 2 100 ? 83.798  64.922  60.550  1.00 43.67  ?  99  GLY F CA    1 
ATOM 4204  C C     . GLY F 2 100 ? 82.738  64.906  59.472  1.00 43.67  ?  99  GLY F C     1 
ATOM 4205  O O     . GLY F 2 100 ? 83.055  64.899  58.280  1.00 43.67  ?  99  GLY F O     1 
ATOM 4206  N N     . PHE F 2 101 ? 81.473  64.912  59.875  1.00 46.97  ?  100 PHE F N     1 
ATOM 4207  C CA    . PHE F 2 101 ? 80.374  64.662  58.955  1.00 46.97  ?  100 PHE F CA    1 
ATOM 4208  C C     . PHE F 2 101 ? 79.957  65.894  58.168  1.00 46.97  ?  100 PHE F C     1 
ATOM 4209  O O     . PHE F 2 101 ? 78.992  65.846  57.403  1.00 46.97  ?  100 PHE F O     1 
ATOM 4210  C CB    . PHE F 2 101 ? 79.207  64.093  59.744  1.00 46.97  ?  100 PHE F CB    1 
ATOM 4211  C CG    . PHE F 2 101 ? 79.433  62.690  60.193  1.00 46.97  ?  100 PHE F CG    1 
ATOM 4212  C CD1   . PHE F 2 101 ? 80.209  61.830  59.438  1.00 46.97  ?  100 PHE F CD1   1 
ATOM 4213  C CD2   . PHE F 2 101 ? 78.962  62.258  61.412  1.00 46.97  ?  100 PHE F CD2   1 
ATOM 4214  C CE1   . PHE F 2 101 ? 80.437  60.533  59.858  1.00 46.97  ?  100 PHE F CE1   1 
ATOM 4215  C CE2   . PHE F 2 101 ? 79.186  60.963  61.840  1.00 46.97  ?  100 PHE F CE2   1 
ATOM 4216  C CZ    . PHE F 2 101 ? 79.927  60.101  61.064  1.00 46.97  ?  100 PHE F CZ    1 
ATOM 4217  N N     . GLY F 2 102 ? 80.674  66.996  58.343  1.00 56.39  ?  101 GLY F N     1 
ATOM 4218  C CA    . GLY F 2 102 ? 80.468  68.168  57.518  1.00 56.39  ?  101 GLY F CA    1 
ATOM 4219  C C     . GLY F 2 102 ? 81.044  67.969  56.129  1.00 56.39  ?  101 GLY F C     1 
ATOM 4220  O O     . GLY F 2 102 ? 80.456  67.277  55.298  1.00 56.39  ?  101 GLY F O     1 
ATOM 4221  O OXT   . GLY F 2 102 ? 82.116  68.479  55.800  1.00 56.39  -1 101 GLY F OXT   1 
ATOM 4222  N N     . LYS G 3 16  ? 51.131  108.236 62.312  1.00 70.78  ?  15  LYS G N     1 
ATOM 4223  C CA    . LYS G 3 16  ? 51.782  107.835 61.074  1.00 70.78  ?  15  LYS G CA    1 
ATOM 4224  C C     . LYS G 3 16  ? 53.088  107.101 61.345  1.00 70.78  ?  15  LYS G C     1 
ATOM 4225  O O     . LYS G 3 16  ? 53.738  106.619 60.420  1.00 70.78  ?  15  LYS G O     1 
ATOM 4226  C CB    . LYS G 3 16  ? 52.041  109.052 60.190  1.00 70.78  ?  15  LYS G CB    1 
ATOM 4227  C CG    . LYS G 3 16  ? 52.984  110.071 60.797  1.00 70.78  ?  15  LYS G CG    1 
ATOM 4228  C CD    . LYS G 3 16  ? 53.225  111.213 59.830  1.00 70.78  ?  15  LYS G CD    1 
ATOM 4229  C CE    . LYS G 3 16  ? 51.983  112.077 59.678  1.00 70.78  ?  15  LYS G CE    1 
ATOM 4230  N NZ    . LYS G 3 16  ? 52.227  113.260 58.809  1.00 70.78  1  15  LYS G NZ    1 
ATOM 4231  N N     . SER G 3 17  ? 53.465  107.015 62.616  1.00 71.00  ?  16  SER G N     1 
ATOM 4232  C CA    . SER G 3 17  ? 54.701  106.349 63.000  1.00 71.00  ?  16  SER G CA    1 
ATOM 4233  C C     . SER G 3 17  ? 54.553  104.838 62.886  1.00 71.00  ?  16  SER G C     1 
ATOM 4234  O O     . SER G 3 17  ? 53.470  104.291 63.108  1.00 71.00  ?  16  SER G O     1 
ATOM 4235  C CB    . SER G 3 17  ? 55.084  106.729 64.428  1.00 71.00  ?  16  SER G CB    1 
ATOM 4236  O OG    . SER G 3 17  ? 55.354  108.115 64.524  1.00 71.00  ?  16  SER G OG    1 
ATOM 4237  N N     . ARG G 3 18  ? 55.658  104.161 62.548  1.00 66.50  ?  17  ARG G N     1 
ATOM 4238  C CA    . ARG G 3 18  ? 55.617  102.717 62.336  1.00 66.50  ?  17  ARG G CA    1 
ATOM 4239  C C     . ARG G 3 18  ? 55.408  101.932 63.619  1.00 66.50  ?  17  ARG G C     1 
ATOM 4240  O O     . ARG G 3 18  ? 55.052  100.753 63.554  1.00 66.50  ?  17  ARG G O     1 
ATOM 4241  C CB    . ARG G 3 18  ? 56.892  102.228 61.652  1.00 66.50  ?  17  ARG G CB    1 
ATOM 4242  C CG    . ARG G 3 18  ? 56.985  102.597 60.189  1.00 66.50  ?  17  ARG G CG    1 
ATOM 4243  C CD    . ARG G 3 18  ? 58.209  101.981 59.545  1.00 66.50  ?  17  ARG G CD    1 
ATOM 4244  N NE    . ARG G 3 18  ? 59.450  102.577 60.023  1.00 66.50  ?  17  ARG G NE    1 
ATOM 4245  C CZ    . ARG G 3 18  ? 60.656  102.103 59.732  1.00 66.50  ?  17  ARG G CZ    1 
ATOM 4246  N NH1   . ARG G 3 18  ? 60.777  101.022 58.975  1.00 66.50  1  17  ARG G NH1   1 
ATOM 4247  N NH2   . ARG G 3 18  ? 61.738  102.702 60.202  1.00 66.50  ?  17  ARG G NH2   1 
ATOM 4248  N N     . SER G 3 19  ? 55.635  102.540 64.779  1.00 65.30  ?  18  SER G N     1 
ATOM 4249  C CA    . SER G 3 19  ? 55.239  101.887 66.017  1.00 65.30  ?  18  SER G CA    1 
ATOM 4250  C C     . SER G 3 19  ? 53.722  101.867 66.149  1.00 65.30  ?  18  SER G C     1 
ATOM 4251  O O     . SER G 3 19  ? 53.125  100.820 66.425  1.00 65.30  ?  18  SER G O     1 
ATOM 4252  C CB    . SER G 3 19  ? 55.881  102.593 67.207  1.00 65.30  ?  18  SER G CB    1 
ATOM 4253  O OG    . SER G 3 19  ? 57.290  102.479 67.160  1.00 65.30  ?  18  SER G OG    1 
ATOM 4254  N N     . SER G 3 20  ? 53.081  103.016 65.935  1.00 67.25  ?  19  SER G N     1 
ATOM 4255  C CA    . SER G 3 20  ? 51.635  103.120 66.071  1.00 67.25  ?  19  SER G CA    1 
ATOM 4256  C C     . SER G 3 20  ? 50.887  102.551 64.879  1.00 67.25  ?  19  SER G C     1 
ATOM 4257  O O     . SER G 3 20  ? 49.696  102.252 65.000  1.00 67.25  ?  19  SER G O     1 
ATOM 4258  C CB    . SER G 3 20  ? 51.227  104.580 66.256  1.00 67.25  ?  19  SER G CB    1 
ATOM 4259  O OG    . SER G 3 20  ? 51.483  105.318 65.075  1.00 67.25  ?  19  SER G OG    1 
ATOM 4260  N N     . ARG G 3 21  ? 51.550  102.418 63.730  1.00 69.58  ?  20  ARG G N     1 
ATOM 4261  C CA    . ARG G 3 21  ? 50.882  101.889 62.548  1.00 69.58  ?  20  ARG G CA    1 
ATOM 4262  C C     . ARG G 3 21  ? 50.599  100.401 62.699  1.00 69.58  ?  20  ARG G C     1 
ATOM 4263  O O     . ARG G 3 21  ? 49.548  99.916  62.267  1.00 69.58  ?  20  ARG G O     1 
ATOM 4264  C CB    . ARG G 3 21  ? 51.738  102.153 61.315  1.00 69.58  ?  20  ARG G CB    1 
ATOM 4265  C CG    . ARG G 3 21  ? 51.106  101.786 60.003  1.00 69.58  ?  20  ARG G CG    1 
ATOM 4266  C CD    . ARG G 3 21  ? 52.050  102.167 58.894  1.00 69.58  ?  20  ARG G CD    1 
ATOM 4267  N NE    . ARG G 3 21  ? 52.248  103.610 58.852  1.00 69.58  ?  20  ARG G NE    1 
ATOM 4268  C CZ    . ARG G 3 21  ? 53.188  104.213 58.134  1.00 69.58  ?  20  ARG G CZ    1 
ATOM 4269  N NH1   . ARG G 3 21  ? 54.022  103.496 57.396  1.00 69.58  1  20  ARG G NH1   1 
ATOM 4270  N NH2   . ARG G 3 21  ? 53.296  105.534 58.157  1.00 69.58  ?  20  ARG G NH2   1 
ATOM 4271  N N     . ALA G 3 22  ? 51.515  99.667  63.320  1.00 64.72  ?  21  ALA G N     1 
ATOM 4272  C CA    . ALA G 3 22  ? 51.324  98.250  63.578  1.00 64.72  ?  21  ALA G CA    1 
ATOM 4273  C C     . ALA G 3 22  ? 50.662  97.979  64.918  1.00 64.72  ?  21  ALA G C     1 
ATOM 4274  O O     . ALA G 3 22  ? 50.362  96.821  65.222  1.00 64.72  ?  21  ALA G O     1 
ATOM 4275  C CB    . ALA G 3 22  ? 52.664  97.519  63.515  1.00 64.72  ?  21  ALA G CB    1 
ATOM 4276  N N     . GLY G 3 23  ? 50.429  99.009  65.721  1.00 65.05  ?  22  GLY G N     1 
ATOM 4277  C CA    . GLY G 3 23  ? 49.821  98.812  67.023  1.00 65.05  ?  22  GLY G CA    1 
ATOM 4278  C C     . GLY G 3 23  ? 50.747  98.189  68.043  1.00 65.05  ?  22  GLY G C     1 
ATOM 4279  O O     . GLY G 3 23  ? 50.331  97.291  68.785  1.00 65.05  ?  22  GLY G O     1 
ATOM 4280  N N     . LEU G 3 24  ? 51.995  98.639  68.097  1.00 55.86  ?  23  LEU G N     1 
ATOM 4281  C CA    . LEU G 3 24  ? 52.983  98.126  69.030  1.00 55.86  ?  23  LEU G CA    1 
ATOM 4282  C C     . LEU G 3 24  ? 53.309  99.176  70.080  1.00 55.86  ?  23  LEU G C     1 
ATOM 4283  O O     . LEU G 3 24  ? 52.702  100.248 70.142  1.00 55.86  ?  23  LEU G O     1 
ATOM 4284  C CB    . LEU G 3 24  ? 54.247  97.694  68.294  1.00 55.86  ?  23  LEU G CB    1 
ATOM 4285  C CG    . LEU G 3 24  ? 54.104  96.472  67.396  1.00 55.86  ?  23  LEU G CG    1 
ATOM 4286  C CD1   . LEU G 3 24  ? 55.370  96.283  66.601  1.00 55.86  ?  23  LEU G CD1   1 
ATOM 4287  C CD2   . LEU G 3 24  ? 53.809  95.235  68.221  1.00 55.86  ?  23  LEU G CD2   1 
ATOM 4288  N N     . GLN G 3 25  ? 54.267  98.845  70.919  1.00 55.33  ?  24  GLN G N     1 
ATOM 4289  C CA    . GLN G 3 25  ? 54.794  99.754  71.927  1.00 55.33  ?  24  GLN G CA    1 
ATOM 4290  C C     . GLN G 3 25  ? 56.305  99.874  71.869  1.00 55.33  ?  24  GLN G C     1 
ATOM 4291  O O     . GLN G 3 25  ? 56.835  100.959 72.110  1.00 55.33  ?  24  GLN G O     1 
ATOM 4292  C CB    . GLN G 3 25  ? 54.366  99.305  73.325  1.00 55.33  ?  24  GLN G CB    1 
ATOM 4293  C CG    . GLN G 3 25  ? 52.874  99.378  73.565  1.00 55.33  ?  24  GLN G CG    1 
ATOM 4294  C CD    . GLN G 3 25  ? 52.352  100.796 73.489  1.00 55.33  ?  24  GLN G CD    1 
ATOM 4295  O OE1   . GLN G 3 25  ? 53.021  101.737 73.912  1.00 55.33  ?  24  GLN G OE1   1 
ATOM 4296  N NE2   . GLN G 3 25  ? 51.146  100.956 72.959  1.00 55.33  ?  24  GLN G NE2   1 
ATOM 4297  N N     . PHE G 3 26  ? 57.009  98.786  71.570  1.00 52.51  ?  25  PHE G N     1 
ATOM 4298  C CA    . PHE G 3 26  ? 58.434  98.872  71.311  1.00 52.51  ?  25  PHE G CA    1 
ATOM 4299  C C     . PHE G 3 26  ? 58.690  99.604  69.995  1.00 52.51  ?  25  PHE G C     1 
ATOM 4300  O O     . PHE G 3 26  ? 57.862  99.553  69.083  1.00 52.51  ?  25  PHE G O     1 
ATOM 4301  C CB    . PHE G 3 26  ? 59.056  97.478  71.286  1.00 52.51  ?  25  PHE G CB    1 
ATOM 4302  C CG    . PHE G 3 26  ? 59.372  96.946  72.646  1.00 52.51  ?  25  PHE G CG    1 
ATOM 4303  C CD1   . PHE G 3 26  ? 59.359  97.787  73.739  1.00 52.51  ?  25  PHE G CD1   1 
ATOM 4304  C CD2   . PHE G 3 26  ? 59.716  95.624  72.832  1.00 52.51  ?  25  PHE G CD2   1 
ATOM 4305  C CE1   . PHE G 3 26  ? 59.660  97.326  74.997  1.00 52.51  ?  25  PHE G CE1   1 
ATOM 4306  C CE2   . PHE G 3 26  ? 60.025  95.152  74.090  1.00 52.51  ?  25  PHE G CE2   1 
ATOM 4307  C CZ    . PHE G 3 26  ? 59.989  96.007  75.174  1.00 52.51  ?  25  PHE G CZ    1 
ATOM 4308  N N     . PRO G 3 27  ? 59.807  100.325 69.884  1.00 52.12  ?  26  PRO G N     1 
ATOM 4309  C CA    . PRO G 3 27  ? 60.072  101.075 68.655  1.00 52.12  ?  26  PRO G CA    1 
ATOM 4310  C C     . PRO G 3 27  ? 60.419  100.145 67.511  1.00 52.12  ?  26  PRO G C     1 
ATOM 4311  O O     . PRO G 3 27  ? 60.844  99.005  67.704  1.00 52.12  ?  26  PRO G O     1 
ATOM 4312  C CB    . PRO G 3 27  ? 61.265  101.954 69.028  1.00 52.12  ?  26  PRO G CB    1 
ATOM 4313  C CG    . PRO G 3 27  ? 61.964  101.179 70.074  1.00 52.12  ?  26  PRO G CG    1 
ATOM 4314  C CD    . PRO G 3 27  ? 60.891  100.507 70.866  1.00 52.12  ?  26  PRO G CD    1 
ATOM 4315  N N     . VAL G 3 28  ? 60.214  100.645 66.301  1.00 51.29  ?  27  VAL G N     1 
ATOM 4316  C CA    . VAL G 3 28  ? 60.502  99.897  65.094  1.00 51.29  ?  27  VAL G CA    1 
ATOM 4317  C C     . VAL G 3 28  ? 61.675  100.500 64.336  1.00 51.29  ?  27  VAL G C     1 
ATOM 4318  O O     . VAL G 3 28  ? 62.504  99.772  63.787  1.00 51.29  ?  27  VAL G O     1 
ATOM 4319  C CB    . VAL G 3 28  ? 59.242  99.813  64.208  1.00 51.29  ?  27  VAL G CB    1 
ATOM 4320  C CG1   . VAL G 3 28  ? 59.496  99.013  62.950  1.00 51.29  ?  27  VAL G CG1   1 
ATOM 4321  C CG2   . VAL G 3 28  ? 58.101  99.200  64.990  1.00 51.29  ?  27  VAL G CG2   1 
ATOM 4322  N N     . GLY G 3 29  ? 61.786  101.828 64.338  1.00 55.30  ?  28  GLY G N     1 
ATOM 4323  C CA    . GLY G 3 29  ? 62.906  102.472 63.680  1.00 55.30  ?  28  GLY G CA    1 
ATOM 4324  C C     . GLY G 3 29  ? 64.234  102.198 64.351  1.00 55.30  ?  28  GLY G C     1 
ATOM 4325  O O     . GLY G 3 29  ? 65.260  102.080 63.675  1.00 55.30  ?  28  GLY G O     1 
ATOM 4326  N N     . ARG G 3 30  ? 64.236  102.063 65.675  1.00 53.25  ?  29  ARG G N     1 
ATOM 4327  C CA    . ARG G 3 30  ? 65.486  101.792 66.372  1.00 53.25  ?  29  ARG G CA    1 
ATOM 4328  C C     . ARG G 3 30  ? 65.943  100.357 66.142  1.00 53.25  ?  29  ARG G C     1 
ATOM 4329  O O     . ARG G 3 30  ? 67.143  100.096 65.991  1.00 53.25  ?  29  ARG G O     1 
ATOM 4330  C CB    . ARG G 3 30  ? 65.326  102.077 67.860  1.00 53.25  ?  29  ARG G CB    1 
ATOM 4331  C CG    . ARG G 3 30  ? 66.619  101.997 68.621  1.00 53.25  ?  29  ARG G CG    1 
ATOM 4332  C CD    . ARG G 3 30  ? 66.413  102.370 70.055  1.00 53.25  ?  29  ARG G CD    1 
ATOM 4333  N NE    . ARG G 3 30  ? 66.041  103.765 70.211  1.00 53.25  ?  29  ARG G NE    1 
ATOM 4334  C CZ    . ARG G 3 30  ? 65.635  104.291 71.357  1.00 53.25  ?  29  ARG G CZ    1 
ATOM 4335  N NH1   . ARG G 3 30  ? 65.552  103.534 72.440  1.00 53.25  1  29  ARG G NH1   1 
ATOM 4336  N NH2   . ARG G 3 30  ? 65.312  105.571 71.421  1.00 53.25  ?  29  ARG G NH2   1 
ATOM 4337  N N     . VAL G 3 31  ? 64.997  99.421  66.080  1.00 44.83  ?  30  VAL G N     1 
ATOM 4338  C CA    . VAL G 3 31  ? 65.328  98.029  65.801  1.00 44.83  ?  30  VAL G CA    1 
ATOM 4339  C C     . VAL G 3 31  ? 65.842  97.876  64.374  1.00 44.83  ?  30  VAL G C     1 
ATOM 4340  O O     . VAL G 3 31  ? 66.801  97.138  64.118  1.00 44.83  ?  30  VAL G O     1 
ATOM 4341  C CB    . VAL G 3 31  ? 64.098  97.151  66.075  1.00 44.83  ?  30  VAL G CB    1 
ATOM 4342  C CG1   . VAL G 3 31  ? 64.359  95.727  65.706  1.00 44.83  ?  30  VAL G CG1   1 
ATOM 4343  C CG2   . VAL G 3 31  ? 63.729  97.242  67.528  1.00 44.83  ?  30  VAL G CG2   1 
ATOM 4344  N N     . HIS G 3 32  ? 65.246  98.606  63.433  1.00 46.01  ?  31  HIS G N     1 
ATOM 4345  C CA    . HIS G 3 32  ? 65.731  98.594  62.058  1.00 46.01  ?  31  HIS G CA    1 
ATOM 4346  C C     . HIS G 3 32  ? 67.098  99.252  61.938  1.00 46.01  ?  31  HIS G C     1 
ATOM 4347  O O     . HIS G 3 32  ? 67.922  98.824  61.119  1.00 46.01  ?  31  HIS G O     1 
ATOM 4348  C CB    . HIS G 3 32  ? 64.723  99.297  61.157  1.00 46.01  ?  31  HIS G CB    1 
ATOM 4349  C CG    . HIS G 3 32  ? 65.018  99.168  59.701  1.00 46.01  ?  31  HIS G CG    1 
ATOM 4350  N ND1   . HIS G 3 32  ? 65.881  100.013 59.040  1.00 46.01  ?  31  HIS G ND1   1 
ATOM 4351  C CD2   . HIS G 3 32  ? 64.548  98.306  58.771  1.00 46.01  ?  31  HIS G CD2   1 
ATOM 4352  C CE1   . HIS G 3 32  ? 65.939  99.670  57.766  1.00 46.01  ?  31  HIS G CE1   1 
ATOM 4353  N NE2   . HIS G 3 32  ? 65.139  98.637  57.577  1.00 46.01  ?  31  HIS G NE2   1 
ATOM 4354  N N     . ARG G 3 33  ? 67.363  100.275 62.754  1.00 47.26  ?  32  ARG G N     1 
ATOM 4355  C CA    . ARG G 3 33  ? 68.688  100.881 62.769  1.00 47.26  ?  32  ARG G CA    1 
ATOM 4356  C C     . ARG G 3 33  ? 69.722  99.919  63.333  1.00 47.26  ?  32  ARG G C     1 
ATOM 4357  O O     . ARG G 3 33  ? 70.853  99.859  62.842  1.00 47.26  ?  32  ARG G O     1 
ATOM 4358  C CB    . ARG G 3 33  ? 68.670  102.175 63.578  1.00 47.26  ?  32  ARG G CB    1 
ATOM 4359  C CG    . ARG G 3 33  ? 69.988  102.935 63.560  1.00 47.26  ?  32  ARG G CG    1 
ATOM 4360  C CD    . ARG G 3 33  ? 69.900  104.235 64.338  1.00 47.26  ?  32  ARG G CD    1 
ATOM 4361  N NE    . ARG G 3 33  ? 69.702  104.021 65.765  1.00 47.26  ?  32  ARG G NE    1 
ATOM 4362  C CZ    . ARG G 3 33  ? 70.692  103.828 66.628  1.00 47.26  ?  32  ARG G CZ    1 
ATOM 4363  N NH1   . ARG G 3 33  ? 71.947  103.834 66.207  1.00 47.26  1  32  ARG G NH1   1 
ATOM 4364  N NH2   . ARG G 3 33  ? 70.431  103.638 67.912  1.00 47.26  ?  32  ARG G NH2   1 
ATOM 4365  N N     . LEU G 3 34  ? 69.349  99.142  64.344  1.00 38.49  ?  33  LEU G N     1 
ATOM 4366  C CA    . LEU G 3 34  ? 70.292  98.178  64.892  1.00 38.49  ?  33  LEU G CA    1 
ATOM 4367  C C     . LEU G 3 34  ? 70.431  96.929  64.034  1.00 38.49  ?  33  LEU G C     1 
ATOM 4368  O O     . LEU G 3 34  ? 71.407  96.193  64.195  1.00 38.49  ?  33  LEU G O     1 
ATOM 4369  C CB    . LEU G 3 34  ? 69.892  97.792  66.311  1.00 38.49  ?  33  LEU G CB    1 
ATOM 4370  C CG    . LEU G 3 34  ? 70.056  98.937  67.304  1.00 38.49  ?  33  LEU G CG    1 
ATOM 4371  C CD1   . LEU G 3 34  ? 69.572  98.529  68.677  1.00 38.49  ?  33  LEU G CD1   1 
ATOM 4372  C CD2   . LEU G 3 34  ? 71.502  99.382  67.354  1.00 38.49  ?  33  LEU G CD2   1 
ATOM 4373  N N     . LEU G 3 35  ? 69.487  96.665  63.136  1.00 39.25  ?  34  LEU G N     1 
ATOM 4374  C CA    . LEU G 3 35  ? 69.681  95.584  62.177  1.00 39.25  ?  34  LEU G CA    1 
ATOM 4375  C C     . LEU G 3 35  ? 70.437  96.022  60.933  1.00 39.25  ?  34  LEU G C     1 
ATOM 4376  O O     . LEU G 3 35  ? 71.016  95.170  60.254  1.00 39.25  ?  34  LEU G O     1 
ATOM 4377  C CB    . LEU G 3 35  ? 68.345  94.977  61.764  1.00 39.25  ?  34  LEU G CB    1 
ATOM 4378  C CG    . LEU G 3 35  ? 67.703  94.054  62.784  1.00 39.25  ?  34  LEU G CG    1 
ATOM 4379  C CD1   . LEU G 3 35  ? 66.309  93.689  62.354  1.00 39.25  ?  34  LEU G CD1   1 
ATOM 4380  C CD2   . LEU G 3 35  ? 68.542  92.827  62.855  1.00 39.25  ?  34  LEU G CD2   1 
ATOM 4381  N N     . ARG G 3 36  ? 70.435  97.313  60.598  1.00 45.91  ?  35  ARG G N     1 
ATOM 4382  C CA    . ARG G 3 36  ? 71.320  97.769  59.531  1.00 45.91  ?  35  ARG G CA    1 
ATOM 4383  C C     . ARG G 3 36  ? 72.769  97.786  59.995  1.00 45.91  ?  35  ARG G C     1 
ATOM 4384  O O     . ARG G 3 36  ? 73.645  97.202  59.351  1.00 45.91  ?  35  ARG G O     1 
ATOM 4385  C CB    . ARG G 3 36  ? 70.914  99.155  59.035  1.00 45.91  ?  35  ARG G CB    1 
ATOM 4386  C CG    . ARG G 3 36  ? 69.622  99.212  58.249  1.00 45.91  ?  35  ARG G CG    1 
ATOM 4387  C CD    . ARG G 3 36  ? 69.378  100.632 57.769  1.00 45.91  ?  35  ARG G CD    1 
ATOM 4388  N NE    . ARG G 3 36  ? 69.132  101.553 58.877  1.00 45.91  ?  35  ARG G NE    1 
ATOM 4389  C CZ    . ARG G 3 36  ? 69.095  102.876 58.756  1.00 45.91  ?  35  ARG G CZ    1 
ATOM 4390  N NH1   . ARG G 3 36  ? 69.300  103.439 57.575  1.00 45.91  1  35  ARG G NH1   1 
ATOM 4391  N NH2   . ARG G 3 36  ? 68.862  103.640 59.815  1.00 45.91  ?  35  ARG G NH2   1 
ATOM 4392  N N     . LYS G 3 37  ? 73.040  98.442  61.119  1.00 46.39  ?  36  LYS G N     1 
ATOM 4393  C CA    . LYS G 3 37  ? 74.398  98.631  61.606  1.00 46.39  ?  36  LYS G CA    1 
ATOM 4394  C C     . LYS G 3 37  ? 74.857  97.517  62.536  1.00 46.39  ?  36  LYS G C     1 
ATOM 4395  O O     . LYS G 3 37  ? 75.736  97.744  63.373  1.00 46.39  ?  36  LYS G O     1 
ATOM 4396  C CB    . LYS G 3 37  ? 74.515  99.978  62.321  1.00 46.39  ?  36  LYS G CB    1 
ATOM 4397  C CG    . LYS G 3 37  ? 74.171  101.216 61.488  1.00 46.39  ?  36  LYS G CG    1 
ATOM 4398  C CD    . LYS G 3 37  ? 75.276  101.624 60.507  1.00 46.39  ?  36  LYS G CD    1 
ATOM 4399  C CE    . LYS G 3 37  ? 74.987  101.208 59.067  1.00 46.39  ?  36  LYS G CE    1 
ATOM 4400  N NZ    . LYS G 3 37  ? 76.021  101.719 58.123  1.00 46.39  1  36  LYS G NZ    1 
ATOM 4401  N N     . GLY G 3 38  ? 74.286  96.326  62.418  1.00 45.13  ?  37  GLY G N     1 
ATOM 4402  C CA    . GLY G 3 38  ? 74.658  95.249  63.310  1.00 45.13  ?  37  GLY G CA    1 
ATOM 4403  C C     . GLY G 3 38  ? 75.502  94.179  62.653  1.00 45.13  ?  37  GLY G C     1 
ATOM 4404  O O     . GLY G 3 38  ? 75.945  93.249  63.333  1.00 45.13  ?  37  GLY G O     1 
ATOM 4405  N N     . ASN G 3 39  ? 75.728  94.320  61.344  1.00 50.04  ?  38  ASN G N     1 
ATOM 4406  C CA    . ASN G 3 39  ? 76.467  93.368  60.510  1.00 50.04  ?  38  ASN G CA    1 
ATOM 4407  C C     . ASN G 3 39  ? 75.877  91.964  60.615  1.00 50.04  ?  38  ASN G C     1 
ATOM 4408  O O     . ASN G 3 39  ? 76.504  91.029  61.109  1.00 50.04  ?  38  ASN G O     1 
ATOM 4409  C CB    . ASN G 3 39  ? 77.958  93.363  60.850  1.00 50.04  ?  38  ASN G CB    1 
ATOM 4410  C CG    . ASN G 3 39  ? 78.641  94.646  60.458  1.00 50.04  ?  38  ASN G CG    1 
ATOM 4411  O OD1   . ASN G 3 39  ? 78.352  95.218  59.410  1.00 50.04  ?  38  ASN G OD1   1 
ATOM 4412  N ND2   . ASN G 3 39  ? 79.560  95.107  61.296  1.00 50.04  ?  38  ASN G ND2   1 
ATOM 4413  N N     . TYR G 3 40  ? 74.636  91.842  60.159  1.00 42.91  ?  39  TYR G N     1 
ATOM 4414  C CA    . TYR G 3 40  ? 73.887  90.595  60.228  1.00 42.91  ?  39  TYR G CA    1 
ATOM 4415  C C     . TYR G 3 40  ? 73.537  90.035  58.863  1.00 42.91  ?  39  TYR G C     1 
ATOM 4416  O O     . TYR G 3 40  ? 73.617  88.825  58.658  1.00 42.91  ?  39  TYR G O     1 
ATOM 4417  C CB    . TYR G 3 40  ? 72.608  90.810  61.032  1.00 42.91  ?  39  TYR G CB    1 
ATOM 4418  C CG    . TYR G 3 40  ? 72.857  91.044  62.498  1.00 42.91  ?  39  TYR G CG    1 
ATOM 4419  C CD1   . TYR G 3 40  ? 74.003  90.566  63.116  1.00 42.91  ?  39  TYR G CD1   1 
ATOM 4420  C CD2   . TYR G 3 40  ? 71.972  91.789  63.253  1.00 42.91  ?  39  TYR G CD2   1 
ATOM 4421  C CE1   . TYR G 3 40  ? 74.233  90.790  64.453  1.00 42.91  ?  39  TYR G CE1   1 
ATOM 4422  C CE2   . TYR G 3 40  ? 72.195  92.020  64.586  1.00 42.91  ?  39  TYR G CE2   1 
ATOM 4423  C CZ    . TYR G 3 40  ? 73.327  91.524  65.179  1.00 42.91  ?  39  TYR G CZ    1 
ATOM 4424  O OH    . TYR G 3 40  ? 73.547  91.761  66.512  1.00 42.91  ?  39  TYR G OH    1 
ATOM 4425  N N     . ALA G 3 41  ? 73.137  90.888  57.930  1.00 52.10  ?  40  ALA G N     1 
ATOM 4426  C CA    . ALA G 3 41  ? 73.028  90.513  56.532  1.00 52.10  ?  40  ALA G CA    1 
ATOM 4427  C C     . ALA G 3 41  ? 73.214  91.775  55.714  1.00 52.10  ?  40  ALA G C     1 
ATOM 4428  O O     . ALA G 3 41  ? 73.219  92.887  56.245  1.00 52.10  ?  40  ALA G O     1 
ATOM 4429  C CB    . ALA G 3 41  ? 71.692  89.840  56.213  1.00 52.10  ?  40  ALA G CB    1 
ATOM 4430  N N     . GLU G 3 42  ? 73.374  91.598  54.408  1.00 59.05  ?  41  GLU G N     1 
ATOM 4431  C CA    . GLU G 3 42  ? 73.649  92.753  53.569  1.00 59.05  ?  41  GLU G CA    1 
ATOM 4432  C C     . GLU G 3 42  ? 72.390  93.566  53.310  1.00 59.05  ?  41  GLU G C     1 
ATOM 4433  O O     . GLU G 3 42  ? 72.473  94.782  53.124  1.00 59.05  ?  41  GLU G O     1 
ATOM 4434  C CB    . GLU G 3 42  ? 74.309  92.291  52.267  1.00 59.05  ?  41  GLU G CB    1 
ATOM 4435  C CG    . GLU G 3 42  ? 74.995  93.389  51.459  1.00 59.05  ?  41  GLU G CG    1 
ATOM 4436  C CD    . GLU G 3 42  ? 74.135  93.946  50.347  1.00 59.05  ?  41  GLU G CD    1 
ATOM 4437  O OE1   . GLU G 3 42  ? 73.349  93.175  49.761  1.00 59.05  ?  41  GLU G OE1   1 
ATOM 4438  O OE2   . GLU G 3 42  ? 74.246  95.157  50.046  1.00 59.05  -1 41  GLU G OE2   1 
ATOM 4439  N N     . ARG G 3 43  ? 71.223  92.927  53.328  1.00 65.34  ?  42  ARG G N     1 
ATOM 4440  C CA    . ARG G 3 43  ? 69.947  93.589  53.096  1.00 65.34  ?  42  ARG G CA    1 
ATOM 4441  C C     . ARG G 3 43  ? 68.968  93.170  54.181  1.00 65.34  ?  42  ARG G C     1 
ATOM 4442  O O     . ARG G 3 43  ? 68.960  92.014  54.605  1.00 65.34  ?  42  ARG G O     1 
ATOM 4443  C CB    . ARG G 3 43  ? 69.397  93.244  51.697  1.00 65.34  ?  42  ARG G CB    1 
ATOM 4444  C CG    . ARG G 3 43  ? 70.259  93.806  50.569  1.00 65.34  ?  42  ARG G CG    1 
ATOM 4445  C CD    . ARG G 3 43  ? 69.906  93.302  49.186  1.00 65.34  ?  42  ARG G CD    1 
ATOM 4446  N NE    . ARG G 3 43  ? 68.664  93.846  48.663  1.00 65.34  ?  42  ARG G NE    1 
ATOM 4447  C CZ    . ARG G 3 43  ? 67.576  93.123  48.437  1.00 65.34  ?  42  ARG G CZ    1 
ATOM 4448  N NH1   . ARG G 3 43  ? 67.583  91.825  48.693  1.00 65.34  1  42  ARG G NH1   1 
ATOM 4449  N NH2   . ARG G 3 43  ? 66.483  93.691  47.951  1.00 65.34  ?  42  ARG G NH2   1 
ATOM 4450  N N     . VAL G 3 44  ? 68.157  94.115  54.643  1.00 56.98  ?  43  VAL G N     1 
ATOM 4451  C CA    . VAL G 3 44  ? 67.185  93.872  55.702  1.00 56.98  ?  43  VAL G CA    1 
ATOM 4452  C C     . VAL G 3 44  ? 65.805  94.191  55.158  1.00 56.98  ?  43  VAL G C     1 
ATOM 4453  O O     . VAL G 3 44  ? 65.565  95.307  54.686  1.00 56.98  ?  43  VAL G O     1 
ATOM 4454  C CB    . VAL G 3 44  ? 67.475  94.716  56.948  1.00 56.98  ?  43  VAL G CB    1 
ATOM 4455  C CG1   . VAL G 3 44  ? 66.375  94.530  57.966  1.00 56.98  ?  43  VAL G CG1   1 
ATOM 4456  C CG2   . VAL G 3 44  ? 68.812  94.341  57.534  1.00 56.98  ?  43  VAL G CG2   1 
ATOM 4457  N N     . GLY G 3 45  ? 64.898  93.224  55.239  1.00 52.32  ?  44  GLY G N     1 
ATOM 4458  C CA    . GLY G 3 45  ? 63.546  93.414  54.765  1.00 52.32  ?  44  GLY G CA    1 
ATOM 4459  C C     . GLY G 3 45  ? 62.745  94.349  55.652  1.00 52.32  ?  44  GLY G C     1 
ATOM 4460  O O     . GLY G 3 45  ? 63.195  94.829  56.693  1.00 52.32  ?  44  GLY G O     1 
ATOM 4461  N N     . ALA G 3 46  ? 61.517  94.617  55.217  1.00 53.87  ?  45  ALA G N     1 
ATOM 4462  C CA    . ALA G 3 46  ? 60.627  95.482  55.974  1.00 53.87  ?  45  ALA G CA    1 
ATOM 4463  C C     . ALA G 3 46  ? 59.672  94.718  56.874  1.00 53.87  ?  45  ALA G C     1 
ATOM 4464  O O     . ALA G 3 46  ? 59.185  95.287  57.855  1.00 53.87  ?  45  ALA G O     1 
ATOM 4465  C CB    . ALA G 3 46  ? 59.819  96.375  55.028  1.00 53.87  ?  45  ALA G CB    1 
ATOM 4466  N N     . GLY G 3 47  ? 59.391  93.455  56.569  1.00 47.73  ?  46  GLY G N     1 
ATOM 4467  C CA    . GLY G 3 47  ? 58.485  92.680  57.391  1.00 47.73  ?  46  GLY G CA    1 
ATOM 4468  C C     . GLY G 3 47  ? 59.113  92.028  58.598  1.00 47.73  ?  46  GLY G C     1 
ATOM 4469  O O     . GLY G 3 47  ? 58.390  91.503  59.448  1.00 47.73  ?  46  GLY G O     1 
ATOM 4470  N N     . ALA G 3 48  ? 60.433  92.041  58.694  1.00 46.07  ?  47  ALA G N     1 
ATOM 4471  C CA    . ALA G 3 48  ? 61.130  91.443  59.827  1.00 46.07  ?  47  ALA G CA    1 
ATOM 4472  C C     . ALA G 3 48  ? 61.116  92.263  61.124  1.00 46.07  ?  47  ALA G C     1 
ATOM 4473  O O     . ALA G 3 48  ? 60.748  91.689  62.161  1.00 46.07  ?  47  ALA G O     1 
ATOM 4474  C CB    . ALA G 3 48  ? 62.572  91.101  59.436  1.00 46.07  ?  47  ALA G CB    1 
ATOM 4475  N N     . PRO G 3 49  ? 61.509  93.553  61.167  1.00 41.66  ?  48  PRO G N     1 
ATOM 4476  C CA    . PRO G 3 49  ? 61.676  94.186  62.483  1.00 41.66  ?  48  PRO G CA    1 
ATOM 4477  C C     . PRO G 3 49  ? 60.375  94.458  63.217  1.00 41.66  ?  48  PRO G C     1 
ATOM 4478  O O     . PRO G 3 49  ? 60.400  94.534  64.450  1.00 41.66  ?  48  PRO G O     1 
ATOM 4479  C CB    . PRO G 3 49  ? 62.410  95.487  62.159  1.00 41.66  ?  48  PRO G CB    1 
ATOM 4480  C CG    . PRO G 3 49  ? 61.970  95.817  60.842  1.00 41.66  ?  48  PRO G CG    1 
ATOM 4481  C CD    . PRO G 3 49  ? 61.819  94.538  60.109  1.00 41.66  ?  48  PRO G CD    1 
ATOM 4482  N N     . VAL G 3 50  ? 59.244  94.566  62.518  1.00 44.92  ?  49  VAL G N     1 
ATOM 4483  C CA    . VAL G 3 50  ? 57.960  94.661  63.208  1.00 44.92  ?  49  VAL G CA    1 
ATOM 4484  C C     . VAL G 3 50  ? 57.639  93.352  63.930  1.00 44.92  ?  49  VAL G C     1 
ATOM 4485  O O     . VAL G 3 50  ? 57.187  93.358  65.085  1.00 44.92  ?  49  VAL G O     1 
ATOM 4486  C CB    . VAL G 3 50  ? 56.858  95.092  62.216  1.00 44.92  ?  49  VAL G CB    1 
ATOM 4487  C CG1   . VAL G 3 50  ? 56.836  94.226  60.965  1.00 44.92  ?  49  VAL G CG1   1 
ATOM 4488  C CG2   . VAL G 3 50  ? 55.502  95.056  62.875  1.00 44.92  ?  49  VAL G CG2   1 
ATOM 4489  N N     . TYR G 3 51  ? 57.949  92.220  63.293  1.00 40.05  ?  50  TYR G N     1 
ATOM 4490  C CA    . TYR G 3 51  ? 57.803  90.914  63.917  1.00 40.05  ?  50  TYR G CA    1 
ATOM 4491  C C     . TYR G 3 51  ? 58.725  90.787  65.119  1.00 40.05  ?  50  TYR G C     1 
ATOM 4492  O O     . TYR G 3 51  ? 58.329  90.267  66.173  1.00 40.05  ?  50  TYR G O     1 
ATOM 4493  C CB    . TYR G 3 51  ? 58.122  89.844  62.879  1.00 40.05  ?  50  TYR G CB    1 
ATOM 4494  C CG    . TYR G 3 51  ? 57.818  88.442  63.291  1.00 40.05  ?  50  TYR G CG    1 
ATOM 4495  C CD1   . TYR G 3 51  ? 56.557  87.910  63.105  1.00 40.05  ?  50  TYR G CD1   1 
ATOM 4496  C CD2   . TYR G 3 51  ? 58.785  87.652  63.874  1.00 40.05  ?  50  TYR G CD2   1 
ATOM 4497  C CE1   . TYR G 3 51  ? 56.278  86.620  63.474  1.00 40.05  ?  50  TYR G CE1   1 
ATOM 4498  C CE2   . TYR G 3 51  ? 58.516  86.371  64.253  1.00 40.05  ?  50  TYR G CE2   1 
ATOM 4499  C CZ    . TYR G 3 51  ? 57.261  85.858  64.051  1.00 40.05  ?  50  TYR G CZ    1 
ATOM 4500  O OH    . TYR G 3 51  ? 56.988  84.572  64.432  1.00 40.05  ?  50  TYR G OH    1 
ATOM 4501  N N     . LEU G 3 52  ? 59.945  91.309  64.987  1.00 38.36  ?  51  LEU G N     1 
ATOM 4502  C CA    . LEU G 3 52  ? 60.921  91.229  66.066  1.00 38.36  ?  51  LEU G CA    1 
ATOM 4503  C C     . LEU G 3 52  ? 60.496  92.058  67.273  1.00 38.36  ?  51  LEU G C     1 
ATOM 4504  O O     . LEU G 3 52  ? 60.579  91.588  68.417  1.00 38.36  ?  51  LEU G O     1 
ATOM 4505  C CB    . LEU G 3 52  ? 62.278  91.684  65.551  1.00 38.36  ?  51  LEU G CB    1 
ATOM 4506  C CG    . LEU G 3 52  ? 63.437  91.597  66.523  1.00 38.36  ?  51  LEU G CG    1 
ATOM 4507  C CD1   . LEU G 3 52  ? 63.599  90.172  66.983  1.00 38.36  ?  51  LEU G CD1   1 
ATOM 4508  C CD2   . LEU G 3 52  ? 64.662  92.034  65.793  1.00 38.36  ?  51  LEU G CD2   1 
ATOM 4509  N N     . ALA G 3 53  ? 60.019  93.281  67.034  1.00 43.36  ?  52  ALA G N     1 
ATOM 4510  C CA    . ALA G 3 53  ? 59.561  94.129  68.126  1.00 43.36  ?  52  ALA G CA    1 
ATOM 4511  C C     . ALA G 3 53  ? 58.320  93.561  68.794  1.00 43.36  ?  52  ALA G C     1 
ATOM 4512  O O     . ALA G 3 53  ? 58.165  93.696  70.013  1.00 43.36  ?  52  ALA G O     1 
ATOM 4513  C CB    . ALA G 3 53  ? 59.292  95.542  67.619  1.00 43.36  ?  52  ALA G CB    1 
ATOM 4514  N N     . ALA G 3 54  ? 57.453  92.889  68.030  1.00 45.82  ?  53  ALA G N     1 
ATOM 4515  C CA    . ALA G 3 54  ? 56.290  92.248  68.635  1.00 45.82  ?  53  ALA G CA    1 
ATOM 4516  C C     . ALA G 3 54  ? 56.696  91.097  69.551  1.00 45.82  ?  53  ALA G C     1 
ATOM 4517  O O     . ALA G 3 54  ? 56.137  90.944  70.647  1.00 45.82  ?  53  ALA G O     1 
ATOM 4518  C CB    . ALA G 3 54  ? 55.343  91.758  67.546  1.00 45.82  ?  53  ALA G CB    1 
ATOM 4519  N N     . VAL G 3 55  ? 57.681  90.297  69.131  1.00 43.11  ?  54  VAL G N     1 
ATOM 4520  C CA    . VAL G 3 55  ? 58.141  89.193  69.973  1.00 43.11  ?  54  VAL G CA    1 
ATOM 4521  C C     . VAL G 3 55  ? 58.813  89.717  71.244  1.00 43.11  ?  54  VAL G C     1 
ATOM 4522  O O     . VAL G 3 55  ? 58.584  89.189  72.346  1.00 43.11  ?  54  VAL G O     1 
ATOM 4523  C CB    . VAL G 3 55  ? 59.065  88.268  69.163  1.00 43.11  ?  54  VAL G CB    1 
ATOM 4524  C CG1   . VAL G 3 55  ? 59.707  87.222  70.046  1.00 43.11  ?  54  VAL G CG1   1 
ATOM 4525  C CG2   . VAL G 3 55  ? 58.274  87.583  68.077  1.00 43.11  ?  54  VAL G CG2   1 
ATOM 4526  N N     . LEU G 3 56  ? 59.605  90.790  71.123  1.00 40.93  ?  55  LEU G N     1 
ATOM 4527  C CA    . LEU G 3 56  ? 60.241  91.378  72.304  1.00 40.93  ?  55  LEU G CA    1 
ATOM 4528  C C     . LEU G 3 56  ? 59.216  91.969  73.264  1.00 40.93  ?  55  LEU G C     1 
ATOM 4529  O O     . LEU G 3 56  ? 59.371  91.859  74.488  1.00 40.93  ?  55  LEU G O     1 
ATOM 4530  C CB    . LEU G 3 56  ? 61.242  92.453  71.900  1.00 40.93  ?  55  LEU G CB    1 
ATOM 4531  C CG    . LEU G 3 56  ? 62.485  91.997  71.155  1.00 40.93  ?  55  LEU G CG    1 
ATOM 4532  C CD1   . LEU G 3 56  ? 63.317  93.200  70.778  1.00 40.93  ?  55  LEU G CD1   1 
ATOM 4533  C CD2   . LEU G 3 56  ? 63.275  91.036  72.005  1.00 40.93  ?  55  LEU G CD2   1 
ATOM 4534  N N     . GLU G 3 57  ? 58.161  92.592  72.729  1.00 49.91  ?  56  GLU G N     1 
ATOM 4535  C CA    . GLU G 3 57  ? 57.107  93.131  73.582  1.00 49.91  ?  56  GLU G CA    1 
ATOM 4536  C C     . GLU G 3 57  ? 56.360  92.024  74.310  1.00 49.91  ?  56  GLU G C     1 
ATOM 4537  O O     . GLU G 3 57  ? 56.017  92.174  75.493  1.00 49.91  ?  56  GLU G O     1 
ATOM 4538  C CB    . GLU G 3 57  ? 56.142  93.976  72.754  1.00 49.91  ?  56  GLU G CB    1 
ATOM 4539  C CG    . GLU G 3 57  ? 55.065  94.661  73.576  1.00 49.91  ?  56  GLU G CG    1 
ATOM 4540  C CD    . GLU G 3 57  ? 54.135  95.514  72.742  1.00 49.91  ?  56  GLU G CD    1 
ATOM 4541  O OE1   . GLU G 3 57  ? 54.278  95.523  71.503  1.00 49.91  ?  56  GLU G OE1   1 
ATOM 4542  O OE2   . GLU G 3 57  ? 53.267  96.192  73.331  1.00 49.91  -1 56  GLU G OE2   1 
ATOM 4543  N N     . TYR G 3 58  ? 56.131  90.896  73.634  1.00 47.30  ?  57  TYR G N     1 
ATOM 4544  C CA    . TYR G 3 58  ? 55.459  89.786  74.299  1.00 47.30  ?  57  TYR G CA    1 
ATOM 4545  C C     . TYR G 3 58  ? 56.311  89.194  75.414  1.00 47.30  ?  57  TYR G C     1 
ATOM 4546  O O     . TYR G 3 58  ? 55.788  88.868  76.487  1.00 47.30  ?  57  TYR G O     1 
ATOM 4547  C CB    . TYR G 3 58  ? 55.074  88.704  73.304  1.00 47.30  ?  57  TYR G CB    1 
ATOM 4548  C CG    . TYR G 3 58  ? 54.410  87.557  73.999  1.00 47.30  ?  57  TYR G CG    1 
ATOM 4549  C CD1   . TYR G 3 58  ? 53.142  87.700  74.535  1.00 47.30  ?  57  TYR G CD1   1 
ATOM 4550  C CD2   . TYR G 3 58  ? 55.051  86.340  74.143  1.00 47.30  ?  57  TYR G CD2   1 
ATOM 4551  C CE1   . TYR G 3 58  ? 52.526  86.658  75.193  1.00 47.30  ?  57  TYR G CE1   1 
ATOM 4552  C CE2   . TYR G 3 58  ? 54.444  85.295  74.795  1.00 47.30  ?  57  TYR G CE2   1 
ATOM 4553  C CZ    . TYR G 3 58  ? 53.183  85.456  75.319  1.00 47.30  ?  57  TYR G CZ    1 
ATOM 4554  O OH    . TYR G 3 58  ? 52.578  84.409  75.970  1.00 47.30  ?  57  TYR G OH    1 
ATOM 4555  N N     . LEU G 3 59  ? 57.622  89.077  75.196  1.00 45.36  ?  58  LEU G N     1 
ATOM 4556  C CA    . LEU G 3 59  ? 58.483  88.540  76.251  1.00 45.36  ?  58  LEU G CA    1 
ATOM 4557  C C     . LEU G 3 59  ? 58.596  89.495  77.437  1.00 45.36  ?  58  LEU G C     1 
ATOM 4558  O O     . LEU G 3 59  ? 58.619  89.055  78.598  1.00 45.36  ?  58  LEU G O     1 
ATOM 4559  C CB    . LEU G 3 59  ? 59.864  88.220  75.695  1.00 45.36  ?  58  LEU G CB    1 
ATOM 4560  C CG    . LEU G 3 59  ? 59.849  87.041  74.736  1.00 45.36  ?  58  LEU G CG    1 
ATOM 4561  C CD1   . LEU G 3 59  ? 61.213  86.862  74.130  1.00 45.36  ?  58  LEU G CD1   1 
ATOM 4562  C CD2   . LEU G 3 59  ? 59.420  85.796  75.471  1.00 45.36  ?  58  LEU G CD2   1 
ATOM 4563  N N     . THR G 3 60  ? 58.643  90.803  77.164  1.00 44.95  ?  59  THR G N     1 
ATOM 4564  C CA    . THR G 3 60  ? 58.700  91.786  78.241  1.00 44.95  ?  59  THR G CA    1 
ATOM 4565  C C     . THR G 3 60  ? 57.427  91.764  79.080  1.00 44.95  ?  59  THR G C     1 
ATOM 4566  O O     . THR G 3 60  ? 57.493  91.798  80.318  1.00 44.95  ?  59  THR G O     1 
ATOM 4567  C CB    . THR G 3 60  ? 58.939  93.172  77.652  1.00 44.95  ?  59  THR G CB    1 
ATOM 4568  O OG1   . THR G 3 60  ? 60.170  93.166  76.924  1.00 44.95  ?  59  THR G OG1   1 
ATOM 4569  C CG2   . THR G 3 60  ? 59.021  94.214  78.741  1.00 44.95  ?  59  THR G CG2   1 
ATOM 4570  N N     . ALA G 3 61  ? 56.263  91.661  78.428  1.00 46.77  ?  60  ALA G N     1 
ATOM 4571  C CA    . ALA G 3 61  ? 55.009  91.559  79.172  1.00 46.77  ?  60  ALA G CA    1 
ATOM 4572  C C     . ALA G 3 61  ? 54.928  90.253  79.955  1.00 46.77  ?  60  ALA G C     1 
ATOM 4573  O O     . ALA G 3 61  ? 54.409  90.232  81.081  1.00 46.77  ?  60  ALA G O     1 
ATOM 4574  C CB    . ALA G 3 61  ? 53.821  91.684  78.222  1.00 46.77  ?  60  ALA G CB    1 
ATOM 4575  N N     . GLU G 3 62  ? 55.472  89.171  79.386  1.00 46.61  ?  61  GLU G N     1 
ATOM 4576  C CA    . GLU G 3 62  ? 55.483  87.876  80.059  1.00 46.61  ?  61  GLU G CA    1 
ATOM 4577  C C     . GLU G 3 62  ? 56.300  87.911  81.343  1.00 46.61  ?  61  GLU G C     1 
ATOM 4578  O O     . GLU G 3 62  ? 55.906  87.313  82.351  1.00 46.61  ?  61  GLU G O     1 
ATOM 4579  C CB    . GLU G 3 62  ? 56.032  86.811  79.113  1.00 46.61  ?  61  GLU G CB    1 
ATOM 4580  C CG    . GLU G 3 62  ? 56.126  85.420  79.709  1.00 46.61  ?  61  GLU G CG    1 
ATOM 4581  C CD    . GLU G 3 62  ? 54.773  84.809  79.982  1.00 46.61  ?  61  GLU G CD    1 
ATOM 4582  O OE1   . GLU G 3 62  ? 53.809  85.140  79.260  1.00 46.61  ?  61  GLU G OE1   1 
ATOM 4583  O OE2   . GLU G 3 62  ? 54.669  83.998  80.924  1.00 46.61  -1 61  GLU G OE2   1 
ATOM 4584  N N     . ILE G 3 63  ? 57.439  88.605  81.332  1.00 42.96  ?  62  ILE G N     1 
ATOM 4585  C CA    . ILE G 3 63  ? 58.214  88.736  82.566  1.00 42.96  ?  62  ILE G CA    1 
ATOM 4586  C C     . ILE G 3 63  ? 57.505  89.647  83.559  1.00 42.96  ?  62  ILE G C     1 
ATOM 4587  O O     . ILE G 3 63  ? 57.323  89.289  84.732  1.00 42.96  ?  62  ILE G O     1 
ATOM 4588  C CB    . ILE G 3 63  ? 59.638  89.233  82.271  1.00 42.96  ?  62  ILE G CB    1 
ATOM 4589  C CG1   . ILE G 3 63  ? 60.462  88.122  81.649  1.00 42.96  ?  62  ILE G CG1   1 
ATOM 4590  C CG2   . ILE G 3 63  ? 60.319  89.730  83.527  1.00 42.96  ?  62  ILE G CG2   1 
ATOM 4591  C CD1   . ILE G 3 63  ? 61.809  88.592  81.226  1.00 42.96  ?  62  ILE G CD1   1 
ATOM 4592  N N     . LEU G 3 64  ? 57.079  90.829  83.104  1.00 48.10  ?  63  LEU G N     1 
ATOM 4593  C CA    . LEU G 3 64  ? 56.614  91.837  84.045  1.00 48.10  ?  63  LEU G CA    1 
ATOM 4594  C C     . LEU G 3 64  ? 55.263  91.506  84.663  1.00 48.10  ?  63  LEU G C     1 
ATOM 4595  O O     . LEU G 3 64  ? 54.980  92.004  85.754  1.00 48.10  ?  63  LEU G O     1 
ATOM 4596  C CB    . LEU G 3 64  ? 56.567  93.207  83.377  1.00 48.10  ?  63  LEU G CB    1 
ATOM 4597  C CG    . LEU G 3 64  ? 57.952  93.770  83.064  1.00 48.10  ?  63  LEU G CG    1 
ATOM 4598  C CD1   . LEU G 3 64  ? 57.842  95.083  82.328  1.00 48.10  ?  63  LEU G CD1   1 
ATOM 4599  C CD2   . LEU G 3 64  ? 58.756  93.941  84.333  1.00 48.10  ?  63  LEU G CD2   1 
ATOM 4600  N N     . GLU G 3 65  ? 54.457  90.640  84.039  1.00 57.32  ?  64  GLU G N     1 
ATOM 4601  C CA    . GLU G 3 65  ? 53.222  90.197  84.687  1.00 57.32  ?  64  GLU G CA    1 
ATOM 4602  C C     . GLU G 3 65  ? 53.513  89.381  85.942  1.00 57.32  ?  64  GLU G C     1 
ATOM 4603  O O     . GLU G 3 65  ? 52.958  89.653  87.017  1.00 57.32  ?  64  GLU G O     1 
ATOM 4604  C CB    . GLU G 3 65  ? 52.379  89.382  83.711  1.00 57.32  ?  64  GLU G CB    1 
ATOM 4605  C CG    . GLU G 3 65  ? 51.056  88.921  84.291  1.00 57.32  ?  64  GLU G CG    1 
ATOM 4606  C CD    . GLU G 3 65  ? 50.226  88.129  83.301  1.00 57.32  ?  64  GLU G CD    1 
ATOM 4607  O OE1   . GLU G 3 65  ? 50.694  87.910  82.165  1.00 57.32  ?  64  GLU G OE1   1 
ATOM 4608  O OE2   . GLU G 3 65  ? 49.101  87.724  83.661  1.00 57.32  -1 64  GLU G OE2   1 
ATOM 4609  N N     . LEU G 3 66  ? 54.401  88.389  85.827  1.00 49.86  ?  65  LEU G N     1 
ATOM 4610  C CA    . LEU G 3 66  ? 54.769  87.571  86.977  1.00 49.86  ?  65  LEU G CA    1 
ATOM 4611  C C     . LEU G 3 66  ? 55.530  88.382  88.016  1.00 49.86  ?  65  LEU G C     1 
ATOM 4612  O O     . LEU G 3 66  ? 55.344  88.182  89.224  1.00 49.86  ?  65  LEU G O     1 
ATOM 4613  C CB    . LEU G 3 66  ? 55.604  86.378  86.523  1.00 49.86  ?  65  LEU G CB    1 
ATOM 4614  C CG    . LEU G 3 66  ? 54.883  85.369  85.638  1.00 49.86  ?  65  LEU G CG    1 
ATOM 4615  C CD1   . LEU G 3 66  ? 55.847  84.304  85.157  1.00 49.86  ?  65  LEU G CD1   1 
ATOM 4616  C CD2   . LEU G 3 66  ? 53.737  84.751  86.403  1.00 49.86  ?  65  LEU G CD2   1 
ATOM 4617  N N     . ALA G 3 67  ? 56.373  89.316  87.561  1.00 50.33  ?  66  ALA G N     1 
ATOM 4618  C CA    . ALA G 3 67  ? 57.107  90.168  88.492  1.00 50.33  ?  66  ALA G CA    1 
ATOM 4619  C C     . ALA G 3 67  ? 56.168  91.069  89.283  1.00 50.33  ?  66  ALA G C     1 
ATOM 4620  O O     . ALA G 3 67  ? 56.318  91.208  90.502  1.00 50.33  ?  66  ALA G O     1 
ATOM 4621  C CB    . ALA G 3 67  ? 58.137  91.003  87.740  1.00 50.33  ?  66  ALA G CB    1 
ATOM 4622  N N     . GLY G 3 68  ? 55.170  91.656  88.616  1.00 57.13  ?  67  GLY G N     1 
ATOM 4623  C CA    . GLY G 3 68  ? 54.208  92.488  89.312  1.00 57.13  ?  67  GLY G CA    1 
ATOM 4624  C C     . GLY G 3 68  ? 53.307  91.712  90.247  1.00 57.13  ?  67  GLY G C     1 
ATOM 4625  O O     . GLY G 3 68  ? 52.947  92.213  91.316  1.00 57.13  ?  67  GLY G O     1 
ATOM 4626  N N     . ASN G 3 69  ? 52.952  90.477  89.882  1.00 60.65  ?  68  ASN G N     1 
ATOM 4627  C CA    . ASN G 3 69  ? 52.135  89.670  90.784  1.00 60.65  ?  68  ASN G CA    1 
ATOM 4628  C C     . ASN G 3 69  ? 52.919  89.252  92.021  1.00 60.65  ?  68  ASN G C     1 
ATOM 4629  O O     . ASN G 3 69  ? 52.381  89.264  93.138  1.00 60.65  ?  68  ASN G O     1 
ATOM 4630  C CB    . ASN G 3 69  ? 51.591  88.452  90.049  1.00 60.65  ?  68  ASN G CB    1 
ATOM 4631  C CG    . ASN G 3 69  ? 50.573  88.824  88.998  1.00 60.65  ?  68  ASN G CG    1 
ATOM 4632  O OD1   . ASN G 3 69  ? 49.746  89.710  89.208  1.00 60.65  ?  68  ASN G OD1   1 
ATOM 4633  N ND2   . ASN G 3 69  ? 50.625  88.149  87.858  1.00 60.65  ?  68  ASN G ND2   1 
ATOM 4634  N N     . ALA G 3 70  ? 54.198  88.911  91.853  1.00 58.59  ?  69  ALA G N     1 
ATOM 4635  C CA    . ALA G 3 70  ? 55.016  88.575  93.012  1.00 58.59  ?  69  ALA G CA    1 
ATOM 4636  C C     . ALA G 3 70  ? 55.325  89.802  93.862  1.00 58.59  ?  69  ALA G C     1 
ATOM 4637  O O     . ALA G 3 70  ? 55.519  89.678  95.076  1.00 58.59  ?  69  ALA G O     1 
ATOM 4638  C CB    . ALA G 3 70  ? 56.308  87.898  92.568  1.00 58.59  ?  69  ALA G CB    1 
ATOM 4639  N N     . ALA G 3 71  ? 55.378  90.988  93.251  1.00 60.25  ?  70  ALA G N     1 
ATOM 4640  C CA    . ALA G 3 71  ? 55.537  92.210  94.032  1.00 60.25  ?  70  ALA G CA    1 
ATOM 4641  C C     . ALA G 3 71  ? 54.268  92.539  94.801  1.00 60.25  ?  70  ALA G C     1 
ATOM 4642  O O     . ALA G 3 71  ? 54.328  93.060  95.921  1.00 60.25  ?  70  ALA G O     1 
ATOM 4643  C CB    . ALA G 3 71  ? 55.910  93.374  93.120  1.00 60.25  ?  70  ALA G CB    1 
ATOM 4644  N N     . ARG G 3 72  ? 53.110  92.259  94.200  1.00 66.95  ?  71  ARG G N     1 
ATOM 4645  C CA    . ARG G 3 72  ? 51.835  92.493  94.864  1.00 66.95  ?  71  ARG G CA    1 
ATOM 4646  C C     . ARG G 3 72  ? 51.646  91.550  96.044  1.00 66.95  ?  71  ARG G C     1 
ATOM 4647  O O     . ARG G 3 72  ? 51.124  91.954  97.089  1.00 66.95  ?  71  ARG G O     1 
ATOM 4648  C CB    . ARG G 3 72  ? 50.700  92.351  93.846  1.00 66.95  ?  71  ARG G CB    1 
ATOM 4649  C CG    . ARG G 3 72  ? 49.287  92.516  94.384  1.00 66.95  ?  71  ARG G CG    1 
ATOM 4650  C CD    . ARG G 3 72  ? 48.589  91.170  94.563  1.00 66.95  ?  71  ARG G CD    1 
ATOM 4651  N NE    . ARG G 3 72  ? 47.222  91.331  95.037  1.00 66.95  ?  71  ARG G NE    1 
ATOM 4652  C CZ    . ARG G 3 72  ? 46.179  91.507  94.236  1.00 66.95  ?  71  ARG G CZ    1 
ATOM 4653  N NH1   . ARG G 3 72  ? 46.351  91.539  92.922  1.00 66.95  1  71  ARG G NH1   1 
ATOM 4654  N NH2   . ARG G 3 72  ? 44.966  91.648  94.748  1.00 66.95  ?  71  ARG G NH2   1 
ATOM 4655  N N     . ASP G 3 73  ? 52.067  90.291  95.903  1.00 76.68  ?  72  ASP G N     1 
ATOM 4656  C CA    . ASP G 3 73  ? 51.874  89.348  96.997  1.00 76.68  ?  72  ASP G CA    1 
ATOM 4657  C C     . ASP G 3 73  ? 52.815  89.586  98.171  1.00 76.68  ?  72  ASP G C     1 
ATOM 4658  O O     . ASP G 3 73  ? 52.585  89.017  99.243  1.00 76.68  ?  72  ASP G O     1 
ATOM 4659  C CB    . ASP G 3 73  ? 52.023  87.913  96.495  1.00 76.68  ?  72  ASP G CB    1 
ATOM 4660  C CG    . ASP G 3 73  ? 50.837  87.465  95.666  1.00 76.68  ?  72  ASP G CG    1 
ATOM 4661  O OD1   . ASP G 3 73  ? 49.726  87.984  95.897  1.00 76.68  ?  72  ASP G OD1   1 
ATOM 4662  O OD2   . ASP G 3 73  ? 51.010  86.590  94.792  1.00 76.68  -1 72  ASP G OD2   1 
ATOM 4663  N N     . ASN G 3 74  ? 53.852  90.403  98.010  1.00 73.77  ?  73  ASN G N     1 
ATOM 4664  C CA    . ASN G 3 74  ? 54.717  90.776  99.119  1.00 73.77  ?  73  ASN G CA    1 
ATOM 4665  C C     . ASN G 3 74  ? 54.329  92.125  99.713  1.00 73.77  ?  73  ASN G C     1 
ATOM 4666  O O     . ASN G 3 74  ? 55.095  92.678  100.511 1.00 73.77  ?  73  ASN G O     1 
ATOM 4667  C CB    . ASN G 3 74  ? 56.179  90.793  98.664  1.00 73.77  ?  73  ASN G CB    1 
ATOM 4668  C CG    . ASN G 3 74  ? 57.154  90.476  99.789  1.00 73.77  ?  73  ASN G CG    1 
ATOM 4669  O OD1   . ASN G 3 74  ? 58.333  90.231  99.543  1.00 73.77  ?  73  ASN G OD1   1 
ATOM 4670  N ND2   . ASN G 3 74  ? 56.662  90.454  101.021 1.00 73.77  ?  73  ASN G ND2   1 
ATOM 4671  N N     . LYS G 3 75  ? 53.165  92.660  99.317  1.00 75.44  ?  74  LYS G N     1 
ATOM 4672  C CA    . LYS G 3 75  ? 52.563  93.880  99.875  1.00 75.44  ?  74  LYS G CA    1 
ATOM 4673  C C     . LYS G 3 75  ? 53.463  95.101  99.694  1.00 75.44  ?  74  LYS G C     1 
ATOM 4674  O O     . LYS G 3 75  ? 53.576  95.948  100.581 1.00 75.44  ?  74  LYS G O     1 
ATOM 4675  C CB    . LYS G 3 75  ? 52.179  93.690  101.345 1.00 75.44  ?  74  LYS G CB    1 
ATOM 4676  C CG    . LYS G 3 75  ? 51.079  92.667  101.546 1.00 75.44  ?  74  LYS G CG    1 
ATOM 4677  C CD    . LYS G 3 75  ? 50.739  92.489  103.011 1.00 75.44  ?  74  LYS G CD    1 
ATOM 4678  C CE    . LYS G 3 75  ? 49.662  91.433  103.195 1.00 75.44  ?  74  LYS G CE    1 
ATOM 4679  N NZ    . LYS G 3 75  ? 49.330  91.224  104.630 1.00 75.44  1  74  LYS G NZ    1 
ATOM 4680  N N     . LYS G 3 76  ? 54.113  95.190  98.537  1.00 79.09  ?  75  LYS G N     1 
ATOM 4681  C CA    . LYS G 3 76  ? 54.952  96.328  98.195  1.00 79.09  ?  75  LYS G CA    1 
ATOM 4682  C C     . LYS G 3 76  ? 54.576  96.826  96.809  1.00 79.09  ?  75  LYS G C     1 
ATOM 4683  O O     . LYS G 3 76  ? 54.299  96.030  95.909  1.00 79.09  ?  75  LYS G O     1 
ATOM 4684  C CB    . LYS G 3 76  ? 56.438  95.963  98.249  1.00 79.09  ?  75  LYS G CB    1 
ATOM 4685  C CG    . LYS G 3 76  ? 56.933  95.672  99.653  1.00 79.09  ?  75  LYS G CG    1 
ATOM 4686  C CD    . LYS G 3 76  ? 58.420  95.392  99.698  1.00 79.09  ?  75  LYS G CD    1 
ATOM 4687  C CE    . LYS G 3 76  ? 58.861  95.103  101.124 1.00 79.09  ?  75  LYS G CE    1 
ATOM 4688  N NZ    . LYS G 3 76  ? 60.319  94.838  101.232 1.00 79.09  1  75  LYS G NZ    1 
ATOM 4689  N N     . THR G 3 77  ? 54.568  98.146  96.644  1.00 83.82  ?  76  THR G N     1 
ATOM 4690  C CA    . THR G 3 77  ? 54.126  98.791  95.409  1.00 83.82  ?  76  THR G CA    1 
ATOM 4691  C C     . THR G 3 77  ? 55.296  99.202  94.534  1.00 83.82  ?  76  THR G C     1 
ATOM 4692  O O     . THR G 3 77  ? 55.270  100.259 93.900  1.00 83.82  ?  76  THR G O     1 
ATOM 4693  C CB    . THR G 3 77  ? 53.258  100.000 95.723  1.00 83.82  ?  76  THR G CB    1 
ATOM 4694  O OG1   . THR G 3 77  ? 54.037  100.963 96.440  1.00 83.82  ?  76  THR G OG1   1 
ATOM 4695  C CG2   . THR G 3 77  ? 52.067  99.585  96.566  1.00 83.82  ?  76  THR G CG2   1 
ATOM 4696  N N     . ARG G 3 78  ? 56.343  98.389  94.494  1.00 74.82  ?  77  ARG G N     1 
ATOM 4697  C CA    . ARG G 3 78  ? 57.535  98.723  93.736  1.00 74.82  ?  77  ARG G CA    1 
ATOM 4698  C C     . ARG G 3 78  ? 58.227  97.425  93.359  1.00 74.82  ?  77  ARG G C     1 
ATOM 4699  O O     . ARG G 3 78  ? 58.214  96.466  94.132  1.00 74.82  ?  77  ARG G O     1 
ATOM 4700  C CB    . ARG G 3 78  ? 58.453  99.627  94.561  1.00 74.82  ?  77  ARG G CB    1 
ATOM 4701  C CG    . ARG G 3 78  ? 59.589  100.237 93.795  1.00 74.82  ?  77  ARG G CG    1 
ATOM 4702  C CD    . ARG G 3 78  ? 60.389  101.158 94.685  1.00 74.82  ?  77  ARG G CD    1 
ATOM 4703  N NE    . ARG G 3 78  ? 59.592  102.295 95.121  1.00 74.82  ?  77  ARG G NE    1 
ATOM 4704  C CZ    . ARG G 3 78  ? 59.395  103.386 94.391  1.00 74.82  ?  77  ARG G CZ    1 
ATOM 4705  N NH1   . ARG G 3 78  ? 59.932  103.483 93.185  1.00 74.82  1  77  ARG G NH1   1 
ATOM 4706  N NH2   . ARG G 3 78  ? 58.657  104.379 94.865  1.00 74.82  ?  77  ARG G NH2   1 
ATOM 4707  N N     . ILE G 3 79  ? 58.816  97.390  92.173  1.00 57.00  ?  78  ILE G N     1 
ATOM 4708  C CA    . ILE G 3 79  ? 59.461  96.183  91.673  1.00 57.00  ?  78  ILE G CA    1 
ATOM 4709  C C     . ILE G 3 79  ? 60.952  96.246  91.976  1.00 57.00  ?  78  ILE G C     1 
ATOM 4710  O O     . ILE G 3 79  ? 61.626  97.228  91.648  1.00 57.00  ?  78  ILE G O     1 
ATOM 4711  C CB    . ILE G 3 79  ? 59.202  96.008  90.171  1.00 57.00  ?  78  ILE G CB    1 
ATOM 4712  C CG1   . ILE G 3 79  ? 57.713  95.818  89.920  1.00 57.00  ?  78  ILE G CG1   1 
ATOM 4713  C CG2   . ILE G 3 79  ? 59.906  94.805  89.657  1.00 57.00  ?  78  ILE G CG2   1 
ATOM 4714  C CD1   . ILE G 3 79  ? 57.353  95.819  88.463  1.00 57.00  ?  78  ILE G CD1   1 
ATOM 4715  N N     . ILE G 3 80  ? 61.461  95.198  92.613  1.00 48.62  ?  79  ILE G N     1 
ATOM 4716  C CA    . ILE G 3 80  ? 62.855  95.102  93.041  1.00 48.62  ?  79  ILE G CA    1 
ATOM 4717  C C     . ILE G 3 80  ? 63.407  93.784  92.507  1.00 48.62  ?  79  ILE G C     1 
ATOM 4718  O O     . ILE G 3 80  ? 62.627  92.863  92.220  1.00 48.62  ?  79  ILE G O     1 
ATOM 4719  C CB    . ILE G 3 80  ? 62.973  95.215  94.582  1.00 48.62  ?  79  ILE G CB    1 
ATOM 4720  C CG1   . ILE G 3 80  ? 62.058  94.204  95.268  1.00 48.62  ?  79  ILE G CG1   1 
ATOM 4721  C CG2   . ILE G 3 80  ? 62.682  96.632  95.039  1.00 48.62  ?  79  ILE G CG2   1 
ATOM 4722  C CD1   . ILE G 3 80  ? 62.204  94.172  96.771  1.00 48.62  ?  79  ILE G CD1   1 
ATOM 4723  N N     . PRO G 3 81  ? 64.736  93.671  92.315  1.00 39.43  ?  80  PRO G N     1 
ATOM 4724  C CA    . PRO G 3 81  ? 65.283  92.492  91.610  1.00 39.43  ?  80  PRO G CA    1 
ATOM 4725  C C     . PRO G 3 81  ? 65.055  91.149  92.283  1.00 39.43  ?  80  PRO G C     1 
ATOM 4726  O O     . PRO G 3 81  ? 65.105  90.123  91.590  1.00 39.43  ?  80  PRO G O     1 
ATOM 4727  C CB    . PRO G 3 81  ? 66.777  92.806  91.527  1.00 39.43  ?  80  PRO G CB    1 
ATOM 4728  C CG    . PRO G 3 81  ? 66.841  94.256  91.525  1.00 39.43  ?  80  PRO G CG    1 
ATOM 4729  C CD    . PRO G 3 81  ? 65.772  94.713  92.448  1.00 39.43  ?  80  PRO G CD    1 
ATOM 4730  N N     . ARG G 3 82  ? 64.793  91.119  93.591  1.00 38.15  ?  81  ARG G N     1 
ATOM 4731  C CA    . ARG G 3 82  ? 64.400  89.872  94.239  1.00 38.15  ?  81  ARG G CA    1 
ATOM 4732  C C     . ARG G 3 82  ? 63.080  89.351  93.682  1.00 38.15  ?  81  ARG G C     1 
ATOM 4733  O O     . ARG G 3 82  ? 62.887  88.132  93.554  1.00 38.15  ?  81  ARG G O     1 
ATOM 4734  C CB    . ARG G 3 82  ? 64.311  90.086  95.749  1.00 38.15  ?  81  ARG G CB    1 
ATOM 4735  C CG    . ARG G 3 82  ? 63.871  88.873  96.539  1.00 38.15  ?  81  ARG G CG    1 
ATOM 4736  C CD    . ARG G 3 82  ? 64.892  87.767  96.441  1.00 38.15  ?  81  ARG G CD    1 
ATOM 4737  N NE    . ARG G 3 82  ? 64.456  86.562  97.135  1.00 38.15  ?  81  ARG G NE    1 
ATOM 4738  C CZ    . ARG G 3 82  ? 64.714  86.301  98.410  1.00 38.15  ?  81  ARG G CZ    1 
ATOM 4739  N NH1   . ARG G 3 82  ? 65.410  87.164  99.136  1.00 38.15  1  81  ARG G NH1   1 
ATOM 4740  N NH2   . ARG G 3 82  ? 64.277  85.178  98.960  1.00 38.15  ?  81  ARG G NH2   1 
ATOM 4741  N N     . HIS G 3 83  ? 62.194  90.257  93.273  1.00 45.33  ?  82  HIS G N     1 
ATOM 4742  C CA    . HIS G 3 83  ? 60.911  89.839  92.727  1.00 45.33  ?  82  HIS G CA    1 
ATOM 4743  C C     . HIS G 3 83  ? 61.072  89.230  91.338  1.00 45.33  ?  82  HIS G C     1 
ATOM 4744  O O     . HIS G 3 83  ? 60.416  88.230  91.021  1.00 45.33  ?  82  HIS G O     1 
ATOM 4745  C CB    . HIS G 3 83  ? 59.958  91.027  92.713  1.00 45.33  ?  82  HIS G CB    1 
ATOM 4746  C CG    . HIS G 3 83  ? 59.624  91.537  94.079  1.00 45.33  ?  82  HIS G CG    1 
ATOM 4747  N ND1   . HIS G 3 83  ? 58.981  92.735  94.292  1.00 45.33  ?  82  HIS G ND1   1 
ATOM 4748  C CD2   . HIS G 3 83  ? 59.847  91.009  95.305  1.00 45.33  ?  82  HIS G CD2   1 
ATOM 4749  C CE1   . HIS G 3 83  ? 58.815  92.921  95.588  1.00 45.33  ?  82  HIS G CE1   1 
ATOM 4750  N NE2   . HIS G 3 83  ? 59.337  91.890  96.226  1.00 45.33  ?  82  HIS G NE2   1 
ATOM 4751  N N     . LEU G 3 84  ? 61.962  89.790  90.508  1.00 37.73  ?  83  LEU G N     1 
ATOM 4752  C CA    . LEU G 3 84  ? 62.252  89.152  89.227  1.00 37.73  ?  83  LEU G CA    1 
ATOM 4753  C C     . LEU G 3 84  ? 62.955  87.823  89.411  1.00 37.73  ?  83  LEU G C     1 
ATOM 4754  O O     . LEU G 3 84  ? 62.736  86.905  88.615  1.00 37.73  ?  83  LEU G O     1 
ATOM 4755  C CB    . LEU G 3 84  ? 63.116  90.031  88.328  1.00 37.73  ?  83  LEU G CB    1 
ATOM 4756  C CG    . LEU G 3 84  ? 62.489  91.141  87.495  1.00 37.73  ?  83  LEU G CG    1 
ATOM 4757  C CD1   . LEU G 3 84  ? 62.305  92.363  88.329  1.00 37.73  ?  83  LEU G CD1   1 
ATOM 4758  C CD2   . LEU G 3 84  ? 63.339  91.445  86.288  1.00 37.73  ?  83  LEU G CD2   1 
ATOM 4759  N N     . GLN G 3 85  ? 63.798  87.708  90.441  1.00 38.39  ?  84  GLN G N     1 
ATOM 4760  C CA    . GLN G 3 85  ? 64.448  86.434  90.738  1.00 38.39  ?  84  GLN G CA    1 
ATOM 4761  C C     . GLN G 3 85  ? 63.423  85.362  91.072  1.00 38.39  ?  84  GLN G C     1 
ATOM 4762  O O     . GLN G 3 85  ? 63.489  84.240  90.552  1.00 38.39  ?  84  GLN G O     1 
ATOM 4763  C CB    . GLN G 3 85  ? 65.423  86.604  91.896  1.00 38.39  ?  84  GLN G CB    1 
ATOM 4764  C CG    . GLN G 3 85  ? 66.220  85.367  92.220  1.00 38.39  ?  84  GLN G CG    1 
ATOM 4765  C CD    . GLN G 3 85  ? 67.205  85.021  91.135  1.00 38.39  ?  84  GLN G CD    1 
ATOM 4766  O OE1   . GLN G 3 85  ? 66.988  84.101  90.351  1.00 38.39  ?  84  GLN G OE1   1 
ATOM 4767  N NE2   . GLN G 3 85  ? 68.307  85.755  91.088  1.00 38.39  ?  84  GLN G NE2   1 
ATOM 4768  N N     . LEU G 3 86  ? 62.441  85.708  91.909  1.00 42.49  ?  85  LEU G N     1 
ATOM 4769  C CA    . LEU G 3 86  ? 61.387  84.757  92.259  1.00 42.49  ?  85  LEU G CA    1 
ATOM 4770  C C     . LEU G 3 86  ? 60.504  84.423  91.063  1.00 42.49  ?  85  LEU G C     1 
ATOM 4771  O O     . LEU G 3 86  ? 60.114  83.262  90.880  1.00 42.49  ?  85  LEU G O     1 
ATOM 4772  C CB    . LEU G 3 86  ? 60.534  85.304  93.398  1.00 42.49  ?  85  LEU G CB    1 
ATOM 4773  C CG    . LEU G 3 86  ? 61.222  85.384  94.753  1.00 42.49  ?  85  LEU G CG    1 
ATOM 4774  C CD1   . LEU G 3 86  ? 60.301  86.026  95.775  1.00 42.49  ?  85  LEU G CD1   1 
ATOM 4775  C CD2   . LEU G 3 86  ? 61.639  83.997  95.192  1.00 42.49  ?  85  LEU G CD2   1 
ATOM 4776  N N     . ALA G 3 87  ? 60.193  85.419  90.230  1.00 45.85  ?  86  ALA G N     1 
ATOM 4777  C CA    . ALA G 3 87  ? 59.315  85.173  89.092  1.00 45.85  ?  86  ALA G CA    1 
ATOM 4778  C C     . ALA G 3 87  ? 59.994  84.334  88.020  1.00 45.85  ?  86  ALA G C     1 
ATOM 4779  O O     . ALA G 3 87  ? 59.334  83.519  87.369  1.00 45.85  ?  86  ALA G O     1 
ATOM 4780  C CB    . ALA G 3 87  ? 58.836  86.495  88.499  1.00 45.85  ?  86  ALA G CB    1 
ATOM 4781  N N     . ILE G 3 88  ? 61.300  84.512  87.820  1.00 39.75  ?  87  ILE G N     1 
ATOM 4782  C CA    . ILE G 3 88  ? 62.011  83.681  86.858  1.00 39.75  ?  87  ILE G CA    1 
ATOM 4783  C C     . ILE G 3 88  ? 62.177  82.266  87.393  1.00 39.75  ?  87  ILE G C     1 
ATOM 4784  O O     . ILE G 3 88  ? 61.857  81.290  86.706  1.00 39.75  ?  87  ILE G O     1 
ATOM 4785  C CB    . ILE G 3 88  ? 63.361  84.317  86.487  1.00 39.75  ?  87  ILE G CB    1 
ATOM 4786  C CG1   . ILE G 3 88  ? 63.136  85.554  85.624  1.00 39.75  ?  87  ILE G CG1   1 
ATOM 4787  C CG2   . ILE G 3 88  ? 64.243  83.334  85.764  1.00 39.75  ?  87  ILE G CG2   1 
ATOM 4788  C CD1   . ILE G 3 88  ? 64.391  86.340  85.354  1.00 39.75  ?  87  ILE G CD1   1 
ATOM 4789  N N     . ARG G 3 89  ? 62.643  82.123  88.634  1.00 39.49  ?  88  ARG G N     1 
ATOM 4790  C CA    . ARG G 3 89  ? 62.914  80.781  89.128  1.00 39.49  ?  88  ARG G CA    1 
ATOM 4791  C C     . ARG G 3 89  ? 61.663  80.005  89.515  1.00 39.49  ?  88  ARG G C     1 
ATOM 4792  O O     . ARG G 3 89  ? 61.762  78.796  89.737  1.00 39.49  ?  88  ARG G O     1 
ATOM 4793  C CB    . ARG G 3 89  ? 63.859  80.833  90.320  1.00 39.49  ?  88  ARG G CB    1 
ATOM 4794  C CG    . ARG G 3 89  ? 65.228  81.358  89.979  1.00 39.49  ?  88  ARG G CG    1 
ATOM 4795  C CD    . ARG G 3 89  ? 65.953  80.424  89.041  1.00 39.49  ?  88  ARG G CD    1 
ATOM 4796  N NE    . ARG G 3 89  ? 67.347  80.817  88.870  1.00 39.49  ?  88  ARG G NE    1 
ATOM 4797  C CZ    . ARG G 3 89  ? 67.773  81.684  87.959  1.00 39.49  ?  88  ARG G CZ    1 
ATOM 4798  N NH1   . ARG G 3 89  ? 66.912  82.260  87.137  1.00 39.49  1  88  ARG G NH1   1 
ATOM 4799  N NH2   . ARG G 3 89  ? 69.061  81.980  87.875  1.00 39.49  ?  88  ARG G NH2   1 
ATOM 4800  N N     . ASN G 3 90  ? 60.499  80.646  89.601  1.00 49.96  ?  89  ASN G N     1 
ATOM 4801  C CA    . ASN G 3 90  ? 59.275  79.889  89.825  1.00 49.96  ?  89  ASN G CA    1 
ATOM 4802  C C     . ASN G 3 90  ? 58.563  79.497  88.538  1.00 49.96  ?  89  ASN G C     1 
ATOM 4803  O O     . ASN G 3 90  ? 57.809  78.518  88.540  1.00 49.96  ?  89  ASN G O     1 
ATOM 4804  C CB    . ASN G 3 90  ? 58.314  80.675  90.719  1.00 49.96  ?  89  ASN G CB    1 
ATOM 4805  C CG    . ASN G 3 90  ? 58.706  80.618  92.175  1.00 49.96  ?  89  ASN G CG    1 
ATOM 4806  O OD1   . ASN G 3 90  ? 59.076  79.563  92.684  1.00 49.96  ?  89  ASN G OD1   1 
ATOM 4807  N ND2   . ASN G 3 90  ? 58.629  81.752  92.856  1.00 49.96  ?  89  ASN G ND2   1 
ATOM 4808  N N     . ASP G 3 91  ? 58.780  80.222  87.448  1.00 56.23  ?  90  ASP G N     1 
ATOM 4809  C CA    . ASP G 3 91  ? 58.192  79.876  86.163  1.00 56.23  ?  90  ASP G CA    1 
ATOM 4810  C C     . ASP G 3 91  ? 58.991  78.754  85.513  1.00 56.23  ?  90  ASP G C     1 
ATOM 4811  O O     . ASP G 3 91  ? 60.199  78.628  85.721  1.00 56.23  ?  90  ASP G O     1 
ATOM 4812  C CB    . ASP G 3 91  ? 58.150  81.104  85.251  1.00 56.23  ?  90  ASP G CB    1 
ATOM 4813  C CG    . ASP G 3 91  ? 57.439  80.841  83.943  1.00 56.23  ?  90  ASP G CG    1 
ATOM 4814  O OD1   . ASP G 3 91  ? 56.196  80.724  83.952  1.00 56.23  ?  90  ASP G OD1   1 
ATOM 4815  O OD2   . ASP G 3 91  ? 58.127  80.745  82.905  1.00 56.23  -1 90  ASP G OD2   1 
ATOM 4816  N N     . GLU G 3 92  ? 58.305  77.926  84.727  1.00 61.35  ?  91  GLU G N     1 
ATOM 4817  C CA    . GLU G 3 92  ? 58.960  76.789  84.096  1.00 61.35  ?  91  GLU G CA    1 
ATOM 4818  C C     . GLU G 3 92  ? 59.601  77.145  82.758  1.00 61.35  ?  91  GLU G C     1 
ATOM 4819  O O     . GLU G 3 92  ? 60.701  76.671  82.459  1.00 61.35  ?  91  GLU G O     1 
ATOM 4820  C CB    . GLU G 3 92  ? 57.958  75.650  83.905  1.00 61.35  ?  91  GLU G CB    1 
ATOM 4821  C CG    . GLU G 3 92  ? 58.575  74.364  83.396  1.00 61.35  ?  91  GLU G CG    1 
ATOM 4822  C CD    . GLU G 3 92  ? 57.568  73.243  83.273  1.00 61.35  ?  91  GLU G CD    1 
ATOM 4823  O OE1   . GLU G 3 92  ? 56.376  73.483  83.554  1.00 61.35  ?  91  GLU G OE1   1 
ATOM 4824  O OE2   . GLU G 3 92  ? 57.969  72.121  82.900  1.00 61.35  -1 91  GLU G OE2   1 
ATOM 4825  N N     . GLU G 3 93  ? 58.939  77.976  81.949  1.00 56.10  ?  92  GLU G N     1 
ATOM 4826  C CA    . GLU G 3 93  ? 59.459  78.299  80.622  1.00 56.10  ?  92  GLU G CA    1 
ATOM 4827  C C     . GLU G 3 93  ? 60.697  79.177  80.717  1.00 56.10  ?  92  GLU G C     1 
ATOM 4828  O O     . GLU G 3 93  ? 61.709  78.921  80.054  1.00 56.10  ?  92  GLU G O     1 
ATOM 4829  C CB    . GLU G 3 93  ? 58.385  78.991  79.784  1.00 56.10  ?  92  GLU G CB    1 
ATOM 4830  C CG    . GLU G 3 93  ? 57.181  78.124  79.445  1.00 56.10  ?  92  GLU G CG    1 
ATOM 4831  C CD    . GLU G 3 93  ? 56.088  78.193  80.494  1.00 56.10  ?  92  GLU G CD    1 
ATOM 4832  O OE1   . GLU G 3 93  ? 56.216  79.000  81.438  1.00 56.10  ?  92  GLU G OE1   1 
ATOM 4833  O OE2   . GLU G 3 93  ? 55.102  77.438  80.377  1.00 56.10  -1 92  GLU G OE2   1 
ATOM 4834  N N     . LEU G 3 94  ? 60.642  80.208  81.556  1.00 51.22  ?  93  LEU G N     1 
ATOM 4835  C CA    . LEU G 3 94  ? 61.797  81.074  81.726  1.00 51.22  ?  93  LEU G CA    1 
ATOM 4836  C C     . LEU G 3 94  ? 62.915  80.396  82.507  1.00 51.22  ?  93  LEU G C     1 
ATOM 4837  O O     . LEU G 3 94  ? 64.049  80.887  82.488  1.00 51.22  ?  93  LEU G O     1 
ATOM 4838  C CB    . LEU G 3 94  ? 61.373  82.371  82.407  1.00 51.22  ?  93  LEU G CB    1 
ATOM 4839  C CG    . LEU G 3 94  ? 60.443  83.234  81.557  1.00 51.22  ?  93  LEU G CG    1 
ATOM 4840  C CD1   . LEU G 3 94  ? 59.950  84.424  82.343  1.00 51.22  ?  93  LEU G CD1   1 
ATOM 4841  C CD2   . LEU G 3 94  ? 61.154  83.694  80.309  1.00 51.22  ?  93  LEU G CD2   1 
ATOM 4842  N N     . ASN G 3 95  ? 62.626  79.282  83.184  1.00 51.10  ?  94  ASN G N     1 
ATOM 4843  C CA    . ASN G 3 95  ? 63.688  78.484  83.782  1.00 51.10  ?  94  ASN G CA    1 
ATOM 4844  C C     . ASN G 3 95  ? 64.558  77.838  82.714  1.00 51.10  ?  94  ASN G C     1 
ATOM 4845  O O     . ASN G 3 95  ? 65.749  77.607  82.945  1.00 51.10  ?  94  ASN G O     1 
ATOM 4846  C CB    . ASN G 3 95  ? 63.091  77.408  84.690  1.00 51.10  ?  94  ASN G CB    1 
ATOM 4847  C CG    . ASN G 3 95  ? 64.035  76.975  85.800  1.00 51.10  ?  94  ASN G CG    1 
ATOM 4848  O OD1   . ASN G 3 95  ? 63.627  76.274  86.724  1.00 51.10  ?  94  ASN G OD1   1 
ATOM 4849  N ND2   . ASN G 3 95  ? 65.285  77.416  85.737  1.00 51.10  ?  94  ASN G ND2   1 
ATOM 4850  N N     . LYS G 3 96  ? 63.987  77.529  81.552  1.00 49.86  ?  95  LYS G N     1 
ATOM 4851  C CA    . LYS G 3 96  ? 64.773  76.959  80.469  1.00 49.86  ?  95  LYS G CA    1 
ATOM 4852  C C     . LYS G 3 96  ? 65.295  78.030  79.525  1.00 49.86  ?  95  LYS G C     1 
ATOM 4853  O O     . LYS G 3 96  ? 66.371  77.855  78.942  1.00 49.86  ?  95  LYS G O     1 
ATOM 4854  C CB    . LYS G 3 96  ? 63.939  75.922  79.706  1.00 49.86  ?  95  LYS G CB    1 
ATOM 4855  C CG    . LYS G 3 96  ? 64.720  74.995  78.772  1.00 49.86  ?  95  LYS G CG    1 
ATOM 4856  C CD    . LYS G 3 96  ? 64.669  75.435  77.316  1.00 49.86  ?  95  LYS G CD    1 
ATOM 4857  C CE    . LYS G 3 96  ? 65.297  74.393  76.404  1.00 49.86  ?  95  LYS G CE    1 
ATOM 4858  N NZ    . LYS G 3 96  ? 66.758  74.241  76.647  1.00 49.86  1  95  LYS G NZ    1 
ATOM 4859  N N     . LEU G 3 97  ? 64.561  79.132  79.357  1.00 45.71  ?  96  LEU G N     1 
ATOM 4860  C CA    . LEU G 3 97  ? 65.091  80.250  78.582  1.00 45.71  ?  96  LEU G CA    1 
ATOM 4861  C C     . LEU G 3 97  ? 66.261  80.901  79.301  1.00 45.71  ?  96  LEU G C     1 
ATOM 4862  O O     . LEU G 3 97  ? 67.353  81.031  78.739  1.00 45.71  ?  96  LEU G O     1 
ATOM 4863  C CB    . LEU G 3 97  ? 64.004  81.282  78.304  1.00 45.71  ?  96  LEU G CB    1 
ATOM 4864  C CG    . LEU G 3 97  ? 64.514  82.478  77.502  1.00 45.71  ?  96  LEU G CG    1 
ATOM 4865  C CD1   . LEU G 3 97  ? 65.025  82.029  76.158  1.00 45.71  ?  96  LEU G CD1   1 
ATOM 4866  C CD2   . LEU G 3 97  ? 63.432  83.510  77.320  1.00 45.71  ?  96  LEU G CD2   1 
ATOM 4867  N N     . LEU G 3 98  ? 66.055  81.316  80.544  1.00 44.72  ?  97  LEU G N     1 
ATOM 4868  C CA    . LEU G 3 98  ? 67.132  81.885  81.342  1.00 44.72  ?  97  LEU G CA    1 
ATOM 4869  C C     . LEU G 3 98  ? 67.573  80.823  82.342  1.00 44.72  ?  97  LEU G C     1 
ATOM 4870  O O     . LEU G 3 98  ? 67.117  80.767  83.483  1.00 44.72  ?  97  LEU G O     1 
ATOM 4871  C CB    . LEU G 3 98  ? 66.676  83.161  82.027  1.00 44.72  ?  97  LEU G CB    1 
ATOM 4872  C CG    . LEU G 3 98  ? 66.181  84.256  81.087  1.00 44.72  ?  97  LEU G CG    1 
ATOM 4873  C CD1   . LEU G 3 98  ? 65.759  85.473  81.891  1.00 44.72  ?  97  LEU G CD1   1 
ATOM 4874  C CD2   . LEU G 3 98  ? 67.218  84.621  80.039  1.00 44.72  ?  97  LEU G CD2   1 
ATOM 4875  N N     . GLY G 3 99  ? 68.474  79.958  81.890  1.00 45.57  ?  98  GLY G N     1 
ATOM 4876  C CA    . GLY G 3 99  ? 69.009  78.919  82.744  1.00 45.57  ?  98  GLY G CA    1 
ATOM 4877  C C     . GLY G 3 99  ? 70.478  79.121  83.036  1.00 45.57  ?  98  GLY G C     1 
ATOM 4878  O O     . GLY G 3 99  ? 71.051  78.443  83.891  1.00 45.57  ?  98  GLY G O     1 
ATOM 4879  N N     . ARG G 3 100 ? 71.098  80.053  82.322  1.00 44.75  ?  99  ARG G N     1 
ATOM 4880  C CA    . ARG G 3 100 ? 72.506  80.354  82.526  1.00 44.75  ?  99  ARG G CA    1 
ATOM 4881  C C     . ARG G 3 100 ? 72.665  81.825  82.854  1.00 44.75  ?  99  ARG G C     1 
ATOM 4882  O O     . ARG G 3 100 ? 73.516  82.505  82.275  1.00 44.75  ?  99  ARG G O     1 
ATOM 4883  C CB    . ARG G 3 100 ? 73.318  80.004  81.283  1.00 44.75  ?  99  ARG G CB    1 
ATOM 4884  C CG    . ARG G 3 100 ? 73.245  78.547  80.894  1.00 44.75  ?  99  ARG G CG    1 
ATOM 4885  C CD    . ARG G 3 100 ? 73.955  77.664  81.904  1.00 44.75  ?  99  ARG G CD    1 
ATOM 4886  N NE    . ARG G 3 100 ? 73.914  76.262  81.501  1.00 44.75  ?  99  ARG G NE    1 
ATOM 4887  C CZ    . ARG G 3 100 ? 74.405  75.259  82.222  1.00 44.75  ?  99  ARG G CZ    1 
ATOM 4888  N NH1   . ARG G 3 100 ? 74.985  75.497  83.389  1.00 44.75  1  99  ARG G NH1   1 
ATOM 4889  N NH2   . ARG G 3 100 ? 74.318  74.016  81.770  1.00 44.75  ?  99  ARG G NH2   1 
ATOM 4890  N N     . VAL G 3 101 ? 71.836  82.338  83.755  1.00 36.80  ?  100 VAL G N     1 
ATOM 4891  C CA    . VAL G 3 101 ? 71.763  83.768  84.021  1.00 36.80  ?  100 VAL G CA    1 
ATOM 4892  C C     . VAL G 3 101 ? 71.918  84.004  85.513  1.00 36.80  ?  100 VAL G C     1 
ATOM 4893  O O     . VAL G 3 101 ? 71.176  83.429  86.315  1.00 36.80  ?  100 VAL G O     1 
ATOM 4894  C CB    . VAL G 3 101 ? 70.443  84.376  83.524  1.00 36.80  ?  100 VAL G CB    1 
ATOM 4895  C CG1   . VAL G 3 101 ? 70.311  85.806  83.997  1.00 36.80  ?  100 VAL G CG1   1 
ATOM 4896  C CG2   . VAL G 3 101 ? 70.370  84.323  82.016  1.00 36.80  ?  100 VAL G CG2   1 
ATOM 4897  N N     . THR G 3 102 ? 72.883  84.835  85.881  1.00 36.09  ?  101 THR G N     1 
ATOM 4898  C CA    . THR G 3 102 ? 72.963  85.389  87.219  1.00 36.09  ?  101 THR G CA    1 
ATOM 4899  C C     . THR G 3 102 ? 72.362  86.786  87.206  1.00 36.09  ?  101 THR G C     1 
ATOM 4900  O O     . THR G 3 102 ? 72.464  87.509  86.215  1.00 36.09  ?  101 THR G O     1 
ATOM 4901  C CB    . THR G 3 102 ? 74.409  85.446  87.699  1.00 36.09  ?  101 THR G CB    1 
ATOM 4902  O OG1   . THR G 3 102 ? 75.146  86.360  86.880  1.00 36.09  ?  101 THR G OG1   1 
ATOM 4903  C CG2   . THR G 3 102 ? 75.041  84.074  87.587  1.00 36.09  ?  101 THR G CG2   1 
ATOM 4904  N N     . ILE G 3 103 ? 71.716  87.157  88.305  1.00 30.26  ?  102 ILE G N     1 
ATOM 4905  C CA    . ILE G 3 103 ? 71.023  88.434  88.417  1.00 30.26  ?  102 ILE G CA    1 
ATOM 4906  C C     . ILE G 3 103 ? 71.605  89.193  89.598  1.00 30.26  ?  102 ILE G C     1 
ATOM 4907  O O     . ILE G 3 103 ? 71.696  88.649  90.703  1.00 30.26  ?  102 ILE G O     1 
ATOM 4908  C CB    . ILE G 3 103 ? 69.506  88.237  88.579  1.00 30.26  ?  102 ILE G CB    1 
ATOM 4909  C CG1   . ILE G 3 103 ? 68.919  87.617  87.321  1.00 30.26  ?  102 ILE G CG1   1 
ATOM 4910  C CG2   . ILE G 3 103 ? 68.811  89.540  88.862  1.00 30.26  ?  102 ILE G CG2   1 
ATOM 4911  C CD1   . ILE G 3 103 ? 67.512  87.151  87.497  1.00 30.26  ?  102 ILE G CD1   1 
ATOM 4912  N N     . ALA G 3 104 ? 72.010  90.438  89.360  1.00 32.63  ?  103 ALA G N     1 
ATOM 4913  C CA    . ALA G 3 104 ? 72.561  91.271  90.418  1.00 32.63  ?  103 ALA G CA    1 
ATOM 4914  C C     . ALA G 3 104 ? 71.491  91.614  91.441  1.00 32.63  ?  103 ALA G C     1 
ATOM 4915  O O     . ALA G 3 104 ? 70.317  91.776  91.101  1.00 32.63  ?  103 ALA G O     1 
ATOM 4916  C CB    . ALA G 3 104 ? 73.147  92.552  89.838  1.00 32.63  ?  103 ALA G CB    1 
ATOM 4917  N N     . GLN G 3 105 ? 71.924  91.721  92.704  1.00 32.95  ?  104 GLN G N     1 
ATOM 4918  C CA    . GLN G 3 105 ? 71.051  91.840  93.879  1.00 32.95  ?  104 GLN G CA    1 
ATOM 4919  C C     . GLN G 3 105 ? 70.028  90.710  93.916  1.00 32.95  ?  104 GLN G C     1 
ATOM 4920  O O     . GLN G 3 105 ? 68.865  90.904  94.267  1.00 32.95  ?  104 GLN G O     1 
ATOM 4921  C CB    . GLN G 3 105 ? 70.360  93.203  93.934  1.00 32.95  ?  104 GLN G CB    1 
ATOM 4922  C CG    . GLN G 3 105 ? 71.301  94.374  94.038  1.00 32.95  ?  104 GLN G CG    1 
ATOM 4923  C CD    . GLN G 3 105 ? 72.012  94.424  95.366  1.00 32.95  ?  104 GLN G CD    1 
ATOM 4924  O OE1   . GLN G 3 105 ? 71.427  94.124  96.404  1.00 32.95  ?  104 GLN G OE1   1 
ATOM 4925  N NE2   . GLN G 3 105 ? 73.279  94.814  95.345  1.00 32.95  ?  104 GLN G NE2   1 
ATOM 4926  N N     . GLY G 3 106 ? 70.468  89.516  93.544  1.00 35.99  ?  105 GLY G N     1 
ATOM 4927  C CA    . GLY G 3 106 ? 69.542  88.447  93.246  1.00 35.99  ?  105 GLY G CA    1 
ATOM 4928  C C     . GLY G 3 106 ? 68.961  87.730  94.440  1.00 35.99  ?  105 GLY G C     1 
ATOM 4929  O O     . GLY G 3 106 ? 67.750  87.768  94.664  1.00 35.99  ?  105 GLY G O     1 
ATOM 4930  N N     . GLY G 3 107 ? 69.808  87.074  95.215  1.00 40.08  ?  106 GLY G N     1 
ATOM 4931  C CA    . GLY G 3 107 ? 69.325  86.113  96.178  1.00 40.08  ?  106 GLY G CA    1 
ATOM 4932  C C     . GLY G 3 107 ? 68.995  84.810  95.486  1.00 40.08  ?  106 GLY G C     1 
ATOM 4933  O O     . GLY G 3 107 ? 69.203  84.632  94.287  1.00 40.08  ?  106 GLY G O     1 
ATOM 4934  N N     . VAL G 3 108 ? 68.478  83.867  96.266  1.00 47.19  ?  107 VAL G N     1 
ATOM 4935  C CA    . VAL G 3 108 ? 68.124  82.551  95.764  1.00 47.19  ?  107 VAL G CA    1 
ATOM 4936  C C     . VAL G 3 108 ? 66.690  82.237  96.165  1.00 47.19  ?  107 VAL G C     1 
ATOM 4937  O O     . VAL G 3 108 ? 65.996  83.051  96.770  1.00 47.19  ?  107 VAL G O     1 
ATOM 4938  C CB    . VAL G 3 108 ? 69.077  81.452  96.272  1.00 47.19  ?  107 VAL G CB    1 
ATOM 4939  C CG1   . VAL G 3 108 ? 70.488  81.680  95.760  1.00 47.19  ?  107 VAL G CG1   1 
ATOM 4940  C CG2   . VAL G 3 108 ? 69.058  81.406  97.781  1.00 47.19  ?  107 VAL G CG2   1 
ATOM 4941  N N     . LEU G 3 109 ? 66.256  81.047  95.809  1.00 50.49  ?  108 LEU G N     1 
ATOM 4942  C CA    . LEU G 3 109 ? 64.988  80.519  96.271  1.00 50.49  ?  108 LEU G CA    1 
ATOM 4943  C C     . LEU G 3 109 ? 65.114  80.046  97.716  1.00 50.49  ?  108 LEU G C     1 
ATOM 4944  O O     . LEU G 3 109 ? 66.202  79.674  98.159  1.00 50.49  ?  108 LEU G O     1 
ATOM 4945  C CB    . LEU G 3 109 ? 64.552  79.356  95.393  1.00 50.49  ?  108 LEU G CB    1 
ATOM 4946  C CG    . LEU G 3 109 ? 64.174  79.703  93.963  1.00 50.49  ?  108 LEU G CG    1 
ATOM 4947  C CD1   . LEU G 3 109 ? 63.870  78.432  93.192  1.00 50.49  ?  108 LEU G CD1   1 
ATOM 4948  C CD2   . LEU G 3 109 ? 62.983  80.637  93.972  1.00 50.49  ?  108 LEU G CD2   1 
ATOM 4949  N N     . PRO G 3 110 ? 64.018  80.044  98.474  1.00 46.77  ?  109 PRO G N     1 
ATOM 4950  C CA    . PRO G 3 110 ? 64.082  79.486  99.830  1.00 46.77  ?  109 PRO G CA    1 
ATOM 4951  C C     . PRO G 3 110 ? 64.166  77.970  99.817  1.00 46.77  ?  109 PRO G C     1 
ATOM 4952  O O     . PRO G 3 110 ? 63.155  77.273  99.942  1.00 46.77  ?  109 PRO G O     1 
ATOM 4953  C CB    . PRO G 3 110 ? 62.785  79.986  100.477 1.00 46.77  ?  109 PRO G CB    1 
ATOM 4954  C CG    . PRO G 3 110 ? 61.874  80.256  99.346  1.00 46.77  ?  109 PRO G CG    1 
ATOM 4955  C CD    . PRO G 3 110 ? 62.738  80.729  98.224  1.00 46.77  ?  109 PRO G CD    1 
ATOM 4956  N N     . ASN G 3 111 ? 65.382  77.452  99.661  1.00 53.81  ?  110 ASN G N     1 
ATOM 4957  C CA    . ASN G 3 111 ? 65.625  76.021  99.544  1.00 53.81  ?  110 ASN G CA    1 
ATOM 4958  C C     . ASN G 3 111 ? 66.066  75.453  100.885 1.00 53.81  ?  110 ASN G C     1 
ATOM 4959  O O     . ASN G 3 111 ? 67.127  75.818  101.401 1.00 53.81  ?  110 ASN G O     1 
ATOM 4960  C CB    . ASN G 3 111 ? 66.683  75.742  98.481  1.00 53.81  ?  110 ASN G CB    1 
ATOM 4961  C CG    . ASN G 3 111 ? 66.235  76.159  97.105  1.00 53.81  ?  110 ASN G CG    1 
ATOM 4962  O OD1   . ASN G 3 111 ? 66.800  77.074  96.507  1.00 53.81  ?  110 ASN G OD1   1 
ATOM 4963  N ND2   . ASN G 3 111 ? 65.206  75.494  96.594  1.00 53.81  ?  110 ASN G ND2   1 
ATOM 4964  N N     . ILE G 3 112 ? 65.247  74.566  101.444 1.00 58.78  ?  111 ILE G N     1 
ATOM 4965  C CA    . ILE G 3 112 ? 65.569  73.813  102.649 1.00 58.78  ?  111 ILE G CA    1 
ATOM 4966  C C     . ILE G 3 112 ? 65.340  72.344  102.328 1.00 58.78  ?  111 ILE G C     1 
ATOM 4967  O O     . ILE G 3 112 ? 64.325  71.995  101.716 1.00 58.78  ?  111 ILE G O     1 
ATOM 4968  C CB    . ILE G 3 112 ? 64.698  74.241  103.847 1.00 58.78  ?  111 ILE G CB    1 
ATOM 4969  C CG1   . ILE G 3 112 ? 64.825  75.735  104.122 1.00 58.78  ?  111 ILE G CG1   1 
ATOM 4970  C CG2   . ILE G 3 112 ? 65.096  73.496  105.107 1.00 58.78  ?  111 ILE G CG2   1 
ATOM 4971  C CD1   . ILE G 3 112 ? 63.777  76.249  105.077 1.00 58.78  ?  111 ILE G CD1   1 
ATOM 4972  N N     . GLN G 3 113 ? 66.276  71.487  102.726 1.00 64.53  ?  112 GLN G N     1 
ATOM 4973  C CA    . GLN G 3 113 ? 66.078  70.053  102.579 1.00 64.53  ?  112 GLN G CA    1 
ATOM 4974  C C     . GLN G 3 113 ? 66.785  69.326  103.714 1.00 64.53  ?  112 GLN G C     1 
ATOM 4975  O O     . GLN G 3 113 ? 67.843  69.752  104.186 1.00 64.53  ?  112 GLN G O     1 
ATOM 4976  C CB    . GLN G 3 113 ? 66.562  69.558  101.211 1.00 64.53  ?  112 GLN G CB    1 
ATOM 4977  C CG    . GLN G 3 113 ? 68.020  69.838  100.917 1.00 64.53  ?  112 GLN G CG    1 
ATOM 4978  C CD    . GLN G 3 113 ? 68.436  69.350  99.549  1.00 64.53  ?  112 GLN G CD    1 
ATOM 4979  O OE1   . GLN G 3 113 ? 67.655  68.714  98.842  1.00 64.53  ?  112 GLN G OE1   1 
ATOM 4980  N NE2   . GLN G 3 113 ? 69.669  69.651  99.162  1.00 64.53  ?  112 GLN G NE2   1 
ATOM 4981  N N     . ALA G 3 114 ? 66.171  68.236  104.164 1.00 71.36  ?  113 ALA G N     1 
ATOM 4982  C CA    . ALA G 3 114 ? 66.689  67.409  105.241 1.00 71.36  ?  113 ALA G CA    1 
ATOM 4983  C C     . ALA G 3 114 ? 67.210  66.097  104.665 1.00 71.36  ?  113 ALA G C     1 
ATOM 4984  O O     . ALA G 3 114 ? 67.265  65.907  103.445 1.00 71.36  ?  113 ALA G O     1 
ATOM 4985  C CB    . ALA G 3 114 ? 65.609  67.178  106.300 1.00 71.36  ?  113 ALA G CB    1 
ATOM 4986  N N     . VAL G 3 115 ? 67.585  65.180  105.549 1.00 78.04  ?  114 VAL G N     1 
ATOM 4987  C CA    . VAL G 3 115 ? 68.125  63.891  105.131 1.00 78.04  ?  114 VAL G CA    1 
ATOM 4988  C C     . VAL G 3 115 ? 67.021  62.917  104.718 1.00 78.04  ?  114 VAL G C     1 
ATOM 4989  O O     . VAL G 3 115 ? 65.959  63.315  104.237 1.00 78.04  ?  114 VAL G O     1 
ATOM 4990  C CB    . VAL G 3 115 ? 68.988  63.270  106.243 1.00 78.04  ?  114 VAL G CB    1 
ATOM 4991  C CG1   . VAL G 3 115 ? 68.134  62.947  107.458 1.00 78.04  ?  114 VAL G CG1   1 
ATOM 4992  C CG2   . VAL G 3 115 ? 69.692  62.022  105.732 1.00 78.04  ?  114 VAL G CG2   1 
ATOM 4993  N N     . ARG H 4 34  ? 72.519  111.026 74.974  1.00 68.74  ?  33  ARG H N     1 
ATOM 4994  C CA    . ARG H 4 34  ? 73.353  110.673 73.834  1.00 68.74  ?  33  ARG H CA    1 
ATOM 4995  C C     . ARG H 4 34  ? 73.640  109.179 73.824  1.00 68.74  ?  33  ARG H C     1 
ATOM 4996  O O     . ARG H 4 34  ? 74.096  108.633 72.824  1.00 68.74  ?  33  ARG H O     1 
ATOM 4997  C CB    . ARG H 4 34  ? 74.661  111.467 73.859  1.00 68.74  ?  33  ARG H CB    1 
ATOM 4998  C CG    . ARG H 4 34  ? 75.594  111.097 75.001  1.00 68.74  ?  33  ARG H CG    1 
ATOM 4999  C CD    . ARG H 4 34  ? 76.807  112.012 75.041  1.00 68.74  ?  33  ARG H CD    1 
ATOM 5000  N NE    . ARG H 4 34  ? 76.449  113.373 75.431  1.00 68.74  ?  33  ARG H NE    1 
ATOM 5001  C CZ    . ARG H 4 34  ? 77.289  114.403 75.411  1.00 68.74  ?  33  ARG H CZ    1 
ATOM 5002  N NH1   . ARG H 4 34  ? 78.542  114.230 75.019  1.00 68.74  1  33  ARG H NH1   1 
ATOM 5003  N NH2   . ARG H 4 34  ? 76.877  115.606 75.785  1.00 68.74  ?  33  ARG H NH2   1 
ATOM 5004  N N     . LYS H 4 35  ? 73.366  108.521 74.947  1.00 64.56  ?  34  LYS H N     1 
ATOM 5005  C CA    . LYS H 4 35  ? 73.553  107.081 75.095  1.00 64.56  ?  34  LYS H CA    1 
ATOM 5006  C C     . LYS H 4 35  ? 72.193  106.472 75.399  1.00 64.56  ?  34  LYS H C     1 
ATOM 5007  O O     . LYS H 4 35  ? 71.712  106.555 76.533  1.00 64.56  ?  34  LYS H O     1 
ATOM 5008  C CB    . LYS H 4 35  ? 74.560  106.771 76.198  1.00 64.56  ?  34  LYS H CB    1 
ATOM 5009  C CG    . LYS H 4 35  ? 75.963  107.251 75.881  1.00 64.56  ?  34  LYS H CG    1 
ATOM 5010  C CD    . LYS H 4 35  ? 76.914  107.034 77.046  1.00 64.56  ?  34  LYS H CD    1 
ATOM 5011  C CE    . LYS H 4 35  ? 77.254  105.562 77.217  1.00 64.56  ?  34  LYS H CE    1 
ATOM 5012  N NZ    . LYS H 4 35  ? 78.303  105.349 78.254  1.00 64.56  1  34  LYS H NZ    1 
ATOM 5013  N N     . GLU H 4 36  ? 71.581  105.856 74.394  1.00 61.88  ?  35  GLU H N     1 
ATOM 5014  C CA    . GLU H 4 36  ? 70.186  105.468 74.498  1.00 61.88  ?  35  GLU H CA    1 
ATOM 5015  C C     . GLU H 4 36  ? 70.025  104.187 75.308  1.00 61.88  ?  35  GLU H C     1 
ATOM 5016  O O     . GLU H 4 36  ? 70.988  103.487 75.628  1.00 61.88  ?  35  GLU H O     1 
ATOM 5017  C CB    . GLU H 4 36  ? 69.577  105.276 73.116  1.00 61.88  ?  35  GLU H CB    1 
ATOM 5018  C CG    . GLU H 4 36  ? 70.108  104.068 72.385  1.00 61.88  ?  35  GLU H CG    1 
ATOM 5019  C CD    . GLU H 4 36  ? 69.517  103.933 71.001  1.00 61.88  ?  35  GLU H CD    1 
ATOM 5020  O OE1   . GLU H 4 36  ? 68.719  104.809 70.610  1.00 61.88  ?  35  GLU H OE1   1 
ATOM 5021  O OE2   . GLU H 4 36  ? 69.845  102.951 70.305  1.00 61.88  -1 35  GLU H OE2   1 
ATOM 5022  N N     . SER H 4 37  ? 68.773  103.884 75.628  1.00 55.65  ?  36  SER H N     1 
ATOM 5023  C CA    . SER H 4 37  ? 68.405  102.711 76.406  1.00 55.65  ?  36  SER H CA    1 
ATOM 5024  C C     . SER H 4 37  ? 66.956  102.370 76.083  1.00 55.65  ?  36  SER H C     1 
ATOM 5025  O O     . SER H 4 37  ? 66.346  102.965 75.191  1.00 55.65  ?  36  SER H O     1 
ATOM 5026  C CB    . SER H 4 37  ? 68.611  102.956 77.902  1.00 55.65  ?  36  SER H CB    1 
ATOM 5027  O OG    . SER H 4 37  ? 68.171  101.843 78.654  1.00 55.65  ?  36  SER H OG    1 
ATOM 5028  N N     . TYR H 4 38  ? 66.402  101.416 76.819  1.00 43.92  ?  37  TYR H N     1 
ATOM 5029  C CA    . TYR H 4 38  ? 65.057  100.906 76.597  1.00 43.92  ?  37  TYR H CA    1 
ATOM 5030  C C     . TYR H 4 38  ? 64.191  101.069 77.835  1.00 43.92  ?  37  TYR H C     1 
ATOM 5031  O O     . TYR H 4 38  ? 63.335  100.237 78.121  1.00 43.92  ?  37  TYR H O     1 
ATOM 5032  C CB    . TYR H 4 38  ? 65.102  99.438  76.190  1.00 43.92  ?  37  TYR H CB    1 
ATOM 5033  C CG    . TYR H 4 38  ? 65.619  99.180  74.801  1.00 43.92  ?  37  TYR H CG    1 
ATOM 5034  C CD1   . TYR H 4 38  ? 65.583  100.158 73.832  1.00 43.92  ?  37  TYR H CD1   1 
ATOM 5035  C CD2   . TYR H 4 38  ? 66.173  97.958  74.472  1.00 43.92  ?  37  TYR H CD2   1 
ATOM 5036  C CE1   . TYR H 4 38  ? 66.060  99.911  72.569  1.00 43.92  ?  37  TYR H CE1   1 
ATOM 5037  C CE2   . TYR H 4 38  ? 66.651  97.703  73.216  1.00 43.92  ?  37  TYR H CE2   1 
ATOM 5038  C CZ    . TYR H 4 38  ? 66.596  98.683  72.269  1.00 43.92  ?  37  TYR H CZ    1 
ATOM 5039  O OH    . TYR H 4 38  ? 67.079  98.430  71.012  1.00 43.92  ?  37  TYR H OH    1 
ATOM 5040  N N     . SER H 4 39  ? 64.397  102.143 78.593  1.00 45.81  ?  38  SER H N     1 
ATOM 5041  C CA    . SER H 4 39  ? 63.673  102.281 79.851  1.00 45.81  ?  38  SER H CA    1 
ATOM 5042  C C     . SER H 4 39  ? 62.245  102.761 79.632  1.00 45.81  ?  38  SER H C     1 
ATOM 5043  O O     . SER H 4 39  ? 61.316  102.268 80.288  1.00 45.81  ?  38  SER H O     1 
ATOM 5044  C CB    . SER H 4 39  ? 64.407  103.243 80.777  1.00 45.81  ?  38  SER H CB    1 
ATOM 5045  O OG    . SER H 4 39  ? 64.355  104.560 80.263  1.00 45.81  ?  38  SER H OG    1 
ATOM 5046  N N     . VAL H 4 40  ? 62.065  103.714 78.714  1.00 48.61  ?  39  VAL H N     1 
ATOM 5047  C CA    . VAL H 4 40  ? 60.770  104.356 78.506  1.00 48.61  ?  39  VAL H CA    1 
ATOM 5048  C C     . VAL H 4 40  ? 59.754  103.355 77.977  1.00 48.61  ?  39  VAL H C     1 
ATOM 5049  O O     . VAL H 4 40  ? 58.588  103.345 78.391  1.00 48.61  ?  39  VAL H O     1 
ATOM 5050  C CB    . VAL H 4 40  ? 60.935  105.555 77.555  1.00 48.61  ?  39  VAL H CB    1 
ATOM 5051  C CG1   . VAL H 4 40  ? 59.605  106.236 77.286  1.00 48.61  ?  39  VAL H CG1   1 
ATOM 5052  C CG2   . VAL H 4 40  ? 61.933  106.536 78.125  1.00 48.61  ?  39  VAL H CG2   1 
ATOM 5053  N N     . TYR H 4 41  ? 60.200  102.453 77.110  1.00 50.99  ?  40  TYR H N     1 
ATOM 5054  C CA    . TYR H 4 41  ? 59.276  101.520 76.484  1.00 50.99  ?  40  TYR H CA    1 
ATOM 5055  C C     . TYR H 4 41  ? 58.836  100.432 77.457  1.00 50.99  ?  40  TYR H C     1 
ATOM 5056  O O     . TYR H 4 41  ? 57.662  100.037 77.467  1.00 50.99  ?  40  TYR H O     1 
ATOM 5057  C CB    . TYR H 4 41  ? 59.934  100.927 75.252  1.00 50.99  ?  40  TYR H CB    1 
ATOM 5058  C CG    . TYR H 4 41  ? 60.289  101.960 74.221  1.00 50.99  ?  40  TYR H CG    1 
ATOM 5059  C CD1   . TYR H 4 41  ? 59.312  102.525 73.422  1.00 50.99  ?  40  TYR H CD1   1 
ATOM 5060  C CD2   . TYR H 4 41  ? 61.601  102.365 74.039  1.00 50.99  ?  40  TYR H CD2   1 
ATOM 5061  C CE1   . TYR H 4 41  ? 59.627  103.470 72.473  1.00 50.99  ?  40  TYR H CE1   1 
ATOM 5062  C CE2   . TYR H 4 41  ? 61.929  103.306 73.090  1.00 50.99  ?  40  TYR H CE2   1 
ATOM 5063  C CZ    . TYR H 4 41  ? 60.936  103.855 72.310  1.00 50.99  ?  40  TYR H CZ    1 
ATOM 5064  O OH    . TYR H 4 41  ? 61.244  104.798 71.359  1.00 50.99  ?  40  TYR H OH    1 
ATOM 5065  N N     . VAL H 4 42  ? 59.761  99.950  78.290  1.00 48.08  ?  41  VAL H N     1 
ATOM 5066  C CA    . VAL H 4 42  ? 59.412  99.000  79.343  1.00 48.08  ?  41  VAL H CA    1 
ATOM 5067  C C     . VAL H 4 42  ? 58.472  99.649  80.348  1.00 48.08  ?  41  VAL H C     1 
ATOM 5068  O O     . VAL H 4 42  ? 57.522  99.017  80.832  1.00 48.08  ?  41  VAL H O     1 
ATOM 5069  C CB    . VAL H 4 42  ? 60.693  98.464  80.007  1.00 48.08  ?  41  VAL H CB    1 
ATOM 5070  C CG1   . VAL H 4 42  ? 60.381  97.606  81.212  1.00 48.08  ?  41  VAL H CG1   1 
ATOM 5071  C CG2   . VAL H 4 42  ? 61.475  97.656  79.007  1.00 48.08  ?  41  VAL H CG2   1 
ATOM 5072  N N     . TYR H 4 43  ? 58.681  100.938 80.624  1.00 54.67  ?  42  TYR H N     1 
ATOM 5073  C CA    . TYR H 4 43  ? 57.779  101.657 81.517  1.00 54.67  ?  42  TYR H CA    1 
ATOM 5074  C C     . TYR H 4 43  ? 56.382  101.791 80.917  1.00 54.67  ?  42  TYR H C     1 
ATOM 5075  O O     . TYR H 4 43  ? 55.381  101.671 81.634  1.00 54.67  ?  42  TYR H O     1 
ATOM 5076  C CB    . TYR H 4 43  ? 58.359  103.028 81.839  1.00 54.67  ?  42  TYR H CB    1 
ATOM 5077  C CG    . TYR H 4 43  ? 57.560  103.791 82.854  1.00 54.67  ?  42  TYR H CG    1 
ATOM 5078  C CD1   . TYR H 4 43  ? 57.644  103.481 84.201  1.00 54.67  ?  42  TYR H CD1   1 
ATOM 5079  C CD2   . TYR H 4 43  ? 56.712  104.818 82.465  1.00 54.67  ?  42  TYR H CD2   1 
ATOM 5080  C CE1   . TYR H 4 43  ? 56.911  104.175 85.137  1.00 54.67  ?  42  TYR H CE1   1 
ATOM 5081  C CE2   . TYR H 4 43  ? 55.974  105.518 83.389  1.00 54.67  ?  42  TYR H CE2   1 
ATOM 5082  C CZ    . TYR H 4 43  ? 56.076  105.189 84.725  1.00 54.67  ?  42  TYR H CZ    1 
ATOM 5083  O OH    . TYR H 4 43  ? 55.340  105.890 85.647  1.00 54.67  ?  42  TYR H OH    1 
ATOM 5084  N N     . LYS H 4 44  ? 56.297  102.000 79.600  1.00 47.16  ?  43  LYS H N     1 
ATOM 5085  C CA    . LYS H 4 44  ? 54.991  102.090 78.949  1.00 47.16  ?  43  LYS H CA    1 
ATOM 5086  C C     . LYS H 4 44  ? 54.270  100.749 78.943  1.00 47.16  ?  43  LYS H C     1 
ATOM 5087  O O     . LYS H 4 44  ? 53.053  100.697 79.154  1.00 47.16  ?  43  LYS H O     1 
ATOM 5088  C CB    . LYS H 4 44  ? 55.136  102.611 77.522  1.00 47.16  ?  43  LYS H CB    1 
ATOM 5089  C CG    . LYS H 4 44  ? 55.499  104.074 77.432  1.00 47.16  ?  43  LYS H CG    1 
ATOM 5090  C CD    . LYS H 4 44  ? 55.604  104.517 75.989  1.00 47.16  ?  43  LYS H CD    1 
ATOM 5091  C CE    . LYS H 4 44  ? 56.011  105.973 75.897  1.00 47.16  ?  43  LYS H CE    1 
ATOM 5092  N NZ    . LYS H 4 44  ? 56.152  106.412 74.484  1.00 47.16  1  43  LYS H NZ    1 
ATOM 5093  N N     . VAL H 4 45  ? 55.001  99.654  78.719  1.00 47.50  ?  44  VAL H N     1 
ATOM 5094  C CA    . VAL H 4 45  ? 54.380  98.331  78.746  1.00 47.50  ?  44  VAL H CA    1 
ATOM 5095  C C     . VAL H 4 45  ? 53.913  97.984  80.156  1.00 47.50  ?  44  VAL H C     1 
ATOM 5096  O O     . VAL H 4 45  ? 52.828  97.413  80.346  1.00 47.50  ?  44  VAL H O     1 
ATOM 5097  C CB    . VAL H 4 45  ? 55.355  97.282  78.182  1.00 47.50  ?  44  VAL H CB    1 
ATOM 5098  C CG1   . VAL H 4 45  ? 54.815  95.876  78.346  1.00 47.50  ?  44  VAL H CG1   1 
ATOM 5099  C CG2   . VAL H 4 45  ? 55.601  97.555  76.721  1.00 47.50  ?  44  VAL H CG2   1 
ATOM 5100  N N     . LEU H 4 46  ? 54.691  98.378  81.166  1.00 53.75  ?  45  LEU H N     1 
ATOM 5101  C CA    . LEU H 4 46  ? 54.308  98.111  82.547  1.00 53.75  ?  45  LEU H CA    1 
ATOM 5102  C C     . LEU H 4 46  ? 53.089  98.925  82.960  1.00 53.75  ?  45  LEU H C     1 
ATOM 5103  O O     . LEU H 4 46  ? 52.202  98.412  83.650  1.00 53.75  ?  45  LEU H O     1 
ATOM 5104  C CB    . LEU H 4 46  ? 55.483  98.395  83.474  1.00 53.75  ?  45  LEU H CB    1 
ATOM 5105  C CG    . LEU H 4 46  ? 55.232  98.112  84.950  1.00 53.75  ?  45  LEU H CG    1 
ATOM 5106  C CD1   . LEU H 4 46  ? 54.877  96.657  85.146  1.00 53.75  ?  45  LEU H CD1   1 
ATOM 5107  C CD2   . LEU H 4 46  ? 56.456  98.469  85.753  1.00 53.75  ?  45  LEU H CD2   1 
ATOM 5108  N N     . LYS H 4 47  ? 53.008  100.187 82.530  1.00 58.01  ?  46  LYS H N     1 
ATOM 5109  C CA    . LYS H 4 47  ? 51.798  100.956 82.801  1.00 58.01  ?  46  LYS H CA    1 
ATOM 5110  C C     . LYS H 4 47  ? 50.622  100.514 81.944  1.00 58.01  ?  46  LYS H C     1 
ATOM 5111  O O     . LYS H 4 47  ? 49.478  100.841 82.273  1.00 58.01  ?  46  LYS H O     1 
ATOM 5112  C CB    . LYS H 4 47  ? 52.052  102.449 82.611  1.00 58.01  ?  46  LYS H CB    1 
ATOM 5113  C CG    . LYS H 4 47  ? 52.952  103.033 83.676  1.00 58.01  ?  46  LYS H CG    1 
ATOM 5114  C CD    . LYS H 4 47  ? 52.236  103.008 85.016  1.00 58.01  ?  46  LYS H CD    1 
ATOM 5115  C CE    . LYS H 4 47  ? 53.107  103.550 86.133  1.00 58.01  ?  46  LYS H CE    1 
ATOM 5116  N NZ    . LYS H 4 47  ? 53.363  105.005 85.970  1.00 58.01  1  46  LYS H NZ    1 
ATOM 5117  N N     . GLN H 4 48  ? 50.870  99.791  80.853  1.00 55.24  ?  47  GLN H N     1 
ATOM 5118  C CA    . GLN H 4 48  ? 49.767  99.208  80.100  1.00 55.24  ?  47  GLN H CA    1 
ATOM 5119  C C     . GLN H 4 48  ? 49.176  98.002  80.820  1.00 55.24  ?  47  GLN H C     1 
ATOM 5120  O O     . GLN H 4 48  ? 47.973  97.967  81.095  1.00 55.24  ?  47  GLN H O     1 
ATOM 5121  C CB    . GLN H 4 48  ? 50.230  98.816  78.699  1.00 55.24  ?  47  GLN H CB    1 
ATOM 5122  C CG    . GLN H 4 48  ? 49.132  98.222  77.841  1.00 55.24  ?  47  GLN H CG    1 
ATOM 5123  C CD    . GLN H 4 48  ? 49.602  97.893  76.439  1.00 55.24  ?  47  GLN H CD    1 
ATOM 5124  O OE1   . GLN H 4 48  ? 50.764  98.103  76.097  1.00 55.24  ?  47  GLN H OE1   1 
ATOM 5125  N NE2   . GLN H 4 48  ? 48.703  97.364  75.622  1.00 55.24  ?  47  GLN H NE2   1 
ATOM 5126  N N     . VAL H 4 49  ? 50.003  96.999  81.138  1.00 63.95  ?  48  VAL H N     1 
ATOM 5127  C CA    . VAL H 4 49  ? 49.476  95.756  81.698  1.00 63.95  ?  48  VAL H CA    1 
ATOM 5128  C C     . VAL H 4 49  ? 49.331  95.794  83.211  1.00 63.95  ?  48  VAL H C     1 
ATOM 5129  O O     . VAL H 4 49  ? 48.958  94.777  83.811  1.00 63.95  ?  48  VAL H O     1 
ATOM 5130  C CB    . VAL H 4 49  ? 50.346  94.542  81.319  1.00 63.95  ?  48  VAL H CB    1 
ATOM 5131  C CG1   . VAL H 4 49  ? 50.409  94.391  79.814  1.00 63.95  ?  48  VAL H CG1   1 
ATOM 5132  C CG2   . VAL H 4 49  ? 51.729  94.676  81.916  1.00 63.95  ?  48  VAL H CG2   1 
ATOM 5133  N N     . HIS H 4 50  ? 49.619  96.928  83.851  1.00 67.74  ?  49  HIS H N     1 
ATOM 5134  C CA    . HIS H 4 50  ? 49.425  97.110  85.282  1.00 67.74  ?  49  HIS H CA    1 
ATOM 5135  C C     . HIS H 4 50  ? 49.085  98.565  85.552  1.00 67.74  ?  49  HIS H C     1 
ATOM 5136  O O     . HIS H 4 50  ? 49.653  99.454  84.902  1.00 67.74  ?  49  HIS H O     1 
ATOM 5137  C CB    . HIS H 4 50  ? 50.652  96.694  86.095  1.00 67.74  ?  49  HIS H CB    1 
ATOM 5138  C CG    . HIS H 4 50  ? 50.765  95.219  86.294  1.00 67.74  ?  49  HIS H CG    1 
ATOM 5139  N ND1   . HIS H 4 50  ? 51.338  94.379  85.365  1.00 67.74  ?  49  HIS H ND1   1 
ATOM 5140  C CD2   . HIS H 4 50  ? 50.376  94.429  87.324  1.00 67.74  ?  49  HIS H CD2   1 
ATOM 5141  C CE1   . HIS H 4 50  ? 51.295  93.137  85.811  1.00 67.74  ?  49  HIS H CE1   1 
ATOM 5142  N NE2   . HIS H 4 50  ? 50.717  93.141  86.999  1.00 67.74  ?  49  HIS H NE2   1 
ATOM 5143  N N     . PRO H 4 51  ? 48.157  98.838  86.473  1.00 69.28  ?  50  PRO H N     1 
ATOM 5144  C CA    . PRO H 4 51  ? 47.672  100.212 86.658  1.00 69.28  ?  50  PRO H CA    1 
ATOM 5145  C C     . PRO H 4 51  ? 48.695  101.167 87.250  1.00 69.28  ?  50  PRO H C     1 
ATOM 5146  O O     . PRO H 4 51  ? 48.942  102.237 86.689  1.00 69.28  ?  50  PRO H O     1 
ATOM 5147  C CB    . PRO H 4 51  ? 46.486  100.032 87.614  1.00 69.28  ?  50  PRO H CB    1 
ATOM 5148  C CG    . PRO H 4 51  ? 46.091  98.601  87.476  1.00 69.28  ?  50  PRO H CG    1 
ATOM 5149  C CD    . PRO H 4 51  ? 47.368  97.871  87.252  1.00 69.28  ?  50  PRO H CD    1 
ATOM 5150  N N     . ASP H 4 52  ? 49.293  100.800 88.383  1.00 67.83  ?  51  ASP H N     1 
ATOM 5151  C CA    . ASP H 4 52  ? 50.163  101.742 89.076  1.00 67.83  ?  51  ASP H CA    1 
ATOM 5152  C C     . ASP H 4 52  ? 51.390  101.085 89.698  1.00 67.83  ?  51  ASP H C     1 
ATOM 5153  O O     . ASP H 4 52  ? 51.982  101.657 90.621  1.00 67.83  ?  51  ASP H O     1 
ATOM 5154  C CB    . ASP H 4 52  ? 49.373  102.500 90.148  1.00 67.83  ?  51  ASP H CB    1 
ATOM 5155  C CG    . ASP H 4 52  ? 48.675  101.574 91.133  1.00 67.83  ?  51  ASP H CG    1 
ATOM 5156  O OD1   . ASP H 4 52  ? 48.709  100.338 90.948  1.00 67.83  ?  51  ASP H OD1   1 
ATOM 5157  O OD2   . ASP H 4 52  ? 48.084  102.091 92.102  1.00 67.83  -1 51  ASP H OD2   1 
ATOM 5158  N N     . THR H 4 53  ? 51.785  99.907  89.228  1.00 64.68  ?  52  THR H N     1 
ATOM 5159  C CA    . THR H 4 53  ? 52.916  99.202  89.817  1.00 64.68  ?  52  THR H CA    1 
ATOM 5160  C C     . THR H 4 53  ? 54.212  99.875  89.389  1.00 64.68  ?  52  THR H C     1 
ATOM 5161  O O     . THR H 4 53  ? 54.612  99.789  88.224  1.00 64.68  ?  52  THR H O     1 
ATOM 5162  C CB    . THR H 4 53  ? 52.899  97.737  89.399  1.00 64.68  ?  52  THR H CB    1 
ATOM 5163  O OG1   . THR H 4 53  ? 51.678  97.131  89.840  1.00 64.68  ?  52  THR H OG1   1 
ATOM 5164  C CG2   . THR H 4 53  ? 54.071  97.003  90.016  1.00 64.68  ?  52  THR H CG2   1 
ATOM 5165  N N     . GLY H 4 54  ? 54.860  100.559 90.324  1.00 65.08  ?  53  GLY H N     1 
ATOM 5166  C CA    . GLY H 4 54  ? 56.110  101.214 90.021  1.00 65.08  ?  53  GLY H CA    1 
ATOM 5167  C C     . GLY H 4 54  ? 57.258  100.236 89.889  1.00 65.08  ?  53  GLY H C     1 
ATOM 5168  O O     . GLY H 4 54  ? 57.181  99.084  90.310  1.00 65.08  ?  53  GLY H O     1 
ATOM 5169  N N     . ILE H 4 55  ? 58.342  100.717 89.286  1.00 55.30  ?  54  ILE H N     1 
ATOM 5170  C CA    . ILE H 4 55  ? 59.540  99.919  89.060  1.00 55.30  ?  54  ILE H CA    1 
ATOM 5171  C C     . ILE H 4 55  ? 60.755  100.757 89.433  1.00 55.30  ?  54  ILE H C     1 
ATOM 5172  O O     . ILE H 4 55  ? 60.825  101.948 89.115  1.00 55.30  ?  54  ILE H O     1 
ATOM 5173  C CB    . ILE H 4 55  ? 59.598  99.403  87.603  1.00 55.30  ?  54  ILE H CB    1 
ATOM 5174  C CG1   . ILE H 4 55  ? 60.822  98.524  87.373  1.00 55.30  ?  54  ILE H CG1   1 
ATOM 5175  C CG2   . ILE H 4 55  ? 59.487  100.530 86.584  1.00 55.30  ?  54  ILE H CG2   1 
ATOM 5176  C CD1   . ILE H 4 55  ? 60.785  97.782  86.066  1.00 55.30  ?  54  ILE H CD1   1 
ATOM 5177  N N     . SER H 4 56  ? 61.686  100.152 90.163  1.00 56.91  ?  55  SER H N     1 
ATOM 5178  C CA    . SER H 4 56  ? 62.831  100.903 90.648  1.00 56.91  ?  55  SER H CA    1 
ATOM 5179  C C     . SER H 4 56  ? 63.808  101.173 89.511  1.00 56.91  ?  55  SER H C     1 
ATOM 5180  O O     . SER H 4 56  ? 63.735  100.578 88.435  1.00 56.91  ?  55  SER H O     1 
ATOM 5181  C CB    . SER H 4 56  ? 63.532  100.151 91.773  1.00 56.91  ?  55  SER H CB    1 
ATOM 5182  O OG    . SER H 4 56  ? 64.125  98.968  91.283  1.00 56.91  ?  55  SER H OG    1 
ATOM 5183  N N     . SER H 4 57  ? 64.737  102.092 89.760  1.00 58.87  ?  56  SER H N     1 
ATOM 5184  C CA    . SER H 4 57  ? 65.712  102.456 88.743  1.00 58.87  ?  56  SER H CA    1 
ATOM 5185  C C     . SER H 4 57  ? 66.831  101.439 88.600  1.00 58.87  ?  56  SER H C     1 
ATOM 5186  O O     . SER H 4 57  ? 67.651  101.575 87.688  1.00 58.87  ?  56  SER H O     1 
ATOM 5187  C CB    . SER H 4 57  ? 66.318  103.824 89.051  1.00 58.87  ?  56  SER H CB    1 
ATOM 5188  O OG    . SER H 4 57  ? 67.088  103.779 90.238  1.00 58.87  ?  56  SER H OG    1 
ATOM 5189  N N     . LYS H 4 58  ? 66.900  100.439 89.473  1.00 46.01  ?  57  LYS H N     1 
ATOM 5190  C CA    . LYS H 4 58  ? 67.906  99.404  89.304  1.00 46.01  ?  57  LYS H CA    1 
ATOM 5191  C C     . LYS H 4 58  ? 67.359  98.223  88.518  1.00 46.01  ?  57  LYS H C     1 
ATOM 5192  O O     . LYS H 4 58  ? 68.021  97.731  87.600  1.00 46.01  ?  57  LYS H O     1 
ATOM 5193  C CB    . LYS H 4 58  ? 68.426  98.943  90.662  1.00 46.01  ?  57  LYS H CB    1 
ATOM 5194  C CG    . LYS H 4 58  ? 69.602  97.999  90.565  1.00 46.01  ?  57  LYS H CG    1 
ATOM 5195  C CD    . LYS H 4 58  ? 70.102  97.618  91.942  1.00 46.01  ?  57  LYS H CD    1 
ATOM 5196  C CE    . LYS H 4 58  ? 71.245  98.520  92.374  1.00 46.01  ?  57  LYS H CE    1 
ATOM 5197  N NZ    . LYS H 4 58  ? 70.759  99.859  92.807  1.00 46.01  1  57  LYS H NZ    1 
ATOM 5198  N N     . ALA H 4 59  ? 66.144  97.781  88.855  1.00 43.56  ?  58  ALA H N     1 
ATOM 5199  C CA    . ALA H 4 59  ? 65.545  96.632  88.186  1.00 43.56  ?  58  ALA H CA    1 
ATOM 5200  C C     . ALA H 4 59  ? 65.247  96.922  86.727  1.00 43.56  ?  58  ALA H C     1 
ATOM 5201  O O     . ALA H 4 59  ? 65.345  96.016  85.891  1.00 43.56  ?  58  ALA H O     1 
ATOM 5202  C CB    . ALA H 4 59  ? 64.268  96.210  88.903  1.00 43.56  ?  58  ALA H CB    1 
ATOM 5203  N N     . MET H 4 60  ? 64.904  98.176  86.413  1.00 40.77  ?  59  MET H N     1 
ATOM 5204  C CA    . MET H 4 60  ? 64.786  98.623  85.029  1.00 40.77  ?  59  MET H CA    1 
ATOM 5205  C C     . MET H 4 60  ? 66.070  98.381  84.251  1.00 40.77  ?  59  MET H C     1 
ATOM 5206  O O     . MET H 4 60  ? 66.024  97.972  83.083  1.00 40.77  ?  59  MET H O     1 
ATOM 5207  C CB    . MET H 4 60  ? 64.421  100.104 84.995  1.00 40.77  ?  59  MET H CB    1 
ATOM 5208  C CG    . MET H 4 60  ? 64.298  100.687 83.609  1.00 40.77  ?  59  MET H CG    1 
ATOM 5209  S SD    . MET H 4 60  ? 63.014  99.882  82.646  1.00 40.77  ?  59  MET H SD    1 
ATOM 5210  C CE    . MET H 4 60  ? 61.555  100.526 83.451  1.00 40.77  ?  59  MET H CE    1 
ATOM 5211  N N     . GLY H 4 61  ? 67.220  98.579  84.909  1.00 38.72  ?  60  GLY H N     1 
ATOM 5212  C CA    . GLY H 4 61  ? 68.497  98.263  84.288  1.00 38.72  ?  60  GLY H CA    1 
ATOM 5213  C C     . GLY H 4 61  ? 68.613  96.806  83.890  1.00 38.72  ?  60  GLY H C     1 
ATOM 5214  O O     . GLY H 4 61  ? 69.118  96.496  82.804  1.00 38.72  ?  60  GLY H O     1 
ATOM 5215  N N     . ILE H 4 62  ? 68.079  95.904  84.730  1.00 34.26  ?  61  ILE H N     1 
ATOM 5216  C CA    . ILE H 4 62  ? 68.008  94.482  84.401  1.00 34.26  ?  61  ILE H CA    1 
ATOM 5217  C C     . ILE H 4 62  ? 67.246  94.272  83.108  1.00 34.26  ?  61  ILE H C     1 
ATOM 5218  O O     . ILE H 4 62  ? 67.713  93.557  82.210  1.00 34.26  ?  61  ILE H O     1 
ATOM 5219  C CB    . ILE H 4 62  ? 67.371  93.691  85.556  1.00 34.26  ?  61  ILE H CB    1 
ATOM 5220  C CG1   . ILE H 4 62  ? 68.312  93.648  86.747  1.00 34.26  ?  61  ILE H CG1   1 
ATOM 5221  C CG2   . ILE H 4 62  ? 66.999  92.289  85.130  1.00 34.26  ?  61  ILE H CG2   1 
ATOM 5222  C CD1   . ILE H 4 62  ? 67.694  93.024  87.949  1.00 34.26  ?  61  ILE H CD1   1 
ATOM 5223  N N     . MET H 4 63  ? 66.127  94.988  82.951  1.00 34.68  ?  62  MET H N     1 
ATOM 5224  C CA    . MET H 4 63  ? 65.329  94.861  81.742  1.00 34.68  ?  62  MET H CA    1 
ATOM 5225  C C     . MET H 4 63  ? 66.096  95.317  80.517  1.00 34.68  ?  62  MET H C     1 
ATOM 5226  O O     . MET H 4 63  ? 65.970  94.685  79.460  1.00 34.68  ?  62  MET H O     1 
ATOM 5227  C CB    . MET H 4 63  ? 64.031  95.641  81.880  1.00 34.68  ?  62  MET H CB    1 
ATOM 5228  C CG    . MET H 4 63  ? 63.131  95.072  82.936  1.00 34.68  ?  62  MET H CG    1 
ATOM 5229  S SD    . MET H 4 63  ? 62.806  93.349  82.579  1.00 34.68  ?  62  MET H SD    1 
ATOM 5230  C CE    . MET H 4 63  ? 61.874  93.525  81.068  1.00 34.68  ?  62  MET H CE    1 
ATOM 5231  N N     . ASN H 4 64  ? 66.965  96.328  80.670  1.00 35.09  ?  63  ASN H N     1 
ATOM 5232  C CA    . ASN H 4 64  ? 67.845  96.718  79.574  1.00 35.09  ?  63  ASN H CA    1 
ATOM 5233  C C     . ASN H 4 64  ? 68.744  95.562  79.181  1.00 35.09  ?  63  ASN H C     1 
ATOM 5234  O O     . ASN H 4 64  ? 68.703  95.089  78.037  1.00 35.09  ?  63  ASN H O     1 
ATOM 5235  C CB    . ASN H 4 64  ? 68.678  97.930  79.966  1.00 35.09  ?  63  ASN H CB    1 
ATOM 5236  C CG    . ASN H 4 64  ? 67.839  99.145  80.209  1.00 35.09  ?  63  ASN H CG    1 
ATOM 5237  O OD1   . ASN H 4 64  ? 67.785  99.665  81.320  1.00 35.09  ?  63  ASN H OD1   1 
ATOM 5238  N ND2   . ASN H 4 64  ? 67.164  99.607  79.169  1.00 35.09  ?  63  ASN H ND2   1 
ATOM 5239  N N     . SER H 4 65  ? 69.430  94.980  80.164  1.00 33.67  ?  64  SER H N     1 
ATOM 5240  C CA    . SER H 4 65  ? 70.290  93.855  79.854  1.00 33.67  ?  64  SER H CA    1 
ATOM 5241  C C     . SER H 4 65  ? 69.506  92.584  79.595  1.00 33.67  ?  64  SER H C     1 
ATOM 5242  O O     . SER H 4 65  ? 70.112  91.574  79.233  1.00 33.67  ?  64  SER H O     1 
ATOM 5243  C CB    . SER H 4 65  ? 71.295  93.630  80.976  1.00 33.67  ?  64  SER H CB    1 
ATOM 5244  O OG    . SER H 4 65  ? 72.181  94.730  81.082  1.00 33.67  ?  64  SER H OG    1 
ATOM 5245  N N     . PHE H 4 66  ? 68.183  92.602  79.749  1.00 31.99  ?  65  PHE H N     1 
ATOM 5246  C CA    . PHE H 4 66  ? 67.439  91.498  79.180  1.00 31.99  ?  65  PHE H CA    1 
ATOM 5247  C C     . PHE H 4 66  ? 67.257  91.710  77.690  1.00 31.99  ?  65  PHE H C     1 
ATOM 5248  O O     . PHE H 4 66  ? 67.606  90.844  76.884  1.00 31.99  ?  65  PHE H O     1 
ATOM 5249  C CB    . PHE H 4 66  ? 66.089  91.340  79.866  1.00 31.99  ?  65  PHE H CB    1 
ATOM 5250  C CG    . PHE H 4 66  ? 65.300  90.186  79.354  1.00 31.99  ?  65  PHE H CG    1 
ATOM 5251  C CD1   . PHE H 4 66  ? 65.640  88.899  79.710  1.00 31.99  ?  65  PHE H CD1   1 
ATOM 5252  C CD2   . PHE H 4 66  ? 64.231  90.384  78.504  1.00 31.99  ?  65  PHE H CD2   1 
ATOM 5253  C CE1   . PHE H 4 66  ? 64.924  87.828  79.233  1.00 31.99  ?  65  PHE H CE1   1 
ATOM 5254  C CE2   . PHE H 4 66  ? 63.511  89.318  78.024  1.00 31.99  ?  65  PHE H CE2   1 
ATOM 5255  C CZ    . PHE H 4 66  ? 63.860  88.038  78.387  1.00 31.99  ?  65  PHE H CZ    1 
ATOM 5256  N N     . VAL H 4 67  ? 66.760  92.881  77.299  1.00 29.73  ?  66  VAL H N     1 
ATOM 5257  C CA    . VAL H 4 67  ? 66.253  93.037  75.948  1.00 29.73  ?  66  VAL H CA    1 
ATOM 5258  C C     . VAL H 4 67  ? 67.269  93.720  75.040  1.00 29.73  ?  66  VAL H C     1 
ATOM 5259  O O     . VAL H 4 67  ? 66.975  94.010  73.875  1.00 29.73  ?  66  VAL H O     1 
ATOM 5260  C CB    . VAL H 4 67  ? 64.881  93.745  76.004  1.00 29.73  ?  66  VAL H CB    1 
ATOM 5261  C CG1   . VAL H 4 67  ? 65.021  95.198  76.312  1.00 29.73  ?  66  VAL H CG1   1 
ATOM 5262  C CG2   . VAL H 4 67  ? 63.992  93.453  74.787  1.00 29.73  ?  66  VAL H CG2   1 
ATOM 5263  N N     . ASN H 4 68  ? 68.481  93.948  75.534  1.00 33.67  ?  67  ASN H N     1 
ATOM 5264  C CA    . ASN H 4 68  ? 69.655  94.038  74.680  1.00 33.67  ?  67  ASN H CA    1 
ATOM 5265  C C     . ASN H 4 68  ? 70.356  92.702  74.555  1.00 33.67  ?  67  ASN H C     1 
ATOM 5266  O O     . ASN H 4 68  ? 71.479  92.649  74.048  1.00 33.67  ?  67  ASN H O     1 
ATOM 5267  C CB    . ASN H 4 68  ? 70.644  95.077  75.207  1.00 33.67  ?  67  ASN H CB    1 
ATOM 5268  C CG    . ASN H 4 68  ? 70.200  96.490  74.938  1.00 33.67  ?  67  ASN H CG    1 
ATOM 5269  O OD1   . ASN H 4 68  ? 69.681  96.791  73.866  1.00 33.67  ?  67  ASN H OD1   1 
ATOM 5270  N ND2   . ASN H 4 68  ? 70.417  97.373  75.903  1.00 33.67  ?  67  ASN H ND2   1 
ATOM 5271  N N     . ASP H 4 69  ? 69.730  91.629  75.027  1.00 32.58  ?  68  ASP H N     1 
ATOM 5272  C CA    . ASP H 4 69  ? 70.303  90.295  74.990  1.00 32.58  ?  68  ASP H CA    1 
ATOM 5273  C C     . ASP H 4 69  ? 69.524  89.346  74.098  1.00 32.58  ?  68  ASP H C     1 
ATOM 5274  O O     . ASP H 4 69  ? 70.124  88.647  73.278  1.00 32.58  ?  68  ASP H O     1 
ATOM 5275  C CB    . ASP H 4 69  ? 70.377  89.720  76.405  1.00 32.58  ?  68  ASP H CB    1 
ATOM 5276  C CG    . ASP H 4 69  ? 70.974  88.340  76.434  1.00 32.58  ?  68  ASP H CG    1 
ATOM 5277  O OD1   . ASP H 4 69  ? 72.201  88.218  76.256  1.00 32.58  ?  68  ASP H OD1   1 
ATOM 5278  O OD2   . ASP H 4 69  ? 70.213  87.373  76.634  1.00 32.58  -1 68  ASP H OD2   1 
ATOM 5279  N N     . ILE H 4 70  ? 68.199  89.299  74.258  1.00 28.24  ?  69  ILE H N     1 
ATOM 5280  C CA    . ILE H 4 70  ? 67.360  88.461  73.407  1.00 28.24  ?  69  ILE H CA    1 
ATOM 5281  C C     . ILE H 4 70  ? 67.445  88.924  71.962  1.00 28.24  ?  69  ILE H C     1 
ATOM 5282  O O     . ILE H 4 70  ? 67.572  88.108  71.040  1.00 28.24  ?  69  ILE H O     1 
ATOM 5283  C CB    . ILE H 4 70  ? 65.915  88.468  73.928  1.00 28.24  ?  69  ILE H CB    1 
ATOM 5284  C CG1   . ILE H 4 70  ? 65.881  87.902  75.341  1.00 28.24  ?  69  ILE H CG1   1 
ATOM 5285  C CG2   . ILE H 4 70  ? 65.016  87.663  73.036  1.00 28.24  ?  69  ILE H CG2   1 
ATOM 5286  C CD1   . ILE H 4 70  ? 66.371  86.483  75.430  1.00 28.24  ?  69  ILE H CD1   1 
ATOM 5287  N N     . PHE H 4 71  ? 67.448  90.241  71.751  1.00 28.24  ?  70  PHE H N     1 
ATOM 5288  C CA    . PHE H 4 71  ? 67.713  90.804  70.432  1.00 28.24  ?  70  PHE H CA    1 
ATOM 5289  C C     . PHE H 4 71  ? 69.096  90.435  69.915  1.00 28.24  ?  70  PHE H C     1 
ATOM 5290  O O     . PHE H 4 71  ? 69.289  90.321  68.702  1.00 28.24  ?  70  PHE H O     1 
ATOM 5291  C CB    . PHE H 4 71  ? 67.547  92.319  70.479  1.00 28.24  ?  70  PHE H CB    1 
ATOM 5292  C CG    . PHE H 4 71  ? 68.017  93.017  69.251  1.00 28.24  ?  70  PHE H CG    1 
ATOM 5293  C CD1   . PHE H 4 71  ? 67.324  92.905  68.068  1.00 28.24  ?  70  PHE H CD1   1 
ATOM 5294  C CD2   . PHE H 4 71  ? 69.166  93.788  69.285  1.00 28.24  ?  70  PHE H CD2   1 
ATOM 5295  C CE1   . PHE H 4 71  ? 67.768  93.547  66.932  1.00 28.24  ?  70  PHE H CE1   1 
ATOM 5296  C CE2   . PHE H 4 71  ? 69.616  94.437  68.160  1.00 28.24  ?  70  PHE H CE2   1 
ATOM 5297  C CZ    . PHE H 4 71  ? 68.913  94.316  66.978  1.00 28.24  ?  70  PHE H CZ    1 
ATOM 5298  N N     . GLU H 4 72  ? 70.060  90.212  70.807  1.00 34.45  ?  71  GLU H N     1 
ATOM 5299  C CA    . GLU H 4 72  ? 71.352  89.735  70.335  1.00 34.45  ?  71  GLU H CA    1 
ATOM 5300  C C     . GLU H 4 72  ? 71.279  88.274  69.919  1.00 34.45  ?  71  GLU H C     1 
ATOM 5301  O O     . GLU H 4 72  ? 72.003  87.860  69.009  1.00 34.45  ?  71  GLU H O     1 
ATOM 5302  C CB    . GLU H 4 72  ? 72.418  89.944  71.408  1.00 34.45  ?  71  GLU H CB    1 
ATOM 5303  C CG    . GLU H 4 72  ? 73.855  89.815  70.920  1.00 34.45  ?  71  GLU H CG    1 
ATOM 5304  C CD    . GLU H 4 72  ? 74.376  88.393  70.974  1.00 34.45  ?  71  GLU H CD    1 
ATOM 5305  O OE1   . GLU H 4 72  ? 73.912  87.623  71.839  1.00 34.45  ?  71  GLU H OE1   1 
ATOM 5306  O OE2   . GLU H 4 72  ? 75.240  88.040  70.143  1.00 34.45  -1 71  GLU H OE2   1 
ATOM 5307  N N     . ARG H 4 73  ? 70.417  87.481  70.556  1.00 30.93  ?  72  ARG H N     1 
ATOM 5308  C CA    . ARG H 4 73  ? 70.319  86.081  70.165  1.00 30.93  ?  72  ARG H CA    1 
ATOM 5309  C C     . ARG H 4 73  ? 69.584  85.933  68.845  1.00 30.93  ?  72  ARG H C     1 
ATOM 5310  O O     . ARG H 4 73  ? 70.178  85.510  67.849  1.00 30.93  ?  72  ARG H O     1 
ATOM 5311  C CB    . ARG H 4 73  ? 69.622  85.260  71.245  1.00 30.93  ?  72  ARG H CB    1 
ATOM 5312  C CG    . ARG H 4 73  ? 70.435  85.035  72.488  1.00 30.93  ?  72  ARG H CG    1 
ATOM 5313  C CD    . ARG H 4 73  ? 69.651  84.171  73.445  1.00 30.93  ?  72  ARG H CD    1 
ATOM 5314  N NE    . ARG H 4 73  ? 70.343  83.961  74.707  1.00 30.93  ?  72  ARG H NE    1 
ATOM 5315  C CZ    . ARG H 4 73  ? 69.822  83.298  75.730  1.00 30.93  ?  72  ARG H CZ    1 
ATOM 5316  N NH1   . ARG H 4 73  ? 68.606  82.785  75.629  1.00 30.93  1  72  ARG H NH1   1 
ATOM 5317  N NH2   . ARG H 4 73  ? 70.511  83.147  76.850  1.00 30.93  ?  72  ARG H NH2   1 
ATOM 5318  N N     . ILE H 4 74  ? 68.305  86.331  68.821  1.00 30.96  ?  73  ILE H N     1 
ATOM 5319  C CA    . ILE H 4 74  ? 67.410  86.044  67.698  1.00 30.96  ?  73  ILE H CA    1 
ATOM 5320  C C     . ILE H 4 74  ? 67.908  86.715  66.428  1.00 30.96  ?  73  ILE H C     1 
ATOM 5321  O O     . ILE H 4 74  ? 68.259  86.048  65.448  1.00 30.96  ?  73  ILE H O     1 
ATOM 5322  C CB    . ILE H 4 74  ? 65.977  86.487  68.026  1.00 30.96  ?  73  ILE H CB    1 
ATOM 5323  C CG1   . ILE H 4 74  ? 65.426  85.676  69.188  1.00 30.96  ?  73  ILE H CG1   1 
ATOM 5324  C CG2   . ILE H 4 74  ? 65.094  86.330  66.819  1.00 30.96  ?  73  ILE H CG2   1 
ATOM 5325  C CD1   . ILE H 4 74  ? 64.116  86.204  69.698  1.00 30.96  ?  73  ILE H CD1   1 
ATOM 5326  N N     . ALA H 4 75  ? 68.054  88.035  66.469  1.00 34.65  ?  74  ALA H N     1 
ATOM 5327  C CA    . ALA H 4 75  ? 68.608  88.752  65.331  1.00 34.65  ?  74  ALA H CA    1 
ATOM 5328  C C     . ALA H 4 75  ? 70.095  88.500  65.128  1.00 34.65  ?  74  ALA H C     1 
ATOM 5329  O O     . ALA H 4 75  ? 70.659  89.020  64.163  1.00 34.65  ?  74  ALA H O     1 
ATOM 5330  C CB    . ALA H 4 75  ? 68.362  90.247  65.487  1.00 34.65  ?  74  ALA H CB    1 
ATOM 5331  N N     . GLY H 4 76  ? 70.745  87.743  66.004  1.00 32.35  ?  75  GLY H N     1 
ATOM 5332  C CA    . GLY H 4 76  ? 72.031  87.186  65.662  1.00 32.35  ?  75  GLY H CA    1 
ATOM 5333  C C     . GLY H 4 76  ? 71.825  85.878  64.931  1.00 32.35  ?  75  GLY H C     1 
ATOM 5334  O O     . GLY H 4 76  ? 72.319  85.696  63.813  1.00 32.35  ?  75  GLY H O     1 
ATOM 5335  N N     . GLU H 4 77  ? 71.032  84.990  65.538  1.00 34.92  ?  76  GLU H N     1 
ATOM 5336  C CA    . GLU H 4 77  ? 70.965  83.606  65.081  1.00 34.92  ?  76  GLU H CA    1 
ATOM 5337  C C     . GLU H 4 77  ? 70.256  83.489  63.742  1.00 34.92  ?  76  GLU H C     1 
ATOM 5338  O O     . GLU H 4 77  ? 70.633  82.644  62.923  1.00 34.92  ?  76  GLU H O     1 
ATOM 5339  C CB    . GLU H 4 77  ? 70.275  82.750  66.140  1.00 34.92  ?  76  GLU H CB    1 
ATOM 5340  C CG    . GLU H 4 77  ? 70.407  81.256  65.972  1.00 34.92  ?  76  GLU H CG    1 
ATOM 5341  C CD    . GLU H 4 77  ? 69.331  80.678  65.094  1.00 34.92  ?  76  GLU H CD    1 
ATOM 5342  O OE1   . GLU H 4 77  ? 68.248  81.292  65.012  1.00 34.92  ?  76  GLU H OE1   1 
ATOM 5343  O OE2   . GLU H 4 77  ? 69.566  79.616  64.486  1.00 34.92  -1 76  GLU H OE2   1 
ATOM 5344  N N     . ALA H 4 78  ? 69.257  84.338  63.494  1.00 33.65  ?  77  ALA H N     1 
ATOM 5345  C CA    . ALA H 4 78  ? 68.604  84.356  62.191  1.00 33.65  ?  77  ALA H CA    1 
ATOM 5346  C C     . ALA H 4 78  ? 69.560  84.788  61.095  1.00 33.65  ?  77  ALA H C     1 
ATOM 5347  O O     . ALA H 4 78  ? 69.412  84.349  59.949  1.00 33.65  ?  77  ALA H O     1 
ATOM 5348  C CB    . ALA H 4 78  ? 67.393  85.277  62.212  1.00 33.65  ?  77  ALA H CB    1 
ATOM 5349  N N     . SER H 4 79  ? 70.555  85.616  61.438  1.00 34.50  ?  78  SER H N     1 
ATOM 5350  C CA    . SER H 4 79  ? 71.620  85.949  60.500  1.00 34.50  ?  78  SER H CA    1 
ATOM 5351  C C     . SER H 4 79  ? 72.365  84.709  60.040  1.00 34.50  ?  78  SER H C     1 
ATOM 5352  O O     . SER H 4 79  ? 72.746  84.613  58.867  1.00 34.50  ?  78  SER H O     1 
ATOM 5353  C CB    . SER H 4 79  ? 72.594  86.928  61.143  1.00 34.50  ?  78  SER H CB    1 
ATOM 5354  O OG    . SER H 4 79  ? 73.686  87.179  60.283  1.00 34.50  ?  78  SER H OG    1 
ATOM 5355  N N     . ARG H 4 80  ? 72.535  83.739  60.939  1.00 36.99  ?  79  ARG H N     1 
ATOM 5356  C CA    . ARG H 4 80  ? 73.143  82.470  60.573  1.00 36.99  ?  79  ARG H CA    1 
ATOM 5357  C C     . ARG H 4 80  ? 72.295  81.722  59.557  1.00 36.99  ?  79  ARG H C     1 
ATOM 5358  O O     . ARG H 4 80  ? 72.835  81.101  58.636  1.00 36.99  ?  79  ARG H O     1 
ATOM 5359  C CB    . ARG H 4 80  ? 73.345  81.639  61.831  1.00 36.99  ?  79  ARG H CB    1 
ATOM 5360  C CG    . ARG H 4 80  ? 74.128  80.378  61.653  1.00 36.99  ?  79  ARG H CG    1 
ATOM 5361  C CD    . ARG H 4 80  ? 74.318  79.739  63.008  1.00 36.99  ?  79  ARG H CD    1 
ATOM 5362  N NE    . ARG H 4 80  ? 75.104  80.608  63.875  1.00 36.99  ?  79  ARG H NE    1 
ATOM 5363  C CZ    . ARG H 4 80  ? 75.246  80.428  65.182  1.00 36.99  ?  79  ARG H CZ    1 
ATOM 5364  N NH1   . ARG H 4 80  ? 74.648  79.408  65.779  1.00 36.99  1  79  ARG H NH1   1 
ATOM 5365  N NH2   . ARG H 4 80  ? 75.979  81.272  65.891  1.00 36.99  ?  79  ARG H NH2   1 
ATOM 5366  N N     . LEU H 4 81  ? 70.971  81.830  59.655  1.00 33.97  ?  80  LEU H N     1 
ATOM 5367  C CA    . LEU H 4 81  ? 70.128  81.201  58.651  1.00 33.97  ?  80  LEU H CA    1 
ATOM 5368  C C     . LEU H 4 81  ? 70.087  81.979  57.348  1.00 33.97  ?  80  LEU H C     1 
ATOM 5369  O O     . LEU H 4 81  ? 69.494  81.496  56.380  1.00 33.97  ?  80  LEU H O     1 
ATOM 5370  C CB    . LEU H 4 81  ? 68.703  81.009  59.161  1.00 33.97  ?  80  LEU H CB    1 
ATOM 5371  C CG    . LEU H 4 81  ? 68.385  79.763  59.984  1.00 33.97  ?  80  LEU H CG    1 
ATOM 5372  C CD1   . LEU H 4 81  ? 68.882  79.876  61.403  1.00 33.97  ?  80  LEU H CD1   1 
ATOM 5373  C CD2   . LEU H 4 81  ? 66.899  79.513  59.961  1.00 33.97  ?  80  LEU H CD2   1 
ATOM 5374  N N     . ALA H 4 82  ? 70.687  83.160  57.292  1.00 40.97  ?  81  ALA H N     1 
ATOM 5375  C CA    . ALA H 4 82  ? 70.914  83.814  56.017  1.00 40.97  ?  81  ALA H CA    1 
ATOM 5376  C C     . ALA H 4 82  ? 72.200  83.346  55.366  1.00 40.97  ?  81  ALA H C     1 
ATOM 5377  O O     . ALA H 4 82  ? 72.501  83.759  54.244  1.00 40.97  ?  81  ALA H O     1 
ATOM 5378  C CB    . ALA H 4 82  ? 70.950  85.330  56.194  1.00 40.97  ?  81  ALA H CB    1 
ATOM 5379  N N     . HIS H 4 83  ? 72.959  82.492  56.045  1.00 40.03  ?  82  HIS H N     1 
ATOM 5380  C CA    . HIS H 4 83  ? 74.250  82.038  55.560  1.00 40.03  ?  82  HIS H CA    1 
ATOM 5381  C C     . HIS H 4 83  ? 74.261  80.571  55.173  1.00 40.03  ?  82  HIS H C     1 
ATOM 5382  O O     . HIS H 4 83  ? 75.005  80.190  54.271  1.00 40.03  ?  82  HIS H O     1 
ATOM 5383  C CB    . HIS H 4 83  ? 75.316  82.292  56.630  1.00 40.03  ?  82  HIS H CB    1 
ATOM 5384  C CG    . HIS H 4 83  ? 76.714  82.058  56.165  1.00 40.03  ?  82  HIS H CG    1 
ATOM 5385  N ND1   . HIS H 4 83  ? 77.322  80.822  56.223  1.00 40.03  ?  82  HIS H ND1   1 
ATOM 5386  C CD2   . HIS H 4 83  ? 77.634  82.904  55.646  1.00 40.03  ?  82  HIS H CD2   1 
ATOM 5387  C CE1   . HIS H 4 83  ? 78.551  80.916  55.755  1.00 40.03  ?  82  HIS H CE1   1 
ATOM 5388  N NE2   . HIS H 4 83  ? 78.767  82.170  55.397  1.00 40.03  ?  82  HIS H NE2   1 
ATOM 5389  N N     . TYR H 4 84  ? 73.445  79.745  55.827  1.00 36.87  ?  83  TYR H N     1 
ATOM 5390  C CA    . TYR H 4 84  ? 73.393  78.329  55.490  1.00 36.87  ?  83  TYR H CA    1 
ATOM 5391  C C     . TYR H 4 84  ? 72.634  78.088  54.199  1.00 36.87  ?  83  TYR H C     1 
ATOM 5392  O O     . TYR H 4 84  ? 72.938  77.139  53.472  1.00 36.87  ?  83  TYR H O     1 
ATOM 5393  C CB    . TYR H 4 84  ? 72.740  77.544  56.623  1.00 36.87  ?  83  TYR H CB    1 
ATOM 5394  C CG    . TYR H 4 84  ? 73.574  77.449  57.875  1.00 36.87  ?  83  TYR H CG    1 
ATOM 5395  C CD1   . TYR H 4 84  ? 74.945  77.660  57.842  1.00 36.87  ?  83  TYR H CD1   1 
ATOM 5396  C CD2   . TYR H 4 84  ? 72.981  77.179  59.097  1.00 36.87  ?  83  TYR H CD2   1 
ATOM 5397  C CE1   . TYR H 4 84  ? 75.704  77.582  58.991  1.00 36.87  ?  83  TYR H CE1   1 
ATOM 5398  C CE2   . TYR H 4 84  ? 73.732  77.090  60.248  1.00 36.87  ?  83  TYR H CE2   1 
ATOM 5399  C CZ    . TYR H 4 84  ? 75.091  77.292  60.189  1.00 36.87  ?  83  TYR H CZ    1 
ATOM 5400  O OH    . TYR H 4 84  ? 75.840  77.214  61.338  1.00 36.87  ?  83  TYR H OH    1 
ATOM 5401  N N     . ASN H 4 85  ? 71.646  78.923  53.900  1.00 42.07  ?  84  ASN H N     1 
ATOM 5402  C CA    . ASN H 4 85  ? 70.847  78.777  52.696  1.00 42.07  ?  84  ASN H CA    1 
ATOM 5403  C C     . ASN H 4 85  ? 71.367  79.624  51.554  1.00 42.07  ?  84  ASN H C     1 
ATOM 5404  O O     . ASN H 4 85  ? 70.736  79.660  50.492  1.00 42.07  ?  84  ASN H O     1 
ATOM 5405  C CB    . ASN H 4 85  ? 69.401  79.136  52.992  1.00 42.07  ?  84  ASN H CB    1 
ATOM 5406  C CG    . ASN H 4 85  ? 68.767  78.165  53.934  1.00 42.07  ?  84  ASN H CG    1 
ATOM 5407  O OD1   . ASN H 4 85  ? 68.915  76.957  53.784  1.00 42.07  ?  84  ASN H OD1   1 
ATOM 5408  N ND2   . ASN H 4 85  ? 68.090  78.682  54.942  1.00 42.07  ?  84  ASN H ND2   1 
ATOM 5409  N N     . LYS H 4 86  ? 72.494  80.308  51.770  1.00 45.88  ?  85  LYS H N     1 
ATOM 5410  C CA    . LYS H 4 86  ? 73.199  81.123  50.780  1.00 45.88  ?  85  LYS H CA    1 
ATOM 5411  C C     . LYS H 4 86  ? 72.290  82.238  50.254  1.00 45.88  ?  85  LYS H C     1 
ATOM 5412  O O     . LYS H 4 86  ? 71.963  82.323  49.071  1.00 45.88  ?  85  LYS H O     1 
ATOM 5413  C CB    . LYS H 4 86  ? 73.760  80.242  49.657  1.00 45.88  ?  85  LYS H CB    1 
ATOM 5414  C CG    . LYS H 4 86  ? 74.847  80.875  48.819  1.00 45.88  ?  85  LYS H CG    1 
ATOM 5415  C CD    . LYS H 4 86  ? 75.283  79.911  47.736  1.00 45.88  ?  85  LYS H CD    1 
ATOM 5416  C CE    . LYS H 4 86  ? 76.059  78.749  48.329  1.00 45.88  ?  85  LYS H CE    1 
ATOM 5417  N NZ    . LYS H 4 86  ? 76.588  77.849  47.270  1.00 45.88  1  85  LYS H NZ    1 
ATOM 5418  N N     . ARG H 4 87  ? 71.854  83.074  51.185  1.00 58.06  ?  86  ARG H N     1 
ATOM 5419  C CA    . ARG H 4 87  ? 71.010  84.227  50.922  1.00 58.06  ?  86  ARG H CA    1 
ATOM 5420  C C     . ARG H 4 87  ? 71.740  85.486  51.361  1.00 58.06  ?  86  ARG H C     1 
ATOM 5421  O O     . ARG H 4 87  ? 72.904  85.450  51.758  1.00 58.06  ?  86  ARG H O     1 
ATOM 5422  C CB    . ARG H 4 87  ? 69.676  84.106  51.658  1.00 58.06  ?  86  ARG H CB    1 
ATOM 5423  C CG    . ARG H 4 87  ? 68.870  82.891  51.285  1.00 58.06  ?  86  ARG H CG    1 
ATOM 5424  C CD    . ARG H 4 87  ? 68.261  83.024  49.915  1.00 58.06  ?  86  ARG H CD    1 
ATOM 5425  N NE    . ARG H 4 87  ? 67.497  81.830  49.582  1.00 58.06  ?  86  ARG H NE    1 
ATOM 5426  C CZ    . ARG H 4 87  ? 66.231  81.640  49.931  1.00 58.06  ?  86  ARG H CZ    1 
ATOM 5427  N NH1   . ARG H 4 87  ? 65.589  82.565  50.629  1.00 58.06  1  86  ARG H NH1   1 
ATOM 5428  N NH2   . ARG H 4 87  ? 65.607  80.522  49.589  1.00 58.06  ?  86  ARG H NH2   1 
ATOM 5429  N N     . SER H 4 88  ? 71.045  86.610  51.287  1.00 64.54  ?  87  SER H N     1 
ATOM 5430  C CA    . SER H 4 88  ? 71.604  87.850  51.790  1.00 64.54  ?  87  SER H CA    1 
ATOM 5431  C C     . SER H 4 88  ? 70.590  88.733  52.499  1.00 64.54  ?  87  SER H C     1 
ATOM 5432  O O     . SER H 4 88  ? 70.952  89.836  52.913  1.00 64.54  ?  87  SER H O     1 
ATOM 5433  C CB    . SER H 4 88  ? 72.258  88.637  50.649  1.00 64.54  ?  87  SER H CB    1 
ATOM 5434  O OG    . SER H 4 88  ? 71.290  89.037  49.700  1.00 64.54  ?  87  SER H OG    1 
ATOM 5435  N N     . THR H 4 89  ? 69.349  88.291  52.665  1.00 61.74  ?  88  THR H N     1 
ATOM 5436  C CA    . THR H 4 89  ? 68.311  89.098  53.284  1.00 61.74  ?  88  THR H CA    1 
ATOM 5437  C C     . THR H 4 89  ? 67.877  88.497  54.613  1.00 61.74  ?  88  THR H C     1 
ATOM 5438  O O     . THR H 4 89  ? 68.148  87.334  54.917  1.00 61.74  ?  88  THR H O     1 
ATOM 5439  C CB    . THR H 4 89  ? 67.089  89.221  52.373  1.00 61.74  ?  88  THR H CB    1 
ATOM 5440  O OG1   . THR H 4 89  ? 66.518  87.924  52.171  1.00 61.74  ?  88  THR H OG1   1 
ATOM 5441  C CG2   . THR H 4 89  ? 67.484  89.796  51.037  1.00 61.74  ?  88  THR H CG2   1 
ATOM 5442  N N     . ILE H 4 90  ? 67.189  89.312  55.405  1.00 47.90  ?  89  ILE H N     1 
ATOM 5443  C CA    . ILE H 4 90  ? 66.517  88.866  56.618  1.00 47.90  ?  89  ILE H CA    1 
ATOM 5444  C C     . ILE H 4 90  ? 65.068  89.312  56.486  1.00 47.90  ?  89  ILE H C     1 
ATOM 5445  O O     . ILE H 4 90  ? 64.750  90.485  56.706  1.00 47.90  ?  89  ILE H O     1 
ATOM 5446  C CB    . ILE H 4 90  ? 67.154  89.424  57.890  1.00 47.90  ?  89  ILE H CB    1 
ATOM 5447  C CG1   . ILE H 4 90  ? 68.582  88.929  58.029  1.00 47.90  ?  89  ILE H CG1   1 
ATOM 5448  C CG2   . ILE H 4 90  ? 66.390  88.978  59.103  1.00 47.90  ?  89  ILE H CG2   1 
ATOM 5449  C CD1   . ILE H 4 90  ? 69.314  89.595  59.147  1.00 47.90  ?  89  ILE H CD1   1 
ATOM 5450  N N     . THR H 4 91  ? 64.197  88.397  56.102  1.00 48.74  ?  90  THR H N     1 
ATOM 5451  C CA    . THR H 4 91  ? 62.781  88.686  56.004  1.00 48.74  ?  90  THR H CA    1 
ATOM 5452  C C     . THR H 4 91  ? 62.097  88.248  57.289  1.00 48.74  ?  90  THR H C     1 
ATOM 5453  O O     . THR H 4 91  ? 62.748  87.889  58.271  1.00 48.74  ?  90  THR H O     1 
ATOM 5454  C CB    . THR H 4 91  ? 62.184  87.990  54.788  1.00 48.74  ?  90  THR H CB    1 
ATOM 5455  O OG1   . THR H 4 91  ? 62.307  86.574  54.952  1.00 48.74  ?  90  THR H OG1   1 
ATOM 5456  C CG2   . THR H 4 91  ? 62.921  88.410  53.534  1.00 48.74  ?  90  THR H CG2   1 
ATOM 5457  N N     . SER H 4 92  ? 60.765  88.269  57.289  1.00 49.93  ?  91  SER H N     1 
ATOM 5458  C CA    . SER H 4 92  ? 60.030  87.871  58.482  1.00 49.93  ?  91  SER H CA    1 
ATOM 5459  C C     . SER H 4 92  ? 60.100  86.370  58.710  1.00 49.93  ?  91  SER H C     1 
ATOM 5460  O O     . SER H 4 92  ? 59.961  85.912  59.849  1.00 49.93  ?  91  SER H O     1 
ATOM 5461  C CB    . SER H 4 92  ? 58.574  88.305  58.375  1.00 49.93  ?  91  SER H CB    1 
ATOM 5462  O OG    . SER H 4 92  ? 57.914  87.571  57.362  1.00 49.93  ?  91  SER H OG    1 
ATOM 5463  N N     . ARG H 4 93  ? 60.326  85.597  57.649  1.00 48.77  ?  92  ARG H N     1 
ATOM 5464  C CA    . ARG H 4 93  ? 60.303  84.145  57.769  1.00 48.77  ?  92  ARG H CA    1 
ATOM 5465  C C     . ARG H 4 93  ? 61.516  83.636  58.541  1.00 48.77  ?  92  ARG H C     1 
ATOM 5466  O O     . ARG H 4 93  ? 61.405  82.694  59.338  1.00 48.77  ?  92  ARG H O     1 
ATOM 5467  C CB    . ARG H 4 93  ? 60.226  83.532  56.373  1.00 48.77  ?  92  ARG H CB    1 
ATOM 5468  C CG    . ARG H 4 93  ? 59.986  82.043  56.323  1.00 48.77  ?  92  ARG H CG    1 
ATOM 5469  C CD    . ARG H 4 93  ? 59.740  81.622  54.884  1.00 48.77  ?  92  ARG H CD    1 
ATOM 5470  N NE    . ARG H 4 93  ? 59.420  80.205  54.756  1.00 48.77  ?  92  ARG H NE    1 
ATOM 5471  C CZ    . ARG H 4 93  ? 60.317  79.255  54.519  1.00 48.77  ?  92  ARG H CZ    1 
ATOM 5472  N NH1   . ARG H 4 93  ? 61.597  79.570  54.377  1.00 48.77  1  92  ARG H NH1   1 
ATOM 5473  N NH2   . ARG H 4 93  ? 59.932  77.991  54.417  1.00 48.77  ?  92  ARG H NH2   1 
ATOM 5474  N N     . GLU H 4 94  ? 62.668  84.285  58.360  1.00 44.74  ?  93  GLU H N     1 
ATOM 5475  C CA    . GLU H 4 94  ? 63.866  83.877  59.082  1.00 44.74  ?  93  GLU H CA    1 
ATOM 5476  C C     . GLU H 4 94  ? 63.762  84.216  60.562  1.00 44.74  ?  93  GLU H C     1 
ATOM 5477  O O     . GLU H 4 94  ? 64.189  83.427  61.414  1.00 44.74  ?  93  GLU H O     1 
ATOM 5478  C CB    . GLU H 4 94  ? 65.092  84.534  58.464  1.00 44.74  ?  93  GLU H CB    1 
ATOM 5479  C CG    . GLU H 4 94  ? 65.356  84.074  57.054  1.00 44.74  ?  93  GLU H CG    1 
ATOM 5480  C CD    . GLU H 4 94  ? 66.569  84.731  56.448  1.00 44.74  ?  93  GLU H CD    1 
ATOM 5481  O OE1   . GLU H 4 94  ? 67.130  85.639  57.093  1.00 44.74  ?  93  GLU H OE1   1 
ATOM 5482  O OE2   . GLU H 4 94  ? 66.964  84.342  55.328  1.00 44.74  -1 93  GLU H OE2   1 
ATOM 5483  N N     . ILE H 4 95  ? 63.173  85.369  60.887  1.00 37.66  ?  94  ILE H N     1 
ATOM 5484  C CA    . ILE H 4 95  ? 62.943  85.718  62.283  1.00 37.66  ?  94  ILE H CA    1 
ATOM 5485  C C     . ILE H 4 95  ? 61.918  84.779  62.898  1.00 37.66  ?  94  ILE H C     1 
ATOM 5486  O O     . ILE H 4 95  ? 62.034  84.409  64.074  1.00 37.66  ?  94  ILE H O     1 
ATOM 5487  C CB    . ILE H 4 95  ? 62.509  87.188  62.399  1.00 37.66  ?  94  ILE H CB    1 
ATOM 5488  C CG1   . ILE H 4 95  ? 63.538  88.090  61.740  1.00 37.66  ?  94  ILE H CG1   1 
ATOM 5489  C CG2   . ILE H 4 95  ? 62.398  87.605  63.844  1.00 37.66  ?  94  ILE H CG2   1 
ATOM 5490  C CD1   . ILE H 4 95  ? 64.881  88.035  62.396  1.00 37.66  ?  94  ILE H CD1   1 
ATOM 5491  N N     . GLN H 4 96  ? 60.932  84.341  62.108  1.00 39.57  ?  95  GLN H N     1 
ATOM 5492  C CA    . GLN H 4 96  ? 59.953  83.372  62.591  1.00 39.57  ?  95  GLN H CA    1 
ATOM 5493  C C     . GLN H 4 96  ? 60.605  82.043  62.945  1.00 39.57  ?  95  GLN H C     1 
ATOM 5494  O O     . GLN H 4 96  ? 60.328  81.472  64.007  1.00 39.57  ?  95  GLN H O     1 
ATOM 5495  C CB    . GLN H 4 96  ? 58.867  83.163  61.543  1.00 39.57  ?  95  GLN H CB    1 
ATOM 5496  C CG    . GLN H 4 96  ? 57.816  82.170  61.960  1.00 39.57  ?  95  GLN H CG    1 
ATOM 5497  C CD    . GLN H 4 96  ? 56.730  82.022  60.929  1.00 39.57  ?  95  GLN H CD    1 
ATOM 5498  O OE1   . GLN H 4 96  ? 56.747  82.686  59.897  1.00 39.57  ?  95  GLN H OE1   1 
ATOM 5499  N NE2   . GLN H 4 96  ? 55.786  81.132  61.191  1.00 39.57  ?  95  GLN H NE2   1 
ATOM 5500  N N     . THR H 4 97  ? 61.503  81.554  62.089  1.00 40.92  ?  96  THR H N     1 
ATOM 5501  C CA    . THR H 4 97  ? 62.200  80.312  62.413  1.00 40.92  ?  96  THR H CA    1 
ATOM 5502  C C     . THR H 4 97  ? 63.173  80.485  63.572  1.00 40.92  ?  96  THR H C     1 
ATOM 5503  O O     . THR H 4 97  ? 63.362  79.549  64.360  1.00 40.92  ?  96  THR H O     1 
ATOM 5504  C CB    . THR H 4 97  ? 62.938  79.780  61.196  1.00 40.92  ?  96  THR H CB    1 
ATOM 5505  O OG1   . THR H 4 97  ? 63.875  80.762  60.745  1.00 40.92  ?  96  THR H OG1   1 
ATOM 5506  C CG2   . THR H 4 97  ? 61.953  79.460  60.092  1.00 40.92  ?  96  THR H CG2   1 
ATOM 5507  N N     . ALA H 4 98  ? 63.780  81.665  63.711  1.00 38.68  ?  97  ALA H N     1 
ATOM 5508  C CA    . ALA H 4 98  ? 64.654  81.898  64.856  1.00 38.68  ?  97  ALA H CA    1 
ATOM 5509  C C     . ALA H 4 98  ? 63.875  81.930  66.163  1.00 38.68  ?  97  ALA H C     1 
ATOM 5510  O O     . ALA H 4 98  ? 64.388  81.498  67.197  1.00 38.68  ?  97  ALA H O     1 
ATOM 5511  C CB    . ALA H 4 98  ? 65.433  83.196  64.675  1.00 38.68  ?  97  ALA H CB    1 
ATOM 5512  N N     . VAL H 4 99  ? 62.637  82.419  66.133  1.00 39.30  ?  98  VAL H N     1 
ATOM 5513  C CA    . VAL H 4 99  ? 61.798  82.369  67.325  1.00 39.30  ?  98  VAL H CA    1 
ATOM 5514  C C     . VAL H 4 99  ? 61.340  80.940  67.595  1.00 39.30  ?  98  VAL H C     1 
ATOM 5515  O O     . VAL H 4 99  ? 61.257  80.513  68.755  1.00 39.30  ?  98  VAL H O     1 
ATOM 5516  C CB    . VAL H 4 99  ? 60.626  83.357  67.177  1.00 39.30  ?  98  VAL H CB    1 
ATOM 5517  C CG1   . VAL H 4 99  ? 59.606  83.197  68.276  1.00 39.30  ?  98  VAL H CG1   1 
ATOM 5518  C CG2   . VAL H 4 99  ? 61.154  84.765  67.225  1.00 39.30  ?  98  VAL H CG2   1 
ATOM 5519  N N     . ARG H 4 100 ? 61.085  80.161  66.535  1.00 42.65  ?  99  ARG H N     1 
ATOM 5520  C CA    . ARG H 4 100 ? 60.770  78.741  66.712  1.00 42.65  ?  99  ARG H CA    1 
ATOM 5521  C C     . ARG H 4 100 ? 61.932  77.968  67.326  1.00 42.65  ?  99  ARG H C     1 
ATOM 5522  O O     . ARG H 4 100 ? 61.713  76.971  68.020  1.00 42.65  ?  99  ARG H O     1 
ATOM 5523  C CB    . ARG H 4 100 ? 60.391  78.091  65.381  1.00 42.65  ?  99  ARG H CB    1 
ATOM 5524  C CG    . ARG H 4 100 ? 59.097  78.561  64.761  1.00 42.65  ?  99  ARG H CG    1 
ATOM 5525  C CD    . ARG H 4 100 ? 57.893  78.089  65.535  1.00 42.65  ?  99  ARG H CD    1 
ATOM 5526  N NE    . ARG H 4 100 ? 57.754  76.639  65.503  1.00 42.65  ?  99  ARG H NE    1 
ATOM 5527  C CZ    . ARG H 4 100 ? 56.958  75.952  66.315  1.00 42.65  ?  99  ARG H CZ    1 
ATOM 5528  N NH1   . ARG H 4 100 ? 56.222  76.586  67.217  1.00 42.65  1  99  ARG H NH1   1 
ATOM 5529  N NH2   . ARG H 4 100 ? 56.889  74.633  66.222  1.00 42.65  ?  99  ARG H NH2   1 
ATOM 5530  N N     . LEU H 4 101 ? 63.165  78.404  67.082  1.00 40.34  ?  100 LEU H N     1 
ATOM 5531  C CA    . LEU H 4 101 ? 64.308  77.725  67.681  1.00 40.34  ?  100 LEU H CA    1 
ATOM 5532  C C     . LEU H 4 101 ? 64.630  78.216  69.089  1.00 40.34  ?  100 LEU H C     1 
ATOM 5533  O O     . LEU H 4 101 ? 64.804  77.405  70.002  1.00 40.34  ?  100 LEU H O     1 
ATOM 5534  C CB    . LEU H 4 101 ? 65.541  77.878  66.796  1.00 40.34  ?  100 LEU H CB    1 
ATOM 5535  C CG    . LEU H 4 101 ? 65.468  77.118  65.485  1.00 40.34  ?  100 LEU H CG    1 
ATOM 5536  C CD1   . LEU H 4 101 ? 66.696  77.397  64.654  1.00 40.34  ?  100 LEU H CD1   1 
ATOM 5537  C CD2   . LEU H 4 101 ? 65.335  75.645  65.771  1.00 40.34  ?  100 LEU H CD2   1 
ATOM 5538  N N     . LEU H 4 102 ? 64.727  79.529  69.286  1.00 43.56  ?  101 LEU H N     1 
ATOM 5539  C CA    . LEU H 4 102 ? 65.278  80.085  70.519  1.00 43.56  ?  101 LEU H CA    1 
ATOM 5540  C C     . LEU H 4 102 ? 64.323  80.079  71.700  1.00 43.56  ?  101 LEU H C     1 
ATOM 5541  O O     . LEU H 4 102 ? 64.703  80.571  72.764  1.00 43.56  ?  101 LEU H O     1 
ATOM 5542  C CB    . LEU H 4 102 ? 65.760  81.516  70.294  1.00 43.56  ?  101 LEU H CB    1 
ATOM 5543  C CG    . LEU H 4 102 ? 67.254  81.718  70.055  1.00 43.56  ?  101 LEU H CG    1 
ATOM 5544  C CD1   . LEU H 4 102 ? 67.989  81.354  71.327  1.00 43.56  ?  101 LEU H CD1   1 
ATOM 5545  C CD2   . LEU H 4 102 ? 67.778  80.896  68.895  1.00 43.56  ?  101 LEU H CD2   1 
ATOM 5546  N N     . LEU H 4 103 ? 63.113  79.560  71.563  1.00 43.28  ?  102 LEU H N     1 
ATOM 5547  C CA    . LEU H 4 103 ? 62.191  79.592  72.685  1.00 43.28  ?  102 LEU H CA    1 
ATOM 5548  C C     . LEU H 4 103 ? 61.635  78.203  72.948  1.00 43.28  ?  102 LEU H C     1 
ATOM 5549  O O     . LEU H 4 103 ? 61.466  77.414  72.017  1.00 43.28  ?  102 LEU H O     1 
ATOM 5550  C CB    . LEU H 4 103 ? 61.034  80.563  72.418  1.00 43.28  ?  102 LEU H CB    1 
ATOM 5551  C CG    . LEU H 4 103 ? 61.421  82.032  72.272  1.00 43.28  ?  102 LEU H CG    1 
ATOM 5552  C CD1   . LEU H 4 103 ? 60.208  82.878  71.953  1.00 43.28  ?  102 LEU H CD1   1 
ATOM 5553  C CD2   . LEU H 4 103 ? 62.104  82.526  73.524  1.00 43.28  ?  102 LEU H CD2   1 
ATOM 5554  N N     . PRO H 4 104 ? 61.346  77.874  74.205  1.00 52.37  ?  103 PRO H N     1 
ATOM 5555  C CA    . PRO H 4 104 ? 60.634  76.626  74.494  1.00 52.37  ?  103 PRO H CA    1 
ATOM 5556  C C     . PRO H 4 104 ? 59.185  76.711  74.041  1.00 52.37  ?  103 PRO H C     1 
ATOM 5557  O O     . PRO H 4 104 ? 58.666  77.783  73.729  1.00 52.37  ?  103 PRO H O     1 
ATOM 5558  C CB    . PRO H 4 104 ? 60.744  76.499  76.012  1.00 52.37  ?  103 PRO H CB    1 
ATOM 5559  C CG    . PRO H 4 104 ? 60.899  77.887  76.484  1.00 52.37  ?  103 PRO H CG    1 
ATOM 5560  C CD    . PRO H 4 104 ? 61.700  78.595  75.435  1.00 52.37  ?  103 PRO H CD    1 
ATOM 5561  N N     . GLY H 4 105 ? 58.524  75.552  74.062  1.00 62.55  ?  104 GLY H N     1 
ATOM 5562  C CA    . GLY H 4 105 ? 57.294  75.277  73.334  1.00 62.55  ?  104 GLY H CA    1 
ATOM 5563  C C     . GLY H 4 105 ? 56.127  76.246  73.383  1.00 62.55  ?  104 GLY H C     1 
ATOM 5564  O O     . GLY H 4 105 ? 55.817  76.880  72.368  1.00 62.55  ?  104 GLY H O     1 
ATOM 5565  N N     . GLU H 4 106 ? 55.484  76.379  74.547  1.00 71.15  ?  105 GLU H N     1 
ATOM 5566  C CA    . GLU H 4 106 ? 54.252  77.162  74.631  1.00 71.15  ?  105 GLU H CA    1 
ATOM 5567  C C     . GLU H 4 106 ? 54.522  78.648  74.446  1.00 71.15  ?  105 GLU H C     1 
ATOM 5568  O O     . GLU H 4 106 ? 53.732  79.359  73.805  1.00 71.15  ?  105 GLU H O     1 
ATOM 5569  C CB    . GLU H 4 106 ? 53.561  76.900  75.970  1.00 71.15  ?  105 GLU H CB    1 
ATOM 5570  C CG    . GLU H 4 106 ? 52.263  77.669  76.173  1.00 71.15  ?  105 GLU H CG    1 
ATOM 5571  C CD    . GLU H 4 106 ? 51.170  77.249  75.209  1.00 71.15  ?  105 GLU H CD    1 
ATOM 5572  O OE1   . GLU H 4 106 ? 51.154  76.073  74.789  1.00 71.15  ?  105 GLU H OE1   1 
ATOM 5573  O OE2   . GLU H 4 106 ? 50.331  78.104  74.860  1.00 71.15  -1 105 GLU H OE2   1 
ATOM 5574  N N     . LEU H 4 107 ? 55.649  79.121  74.975  1.00 60.58  ?  106 LEU H N     1 
ATOM 5575  C CA    . LEU H 4 107 ? 56.030  80.515  74.808  1.00 60.58  ?  106 LEU H CA    1 
ATOM 5576  C C     . LEU H 4 107 ? 56.331  80.823  73.347  1.00 60.58  ?  106 LEU H C     1 
ATOM 5577  O O     . LEU H 4 107 ? 55.961  81.890  72.842  1.00 60.58  ?  106 LEU H O     1 
ATOM 5578  C CB    . LEU H 4 107 ? 57.231  80.812  75.697  1.00 60.58  ?  106 LEU H CB    1 
ATOM 5579  C CG    . LEU H 4 107 ? 57.669  82.253  75.875  1.00 60.58  ?  106 LEU H CG    1 
ATOM 5580  C CD1   . LEU H 4 107 ? 56.552  83.015  76.532  1.00 60.58  ?  106 LEU H CD1   1 
ATOM 5581  C CD2   . LEU H 4 107 ? 58.905  82.285  76.741  1.00 60.58  ?  106 LEU H CD2   1 
ATOM 5582  N N     . ALA H 4 108 ? 56.939  79.866  72.640  1.00 59.56  ?  107 ALA H N     1 
ATOM 5583  C CA    . ALA H 4 108 ? 57.199  80.042  71.216  1.00 59.56  ?  107 ALA H CA    1 
ATOM 5584  C C     . ALA H 4 108 ? 55.910  80.040  70.411  1.00 59.56  ?  107 ALA H C     1 
ATOM 5585  O O     . ALA H 4 108 ? 55.785  80.795  69.441  1.00 59.56  ?  107 ALA H O     1 
ATOM 5586  C CB    . ALA H 4 108 ? 58.132  78.948  70.707  1.00 59.56  ?  107 ALA H CB    1 
ATOM 5587  N N     . LYS H 4 109 ? 54.945  79.200  70.801  1.00 64.29  ?  108 LYS H N     1 
ATOM 5588  C CA    . LYS H 4 109 ? 53.661  79.164  70.106  1.00 64.29  ?  108 LYS H CA    1 
ATOM 5589  C C     . LYS H 4 109 ? 52.904  80.474  70.272  1.00 64.29  ?  108 LYS H C     1 
ATOM 5590  O O     . LYS H 4 109 ? 52.356  81.009  69.300  1.00 64.29  ?  108 LYS H O     1 
ATOM 5591  C CB    . LYS H 4 109 ? 52.814  78.001  70.615  1.00 64.29  ?  108 LYS H CB    1 
ATOM 5592  C CG    . LYS H 4 109 ? 53.332  76.635  70.224  1.00 64.29  ?  108 LYS H CG    1 
ATOM 5593  C CD    . LYS H 4 109 ? 52.442  75.538  70.773  1.00 64.29  ?  108 LYS H CD    1 
ATOM 5594  C CE    . LYS H 4 109 ? 52.985  74.167  70.421  1.00 64.29  ?  108 LYS H CE    1 
ATOM 5595  N NZ    . LYS H 4 109 ? 52.129  73.077  70.962  1.00 64.29  1  108 LYS H NZ    1 
ATOM 5596  N N     . HIS H 4 110 ? 52.897  81.022  71.490  1.00 64.63  ?  109 HIS H N     1 
ATOM 5597  C CA    . HIS H 4 110 ? 52.243  82.309  71.707  1.00 64.63  ?  109 HIS H CA    1 
ATOM 5598  C C     . HIS H 4 110 ? 52.965  83.435  70.977  1.00 64.63  ?  109 HIS H C     1 
ATOM 5599  O O     . HIS H 4 110 ? 52.319  84.334  70.423  1.00 64.63  ?  109 HIS H O     1 
ATOM 5600  C CB    . HIS H 4 110 ? 52.157  82.618  73.197  1.00 64.63  ?  109 HIS H CB    1 
ATOM 5601  C CG    . HIS H 4 110 ? 51.211  81.736  73.944  1.00 64.63  ?  109 HIS H CG    1 
ATOM 5602  N ND1   . HIS H 4 110 ? 51.084  81.779  75.315  1.00 64.63  ?  109 HIS H ND1   1 
ATOM 5603  C CD2   . HIS H 4 110 ? 50.353  80.782  73.515  1.00 64.63  ?  109 HIS H CD2   1 
ATOM 5604  C CE1   . HIS H 4 110 ? 50.182  80.893  75.699  1.00 64.63  ?  109 HIS H CE1   1 
ATOM 5605  N NE2   . HIS H 4 110 ? 49.724  80.274  74.626  1.00 64.63  ?  109 HIS H NE2   1 
ATOM 5606  N N     . ALA H 4 111 ? 54.300  83.381  70.925  1.00 63.30  ?  110 ALA H N     1 
ATOM 5607  C CA    . ALA H 4 111 ? 55.053  84.437  70.258  1.00 63.30  ?  110 ALA H CA    1 
ATOM 5608  C C     . ALA H 4 111 ? 54.847  84.413  68.748  1.00 63.30  ?  110 ALA H C     1 
ATOM 5609  O O     . ALA H 4 111 ? 54.669  85.468  68.126  1.00 63.30  ?  110 ALA H O     1 
ATOM 5610  C CB    . ALA H 4 111 ? 56.535  84.314  70.596  1.00 63.30  ?  110 ALA H CB    1 
ATOM 5611  N N     . VAL H 4 112 ? 54.853  83.223  68.142  1.00 59.21  ?  111 VAL H N     1 
ATOM 5612  C CA    . VAL H 4 112 ? 54.636  83.151  66.702  1.00 59.21  ?  111 VAL H CA    1 
ATOM 5613  C C     . VAL H 4 112 ? 53.178  83.453  66.368  1.00 59.21  ?  111 VAL H C     1 
ATOM 5614  O O     . VAL H 4 112 ? 52.879  83.965  65.283  1.00 59.21  ?  111 VAL H O     1 
ATOM 5615  C CB    . VAL H 4 112 ? 55.104  81.787  66.146  1.00 59.21  ?  111 VAL H CB    1 
ATOM 5616  C CG1   . VAL H 4 112 ? 54.200  80.642  66.577  1.00 59.21  ?  111 VAL H CG1   1 
ATOM 5617  C CG2   . VAL H 4 112 ? 55.228  81.818  64.633  1.00 59.21  ?  111 VAL H CG2   1 
ATOM 5618  N N     . SER H 4 113 ? 52.252  83.205  67.301  1.00 62.57  ?  112 SER H N     1 
ATOM 5619  C CA    . SER H 4 113 ? 50.868  83.578  67.048  1.00 62.57  ?  112 SER H CA    1 
ATOM 5620  C C     . SER H 4 113 ? 50.656  85.079  67.169  1.00 62.57  ?  112 SER H C     1 
ATOM 5621  O O     . SER H 4 113 ? 49.770  85.630  66.510  1.00 62.57  ?  112 SER H O     1 
ATOM 5622  C CB    . SER H 4 113 ? 49.939  82.838  68.009  1.00 62.57  ?  112 SER H CB    1 
ATOM 5623  O OG    . SER H 4 113 ? 48.593  83.217  67.802  1.00 62.57  ?  112 SER H OG    1 
ATOM 5624  N N     . GLU H 4 114 ? 51.455  85.753  67.990  1.00 64.00  ?  113 GLU H N     1 
ATOM 5625  C CA    . GLU H 4 114 ? 51.298  87.190  68.164  1.00 64.00  ?  113 GLU H CA    1 
ATOM 5626  C C     . GLU H 4 114 ? 52.028  87.992  67.092  1.00 64.00  ?  113 GLU H C     1 
ATOM 5627  O O     . GLU H 4 114 ? 51.556  89.069  66.695  1.00 64.00  ?  113 GLU H O     1 
ATOM 5628  C CB    . GLU H 4 114 ? 51.793  87.584  69.558  1.00 64.00  ?  113 GLU H CB    1 
ATOM 5629  C CG    . GLU H 4 114 ? 51.341  88.942  70.068  1.00 64.00  ?  113 GLU H CG    1 
ATOM 5630  C CD    . GLU H 4 114 ? 52.250  90.063  69.635  1.00 64.00  ?  113 GLU H CD    1 
ATOM 5631  O OE1   . GLU H 4 114 ? 53.435  89.785  69.360  1.00 64.00  ?  113 GLU H OE1   1 
ATOM 5632  O OE2   . GLU H 4 114 ? 51.786  91.220  69.580  1.00 64.00  -1 113 GLU H OE2   1 
ATOM 5633  N N     . GLY H 4 115 ? 53.158  87.484  66.601  1.00 60.93  ?  114 GLY H N     1 
ATOM 5634  C CA    . GLY H 4 115 ? 53.959  88.263  65.670  1.00 60.93  ?  114 GLY H CA    1 
ATOM 5635  C C     . GLY H 4 115 ? 53.313  88.436  64.308  1.00 60.93  ?  114 GLY H C     1 
ATOM 5636  O O     . GLY H 4 115 ? 53.320  89.535  63.746  1.00 60.93  ?  114 GLY H O     1 
ATOM 5637  N N     . THR H 4 116 ? 52.739  87.363  63.761  1.00 63.66  ?  115 THR H N     1 
ATOM 5638  C CA    . THR H 4 116 ? 52.046  87.476  62.482  1.00 63.66  ?  115 THR H CA    1 
ATOM 5639  C C     . THR H 4 116 ? 50.778  88.303  62.622  1.00 63.66  ?  115 THR H C     1 
ATOM 5640  O O     . THR H 4 116 ? 50.359  88.975  61.672  1.00 63.66  ?  115 THR H O     1 
ATOM 5641  C CB    . THR H 4 116 ? 51.714  86.093  61.933  1.00 63.66  ?  115 THR H CB    1 
ATOM 5642  O OG1   . THR H 4 116 ? 50.839  85.419  62.844  1.00 63.66  ?  115 THR H OG1   1 
ATOM 5643  C CG2   . THR H 4 116 ? 52.977  85.277  61.752  1.00 63.66  ?  115 THR H CG2   1 
ATOM 5644  N N     . LYS H 4 117 ? 50.165  88.276  63.808  1.00 66.15  ?  116 LYS H N     1 
ATOM 5645  C CA    . LYS H 4 117 ? 49.045  89.161  64.102  1.00 66.15  ?  116 LYS H CA    1 
ATOM 5646  C C     . LYS H 4 117 ? 49.474  90.621  64.076  1.00 66.15  ?  116 LYS H C     1 
ATOM 5647  O O     . LYS H 4 117 ? 48.689  91.491  63.686  1.00 66.15  ?  116 LYS H O     1 
ATOM 5648  C CB    . LYS H 4 117 ? 48.445  88.774  65.456  1.00 66.15  ?  116 LYS H CB    1 
ATOM 5649  C CG    . LYS H 4 117 ? 47.159  89.478  65.854  1.00 66.15  ?  116 LYS H CG    1 
ATOM 5650  C CD    . LYS H 4 117 ? 47.410  90.594  66.854  1.00 66.15  ?  116 LYS H CD    1 
ATOM 5651  C CE    . LYS H 4 117 ? 46.107  91.206  67.323  1.00 66.15  ?  116 LYS H CE    1 
ATOM 5652  N NZ    . LYS H 4 117 ? 46.333  92.317  68.283  1.00 66.15  1  116 LYS H NZ    1 
ATOM 5653  N N     . ALA H 4 118 ? 50.713  90.907  64.477  1.00 65.95  ?  117 ALA H N     1 
ATOM 5654  C CA    . ALA H 4 118 ? 51.229  92.267  64.330  1.00 65.95  ?  117 ALA H CA    1 
ATOM 5655  C C     . ALA H 4 118 ? 51.529  92.602  62.870  1.00 65.95  ?  117 ALA H C     1 
ATOM 5656  O O     . ALA H 4 118 ? 51.241  93.714  62.408  1.00 65.95  ?  117 ALA H O     1 
ATOM 5657  C CB    . ALA H 4 118 ? 52.480  92.452  65.183  1.00 65.95  ?  117 ALA H CB    1 
ATOM 5658  N N     . VAL H 4 119 ? 52.106  91.651  62.133  1.00 64.50  ?  118 VAL H N     1 
ATOM 5659  C CA    . VAL H 4 119 ? 52.512  91.899  60.748  1.00 64.50  ?  118 VAL H CA    1 
ATOM 5660  C C     . VAL H 4 119 ? 51.315  92.125  59.825  1.00 64.50  ?  118 VAL H C     1 
ATOM 5661  O O     . VAL H 4 119 ? 51.358  93.023  58.970  1.00 64.50  ?  118 VAL H O     1 
ATOM 5662  C CB    . VAL H 4 119 ? 53.396  90.740  60.251  1.00 64.50  ?  118 VAL H CB    1 
ATOM 5663  C CG1   . VAL H 4 119 ? 53.703  90.856  58.768  1.00 64.50  ?  118 VAL H CG1   1 
ATOM 5664  C CG2   . VAL H 4 119 ? 54.693  90.726  61.013  1.00 64.50  ?  118 VAL H CG2   1 
ATOM 5665  N N     . THR H 4 120 ? 50.231  91.361  60.002  1.00 69.54  ?  119 THR H N     1 
ATOM 5666  C CA    . THR H 4 120 ? 49.068  91.485  59.125  1.00 69.54  ?  119 THR H CA    1 
ATOM 5667  C C     . THR H 4 120 ? 48.376  92.834  59.269  1.00 69.54  ?  119 THR H C     1 
ATOM 5668  O O     . THR H 4 120 ? 47.841  93.367  58.291  1.00 69.54  ?  119 THR H O     1 
ATOM 5669  C CB    . THR H 4 120 ? 48.078  90.353  59.392  1.00 69.54  ?  119 THR H CB    1 
ATOM 5670  O OG1   . THR H 4 120 ? 47.789  90.286  60.795  1.00 69.54  ?  119 THR H OG1   1 
ATOM 5671  C CG2   . THR H 4 120 ? 48.623  89.024  58.894  1.00 69.54  ?  119 THR H CG2   1 
ATOM 5672  N N     . LYS H 4 121 ? 48.390  93.413  60.465  1.00 70.78  ?  120 LYS H N     1 
ATOM 5673  C CA    . LYS H 4 121 ? 47.832  94.753  60.616  1.00 70.78  ?  120 LYS H CA    1 
ATOM 5674  C C     . LYS H 4 121 ? 48.886  95.818  60.353  1.00 70.78  ?  120 LYS H C     1 
ATOM 5675  O O     . LYS H 4 121 ? 48.573  97.010  60.330  1.00 70.78  ?  120 LYS H O     1 
ATOM 5676  C CB    . LYS H 4 121 ? 47.215  94.924  61.998  1.00 70.78  ?  120 LYS H CB    1 
ATOM 5677  C CG    . LYS H 4 121 ? 48.208  94.968  63.125  1.00 70.78  ?  120 LYS H CG    1 
ATOM 5678  C CD    . LYS H 4 121 ? 47.482  95.007  64.452  1.00 70.78  ?  120 LYS H CD    1 
ATOM 5679  C CE    . LYS H 4 121 ? 46.780  96.333  64.639  1.00 70.78  ?  120 LYS H CE    1 
ATOM 5680  N NZ    . LYS H 4 121 ? 46.131  96.424  65.972  1.00 70.78  1  120 LYS H NZ    1 
ATOM 5681  N N     . TYR H 4 122 ? 50.141  95.413  60.161  1.00 69.77  ?  121 TYR H N     1 
ATOM 5682  C CA    . TYR H 4 122 ? 51.115  96.345  59.603  1.00 69.77  ?  121 TYR H CA    1 
ATOM 5683  C C     . TYR H 4 122 ? 51.028  96.449  58.087  1.00 69.77  ?  121 TYR H C     1 
ATOM 5684  O O     . TYR H 4 122 ? 51.291  97.526  57.540  1.00 69.77  ?  121 TYR H O     1 
ATOM 5685  C CB    . TYR H 4 122 ? 52.537  95.943  60.008  1.00 69.77  ?  121 TYR H CB    1 
ATOM 5686  C CG    . TYR H 4 122 ? 53.618  96.789  59.375  1.00 69.77  ?  121 TYR H CG    1 
ATOM 5687  C CD1   . TYR H 4 122 ? 53.864  98.081  59.811  1.00 69.77  ?  121 TYR H CD1   1 
ATOM 5688  C CD2   . TYR H 4 122 ? 54.386  96.293  58.328  1.00 69.77  ?  121 TYR H CD2   1 
ATOM 5689  C CE1   . TYR H 4 122 ? 54.849  98.850  59.227  1.00 69.77  ?  121 TYR H CE1   1 
ATOM 5690  C CE2   . TYR H 4 122 ? 55.361  97.055  57.740  1.00 69.77  ?  121 TYR H CE2   1 
ATOM 5691  C CZ    . TYR H 4 122 ? 55.590  98.330  58.195  1.00 69.77  ?  121 TYR H CZ    1 
ATOM 5692  O OH    . TYR H 4 122 ? 56.571  99.075  57.592  1.00 69.77  ?  121 TYR H OH    1 
ATOM 5693  N N     . THR H 4 123 ? 50.663  95.369  57.393  1.00 77.14  ?  122 THR H N     1 
ATOM 5694  C CA    . THR H 4 123 ? 50.711  95.361  55.934  1.00 77.14  ?  122 THR H CA    1 
ATOM 5695  C C     . THR H 4 123 ? 49.628  96.249  55.333  1.00 77.14  ?  122 THR H C     1 
ATOM 5696  O O     . THR H 4 123 ? 49.915  97.110  54.493  1.00 77.14  ?  122 THR H O     1 
ATOM 5697  C CB    . THR H 4 123 ? 50.578  93.931  55.415  1.00 77.14  ?  122 THR H CB    1 
ATOM 5698  O OG1   . THR H 4 123 ? 51.637  93.131  55.954  1.00 77.14  ?  122 THR H OG1   1 
ATOM 5699  C CG2   . THR H 4 123 ? 50.656  93.907  53.898  1.00 77.14  ?  122 THR H CG2   1 
ATOM 5700  N N     . SER H 4 124 ? 48.380  96.063  55.753  1.00 79.42  ?  123 SER H N     1 
ATOM 5701  C CA    . SER H 4 124 ? 47.286  96.942  55.337  1.00 79.42  ?  123 SER H CA    1 
ATOM 5702  C C     . SER H 4 124 ? 47.329  98.229  56.153  1.00 79.42  ?  123 SER H C     1 
ATOM 5703  O O     . SER H 4 124 ? 46.523  98.458  57.057  1.00 79.42  ?  123 SER H O     1 
ATOM 5704  C CB    . SER H 4 124 ? 45.945  96.238  55.487  1.00 79.42  ?  123 SER H CB    1 
ATOM 5705  O OG    . SER H 4 124 ? 45.641  96.009  56.851  1.00 79.42  ?  123 SER H OG    1 
ATOM 5706  N N     . SER H 4 125 ? 48.297  99.079  55.825  1.00 81.21  ?  124 SER H N     1 
ATOM 5707  C CA    . SER H 4 125 ? 48.558  100.300 56.573  1.00 81.21  ?  124 SER H CA    1 
ATOM 5708  C C     . SER H 4 125 ? 47.458  101.333 56.375  1.00 81.21  ?  124 SER H C     1 
ATOM 5709  O O     . SER H 4 125 ? 46.749  101.681 57.319  1.00 81.21  ?  124 SER H O     1 
ATOM 5710  C CB    . SER H 4 125 ? 49.906  100.890 56.162  1.00 81.21  ?  124 SER H CB    1 
ATOM 5711  O OG    . SER H 4 125 ? 49.879  101.317 54.812  1.00 81.21  ?  124 SER H OG    1 
ATOM 5712  P P     . DG  I 5 5   ? 100.509 22.897  89.128  1.00 224.26 ?  -69 DG  I P     1 
ATOM 5713  O OP1   . DG  I 5 5   ? 101.646 23.832  88.973  1.00 224.26 ?  -69 DG  I OP1   1 
ATOM 5714  O OP2   . DG  I 5 5   ? 99.464  23.164  90.141  1.00 224.26 -1 -69 DG  I OP2   1 
ATOM 5715  O "O5'" . DG  I 5 5   ? 99.790  22.720  87.711  1.00 224.26 ?  -69 DG  I "O5'" 1 
ATOM 5716  C "C5'" . DG  I 5 5   ? 99.482  23.864  86.928  1.00 224.26 ?  -69 DG  I "C5'" 1 
ATOM 5717  C "C4'" . DG  I 5 5   ? 99.729  23.599  85.454  1.00 224.26 ?  -69 DG  I "C4'" 1 
ATOM 5718  O "O4'" . DG  I 5 5   ? 100.246 24.793  84.852  1.00 224.26 ?  -69 DG  I "O4'" 1 
ATOM 5719  C "C3'" . DG  I 5 5   ? 100.796 22.569  85.158  1.00 224.26 ?  -69 DG  I "C3'" 1 
ATOM 5720  O "O3'" . DG  I 5 5   ? 100.706 22.158  83.797  1.00 224.26 ?  -69 DG  I "O3'" 1 
ATOM 5721  C "C2'" . DG  I 5 5   ? 102.073 23.376  85.401  1.00 224.26 ?  -69 DG  I "C2'" 1 
ATOM 5722  C "C1'" . DG  I 5 5   ? 101.657 24.794  84.974  1.00 224.26 ?  -69 DG  I "C1'" 1 
ATOM 5723  N N9    . DG  I 5 5   ? 102.103 25.844  85.914  1.00 224.26 ?  -69 DG  I N9    1 
ATOM 5724  C C8    . DG  I 5 5   ? 103.364 25.946  86.448  1.00 224.26 ?  -69 DG  I C8    1 
ATOM 5725  N N7    . DG  I 5 5   ? 103.519 26.960  87.248  1.00 224.26 ?  -69 DG  I N7    1 
ATOM 5726  C C5    . DG  I 5 5   ? 102.285 27.589  87.254  1.00 224.26 ?  -69 DG  I C5    1 
ATOM 5727  C C6    . DG  I 5 5   ? 101.866 28.747  87.949  1.00 224.26 ?  -69 DG  I C6    1 
ATOM 5728  O O6    . DG  I 5 5   ? 102.527 29.460  88.716  1.00 224.26 ?  -69 DG  I O6    1 
ATOM 5729  N N1    . DG  I 5 5   ? 100.535 29.054  87.687  1.00 224.26 ?  -69 DG  I N1    1 
ATOM 5730  C C2    . DG  I 5 5   ? 99.713  28.338  86.856  1.00 224.26 ?  -69 DG  I C2    1 
ATOM 5731  N N2    . DG  I 5 5   ? 98.458  28.791  86.725  1.00 224.26 ?  -69 DG  I N2    1 
ATOM 5732  N N3    . DG  I 5 5   ? 100.089 27.253  86.197  1.00 224.26 ?  -69 DG  I N3    1 
ATOM 5733  C C4    . DG  I 5 5   ? 101.389 26.927  86.439  1.00 224.26 ?  -69 DG  I C4    1 
ATOM 5734  P P     . DA  I 5 6   ? 99.514  21.197  83.303  1.00 221.46 ?  -68 DA  I P     1 
ATOM 5735  O OP1   . DA  I 5 6   ? 98.928  20.529  84.486  1.00 221.46 ?  -68 DA  I OP1   1 
ATOM 5736  O OP2   . DA  I 5 6   ? 100.059 20.368  82.206  1.00 221.46 -1 -68 DA  I OP2   1 
ATOM 5737  O "O5'" . DA  I 5 6   ? 98.439  22.208  82.674  1.00 221.46 ?  -68 DA  I "O5'" 1 
ATOM 5738  C "C5'" . DA  I 5 6   ? 97.251  21.702  82.059  1.00 221.46 ?  -68 DA  I "C5'" 1 
ATOM 5739  C "C4'" . DA  I 5 6   ? 96.386  22.827  81.505  1.00 221.46 ?  -68 DA  I "C4'" 1 
ATOM 5740  O "O4'" . DA  I 5 6   ? 96.891  24.109  81.958  1.00 221.46 ?  -68 DA  I "O4'" 1 
ATOM 5741  C "C3'" . DA  I 5 6   ? 96.374  22.941  79.992  1.00 221.46 ?  -68 DA  I "C3'" 1 
ATOM 5742  O "O3'" . DA  I 5 6   ? 95.216  23.661  79.588  1.00 221.46 ?  -68 DA  I "O3'" 1 
ATOM 5743  C "C2'" . DA  I 5 6   ? 97.630  23.763  79.758  1.00 221.46 ?  -68 DA  I "C2'" 1 
ATOM 5744  C "C1'" . DA  I 5 6   ? 97.483  24.798  80.866  1.00 221.46 ?  -68 DA  I "C1'" 1 
ATOM 5745  N N9    . DA  I 5 6   ? 98.743  25.352  81.332  1.00 221.46 ?  -68 DA  I N9    1 
ATOM 5746  C C8    . DA  I 5 6   ? 99.991  24.817  81.180  1.00 221.46 ?  -68 DA  I C8    1 
ATOM 5747  N N7    . DA  I 5 6   ? 100.942 25.534  81.727  1.00 221.46 ?  -68 DA  I N7    1 
ATOM 5748  C C5    . DA  I 5 6   ? 100.268 26.609  82.283  1.00 221.46 ?  -68 DA  I C5    1 
ATOM 5749  C C6    . DA  I 5 6   ? 100.703 27.731  83.016  1.00 221.46 ?  -68 DA  I C6    1 
ATOM 5750  N N6    . DA  I 5 6   ? 101.984 27.962  83.318  1.00 221.46 ?  -68 DA  I N6    1 
ATOM 5751  N N1    . DA  I 5 6   ? 99.766  28.614  83.424  1.00 221.46 ?  -68 DA  I N1    1 
ATOM 5752  C C2    . DA  I 5 6   ? 98.484  28.383  83.123  1.00 221.46 ?  -68 DA  I C2    1 
ATOM 5753  N N3    . DA  I 5 6   ? 97.957  27.366  82.446  1.00 221.46 ?  -68 DA  I N3    1 
ATOM 5754  C C4    . DA  I 5 6   ? 98.912  26.507  82.054  1.00 221.46 ?  -68 DA  I C4    1 
ATOM 5755  P P     . DG  I 5 7   ? 94.146  23.000  78.588  1.00 218.33 ?  -67 DG  I P     1 
ATOM 5756  O OP1   . DG  I 5 7   ? 94.068  21.558  78.909  1.00 218.33 ?  -67 DG  I OP1   1 
ATOM 5757  O OP2   . DG  I 5 7   ? 94.488  23.438  77.217  1.00 218.33 -1 -67 DG  I OP2   1 
ATOM 5758  O "O5'" . DG  I 5 7   ? 92.764  23.703  78.990  1.00 218.33 ?  -67 DG  I "O5'" 1 
ATOM 5759  C "C5'" . DG  I 5 7   ? 91.975  24.345  77.994  1.00 218.33 ?  -67 DG  I "C5'" 1 
ATOM 5760  C "C4'" . DG  I 5 7   ? 91.488  25.700  78.479  1.00 218.33 ?  -67 DG  I "C4'" 1 
ATOM 5761  O "O4'" . DG  I 5 7   ? 92.557  26.361  79.196  1.00 218.33 ?  -67 DG  I "O4'" 1 
ATOM 5762  C "C3'" . DG  I 5 7   ? 91.107  26.672  77.376  1.00 218.33 ?  -67 DG  I "C3'" 1 
ATOM 5763  O "O3'" . DG  I 5 7   ? 90.233  27.671  77.886  1.00 218.33 ?  -67 DG  I "O3'" 1 
ATOM 5764  C "C2'" . DG  I 5 7   ? 92.458  27.261  77.015  1.00 218.33 ?  -67 DG  I "C2'" 1 
ATOM 5765  C "C1'" . DG  I 5 7   ? 93.106  27.389  78.391  1.00 218.33 ?  -67 DG  I "C1'" 1 
ATOM 5766  N N9    . DG  I 5 7   ? 94.553  27.224  78.363  1.00 218.33 ?  -67 DG  I N9    1 
ATOM 5767  C C8    . DG  I 5 7   ? 95.256  26.225  77.739  1.00 218.33 ?  -67 DG  I C8    1 
ATOM 5768  N N7    . DG  I 5 7   ? 96.545  26.332  77.882  1.00 218.33 ?  -67 DG  I N7    1 
ATOM 5769  C C5    . DG  I 5 7   ? 96.708  27.473  78.653  1.00 218.33 ?  -67 DG  I C5    1 
ATOM 5770  C C6    . DG  I 5 7   ? 97.886  28.086  79.132  1.00 218.33 ?  -67 DG  I C6    1 
ATOM 5771  O O6    . DG  I 5 7   ? 99.058  27.730  78.962  1.00 218.33 ?  -67 DG  I O6    1 
ATOM 5772  N N1    . DG  I 5 7   ? 97.606  29.226  79.876  1.00 218.33 ?  -67 DG  I N1    1 
ATOM 5773  C C2    . DG  I 5 7   ? 96.345  29.713  80.125  1.00 218.33 ?  -67 DG  I C2    1 
ATOM 5774  N N2    . DG  I 5 7   ? 96.271  30.828  80.864  1.00 218.33 ?  -67 DG  I N2    1 
ATOM 5775  N N3    . DG  I 5 7   ? 95.232  29.147  79.683  1.00 218.33 ?  -67 DG  I N3    1 
ATOM 5776  C C4    . DG  I 5 7   ? 95.489  28.033  78.960  1.00 218.33 ?  -67 DG  I C4    1 
ATOM 5777  P P     . DA  I 5 8   ? 89.729  28.864  76.933  1.00 211.26 ?  -66 DA  I P     1 
ATOM 5778  O OP1   . DA  I 5 8   ? 88.348  29.201  77.344  1.00 211.26 ?  -66 DA  I OP1   1 
ATOM 5779  O OP2   . DA  I 5 8   ? 89.999  28.468  75.533  1.00 211.26 -1 -66 DA  I OP2   1 
ATOM 5780  O "O5'" . DA  I 5 8   ? 90.689  30.094  77.299  1.00 211.26 ?  -66 DA  I "O5'" 1 
ATOM 5781  C "C5'" . DA  I 5 8   ? 90.433  30.878  78.464  1.00 211.26 ?  -66 DA  I "C5'" 1 
ATOM 5782  C "C4'" . DA  I 5 8   ? 91.437  32.013  78.597  1.00 211.26 ?  -66 DA  I "C4'" 1 
ATOM 5783  O "O4'" . DA  I 5 8   ? 92.784  31.475  78.608  1.00 211.26 ?  -66 DA  I "O4'" 1 
ATOM 5784  C "C3'" . DA  I 5 8   ? 91.404  33.055  77.475  1.00 211.26 ?  -66 DA  I "C3'" 1 
ATOM 5785  O "O3'" . DA  I 5 8   ? 91.515  34.360  78.023  1.00 211.26 ?  -66 DA  I "O3'" 1 
ATOM 5786  C "C2'" . DA  I 5 8   ? 92.626  32.701  76.634  1.00 211.26 ?  -66 DA  I "C2'" 1 
ATOM 5787  C "C1'" . DA  I 5 8   ? 93.580  32.197  77.699  1.00 211.26 ?  -66 DA  I "C1'" 1 
ATOM 5788  N N9    . DA  I 5 8   ? 94.602  31.305  77.176  1.00 211.26 ?  -66 DA  I N9    1 
ATOM 5789  C C8    . DA  I 5 8   ? 94.403  30.132  76.507  1.00 211.26 ?  -66 DA  I C8    1 
ATOM 5790  N N7    . DA  I 5 8   ? 95.511  29.534  76.147  1.00 211.26 ?  -66 DA  I N7    1 
ATOM 5791  C C5    . DA  I 5 8   ? 96.504  30.373  76.614  1.00 211.26 ?  -66 DA  I C5    1 
ATOM 5792  C C6    . DA  I 5 8   ? 97.905  30.306  76.553  1.00 211.26 ?  -66 DA  I C6    1 
ATOM 5793  N N6    . DA  I 5 8   ? 98.564  29.300  75.971  1.00 211.26 ?  -66 DA  I N6    1 
ATOM 5794  N N1    . DA  I 5 8   ? 98.606  31.313  77.118  1.00 211.26 ?  -66 DA  I N1    1 
ATOM 5795  C C2    . DA  I 5 8   ? 97.942  32.319  77.701  1.00 211.26 ?  -66 DA  I C2    1 
ATOM 5796  N N3    . DA  I 5 8   ? 96.628  32.491  77.818  1.00 211.26 ?  -66 DA  I N3    1 
ATOM 5797  C C4    . DA  I 5 8   ? 95.961  31.473  77.248  1.00 211.26 ?  -66 DA  I C4    1 
ATOM 5798  P P     . DA  I 5 9   ? 91.569  35.644  77.059  1.00 194.65 ?  -65 DA  I P     1 
ATOM 5799  O OP1   . DA  I 5 9   ? 90.822  36.724  77.736  1.00 194.65 ?  -65 DA  I OP1   1 
ATOM 5800  O OP2   . DA  I 5 9   ? 91.183  35.222  75.694  1.00 194.65 -1 -65 DA  I OP2   1 
ATOM 5801  O "O5'" . DA  I 5 9   ? 93.116  36.047  77.032  1.00 194.65 ?  -65 DA  I "O5'" 1 
ATOM 5802  C "C5'" . DA  I 5 9   ? 93.638  36.924  78.026  1.00 194.65 ?  -65 DA  I "C5'" 1 
ATOM 5803  C "C4'" . DA  I 5 9   ? 94.988  37.500  77.616  1.00 194.65 ?  -65 DA  I "C4'" 1 
ATOM 5804  O "O4'" . DA  I 5 9   ? 95.856  36.438  77.144  1.00 194.65 ?  -65 DA  I "O4'" 1 
ATOM 5805  C "C3'" . DA  I 5 9   ? 94.954  38.538  76.497  1.00 194.65 ?  -65 DA  I "C3'" 1 
ATOM 5806  O "O3'" . DA  I 5 9   ? 95.953  39.521  76.734  1.00 194.65 ?  -65 DA  I "O3'" 1 
ATOM 5807  C "C2'" . DA  I 5 9   ? 95.275  37.708  75.258  1.00 194.65 ?  -65 DA  I "C2'" 1 
ATOM 5808  C "C1'" . DA  I 5 9   ? 96.275  36.710  75.819  1.00 194.65 ?  -65 DA  I "C1'" 1 
ATOM 5809  N N9    . DA  I 5 9   ? 96.320  35.443  75.102  1.00 194.65 ?  -65 DA  I N9    1 
ATOM 5810  C C8    . DA  I 5 9   ? 95.263  34.643  74.772  1.00 194.65 ?  -65 DA  I C8    1 
ATOM 5811  N N7    . DA  I 5 9   ? 95.606  33.544  74.146  1.00 194.65 ?  -65 DA  I N7    1 
ATOM 5812  C C5    . DA  I 5 9   ? 96.983  33.624  74.072  1.00 194.65 ?  -65 DA  I C5    1 
ATOM 5813  C C6    . DA  I 5 9   ? 97.953  32.768  73.526  1.00 194.65 ?  -65 DA  I C6    1 
ATOM 5814  N N6    . DA  I 5 9   ? 97.655  31.614  72.927  1.00 194.65 ?  -65 DA  I N6    1 
ATOM 5815  N N1    . DA  I 5 9   ? 99.248  33.144  73.620  1.00 194.65 ?  -65 DA  I N1    1 
ATOM 5816  C C2    . DA  I 5 9   ? 99.541  34.305  74.218  1.00 194.65 ?  -65 DA  I C2    1 
ATOM 5817  N N3    . DA  I 5 9   ? 98.715  35.189  74.772  1.00 194.65 ?  -65 DA  I N3    1 
ATOM 5818  C C4    . DA  I 5 9   ? 97.440  34.786  74.662  1.00 194.65 ?  -65 DA  I C4    1 
ATOM 5819  P P     . DT  I 5 10  ? 96.230  40.675  75.654  1.00 190.17 ?  -64 DT  I P     1 
ATOM 5820  O OP1   . DT  I 5 10  ? 96.612  41.895  76.397  1.00 190.17 ?  -64 DT  I OP1   1 
ATOM 5821  O OP2   . DT  I 5 10  ? 95.083  40.708  74.722  1.00 190.17 -1 -64 DT  I OP2   1 
ATOM 5822  O "O5'" . DT  I 5 10  ? 97.509  40.157  74.850  1.00 190.17 ?  -64 DT  I "O5'" 1 
ATOM 5823  C "C5'" . DT  I 5 10  ? 98.763  40.049  75.509  1.00 190.17 ?  -64 DT  I "C5'" 1 
ATOM 5824  C "C4'" . DT  I 5 10  ? 99.887  39.849  74.508  1.00 190.17 ?  -64 DT  I "C4'" 1 
ATOM 5825  O "O4'" . DT  I 5 10  ? 99.833  38.501  73.975  1.00 190.17 ?  -64 DT  I "O4'" 1 
ATOM 5826  C "C3'" . DT  I 5 10  ? 99.859  40.794  73.304  1.00 190.17 ?  -64 DT  I "C3'" 1 
ATOM 5827  O "O3'" . DT  I 5 10  ? 101.156 41.330  73.081  1.00 190.17 ?  -64 DT  I "O3'" 1 
ATOM 5828  C "C2'" . DT  I 5 10  ? 99.407  39.898  72.151  1.00 190.17 ?  -64 DT  I "C2'" 1 
ATOM 5829  C "C1'" . DT  I 5 10  ? 99.938  38.538  72.572  1.00 190.17 ?  -64 DT  I "C1'" 1 
ATOM 5830  N N1    . DT  I 5 10  ? 99.150  37.408  72.023  1.00 190.17 ?  -64 DT  I N1    1 
ATOM 5831  C C2    . DT  I 5 10  ? 99.802  36.347  71.440  1.00 190.17 ?  -64 DT  I C2    1 
ATOM 5832  O O2    . DT  I 5 10  ? 101.014 36.277  71.348  1.00 190.17 ?  -64 DT  I O2    1 
ATOM 5833  N N3    . DT  I 5 10  ? 98.979  35.361  70.971  1.00 190.17 ?  -64 DT  I N3    1 
ATOM 5834  C C4    . DT  I 5 10  ? 97.599  35.334  71.023  1.00 190.17 ?  -64 DT  I C4    1 
ATOM 5835  O O4    . DT  I 5 10  ? 96.943  34.403  70.573  1.00 190.17 ?  -64 DT  I O4    1 
ATOM 5836  C C5    . DT  I 5 10  ? 96.983  36.475  71.644  1.00 190.17 ?  -64 DT  I C5    1 
ATOM 5837  C C7    . DT  I 5 10  ? 95.492  36.554  71.752  1.00 190.17 ?  -64 DT  I C7    1 
ATOM 5838  C C6    . DT  I 5 10  ? 97.777  37.446  72.108  1.00 190.17 ?  -64 DT  I C6    1 
ATOM 5839  P P     . DC  I 5 11  ? 101.431 42.326  71.849  1.00 191.11 ?  -63 DC  I P     1 
ATOM 5840  O OP1   . DC  I 5 11  ? 102.350 43.380  72.331  1.00 191.11 ?  -63 DC  I OP1   1 
ATOM 5841  O OP2   . DC  I 5 11  ? 100.136 42.710  71.246  1.00 191.11 -1 -63 DC  I OP2   1 
ATOM 5842  O "O5'" . DC  I 5 11  ? 102.215 41.414  70.797  1.00 191.11 ?  -63 DC  I "O5'" 1 
ATOM 5843  C "C5'" . DC  I 5 11  ? 103.400 40.734  71.197  1.00 191.11 ?  -63 DC  I "C5'" 1 
ATOM 5844  C "C4'" . DC  I 5 11  ? 103.898 39.811  70.100  1.00 191.11 ?  -63 DC  I "C4'" 1 
ATOM 5845  O "O4'" . DC  I 5 11  ? 102.930 38.755  69.874  1.00 191.11 ?  -63 DC  I "O4'" 1 
ATOM 5846  C "C3'" . DC  I 5 11  ? 104.128 40.479  68.744  1.00 191.11 ?  -63 DC  I "C3'" 1 
ATOM 5847  O "O3'" . DC  I 5 11  ? 105.363 40.044  68.198  1.00 191.11 ?  -63 DC  I "O3'" 1 
ATOM 5848  C "C2'" . DC  I 5 11  ? 102.943 40.002  67.905  1.00 191.11 ?  -63 DC  I "C2'" 1 
ATOM 5849  C "C1'" . DC  I 5 11  ? 102.690 38.627  68.495  1.00 191.11 ?  -63 DC  I "C1'" 1 
ATOM 5850  N N1    . DC  I 5 11  ? 101.298 38.152  68.308  1.00 191.11 ?  -63 DC  I N1    1 
ATOM 5851  C C2    . DC  I 5 11  ? 101.067 36.943  67.652  1.00 191.11 ?  -63 DC  I C2    1 
ATOM 5852  O O2    . DC  I 5 11  ? 102.027 36.294  67.238  1.00 191.11 ?  -63 DC  I O2    1 
ATOM 5853  N N3    . DC  I 5 11  ? 99.794  36.518  67.488  1.00 191.11 ?  -63 DC  I N3    1 
ATOM 5854  C C4    . DC  I 5 11  ? 98.783  37.252  67.952  1.00 191.11 ?  -63 DC  I C4    1 
ATOM 5855  N N4    . DC  I 5 11  ? 97.543  36.794  67.769  1.00 191.11 ?  -63 DC  I N4    1 
ATOM 5856  C C5    . DC  I 5 11  ? 98.999  38.489  68.626  1.00 191.11 ?  -63 DC  I C5    1 
ATOM 5857  C C6    . DC  I 5 11  ? 100.261 38.897  68.778  1.00 191.11 ?  -63 DC  I C6    1 
ATOM 5858  P P     . DC  I 5 12  ? 105.876 40.622  66.790  1.00 187.05 ?  -62 DC  I P     1 
ATOM 5859  O OP1   . DC  I 5 12  ? 107.354 40.642  66.824  1.00 187.05 ?  -62 DC  I OP1   1 
ATOM 5860  O OP2   . DC  I 5 12  ? 105.127 41.866  66.508  1.00 187.05 -1 -62 DC  I OP2   1 
ATOM 5861  O "O5'" . DC  I 5 12  ? 105.404 39.519  65.737  1.00 187.05 ?  -62 DC  I "O5'" 1 
ATOM 5862  C "C5'" . DC  I 5 12  ? 105.606 38.145  66.021  1.00 187.05 ?  -62 DC  I "C5'" 1 
ATOM 5863  C "C4'" . DC  I 5 12  ? 105.296 37.298  64.805  1.00 187.05 ?  -62 DC  I "C4'" 1 
ATOM 5864  O "O4'" . DC  I 5 12  ? 103.916 36.858  64.854  1.00 187.05 ?  -62 DC  I "O4'" 1 
ATOM 5865  C "C3'" . DC  I 5 12  ? 105.479 38.010  63.466  1.00 187.05 ?  -62 DC  I "C3'" 1 
ATOM 5866  O "O3'" . DC  I 5 12  ? 106.229 37.192  62.591  1.00 187.05 ?  -62 DC  I "O3'" 1 
ATOM 5867  C "C2'" . DC  I 5 12  ? 104.049 38.221  62.964  1.00 187.05 ?  -62 DC  I "C2'" 1 
ATOM 5868  C "C1'" . DC  I 5 12  ? 103.309 37.057  63.601  1.00 187.05 ?  -62 DC  I "C1'" 1 
ATOM 5869  N N1    . DC  I 5 12  ? 101.875 37.333  63.837  1.00 187.05 ?  -62 DC  I N1    1 
ATOM 5870  C C2    . DC  I 5 12  ? 100.907 36.454  63.343  1.00 187.05 ?  -62 DC  I C2    1 
ATOM 5871  O O2    . DC  I 5 12  ? 101.262 35.460  62.708  1.00 187.05 ?  -62 DC  I O2    1 
ATOM 5872  N N3    . DC  I 5 12  ? 99.602  36.719  63.577  1.00 187.05 ?  -62 DC  I N3    1 
ATOM 5873  C C4    . DC  I 5 12  ? 99.257  37.804  64.270  1.00 187.05 ?  -62 DC  I C4    1 
ATOM 5874  N N4    . DC  I 5 12  ? 97.957  38.028  64.477  1.00 187.05 ?  -62 DC  I N4    1 
ATOM 5875  C C5    . DC  I 5 12  ? 100.230 38.711  64.782  1.00 187.05 ?  -62 DC  I C5    1 
ATOM 5876  C C6    . DC  I 5 12  ? 101.513 38.437  64.545  1.00 187.05 ?  -62 DC  I C6    1 
ATOM 5877  P P     . DG  I 5 13  ? 106.696 37.750  61.161  1.00 178.17 ?  -61 DG  I P     1 
ATOM 5878  O OP1   . DG  I 5 13  ? 108.116 37.379  60.980  1.00 178.17 ?  -61 DG  I OP1   1 
ATOM 5879  O OP2   . DG  I 5 13  ? 106.294 39.170  61.067  1.00 178.17 -1 -61 DG  I OP2   1 
ATOM 5880  O "O5'" . DG  I 5 13  ? 105.812 36.909  60.132  1.00 178.17 ?  -61 DG  I "O5'" 1 
ATOM 5881  C "C5'" . DG  I 5 13  ? 105.717 35.498  60.277  1.00 178.17 ?  -61 DG  I "C5'" 1 
ATOM 5882  C "C4'" . DG  I 5 13  ? 104.659 34.927  59.354  1.00 178.17 ?  -61 DG  I "C4'" 1 
ATOM 5883  O "O4'" . DG  I 5 13  ? 103.341 35.193  59.896  1.00 178.17 ?  -61 DG  I "O4'" 1 
ATOM 5884  C "C3'" . DG  I 5 13  ? 104.664 35.497  57.937  1.00 178.17 ?  -61 DG  I "C3'" 1 
ATOM 5885  O "O3'" . DG  I 5 13  ? 104.532 34.447  57.000  1.00 178.17 ?  -61 DG  I "O3'" 1 
ATOM 5886  C "C2'" . DG  I 5 13  ? 103.449 36.424  57.917  1.00 178.17 ?  -61 DG  I "C2'" 1 
ATOM 5887  C "C1'" . DG  I 5 13  ? 102.514 35.726  58.889  1.00 178.17 ?  -61 DG  I "C1'" 1 
ATOM 5888  N N9    . DG  I 5 13  ? 101.553 36.620  59.521  1.00 178.17 ?  -61 DG  I N9    1 
ATOM 5889  C C8    . DG  I 5 13  ? 101.832 37.746  60.252  1.00 178.17 ?  -61 DG  I C8    1 
ATOM 5890  N N7    . DG  I 5 13  ? 100.771 38.345  60.708  1.00 178.17 ?  -61 DG  I N7    1 
ATOM 5891  C C5    . DG  I 5 13  ? 99.720  37.563  60.254  1.00 178.17 ?  -61 DG  I C5    1 
ATOM 5892  C C6    . DG  I 5 13  ? 98.330  37.717  60.438  1.00 178.17 ?  -61 DG  I C6    1 
ATOM 5893  O O6    . DG  I 5 13  ? 97.736  38.606  61.058  1.00 178.17 ?  -61 DG  I O6    1 
ATOM 5894  N N1    . DG  I 5 13  ? 97.610  36.704  59.811  1.00 178.17 ?  -61 DG  I N1    1 
ATOM 5895  C C2    . DG  I 5 13  ? 98.168  35.675  59.100  1.00 178.17 ?  -61 DG  I C2    1 
ATOM 5896  N N2    . DG  I 5 13  ? 97.313  34.795  58.570  1.00 178.17 ?  -61 DG  I N2    1 
ATOM 5897  N N3    . DG  I 5 13  ? 99.472  35.517  58.919  1.00 178.17 ?  -61 DG  I N3    1 
ATOM 5898  C C4    . DG  I 5 13  ? 100.184 36.496  59.524  1.00 178.17 ?  -61 DG  I C4    1 
ATOM 5899  P P     . DG  I 5 14  ? 104.801 34.721  55.443  1.00 168.41 ?  -60 DG  I P     1 
ATOM 5900  O OP1   . DG  I 5 14  ? 105.719 33.671  54.949  1.00 168.41 ?  -60 DG  I OP1   1 
ATOM 5901  O OP2   . DG  I 5 14  ? 105.163 36.147  55.295  1.00 168.41 -1 -60 DG  I OP2   1 
ATOM 5902  O "O5'" . DG  I 5 14  ? 103.370 34.510  54.773  1.00 168.41 ?  -60 DG  I "O5'" 1 
ATOM 5903  C "C5'" . DG  I 5 14  ? 102.660 33.304  54.995  1.00 168.41 ?  -60 DG  I "C5'" 1 
ATOM 5904  C "C4'" . DG  I 5 14  ? 101.261 33.382  54.412  1.00 168.41 ?  -60 DG  I "C4'" 1 
ATOM 5905  O "O4'" . DG  I 5 14  ? 100.426 34.211  55.255  1.00 168.41 ?  -60 DG  I "O4'" 1 
ATOM 5906  C "C3'" . DG  I 5 14  ? 101.174 33.965  53.006  1.00 168.41 ?  -60 DG  I "C3'" 1 
ATOM 5907  O "O3'" . DG  I 5 14  ? 100.299 33.180  52.222  1.00 168.41 ?  -60 DG  I "O3'" 1 
ATOM 5908  C "C2'" . DG  I 5 14  ? 100.626 35.377  53.227  1.00 168.41 ?  -60 DG  I "C2'" 1 
ATOM 5909  C "C1'" . DG  I 5 14  ? 99.793  35.210  54.488  1.00 168.41 ?  -60 DG  I "C1'" 1 
ATOM 5910  N N9    . DG  I 5 14  ? 99.726  36.411  55.309  1.00 168.41 ?  -60 DG  I N9    1 
ATOM 5911  C C8    . DG  I 5 14  ? 100.783 37.157  55.766  1.00 168.41 ?  -60 DG  I C8    1 
ATOM 5912  N N7    . DG  I 5 14  ? 100.424 38.169  56.502  1.00 168.41 ?  -60 DG  I N7    1 
ATOM 5913  C C5    . DG  I 5 14  ? 99.042  38.085  56.541  1.00 168.41 ?  -60 DG  I C5    1 
ATOM 5914  C C6    . DG  I 5 14  ? 98.101  38.913  57.187  1.00 168.41 ?  -60 DG  I C6    1 
ATOM 5915  O O6    . DG  I 5 14  ? 98.312  39.917  57.875  1.00 168.41 ?  -60 DG  I O6    1 
ATOM 5916  N N1    . DG  I 5 14  ? 96.799  38.475  56.973  1.00 168.41 ?  -60 DG  I N1    1 
ATOM 5917  C C2    . DG  I 5 14  ? 96.453  37.374  56.228  1.00 168.41 ?  -60 DG  I C2    1 
ATOM 5918  N N2    . DG  I 5 14  ? 95.145  37.104  56.130  1.00 168.41 ?  -60 DG  I N2    1 
ATOM 5919  N N3    . DG  I 5 14  ? 97.328  36.591  55.616  1.00 168.41 ?  -60 DG  I N3    1 
ATOM 5920  C C4    . DG  I 5 14  ? 98.598  37.004  55.816  1.00 168.41 ?  -60 DG  I C4    1 
ATOM 5921  P P     . DT  I 5 15  ? 100.256 33.362  50.628  1.00 159.19 ?  -59 DT  I P     1 
ATOM 5922  O OP1   . DT  I 5 15  ? 100.269 32.016  50.017  1.00 159.19 ?  -59 DT  I OP1   1 
ATOM 5923  O OP2   . DT  I 5 15  ? 101.289 34.354  50.260  1.00 159.19 -1 -59 DT  I OP2   1 
ATOM 5924  O "O5'" . DT  I 5 15  ? 98.829  34.023  50.371  1.00 159.19 ?  -59 DT  I "O5'" 1 
ATOM 5925  C "C5'" . DT  I 5 15  ? 97.715  33.615  51.149  1.00 159.19 ?  -59 DT  I "C5'" 1 
ATOM 5926  C "C4'" . DT  I 5 15  ? 96.535  34.538  50.922  1.00 159.19 ?  -59 DT  I "C4'" 1 
ATOM 5927  O "O4'" . DT  I 5 15  ? 96.540  35.601  51.914  1.00 159.19 ?  -59 DT  I "O4'" 1 
ATOM 5928  C "C3'" . DT  I 5 15  ? 96.512  35.230  49.558  1.00 159.19 ?  -59 DT  I "C3'" 1 
ATOM 5929  O "O3'" . DT  I 5 15  ? 95.197  35.199  49.034  1.00 159.19 ?  -59 DT  I "O3'" 1 
ATOM 5930  C "C2'" . DT  I 5 15  ? 96.948  36.655  49.891  1.00 159.19 ?  -59 DT  I "C2'" 1 
ATOM 5931  C "C1'" . DT  I 5 15  ? 96.335  36.832  51.266  1.00 159.19 ?  -59 DT  I "C1'" 1 
ATOM 5932  N N1    . DT  I 5 15  ? 96.976  37.906  52.068  1.00 159.19 ?  -59 DT  I N1    1 
ATOM 5933  C C2    . DT  I 5 15  ? 96.187  38.764  52.795  1.00 159.19 ?  -59 DT  I C2    1 
ATOM 5934  O O2    . DT  I 5 15  ? 94.973  38.692  52.823  1.00 159.19 ?  -59 DT  I O2    1 
ATOM 5935  N N3    . DT  I 5 15  ? 96.876  39.717  53.496  1.00 159.19 ?  -59 DT  I N3    1 
ATOM 5936  C C4    . DT  I 5 15  ? 98.246  39.890  53.539  1.00 159.19 ?  -59 DT  I C4    1 
ATOM 5937  O O4    . DT  I 5 15  ? 98.778  40.774  54.196  1.00 159.19 ?  -59 DT  I O4    1 
ATOM 5938  C C5    . DT  I 5 15  ? 99.011  38.959  52.753  1.00 159.19 ?  -59 DT  I C5    1 
ATOM 5939  C C7    . DT  I 5 15  ? 100.507 39.055  52.722  1.00 159.19 ?  -59 DT  I C7    1 
ATOM 5940  C C6    . DT  I 5 15  ? 98.348  38.023  52.062  1.00 159.19 ?  -59 DT  I C6    1 
ATOM 5941  P P     . DG  I 5 16  ? 94.918  35.596  47.504  1.00 149.02 ?  -58 DG  I P     1 
ATOM 5942  O OP1   . DG  I 5 16  ? 94.445  34.378  46.813  1.00 149.02 ?  -58 DG  I OP1   1 
ATOM 5943  O OP2   . DG  I 5 16  ? 96.097  36.320  46.980  1.00 149.02 -1 -58 DG  I OP2   1 
ATOM 5944  O "O5'" . DG  I 5 16  ? 93.702  36.629  47.603  1.00 149.02 ?  -58 DG  I "O5'" 1 
ATOM 5945  C "C5'" . DG  I 5 16  ? 92.451  36.203  48.139  1.00 149.02 ?  -58 DG  I "C5'" 1 
ATOM 5946  C "C4'" . DG  I 5 16  ? 91.666  37.366  48.735  1.00 149.02 ?  -58 DG  I "C4'" 1 
ATOM 5947  O "O4'" . DG  I 5 16  ? 92.506  38.122  49.647  1.00 149.02 ?  -58 DG  I "O4'" 1 
ATOM 5948  C "C3'" . DG  I 5 16  ? 91.121  38.379  47.735  1.00 149.02 ?  -58 DG  I "C3'" 1 
ATOM 5949  O "O3'" . DG  I 5 16  ? 89.868  38.857  48.197  1.00 149.02 ?  -58 DG  I "O3'" 1 
ATOM 5950  C "C2'" . DG  I 5 16  ? 92.180  39.475  47.766  1.00 149.02 ?  -58 DG  I "C2'" 1 
ATOM 5951  C "C1'" . DG  I 5 16  ? 92.568  39.474  49.236  1.00 149.02 ?  -58 DG  I "C1'" 1 
ATOM 5952  N N9    . DG  I 5 16  ? 93.922  39.950  49.495  1.00 149.02 ?  -58 DG  I N9    1 
ATOM 5953  C C8    . DG  I 5 16  ? 95.082  39.416  49.003  1.00 149.02 ?  -58 DG  I C8    1 
ATOM 5954  N N7    . DG  I 5 16  ? 96.155  40.022  49.423  1.00 149.02 ?  -58 DG  I N7    1 
ATOM 5955  C C5    . DG  I 5 16  ? 95.677  41.025  50.250  1.00 149.02 ?  -58 DG  I C5    1 
ATOM 5956  C C6    . DG  I 5 16  ? 96.379  42.006  50.984  1.00 149.02 ?  -58 DG  I C6    1 
ATOM 5957  O O6    . DG  I 5 16  ? 97.600  42.184  51.050  1.00 149.02 ?  -58 DG  I O6    1 
ATOM 5958  N N1    . DG  I 5 16  ? 95.518  42.833  51.695  1.00 149.02 ?  -58 DG  I N1    1 
ATOM 5959  C C2    . DG  I 5 16  ? 94.150  42.722  51.697  1.00 149.02 ?  -58 DG  I C2    1 
ATOM 5960  N N2    . DG  I 5 16  ? 93.482  43.612  52.445  1.00 149.02 ?  -58 DG  I N2    1 
ATOM 5961  N N3    . DG  I 5 16  ? 93.477  41.805  51.010  1.00 149.02 ?  -58 DG  I N3    1 
ATOM 5962  C C4    . DG  I 5 16  ? 94.303  40.993  50.312  1.00 149.02 ?  -58 DG  I C4    1 
ATOM 5963  P P     . DC  I 5 17  ? 88.901  39.709  47.237  1.00 142.44 ?  -57 DC  I P     1 
ATOM 5964  O OP1   . DC  I 5 17  ? 87.815  38.808  46.795  1.00 142.44 ?  -57 DC  I OP1   1 
ATOM 5965  O OP2   . DC  I 5 17  ? 89.723  40.419  46.232  1.00 142.44 -1 -57 DC  I OP2   1 
ATOM 5966  O "O5'" . DC  I 5 17  ? 88.283  40.805  48.221  1.00 142.44 ?  -57 DC  I "O5'" 1 
ATOM 5967  C "C5'" . DC  I 5 17  ? 89.066  41.301  49.304  1.00 142.44 ?  -57 DC  I "C5'" 1 
ATOM 5968  C "C4'" . DC  I 5 17  ? 89.037  42.815  49.341  1.00 142.44 ?  -57 DC  I "C4'" 1 
ATOM 5969  O "O4'" . DC  I 5 17  ? 90.378  43.313  49.609  1.00 142.44 ?  -57 DC  I "O4'" 1 
ATOM 5970  C "C3'" . DC  I 5 17  ? 88.639  43.471  48.025  1.00 142.44 ?  -57 DC  I "C3'" 1 
ATOM 5971  O "O3'" . DC  I 5 17  ? 88.196  44.794  48.275  1.00 142.44 ?  -57 DC  I "O3'" 1 
ATOM 5972  C "C2'" . DC  I 5 17  ? 89.982  43.507  47.331  1.00 142.44 ?  -57 DC  I "C2'" 1 
ATOM 5973  C "C1'" . DC  I 5 17  ? 90.815  44.044  48.483  1.00 142.44 ?  -57 DC  I "C1'" 1 
ATOM 5974  N N1    . DC  I 5 17  ? 92.283  43.876  48.321  1.00 142.44 ?  -57 DC  I N1    1 
ATOM 5975  C C2    . DC  I 5 17  ? 93.156  44.714  49.025  1.00 142.44 ?  -57 DC  I C2    1 
ATOM 5976  O O2    . DC  I 5 17  ? 92.686  45.576  49.776  1.00 142.44 ?  -57 DC  I O2    1 
ATOM 5977  N N3    . DC  I 5 17  ? 94.491  44.550  48.865  1.00 142.44 ?  -57 DC  I N3    1 
ATOM 5978  C C4    . DC  I 5 17  ? 94.951  43.604  48.046  1.00 142.44 ?  -57 DC  I C4    1 
ATOM 5979  N N4    . DC  I 5 17  ? 96.273  43.479  47.914  1.00 142.44 ?  -57 DC  I N4    1 
ATOM 5980  C C5    . DC  I 5 17  ? 94.077  42.751  47.317  1.00 142.44 ?  -57 DC  I C5    1 
ATOM 5981  C C6    . DC  I 5 17  ? 92.766  42.927  47.479  1.00 142.44 ?  -57 DC  I C6    1 
ATOM 5982  P P     . DC  I 5 18  ? 86.638  45.144  48.457  1.00 129.60 ?  -56 DC  I P     1 
ATOM 5983  O OP1   . DC  I 5 18  ? 86.015  44.144  49.351  1.00 129.60 ?  -56 DC  I OP1   1 
ATOM 5984  O OP2   . DC  I 5 18  ? 86.068  45.387  47.114  1.00 129.60 -1 -56 DC  I OP2   1 
ATOM 5985  O "O5'" . DC  I 5 18  ? 86.686  46.545  49.220  1.00 129.60 ?  -56 DC  I "O5'" 1 
ATOM 5986  C "C5'" . DC  I 5 18  ? 87.781  46.828  50.090  1.00 129.60 ?  -56 DC  I "C5'" 1 
ATOM 5987  C "C4'" . DC  I 5 18  ? 88.430  48.155  49.739  1.00 129.60 ?  -56 DC  I "C4'" 1 
ATOM 5988  O "O4'" . DC  I 5 18  ? 89.797  47.943  49.281  1.00 129.60 ?  -56 DC  I "O4'" 1 
ATOM 5989  C "C3'" . DC  I 5 18  ? 87.740  48.938  48.630  1.00 129.60 ?  -56 DC  I "C3'" 1 
ATOM 5990  O "O3'" . DC  I 5 18  ? 87.823  50.316  48.919  1.00 129.60 ?  -56 DC  I "O3'" 1 
ATOM 5991  C "C2'" . DC  I 5 18  ? 88.587  48.581  47.413  1.00 129.60 ?  -56 DC  I "C2'" 1 
ATOM 5992  C "C1'" . DC  I 5 18  ? 89.969  48.586  48.039  1.00 129.60 ?  -56 DC  I "C1'" 1 
ATOM 5993  N N1    . DC  I 5 18  ? 90.998  47.842  47.260  1.00 129.60 ?  -56 DC  I N1    1 
ATOM 5994  C C2    . DC  I 5 18  ? 92.354  48.106  47.474  1.00 129.60 ?  -56 DC  I C2    1 
ATOM 5995  O O2    . DC  I 5 18  ? 92.679  48.961  48.299  1.00 129.60 ?  -56 DC  I O2    1 
ATOM 5996  N N3    . DC  I 5 18  ? 93.277  47.413  46.765  1.00 129.60 ?  -56 DC  I N3    1 
ATOM 5997  C C4    . DC  I 5 18  ? 92.888  46.496  45.883  1.00 129.60 ?  -56 DC  I C4    1 
ATOM 5998  N N4    . DC  I 5 18  ? 93.831  45.834  45.208  1.00 129.60 ?  -56 DC  I N4    1 
ATOM 5999  C C5    . DC  I 5 18  ? 91.514  46.219  45.648  1.00 129.60 ?  -56 DC  I C5    1 
ATOM 6000  C C6    . DC  I 5 18  ? 90.612  46.908  46.352  1.00 129.60 ?  -56 DC  I C6    1 
ATOM 6001  P P     . DG  I 5 19  ? 86.563  51.103  49.527  1.00 119.18 ?  -55 DG  I P     1 
ATOM 6002  O OP1   . DG  I 5 19  ? 86.047  50.326  50.673  1.00 119.18 ?  -55 DG  I OP1   1 
ATOM 6003  O OP2   . DG  I 5 19  ? 85.663  51.442  48.404  1.00 119.18 -1 -55 DG  I OP2   1 
ATOM 6004  O "O5'" . DG  I 5 19  ? 87.201  52.460  50.079  1.00 119.18 ?  -55 DG  I "O5'" 1 
ATOM 6005  C "C5'" . DG  I 5 19  ? 88.006  52.444  51.259  1.00 119.18 ?  -55 DG  I "C5'" 1 
ATOM 6006  C "C4'" . DG  I 5 19  ? 89.426  52.953  51.004  1.00 119.18 ?  -55 DG  I "C4'" 1 
ATOM 6007  O "O4'" . DG  I 5 19  ? 90.068  52.186  49.954  1.00 119.18 ?  -55 DG  I "O4'" 1 
ATOM 6008  C "C3'" . DG  I 5 19  ? 89.566  54.409  50.568  1.00 119.18 ?  -55 DG  I "C3'" 1 
ATOM 6009  O "O3'" . DG  I 5 19  ? 90.805  54.891  51.066  1.00 119.18 ?  -55 DG  I "O3'" 1 
ATOM 6010  C "C2'" . DG  I 5 19  ? 89.624  54.266  49.049  1.00 119.18 ?  -55 DG  I "C2'" 1 
ATOM 6011  C "C1'" . DG  I 5 19  ? 90.558  53.081  48.973  1.00 119.18 ?  -55 DG  I "C1'" 1 
ATOM 6012  N N9    . DG  I 5 19  ? 90.592  52.361  47.713  1.00 119.18 ?  -55 DG  I N9    1 
ATOM 6013  C C8    . DG  I 5 19  ? 89.529  51.947  46.957  1.00 119.18 ?  -55 DG  I C8    1 
ATOM 6014  N N7    . DG  I 5 19  ? 89.881  51.258  45.906  1.00 119.18 ?  -55 DG  I N7    1 
ATOM 6015  C C5    . DG  I 5 19  ? 91.262  51.198  45.989  1.00 119.18 ?  -55 DG  I C5    1 
ATOM 6016  C C6    . DG  I 5 19  ? 92.201  50.587  45.132  1.00 119.18 ?  -55 DG  I C6    1 
ATOM 6017  O O6    . DG  I 5 19  ? 91.997  49.946  44.095  1.00 119.18 ?  -55 DG  I O6    1 
ATOM 6018  N N1    . DG  I 5 19  ? 93.500  50.772  45.583  1.00 119.18 ?  -55 DG  I N1    1 
ATOM 6019  C C2    . DG  I 5 19  ? 93.848  51.456  46.719  1.00 119.18 ?  -55 DG  I C2    1 
ATOM 6020  N N2    . DG  I 5 19  ? 95.155  51.534  46.993  1.00 119.18 ?  -55 DG  I N2    1 
ATOM 6021  N N3    . DG  I 5 19  ? 92.979  52.035  47.525  1.00 119.18 ?  -55 DG  I N3    1 
ATOM 6022  C C4    . DG  I 5 19  ? 91.709  51.862  47.102  1.00 119.18 ?  -55 DG  I C4    1 
ATOM 6023  P P     . DA  I 5 20  ? 90.980  56.413  51.534  1.00 106.84 ?  -54 DA  I P     1 
ATOM 6024  O OP1   . DA  I 5 20  ? 90.252  56.564  52.810  1.00 106.84 ?  -54 DA  I OP1   1 
ATOM 6025  O OP2   . DA  I 5 20  ? 90.649  57.277  50.382  1.00 106.84 -1 -54 DA  I OP2   1 
ATOM 6026  O "O5'" . DA  I 5 20  ? 92.550  56.548  51.810  1.00 106.84 ?  -54 DA  I "O5'" 1 
ATOM 6027  C "C5'" . DA  I 5 20  ? 93.443  55.586  51.264  1.00 106.84 ?  -54 DA  I "C5'" 1 
ATOM 6028  C "C4'" . DA  I 5 20  ? 94.822  56.175  50.998  1.00 106.84 ?  -54 DA  I "C4'" 1 
ATOM 6029  O "O4'" . DA  I 5 20  ? 95.230  55.868  49.651  1.00 106.84 ?  -54 DA  I "O4'" 1 
ATOM 6030  C "C3'" . DA  I 5 20  ? 94.935  57.677  51.068  1.00 106.84 ?  -54 DA  I "C3'" 1 
ATOM 6031  O "O3'" . DA  I 5 20  ? 96.302  58.008  51.284  1.00 106.84 ?  -54 DA  I "O3'" 1 
ATOM 6032  C "C2'" . DA  I 5 20  ? 94.451  58.108  49.677  1.00 106.84 ?  -54 DA  I "C2'" 1 
ATOM 6033  C "C1'" . DA  I 5 20  ? 94.853  56.927  48.789  1.00 106.84 ?  -54 DA  I "C1'" 1 
ATOM 6034  N N9    . DA  I 5 20  ? 93.773  56.430  47.951  1.00 106.84 ?  -54 DA  I N9    1 
ATOM 6035  C C8    . DA  I 5 20  ? 92.437  56.630  48.124  1.00 106.84 ?  -54 DA  I C8    1 
ATOM 6036  N N7    . DA  I 5 20  ? 91.696  56.029  47.232  1.00 106.84 ?  -54 DA  I N7    1 
ATOM 6037  C C5    . DA  I 5 20  ? 92.603  55.376  46.432  1.00 106.84 ?  -54 DA  I C5    1 
ATOM 6038  C C6    . DA  I 5 20  ? 92.447  54.562  45.304  1.00 106.84 ?  -54 DA  I C6    1 
ATOM 6039  N N6    . DA  I 5 20  ? 91.257  54.253  44.790  1.00 106.84 ?  -54 DA  I N6    1 
ATOM 6040  N N1    . DA  I 5 20  ? 93.562  54.070  44.725  1.00 106.84 ?  -54 DA  I N1    1 
ATOM 6041  C C2    . DA  I 5 20  ? 94.750  54.383  45.252  1.00 106.84 ?  -54 DA  I C2    1 
ATOM 6042  N N3    . DA  I 5 20  ? 95.018  55.141  46.311  1.00 106.84 ?  -54 DA  I N3    1 
ATOM 6043  C C4    . DA  I 5 20  ? 93.890  55.609  46.858  1.00 106.84 ?  -54 DA  I C4    1 
ATOM 6044  P P     . DG  I 5 21  ? 96.841  59.507  51.097  1.00 112.13 ?  -53 DG  I P     1 
ATOM 6045  O OP1   . DG  I 5 21  ? 97.936  59.691  52.071  1.00 112.13 ?  -53 DG  I OP1   1 
ATOM 6046  O OP2   . DG  I 5 21  ? 95.698  60.444  51.103  1.00 112.13 -1 -53 DG  I OP2   1 
ATOM 6047  O "O5'" . DG  I 5 21  ? 97.488  59.494  49.638  1.00 112.13 ?  -53 DG  I "O5'" 1 
ATOM 6048  C "C5'" . DG  I 5 21  ? 98.675  58.748  49.396  1.00 112.13 ?  -53 DG  I "C5'" 1 
ATOM 6049  C "C4'" . DG  I 5 21  ? 99.074  58.804  47.928  1.00 112.13 ?  -53 DG  I "C4'" 1 
ATOM 6050  O "O4'" . DG  I 5 21  ? 98.018  58.246  47.107  1.00 112.13 ?  -53 DG  I "O4'" 1 
ATOM 6051  C "C3'" . DG  I 5 21  ? 99.345  60.201  47.371  1.00 112.13 ?  -53 DG  I "C3'" 1 
ATOM 6052  O "O3'" . DG  I 5 21  ? 100.455 60.147  46.494  1.00 112.13 ?  -53 DG  I "O3'" 1 
ATOM 6053  C "C2'" . DG  I 5 21  ? 98.056  60.526  46.620  1.00 112.13 ?  -53 DG  I "C2'" 1 
ATOM 6054  C "C1'" . DG  I 5 21  ? 97.681  59.158  46.086  1.00 112.13 ?  -53 DG  I "C1'" 1 
ATOM 6055  N N9    . DG  I 5 21  ? 96.264  59.000  45.797  1.00 112.13 ?  -53 DG  I N9    1 
ATOM 6056  C C8    . DG  I 5 21  ? 95.212  59.507  46.510  1.00 112.13 ?  -53 DG  I C8    1 
ATOM 6057  N N7    . DG  I 5 21  ? 94.050  59.168  46.030  1.00 112.13 ?  -53 DG  I N7    1 
ATOM 6058  C C5    . DG  I 5 21  ? 94.354  58.394  44.923  1.00 112.13 ?  -53 DG  I C5    1 
ATOM 6059  C C6    . DG  I 5 21  ? 93.502  57.752  44.000  1.00 112.13 ?  -53 DG  I C6    1 
ATOM 6060  O O6    . DG  I 5 21  ? 92.267  57.746  43.969  1.00 112.13 ?  -53 DG  I O6    1 
ATOM 6061  N N1    . DG  I 5 21  ? 94.221  57.073  43.023  1.00 112.13 ?  -53 DG  I N1    1 
ATOM 6062  C C2    . DG  I 5 21  ? 95.593  57.015  42.957  1.00 112.13 ?  -53 DG  I C2    1 
ATOM 6063  N N2    . DG  I 5 21  ? 96.115  56.309  41.941  1.00 112.13 ?  -53 DG  I N2    1 
ATOM 6064  N N3    . DG  I 5 21  ? 96.400  57.612  43.818  1.00 112.13 ?  -53 DG  I N3    1 
ATOM 6065  C C4    . DG  I 5 21  ? 95.713  58.278  44.771  1.00 112.13 ?  -53 DG  I C4    1 
ATOM 6066  P P     . DG  I 5 22  ? 101.180 61.493  46.005  1.00 122.14 ?  -52 DG  I P     1 
ATOM 6067  O OP1   . DG  I 5 22  ? 102.523 61.525  46.620  1.00 122.14 ?  -52 DG  I OP1   1 
ATOM 6068  O OP2   . DG  I 5 22  ? 100.252 62.624  46.216  1.00 122.14 -1 -52 DG  I OP2   1 
ATOM 6069  O "O5'" . DG  I 5 22  ? 101.346 61.275  44.430  1.00 122.14 ?  -52 DG  I "O5'" 1 
ATOM 6070  C "C5'" . DG  I 5 22  ? 101.919 60.067  43.938  1.00 122.14 ?  -52 DG  I "C5'" 1 
ATOM 6071  C "C4'" . DG  I 5 22  ? 101.515 59.820  42.495  1.00 122.14 ?  -52 DG  I "C4'" 1 
ATOM 6072  O "O4'" . DG  I 5 22  ? 100.119 59.436  42.435  1.00 122.14 ?  -52 DG  I "O4'" 1 
ATOM 6073  C "C3'" . DG  I 5 22  ? 101.674 61.019  41.565  1.00 122.14 ?  -52 DG  I "C3'" 1 
ATOM 6074  O "O3'" . DG  I 5 22  ? 102.268 60.609  40.350  1.00 122.14 ?  -52 DG  I "O3'" 1 
ATOM 6075  C "C2'" . DG  I 5 22  ? 100.244 61.512  41.353  1.00 122.14 ?  -52 DG  I "C2'" 1 
ATOM 6076  C "C1'" . DG  I 5 22  ? 99.433  60.235  41.497  1.00 122.14 ?  -52 DG  I "C1'" 1 
ATOM 6077  N N9    . DG  I 5 22  ? 98.093  60.467  42.011  1.00 122.14 ?  -52 DG  I N9    1 
ATOM 6078  C C8    . DG  I 5 22  ? 97.768  61.082  43.187  1.00 122.14 ?  -52 DG  I C8    1 
ATOM 6079  N N7    . DG  I 5 22  ? 96.488  61.146  43.408  1.00 122.14 ?  -52 DG  I N7    1 
ATOM 6080  C C5    . DG  I 5 22  ? 95.925  60.543  42.297  1.00 122.14 ?  -52 DG  I C5    1 
ATOM 6081  C C6    . DG  I 5 22  ? 94.571  60.325  41.973  1.00 122.14 ?  -52 DG  I C6    1 
ATOM 6082  O O6    . DG  I 5 22  ? 93.564  60.638  42.621  1.00 122.14 ?  -52 DG  I O6    1 
ATOM 6083  N N1    . DG  I 5 22  ? 94.435  59.681  40.754  1.00 122.14 ?  -52 DG  I N1    1 
ATOM 6084  C C2    . DG  I 5 22  ? 95.479  59.294  39.950  1.00 122.14 ?  -52 DG  I C2    1 
ATOM 6085  N N2    . DG  I 5 22  ? 95.153  58.679  38.809  1.00 122.14 ?  -52 DG  I N2    1 
ATOM 6086  N N3    . DG  I 5 22  ? 96.753  59.490  40.244  1.00 122.14 ?  -52 DG  I N3    1 
ATOM 6087  C C4    . DG  I 5 22  ? 96.902  60.111  41.430  1.00 122.14 ?  -52 DG  I C4    1 
ATOM 6088  P P     . DC  I 5 23  ? 102.731 61.708  39.277  1.00 128.40 ?  -51 DC  I P     1 
ATOM 6089  O OP1   . DC  I 5 23  ? 103.915 61.178  38.567  1.00 128.40 ?  -51 DC  I OP1   1 
ATOM 6090  O OP2   . DC  I 5 23  ? 102.812 63.005  39.983  1.00 128.40 -1 -51 DC  I OP2   1 
ATOM 6091  O "O5'" . DC  I 5 23  ? 101.503 61.786  38.259  1.00 128.40 ?  -51 DC  I "O5'" 1 
ATOM 6092  C "C5'" . DC  I 5 23  ? 101.024 60.604  37.635  1.00 128.40 ?  -51 DC  I "C5'" 1 
ATOM 6093  C "C4'" . DC  I 5 23  ? 99.921  60.932  36.647  1.00 128.40 ?  -51 DC  I "C4'" 1 
ATOM 6094  O "O4'" . DC  I 5 23  ? 98.644  60.944  37.331  1.00 128.40 ?  -51 DC  I "O4'" 1 
ATOM 6095  C "C3'" . DC  I 5 23  ? 100.060 62.294  35.964  1.00 128.40 ?  -51 DC  I "C3'" 1 
ATOM 6096  O "O3'" . DC  I 5 23  ? 99.882  62.160  34.564  1.00 128.40 ?  -51 DC  I "O3'" 1 
ATOM 6097  C "C2'" . DC  I 5 23  ? 98.950  63.133  36.594  1.00 128.40 ?  -51 DC  I "C2'" 1 
ATOM 6098  C "C1'" . DC  I 5 23  ? 97.915  62.079  36.941  1.00 128.40 ?  -51 DC  I "C1'" 1 
ATOM 6099  N N1    . DC  I 5 23  ? 97.037  62.477  38.065  1.00 128.40 ?  -51 DC  I N1    1 
ATOM 6100  C C2    . DC  I 5 23  ? 95.652  62.443  37.904  1.00 128.40 ?  -51 DC  I C2    1 
ATOM 6101  O O2    . DC  I 5 23  ? 95.185  62.074  36.823  1.00 128.40 ?  -51 DC  I O2    1 
ATOM 6102  N N3    . DC  I 5 23  ? 94.865  62.811  38.940  1.00 128.40 ?  -51 DC  I N3    1 
ATOM 6103  C C4    . DC  I 5 23  ? 95.416  63.202  40.089  1.00 128.40 ?  -51 DC  I C4    1 
ATOM 6104  N N4    . DC  I 5 23  ? 94.602  63.558  41.084  1.00 128.40 ?  -51 DC  I N4    1 
ATOM 6105  C C5    . DC  I 5 23  ? 96.826  63.252  40.267  1.00 128.40 ?  -51 DC  I C5    1 
ATOM 6106  C C6    . DC  I 5 23  ? 97.590  62.878  39.241  1.00 128.40 ?  -51 DC  I C6    1 
ATOM 6107  P P     . DC  I 5 24  ? 100.230 63.388  33.588  1.00 126.69 ?  -50 DC  I P     1 
ATOM 6108  O OP1   . DC  I 5 24  ? 101.018 62.849  32.458  1.00 126.69 ?  -50 DC  I OP1   1 
ATOM 6109  O OP2   . DC  I 5 24  ? 100.782 64.485  34.412  1.00 126.69 -1 -50 DC  I OP2   1 
ATOM 6110  O "O5'" . DC  I 5 24  ? 98.804  63.848  33.035  1.00 126.69 ?  -50 DC  I "O5'" 1 
ATOM 6111  C "C5'" . DC  I 5 24  ? 98.024  62.939  32.277  1.00 126.69 ?  -50 DC  I "C5'" 1 
ATOM 6112  C "C4'" . DC  I 5 24  ? 96.644  63.501  31.989  1.00 126.69 ?  -50 DC  I "C4'" 1 
ATOM 6113  O "O4'" . DC  I 5 24  ? 95.908  63.659  33.227  1.00 126.69 ?  -50 DC  I "O4'" 1 
ATOM 6114  C "C3'" . DC  I 5 24  ? 96.622  64.863  31.297  1.00 126.69 ?  -50 DC  I "C3'" 1 
ATOM 6115  O "O3'" . DC  I 5 24  ? 95.634  64.855  30.279  1.00 126.69 ?  -50 DC  I "O3'" 1 
ATOM 6116  C "C2'" . DC  I 5 24  ? 96.255  65.822  32.430  1.00 126.69 ?  -50 DC  I "C2'" 1 
ATOM 6117  C "C1'" . DC  I 5 24  ? 95.350  64.951  33.282  1.00 126.69 ?  -50 DC  I "C1'" 1 
ATOM 6118  N N1    . DC  I 5 24  ? 95.292  65.363  34.708  1.00 126.69 ?  -50 DC  I N1    1 
ATOM 6119  C C2    . DC  I 5 24  ? 94.057  65.636  35.302  1.00 126.69 ?  -50 DC  I C2    1 
ATOM 6120  O O2    . DC  I 5 24  ? 93.031  65.545  34.624  1.00 126.69 ?  -50 DC  I O2    1 
ATOM 6121  N N3    . DC  I 5 24  ? 94.025  65.998  36.606  1.00 126.69 ?  -50 DC  I N3    1 
ATOM 6122  C C4    . DC  I 5 24  ? 95.158  66.085  37.301  1.00 126.69 ?  -50 DC  I C4    1 
ATOM 6123  N N4    . DC  I 5 24  ? 95.080  66.446  38.585  1.00 126.69 ?  -50 DC  I N4    1 
ATOM 6124  C C5    . DC  I 5 24  ? 96.425  65.806  36.713  1.00 126.69 ?  -50 DC  I C5    1 
ATOM 6125  C C6    . DC  I 5 24  ? 96.444  65.451  35.428  1.00 126.69 ?  -50 DC  I C6    1 
ATOM 6126  P P     . DG  I 5 25  ? 95.580  66.017  29.171  1.00 115.92 ?  -49 DG  I P     1 
ATOM 6127  O OP1   . DG  I 5 25  ? 95.996  65.419  27.885  1.00 115.92 ?  -49 DG  I OP1   1 
ATOM 6128  O OP2   . DG  I 5 25  ? 96.288  67.205  29.694  1.00 115.92 -1 -49 DG  I OP2   1 
ATOM 6129  O "O5'" . DG  I 5 25  ? 94.026  66.367  29.089  1.00 115.92 ?  -49 DG  I "O5'" 1 
ATOM 6130  C "C5'" . DG  I 5 25  ? 93.189  66.079  30.198  1.00 115.92 ?  -49 DG  I "C5'" 1 
ATOM 6131  C "C4'" . DG  I 5 25  ? 91.839  66.751  30.053  1.00 115.92 ?  -49 DG  I "C4'" 1 
ATOM 6132  O "O4'" . DG  I 5 25  ? 91.383  67.169  31.357  1.00 115.92 ?  -49 DG  I "O4'" 1 
ATOM 6133  C "C3'" . DG  I 5 25  ? 91.851  68.027  29.243  1.00 115.92 ?  -49 DG  I "C3'" 1 
ATOM 6134  O "O3'" . DG  I 5 25  ? 90.529  68.344  28.833  1.00 115.92 ?  -49 DG  I "O3'" 1 
ATOM 6135  C "C2'" . DG  I 5 25  ? 92.372  69.027  30.267  1.00 115.92 ?  -49 DG  I "C2'" 1 
ATOM 6136  C "C1'" . DG  I 5 25  ? 91.712  68.532  31.557  1.00 115.92 ?  -49 DG  I "C1'" 1 
ATOM 6137  N N9    . DG  I 5 25  ? 92.578  68.627  32.727  1.00 115.92 ?  -49 DG  I N9    1 
ATOM 6138  C C8    . DG  I 5 25  ? 93.937  68.450  32.768  1.00 115.92 ?  -49 DG  I C8    1 
ATOM 6139  N N7    . DG  I 5 25  ? 94.443  68.591  33.959  1.00 115.92 ?  -49 DG  I N7    1 
ATOM 6140  C C5    . DG  I 5 25  ? 93.349  68.881  34.757  1.00 115.92 ?  -49 DG  I C5    1 
ATOM 6141  C C6    . DG  I 5 25  ? 93.279  69.138  36.140  1.00 115.92 ?  -49 DG  I C6    1 
ATOM 6142  O O6    . DG  I 5 25  ? 94.201  69.158  36.960  1.00 115.92 ?  -49 DG  I O6    1 
ATOM 6143  N N1    . DG  I 5 25  ? 91.975  69.388  36.553  1.00 115.92 ?  -49 DG  I N1    1 
ATOM 6144  C C2    . DG  I 5 25  ? 90.880  69.390  35.727  1.00 115.92 ?  -49 DG  I C2    1 
ATOM 6145  N N2    . DG  I 5 25  ? 89.697  69.651  36.298  1.00 115.92 ?  -49 DG  I N2    1 
ATOM 6146  N N3    . DG  I 5 25  ? 90.935  69.154  34.427  1.00 115.92 ?  -49 DG  I N3    1 
ATOM 6147  C C4    . DG  I 5 25  ? 92.196  68.908  34.013  1.00 115.92 ?  -49 DG  I C4    1 
ATOM 6148  P P     . DC  I 5 26  ? 90.237  69.692  28.010  1.00 113.15 ?  -48 DC  I P     1 
ATOM 6149  O OP1   . DC  I 5 26  ? 89.104  69.430  27.098  1.00 113.15 ?  -48 DC  I OP1   1 
ATOM 6150  O OP2   . DC  I 5 26  ? 91.523  70.174  27.463  1.00 113.15 -1 -48 DC  I OP2   1 
ATOM 6151  O "O5'" . DC  I 5 26  ? 89.758  70.726  29.130  1.00 113.15 ?  -48 DC  I "O5'" 1 
ATOM 6152  C "C5'" . DC  I 5 26  ? 88.683  70.384  29.997  1.00 113.15 ?  -48 DC  I "C5'" 1 
ATOM 6153  C "C4'" . DC  I 5 26  ? 88.547  71.384  31.136  1.00 113.15 ?  -48 DC  I "C4'" 1 
ATOM 6154  O "O4'" . DC  I 5 26  ? 89.621  71.194  32.097  1.00 113.15 ?  -48 DC  I "O4'" 1 
ATOM 6155  C "C3'" . DC  I 5 26  ? 88.609  72.862  30.731  1.00 113.15 ?  -48 DC  I "C3'" 1 
ATOM 6156  O "O3'" . DC  I 5 26  ? 87.660  73.593  31.479  1.00 113.15 ?  -48 DC  I "O3'" 1 
ATOM 6157  C "C2'" . DC  I 5 26  ? 90.021  73.252  31.146  1.00 113.15 ?  -48 DC  I "C2'" 1 
ATOM 6158  C "C1'" . DC  I 5 26  ? 90.135  72.459  32.426  1.00 113.15 ?  -48 DC  I "C1'" 1 
ATOM 6159  N N1    . DC  I 5 26  ? 91.517  72.311  32.943  1.00 113.15 ?  -48 DC  I N1    1 
ATOM 6160  C C2    . DC  I 5 26  ? 91.733  72.395  34.314  1.00 113.15 ?  -48 DC  I C2    1 
ATOM 6161  O O2    . DC  I 5 26  ? 90.762  72.583  35.051  1.00 113.15 ?  -48 DC  I O2    1 
ATOM 6162  N N3    . DC  I 5 26  ? 92.990  72.262  34.793  1.00 113.15 ?  -48 DC  I N3    1 
ATOM 6163  C C4    . DC  I 5 26  ? 94.002  72.061  33.952  1.00 113.15 ?  -48 DC  I C4    1 
ATOM 6164  N N4    . DC  I 5 26  ? 95.227  71.935  34.468  1.00 113.15 ?  -48 DC  I N4    1 
ATOM 6165  C C5    . DC  I 5 26  ? 93.802  71.974  32.543  1.00 113.15 ?  -48 DC  I C5    1 
ATOM 6166  C C6    . DC  I 5 26  ? 92.554  72.109  32.087  1.00 113.15 ?  -48 DC  I C6    1 
ATOM 6167  P P     . DT  I 5 27  ? 86.267  74.050  30.826  1.00 106.93 ?  -47 DT  I P     1 
ATOM 6168  O OP1   . DT  I 5 27  ? 85.557  72.826  30.395  1.00 106.93 ?  -47 DT  I OP1   1 
ATOM 6169  O OP2   . DT  I 5 27  ? 86.553  75.124  29.850  1.00 106.93 -1 -47 DT  I OP2   1 
ATOM 6170  O "O5'" . DT  I 5 27  ? 85.482  74.704  32.057  1.00 106.93 ?  -47 DT  I "O5'" 1 
ATOM 6171  C "C5'" . DT  I 5 27  ? 85.915  74.430  33.392  1.00 106.93 ?  -47 DT  I "C5'" 1 
ATOM 6172  C "C4'" . DT  I 5 27  ? 85.908  75.682  34.260  1.00 106.93 ?  -47 DT  I "C4'" 1 
ATOM 6173  O "O4'" . DT  I 5 27  ? 87.231  75.896  34.816  1.00 106.93 ?  -47 DT  I "O4'" 1 
ATOM 6174  C "C3'" . DT  I 5 27  ? 85.572  76.984  33.545  1.00 106.93 ?  -47 DT  I "C3'" 1 
ATOM 6175  O "O3'" . DT  I 5 27  ? 85.090  77.932  34.495  1.00 106.93 ?  -47 DT  I "O3'" 1 
ATOM 6176  C "C2'" . DT  I 5 27  ? 86.947  77.400  33.049  1.00 106.93 ?  -47 DT  I "C2'" 1 
ATOM 6177  C "C1'" . DT  I 5 27  ? 87.771  77.092  34.291  1.00 106.93 ?  -47 DT  I "C1'" 1 
ATOM 6178  N N1    . DT  I 5 27  ? 89.213  76.872  34.039  1.00 106.93 ?  -47 DT  I N1    1 
ATOM 6179  C C2    . DT  I 5 27  ? 90.047  76.701  35.113  1.00 106.93 ?  -47 DT  I C2    1 
ATOM 6180  O O2    . DT  I 5 27  ? 89.661  76.731  36.264  1.00 106.93 ?  -47 DT  I O2    1 
ATOM 6181  N N3    . DT  I 5 27  ? 91.357  76.495  34.794  1.00 106.93 ?  -47 DT  I N3    1 
ATOM 6182  C C4    . DT  I 5 27  ? 91.904  76.439  33.529  1.00 106.93 ?  -47 DT  I C4    1 
ATOM 6183  O O4    . DT  I 5 27  ? 93.098  76.250  33.343  1.00 106.93 ?  -47 DT  I O4    1 
ATOM 6184  C C5    . DT  I 5 27  ? 90.976  76.625  32.444  1.00 106.93 ?  -47 DT  I C5    1 
ATOM 6185  C C7    . DT  I 5 27  ? 91.461  76.595  31.026  1.00 106.93 ?  -47 DT  I C7    1 
ATOM 6186  C C6    . DT  I 5 27  ? 89.687  76.829  32.747  1.00 106.93 ?  -47 DT  I C6    1 
ATOM 6187  P P     . DC  I 5 28  ? 83.531  78.039  34.877  1.00 100.08 ?  -46 DC  I P     1 
ATOM 6188  O OP1   . DC  I 5 28  ? 82.862  76.730  34.718  1.00 100.08 ?  -46 DC  I OP1   1 
ATOM 6189  O OP2   . DC  I 5 28  ? 82.995  79.213  34.158  1.00 100.08 -1 -46 DC  I OP2   1 
ATOM 6190  O "O5'" . DC  I 5 28  ? 83.567  78.408  36.433  1.00 100.08 ?  -46 DC  I "O5'" 1 
ATOM 6191  C "C5'" . DC  I 5 28  ? 84.525  77.779  37.292  1.00 100.08 ?  -46 DC  I "C5'" 1 
ATOM 6192  C "C4'" . DC  I 5 28  ? 85.366  78.799  38.056  1.00 100.08 ?  -46 DC  I "C4'" 1 
ATOM 6193  O "O4'" . DC  I 5 28  ? 86.674  78.935  37.435  1.00 100.08 ?  -46 DC  I "O4'" 1 
ATOM 6194  C "C3'" . DC  I 5 28  ? 84.802  80.218  38.133  1.00 100.08 ?  -46 DC  I "C3'" 1 
ATOM 6195  O "O3'" . DC  I 5 28  ? 85.192  80.804  39.362  1.00 100.08 ?  -46 DC  I "O3'" 1 
ATOM 6196  C "C2'" . DC  I 5 28  ? 85.522  80.902  36.979  1.00 100.08 ?  -46 DC  I "C2'" 1 
ATOM 6197  C "C1'" . DC  I 5 28  ? 86.905  80.297  37.142  1.00 100.08 ?  -46 DC  I "C1'" 1 
ATOM 6198  N N1    . DC  I 5 28  ? 87.754  80.371  35.931  1.00 100.08 ?  -46 DC  I N1    1 
ATOM 6199  C C2    . DC  I 5 28  ? 89.116  80.088  36.034  1.00 100.08 ?  -46 DC  I C2    1 
ATOM 6200  O O2    . DC  I 5 28  ? 89.585  79.795  37.135  1.00 100.08 ?  -46 DC  I O2    1 
ATOM 6201  N N3    . DC  I 5 28  ? 89.881  80.144  34.923  1.00 100.08 ?  -46 DC  I N3    1 
ATOM 6202  C C4    . DC  I 5 28  ? 89.334  80.464  33.754  1.00 100.08 ?  -46 DC  I C4    1 
ATOM 6203  N N4    . DC  I 5 28  ? 90.131  80.508  32.683  1.00 100.08 ?  -46 DC  I N4    1 
ATOM 6204  C C5    . DC  I 5 28  ? 87.948  80.759  33.628  1.00 100.08 ?  -46 DC  I C5    1 
ATOM 6205  C C6    . DC  I 5 28  ? 87.201  80.696  34.731  1.00 100.08 ?  -46 DC  I C6    1 
ATOM 6206  P P     . DA  I 5 29  ? 84.197  80.842  40.622  1.00 93.78  ?  -45 DA  I P     1 
ATOM 6207  O OP1   . DA  I 5 29  ? 83.520  79.532  40.725  1.00 93.78  ?  -45 DA  I OP1   1 
ATOM 6208  O OP2   . DA  I 5 29  ? 83.388  82.075  40.507  1.00 93.78  -1 -45 DA  I OP2   1 
ATOM 6209  O "O5'" . DA  I 5 29  ? 85.189  81.014  41.868  1.00 93.78  ?  -45 DA  I "O5'" 1 
ATOM 6210  C "C5'" . DA  I 5 29  ? 86.308  80.135  42.017  1.00 93.78  ?  -45 DA  I "C5'" 1 
ATOM 6211  C "C4'" . DA  I 5 29  ? 87.629  80.894  42.148  1.00 93.78  ?  -45 DA  I "C4'" 1 
ATOM 6212  O "O4'" . DA  I 5 29  ? 88.173  81.198  40.838  1.00 93.78  ?  -45 DA  I "O4'" 1 
ATOM 6213  C "C3'" . DA  I 5 29  ? 87.578  82.227  42.887  1.00 93.78  ?  -45 DA  I "C3'" 1 
ATOM 6214  O "O3'" . DA  I 5 29  ? 88.785  82.392  43.600  1.00 93.78  ?  -45 DA  I "O3'" 1 
ATOM 6215  C "C2'" . DA  I 5 29  ? 87.501  83.225  41.740  1.00 93.78  ?  -45 DA  I "C2'" 1 
ATOM 6216  C "C1'" . DA  I 5 29  ? 88.461  82.578  40.767  1.00 93.78  ?  -45 DA  I "C1'" 1 
ATOM 6217  N N9    . DA  I 5 29  ? 88.280  82.995  39.391  1.00 93.78  ?  -45 DA  I N9    1 
ATOM 6218  C C8    . DA  I 5 29  ? 87.130  83.444  38.815  1.00 93.78  ?  -45 DA  I C8    1 
ATOM 6219  N N7    . DA  I 5 29  ? 87.254  83.724  37.542  1.00 93.78  ?  -45 DA  I N7    1 
ATOM 6220  C C5    . DA  I 5 29  ? 88.574  83.430  37.266  1.00 93.78  ?  -45 DA  I C5    1 
ATOM 6221  C C6    . DA  I 5 29  ? 89.332  83.508  36.090  1.00 93.78  ?  -45 DA  I C6    1 
ATOM 6222  N N6    . DA  I 5 29  ? 88.835  83.930  34.927  1.00 93.78  ?  -45 DA  I N6    1 
ATOM 6223  N N1    . DA  I 5 29  ? 90.627  83.139  36.153  1.00 93.78  ?  -45 DA  I N1    1 
ATOM 6224  C C2    . DA  I 5 29  ? 91.121  82.716  37.319  1.00 93.78  ?  -45 DA  I C2    1 
ATOM 6225  N N3    . DA  I 5 29  ? 90.504  82.602  38.492  1.00 93.78  ?  -45 DA  I N3    1 
ATOM 6226  C C4    . DA  I 5 29  ? 89.220  82.976  38.393  1.00 93.78  ?  -45 DA  I C4    1 
ATOM 6227  P P     . DA  I 5 30  ? 88.790  83.034  45.068  1.00 85.82  ?  -44 DA  I P     1 
ATOM 6228  O OP1   . DA  I 5 30  ? 88.455  81.952  46.014  1.00 85.82  ?  -44 DA  I OP1   1 
ATOM 6229  O OP2   . DA  I 5 30  ? 88.013  84.290  45.039  1.00 85.82  -1 -44 DA  I OP2   1 
ATOM 6230  O "O5'" . DA  I 5 30  ? 90.315  83.421  45.295  1.00 85.82  ?  -44 DA  I "O5'" 1 
ATOM 6231  C "C5'" . DA  I 5 30  ? 91.314  82.450  45.084  1.00 85.82  ?  -44 DA  I "C5'" 1 
ATOM 6232  C "C4'" . DA  I 5 30  ? 92.449  83.002  44.239  1.00 85.82  ?  -44 DA  I "C4'" 1 
ATOM 6233  O "O4'" . DA  I 5 30  ? 91.979  83.332  42.907  1.00 85.82  ?  -44 DA  I "O4'" 1 
ATOM 6234  C "C3'" . DA  I 5 30  ? 93.118  84.266  44.766  1.00 85.82  ?  -44 DA  I "C3'" 1 
ATOM 6235  O "O3'" . DA  I 5 30  ? 94.505  84.157  44.528  1.00 85.82  ?  -44 DA  I "O3'" 1 
ATOM 6236  C "C2'" . DA  I 5 30  ? 92.491  85.359  43.897  1.00 85.82  ?  -44 DA  I "C2'" 1 
ATOM 6237  C "C1'" . DA  I 5 30  ? 92.414  84.632  42.571  1.00 85.82  ?  -44 DA  I "C1'" 1 
ATOM 6238  N N9    . DA  I 5 30  ? 91.459  85.173  41.612  1.00 85.82  ?  -44 DA  I N9    1 
ATOM 6239  C C8    . DA  I 5 30  ? 90.148  85.452  41.832  1.00 85.82  ?  -44 DA  I C8    1 
ATOM 6240  N N7    . DA  I 5 30  ? 89.510  85.876  40.768  1.00 85.82  ?  -44 DA  I N7    1 
ATOM 6241  C C5    . DA  I 5 30  ? 90.470  85.866  39.780  1.00 85.82  ?  -44 DA  I C5    1 
ATOM 6242  C C6    . DA  I 5 30  ? 90.432  86.212  38.418  1.00 85.82  ?  -44 DA  I C6    1 
ATOM 6243  N N6    . DA  I 5 30  ? 89.332  86.653  37.808  1.00 85.82  ?  -44 DA  I N6    1 
ATOM 6244  N N1    . DA  I 5 30  ? 91.572  86.092  37.706  1.00 85.82  ?  -44 DA  I N1    1 
ATOM 6245  C C2    . DA  I 5 30  ? 92.670  85.648  38.328  1.00 85.82  ?  -44 DA  I C2    1 
ATOM 6246  N N3    . DA  I 5 30  ? 92.823  85.289  39.602  1.00 85.82  ?  -44 DA  I N3    1 
ATOM 6247  C C4    . DA  I 5 30  ? 91.676  85.425  40.278  1.00 85.82  ?  -44 DA  I C4    1 
ATOM 6248  P P     . DT  I 5 31  ? 95.568  84.947  45.428  1.00 88.62  ?  -43 DT  I P     1 
ATOM 6249  O OP1   . DT  I 5 31  ? 96.350  83.938  46.172  1.00 88.62  ?  -43 DT  I OP1   1 
ATOM 6250  O OP2   . DT  I 5 31  ? 94.861  86.027  46.142  1.00 88.62  -1 -43 DT  I OP2   1 
ATOM 6251  O "O5'" . DT  I 5 31  ? 96.515  85.627  44.345  1.00 88.62  ?  -43 DT  I "O5'" 1 
ATOM 6252  C "C5'" . DT  I 5 31  ? 95.973  85.953  43.084  1.00 88.62  ?  -43 DT  I "C5'" 1 
ATOM 6253  C "C4'" . DT  I 5 31  ? 97.019  86.494  42.147  1.00 88.62  ?  -43 DT  I "C4'" 1 
ATOM 6254  O "O4'" . DT  I 5 31  ? 96.373  86.894  40.916  1.00 88.62  ?  -43 DT  I "O4'" 1 
ATOM 6255  C "C3'" . DT  I 5 31  ? 97.721  87.735  42.643  1.00 88.62  ?  -43 DT  I "C3'" 1 
ATOM 6256  O "O3'" . DT  I 5 31  ? 98.966  87.858  42.013  1.00 88.62  ?  -43 DT  I "O3'" 1 
ATOM 6257  C "C2'" . DT  I 5 31  ? 96.767  88.834  42.205  1.00 88.62  ?  -43 DT  I "C2'" 1 
ATOM 6258  C "C1'" . DT  I 5 31  ? 96.253  88.301  40.870  1.00 88.62  ?  -43 DT  I "C1'" 1 
ATOM 6259  N N1    . DT  I 5 31  ? 94.826  88.648  40.597  1.00 88.62  ?  -43 DT  I N1    1 
ATOM 6260  C C2    . DT  I 5 31  ? 94.473  89.118  39.356  1.00 88.62  ?  -43 DT  I C2    1 
ATOM 6261  O O2    . DT  I 5 31  ? 95.268  89.264  38.450  1.00 88.62  ?  -43 DT  I O2    1 
ATOM 6262  N N3    . DT  I 5 31  ? 93.145  89.406  39.209  1.00 88.62  ?  -43 DT  I N3    1 
ATOM 6263  C C4    . DT  I 5 31  ? 92.158  89.280  40.155  1.00 88.62  ?  -43 DT  I C4    1 
ATOM 6264  O O4    . DT  I 5 31  ? 90.989  89.567  39.928  1.00 88.62  ?  -43 DT  I O4    1 
ATOM 6265  C C5    . DT  I 5 31  ? 92.592  88.787  41.432  1.00 88.62  ?  -43 DT  I C5    1 
ATOM 6266  C C7    . DT  I 5 31  ? 91.601  88.618  42.536  1.00 88.62  ?  -43 DT  I C7    1 
ATOM 6267  C C6    . DT  I 5 31  ? 93.888  88.491  41.591  1.00 88.62  ?  -43 DT  I C6    1 
ATOM 6268  P P     . DT  I 5 32  ? 99.945  89.055  42.425  1.00 95.91  ?  -42 DT  I P     1 
ATOM 6269  O OP1   . DT  I 5 32  ? 101.334 88.569  42.295  1.00 95.91  ?  -42 DT  I OP1   1 
ATOM 6270  O OP2   . DT  I 5 32  ? 99.456  89.576  43.717  1.00 95.91  -1 -42 DT  I OP2   1 
ATOM 6271  O "O5'" . DT  I 5 32  ? 99.679  90.166  41.312  1.00 95.91  ?  -42 DT  I "O5'" 1 
ATOM 6272  C "C5'" . DT  I 5 32  ? 99.801  89.831  39.941  1.00 95.91  ?  -42 DT  I "C5'" 1 
ATOM 6273  C "C4'" . DT  I 5 32  ? 99.592  91.050  39.060  1.00 95.91  ?  -42 DT  I "C4'" 1 
ATOM 6274  O "O4'" . DT  I 5 32  ? 98.175  91.280  38.864  1.00 95.91  ?  -42 DT  I "O4'" 1 
ATOM 6275  C "C3'" . DT  I 5 32  ? 100.165 92.354  39.609  1.00 95.91  ?  -42 DT  I "C3'" 1 
ATOM 6276  O "O3'" . DT  I 5 32  ? 100.833 93.044  38.577  1.00 95.91  ?  -42 DT  I "O3'" 1 
ATOM 6277  C "C2'" . DT  I 5 32  ? 98.925  93.115  40.078  1.00 95.91  ?  -42 DT  I "C2'" 1 
ATOM 6278  C "C1'" . DT  I 5 32  ? 97.888  92.639  39.081  1.00 95.91  ?  -42 DT  I "C1'" 1 
ATOM 6279  N N1    . DT  I 5 32  ? 96.497  92.738  39.574  1.00 95.91  ?  -42 DT  I N1    1 
ATOM 6280  C C2    . DT  I 5 32  ? 95.539  93.295  38.767  1.00 95.91  ?  -42 DT  I C2    1 
ATOM 6281  O O2    . DT  I 5 32  ? 95.774  93.732  37.659  1.00 95.91  ?  -42 DT  I O2    1 
ATOM 6282  N N3    . DT  I 5 32  ? 94.289  93.329  39.308  1.00 95.91  ?  -42 DT  I N3    1 
ATOM 6283  C C4    . DT  I 5 32  ? 93.910  92.865  40.548  1.00 95.91  ?  -42 DT  I C4    1 
ATOM 6284  O O4    . DT  I 5 32  ? 92.762  92.938  40.952  1.00 95.91  ?  -42 DT  I O4    1 
ATOM 6285  C C5    . DT  I 5 32  ? 94.956  92.292  41.340  1.00 95.91  ?  -42 DT  I C5    1 
ATOM 6286  C C7    . DT  I 5 32  ? 94.649  91.770  42.708  1.00 95.91  ?  -42 DT  I C7    1 
ATOM 6287  C C6    . DT  I 5 32  ? 96.188  92.251  40.822  1.00 95.91  ?  -42 DT  I C6    1 
ATOM 6288  P P     . DG  I 5 33  ? 101.589 94.424  38.890  1.00 106.91 ?  -41 DG  I P     1 
ATOM 6289  O OP1   . DG  I 5 33  ? 102.750 94.521  37.980  1.00 106.91 ?  -41 DG  I OP1   1 
ATOM 6290  O OP2   . DG  I 5 33  ? 101.790 94.490  40.353  1.00 106.91 -1 -41 DG  I OP2   1 
ATOM 6291  O "O5'" . DG  I 5 33  ? 100.520 95.541  38.492  1.00 106.91 ?  -41 DG  I "O5'" 1 
ATOM 6292  C "C5'" . DG  I 5 33  ? 99.844  95.463  37.247  1.00 106.91 ?  -41 DG  I "C5'" 1 
ATOM 6293  C "C4'" . DG  I 5 33  ? 98.841  96.592  37.110  1.00 106.91 ?  -41 DG  I "C4'" 1 
ATOM 6294  O "O4'" . DG  I 5 33  ? 97.580  96.201  37.706  1.00 106.91 ?  -41 DG  I "O4'" 1 
ATOM 6295  C "C3'" . DG  I 5 33  ? 99.248  97.903  37.787  1.00 106.91 ?  -41 DG  I "C3'" 1 
ATOM 6296  O "O3'" . DG  I 5 33  ? 99.028  98.986  36.903  1.00 106.91 ?  -41 DG  I "O3'" 1 
ATOM 6297  C "C2'" . DG  I 5 33  ? 98.328  97.978  39.006  1.00 106.91 ?  -41 DG  I "C2'" 1 
ATOM 6298  C "C1'" . DG  I 5 33  ? 97.095  97.256  38.498  1.00 106.91 ?  -41 DG  I "C1'" 1 
ATOM 6299  N N9    . DG  I 5 33  ? 96.271  96.689  39.556  1.00 106.91 ?  -41 DG  I N9    1 
ATOM 6300  C C8    . DG  I 5 33  ? 96.681  95.872  40.578  1.00 106.91 ?  -41 DG  I C8    1 
ATOM 6301  N N7    . DG  I 5 33  ? 95.714  95.510  41.372  1.00 106.91 ?  -41 DG  I N7    1 
ATOM 6302  C C5    . DG  I 5 33  ? 94.594  96.130  40.843  1.00 106.91 ?  -41 DG  I C5    1 
ATOM 6303  C C6    . DG  I 5 33  ? 93.252  96.101  41.275  1.00 106.91 ?  -41 DG  I C6    1 
ATOM 6304  O O6    . DG  I 5 33  ? 92.776  95.515  42.253  1.00 106.91 ?  -41 DG  I O6    1 
ATOM 6305  N N1    . DG  I 5 33  ? 92.429  96.862  40.451  1.00 106.91 ?  -41 DG  I N1    1 
ATOM 6306  C C2    . DG  I 5 33  ? 92.857  97.558  39.352  1.00 106.91 ?  -41 DG  I C2    1 
ATOM 6307  N N2    . DG  I 5 33  ? 91.922  98.234  38.684  1.00 106.91 ?  -41 DG  I N2    1 
ATOM 6308  N N3    . DG  I 5 33  ? 94.112  97.590  38.934  1.00 106.91 ?  -41 DG  I N3    1 
ATOM 6309  C C4    . DG  I 5 33  ? 94.921  96.855  39.724  1.00 106.91 ?  -41 DG  I C4    1 
ATOM 6310  P P     . DG  I 5 34  ? 99.807  100.373 37.118  1.00 109.89 ?  -40 DG  I P     1 
ATOM 6311  O OP1   . DG  I 5 34  ? 100.543 100.666 35.869  1.00 109.89 ?  -40 DG  I OP1   1 
ATOM 6312  O OP2   . DG  I 5 34  ? 100.539 100.288 38.400  1.00 109.89 -1 -40 DG  I OP2   1 
ATOM 6313  O "O5'" . DG  I 5 34  ? 98.633  101.444 37.285  1.00 109.89 ?  -40 DG  I "O5'" 1 
ATOM 6314  C "C5'" . DG  I 5 34  ? 97.727  101.661 36.217  1.00 109.89 ?  -40 DG  I "C5'" 1 
ATOM 6315  C "C4'" . DG  I 5 34  ? 96.410  102.220 36.721  1.00 109.89 ?  -40 DG  I "C4'" 1 
ATOM 6316  O "O4'" . DG  I 5 34  ? 95.777  101.264 37.610  1.00 109.89 ?  -40 DG  I "O4'" 1 
ATOM 6317  C "C3'" . DG  I 5 34  ? 96.513  103.531 37.508  1.00 109.89 ?  -40 DG  I "C3'" 1 
ATOM 6318  O "O3'" . DG  I 5 34  ? 95.547  104.455 37.015  1.00 109.89 ?  -40 DG  I "O3'" 1 
ATOM 6319  C "C2'" . DG  I 5 34  ? 96.205  103.104 38.943  1.00 109.89 ?  -40 DG  I "C2'" 1 
ATOM 6320  C "C1'" . DG  I 5 34  ? 95.245  101.958 38.706  1.00 109.89 ?  -40 DG  I "C1'" 1 
ATOM 6321  N N9    . DG  I 5 34  ? 95.121  101.040 39.834  1.00 109.89 ?  -40 DG  I N9    1 
ATOM 6322  C C8    . DG  I 5 34  ? 96.124  100.334 40.451  1.00 109.89 ?  -40 DG  I C8    1 
ATOM 6323  N N7    . DG  I 5 34  ? 95.704  99.588  41.434  1.00 109.89 ?  -40 DG  I N7    1 
ATOM 6324  C C5    . DG  I 5 34  ? 94.336  99.815  41.467  1.00 109.89 ?  -40 DG  I C5    1 
ATOM 6325  C C6    . DG  I 5 34  ? 93.344  99.288  42.323  1.00 109.89 ?  -40 DG  I C6    1 
ATOM 6326  O O6    . DG  I 5 34  ? 93.479  98.484  43.251  1.00 109.89 ?  -40 DG  I O6    1 
ATOM 6327  N N1    . DG  I 5 34  ? 92.083  99.780  42.013  1.00 109.89 ?  -40 DG  I N1    1 
ATOM 6328  C C2    . DG  I 5 34  ? 91.815  100.672 41.005  1.00 109.89 ?  -40 DG  I C2    1 
ATOM 6329  N N2    . DG  I 5 34  ? 90.537  101.039 40.854  1.00 109.89 ?  -40 DG  I N2    1 
ATOM 6330  N N3    . DG  I 5 34  ? 92.735  101.175 40.200  1.00 109.89 ?  -40 DG  I N3    1 
ATOM 6331  C C4    . DG  I 5 34  ? 93.966  100.704 40.488  1.00 109.89 ?  -40 DG  I C4    1 
ATOM 6332  P P     . DT  I 5 35  ? 95.285  105.854 37.762  1.00 111.10 ?  -39 DT  I P     1 
ATOM 6333  O OP1   . DT  I 5 35  ? 94.938  106.848 36.724  1.00 111.10 ?  -39 DT  I OP1   1 
ATOM 6334  O OP2   . DT  I 5 35  ? 96.410  106.124 38.684  1.00 111.10 -1 -39 DT  I OP2   1 
ATOM 6335  O "O5'" . DT  I 5 35  ? 93.974  105.580 38.633  1.00 111.10 ?  -39 DT  I "O5'" 1 
ATOM 6336  C "C5'" . DT  I 5 35  ? 92.738  105.309 37.983  1.00 111.10 ?  -39 DT  I "C5'" 1 
ATOM 6337  C "C4'" . DT  I 5 35  ? 91.561  105.702 38.860  1.00 111.10 ?  -39 DT  I "C4'" 1 
ATOM 6338  O "O4'" . DT  I 5 35  ? 91.318  104.667 39.843  1.00 111.10 ?  -39 DT  I "O4'" 1 
ATOM 6339  C "C3'" . DT  I 5 35  ? 91.733  107.007 39.629  1.00 111.10 ?  -39 DT  I "C3'" 1 
ATOM 6340  O "O3'" . DT  I 5 35  ? 90.548  107.779 39.545  1.00 111.10 ?  -39 DT  I "O3'" 1 
ATOM 6341  C "C2'" . DT  I 5 35  ? 92.018  106.561 41.063  1.00 111.10 ?  -39 DT  I "C2'" 1 
ATOM 6342  C "C1'" . DT  I 5 35  ? 91.324  105.208 41.145  1.00 111.10 ?  -39 DT  I "C1'" 1 
ATOM 6343  N N1    . DT  I 5 35  ? 92.030  104.248 42.027  1.00 111.10 ?  -39 DT  I N1    1 
ATOM 6344  C C2    . DT  I 5 35  ? 91.306  103.468 42.891  1.00 111.10 ?  -39 DT  I C2    1 
ATOM 6345  O O2    . DT  I 5 35  ? 90.095  103.518 42.980  1.00 111.10 ?  -39 DT  I O2    1 
ATOM 6346  N N3    . DT  I 5 35  ? 92.054  102.617 43.653  1.00 111.10 ?  -39 DT  I N3    1 
ATOM 6347  C C4    . DT  I 5 35  ? 93.423  102.472 43.638  1.00 111.10 ?  -39 DT  I C4    1 
ATOM 6348  O O4    . DT  I 5 35  ? 94.004  101.677 44.364  1.00 111.10 ?  -39 DT  I O4    1 
ATOM 6349  C C5    . DT  I 5 35  ? 94.124  103.320 42.710  1.00 111.10 ?  -39 DT  I C5    1 
ATOM 6350  C C7    . DT  I 5 35  ? 95.616  103.252 42.607  1.00 111.10 ?  -39 DT  I C7    1 
ATOM 6351  C C6    . DT  I 5 35  ? 93.402  104.157 41.957  1.00 111.10 ?  -39 DT  I C6    1 
ATOM 6352  P P     . DC  I 5 36  ? 90.477  109.225 40.240  1.00 109.69 ?  -38 DC  I P     1 
ATOM 6353  O OP1   . DC  I 5 36  ? 89.617  110.092 39.406  1.00 109.69 ?  -38 DC  I OP1   1 
ATOM 6354  O OP2   . DC  I 5 36  ? 91.860  109.645 40.555  1.00 109.69 -1 -38 DC  I OP2   1 
ATOM 6355  O "O5'" . DC  I 5 36  ? 89.731  108.937 41.622  1.00 109.69 ?  -38 DC  I "O5'" 1 
ATOM 6356  C "C5'" . DC  I 5 36  ? 88.569  108.112 41.648  1.00 109.69 ?  -38 DC  I "C5'" 1 
ATOM 6357  C "C4'" . DC  I 5 36  ? 88.005  107.995 43.056  1.00 109.69 ?  -38 DC  I "C4'" 1 
ATOM 6358  O "O4'" . DC  I 5 36  ? 88.802  107.066 43.835  1.00 109.69 ?  -38 DC  I "O4'" 1 
ATOM 6359  C "C3'" . DC  I 5 36  ? 87.970  109.295 43.856  1.00 109.69 ?  -38 DC  I "C3'" 1 
ATOM 6360  O "O3'" . DC  I 5 36  ? 86.766  109.362 44.588  1.00 109.69 ?  -38 DC  I "O3'" 1 
ATOM 6361  C "C2'" . DC  I 5 36  ? 89.175  109.162 44.783  1.00 109.69 ?  -38 DC  I "C2'" 1 
ATOM 6362  C "C1'" . DC  I 5 36  ? 89.173  107.669 45.055  1.00 109.69 ?  -38 DC  I "C1'" 1 
ATOM 6363  N N1    . DC  I 5 36  ? 90.501  107.132 45.451  1.00 109.69 ?  -38 DC  I N1    1 
ATOM 6364  C C2    . DC  I 5 36  ? 90.581  106.090 46.383  1.00 109.69 ?  -38 DC  I C2    1 
ATOM 6365  O O2    . DC  I 5 36  ? 89.542  105.632 46.872  1.00 109.69 ?  -38 DC  I O2    1 
ATOM 6366  N N3    . DC  I 5 36  ? 91.800  105.609 46.721  1.00 109.69 ?  -38 DC  I N3    1 
ATOM 6367  C C4    . DC  I 5 36  ? 92.898  106.130 46.170  1.00 109.69 ?  -38 DC  I C4    1 
ATOM 6368  N N4    . DC  I 5 36  ? 94.078  105.623 46.532  1.00 109.69 ?  -38 DC  I N4    1 
ATOM 6369  C C5    . DC  I 5 36  ? 92.835  107.187 45.219  1.00 109.69 ?  -38 DC  I C5    1 
ATOM 6370  C C6    . DC  I 5 36  ? 91.629  107.652 44.892  1.00 109.69 ?  -38 DC  I C6    1 
ATOM 6371  P P     . DG  I 5 37  ? 86.242  110.766 45.161  1.00 106.18 ?  -37 DG  I P     1 
ATOM 6372  O OP1   . DG  I 5 37  ? 85.216  111.275 44.226  1.00 106.18 ?  -37 DG  I OP1   1 
ATOM 6373  O OP2   . DG  I 5 37  ? 87.422  111.595 45.490  1.00 106.18 -1 -37 DG  I OP2   1 
ATOM 6374  O "O5'" . DG  I 5 37  ? 85.527  110.365 46.530  1.00 106.18 ?  -37 DG  I "O5'" 1 
ATOM 6375  C "C5'" . DG  I 5 37  ? 84.641  109.256 46.563  1.00 106.18 ?  -37 DG  I "C5'" 1 
ATOM 6376  C "C4'" . DG  I 5 37  ? 84.754  108.500 47.876  1.00 106.18 ?  -37 DG  I "C4'" 1 
ATOM 6377  O "O4'" . DG  I 5 37  ? 86.080  107.932 48.010  1.00 106.18 ?  -37 DG  I "O4'" 1 
ATOM 6378  C "C3'" . DG  I 5 37  ? 84.513  109.327 49.132  1.00 106.18 ?  -37 DG  I "C3'" 1 
ATOM 6379  O "O3'" . DG  I 5 37  ? 83.741  108.568 50.043  1.00 106.18 ?  -37 DG  I "O3'" 1 
ATOM 6380  C "C2'" . DG  I 5 37  ? 85.924  109.585 49.663  1.00 106.18 ?  -37 DG  I "C2'" 1 
ATOM 6381  C "C1'" . DG  I 5 37  ? 86.662  108.329 49.232  1.00 106.18 ?  -37 DG  I "C1'" 1 
ATOM 6382  N N9    . DG  I 5 37  ? 88.087  108.533 48.991  1.00 106.18 ?  -37 DG  I N9    1 
ATOM 6383  C C8    . DG  I 5 37  ? 88.653  109.476 48.177  1.00 106.18 ?  -37 DG  I C8    1 
ATOM 6384  N N7    . DG  I 5 37  ? 89.953  109.411 48.129  1.00 106.18 ?  -37 DG  I N7    1 
ATOM 6385  C C5    . DG  I 5 37  ? 90.271  108.351 48.962  1.00 106.18 ?  -37 DG  I C5    1 
ATOM 6386  C C6    . DG  I 5 37  ? 91.531  107.809 49.306  1.00 106.18 ?  -37 DG  I C6    1 
ATOM 6387  O O6    . DG  I 5 37  ? 92.651  108.172 48.928  1.00 106.18 ?  -37 DG  I O6    1 
ATOM 6388  N N1    . DG  I 5 37  ? 91.409  106.739 50.181  1.00 106.18 ?  -37 DG  I N1    1 
ATOM 6389  C C2    . DG  I 5 37  ? 90.220  106.253 50.663  1.00 106.18 ?  -37 DG  I C2    1 
ATOM 6390  N N2    . DG  I 5 37  ? 90.295  105.213 51.501  1.00 106.18 ?  -37 DG  I N2    1 
ATOM 6391  N N3    . DG  I 5 37  ? 89.033  106.752 50.349  1.00 106.18 ?  -37 DG  I N3    1 
ATOM 6392  C C4    . DG  I 5 37  ? 89.134  107.795 49.498  1.00 106.18 ?  -37 DG  I C4    1 
ATOM 6393  P P     . DT  I 5 38  ? 83.113  109.243 51.356  1.00 101.77 ?  -36 DT  I P     1 
ATOM 6394  O OP1   . DT  I 5 38  ? 81.642  109.153 51.247  1.00 101.77 ?  -36 DT  I OP1   1 
ATOM 6395  O OP2   . DT  I 5 38  ? 83.750  110.560 51.570  1.00 101.77 -1 -36 DT  I OP2   1 
ATOM 6396  O "O5'" . DT  I 5 38  ? 83.590  108.266 52.521  1.00 101.77 ?  -36 DT  I "O5'" 1 
ATOM 6397  C "C5'" . DT  I 5 38  ? 84.551  107.256 52.237  1.00 101.77 ?  -36 DT  I "C5'" 1 
ATOM 6398  C "C4'" . DT  I 5 38  ? 85.354  106.915 53.472  1.00 101.77 ?  -36 DT  I "C4'" 1 
ATOM 6399  O "O4'" . DT  I 5 38  ? 86.771  107.082 53.200  1.00 101.77 ?  -36 DT  I "O4'" 1 
ATOM 6400  C "C3'" . DT  I 5 38  ? 85.068  107.794 54.680  1.00 101.77 ?  -36 DT  I "C3'" 1 
ATOM 6401  O "O3'" . DT  I 5 38  ? 85.285  107.040 55.860  1.00 101.77 ?  -36 DT  I "O3'" 1 
ATOM 6402  C "C2'" . DT  I 5 38  ? 86.130  108.881 54.520  1.00 101.77 ?  -36 DT  I "C2'" 1 
ATOM 6403  C "C1'" . DT  I 5 38  ? 87.309  108.024 54.101  1.00 101.77 ?  -36 DT  I "C1'" 1 
ATOM 6404  N N1    . DT  I 5 38  ? 88.408  108.752 53.413  1.00 101.77 ?  -36 DT  I N1    1 
ATOM 6405  C C2    . DT  I 5 38  ? 89.702  108.342 53.619  1.00 101.77 ?  -36 DT  I C2    1 
ATOM 6406  O O2    . DT  I 5 38  ? 89.999  107.425 54.356  1.00 101.77 ?  -36 DT  I O2    1 
ATOM 6407  N N3    . DT  I 5 38  ? 90.644  109.055 52.937  1.00 101.77 ?  -36 DT  I N3    1 
ATOM 6408  C C4    . DT  I 5 38  ? 90.428  110.107 52.076  1.00 101.77 ?  -36 DT  I C4    1 
ATOM 6409  O O4    . DT  I 5 38  ? 91.345  110.686 51.507  1.00 101.77 ?  -36 DT  I O4    1 
ATOM 6410  C C5    . DT  I 5 38  ? 89.050  110.483 51.896  1.00 101.77 ?  -36 DT  I C5    1 
ATOM 6411  C C7    . DT  I 5 38  ? 88.700  111.620 50.986  1.00 101.77 ?  -36 DT  I C7    1 
ATOM 6412  C C6    . DT  I 5 38  ? 88.114  109.792 52.563  1.00 101.77 ?  -36 DT  I C6    1 
ATOM 6413  P P     . DA  I 5 39  ? 84.105  106.211 56.574  1.00 85.91  ?  -35 DA  I P     1 
ATOM 6414  O OP1   . DA  I 5 39  ? 83.223  105.596 55.560  1.00 85.91  ?  -35 DA  I OP1   1 
ATOM 6415  O OP2   . DA  I 5 39  ? 83.520  107.089 57.607  1.00 85.91  -1 -35 DA  I OP2   1 
ATOM 6416  O "O5'" . DA  I 5 39  ? 84.897  105.041 57.324  1.00 85.91  ?  -35 DA  I "O5'" 1 
ATOM 6417  C "C5'" . DA  I 5 39  ? 86.065  104.494 56.718  1.00 85.91  ?  -35 DA  I "C5'" 1 
ATOM 6418  C "C4'" . DA  I 5 39  ? 86.968  103.779 57.718  1.00 85.91  ?  -35 DA  I "C4'" 1 
ATOM 6419  O "O4'" . DA  I 5 39  ? 88.263  104.409 57.740  1.00 85.91  ?  -35 DA  I "O4'" 1 
ATOM 6420  C "C3'" . DA  I 5 39  ? 86.524  103.781 59.162  1.00 85.91  ?  -35 DA  I "C3'" 1 
ATOM 6421  O "O3'" . DA  I 5 39  ? 87.108  102.661 59.825  1.00 85.91  ?  -35 DA  I "O3'" 1 
ATOM 6422  C "C2'" . DA  I 5 39  ? 87.090  105.105 59.680  1.00 85.91  ?  -35 DA  I "C2'" 1 
ATOM 6423  C "C1'" . DA  I 5 39  ? 88.330  105.327 58.812  1.00 85.91  ?  -35 DA  I "C1'" 1 
ATOM 6424  N N9    . DA  I 5 39  ? 88.402  106.660 58.238  1.00 85.91  ?  -35 DA  I N9    1 
ATOM 6425  C C8    . DA  I 5 39  ? 87.363  107.505 58.019  1.00 85.91  ?  -35 DA  I C8    1 
ATOM 6426  N N7    . DA  I 5 39  ? 87.707  108.633 57.455  1.00 85.91  ?  -35 DA  I N7    1 
ATOM 6427  C C5    . DA  I 5 39  ? 89.069  108.520 57.290  1.00 85.91  ?  -35 DA  I C5    1 
ATOM 6428  C C6    . DA  I 5 39  ? 90.032  109.391 56.755  1.00 85.91  ?  -35 DA  I C6    1 
ATOM 6429  N N6    . DA  I 5 39  ? 89.736  110.591 56.256  1.00 85.91  ?  -35 DA  I N6    1 
ATOM 6430  N N1    . DA  I 5 39  ? 91.312  108.978 56.739  1.00 85.91  ?  -35 DA  I N1    1 
ATOM 6431  C C2    . DA  I 5 39  ? 91.605  107.770 57.228  1.00 85.91  ?  -35 DA  I C2    1 
ATOM 6432  N N3    . DA  I 5 39  ? 90.785  106.868 57.769  1.00 85.91  ?  -35 DA  I N3    1 
ATOM 6433  C C4    . DA  I 5 39  ? 89.519  107.309 57.765  1.00 85.91  ?  -35 DA  I C4    1 
ATOM 6434  P P     . DG  I 5 40  ? 87.091  102.536 61.426  1.00 80.41  ?  -34 DG  I P     1 
ATOM 6435  O OP1   . DG  I 5 40  ? 87.040  101.101 61.767  1.00 80.41  ?  -34 DG  I OP1   1 
ATOM 6436  O OP2   . DG  I 5 40  ? 86.042  103.430 61.952  1.00 80.41  -1 -34 DG  I OP2   1 
ATOM 6437  O "O5'" . DG  I 5 40  ? 88.508  103.117 61.867  1.00 80.41  ?  -34 DG  I "O5'" 1 
ATOM 6438  C "C5'" . DG  I 5 40  ? 89.683  102.732 61.171  1.00 80.41  ?  -34 DG  I "C5'" 1 
ATOM 6439  C "C4'" . DG  I 5 40  ? 90.882  103.593 61.558  1.00 80.41  ?  -34 DG  I "C4'" 1 
ATOM 6440  O "O4'" . DG  I 5 40  ? 90.807  104.896 60.915  1.00 80.41  ?  -34 DG  I "O4'" 1 
ATOM 6441  C "C3'" . DG  I 5 40  ? 91.045  103.881 63.047  1.00 80.41  ?  -34 DG  I "C3'" 1 
ATOM 6442  O "O3'" . DG  I 5 40  ? 92.426  103.897 63.355  1.00 80.41  ?  -34 DG  I "O3'" 1 
ATOM 6443  C "C2'" . DG  I 5 40  ? 90.451  105.280 63.166  1.00 80.41  ?  -34 DG  I "C2'" 1 
ATOM 6444  C "C1'" . DG  I 5 40  ? 90.985  105.898 61.889  1.00 80.41  ?  -34 DG  I "C1'" 1 
ATOM 6445  N N9    . DG  I 5 40  ? 90.281  107.103 61.457  1.00 80.41  ?  -34 DG  I N9    1 
ATOM 6446  C C8    . DG  I 5 40  ? 88.942  107.352 61.562  1.00 80.41  ?  -34 DG  I C8    1 
ATOM 6447  N N7    . DG  I 5 40  ? 88.583  108.497 61.062  1.00 80.41  ?  -34 DG  I N7    1 
ATOM 6448  C C5    . DG  I 5 40  ? 89.765  109.057 60.610  1.00 80.41  ?  -34 DG  I C5    1 
ATOM 6449  C C6    . DG  I 5 40  ? 89.996  110.301 59.985  1.00 80.41  ?  -34 DG  I C6    1 
ATOM 6450  O O6    . DG  I 5 40  ? 89.172  111.176 59.698  1.00 80.41  ?  -34 DG  I O6    1 
ATOM 6451  N N1    . DG  I 5 40  ? 91.334  110.485 59.681  1.00 80.41  ?  -34 DG  I N1    1 
ATOM 6452  C C2    . DG  I 5 40  ? 92.331  109.587 59.956  1.00 80.41  ?  -34 DG  I C2    1 
ATOM 6453  N N2    . DG  I 5 40  ? 93.569  109.941 59.583  1.00 80.41  ?  -34 DG  I N2    1 
ATOM 6454  N N3    . DG  I 5 40  ? 92.128  108.410 60.541  1.00 80.41  ?  -34 DG  I N3    1 
ATOM 6455  C C4    . DG  I 5 40  ? 90.822  108.214 60.840  1.00 80.41  ?  -34 DG  I C4    1 
ATOM 6456  P P     . DA  I 5 41  ? 92.990  103.169 64.669  1.00 83.25  ?  -33 DA  I P     1 
ATOM 6457  O OP1   . DA  I 5 41  ? 93.092  101.725 64.377  1.00 83.25  ?  -33 DA  I OP1   1 
ATOM 6458  O OP2   . DA  I 5 41  ? 92.195  103.633 65.823  1.00 83.25  -1 -33 DA  I OP2   1 
ATOM 6459  O "O5'" . DA  I 5 41  ? 94.465  103.763 64.815  1.00 83.25  ?  -33 DA  I "O5'" 1 
ATOM 6460  C "C5'" . DA  I 5 41  ? 95.390  103.627 63.743  1.00 83.25  ?  -33 DA  I "C5'" 1 
ATOM 6461  C "C4'" . DA  I 5 41  ? 96.304  104.843 63.606  1.00 83.25  ?  -33 DA  I "C4'" 1 
ATOM 6462  O "O4'" . DA  I 5 41  ? 95.572  105.977 63.087  1.00 83.25  ?  -33 DA  I "O4'" 1 
ATOM 6463  C "C3'" . DA  I 5 41  ? 96.979  105.333 64.875  1.00 83.25  ?  -33 DA  I "C3'" 1 
ATOM 6464  O "O3'" . DA  I 5 41  ? 98.261  105.804 64.544  1.00 83.25  ?  -33 DA  I "O3'" 1 
ATOM 6465  C "C2'" . DA  I 5 41  ? 96.073  106.476 65.323  1.00 83.25  ?  -33 DA  I "C2'" 1 
ATOM 6466  C "C1'" . DA  I 5 41  ? 95.646  107.066 63.990  1.00 83.25  ?  -33 DA  I "C1'" 1 
ATOM 6467  N N9    . DA  I 5 41  ? 94.328  107.674 64.004  1.00 83.25  ?  -33 DA  I N9    1 
ATOM 6468  C C8    . DA  I 5 41  ? 93.179  107.091 64.426  1.00 83.25  ?  -33 DA  I C8    1 
ATOM 6469  N N7    . DA  I 5 41  ? 92.126  107.852 64.300  1.00 83.25  ?  -33 DA  I N7    1 
ATOM 6470  C C5    . DA  I 5 41  ? 92.603  108.993 63.712  1.00 83.25  ?  -33 DA  I C5    1 
ATOM 6471  C C6    . DA  I 5 41  ? 91.970  110.177 63.319  1.00 83.25  ?  -33 DA  I C6    1 
ATOM 6472  N N6    . DA  I 5 41  ? 90.661  110.379 63.452  1.00 83.25  ?  -33 DA  I N6    1 
ATOM 6473  N N1    . DA  I 5 41  ? 92.731  111.143 62.782  1.00 83.25  ?  -33 DA  I N1    1 
ATOM 6474  C C2    . DA  I 5 41  ? 94.047  110.930 62.656  1.00 83.25  ?  -33 DA  I C2    1 
ATOM 6475  N N3    . DA  I 5 41  ? 94.755  109.851 62.991  1.00 83.25  ?  -33 DA  I N3    1 
ATOM 6476  C C4    . DA  I 5 41  ? 93.963  108.909 63.516  1.00 83.25  ?  -33 DA  I C4    1 
ATOM 6477  P P     . DC  I 5 42  ? 99.329  106.139 65.689  1.00 87.87  ?  -32 DC  I P     1 
ATOM 6478  O OP1   . DC  I 5 42  ? 100.655 105.892 65.091  1.00 87.87  ?  -32 DC  I OP1   1 
ATOM 6479  O OP2   . DC  I 5 42  ? 98.922  105.439 66.925  1.00 87.87  -1 -32 DC  I OP2   1 
ATOM 6480  O "O5'" . DC  I 5 42  ? 99.151  107.706 65.927  1.00 87.87  ?  -32 DC  I "O5'" 1 
ATOM 6481  C "C5'" . DC  I 5 42  ? 99.094  108.577 64.814  1.00 87.87  ?  -32 DC  I "C5'" 1 
ATOM 6482  C "C4'" . DC  I 5 42  ? 99.014  110.030 65.250  1.00 87.87  ?  -32 DC  I "C4'" 1 
ATOM 6483  O "O4'" . DC  I 5 42  ? 97.652  110.514 65.138  1.00 87.87  ?  -32 DC  I "O4'" 1 
ATOM 6484  C "C3'" . DC  I 5 42  ? 99.446  110.322 66.681  1.00 87.87  ?  -32 DC  I "C3'" 1 
ATOM 6485  O "O3'" . DC  I 5 42  ? 100.144 111.552 66.685  1.00 87.87  ?  -32 DC  I "O3'" 1 
ATOM 6486  C "C2'" . DC  I 5 42  ? 98.107  110.432 67.420  1.00 87.87  ?  -32 DC  I "C2'" 1 
ATOM 6487  C "C1'" . DC  I 5 42  ? 97.255  111.100 66.358  1.00 87.87  ?  -32 DC  I "C1'" 1 
ATOM 6488  N N1    . DC  I 5 42  ? 95.796  110.880 66.494  1.00 87.87  ?  -32 DC  I N1    1 
ATOM 6489  C C2    . DC  I 5 42  ? 94.926  111.950 66.300  1.00 87.87  ?  -32 DC  I C2    1 
ATOM 6490  O O2    . DC  I 5 42  ? 95.399  113.065 66.069  1.00 87.87  ?  -32 DC  I O2    1 
ATOM 6491  N N3    . DC  I 5 42  ? 93.593  111.737 66.392  1.00 87.87  ?  -32 DC  I N3    1 
ATOM 6492  C C4    . DC  I 5 42  ? 93.133  110.514 66.642  1.00 87.87  ?  -32 DC  I C4    1 
ATOM 6493  N N4    . DC  I 5 42  ? 91.809  110.350 66.725  1.00 87.87  ?  -32 DC  I N4    1 
ATOM 6494  C C5    . DC  I 5 42  ? 94.008  109.410 66.837  1.00 87.87  ?  -32 DC  I C5    1 
ATOM 6495  C C6    . DC  I 5 42  ? 95.318  109.636 66.740  1.00 87.87  ?  -32 DC  I C6    1 
ATOM 6496  P P     . DA  I 5 43  ? 101.193 111.906 67.844  1.00 92.10  ?  -31 DA  I P     1 
ATOM 6497  O OP1   . DA  I 5 43  ? 102.536 111.958 67.230  1.00 92.10  ?  -31 DA  I OP1   1 
ATOM 6498  O OP2   . DA  I 5 43  ? 100.933 111.008 68.987  1.00 92.10  -1 -31 DA  I OP2   1 
ATOM 6499  O "O5'" . DA  I 5 43  ? 100.768 113.384 68.261  1.00 92.10  ?  -31 DA  I "O5'" 1 
ATOM 6500  C "C5'" . DA  I 5 43  ? 99.521  113.894 67.817  1.00 92.10  ?  -31 DA  I "C5'" 1 
ATOM 6501  C "C4'" . DA  I 5 43  ? 99.342  115.332 68.240  1.00 92.10  ?  -31 DA  I "C4'" 1 
ATOM 6502  O "O4'" . DA  I 5 43  ? 97.936  115.659 68.233  1.00 92.10  ?  -31 DA  I "O4'" 1 
ATOM 6503  C "C3'" . DA  I 5 43  ? 99.776  115.630 69.651  1.00 92.10  ?  -31 DA  I "C3'" 1 
ATOM 6504  O "O3'" . DA  I 5 43  ? 99.938  117.028 69.794  1.00 92.10  ?  -31 DA  I "O3'" 1 
ATOM 6505  C "C2'" . DA  I 5 43  ? 98.580  115.115 70.443  1.00 92.10  ?  -31 DA  I "C2'" 1 
ATOM 6506  C "C1'" . DA  I 5 43  ? 97.409  115.508 69.540  1.00 92.10  ?  -31 DA  I "C1'" 1 
ATOM 6507  N N9    . DA  I 5 43  ? 96.355  114.506 69.476  1.00 92.10  ?  -31 DA  I N9    1 
ATOM 6508  C C8    . DA  I 5 43  ? 96.512  113.153 69.483  1.00 92.10  ?  -31 DA  I C8    1 
ATOM 6509  N N7    . DA  I 5 43  ? 95.389  112.490 69.391  1.00 92.10  ?  -31 DA  I N7    1 
ATOM 6510  C C5    . DA  I 5 43  ? 94.427  113.477 69.308  1.00 92.10  ?  -31 DA  I C5    1 
ATOM 6511  C C6    . DA  I 5 43  ? 93.027  113.426 69.192  1.00 92.10  ?  -31 DA  I C6    1 
ATOM 6512  N N6    . DA  I 5 43  ? 92.345  112.284 69.138  1.00 92.10  ?  -31 DA  I N6    1 
ATOM 6513  N N1    . DA  I 5 43  ? 92.351  114.596 69.140  1.00 92.10  ?  -31 DA  I N1    1 
ATOM 6514  C C2    . DA  I 5 43  ? 93.048  115.738 69.196  1.00 92.10  ?  -31 DA  I C2    1 
ATOM 6515  N N3    . DA  I 5 43  ? 94.368  115.908 69.306  1.00 92.10  ?  -31 DA  I N3    1 
ATOM 6516  C C4    . DA  I 5 43  ? 95.003  114.727 69.358  1.00 92.10  ?  -31 DA  I C4    1 
ATOM 6517  P P     . DG  I 5 44  ? 100.558 117.650 71.136  1.00 93.94  ?  -30 DG  I P     1 
ATOM 6518  O OP1   . DG  I 5 44  ? 101.722 118.475 70.747  1.00 93.94  ?  -30 DG  I OP1   1 
ATOM 6519  O OP2   . DG  I 5 44  ? 100.726 116.557 72.117  1.00 93.94  -1 -30 DG  I OP2   1 
ATOM 6520  O "O5'" . DG  I 5 44  ? 99.397  118.614 71.657  1.00 93.94  ?  -30 DG  I "O5'" 1 
ATOM 6521  C "C5'" . DG  I 5 44  ? 98.337  118.964 70.779  1.00 93.94  ?  -30 DG  I "C5'" 1 
ATOM 6522  C "C4'" . DG  I 5 44  ? 97.178  119.594 71.531  1.00 93.94  ?  -30 DG  I "C4'" 1 
ATOM 6523  O "O4'" . DG  I 5 44  ? 96.030  118.706 71.503  1.00 93.94  ?  -30 DG  I "O4'" 1 
ATOM 6524  C "C3'" . DG  I 5 44  ? 97.432  119.898 72.998  1.00 93.94  ?  -30 DG  I "C3'" 1 
ATOM 6525  O "O3'" . DG  I 5 44  ? 96.717  121.067 73.353  1.00 93.94  ?  -30 DG  I "O3'" 1 
ATOM 6526  C "C2'" . DG  I 5 44  ? 96.867  118.664 73.695  1.00 93.94  ?  -30 DG  I "C2'" 1 
ATOM 6527  C "C1'" . DG  I 5 44  ? 95.668  118.336 72.819  1.00 93.94  ?  -30 DG  I "C1'" 1 
ATOM 6528  N N9    . DG  I 5 44  ? 95.334  116.920 72.802  1.00 93.94  ?  -30 DG  I N9    1 
ATOM 6529  C C8    . DG  I 5 44  ? 96.208  115.872 72.888  1.00 93.94  ?  -30 DG  I C8    1 
ATOM 6530  N N7    . DG  I 5 44  ? 95.634  114.708 72.818  1.00 93.94  ?  -30 DG  I N7    1 
ATOM 6531  C C5    . DG  I 5 44  ? 94.290  115.003 72.677  1.00 93.94  ?  -30 DG  I C5    1 
ATOM 6532  C C6    . DG  I 5 44  ? 93.183  114.139 72.555  1.00 93.94  ?  -30 DG  I C6    1 
ATOM 6533  O O6    . DG  I 5 44  ? 93.173  112.903 72.553  1.00 93.94  ?  -30 DG  I O6    1 
ATOM 6534  N N1    . DG  I 5 44  ? 91.990  114.842 72.435  1.00 93.94  ?  -30 DG  I N1    1 
ATOM 6535  C C2    . DG  I 5 44  ? 91.886  116.213 72.426  1.00 93.94  ?  -30 DG  I C2    1 
ATOM 6536  N N2    . DG  I 5 44  ? 90.647  116.715 72.302  1.00 93.94  ?  -30 DG  I N2    1 
ATOM 6537  N N3    . DG  I 5 44  ? 92.921  117.035 72.539  1.00 93.94  ?  -30 DG  I N3    1 
ATOM 6538  C C4    . DG  I 5 44  ? 94.087  116.361 72.660  1.00 93.94  ?  -30 DG  I C4    1 
ATOM 6539  P P     . DC  I 5 45  ? 96.937  121.778 74.775  1.00 95.57  ?  -29 DC  I P     1 
ATOM 6540  O OP1   . DC  I 5 45  ? 97.553  123.095 74.512  1.00 95.57  ?  -29 DC  I OP1   1 
ATOM 6541  O OP2   . DC  I 5 45  ? 97.603  120.837 75.701  1.00 95.57  -1 -29 DC  I OP2   1 
ATOM 6542  O "O5'" . DC  I 5 45  ? 95.445  122.007 75.292  1.00 95.57  ?  -29 DC  I "O5'" 1 
ATOM 6543  C "C5'" . DC  I 5 45  ? 94.424  122.329 74.356  1.00 95.57  ?  -29 DC  I "C5'" 1 
ATOM 6544  C "C4'" . DC  I 5 45  ? 93.050  121.996 74.909  1.00 95.57  ?  -29 DC  I "C4'" 1 
ATOM 6545  O "O4'" . DC  I 5 45  ? 92.776  120.584 74.730  1.00 95.57  ?  -29 DC  I "O4'" 1 
ATOM 6546  C "C3'" . DC  I 5 45  ? 92.867  122.289 76.392  1.00 95.57  ?  -29 DC  I "C3'" 1 
ATOM 6547  O "O3'" . DC  I 5 45  ? 91.636  122.938 76.601  1.00 95.57  ?  -29 DC  I "O3'" 1 
ATOM 6548  C "C2'" . DC  I 5 45  ? 92.894  120.909 77.043  1.00 95.57  ?  -29 DC  I "C2'" 1 
ATOM 6549  C "C1'" . DC  I 5 45  ? 92.348  120.015 75.945  1.00 95.57  ?  -29 DC  I "C1'" 1 
ATOM 6550  N N1    . DC  I 5 45  ? 92.871  118.620 75.994  1.00 95.57  ?  -29 DC  I N1    1 
ATOM 6551  C C2    . DC  I 5 45  ? 91.991  117.541 75.883  1.00 95.57  ?  -29 DC  I C2    1 
ATOM 6552  O O2    . DC  I 5 45  ? 90.783  117.758 75.766  1.00 95.57  ?  -29 DC  I O2    1 
ATOM 6553  N N3    . DC  I 5 45  ? 92.489  116.282 75.911  1.00 95.57  ?  -29 DC  I N3    1 
ATOM 6554  C C4    . DC  I 5 45  ? 93.798  116.088 76.038  1.00 95.57  ?  -29 DC  I C4    1 
ATOM 6555  N N4    . DC  I 5 45  ? 94.245  114.831 76.061  1.00 95.57  ?  -29 DC  I N4    1 
ATOM 6556  C C5    . DC  I 5 45  ? 94.709  117.173 76.150  1.00 95.57  ?  -29 DC  I C5    1 
ATOM 6557  C C6    . DC  I 5 45  ? 94.207  118.410 76.122  1.00 95.57  ?  -29 DC  I C6    1 
ATOM 6558  P P     . DT  I 5 46  ? 91.341  123.662 78.001  1.00 93.65  ?  -28 DT  I P     1 
ATOM 6559  O OP1   . DT  I 5 46  ? 90.911  125.049 77.724  1.00 93.65  ?  -28 DT  I OP1   1 
ATOM 6560  O OP2   . DT  I 5 46  ? 92.492  123.401 78.891  1.00 93.65  -1 -28 DT  I OP2   1 
ATOM 6561  O "O5'" . DT  I 5 46  ? 90.101  122.852 78.578  1.00 93.65  ?  -28 DT  I "O5'" 1 
ATOM 6562  C "C5'" . DT  I 5 46  ? 89.070  122.421 77.705  1.00 93.65  ?  -28 DT  I "C5'" 1 
ATOM 6563  C "C4'" . DT  I 5 46  ? 88.169  121.432 78.410  1.00 93.65  ?  -28 DT  I "C4'" 1 
ATOM 6564  O "O4'" . DT  I 5 46  ? 88.713  120.096 78.267  1.00 93.65  ?  -28 DT  I "O4'" 1 
ATOM 6565  C "C3'" . DT  I 5 46  ? 88.020  121.678 79.912  1.00 93.65  ?  -28 DT  I "C3'" 1 
ATOM 6566  O "O3'" . DT  I 5 46  ? 86.659  121.601 80.288  1.00 93.65  ?  -28 DT  I "O3'" 1 
ATOM 6567  C "C2'" . DT  I 5 46  ? 88.847  120.560 80.545  1.00 93.65  ?  -28 DT  I "C2'" 1 
ATOM 6568  C "C1'" . DT  I 5 46  ? 88.710  119.455 79.517  1.00 93.65  ?  -28 DT  I "C1'" 1 
ATOM 6569  N N1    . DT  I 5 46  ? 89.824  118.479 79.547  1.00 93.65  ?  -28 DT  I N1    1 
ATOM 6570  C C2    . DT  I 5 46  ? 89.538  117.143 79.480  1.00 93.65  ?  -28 DT  I C2    1 
ATOM 6571  O O2    . DT  I 5 46  ? 88.408  116.708 79.394  1.00 93.65  ?  -28 DT  I O2    1 
ATOM 6572  N N3    . DT  I 5 46  ? 90.627  116.324 79.511  1.00 93.65  ?  -28 DT  I N3    1 
ATOM 6573  C C4    . DT  I 5 46  ? 91.948  116.701 79.604  1.00 93.65  ?  -28 DT  I C4    1 
ATOM 6574  O O4    . DT  I 5 46  ? 92.861  115.890 79.627  1.00 93.65  ?  -28 DT  I O4    1 
ATOM 6575  C C5    . DT  I 5 46  ? 92.183  118.114 79.675  1.00 93.65  ?  -28 DT  I C5    1 
ATOM 6576  C C7    . DT  I 5 46  ? 93.586  118.628 79.786  1.00 93.65  ?  -28 DT  I C7    1 
ATOM 6577  C C6    . DT  I 5 46  ? 91.122  118.931 79.644  1.00 93.65  ?  -28 DT  I C6    1 
ATOM 6578  P P     . DC  I 5 47  ? 86.193  122.163 81.718  1.00 96.47  ?  -27 DC  I P     1 
ATOM 6579  O OP1   . DC  I 5 47  ? 85.124  123.156 81.479  1.00 96.47  ?  -27 DC  I OP1   1 
ATOM 6580  O OP2   . DC  I 5 47  ? 87.408  122.557 82.464  1.00 96.47  -1 -27 DC  I OP2   1 
ATOM 6581  O "O5'" . DC  I 5 47  ? 85.557  120.886 82.439  1.00 96.47  ?  -27 DC  I "O5'" 1 
ATOM 6582  C "C5'" . DC  I 5 47  ? 84.312  120.364 81.989  1.00 96.47  ?  -27 DC  I "C5'" 1 
ATOM 6583  C "C4'" . DC  I 5 47  ? 84.159  118.898 82.359  1.00 96.47  ?  -27 DC  I "C4'" 1 
ATOM 6584  O "O4'" . DC  I 5 47  ? 85.427  118.211 82.185  1.00 96.47  ?  -27 DC  I "O4'" 1 
ATOM 6585  C "C3'" . DC  I 5 47  ? 83.740  118.621 83.798  1.00 96.47  ?  -27 DC  I "C3'" 1 
ATOM 6586  O "O3'" . DC  I 5 47  ? 82.955  117.444 83.823  1.00 96.47  ?  -27 DC  I "O3'" 1 
ATOM 6587  C "C2'" . DC  I 5 47  ? 85.081  118.400 84.475  1.00 96.47  ?  -27 DC  I "C2'" 1 
ATOM 6588  C "C1'" . DC  I 5 47  ? 85.801  117.607 83.404  1.00 96.47  ?  -27 DC  I "C1'" 1 
ATOM 6589  N N1    . DC  I 5 47  ? 87.289  117.638 83.501  1.00 96.47  ?  -27 DC  I N1    1 
ATOM 6590  C C2    . DC  I 5 47  ? 88.011  116.439 83.462  1.00 96.47  ?  -27 DC  I C2    1 
ATOM 6591  O O2    . DC  I 5 47  ? 87.396  115.370 83.370  1.00 96.47  ?  -27 DC  I O2    1 
ATOM 6592  N N3    . DC  I 5 47  ? 89.363  116.482 83.531  1.00 96.47  ?  -27 DC  I N3    1 
ATOM 6593  C C4    . DC  I 5 47  ? 89.985  117.656 83.630  1.00 96.47  ?  -27 DC  I C4    1 
ATOM 6594  N N4    . DC  I 5 47  ? 91.319  117.652 83.696  1.00 96.47  ?  -27 DC  I N4    1 
ATOM 6595  C C5    . DC  I 5 47  ? 89.269  118.885 83.669  1.00 96.47  ?  -27 DC  I C5    1 
ATOM 6596  C C6    . DC  I 5 47  ? 87.936  118.831 83.597  1.00 96.47  ?  -27 DC  I C6    1 
ATOM 6597  P P     . DT  I 5 48  ? 82.185  116.974 85.154  1.00 88.50  ?  -26 DT  I P     1 
ATOM 6598  O OP1   . DT  I 5 48  ? 80.835  117.573 85.109  1.00 88.50  ?  -26 DT  I OP1   1 
ATOM 6599  O OP2   . DT  I 5 48  ? 83.047  117.196 86.335  1.00 88.50  -1 -26 DT  I OP2   1 
ATOM 6600  O "O5'" . DT  I 5 48  ? 82.054  115.395 84.952  1.00 88.50  ?  -26 DT  I "O5'" 1 
ATOM 6601  C "C5'" . DT  I 5 48  ? 83.125  114.681 84.342  1.00 88.50  ?  -26 DT  I "C5'" 1 
ATOM 6602  C "C4'" . DT  I 5 48  ? 83.548  113.491 85.181  1.00 88.50  ?  -26 DT  I "C4'" 1 
ATOM 6603  O "O4'" . DT  I 5 48  ? 84.991  113.505 85.351  1.00 88.50  ?  -26 DT  I "O4'" 1 
ATOM 6604  C "C3'" . DT  I 5 48  ? 83.003  113.471 86.598  1.00 88.50  ?  -26 DT  I "C3'" 1 
ATOM 6605  O "O3'" . DT  I 5 48  ? 83.084  112.138 87.107  1.00 88.50  ?  -26 DT  I "O3'" 1 
ATOM 6606  C "C2'" . DT  I 5 48  ? 84.035  114.351 87.290  1.00 88.50  ?  -26 DT  I "C2'" 1 
ATOM 6607  C "C1'" . DT  I 5 48  ? 85.286  113.713 86.718  1.00 88.50  ?  -26 DT  I "C1'" 1 
ATOM 6608  N N1    . DT  I 5 48  ? 86.521  114.524 86.810  1.00 88.50  ?  -26 DT  I N1    1 
ATOM 6609  C C2    . DT  I 5 48  ? 87.724  113.883 86.710  1.00 88.50  ?  -26 DT  I C2    1 
ATOM 6610  O O2    . DT  I 5 48  ? 87.823  112.683 86.572  1.00 88.50  ?  -26 DT  I O2    1 
ATOM 6611  N N3    . DT  I 5 48  ? 88.816  114.694 86.784  1.00 88.50  ?  -26 DT  I N3    1 
ATOM 6612  C C4    . DT  I 5 48  ? 88.824  116.059 86.939  1.00 88.50  ?  -26 DT  I C4    1 
ATOM 6613  O O4    . DT  I 5 48  ? 89.859  116.704 86.996  1.00 88.50  ?  -26 DT  I O4    1 
ATOM 6614  C C5    . DT  I 5 48  ? 87.534  116.677 87.033  1.00 88.50  ?  -26 DT  I C5    1 
ATOM 6615  C C7    . DT  I 5 48  ? 87.438  118.161 87.213  1.00 88.50  ?  -26 DT  I C7    1 
ATOM 6616  C C6    . DT  I 5 48  ? 86.447  115.890 86.961  1.00 88.50  ?  -26 DT  I C6    1 
ATOM 6617  P P     . DA  I 5 49  ? 81.926  111.046 86.862  1.00 80.77  ?  -25 DA  I P     1 
ATOM 6618  O OP1   . DA  I 5 49  ? 81.225  111.270 85.580  1.00 80.77  ?  -25 DA  I OP1   1 
ATOM 6619  O OP2   . DA  I 5 49  ? 81.144  110.982 88.112  1.00 80.77  -1 -25 DA  I OP2   1 
ATOM 6620  O "O5'" . DA  I 5 49  ? 82.745  109.678 86.747  1.00 80.77  ?  -25 DA  I "O5'" 1 
ATOM 6621  C "C5'" . DA  I 5 49  ? 84.169  109.722 86.631  1.00 80.77  ?  -25 DA  I "C5'" 1 
ATOM 6622  C "C4'" . DA  I 5 49  ? 84.855  108.856 87.680  1.00 80.77  ?  -25 DA  I "C4'" 1 
ATOM 6623  O "O4'" . DA  I 5 49  ? 85.903  109.623 88.318  1.00 80.77  ?  -25 DA  I "O4'" 1 
ATOM 6624  C "C3'" . DA  I 5 49  ? 83.981  108.394 88.832  1.00 80.77  ?  -25 DA  I "C3'" 1 
ATOM 6625  O "O3'" . DA  I 5 49  ? 84.623  107.326 89.522  1.00 80.77  ?  -25 DA  I "O3'" 1 
ATOM 6626  C "C2'" . DA  I 5 49  ? 84.012  109.636 89.705  1.00 80.77  ?  -25 DA  I "C2'" 1 
ATOM 6627  C "C1'" . DA  I 5 49  ? 85.496  109.968 89.630  1.00 80.77  ?  -25 DA  I "C1'" 1 
ATOM 6628  N N9    . DA  I 5 49  ? 85.792  111.372 89.836  1.00 80.77  ?  -25 DA  I N9    1 
ATOM 6629  C C8    . DA  I 5 49  ? 84.899  112.370 90.067  1.00 80.77  ?  -25 DA  I C8    1 
ATOM 6630  N N7    . DA  I 5 49  ? 85.449  113.548 90.202  1.00 80.77  ?  -25 DA  I N7    1 
ATOM 6631  C C5    . DA  I 5 49  ? 86.796  113.304 90.040  1.00 80.77  ?  -25 DA  I C5    1 
ATOM 6632  C C6    . DA  I 5 49  ? 87.917  114.145 90.072  1.00 80.77  ?  -25 DA  I C6    1 
ATOM 6633  N N6    . DA  I 5 49  ? 87.835  115.458 90.281  1.00 80.77  ?  -25 DA  I N6    1 
ATOM 6634  N N1    . DA  I 5 49  ? 89.129  113.586 89.881  1.00 80.77  ?  -25 DA  I N1    1 
ATOM 6635  C C2    . DA  I 5 49  ? 89.203  112.267 89.672  1.00 80.77  ?  -25 DA  I C2    1 
ATOM 6636  N N3    . DA  I 5 49  ? 88.214  111.375 89.624  1.00 80.77  ?  -25 DA  I N3    1 
ATOM 6637  C C4    . DA  I 5 49  ? 87.027  111.966 89.817  1.00 80.77  ?  -25 DA  I C4    1 
ATOM 6638  P P     . DG  I 5 50  ? 84.580  105.802 89.013  1.00 68.45  ?  -24 DG  I P     1 
ATOM 6639  O OP1   . DG  I 5 50  ? 84.106  105.703 87.619  1.00 68.45  ?  -24 DG  I OP1   1 
ATOM 6640  O OP2   . DG  I 5 50  ? 83.877  105.037 90.061  1.00 68.45  -1 -24 DG  I OP2   1 
ATOM 6641  O "O5'" . DG  I 5 50  ? 86.116  105.379 89.089  1.00 68.45  ?  -24 DG  I "O5'" 1 
ATOM 6642  C "C5'" . DG  I 5 50  ? 87.077  106.374 89.401  1.00 68.45  ?  -24 DG  I "C5'" 1 
ATOM 6643  C "C4'" . DG  I 5 50  ? 88.414  105.782 89.788  1.00 68.45  ?  -24 DG  I "C4'" 1 
ATOM 6644  O "O4'" . DG  I 5 50  ? 89.196  106.805 90.422  1.00 68.45  ?  -24 DG  I "O4'" 1 
ATOM 6645  C "C3'" . DG  I 5 50  ? 88.370  104.698 90.833  1.00 68.45  ?  -24 DG  I "C3'" 1 
ATOM 6646  O "O3'" . DG  I 5 50  ? 89.636  104.078 90.876  1.00 68.45  ?  -24 DG  I "O3'" 1 
ATOM 6647  C "C2'" . DG  I 5 50  ? 88.120  105.518 92.085  1.00 68.45  ?  -24 DG  I "C2'" 1 
ATOM 6648  C "C1'" . DG  I 5 50  ? 88.958  106.764 91.817  1.00 68.45  ?  -24 DG  I "C1'" 1 
ATOM 6649  N N9    . DG  I 5 50  ? 88.284  107.994 92.196  1.00 68.45  ?  -24 DG  I N9    1 
ATOM 6650  C C8    . DG  I 5 50  ? 86.941  108.165 92.401  1.00 68.45  ?  -24 DG  I C8    1 
ATOM 6651  N N7    . DG  I 5 50  ? 86.619  109.379 92.724  1.00 68.45  ?  -24 DG  I N7    1 
ATOM 6652  C C5    . DG  I 5 50  ? 87.821  110.058 92.725  1.00 68.45  ?  -24 DG  I C5    1 
ATOM 6653  C C6    . DG  I 5 50  ? 88.093  111.410 93.000  1.00 68.45  ?  -24 DG  I C6    1 
ATOM 6654  O O6    . DG  I 5 50  ? 87.297  112.302 93.307  1.00 68.45  ?  -24 DG  I O6    1 
ATOM 6655  N N1    . DG  I 5 50  ? 89.449  111.695 92.906  1.00 68.45  ?  -24 DG  I N1    1 
ATOM 6656  C C2    . DG  I 5 50  ? 90.419  110.783 92.573  1.00 68.45  ?  -24 DG  I C2    1 
ATOM 6657  N N2    . DG  I 5 50  ? 91.679  111.244 92.532  1.00 68.45  ?  -24 DG  I N2    1 
ATOM 6658  N N3    . DG  I 5 50  ? 90.175  109.508 92.313  1.00 68.45  ?  -24 DG  I N3    1 
ATOM 6659  C C4    . DG  I 5 50  ? 88.858  109.220 92.407  1.00 68.45  ?  -24 DG  I C4    1 
ATOM 6660  P P     . DC  I 5 51  ? 89.981  102.947 91.965  1.00 69.42  ?  -23 DC  I P     1 
ATOM 6661  O OP1   . DC  I 5 51  ? 90.563  101.810 91.228  1.00 69.42  ?  -23 DC  I OP1   1 
ATOM 6662  O OP2   . DC  I 5 51  ? 88.829  102.709 92.848  1.00 69.42  -1 -23 DC  I OP2   1 
ATOM 6663  O "O5'" . DC  I 5 51  ? 91.150  103.612 92.812  1.00 69.42  ?  -23 DC  I "O5'" 1 
ATOM 6664  C "C5'" . DC  I 5 51  ? 92.292  104.107 92.142  1.00 69.42  ?  -23 DC  I "C5'" 1 
ATOM 6665  C "C4'" . DC  I 5 51  ? 93.212  104.861 93.087  1.00 69.42  ?  -23 DC  I "C4'" 1 
ATOM 6666  O "O4'" . DC  I 5 51  ? 92.626  106.136 93.446  1.00 69.42  ?  -23 DC  I "O4'" 1 
ATOM 6667  C "C3'" . DC  I 5 51  ? 93.532  104.155 94.394  1.00 69.42  ?  -23 DC  I "C3'" 1 
ATOM 6668  O "O3'" . DC  I 5 51  ? 94.900  104.333 94.681  1.00 69.42  ?  -23 DC  I "O3'" 1 
ATOM 6669  C "C2'" . DC  I 5 51  ? 92.643  104.874 95.411  1.00 69.42  ?  -23 DC  I "C2'" 1 
ATOM 6670  C "C1'" . DC  I 5 51  ? 92.611  106.285 94.848  1.00 69.42  ?  -23 DC  I "C1'" 1 
ATOM 6671  N N1    . DC  I 5 51  ? 91.387  107.052 95.197  1.00 69.42  ?  -23 DC  I N1    1 
ATOM 6672  C C2    . DC  I 5 51  ? 91.487  108.397 95.542  1.00 69.42  ?  -23 DC  I C2    1 
ATOM 6673  O O2    . DC  I 5 51  ? 92.596  108.924 95.587  1.00 69.42  ?  -23 DC  I O2    1 
ATOM 6674  N N3    . DC  I 5 51  ? 90.363  109.086 95.836  1.00 69.42  ?  -23 DC  I N3    1 
ATOM 6675  C C4    . DC  I 5 51  ? 89.182  108.484 95.780  1.00 69.42  ?  -23 DC  I C4    1 
ATOM 6676  N N4    . DC  I 5 51  ? 88.098  109.204 96.076  1.00 69.42  ?  -23 DC  I N4    1 
ATOM 6677  C C5    . DC  I 5 51  ? 89.057  107.116 95.422  1.00 69.42  ?  -23 DC  I C5    1 
ATOM 6678  C C6    . DC  I 5 51  ? 90.176  106.445 95.142  1.00 69.42  ?  -23 DC  I C6    1 
ATOM 6679  P P     . DA  I 5 52  ? 95.633  103.420 95.775  1.00 92.48  ?  -22 DA  I P     1 
ATOM 6680  O OP1   . DA  I 5 52  ? 96.625  102.584 95.071  1.00 92.48  ?  -22 DA  I OP1   1 
ATOM 6681  O OP2   . DA  I 5 52  ? 94.595  102.779 96.608  1.00 92.48  -1 -22 DA  I OP2   1 
ATOM 6682  O "O5'" . DA  I 5 52  ? 96.410  104.486 96.669  1.00 92.48  ?  -22 DA  I "O5'" 1 
ATOM 6683  C "C5'" . DA  I 5 52  ? 96.123  105.865 96.511  1.00 92.48  ?  -22 DA  I "C5'" 1 
ATOM 6684  C "C4'" . DA  I 5 52  ? 96.694  106.663 97.657  1.00 92.48  ?  -22 DA  I "C4'" 1 
ATOM 6685  O "O4'" . DA  I 5 52  ? 95.749  107.689 98.045  1.00 92.48  ?  -22 DA  I "O4'" 1 
ATOM 6686  C "C3'" . DA  I 5 52  ? 96.952  105.864 98.916  1.00 92.48  ?  -22 DA  I "C3'" 1 
ATOM 6687  O "O3'" . DA  I 5 52  ? 97.981  106.488 99.669  1.00 92.48  ?  -22 DA  I "O3'" 1 
ATOM 6688  C "C2'" . DA  I 5 52  ? 95.602  105.935 99.623  1.00 92.48  ?  -22 DA  I "C2'" 1 
ATOM 6689  C "C1'" . DA  I 5 52  ? 95.140  107.347 99.277  1.00 92.48  ?  -22 DA  I "C1'" 1 
ATOM 6690  N N9    . DA  I 5 52  ? 93.694  107.473 99.118  1.00 92.48  ?  -22 DA  I N9    1 
ATOM 6691  C C8    . DA  I 5 52  ? 92.851  106.586 98.521  1.00 92.48  ?  -22 DA  I C8    1 
ATOM 6692  N N7    . DA  I 5 52  ? 91.598  106.970 98.511  1.00 92.48  ?  -22 DA  I N7    1 
ATOM 6693  C C5    . DA  I 5 52  ? 91.623  108.194 99.144  1.00 92.48  ?  -22 DA  I C5    1 
ATOM 6694  C C6    . DA  I 5 52  ? 90.614  109.124 99.457  1.00 92.48  ?  -22 DA  I C6    1 
ATOM 6695  N N6    . DA  I 5 52  ? 89.326  108.943 99.154  1.00 92.48  ?  -22 DA  I N6    1 
ATOM 6696  N N1    . DA  I 5 52  ? 90.980  110.252 100.097 1.00 92.48  ?  -22 DA  I N1    1 
ATOM 6697  C C2    . DA  I 5 52  ? 92.269  110.430 100.404 1.00 92.48  ?  -22 DA  I C2    1 
ATOM 6698  N N3    . DA  I 5 52  ? 93.303  109.631 100.158 1.00 92.48  ?  -22 DA  I N3    1 
ATOM 6699  C C4    . DA  I 5 52  ? 92.908  108.521 99.523  1.00 92.48  ?  -22 DA  I C4    1 
ATOM 6700  P P     . DC  I 5 53  ? 98.494  105.839 101.044 1.00 103.00 ?  -21 DC  I P     1 
ATOM 6701  O OP1   . DC  I 5 53  ? 99.936  106.130 101.172 1.00 103.00 ?  -21 DC  I OP1   1 
ATOM 6702  O OP2   . DC  I 5 53  ? 98.014  104.443 101.099 1.00 103.00 -1 -21 DC  I OP2   1 
ATOM 6703  O "O5'" . DC  I 5 53  ? 97.717  106.676 102.154 1.00 103.00 ?  -21 DC  I "O5'" 1 
ATOM 6704  C "C5'" . DC  I 5 53  ? 97.632  108.083 102.027 1.00 103.00 ?  -21 DC  I "C5'" 1 
ATOM 6705  C "C4'" . DC  I 5 53  ? 96.740  108.671 103.098 1.00 103.00 ?  -21 DC  I "C4'" 1 
ATOM 6706  O "O4'" . DC  I 5 53  ? 95.364  108.697 102.643 1.00 103.00 ?  -21 DC  I "O4'" 1 
ATOM 6707  C "C3'" . DC  I 5 53  ? 96.731  107.913 104.428 1.00 103.00 ?  -21 DC  I "C3'" 1 
ATOM 6708  O "O3'" . DC  I 5 53  ? 96.837  108.846 105.479 1.00 103.00 ?  -21 DC  I "O3'" 1 
ATOM 6709  C "C2'" . DC  I 5 53  ? 95.362  107.236 104.426 1.00 103.00 ?  -21 DC  I "C2'" 1 
ATOM 6710  C "C1'" . DC  I 5 53  ? 94.548  108.287 103.706 1.00 103.00 ?  -21 DC  I "C1'" 1 
ATOM 6711  N N1    . DC  I 5 53  ? 93.253  107.803 103.169 1.00 103.00 ?  -21 DC  I N1    1 
ATOM 6712  C C2    . DC  I 5 53  ? 92.105  108.549 103.411 1.00 103.00 ?  -21 DC  I C2    1 
ATOM 6713  O O2    . DC  I 5 53  ? 92.200  109.590 104.065 1.00 103.00 ?  -21 DC  I O2    1 
ATOM 6714  N N3    . DC  I 5 53  ? 90.922  108.115 102.924 1.00 103.00 ?  -21 DC  I N3    1 
ATOM 6715  C C4    . DC  I 5 53  ? 90.866  106.984 102.223 1.00 103.00 ?  -21 DC  I C4    1 
ATOM 6716  N N4    . DC  I 5 53  ? 89.675  106.595 101.763 1.00 103.00 ?  -21 DC  I N4    1 
ATOM 6717  C C5    . DC  I 5 53  ? 92.030  106.203 101.963 1.00 103.00 ?  -21 DC  I C5    1 
ATOM 6718  C C6    . DC  I 5 53  ? 93.193  106.647 102.452 1.00 103.00 ?  -21 DC  I C6    1 
ATOM 6719  P P     . DC  I 5 54  ? 97.250  108.383 106.959 1.00 115.30 ?  -20 DC  I P     1 
ATOM 6720  O OP1   . DC  I 5 54  ? 98.703  108.105 106.957 1.00 115.30 ?  -20 DC  I OP1   1 
ATOM 6721  O OP2   . DC  I 5 54  ? 96.300  107.341 107.405 1.00 115.30 -1 -20 DC  I OP2   1 
ATOM 6722  O "O5'" . DC  I 5 54  ? 96.978  109.693 107.828 1.00 115.30 ?  -20 DC  I "O5'" 1 
ATOM 6723  C "C5'" . DC  I 5 54  ? 96.031  110.656 107.369 1.00 115.30 ?  -20 DC  I "C5'" 1 
ATOM 6724  C "C4'" . DC  I 5 54  ? 94.794  110.653 108.244 1.00 115.30 ?  -20 DC  I "C4'" 1 
ATOM 6725  O "O4'" . DC  I 5 54  ? 93.664  110.108 107.509 1.00 115.30 ?  -20 DC  I "O4'" 1 
ATOM 6726  C "C3'" . DC  I 5 54  ? 94.914  109.810 109.518 1.00 115.30 ?  -20 DC  I "C3'" 1 
ATOM 6727  O "O3'" . DC  I 5 54  ? 94.386  110.522 110.616 1.00 115.30 ?  -20 DC  I "O3'" 1 
ATOM 6728  C "C2'" . DC  I 5 54  ? 94.068  108.587 109.197 1.00 115.30 ?  -20 DC  I "C2'" 1 
ATOM 6729  C "C1'" . DC  I 5 54  ? 92.981  109.221 108.355 1.00 115.30 ?  -20 DC  I "C1'" 1 
ATOM 6730  N N1    . DC  I 5 54  ? 92.215  108.242 107.543 1.00 115.30 ?  -20 DC  I N1    1 
ATOM 6731  C C2    . DC  I 5 54  ? 90.844  108.425 107.358 1.00 115.30 ?  -20 DC  I C2    1 
ATOM 6732  O O2    . DC  I 5 54  ? 90.297  109.414 107.851 1.00 115.30 ?  -20 DC  I O2    1 
ATOM 6733  N N3    . DC  I 5 54  ? 90.154  107.518 106.628 1.00 115.30 ?  -20 DC  I N3    1 
ATOM 6734  C C4    . DC  I 5 54  ? 90.784  106.462 106.110 1.00 115.30 ?  -20 DC  I C4    1 
ATOM 6735  N N4    . DC  I 5 54  ? 90.064  105.593 105.398 1.00 115.30 ?  -20 DC  I N4    1 
ATOM 6736  C C5    . DC  I 5 54  ? 92.179  106.253 106.297 1.00 115.30 ?  -20 DC  I C5    1 
ATOM 6737  C C6    . DC  I 5 54  ? 92.847  107.156 107.019 1.00 115.30 ?  -20 DC  I C6    1 
ATOM 6738  P P     . DG  I 5 55  ? 94.559  109.952 112.106 1.00 119.89 ?  -19 DG  I P     1 
ATOM 6739  O OP1   . DG  I 5 55  ? 96.009  109.842 112.374 1.00 119.89 ?  -19 DG  I OP1   1 
ATOM 6740  O OP2   . DG  I 5 55  ? 93.701  108.757 112.248 1.00 119.89 -1 -19 DG  I OP2   1 
ATOM 6741  O "O5'" . DG  I 5 55  ? 93.944  111.107 113.022 1.00 119.89 ?  -19 DG  I "O5'" 1 
ATOM 6742  C "C5'" . DG  I 5 55  ? 92.884  111.917 112.527 1.00 119.89 ?  -19 DG  I "C5'" 1 
ATOM 6743  C "C4'" . DG  I 5 55  ? 91.537  111.382 112.977 1.00 119.89 ?  -19 DG  I "C4'" 1 
ATOM 6744  O "O4'" . DG  I 5 55  ? 90.953  110.575 111.928 1.00 119.89 ?  -19 DG  I "O4'" 1 
ATOM 6745  C "C3'" . DG  I 5 55  ? 91.578  110.503 114.229 1.00 119.89 ?  -19 DG  I "C3'" 1 
ATOM 6746  O "O3'" . DG  I 5 55  ? 90.763  111.070 115.246 1.00 119.89 ?  -19 DG  I "O3'" 1 
ATOM 6747  C "C2'" . DG  I 5 55  ? 91.046  109.143 113.755 1.00 119.89 ?  -19 DG  I "C2'" 1 
ATOM 6748  C "C1'" . DG  I 5 55  ? 90.255  109.506 112.508 1.00 119.89 ?  -19 DG  I "C1'" 1 
ATOM 6749  N N9    . DG  I 5 55  ? 90.186  108.423 111.530 1.00 119.89 ?  -19 DG  I N9    1 
ATOM 6750  C C8    . DG  I 5 55  ? 91.237  107.691 111.044 1.00 119.89 ?  -19 DG  I C8    1 
ATOM 6751  N N7    . DG  I 5 55  ? 90.887  106.791 110.171 1.00 119.89 ?  -19 DG  I N7    1 
ATOM 6752  C C5    . DG  I 5 55  ? 89.514  106.934 110.070 1.00 119.89 ?  -19 DG  I C5    1 
ATOM 6753  C C6    . DG  I 5 55  ? 88.587  106.223 109.280 1.00 119.89 ?  -19 DG  I C6    1 
ATOM 6754  O O6    . DG  I 5 55  ? 88.808  105.305 108.484 1.00 119.89 ?  -19 DG  I O6    1 
ATOM 6755  N N1    . DG  I 5 55  ? 87.289  106.676 109.474 1.00 119.89 ?  -19 DG  I N1    1 
ATOM 6756  C C2    . DG  I 5 55  ? 86.932  107.689 110.329 1.00 119.89 ?  -19 DG  I C2    1 
ATOM 6757  N N2    . DG  I 5 55  ? 85.626  107.988 110.381 1.00 119.89 ?  -19 DG  I N2    1 
ATOM 6758  N N3    . DG  I 5 55  ? 87.794  108.365 111.081 1.00 119.89 ?  -19 DG  I N3    1 
ATOM 6759  C C4    . DG  I 5 55  ? 89.063  107.933 110.900 1.00 119.89 ?  -19 DG  I C4    1 
ATOM 6760  P P     . DC  I 5 56  ? 90.517  110.288 116.628 1.00 116.12 ?  -18 DC  I P     1 
ATOM 6761  O OP1   . DC  I 5 56  ? 90.360  111.303 117.692 1.00 116.12 ?  -18 DC  I OP1   1 
ATOM 6762  O OP2   . DC  I 5 56  ? 91.552  109.241 116.764 1.00 116.12 -1 -18 DC  I OP2   1 
ATOM 6763  O "O5'" . DC  I 5 56  ? 89.109  109.572 116.402 1.00 116.12 ?  -18 DC  I "O5'" 1 
ATOM 6764  C "C5'" . DC  I 5 56  ? 88.066  110.278 115.745 1.00 116.12 ?  -18 DC  I "C5'" 1 
ATOM 6765  C "C4'" . DC  I 5 56  ? 86.885  109.372 115.452 1.00 116.12 ?  -18 DC  I "C4'" 1 
ATOM 6766  O "O4'" . DC  I 5 56  ? 87.185  108.504 114.329 1.00 116.12 ?  -18 DC  I "O4'" 1 
ATOM 6767  C "C3'" . DC  I 5 56  ? 86.468  108.452 116.597 1.00 116.12 ?  -18 DC  I "C3'" 1 
ATOM 6768  O "O3'" . DC  I 5 56  ? 85.061  108.448 116.689 1.00 116.12 ?  -18 DC  I "O3'" 1 
ATOM 6769  C "C2'" . DC  I 5 56  ? 87.002  107.092 116.152 1.00 116.12 ?  -18 DC  I "C2'" 1 
ATOM 6770  C "C1'" . DC  I 5 56  ? 86.802  107.190 114.654 1.00 116.12 ?  -18 DC  I "C1'" 1 
ATOM 6771  N N1    . DC  I 5 56  ? 87.629  106.246 113.844 1.00 116.12 ?  -18 DC  I N1    1 
ATOM 6772  C C2    . DC  I 5 56  ? 87.002  105.380 112.951 1.00 116.12 ?  -18 DC  I C2    1 
ATOM 6773  O O2    . DC  I 5 56  ? 85.774  105.397 112.860 1.00 116.12 ?  -18 DC  I O2    1 
ATOM 6774  N N3    . DC  I 5 56  ? 87.759  104.545 112.201 1.00 116.12 ?  -18 DC  I N3    1 
ATOM 6775  C C4    . DC  I 5 56  ? 89.084  104.555 112.325 1.00 116.12 ?  -18 DC  I C4    1 
ATOM 6776  N N4    . DC  I 5 56  ? 89.790  103.713 111.564 1.00 116.12 ?  -18 DC  I N4    1 
ATOM 6777  C C5    . DC  I 5 56  ? 89.744  105.438 113.225 1.00 116.12 ?  -18 DC  I C5    1 
ATOM 6778  C C6    . DC  I 5 56  ? 88.984  106.258 113.957 1.00 116.12 ?  -18 DC  I C6    1 
ATOM 6779  P P     . DT  I 5 57  ? 84.331  108.012 118.048 1.00 116.74 ?  -17 DT  I P     1 
ATOM 6780  O OP1   . DT  I 5 57  ? 84.024  109.243 118.808 1.00 116.74 ?  -17 DT  I OP1   1 
ATOM 6781  O OP2   . DT  I 5 57  ? 85.135  106.941 118.677 1.00 116.74 -1 -17 DT  I OP2   1 
ATOM 6782  O "O5'" . DT  I 5 57  ? 82.962  107.370 117.534 1.00 116.74 ?  -17 DT  I "O5'" 1 
ATOM 6783  C "C5'" . DT  I 5 57  ? 82.887  106.848 116.212 1.00 116.74 ?  -17 DT  I "C5'" 1 
ATOM 6784  C "C4'" . DT  I 5 57  ? 82.557  105.370 116.235 1.00 116.74 ?  -17 DT  I "C4'" 1 
ATOM 6785  O "O4'" . DT  I 5 57  ? 83.539  104.636 115.448 1.00 116.74 ?  -17 DT  I "O4'" 1 
ATOM 6786  C "C3'" . DT  I 5 57  ? 82.594  104.721 117.625 1.00 116.74 ?  -17 DT  I "C3'" 1 
ATOM 6787  O "O3'" . DT  I 5 57  ? 81.691  103.635 117.659 1.00 116.74 ?  -17 DT  I "O3'" 1 
ATOM 6788  C "C2'" . DT  I 5 57  ? 84.013  104.190 117.652 1.00 116.74 ?  -17 DT  I "C2'" 1 
ATOM 6789  C "C1'" . DT  I 5 57  ? 84.037  103.604 116.258 1.00 116.74 ?  -17 DT  I "C1'" 1 
ATOM 6790  N N1    . DT  I 5 57  ? 85.370  103.158 115.771 1.00 116.74 ?  -17 DT  I N1    1 
ATOM 6791  C C2    . DT  I 5 57  ? 85.427  102.258 114.740 1.00 116.74 ?  -17 DT  I C2    1 
ATOM 6792  O O2    . DT  I 5 57  ? 84.436  101.818 114.188 1.00 116.74 ?  -17 DT  I O2    1 
ATOM 6793  N N3    . DT  I 5 57  ? 86.688  101.896 114.362 1.00 116.74 ?  -17 DT  I N3    1 
ATOM 6794  C C4    . DT  I 5 57  ? 87.875  102.329 114.916 1.00 116.74 ?  -17 DT  I C4    1 
ATOM 6795  O O4    . DT  I 5 57  ? 88.963  101.945 114.512 1.00 116.74 ?  -17 DT  I O4    1 
ATOM 6796  C C5    . DT  I 5 57  ? 87.743  103.264 116.001 1.00 116.74 ?  -17 DT  I C5    1 
ATOM 6797  C C7    . DT  I 5 57  ? 88.963  103.804 116.680 1.00 116.74 ?  -17 DT  I C7    1 
ATOM 6798  C C6    . DT  I 5 57  ? 86.511  103.621 116.378 1.00 116.74 ?  -17 DT  I C6    1 
ATOM 6799  P P     . DT  I 5 58  ? 80.160  103.804 118.114 1.00 119.46 ?  -16 DT  I P     1 
ATOM 6800  O OP1   . DT  I 5 58  ? 79.627  105.108 117.660 1.00 119.46 ?  -16 DT  I OP1   1 
ATOM 6801  O OP2   . DT  I 5 58  ? 80.084  103.443 119.547 1.00 119.46 -1 -16 DT  I OP2   1 
ATOM 6802  O "O5'" . DT  I 5 58  ? 79.437  102.649 117.285 1.00 119.46 ?  -16 DT  I "O5'" 1 
ATOM 6803  C "C5'" . DT  I 5 58  ? 79.939  102.301 115.996 1.00 119.46 ?  -16 DT  I "C5'" 1 
ATOM 6804  C "C4'" . DT  I 5 58  ? 80.315  100.831 115.933 1.00 119.46 ?  -16 DT  I "C4'" 1 
ATOM 6805  O "O4'" . DT  I 5 58  ? 81.747  100.685 115.748 1.00 119.46 ?  -16 DT  I "O4'" 1 
ATOM 6806  C "C3'" . DT  I 5 58  ? 79.966  100.009 117.183 1.00 119.46 ?  -16 DT  I "C3'" 1 
ATOM 6807  O "O3'" . DT  I 5 58  ? 79.394  98.772  116.793 1.00 119.46 ?  -16 DT  I "O3'" 1 
ATOM 6808  C "C2'" . DT  I 5 58  ? 81.335  99.783  117.822 1.00 119.46 ?  -16 DT  I "C2'" 1 
ATOM 6809  C "C1'" . DT  I 5 58  ? 82.179  99.638  116.573 1.00 119.46 ?  -16 DT  I "C1'" 1 
ATOM 6810  N N1    . DT  I 5 58  ? 83.643  99.755  116.788 1.00 119.46 ?  -16 DT  I N1    1 
ATOM 6811  C C2    . DT  I 5 58  ? 84.492  99.108  115.925 1.00 119.46 ?  -16 DT  I C2    1 
ATOM 6812  O O2    . DT  I 5 58  ? 84.103  98.433  114.992 1.00 119.46 ?  -16 DT  I O2    1 
ATOM 6813  N N3    . DT  I 5 58  ? 85.821  99.269  116.199 1.00 119.46 ?  -16 DT  I N3    1 
ATOM 6814  C C4    . DT  I 5 58  ? 86.374  100.004 117.228 1.00 119.46 ?  -16 DT  I C4    1 
ATOM 6815  O O4    . DT  I 5 58  ? 87.585  100.093 117.392 1.00 119.46 ?  -16 DT  I O4    1 
ATOM 6816  C C5    . DT  I 5 58  ? 85.430  100.659 118.096 1.00 119.46 ?  -16 DT  I C5    1 
ATOM 6817  C C7    . DT  I 5 58  ? 85.918  101.479 119.251 1.00 119.46 ?  -16 DT  I C7    1 
ATOM 6818  C C6    . DT  I 5 58  ? 84.123  100.491 117.847 1.00 119.46 ?  -16 DT  I C6    1 
ATOM 6819  P P     . DA  I 5 59  ? 77.812  98.609  116.554 1.00 107.62 ?  -15 DA  I P     1 
ATOM 6820  O OP1   . DA  I 5 59  ? 77.199  99.922  116.260 1.00 107.62 ?  -15 DA  I OP1   1 
ATOM 6821  O OP2   . DA  I 5 59  ? 77.284  97.800  117.672 1.00 107.62 -1 -15 DA  I OP2   1 
ATOM 6822  O "O5'" . DA  I 5 59  ? 77.743  97.706  115.238 1.00 107.62 ?  -15 DA  I "O5'" 1 
ATOM 6823  C "C5'" . DA  I 5 59  ? 78.694  97.914  114.203 1.00 107.62 ?  -15 DA  I "C5'" 1 
ATOM 6824  C "C4'" . DA  I 5 59  ? 79.001  96.626  113.456 1.00 107.62 ?  -15 DA  I "C4'" 1 
ATOM 6825  O "O4'" . DA  I 5 59  ? 80.399  96.286  113.612 1.00 107.62 ?  -15 DA  I "O4'" 1 
ATOM 6826  C "C3'" . DA  I 5 59  ? 78.228  95.397  113.898 1.00 107.62 ?  -15 DA  I "C3'" 1 
ATOM 6827  O "O3'" . DA  I 5 59  ? 78.012  94.554  112.761 1.00 107.62 ?  -15 DA  I "O3'" 1 
ATOM 6828  C "C2'" . DA  I 5 59  ? 79.156  94.764  114.943 1.00 107.62 ?  -15 DA  I "C2'" 1 
ATOM 6829  C "C1'" . DA  I 5 59  ? 80.551  95.172  114.472 1.00 107.62 ?  -15 DA  I "C1'" 1 
ATOM 6830  N N9    . DA  I 5 59  ? 81.437  95.573  115.558 1.00 107.62 ?  -15 DA  I N9    1 
ATOM 6831  C C8    . DA  I 5 59  ? 81.075  96.148  116.740 1.00 107.62 ?  -15 DA  I C8    1 
ATOM 6832  N N7    . DA  I 5 59  ? 82.085  96.425  117.525 1.00 107.62 ?  -15 DA  I N7    1 
ATOM 6833  C C5    . DA  I 5 59  ? 83.188  96.016  116.804 1.00 107.62 ?  -15 DA  I C5    1 
ATOM 6834  C C6    . DA  I 5 59  ? 84.566  96.037  117.086 1.00 107.62 ?  -15 DA  I C6    1 
ATOM 6835  N N6    . DA  I 5 59  ? 85.073  96.525  118.220 1.00 107.62 ?  -15 DA  I N6    1 
ATOM 6836  N N1    . DA  I 5 59  ? 85.407  95.552  116.150 1.00 107.62 ?  -15 DA  I N1    1 
ATOM 6837  C C2    . DA  I 5 59  ? 84.894  95.083  115.005 1.00 107.62 ?  -15 DA  I C2    1 
ATOM 6838  N N3    . DA  I 5 59  ? 83.616  94.995  114.638 1.00 107.62 ?  -15 DA  I N3    1 
ATOM 6839  C C4    . DA  I 5 59  ? 82.809  95.490  115.587 1.00 107.62 ?  -15 DA  I C4    1 
ATOM 6840  P P     . DA  I 5 60  ? 77.636  92.998  112.912 1.00 99.07  ?  -14 DA  I P     1 
ATOM 6841  O OP1   . DA  I 5 60  ? 76.862  92.637  111.707 1.00 99.07  ?  -14 DA  I OP1   1 
ATOM 6842  O OP2   . DA  I 5 60  ? 77.052  92.740  114.246 1.00 99.07  -1 -14 DA  I OP2   1 
ATOM 6843  O "O5'" . DA  I 5 60  ? 79.050  92.267  112.798 1.00 99.07  ?  -14 DA  I "O5'" 1 
ATOM 6844  C "C5'" . DA  I 5 60  ? 79.905  92.577  111.706 1.00 99.07  ?  -14 DA  I "C5'" 1 
ATOM 6845  C "C4'" . DA  I 5 60  ? 81.238  91.845  111.795 1.00 99.07  ?  -14 DA  I "C4'" 1 
ATOM 6846  O "O4'" . DA  I 5 60  ? 82.012  92.326  112.922 1.00 99.07  ?  -14 DA  I "O4'" 1 
ATOM 6847  C "C3'" . DA  I 5 60  ? 81.164  90.334  111.955 1.00 99.07  ?  -14 DA  I "C3'" 1 
ATOM 6848  O "O3'" . DA  I 5 60  ? 82.216  89.765  111.211 1.00 99.07  ?  -14 DA  I "O3'" 1 
ATOM 6849  C "C2'" . DA  I 5 60  ? 81.381  90.150  113.457 1.00 99.07  ?  -14 DA  I "C2'" 1 
ATOM 6850  C "C1'" . DA  I 5 60  ? 82.407  91.236  113.730 1.00 99.07  ?  -14 DA  I "C1'" 1 
ATOM 6851  N N9    . DA  I 5 60  ? 82.438  91.721  115.102 1.00 99.07  ?  -14 DA  I N9    1 
ATOM 6852  C C8    . DA  I 5 60  ? 81.367  92.072  115.864 1.00 99.07  ?  -14 DA  I C8    1 
ATOM 6853  N N7    . DA  I 5 60  ? 81.686  92.529  117.047 1.00 99.07  ?  -14 DA  I N7    1 
ATOM 6854  C C5    . DA  I 5 60  ? 83.064  92.483  117.061 1.00 99.07  ?  -14 DA  I C5    1 
ATOM 6855  C C6    . DA  I 5 60  ? 84.005  92.829  118.038 1.00 99.07  ?  -14 DA  I C6    1 
ATOM 6856  N N6    . DA  I 5 60  ? 83.663  93.309  119.230 1.00 99.07  ?  -14 DA  I N6    1 
ATOM 6857  N N1    . DA  I 5 60  ? 85.311  92.665  117.746 1.00 99.07  ?  -14 DA  I N1    1 
ATOM 6858  C C2    . DA  I 5 60  ? 85.643  92.175  116.546 1.00 99.07  ?  -14 DA  I C2    1 
ATOM 6859  N N3    . DA  I 5 60  ? 84.843  91.820  115.539 1.00 99.07  ?  -14 DA  I N3    1 
ATOM 6860  C C4    . DA  I 5 60  ? 83.552  91.998  115.868 1.00 99.07  ?  -14 DA  I C4    1 
ATOM 6861  P P     . DA  I 5 61  ? 82.189  88.221  110.791 1.00 96.31  ?  -13 DA  I P     1 
ATOM 6862  O OP1   . DA  I 5 61  ? 82.017  88.167  109.324 1.00 96.31  ?  -13 DA  I OP1   1 
ATOM 6863  O OP2   . DA  I 5 61  ? 81.233  87.528  111.677 1.00 96.31  -1 -13 DA  I OP2   1 
ATOM 6864  O "O5'" . DA  I 5 61  ? 83.664  87.728  111.144 1.00 96.31  ?  -13 DA  I "O5'" 1 
ATOM 6865  C "C5'" . DA  I 5 61  ? 84.774  88.478  110.679 1.00 96.31  ?  -13 DA  I "C5'" 1 
ATOM 6866  C "C4'" . DA  I 5 61  ? 85.984  88.335  111.594 1.00 96.31  ?  -13 DA  I "C4'" 1 
ATOM 6867  O "O4'" . DA  I 5 61  ? 85.723  88.927  112.896 1.00 96.31  ?  -13 DA  I "O4'" 1 
ATOM 6868  C "C3'" . DA  I 5 61  ? 86.455  86.914  111.866 1.00 96.31  ?  -13 DA  I "C3'" 1 
ATOM 6869  O "O3'" . DA  I 5 61  ? 87.868  86.915  111.861 1.00 96.31  ?  -13 DA  I "O3'" 1 
ATOM 6870  C "C2'" . DA  I 5 61  ? 85.888  86.635  113.262 1.00 96.31  ?  -13 DA  I "C2'" 1 
ATOM 6871  C "C1'" . DA  I 5 61  ? 86.035  87.998  113.916 1.00 96.31  ?  -13 DA  I "C1'" 1 
ATOM 6872  N N9    . DA  I 5 61  ? 85.119  88.255  115.026 1.00 96.31  ?  -13 DA  I N9    1 
ATOM 6873  C C8    . DA  I 5 61  ? 83.762  88.201  114.983 1.00 96.31  ?  -13 DA  I C8    1 
ATOM 6874  N N7    . DA  I 5 61  ? 83.177  88.530  116.107 1.00 96.31  ?  -13 DA  I N7    1 
ATOM 6875  C C5    . DA  I 5 61  ? 84.225  88.826  116.952 1.00 96.31  ?  -13 DA  I C5    1 
ATOM 6876  C C6    . DA  I 5 61  ? 84.268  89.237  118.296 1.00 96.31  ?  -13 DA  I C6    1 
ATOM 6877  N N6    . DA  I 5 61  ? 83.174  89.422  119.038 1.00 96.31  ?  -13 DA  I N6    1 
ATOM 6878  N N1    . DA  I 5 61  ? 85.477  89.447  118.851 1.00 96.31  ?  -13 DA  I N1    1 
ATOM 6879  C C2    . DA  I 5 61  ? 86.569  89.254  118.101 1.00 96.31  ?  -13 DA  I C2    1 
ATOM 6880  N N3    . DA  I 5 61  ? 86.653  88.876  116.824 1.00 96.31  ?  -13 DA  I N3    1 
ATOM 6881  C C4    . DA  I 5 61  ? 85.434  88.683  116.302 1.00 96.31  ?  -13 DA  I C4    1 
ATOM 6882  P P     . DC  I 5 62  ? 88.708  85.551  111.887 1.00 100.48 ?  -12 DC  I P     1 
ATOM 6883  O OP1   . DC  I 5 62  ? 89.308  85.373  110.549 1.00 100.48 ?  -12 DC  I OP1   1 
ATOM 6884  O OP2   . DC  I 5 62  ? 87.867  84.478  112.455 1.00 100.48 -1 -12 DC  I OP2   1 
ATOM 6885  O "O5'" . DC  I 5 62  ? 89.876  85.879  112.924 1.00 100.48 ?  -12 DC  I "O5'" 1 
ATOM 6886  C "C5'" . DC  I 5 62  ? 89.659  86.847  113.954 1.00 100.48 ?  -12 DC  I "C5'" 1 
ATOM 6887  C "C4'" . DC  I 5 62  ? 90.455  86.495  115.191 1.00 100.48 ?  -12 DC  I "C4'" 1 
ATOM 6888  O "O4'" . DC  I 5 62  ? 89.640  86.715  116.375 1.00 100.48 ?  -12 DC  I "O4'" 1 
ATOM 6889  C "C3'" . DC  I 5 62  ? 90.860  85.041  115.269 1.00 100.48 ?  -12 DC  I "C3'" 1 
ATOM 6890  O "O3'" . DC  I 5 62  ? 91.979  84.914  116.111 1.00 100.48 ?  -12 DC  I "O3'" 1 
ATOM 6891  C "C2'" . DC  I 5 62  ? 89.620  84.422  115.894 1.00 100.48 ?  -12 DC  I "C2'" 1 
ATOM 6892  C "C1'" . DC  I 5 62  ? 89.289  85.466  116.951 1.00 100.48 ?  -12 DC  I "C1'" 1 
ATOM 6893  N N1    . DC  I 5 62  ? 87.847  85.524  117.328 1.00 100.48 ?  -12 DC  I N1    1 
ATOM 6894  C C2    . DC  I 5 62  ? 87.483  85.820  118.645 1.00 100.48 ?  -12 DC  I C2    1 
ATOM 6895  O O2    . DC  I 5 62  ? 88.366  86.003  119.487 1.00 100.48 ?  -12 DC  I O2    1 
ATOM 6896  N N3    . DC  I 5 62  ? 86.166  85.890  118.963 1.00 100.48 ?  -12 DC  I N3    1 
ATOM 6897  C C4    . DC  I 5 62  ? 85.246  85.686  118.026 1.00 100.48 ?  -12 DC  I C4    1 
ATOM 6898  N N4    . DC  I 5 62  ? 83.960  85.765  118.381 1.00 100.48 ?  -12 DC  I N4    1 
ATOM 6899  C C5    . DC  I 5 62  ? 85.600  85.380  116.683 1.00 100.48 ?  -12 DC  I C5    1 
ATOM 6900  C C6    . DC  I 5 62  ? 86.899  85.319  116.383 1.00 100.48 ?  -12 DC  I C6    1 
ATOM 6901  P P     . DG  I 5 63  ? 92.998  83.690  115.921 1.00 110.15 ?  -11 DG  I P     1 
ATOM 6902  O OP1   . DG  I 5 63  ? 94.300  84.255  115.506 1.00 110.15 ?  -11 DG  I OP1   1 
ATOM 6903  O OP2   . DG  I 5 63  ? 92.331  82.675  115.078 1.00 110.15 -1 -11 DG  I OP2   1 
ATOM 6904  O "O5'" . DG  I 5 63  ? 93.136  83.098  117.396 1.00 110.15 ?  -11 DG  I "O5'" 1 
ATOM 6905  C "C5'" . DG  I 5 63  ? 93.172  83.981  118.505 1.00 110.15 ?  -11 DG  I "C5'" 1 
ATOM 6906  C "C4'" . DG  I 5 63  ? 92.686  83.283  119.758 1.00 110.15 ?  -11 DG  I "C4'" 1 
ATOM 6907  O "O4'" . DG  I 5 63  ? 91.273  83.527  119.937 1.00 110.15 ?  -11 DG  I "O4'" 1 
ATOM 6908  C "C3'" . DG  I 5 63  ? 92.877  81.771  119.755 1.00 110.15 ?  -11 DG  I "C3'" 1 
ATOM 6909  O "O3'" . DG  I 5 63  ? 93.634  81.388  120.888 1.00 110.15 ?  -11 DG  I "O3'" 1 
ATOM 6910  C "C2'" . DG  I 5 63  ? 91.453  81.199  119.786 1.00 110.15 ?  -11 DG  I "C2'" 1 
ATOM 6911  C "C1'" . DG  I 5 63  ? 90.626  82.347  120.343 1.00 110.15 ?  -11 DG  I "C1'" 1 
ATOM 6912  N N9    . DG  I 5 63  ? 89.274  82.394  119.805 1.00 110.15 ?  -11 DG  I N9    1 
ATOM 6913  C C8    . DG  I 5 63  ? 88.920  82.305  118.491 1.00 110.15 ?  -11 DG  I C8    1 
ATOM 6914  N N7    . DG  I 5 63  ? 87.642  82.408  118.283 1.00 110.15 ?  -11 DG  I N7    1 
ATOM 6915  C C5    . DG  I 5 63  ? 87.109  82.568  119.547 1.00 110.15 ?  -11 DG  I C5    1 
ATOM 6916  C C6    . DG  I 5 63  ? 85.766  82.714  119.950 1.00 110.15 ?  -11 DG  I C6    1 
ATOM 6917  O O6    . DG  I 5 63  ? 84.751  82.737  119.242 1.00 110.15 ?  -11 DG  I O6    1 
ATOM 6918  N N1    . DG  I 5 63  ? 85.655  82.840  121.329 1.00 110.15 ?  -11 DG  I N1    1 
ATOM 6919  C C2    . DG  I 5 63  ? 86.711  82.824  122.206 1.00 110.15 ?  -11 DG  I C2    1 
ATOM 6920  N N2    . DG  I 5 63  ? 86.414  82.969  123.503 1.00 110.15 ?  -11 DG  I N2    1 
ATOM 6921  N N3    . DG  I 5 63  ? 87.978  82.689  121.838 1.00 110.15 ?  -11 DG  I N3    1 
ATOM 6922  C C4    . DG  I 5 63  ? 88.101  82.568  120.499 1.00 110.15 ?  -11 DG  I C4    1 
ATOM 6923  P P     . DC  I 5 64  ? 93.976  79.844  121.156 1.00 114.70 ?  -10 DC  I P     1 
ATOM 6924  O OP1   . DC  I 5 64  ? 95.329  79.785  121.750 1.00 114.70 ?  -10 DC  I OP1   1 
ATOM 6925  O OP2   . DC  I 5 64  ? 93.677  79.073  119.931 1.00 114.70 -1 -10 DC  I OP2   1 
ATOM 6926  O "O5'" . DC  I 5 64  ? 92.916  79.427  122.267 1.00 114.70 ?  -10 DC  I "O5'" 1 
ATOM 6927  C "C5'" . DC  I 5 64  ? 92.555  80.360  123.269 1.00 114.70 ?  -10 DC  I "C5'" 1 
ATOM 6928  C "C4'" . DC  I 5 64  ? 91.388  79.846  124.080 1.00 114.70 ?  -10 DC  I "C4'" 1 
ATOM 6929  O "O4'" . DC  I 5 64  ? 90.141  80.193  123.426 1.00 114.70 ?  -10 DC  I "O4'" 1 
ATOM 6930  C "C3'" . DC  I 5 64  ? 91.361  78.328  124.268 1.00 114.70 ?  -10 DC  I "C3'" 1 
ATOM 6931  O "O3'" . DC  I 5 64  ? 91.084  78.031  125.617 1.00 114.70 ?  -10 DC  I "O3'" 1 
ATOM 6932  C "C2'" . DC  I 5 64  ? 90.222  77.883  123.351 1.00 114.70 ?  -10 DC  I "C2'" 1 
ATOM 6933  C "C1'" . DC  I 5 64  ? 89.294  79.073  123.454 1.00 114.70 ?  -10 DC  I "C1'" 1 
ATOM 6934  N N1    . DC  I 5 64  ? 88.326  79.182  122.340 1.00 114.70 ?  -10 DC  I N1    1 
ATOM 6935  C C2    . DC  I 5 64  ? 86.975  79.325  122.630 1.00 114.70 ?  -10 DC  I C2    1 
ATOM 6936  O O2    . DC  I 5 64  ? 86.621  79.348  123.810 1.00 114.70 ?  -10 DC  I O2    1 
ATOM 6937  N N3    . DC  I 5 64  ? 86.094  79.430  121.614 1.00 114.70 ?  -10 DC  I N3    1 
ATOM 6938  C C4    . DC  I 5 64  ? 86.525  79.404  120.354 1.00 114.70 ?  -10 DC  I C4    1 
ATOM 6939  N N4    . DC  I 5 64  ? 85.613  79.506  119.385 1.00 114.70 ?  -10 DC  I N4    1 
ATOM 6940  C C5    . DC  I 5 64  ? 87.902  79.247  120.035 1.00 114.70 ?  -10 DC  I C5    1 
ATOM 6941  C C6    . DC  I 5 64  ? 88.762  79.150  121.052 1.00 114.70 ?  -10 DC  I C6    1 
ATOM 6942  P P     . DA  I 5 65  ? 91.387  76.574  126.214 1.00 116.94 ?  -9  DA  I P     1 
ATOM 6943  O OP1   . DA  I 5 65  ? 92.779  76.573  126.711 1.00 116.94 ?  -9  DA  I OP1   1 
ATOM 6944  O OP2   . DA  I 5 65  ? 90.963  75.562  125.225 1.00 116.94 -1 -9  DA  I OP2   1 
ATOM 6945  O "O5'" . DA  I 5 65  ? 90.387  76.484  127.450 1.00 116.94 ?  -9  DA  I "O5'" 1 
ATOM 6946  C "C5'" . DA  I 5 65  ? 89.208  77.274  127.444 1.00 116.94 ?  -9  DA  I "C5'" 1 
ATOM 6947  C "C4'" . DA  I 5 65  ? 88.054  76.521  128.069 1.00 116.94 ?  -9  DA  I "C4'" 1 
ATOM 6948  O "O4'" . DA  I 5 65  ? 86.888  76.639  127.219 1.00 116.94 ?  -9  DA  I "O4'" 1 
ATOM 6949  C "C3'" . DA  I 5 65  ? 88.285  75.030  128.243 1.00 116.94 ?  -9  DA  I "C3'" 1 
ATOM 6950  O "O3'" . DA  I 5 65  ? 87.566  74.555  129.372 1.00 116.94 ?  -9  DA  I "O3'" 1 
ATOM 6951  C "C2'" . DA  I 5 65  ? 87.751  74.447  126.937 1.00 116.94 ?  -9  DA  I "C2'" 1 
ATOM 6952  C "C1'" . DA  I 5 65  ? 86.634  75.416  126.556 1.00 116.94 ?  -9  DA  I "C1'" 1 
ATOM 6953  N N9    . DA  I 5 65  ? 86.584  75.675  125.125 1.00 116.94 ?  -9  DA  I N9    1 
ATOM 6954  C C8    . DA  I 5 65  ? 87.641  75.701  124.265 1.00 116.94 ?  -9  DA  I C8    1 
ATOM 6955  N N7    . DA  I 5 65  ? 87.311  75.963  123.026 1.00 116.94 ?  -9  DA  I N7    1 
ATOM 6956  C C5    . DA  I 5 65  ? 85.941  76.112  123.076 1.00 116.94 ?  -9  DA  I C5    1 
ATOM 6957  C C6    . DA  I 5 65  ? 84.990  76.395  122.088 1.00 116.94 ?  -9  DA  I C6    1 
ATOM 6958  N N6    . DA  I 5 65  ? 85.307  76.580  120.811 1.00 116.94 ?  -9  DA  I N6    1 
ATOM 6959  N N1    . DA  I 5 65  ? 83.696  76.476  122.461 1.00 116.94 ?  -9  DA  I N1    1 
ATOM 6960  C C2    . DA  I 5 65  ? 83.386  76.283  123.750 1.00 116.94 ?  -9  DA  I C2    1 
ATOM 6961  N N3    . DA  I 5 65  ? 84.197  76.008  124.772 1.00 116.94 ?  -9  DA  I N3    1 
ATOM 6962  C C4    . DA  I 5 65  ? 85.472  75.934  124.361 1.00 116.94 ?  -9  DA  I C4    1 
ATOM 6963  P P     . DC  I 5 66  ? 87.489  72.982  129.690 1.00 115.05 ?  -8  DC  I P     1 
ATOM 6964  O OP1   . DC  I 5 66  ? 87.443  72.832  131.160 1.00 115.05 ?  -8  DC  I OP1   1 
ATOM 6965  O OP2   . DC  I 5 66  ? 88.547  72.284  128.926 1.00 115.05 -1 -8  DC  I OP2   1 
ATOM 6966  O "O5'" . DC  I 5 66  ? 86.073  72.557  129.090 1.00 115.05 ?  -8  DC  I "O5'" 1 
ATOM 6967  C "C5'" . DC  I 5 66  ? 84.957  73.412  129.271 1.00 115.05 ?  -8  DC  I "C5'" 1 
ATOM 6968  C "C4'" . DC  I 5 66  ? 83.775  72.947  128.446 1.00 115.05 ?  -8  DC  I "C4'" 1 
ATOM 6969  O "O4'" . DC  I 5 66  ? 83.929  73.376  127.068 1.00 115.05 ?  -8  DC  I "O4'" 1 
ATOM 6970  C "C3'" . DC  I 5 66  ? 83.573  71.432  128.397 1.00 115.05 ?  -8  DC  I "C3'" 1 
ATOM 6971  O "O3'" . DC  I 5 66  ? 82.204  71.141  128.579 1.00 115.05 ?  -8  DC  I "O3'" 1 
ATOM 6972  C "C2'" . DC  I 5 66  ? 84.028  71.073  126.984 1.00 115.05 ?  -8  DC  I "C2'" 1 
ATOM 6973  C "C1'" . DC  I 5 66  ? 83.577  72.306  126.229 1.00 115.05 ?  -8  DC  I "C1'" 1 
ATOM 6974  N N1    . DC  I 5 66  ? 84.241  72.490  124.914 1.00 115.05 ?  -8  DC  I N1    1 
ATOM 6975  C C2    . DC  I 5 66  ? 83.467  72.767  123.785 1.00 115.05 ?  -8  DC  I C2    1 
ATOM 6976  O O2    . DC  I 5 66  ? 82.241  72.849  123.900 1.00 115.05 ?  -8  DC  I O2    1 
ATOM 6977  N N3    . DC  I 5 66  ? 84.085  72.937  122.594 1.00 115.05 ?  -8  DC  I N3    1 
ATOM 6978  C C4    . DC  I 5 66  ? 85.410  72.838  122.512 1.00 115.05 ?  -8  DC  I C4    1 
ATOM 6979  N N4    . DC  I 5 66  ? 85.978  73.015  121.318 1.00 115.05 ?  -8  DC  I N4    1 
ATOM 6980  C C5    . DC  I 5 66  ? 86.215  72.558  123.652 1.00 115.05 ?  -8  DC  I C5    1 
ATOM 6981  C C6    . DC  I 5 66  ? 85.594  72.391  124.821 1.00 115.05 ?  -8  DC  I C6    1 
ATOM 6982  P P     . DG  I 5 67  ? 81.745  69.891  129.473 1.00 114.21 ?  -7  DG  I P     1 
ATOM 6983  O OP1   . DG  I 5 67  ? 81.385  70.407  130.811 1.00 114.21 ?  -7  DG  I OP1   1 
ATOM 6984  O OP2   . DG  I 5 67  ? 82.768  68.832  129.335 1.00 114.21 -1 -7  DG  I OP2   1 
ATOM 6985  O "O5'" . DG  I 5 67  ? 80.412  69.391  128.752 1.00 114.21 ?  -7  DG  I "O5'" 1 
ATOM 6986  C "C5'" . DG  I 5 67  ? 79.400  70.330  128.416 1.00 114.21 ?  -7  DG  I "C5'" 1 
ATOM 6987  C "C4'" . DG  I 5 67  ? 78.649  69.913  127.160 1.00 114.21 ?  -7  DG  I "C4'" 1 
ATOM 6988  O "O4'" . DG  I 5 67  ? 79.470  70.146  125.986 1.00 114.21 ?  -7  DG  I "O4'" 1 
ATOM 6989  C "C3'" . DG  I 5 67  ? 78.224  68.452  127.106 1.00 114.21 ?  -7  DG  I "C3'" 1 
ATOM 6990  O "O3'" . DG  I 5 67  ? 76.908  68.372  126.594 1.00 114.21 ?  -7  DG  I "O3'" 1 
ATOM 6991  C "C2'" . DG  I 5 67  ? 79.243  67.823  126.154 1.00 114.21 ?  -7  DG  I "C2'" 1 
ATOM 6992  C "C1'" . DG  I 5 67  ? 79.551  68.973  125.208 1.00 114.21 ?  -7  DG  I "C1'" 1 
ATOM 6993  N N9    . DG  I 5 67  ? 80.894  68.922  124.631 1.00 114.21 ?  -7  DG  I N9    1 
ATOM 6994  C C8    . DG  I 5 67  ? 82.070  68.743  125.310 1.00 114.21 ?  -7  DG  I C8    1 
ATOM 6995  N N7    . DG  I 5 67  ? 83.124  68.767  124.544 1.00 114.21 ?  -7  DG  I N7    1 
ATOM 6996  C C5    . DG  I 5 67  ? 82.618  68.985  123.273 1.00 114.21 ?  -7  DG  I C5    1 
ATOM 6997  C C6    . DG  I 5 67  ? 83.290  69.103  122.037 1.00 114.21 ?  -7  DG  I C6    1 
ATOM 6998  O O6    . DG  I 5 67  ? 84.504  69.037  121.818 1.00 114.21 ?  -7  DG  I O6    1 
ATOM 6999  N N1    . DG  I 5 67  ? 82.408  69.318  120.988 1.00 114.21 ?  -7  DG  I N1    1 
ATOM 7000  C C2    . DG  I 5 67  ? 81.045  69.407  121.117 1.00 114.21 ?  -7  DG  I C2    1 
ATOM 7001  N N2    . DG  I 5 67  ? 80.353  69.620  119.993 1.00 114.21 ?  -7  DG  I N2    1 
ATOM 7002  N N3    . DG  I 5 67  ? 80.400  69.297  122.272 1.00 114.21 ?  -7  DG  I N3    1 
ATOM 7003  C C4    . DG  I 5 67  ? 81.247  69.087  123.305 1.00 114.21 ?  -7  DG  I C4    1 
ATOM 7004  P P     . DT  I 5 68  ? 76.088  66.992  126.635 1.00 112.52 ?  -6  DT  I P     1 
ATOM 7005  O OP1   . DT  I 5 68  ? 74.881  67.214  127.460 1.00 112.52 ?  -6  DT  I OP1   1 
ATOM 7006  O OP2   . DT  I 5 68  ? 77.021  65.898  126.986 1.00 112.52 -1 -6  DT  I OP2   1 
ATOM 7007  O "O5'" . DT  I 5 68  ? 75.638  66.796  125.116 1.00 112.52 ?  -6  DT  I "O5'" 1 
ATOM 7008  C "C5'" . DT  I 5 68  ? 75.992  67.779  124.146 1.00 112.52 ?  -6  DT  I "C5'" 1 
ATOM 7009  C "C4'" . DT  I 5 68  ? 76.140  67.162  122.770 1.00 112.52 ?  -6  DT  I "C4'" 1 
ATOM 7010  O "O4'" . DT  I 5 68  ? 77.526  67.249  122.335 1.00 112.52 ?  -6  DT  I "O4'" 1 
ATOM 7011  C "C3'" . DT  I 5 68  ? 75.772  65.682  122.680 1.00 112.52 ?  -6  DT  I "C3'" 1 
ATOM 7012  O "O3'" . DT  I 5 68  ? 75.229  65.418  121.406 1.00 112.52 ?  -6  DT  I "O3'" 1 
ATOM 7013  C "C2'" . DT  I 5 68  ? 77.137  65.019  122.818 1.00 112.52 ?  -6  DT  I "C2'" 1 
ATOM 7014  C "C1'" . DT  I 5 68  ? 77.964  65.963  121.965 1.00 112.52 ?  -6  DT  I "C1'" 1 
ATOM 7015  N N1    . DT  I 5 68  ? 79.431  65.871  122.189 1.00 112.52 ?  -6  DT  I N1    1 
ATOM 7016  C C2    . DT  I 5 68  ? 80.285  66.045  121.128 1.00 112.52 ?  -6  DT  I C2    1 
ATOM 7017  O O2    . DT  I 5 68  ? 79.903  66.266  119.996 1.00 112.52 ?  -6  DT  I O2    1 
ATOM 7018  N N3    . DT  I 5 68  ? 81.611  65.943  121.439 1.00 112.52 ?  -6  DT  I N3    1 
ATOM 7019  C C4    . DT  I 5 68  ? 82.157  65.692  122.680 1.00 112.52 ?  -6  DT  I C4    1 
ATOM 7020  O O4    . DT  I 5 68  ? 83.364  65.617  122.864 1.00 112.52 ?  -6  DT  I O4    1 
ATOM 7021  C C5    . DT  I 5 68  ? 81.209  65.521  123.747 1.00 112.52 ?  -6  DT  I C5    1 
ATOM 7022  C C7    . DT  I 5 68  ? 81.691  65.240  125.139 1.00 112.52 ?  -6  DT  I C7    1 
ATOM 7023  C C6    . DT  I 5 68  ? 79.906  65.615  123.453 1.00 112.52 ?  -6  DT  I C6    1 
ATOM 7024  P P     . DA  I 5 69  ? 73.647  65.442  121.131 1.00 106.05 ?  -5  DA  I P     1 
ATOM 7025  O OP1   . DA  I 5 69  ? 73.015  66.465  121.990 1.00 106.05 ?  -5  DA  I OP1   1 
ATOM 7026  O OP2   . DA  I 5 69  ? 73.168  64.046  121.181 1.00 106.05 -1 -5  DA  I OP2   1 
ATOM 7027  O "O5'" . DA  I 5 69  ? 73.562  65.914  119.607 1.00 106.05 ?  -5  DA  I "O5'" 1 
ATOM 7028  C "C5'" . DA  I 5 69  ? 74.664  66.620  119.037 1.00 106.05 ?  -5  DA  I "C5'" 1 
ATOM 7029  C "C4'" . DA  I 5 69  ? 74.719  66.461  117.525 1.00 106.05 ?  -5  DA  I "C4'" 1 
ATOM 7030  O "O4'" . DA  I 5 69  ? 76.007  65.942  117.126 1.00 106.05 ?  -5  DA  I "O4'" 1 
ATOM 7031  C "C3'" . DA  I 5 69  ? 73.721  65.501  116.921 1.00 106.05 ?  -5  DA  I "C3'" 1 
ATOM 7032  O "O3'" . DA  I 5 69  ? 73.428  65.937  115.570 1.00 106.05 ?  -5  DA  I "O3'" 1 
ATOM 7033  C "C2'" . DA  I 5 69  ? 74.454  64.150  117.000 1.00 106.05 ?  -5  DA  I "C2'" 1 
ATOM 7034  C "C1'" . DA  I 5 69  ? 75.939  64.534  116.988 1.00 106.05 ?  -5  DA  I "C1'" 1 
ATOM 7035  N N9    . DA  I 5 69  ? 76.695  63.961  118.091 1.00 106.05 ?  -5  DA  I N9    1 
ATOM 7036  C C8    . DA  I 5 69  ? 76.190  63.485  119.261 1.00 106.05 ?  -5  DA  I C8    1 
ATOM 7037  N N7    . DA  I 5 69  ? 77.100  63.069  120.100 1.00 106.05 ?  -5  DA  I N7    1 
ATOM 7038  C C5    . DA  I 5 69  ? 78.288  63.286  119.437 1.00 106.05 ?  -5  DA  I C5    1 
ATOM 7039  C C6    . DA  I 5 69  ? 79.624  63.046  119.793 1.00 106.05 ?  -5  DA  I C6    1 
ATOM 7040  N N6    . DA  I 5 69  ? 79.984  62.516  120.964 1.00 106.05 ?  -5  DA  I N6    1 
ATOM 7041  N N1    . DA  I 5 69  ? 80.581  63.375  118.902 1.00 106.05 ?  -5  DA  I N1    1 
ATOM 7042  C C2    . DA  I 5 69  ? 80.215  63.908  117.730 1.00 106.05 ?  -5  DA  I C2    1 
ATOM 7043  N N3    . DA  I 5 69  ? 78.987  64.180  117.284 1.00 106.05 ?  -5  DA  I N3    1 
ATOM 7044  C C4    . DA  I 5 69  ? 78.062  63.840  118.195 1.00 106.05 ?  -5  DA  I C4    1 
ATOM 7045  P P     . DC  I 5 70  ? 73.199  64.924  114.341 1.00 102.85 ?  -4  DC  I P     1 
ATOM 7046  O OP1   . DC  I 5 70  ? 72.538  65.728  113.294 1.00 102.85 ?  -4  DC  I OP1   1 
ATOM 7047  O OP2   . DC  I 5 70  ? 72.538  63.677  114.782 1.00 102.85 -1 -4  DC  I OP2   1 
ATOM 7048  O "O5'" . DC  I 5 70  ? 74.679  64.614  113.823 1.00 102.85 ?  -4  DC  I "O5'" 1 
ATOM 7049  C "C5'" . DC  I 5 70  ? 74.877  63.873  112.641 1.00 102.85 ?  -4  DC  I "C5'" 1 
ATOM 7050  C "C4'" . DC  I 5 70  ? 76.328  63.940  112.214 1.00 102.85 ?  -4  DC  I "C4'" 1 
ATOM 7051  O "O4'" . DC  I 5 70  ? 77.179  63.696  113.360 1.00 102.85 ?  -4  DC  I "O4'" 1 
ATOM 7052  C "C3'" . DC  I 5 70  ? 76.744  62.883  111.220 1.00 102.85 ?  -4  DC  I "C3'" 1 
ATOM 7053  O "O3'" . DC  I 5 70  ? 77.952  63.278  110.621 1.00 102.85 ?  -4  DC  I "O3'" 1 
ATOM 7054  C "C2'" . DC  I 5 70  ? 76.958  61.694  112.144 1.00 102.85 ?  -4  DC  I "C2'" 1 
ATOM 7055  C "C1'" . DC  I 5 70  ? 77.684  62.371  113.300 1.00 102.85 ?  -4  DC  I "C1'" 1 
ATOM 7056  N N1    . DC  I 5 70  ? 77.456  61.741  114.619 1.00 102.85 ?  -4  DC  I N1    1 
ATOM 7057  C C2    . DC  I 5 70  ? 78.546  61.411  115.418 1.00 102.85 ?  -4  DC  I C2    1 
ATOM 7058  O O2    . DC  I 5 70  ? 79.684  61.601  114.996 1.00 102.85 ?  -4  DC  I O2    1 
ATOM 7059  N N3    . DC  I 5 70  ? 78.329  60.852  116.627 1.00 102.85 ?  -4  DC  I N3    1 
ATOM 7060  C C4    . DC  I 5 70  ? 77.087  60.644  117.049 1.00 102.85 ?  -4  DC  I C4    1 
ATOM 7061  N N4    . DC  I 5 70  ? 76.923  60.094  118.254 1.00 102.85 ?  -4  DC  I N4    1 
ATOM 7062  C C5    . DC  I 5 70  ? 75.958  60.982  116.253 1.00 102.85 ?  -4  DC  I C5    1 
ATOM 7063  C C6    . DC  I 5 70  ? 76.187  61.527  115.056 1.00 102.85 ?  -4  DC  I C6    1 
ATOM 7064  P P     . DG  I 5 71  ? 78.402  62.661  109.213 1.00 104.60 ?  -3  DG  I P     1 
ATOM 7065  O OP1   . DG  I 5 71  ? 77.951  63.601  108.167 1.00 104.60 ?  -3  DG  I OP1   1 
ATOM 7066  O OP2   . DG  I 5 71  ? 77.987  61.244  109.166 1.00 104.60 -1 -3  DG  I OP2   1 
ATOM 7067  O "O5'" . DG  I 5 71  ? 79.992  62.695  109.292 1.00 104.60 ?  -3  DG  I "O5'" 1 
ATOM 7068  C "C5'" . DG  I 5 71  ? 80.641  62.297  110.483 1.00 104.60 ?  -3  DG  I "C5'" 1 
ATOM 7069  C "C4'" . DG  I 5 71  ? 81.971  61.659  110.168 1.00 104.60 ?  -3  DG  I "C4'" 1 
ATOM 7070  O "O4'" . DG  I 5 71  ? 82.276  60.673  111.173 1.00 104.60 ?  -3  DG  I "O4'" 1 
ATOM 7071  C "C3'" . DG  I 5 71  ? 81.991  60.875  108.885 1.00 104.60 ?  -3  DG  I "C3'" 1 
ATOM 7072  O "O3'" . DG  I 5 71  ? 83.333  60.648  108.507 1.00 104.60 ?  -3  DG  I "O3'" 1 
ATOM 7073  C "C2'" . DG  I 5 71  ? 81.295  59.586  109.313 1.00 104.60 ?  -3  DG  I "C2'" 1 
ATOM 7074  C "C1'" . DG  I 5 71  ? 81.822  59.403  110.738 1.00 104.60 ?  -3  DG  I "C1'" 1 
ATOM 7075  N N9    . DG  I 5 71  ? 80.824  58.942  111.699 1.00 104.60 ?  -3  DG  I N9    1 
ATOM 7076  C C8    . DG  I 5 71  ? 79.475  59.188  111.685 1.00 104.60 ?  -3  DG  I C8    1 
ATOM 7077  N N7    . DG  I 5 71  ? 78.843  58.670  112.700 1.00 104.60 ?  -3  DG  I N7    1 
ATOM 7078  C C5    . DG  I 5 71  ? 79.839  58.057  113.438 1.00 104.60 ?  -3  DG  I C5    1 
ATOM 7079  C C6    . DG  I 5 71  ? 79.759  57.329  114.641 1.00 104.60 ?  -3  DG  I C6    1 
ATOM 7080  O O6    . DG  I 5 71  ? 78.759  57.079  115.319 1.00 104.60 ?  -3  DG  I O6    1 
ATOM 7081  N N1    . DG  I 5 71  ? 81.003  56.869  115.047 1.00 104.60 ?  -3  DG  I N1    1 
ATOM 7082  C C2    . DG  I 5 71  ? 82.176  57.081  114.368 1.00 104.60 ?  -3  DG  I C2    1 
ATOM 7083  N N2    . DG  I 5 71  ? 83.283  56.571  114.913 1.00 104.60 ?  -3  DG  I N2    1 
ATOM 7084  N N3    . DG  I 5 71  ? 82.263  57.767  113.243 1.00 104.60 ?  -3  DG  I N3    1 
ATOM 7085  C C4    . DG  I 5 71  ? 81.060  58.217  112.836 1.00 104.60 ?  -3  DG  I C4    1 
ATOM 7086  P P     . DC  I 5 72  ? 83.679  59.809  107.186 1.00 110.02 ?  -2  DC  I P     1 
ATOM 7087  O OP1   . DC  I 5 72  ? 84.857  60.436  106.549 1.00 110.02 ?  -2  DC  I OP1   1 
ATOM 7088  O OP2   . DC  I 5 72  ? 82.428  59.618  106.423 1.00 110.02 -1 -2  DC  I OP2   1 
ATOM 7089  O "O5'" . DC  I 5 72  ? 84.111  58.389  107.758 1.00 110.02 ?  -2  DC  I "O5'" 1 
ATOM 7090  C "C5'" . DC  I 5 72  ? 84.915  58.320  108.919 1.00 110.02 ?  -2  DC  I "C5'" 1 
ATOM 7091  C "C4'" . DC  I 5 72  ? 84.937  56.910  109.474 1.00 110.02 ?  -2  DC  I "C4'" 1 
ATOM 7092  O "O4'" . DC  I 5 72  ? 83.823  56.711  110.386 1.00 110.02 ?  -2  DC  I "O4'" 1 
ATOM 7093  C "C3'" . DC  I 5 72  ? 84.824  55.801  108.427 1.00 110.02 ?  -2  DC  I "C3'" 1 
ATOM 7094  O "O3'" . DC  I 5 72  ? 85.759  54.795  108.719 1.00 110.02 ?  -2  DC  I "O3'" 1 
ATOM 7095  C "C2'" . DC  I 5 72  ? 83.395  55.295  108.619 1.00 110.02 ?  -2  DC  I "C2'" 1 
ATOM 7096  C "C1'" . DC  I 5 72  ? 83.254  55.455  110.117 1.00 110.02 ?  -2  DC  I "C1'" 1 
ATOM 7097  N N1    . DC  I 5 72  ? 81.856  55.444  110.605 1.00 110.02 ?  -2  DC  I N1    1 
ATOM 7098  C C2    . DC  I 5 72  ? 81.561  54.818  111.814 1.00 110.02 ?  -2  DC  I C2    1 
ATOM 7099  O O2    . DC  I 5 72  ? 82.477  54.287  112.448 1.00 110.02 ?  -2  DC  I O2    1 
ATOM 7100  N N3    . DC  I 5 72  ? 80.283  54.812  112.255 1.00 110.02 ?  -2  DC  I N3    1 
ATOM 7101  C C4    . DC  I 5 72  ? 79.330  55.396  111.532 1.00 110.02 ?  -2  DC  I C4    1 
ATOM 7102  N N4    . DC  I 5 72  ? 78.081  55.370  112.002 1.00 110.02 ?  -2  DC  I N4    1 
ATOM 7103  C C5    . DC  I 5 72  ? 79.615  56.040  110.297 1.00 110.02 ?  -2  DC  I C5    1 
ATOM 7104  C C6    . DC  I 5 72  ? 80.878  56.034  109.874 1.00 110.02 ?  -2  DC  I C6    1 
ATOM 7105  P P     . DG  I 5 73  ? 86.517  54.023  107.537 1.00 122.25 ?  -1  DG  I P     1 
ATOM 7106  O OP1   . DG  I 5 73  ? 87.743  54.788  107.225 1.00 122.25 ?  -1  DG  I OP1   1 
ATOM 7107  O OP2   . DG  I 5 73  ? 85.526  53.734  106.478 1.00 122.25 -1 -1  DG  I OP2   1 
ATOM 7108  O "O5'" . DG  I 5 73  ? 86.932  52.642  108.216 1.00 122.25 ?  -1  DG  I "O5'" 1 
ATOM 7109  C "C5'" . DG  I 5 73  ? 87.370  52.633  109.565 1.00 122.25 ?  -1  DG  I "C5'" 1 
ATOM 7110  C "C4'" . DG  I 5 73  ? 86.750  51.475  110.319 1.00 122.25 ?  -1  DG  I "C4'" 1 
ATOM 7111  O "O4'" . DG  I 5 73  ? 85.380  51.792  110.661 1.00 122.25 ?  -1  DG  I "O4'" 1 
ATOM 7112  C "C3'" . DG  I 5 73  ? 86.713  50.161  109.545 1.00 122.25 ?  -1  DG  I "C3'" 1 
ATOM 7113  O "O3'" . DG  I 5 73  ? 87.314  49.138  110.312 1.00 122.25 ?  -1  DG  I "O3'" 1 
ATOM 7114  C "C2'" . DG  I 5 73  ? 85.221  49.901  109.310 1.00 122.25 ?  -1  DG  I "C2'" 1 
ATOM 7115  C "C1'" . DG  I 5 73  ? 84.568  50.668  110.445 1.00 122.25 ?  -1  DG  I "C1'" 1 
ATOM 7116  N N9    . DG  I 5 73  ? 83.230  51.140  110.117 1.00 122.25 ?  -1  DG  I N9    1 
ATOM 7117  C C8    . DG  I 5 73  ? 82.873  51.892  109.033 1.00 122.25 ?  -1  DG  I C8    1 
ATOM 7118  N N7    . DG  I 5 73  ? 81.606  52.180  108.993 1.00 122.25 ?  -1  DG  I N7    1 
ATOM 7119  C C5    . DG  I 5 73  ? 81.086  51.576  110.122 1.00 122.25 ?  -1  DG  I C5    1 
ATOM 7120  C C6    . DG  I 5 73  ? 79.761  51.540  110.601 1.00 122.25 ?  -1  DG  I C6    1 
ATOM 7121  O O6    . DG  I 5 73  ? 78.753  52.056  110.107 1.00 122.25 ?  -1  DG  I O6    1 
ATOM 7122  N N1    . DG  I 5 73  ? 79.661  50.817  111.780 1.00 122.25 ?  -1  DG  I N1    1 
ATOM 7123  C C2    . DG  I 5 73  ? 80.712  50.203  112.415 1.00 122.25 ?  -1  DG  I C2    1 
ATOM 7124  N N2    . DG  I 5 73  ? 80.419  49.552  113.546 1.00 122.25 ?  -1  DG  I N2    1 
ATOM 7125  N N3    . DG  I 5 73  ? 81.962  50.227  111.975 1.00 122.25 ?  -1  DG  I N3    1 
ATOM 7126  C C4    . DG  I 5 73  ? 82.075  50.935  110.831 1.00 122.25 ?  -1  DG  I C4    1 
ATOM 7127  P P     . DC  I 5 74  ? 87.418  47.647  109.730 1.00 126.79 ?  0   DC  I P     1 
ATOM 7128  O OP1   . DC  I 5 74  ? 88.673  47.054  110.239 1.00 126.79 ?  0   DC  I OP1   1 
ATOM 7129  O OP2   . DC  I 5 74  ? 87.168  47.705  108.275 1.00 126.79 -1 0   DC  I OP2   1 
ATOM 7130  O "O5'" . DC  I 5 74  ? 86.187  46.903  110.413 1.00 126.79 ?  0   DC  I "O5'" 1 
ATOM 7131  C "C5'" . DC  I 5 74  ? 85.872  47.180  111.764 1.00 126.79 ?  0   DC  I "C5'" 1 
ATOM 7132  C "C4'" . DC  I 5 74  ? 84.648  46.407  112.189 1.00 126.79 ?  0   DC  I "C4'" 1 
ATOM 7133  O "O4'" . DC  I 5 74  ? 83.458  47.167  111.880 1.00 126.79 ?  0   DC  I "O4'" 1 
ATOM 7134  C "C3'" . DC  I 5 74  ? 84.489  45.053  111.504 1.00 126.79 ?  0   DC  I "C3'" 1 
ATOM 7135  O "O3'" . DC  I 5 74  ? 84.376  44.045  112.484 1.00 126.79 ?  0   DC  I "O3'" 1 
ATOM 7136  C "C2'" . DC  I 5 74  ? 83.210  45.197  110.667 1.00 126.79 ?  0   DC  I "C2'" 1 
ATOM 7137  C "C1'" . DC  I 5 74  ? 82.466  46.301  111.398 1.00 126.79 ?  0   DC  I "C1'" 1 
ATOM 7138  N N1    . DC  I 5 74  ? 81.559  47.093  110.528 1.00 126.79 ?  0   DC  I N1    1 
ATOM 7139  C C2    . DC  I 5 74  ? 80.194  47.151  110.817 1.00 126.79 ?  0   DC  I C2    1 
ATOM 7140  O O2    . DC  I 5 74  ? 79.755  46.537  111.790 1.00 126.79 ?  0   DC  I O2    1 
ATOM 7141  N N3    . DC  I 5 74  ? 79.387  47.892  110.024 1.00 126.79 ?  0   DC  I N3    1 
ATOM 7142  C C4    . DC  I 5 74  ? 79.896  48.549  108.985 1.00 126.79 ?  0   DC  I C4    1 
ATOM 7143  N N4    . DC  I 5 74  ? 79.059  49.263  108.228 1.00 126.79 ?  0   DC  I N4    1 
ATOM 7144  C C5    . DC  I 5 74  ? 81.284  48.499  108.670 1.00 126.79 ?  0   DC  I C5    1 
ATOM 7145  C C6    . DC  I 5 74  ? 82.073  47.779  109.471 1.00 126.79 ?  0   DC  I C6    1 
ATOM 7146  P P     . DT  I 5 75  ? 84.538  42.501  112.082 1.00 128.38 ?  1   DT  I P     1 
ATOM 7147  O OP1   . DT  I 5 75  ? 85.268  41.826  113.177 1.00 128.38 ?  1   DT  I OP1   1 
ATOM 7148  O OP2   . DT  I 5 75  ? 85.056  42.433  110.699 1.00 128.38 -1 1   DT  I OP2   1 
ATOM 7149  O "O5'" . DT  I 5 75  ? 83.035  41.980  112.072 1.00 128.38 ?  1   DT  I "O5'" 1 
ATOM 7150  C "C5'" . DT  I 5 75  ? 82.120  42.497  113.018 1.00 128.38 ?  1   DT  I "C5'" 1 
ATOM 7151  C "C4'" . DT  I 5 75  ? 80.704  42.143  112.637 1.00 128.38 ?  1   DT  I "C4'" 1 
ATOM 7152  O "O4'" . DT  I 5 75  ? 80.122  43.213  111.847 1.00 128.38 ?  1   DT  I "O4'" 1 
ATOM 7153  C "C3'" . DT  I 5 75  ? 80.567  40.873  111.790 1.00 128.38 ?  1   DT  I "C3'" 1 
ATOM 7154  O "O3'" . DT  I 5 75  ? 79.501  40.089  112.287 1.00 128.38 ?  1   DT  I "O3'" 1 
ATOM 7155  C "C2'" . DT  I 5 75  ? 80.244  41.425  110.407 1.00 128.38 ?  1   DT  I "C2'" 1 
ATOM 7156  C "C1'" . DT  I 5 75  ? 79.410  42.626  110.795 1.00 128.38 ?  1   DT  I "C1'" 1 
ATOM 7157  N N1    . DT  I 5 75  ? 79.223  43.615  109.706 1.00 128.38 ?  1   DT  I N1    1 
ATOM 7158  C C2    . DT  I 5 75  ? 77.973  44.132  109.489 1.00 128.38 ?  1   DT  I C2    1 
ATOM 7159  O O2    . DT  I 5 75  ? 77.001  43.823  110.152 1.00 128.38 ?  1   DT  I O2    1 
ATOM 7160  N N3    . DT  I 5 75  ? 77.892  45.027  108.464 1.00 128.38 ?  1   DT  I N3    1 
ATOM 7161  C C4    . DT  I 5 75  ? 78.920  45.445  107.644 1.00 128.38 ?  1   DT  I C4    1 
ATOM 7162  O O4    . DT  I 5 75  ? 78.750  46.256  106.746 1.00 128.38 ?  1   DT  I O4    1 
ATOM 7163  C C5    . DT  I 5 75  ? 80.208  44.863  107.922 1.00 128.38 ?  1   DT  I C5    1 
ATOM 7164  C C7    . DT  I 5 75  ? 81.397  45.236  107.093 1.00 128.38 ?  1   DT  I C7    1 
ATOM 7165  C C6    . DT  I 5 75  ? 80.296  43.982  108.927 1.00 128.38 ?  1   DT  I C6    1 
ATOM 7166  P P     . DG  I 5 76  ? 79.454  38.508  112.015 1.00 123.27 ?  2   DG  I P     1 
ATOM 7167  O OP1   . DG  I 5 76  ? 80.002  37.825  113.207 1.00 123.27 ?  2   DG  I OP1   1 
ATOM 7168  O OP2   . DG  I 5 76  ? 80.046  38.258  110.684 1.00 123.27 -1 2   DG  I OP2   1 
ATOM 7169  O "O5'" . DG  I 5 76  ? 77.893  38.194  111.924 1.00 123.27 ?  2   DG  I "O5'" 1 
ATOM 7170  C "C5'" . DG  I 5 76  ? 76.986  38.889  112.766 1.00 123.27 ?  2   DG  I "C5'" 1 
ATOM 7171  C "C4'" . DG  I 5 76  ? 75.653  39.092  112.069 1.00 123.27 ?  2   DG  I "C4'" 1 
ATOM 7172  O "O4'" . DG  I 5 76  ? 75.731  40.237  111.182 1.00 123.27 ?  2   DG  I "O4'" 1 
ATOM 7173  C "C3'" . DG  I 5 76  ? 75.191  37.914  111.219 1.00 123.27 ?  2   DG  I "C3'" 1 
ATOM 7174  O "O3'" . DG  I 5 76  ? 73.838  37.626  111.494 1.00 123.27 ?  2   DG  I "O3'" 1 
ATOM 7175  C "C2'" . DG  I 5 76  ? 75.388  38.393  109.780 1.00 123.27 ?  2   DG  I "C2'" 1 
ATOM 7176  C "C1'" . DG  I 5 76  ? 75.234  39.900  109.907 1.00 123.27 ?  2   DG  I "C1'" 1 
ATOM 7177  N N9    . DG  I 5 76  ? 76.004  40.654  108.920 1.00 123.27 ?  2   DG  I N9    1 
ATOM 7178  C C8    . DG  I 5 76  ? 77.353  40.581  108.700 1.00 123.27 ?  2   DG  I C8    1 
ATOM 7179  N N7    . DG  I 5 76  ? 77.775  41.387  107.768 1.00 123.27 ?  2   DG  I N7    1 
ATOM 7180  C C5    . DG  I 5 76  ? 76.631  42.039  107.343 1.00 123.27 ?  2   DG  I C5    1 
ATOM 7181  C C6    . DG  I 5 76  ? 76.467  43.029  106.355 1.00 123.27 ?  2   DG  I C6    1 
ATOM 7182  O O6    . DG  I 5 76  ? 77.328  43.541  105.634 1.00 123.27 ?  2   DG  I O6    1 
ATOM 7183  N N1    . DG  I 5 76  ? 75.144  43.428  106.241 1.00 123.27 ?  2   DG  I N1    1 
ATOM 7184  C C2    . DG  I 5 76  ? 74.111  42.935  106.993 1.00 123.27 ?  2   DG  I C2    1 
ATOM 7185  N N2    . DG  I 5 76  ? 72.898  43.437  106.739 1.00 123.27 ?  2   DG  I N2    1 
ATOM 7186  N N3    . DG  I 5 76  ? 74.250  42.003  107.923 1.00 123.27 ?  2   DG  I N3    1 
ATOM 7187  C C4    . DG  I 5 76  ? 75.533  41.606  108.046 1.00 123.27 ?  2   DG  I C4    1 
ATOM 7188  P P     . DT  I 5 77  ? 73.160  36.304  110.890 1.00 122.60 ?  3   DT  I P     1 
ATOM 7189  O OP1   . DT  I 5 77  ? 72.317  35.713  111.951 1.00 122.60 ?  3   DT  I OP1   1 
ATOM 7190  O OP2   . DT  I 5 77  ? 74.223  35.499  110.248 1.00 122.60 -1 3   DT  I OP2   1 
ATOM 7191  O "O5'" . DT  I 5 77  ? 72.213  36.868  109.739 1.00 122.60 ?  3   DT  I "O5'" 1 
ATOM 7192  C "C5'" . DT  I 5 77  ? 71.360  37.965  110.013 1.00 122.60 ?  3   DT  I "C5'" 1 
ATOM 7193  C "C4'" . DT  I 5 77  ? 70.713  38.483  108.744 1.00 122.60 ?  3   DT  I "C4'" 1 
ATOM 7194  O "O4'" . DT  I 5 77  ? 71.642  39.340  108.028 1.00 122.60 ?  3   DT  I "O4'" 1 
ATOM 7195  C "C3'" . DT  I 5 77  ? 70.275  37.406  107.748 1.00 122.60 ?  3   DT  I "C3'" 1 
ATOM 7196  O "O3'" . DT  I 5 77  ? 68.988  37.724  107.255 1.00 122.60 ?  3   DT  I "O3'" 1 
ATOM 7197  C "C2'" . DT  I 5 77  ? 71.331  37.506  106.649 1.00 122.60 ?  3   DT  I "C2'" 1 
ATOM 7198  C "C1'" . DT  I 5 77  ? 71.617  38.994  106.667 1.00 122.60 ?  3   DT  I "C1'" 1 
ATOM 7199  N N1    . DT  I 5 77  ? 72.915  39.368  106.061 1.00 122.60 ?  3   DT  I N1    1 
ATOM 7200  C C2    . DT  I 5 77  ? 72.958  40.405  105.166 1.00 122.60 ?  3   DT  I C2    1 
ATOM 7201  O O2    . DT  I 5 77  ? 71.976  41.043  104.838 1.00 122.60 ?  3   DT  I O2    1 
ATOM 7202  N N3    . DT  I 5 77  ? 74.199  40.678  104.668 1.00 122.60 ?  3   DT  I N3    1 
ATOM 7203  C C4    . DT  I 5 77  ? 75.376  40.026  104.968 1.00 122.60 ?  3   DT  I C4    1 
ATOM 7204  O O4    . DT  I 5 77  ? 76.446  40.340  104.469 1.00 122.60 ?  3   DT  I O4    1 
ATOM 7205  C C5    . DT  I 5 77  ? 75.264  38.949  105.912 1.00 122.60 ?  3   DT  I C5    1 
ATOM 7206  C C7    . DT  I 5 77  ? 76.481  38.169  106.301 1.00 122.60 ?  3   DT  I C7    1 
ATOM 7207  C C6    . DT  I 5 77  ? 74.052  38.672  106.410 1.00 122.60 ?  3   DT  I C6    1 
ATOM 7208  P P     . DC  I 5 78  ? 68.122  36.634  106.456 1.00 116.54 ?  4   DC  I P     1 
ATOM 7209  O OP1   . DC  I 5 78  ? 67.553  35.702  107.452 1.00 116.54 ?  4   DC  I OP1   1 
ATOM 7210  O OP2   . DC  I 5 78  ? 68.943  36.107  105.345 1.00 116.54 -1 4   DC  I OP2   1 
ATOM 7211  O "O5'" . DC  I 5 78  ? 66.939  37.500  105.818 1.00 116.54 ?  4   DC  I "O5'" 1 
ATOM 7212  C "C5'" . DC  I 5 78  ? 67.182  38.850  105.409 1.00 116.54 ?  4   DC  I "C5'" 1 
ATOM 7213  C "C4'" . DC  I 5 78  ? 67.412  38.930  103.909 1.00 116.54 ?  4   DC  I "C4'" 1 
ATOM 7214  O "O4'" . DC  I 5 78  ? 68.825  39.066  103.642 1.00 116.54 ?  4   DC  I "O4'" 1 
ATOM 7215  C "C3'" . DC  I 5 78  ? 66.948  37.700  103.131 1.00 116.54 ?  4   DC  I "C3'" 1 
ATOM 7216  O "O3'" . DC  I 5 78  ? 65.748  38.008  102.350 1.00 116.54 ?  4   DC  I "O3'" 1 
ATOM 7217  C "C2'" . DC  I 5 78  ? 68.171  37.267  102.305 1.00 116.54 ?  4   DC  I "C2'" 1 
ATOM 7218  C "C1'" . DC  I 5 78  ? 69.115  38.462  102.411 1.00 116.54 ?  4   DC  I "C1'" 1 
ATOM 7219  N N1    . DC  I 5 78  ? 70.563  38.093  102.401 1.00 116.54 ?  4   DC  I N1    1 
ATOM 7220  C C2    . DC  I 5 78  ? 71.474  38.838  101.635 1.00 116.54 ?  4   DC  I C2    1 
ATOM 7221  O O2    . DC  I 5 78  ? 71.065  39.793  100.965 1.00 116.54 ?  4   DC  I O2    1 
ATOM 7222  N N3    . DC  I 5 78  ? 72.784  38.486  101.651 1.00 116.54 ?  4   DC  I N3    1 
ATOM 7223  C C4    . DC  I 5 78  ? 73.187  37.449  102.388 1.00 116.54 ?  4   DC  I C4    1 
ATOM 7224  N N4    . DC  I 5 78  ? 74.486  37.138  102.375 1.00 116.54 ?  4   DC  I N4    1 
ATOM 7225  C C5    . DC  I 5 78  ? 72.276  36.685  103.172 1.00 116.54 ?  4   DC  I C5    1 
ATOM 7226  C C6    . DC  I 5 78  ? 70.989  37.037  103.145 1.00 116.54 ?  4   DC  I C6    1 
ATOM 7227  P P     . DC  I 5 79  ? 65.749  38.285  100.760 1.00 114.20 ?  5   DC  I P     1 
ATOM 7228  O OP1   . DC  I 5 79  ? 64.365  38.691  100.441 1.00 114.20 ?  5   DC  I OP1   1 
ATOM 7229  O OP2   . DC  I 5 79  ? 66.310  37.138  100.013 1.00 114.20 -1 5   DC  I OP2   1 
ATOM 7230  O "O5'" . DC  I 5 79  ? 66.661  39.586  100.567 1.00 114.20 ?  5   DC  I "O5'" 1 
ATOM 7231  C "C5'" . DC  I 5 79  ? 66.168  40.698  99.816  1.00 114.20 ?  5   DC  I "C5'" 1 
ATOM 7232  C "C4'" . DC  I 5 79  ? 66.972  40.919  98.540  1.00 114.20 ?  5   DC  I "C4'" 1 
ATOM 7233  O "O4'" . DC  I 5 79  ? 68.311  40.375  98.691  1.00 114.20 ?  5   DC  I "O4'" 1 
ATOM 7234  C "C3'" . DC  I 5 79  ? 66.416  40.233  97.290  1.00 114.20 ?  5   DC  I "C3'" 1 
ATOM 7235  O "O3'" . DC  I 5 79  ? 66.927  40.875  96.117  1.00 114.20 ?  5   DC  I "O3'" 1 
ATOM 7236  C "C2'" . DC  I 5 79  ? 67.094  38.884  97.421  1.00 114.20 ?  5   DC  I "C2'" 1 
ATOM 7237  C "C1'" . DC  I 5 79  ? 68.495  39.407  97.683  1.00 114.20 ?  5   DC  I "C1'" 1 
ATOM 7238  N N1    . DC  I 5 79  ? 69.494  38.416  98.139  1.00 114.20 ?  5   DC  I N1    1 
ATOM 7239  C C2    . DC  I 5 79  ? 70.830  38.595  97.782  1.00 114.20 ?  5   DC  I C2    1 
ATOM 7240  O O2    . DC  I 5 79  ? 71.135  39.562  97.076  1.00 114.20 ?  5   DC  I O2    1 
ATOM 7241  N N3    . DC  I 5 79  ? 71.750  37.706  98.215  1.00 114.20 ?  5   DC  I N3    1 
ATOM 7242  C C4    . DC  I 5 79  ? 71.377  36.678  98.973  1.00 114.20 ?  5   DC  I C4    1 
ATOM 7243  N N4    . DC  I 5 79  ? 72.325  35.829  99.379  1.00 114.20 ?  5   DC  I N4    1 
ATOM 7244  C C5    . DC  I 5 79  ? 70.019  36.481  99.351  1.00 114.20 ?  5   DC  I C5    1 
ATOM 7245  C C6    . DC  I 5 79  ? 69.119  37.367  98.912  1.00 114.20 ?  5   DC  I C6    1 
ATOM 7246  P P     . DC  I 5 80  ? 66.376  42.273  95.535  1.00 109.35 ?  6   DC  I P     1 
ATOM 7247  O OP1   . DC  I 5 80  ? 65.774  43.150  96.562  1.00 109.35 ?  6   DC  I OP1   1 
ATOM 7248  O OP2   . DC  I 5 80  ? 65.585  41.932  94.336  1.00 109.35 -1 6   DC  I OP2   1 
ATOM 7249  O "O5'" . DC  I 5 80  ? 67.721  42.959  95.014  1.00 109.35 ?  6   DC  I "O5'" 1 
ATOM 7250  C "C5'" . DC  I 5 80  ? 68.979  42.329  95.294  1.00 109.35 ?  6   DC  I "C5'" 1 
ATOM 7251  C "C4'" . DC  I 5 80  ? 69.753  42.068  94.016  1.00 109.35 ?  6   DC  I "C4'" 1 
ATOM 7252  O "O4'" . DC  I 5 80  ? 70.535  40.853  94.146  1.00 109.35 ?  6   DC  I "O4'" 1 
ATOM 7253  C "C3'" . DC  I 5 80  ? 68.896  41.852  92.785  1.00 109.35 ?  6   DC  I "C3'" 1 
ATOM 7254  O "O3'" . DC  I 5 80  ? 69.648  42.188  91.635  1.00 109.35 ?  6   DC  I "O3'" 1 
ATOM 7255  C "C2'" . DC  I 5 80  ? 68.648  40.351  92.856  1.00 109.35 ?  6   DC  I "C2'" 1 
ATOM 7256  C "C1'" . DC  I 5 80  ? 70.031  39.863  93.266  1.00 109.35 ?  6   DC  I "C1'" 1 
ATOM 7257  N N1    . DC  I 5 80  ? 70.041  38.574  94.001  1.00 109.35 ?  6   DC  I N1    1 
ATOM 7258  C C2    . DC  I 5 80  ? 71.261  37.962  94.283  1.00 109.35 ?  6   DC  I C2    1 
ATOM 7259  O O2    . DC  I 5 80  ? 72.303  38.471  93.872  1.00 109.35 ?  6   DC  I O2    1 
ATOM 7260  N N3    . DC  I 5 80  ? 71.270  36.800  94.974  1.00 109.35 ?  6   DC  I N3    1 
ATOM 7261  C C4    . DC  I 5 80  ? 70.130  36.264  95.393  1.00 109.35 ?  6   DC  I C4    1 
ATOM 7262  N N4    . DC  I 5 80  ? 70.194  35.117  96.076  1.00 109.35 ?  6   DC  I N4    1 
ATOM 7263  C C5    . DC  I 5 80  ? 68.874  36.873  95.123  1.00 109.35 ?  6   DC  I C5    1 
ATOM 7264  C C6    . DC  I 5 80  ? 68.876  38.019  94.432  1.00 109.35 ?  6   DC  I C6    1 
ATOM 7265  P P     . DC  I 5 81  ? 69.654  43.687  91.053  1.00 91.81  ?  7   DC  I P     1 
ATOM 7266  O OP1   . DC  I 5 81  ? 69.464  44.688  92.123  1.00 91.81  ?  7   DC  I OP1   1 
ATOM 7267  O OP2   . DC  I 5 81  ? 68.734  43.681  89.899  1.00 91.81  -1 7   DC  I OP2   1 
ATOM 7268  O "O5'" . DC  I 5 81  ? 71.128  43.842  90.472  1.00 91.81  ?  7   DC  I "O5'" 1 
ATOM 7269  C "C5'" . DC  I 5 81  ? 71.399  43.395  89.169  1.00 91.81  ?  7   DC  I "C5'" 1 
ATOM 7270  C "C4'" . DC  I 5 81  ? 72.839  42.961  89.021  1.00 91.81  ?  7   DC  I "C4'" 1 
ATOM 7271  O "O4'" . DC  I 5 81  ? 73.055  41.744  89.769  1.00 91.81  ?  7   DC  I "O4'" 1 
ATOM 7272  C "C3'" . DC  I 5 81  ? 73.223  42.602  87.609  1.00 91.81  ?  7   DC  I "C3'" 1 
ATOM 7273  O "O3'" . DC  I 5 81  ? 74.619  42.657  87.468  1.00 91.81  ?  7   DC  I "O3'" 1 
ATOM 7274  C "C2'" . DC  I 5 81  ? 72.708  41.183  87.514  1.00 91.81  ?  7   DC  I "C2'" 1 
ATOM 7275  C "C1'" . DC  I 5 81  ? 73.085  40.638  88.881  1.00 91.81  ?  7   DC  I "C1'" 1 
ATOM 7276  N N1    . DC  I 5 81  ? 72.140  39.630  89.400  1.00 91.81  ?  7   DC  I N1    1 
ATOM 7277  C C2    . DC  I 5 81  ? 72.623  38.465  90.000  1.00 91.81  ?  7   DC  I C2    1 
ATOM 7278  O O2    . DC  I 5 81  ? 73.839  38.264  90.050  1.00 91.81  ?  7   DC  I O2    1 
ATOM 7279  N N3    . DC  I 5 81  ? 71.738  37.564  90.487  1.00 91.81  ?  7   DC  I N3    1 
ATOM 7280  C C4    . DC  I 5 81  ? 70.432  37.803  90.404  1.00 91.81  ?  7   DC  I C4    1 
ATOM 7281  N N4    . DC  I 5 81  ? 69.595  36.890  90.904  1.00 91.81  ?  7   DC  I N4    1 
ATOM 7282  C C5    . DC  I 5 81  ? 69.924  38.986  89.800  1.00 91.81  ?  7   DC  I C5    1 
ATOM 7283  C C6    . DC  I 5 81  ? 70.805  39.866  89.326  1.00 91.81  ?  7   DC  I C6    1 
ATOM 7284  P P     . DC  I 5 82  ? 75.276  42.787  86.011  1.00 96.53  ?  8   DC  I P     1 
ATOM 7285  O OP1   . DC  I 5 82  ? 75.815  44.158  85.875  1.00 96.53  ?  8   DC  I OP1   1 
ATOM 7286  O OP2   . DC  I 5 82  ? 74.296  42.276  85.033  1.00 96.53  -1 8   DC  I OP2   1 
ATOM 7287  O "O5'" . DC  I 5 82  ? 76.476  41.747  86.068  1.00 96.53  ?  8   DC  I "O5'" 1 
ATOM 7288  C "C5'" . DC  I 5 82  ? 76.406  40.684  86.989  1.00 96.53  ?  8   DC  I "C5'" 1 
ATOM 7289  C "C4'" . DC  I 5 82  ? 77.419  39.613  86.669  1.00 96.53  ?  8   DC  I "C4'" 1 
ATOM 7290  O "O4'" . DC  I 5 82  ? 76.835  38.324  86.949  1.00 96.53  ?  8   DC  I "O4'" 1 
ATOM 7291  C "C3'" . DC  I 5 82  ? 77.816  39.526  85.215  1.00 96.53  ?  8   DC  I "C3'" 1 
ATOM 7292  O "O3'" . DC  I 5 82  ? 79.018  38.783  85.109  1.00 96.53  ?  8   DC  I "O3'" 1 
ATOM 7293  C "C2'" . DC  I 5 82  ? 76.633  38.762  84.632  1.00 96.53  ?  8   DC  I "C2'" 1 
ATOM 7294  C "C1'" . DC  I 5 82  ? 76.323  37.767  85.752  1.00 96.53  ?  8   DC  I "C1'" 1 
ATOM 7295  N N1    . DC  I 5 82  ? 74.874  37.508  85.946  1.00 96.53  ?  8   DC  I N1    1 
ATOM 7296  C C2    . DC  I 5 82  ? 74.464  36.337  86.575  1.00 96.53  ?  8   DC  I C2    1 
ATOM 7297  O O2    . DC  I 5 82  ? 75.316  35.531  86.948  1.00 96.53  ?  8   DC  I O2    1 
ATOM 7298  N N3    . DC  I 5 82  ? 73.142  36.117  86.760  1.00 96.53  ?  8   DC  I N3    1 
ATOM 7299  C C4    . DC  I 5 82  ? 72.258  37.011  86.343  1.00 96.53  ?  8   DC  I C4    1 
ATOM 7300  N N4    . DC  I 5 82  ? 70.962  36.756  86.543  1.00 96.53  ?  8   DC  I N4    1 
ATOM 7301  C C5    . DC  I 5 82  ? 72.657  38.205  85.693  1.00 96.53  ?  8   DC  I C5    1 
ATOM 7302  C C6    . DC  I 5 82  ? 73.962  38.418  85.526  1.00 96.53  ?  8   DC  I C6    1 
ATOM 7303  P P     . DG  I 5 83  ? 79.759  38.614  83.694  1.00 108.08 ?  9   DG  I P     1 
ATOM 7304  O OP1   . DG  I 5 83  ? 81.141  39.106  83.861  1.00 108.08 ?  9   DG  I OP1   1 
ATOM 7305  O OP2   . DG  I 5 83  ? 78.902  39.183  82.634  1.00 108.08 -1 9   DG  I OP2   1 
ATOM 7306  O "O5'" . DG  I 5 83  ? 79.808  37.034  83.487  1.00 108.08 ?  9   DG  I "O5'" 1 
ATOM 7307  C "C5'" . DG  I 5 83  ? 80.438  36.218  84.461  1.00 108.08 ?  9   DG  I "C5'" 1 
ATOM 7308  C "C4'" . DG  I 5 83  ? 80.096  34.753  84.253  1.00 108.08 ?  9   DG  I "C4'" 1 
ATOM 7309  O "O4'" . DG  I 5 83  ? 78.698  34.531  84.552  1.00 108.08 ?  9   DG  I "O4'" 1 
ATOM 7310  C "C3'" . DG  I 5 83  ? 80.326  34.225  82.842  1.00 108.08 ?  9   DG  I "C3'" 1 
ATOM 7311  O "O3'" . DG  I 5 83  ? 80.934  32.949  82.906  1.00 108.08 ?  9   DG  I "O3'" 1 
ATOM 7312  C "C2'" . DG  I 5 83  ? 78.920  34.156  82.244  1.00 108.08 ?  9   DG  I "C2'" 1 
ATOM 7313  C "C1'" . DG  I 5 83  ? 78.061  33.893  83.470  1.00 108.08 ?  9   DG  I "C1'" 1 
ATOM 7314  N N9    . DG  I 5 83  ? 76.716  34.440  83.369  1.00 108.08 ?  9   DG  I N9    1 
ATOM 7315  C C8    . DG  I 5 83  ? 76.362  35.691  82.941  1.00 108.08 ?  9   DG  I C8    1 
ATOM 7316  N N7    . DG  I 5 83  ? 75.078  35.913  82.987  1.00 108.08 ?  9   DG  I N7    1 
ATOM 7317  C C5    . DG  I 5 83  ? 74.550  34.728  83.473  1.00 108.08 ?  9   DG  I C5    1 
ATOM 7318  C C6    . DG  I 5 83  ? 73.209  34.361  83.729  1.00 108.08 ?  9   DG  I C6    1 
ATOM 7319  O O6    . DG  I 5 83  ? 72.182  35.034  83.576  1.00 108.08 ?  9   DG  I O6    1 
ATOM 7320  N N1    . DG  I 5 83  ? 73.118  33.064  84.216  1.00 108.08 ?  9   DG  I N1    1 
ATOM 7321  C C2    . DG  I 5 83  ? 74.188  32.228  84.427  1.00 108.08 ?  9   DG  I C2    1 
ATOM 7322  N N2    . DG  I 5 83  ? 73.912  31.007  84.900  1.00 108.08 ?  9   DG  I N2    1 
ATOM 7323  N N3    . DG  I 5 83  ? 75.444  32.559  84.188  1.00 108.08 ?  9   DG  I N3    1 
ATOM 7324  C C4    . DG  I 5 83  ? 75.550  33.817  83.718  1.00 108.08 ?  9   DG  I C4    1 
ATOM 7325  P P     . DC  I 5 84  ? 81.342  32.182  81.557  1.00 112.52 ?  10  DC  I P     1 
ATOM 7326  O OP1   . DC  I 5 84  ? 82.581  31.422  81.826  1.00 112.52 ?  10  DC  I OP1   1 
ATOM 7327  O OP2   . DC  I 5 84  ? 81.305  33.161  80.451  1.00 112.52 -1 10  DC  I OP2   1 
ATOM 7328  O "O5'" . DC  I 5 84  ? 80.142  31.155  81.338  1.00 112.52 ?  10  DC  I "O5'" 1 
ATOM 7329  C "C5'" . DC  I 5 84  ? 79.607  30.458  82.449  1.00 112.52 ?  10  DC  I "C5'" 1 
ATOM 7330  C "C4'" . DC  I 5 84  ? 78.490  29.530  82.018  1.00 112.52 ?  10  DC  I "C4'" 1 
ATOM 7331  O "O4'" . DC  I 5 84  ? 77.212  30.203  82.147  1.00 112.52 ?  10  DC  I "O4'" 1 
ATOM 7332  C "C3'" . DC  I 5 84  ? 78.574  29.052  80.570  1.00 112.52 ?  10  DC  I "C3'" 1 
ATOM 7333  O "O3'" . DC  I 5 84  ? 78.281  27.673  80.515  1.00 112.52 ?  10  DC  I "O3'" 1 
ATOM 7334  C "C2'" . DC  I 5 84  ? 77.500  29.880  79.868  1.00 112.52 ?  10  DC  I "C2'" 1 
ATOM 7335  C "C1'" . DC  I 5 84  ? 76.469  30.007  80.970  1.00 112.52 ?  10  DC  I "C1'" 1 
ATOM 7336  N N1    . DC  I 5 84  ? 75.550  31.154  80.807  1.00 112.52 ?  10  DC  I N1    1 
ATOM 7337  C C2    . DC  I 5 84  ? 74.179  30.963  80.976  1.00 112.52 ?  10  DC  I C2    1 
ATOM 7338  O O2    . DC  I 5 84  ? 73.758  29.836  81.250  1.00 112.52 ?  10  DC  I O2    1 
ATOM 7339  N N3    . DC  I 5 84  ? 73.348  32.018  80.837  1.00 112.52 ?  10  DC  I N3    1 
ATOM 7340  C C4    . DC  I 5 84  ? 73.841  33.218  80.544  1.00 112.52 ?  10  DC  I C4    1 
ATOM 7341  N N4    . DC  I 5 84  ? 72.981  34.229  80.415  1.00 112.52 ?  10  DC  I N4    1 
ATOM 7342  C C5    . DC  I 5 84  ? 75.238  33.434  80.364  1.00 112.52 ?  10  DC  I C5    1 
ATOM 7343  C C6    . DC  I 5 84  ? 76.049  32.385  80.511  1.00 112.52 ?  10  DC  I C6    1 
ATOM 7344  P P     . DG  I 5 85  ? 78.812  26.784  79.291  1.00 120.00 ?  11  DG  I P     1 
ATOM 7345  O OP1   . DG  I 5 85  ? 79.588  25.665  79.868  1.00 120.00 ?  11  DG  I OP1   1 
ATOM 7346  O OP2   . DG  I 5 85  ? 79.445  27.692  78.310  1.00 120.00 -1 11  DG  I OP2   1 
ATOM 7347  O "O5'" . DG  I 5 85  ? 77.474  26.207  78.637  1.00 120.00 ?  11  DG  I "O5'" 1 
ATOM 7348  C "C5'" . DG  I 5 85  ? 76.576  25.450  79.430  1.00 120.00 ?  11  DG  I "C5'" 1 
ATOM 7349  C "C4'" . DG  I 5 85  ? 75.200  25.407  78.795  1.00 120.00 ?  11  DG  I "C4'" 1 
ATOM 7350  O "O4'" . DG  I 5 85  ? 74.555  26.695  78.944  1.00 120.00 ?  11  DG  I "O4'" 1 
ATOM 7351  C "C3'" . DG  I 5 85  ? 75.188  25.088  77.300  1.00 120.00 ?  11  DG  I "C3'" 1 
ATOM 7352  O "O3'" . DG  I 5 85  ? 74.233  24.073  77.038  1.00 120.00 ?  11  DG  I "O3'" 1 
ATOM 7353  C "C2'" . DG  I 5 85  ? 74.798  26.417  76.650  1.00 120.00 ?  11  DG  I "C2'" 1 
ATOM 7354  C "C1'" . DG  I 5 85  ? 73.949  27.057  77.731  1.00 120.00 ?  11  DG  I "C1'" 1 
ATOM 7355  N N9    . DG  I 5 85  ? 73.913  28.512  77.659  1.00 120.00 ?  11  DG  I N9    1 
ATOM 7356  C C8    . DG  I 5 85  ? 74.980  29.356  77.507  1.00 120.00 ?  11  DG  I C8    1 
ATOM 7357  N N7    . DG  I 5 85  ? 74.647  30.615  77.489  1.00 120.00 ?  11  DG  I N7    1 
ATOM 7358  C C5    . DG  I 5 85  ? 73.269  30.603  77.638  1.00 120.00 ?  11  DG  I C5    1 
ATOM 7359  C C6    . DG  I 5 85  ? 72.349  31.675  77.689  1.00 120.00 ?  11  DG  I C6    1 
ATOM 7360  O O6    . DG  I 5 85  ? 72.581  32.886  77.609  1.00 120.00 ?  11  DG  I O6    1 
ATOM 7361  N N1    . DG  I 5 85  ? 71.043  31.228  77.851  1.00 120.00 ?  11  DG  I N1    1 
ATOM 7362  C C2    . DG  I 5 85  ? 70.674  29.910  77.950  1.00 120.00 ?  11  DG  I C2    1 
ATOM 7363  N N2    . DG  I 5 85  ? 69.367  29.663  78.103  1.00 120.00 ?  11  DG  I N2    1 
ATOM 7364  N N3    . DG  I 5 85  ? 71.528  28.896  77.902  1.00 120.00 ?  11  DG  I N3    1 
ATOM 7365  C C4    . DG  I 5 85  ? 72.802  29.317  77.744  1.00 120.00 ?  11  DG  I C4    1 
ATOM 7366  P P     . DT  I 5 86  ? 74.046  23.483  75.555  1.00 118.28 ?  12  DT  I P     1 
ATOM 7367  O OP1   . DT  I 5 86  ? 73.988  22.011  75.669  1.00 118.28 ?  12  DT  I OP1   1 
ATOM 7368  O OP2   . DT  I 5 86  ? 75.047  24.103  74.663  1.00 118.28 -1 12  DT  I OP2   1 
ATOM 7369  O "O5'" . DT  I 5 86  ? 72.603  24.009  75.131  1.00 118.28 ?  12  DT  I "O5'" 1 
ATOM 7370  C "C5'" . DT  I 5 86  ? 71.521  23.889  76.041  1.00 118.28 ?  12  DT  I "C5'" 1 
ATOM 7371  C "C4'" . DT  I 5 86  ? 70.265  24.506  75.464  1.00 118.28 ?  12  DT  I "C4'" 1 
ATOM 7372  O "O4'" . DT  I 5 86  ? 70.303  25.942  75.648  1.00 118.28 ?  12  DT  I "O4'" 1 
ATOM 7373  C "C3'" . DT  I 5 86  ? 70.066  24.257  73.971  1.00 118.28 ?  12  DT  I "C3'" 1 
ATOM 7374  O "O3'" . DT  I 5 86  ? 68.774  23.727  73.737  1.00 118.28 ?  12  DT  I "O3'" 1 
ATOM 7375  C "C2'" . DT  I 5 86  ? 70.244  25.635  73.332  1.00 118.28 ?  12  DT  I "C2'" 1 
ATOM 7376  C "C1'" . DT  I 5 86  ? 69.913  26.590  74.465  1.00 118.28 ?  12  DT  I "C1'" 1 
ATOM 7377  N N1    . DT  I 5 86  ? 70.660  27.876  74.383  1.00 118.28 ?  12  DT  I N1    1 
ATOM 7378  C C2    . DT  I 5 86  ? 69.978  29.063  74.483  1.00 118.28 ?  12  DT  I C2    1 
ATOM 7379  O O2    . DT  I 5 86  ? 68.772  29.130  74.632  1.00 118.28 ?  12  DT  I O2    1 
ATOM 7380  N N3    . DT  I 5 86  ? 70.764  30.181  74.404  1.00 118.28 ?  12  DT  I N3    1 
ATOM 7381  C C4    . DT  I 5 86  ? 72.130  30.227  74.239  1.00 118.28 ?  12  DT  I C4    1 
ATOM 7382  O O4    . DT  I 5 86  ? 72.749  31.282  74.178  1.00 118.28 ?  12  DT  I O4    1 
ATOM 7383  C C5    . DT  I 5 86  ? 72.782  28.949  74.142  1.00 118.28 ?  12  DT  I C5    1 
ATOM 7384  C C7    . DT  I 5 86  ? 74.265  28.878  73.958  1.00 118.28 ?  12  DT  I C7    1 
ATOM 7385  C C6    . DT  I 5 86  ? 72.027  27.849  74.220  1.00 118.28 ?  12  DT  I C6    1 
ATOM 7386  P P     . DT  I 5 87  ? 68.254  23.484  72.237  1.00 116.16 ?  13  DT  I P     1 
ATOM 7387  O OP1   . DT  I 5 87  ? 67.397  22.279  72.252  1.00 116.16 ?  13  DT  I OP1   1 
ATOM 7388  O OP2   . DT  I 5 87  ? 69.412  23.531  71.319  1.00 116.16 -1 13  DT  I OP2   1 
ATOM 7389  O "O5'" . DT  I 5 87  ? 67.335  24.758  71.961  1.00 116.16 ?  13  DT  I "O5'" 1 
ATOM 7390  C "C5'" . DT  I 5 87  ? 66.469  25.230  72.984  1.00 116.16 ?  13  DT  I "C5'" 1 
ATOM 7391  C "C4'" . DT  I 5 87  ? 65.717  26.468  72.537  1.00 116.16 ?  13  DT  I "C4'" 1 
ATOM 7392  O "O4'" . DT  I 5 87  ? 66.578  27.631  72.645  1.00 116.16 ?  13  DT  I "O4'" 1 
ATOM 7393  C "C3'" . DT  I 5 87  ? 65.214  26.431  71.098  1.00 116.16 ?  13  DT  I "C3'" 1 
ATOM 7394  O "O3'" . DT  I 5 87  ? 63.873  26.879  71.050  1.00 116.16 ?  13  DT  I "O3'" 1 
ATOM 7395  C "C2'" . DT  I 5 87  ? 66.159  27.380  70.362  1.00 116.16 ?  13  DT  I "C2'" 1 
ATOM 7396  C "C1'" . DT  I 5 87  ? 66.542  28.369  71.448  1.00 116.16 ?  13  DT  I "C1'" 1 
ATOM 7397  N N1    . DT  I 5 87  ? 67.890  28.999  71.261  1.00 116.16 ?  13  DT  I N1    1 
ATOM 7398  C C2    . DT  I 5 87  ? 68.009  30.365  71.346  1.00 116.16 ?  13  DT  I C2    1 
ATOM 7399  O O2    . DT  I 5 87  ? 67.065  31.103  71.547  1.00 116.16 ?  13  DT  I O2    1 
ATOM 7400  N N3    . DT  I 5 87  ? 69.283  30.840  71.180  1.00 116.16 ?  13  DT  I N3    1 
ATOM 7401  C C4    . DT  I 5 87  ? 70.423  30.101  70.952  1.00 116.16 ?  13  DT  I C4    1 
ATOM 7402  O O4    . DT  I 5 87  ? 71.525  30.616  70.815  1.00 116.16 ?  13  DT  I O4    1 
ATOM 7403  C C5    . DT  I 5 87  ? 70.232  28.680  70.880  1.00 116.16 ?  13  DT  I C5    1 
ATOM 7404  C C7    . DT  I 5 87  ? 71.405  27.786  70.627  1.00 116.16 ?  13  DT  I C7    1 
ATOM 7405  C C6    . DT  I 5 87  ? 68.991  28.198  71.042  1.00 116.16 ?  13  DT  I C6    1 
ATOM 7406  P P     . DT  I 5 88  ? 63.098  26.970  69.647  1.00 113.98 ?  14  DT  I P     1 
ATOM 7407  O OP1   . DT  I 5 88  ? 61.688  26.598  69.893  1.00 113.98 ?  14  DT  I OP1   1 
ATOM 7408  O OP2   . DT  I 5 88  ? 63.883  26.229  68.637  1.00 113.98 -1 14  DT  I OP2   1 
ATOM 7409  O "O5'" . DT  I 5 88  ? 63.156  28.527  69.295  1.00 113.98 ?  14  DT  I "O5'" 1 
ATOM 7410  C "C5'" . DT  I 5 88  ? 62.715  29.476  70.254  1.00 113.98 ?  14  DT  I "C5'" 1 
ATOM 7411  C "C4'" . DT  I 5 88  ? 63.018  30.898  69.815  1.00 113.98 ?  14  DT  I "C4'" 1 
ATOM 7412  O "O4'" . DT  I 5 88  ? 64.450  31.121  69.791  1.00 113.98 ?  14  DT  I "O4'" 1 
ATOM 7413  C "C3'" . DT  I 5 88  ? 62.508  31.291  68.430  1.00 113.98 ?  14  DT  I "C3'" 1 
ATOM 7414  O "O3'" . DT  I 5 88  ? 61.987  32.604  68.504  1.00 113.98 ?  14  DT  I "O3'" 1 
ATOM 7415  C "C2'" . DT  I 5 88  ? 63.778  31.240  67.579  1.00 113.98 ?  14  DT  I "C2'" 1 
ATOM 7416  C "C1'" . DT  I 5 88  ? 64.795  31.745  68.578  1.00 113.98 ?  14  DT  I "C1'" 1 
ATOM 7417  N N1    . DT  I 5 88  ? 66.216  31.407  68.281  1.00 113.98 ?  14  DT  I N1    1 
ATOM 7418  C C2    . DT  I 5 88  ? 67.152  32.407  68.318  1.00 113.98 ?  14  DT  I C2    1 
ATOM 7419  O O2    . DT  I 5 88  ? 66.874  33.569  68.542  1.00 113.98 ?  14  DT  I O2    1 
ATOM 7420  N N3    . DT  I 5 88  ? 68.431  32.004  68.073  1.00 113.98 ?  14  DT  I N3    1 
ATOM 7421  C C4    . DT  I 5 88  ? 68.867  30.728  67.811  1.00 113.98 ?  14  DT  I C4    1 
ATOM 7422  O O4    . DT  I 5 88  ? 70.044  30.470  67.601  1.00 113.98 ?  14  DT  I O4    1 
ATOM 7423  C C5    . DT  I 5 88  ? 67.845  29.718  67.797  1.00 113.98 ?  14  DT  I C5    1 
ATOM 7424  C C7    . DT  I 5 88  ? 68.211  28.294  67.510  1.00 113.98 ?  14  DT  I C7    1 
ATOM 7425  C C6    . DT  I 5 88  ? 66.578  30.098  68.039  1.00 113.98 ?  14  DT  I C6    1 
ATOM 7426  P P     . DT  I 5 89  ? 61.090  33.219  67.324  1.00 111.00 ?  15  DT  I P     1 
ATOM 7427  O OP1   . DT  I 5 89  ? 59.673  33.006  67.684  1.00 111.00 ?  15  DT  I OP1   1 
ATOM 7428  O OP2   . DT  I 5 89  ? 61.599  32.723  66.027  1.00 111.00 -1 15  DT  I OP2   1 
ATOM 7429  O "O5'" . DT  I 5 89  ? 61.416  34.781  67.413  1.00 111.00 ?  15  DT  I "O5'" 1 
ATOM 7430  C "C5'" . DT  I 5 89  ? 62.641  35.206  68.011  1.00 111.00 ?  15  DT  I "C5'" 1 
ATOM 7431  C "C4'" . DT  I 5 89  ? 63.291  36.313  67.204  1.00 111.00 ?  15  DT  I "C4'" 1 
ATOM 7432  O "O4'" . DT  I 5 89  ? 64.684  35.975  66.949  1.00 111.00 ?  15  DT  I "O4'" 1 
ATOM 7433  C "C3'" . DT  I 5 89  ? 62.689  36.540  65.827  1.00 111.00 ?  15  DT  I "C3'" 1 
ATOM 7434  O "O3'" . DT  I 5 89  ? 62.966  37.870  65.412  1.00 111.00 ?  15  DT  I "O3'" 1 
ATOM 7435  C "C2'" . DT  I 5 89  ? 63.492  35.547  65.006  1.00 111.00 ?  15  DT  I "C2'" 1 
ATOM 7436  C "C1'" . DT  I 5 89  ? 64.873  35.850  65.554  1.00 111.00 ?  15  DT  I "C1'" 1 
ATOM 7437  N N1    . DT  I 5 89  ? 65.893  34.799  65.301  1.00 111.00 ?  15  DT  I N1    1 
ATOM 7438  C C2    . DT  I 5 89  ? 67.220  35.152  65.298  1.00 111.00 ?  15  DT  I C2    1 
ATOM 7439  O O2    . DT  I 5 89  ? 67.605  36.288  65.478  1.00 111.00 ?  15  DT  I O2    1 
ATOM 7440  N N3    . DT  I 5 89  ? 68.086  34.123  65.066  1.00 111.00 ?  15  DT  I N3    1 
ATOM 7441  C C4    . DT  I 5 89  ? 67.766  32.801  64.847  1.00 111.00 ?  15  DT  I C4    1 
ATOM 7442  O O4    . DT  I 5 89  ? 68.617  31.945  64.649  1.00 111.00 ?  15  DT  I O4    1 
ATOM 7443  C C5    . DT  I 5 89  ? 66.360  32.494  64.864  1.00 111.00 ?  15  DT  I C5    1 
ATOM 7444  C C7    . DT  I 5 89  ? 65.901  31.087  64.627  1.00 111.00 ?  15  DT  I C7    1 
ATOM 7445  C C6    . DT  I 5 89  ? 65.497  33.497  65.089  1.00 111.00 ?  15  DT  I C6    1 
ATOM 7446  P P     . DA  I 5 90  ? 61.891  39.044  65.633  1.00 105.38 ?  16  DA  I P     1 
ATOM 7447  O OP1   . DA  I 5 90  ? 61.660  39.198  67.085  1.00 105.38 ?  16  DA  I OP1   1 
ATOM 7448  O OP2   . DA  I 5 90  ? 60.752  38.771  64.736  1.00 105.38 -1 16  DA  I OP2   1 
ATOM 7449  O "O5'" . DA  I 5 90  ? 62.635  40.351  65.085  1.00 105.38 ?  16  DA  I "O5'" 1 
ATOM 7450  C "C5'" . DA  I 5 90  ? 63.805  40.843  65.743  1.00 105.38 ?  16  DA  I "C5'" 1 
ATOM 7451  C "C4'" . DA  I 5 90  ? 64.928  41.186  64.760  1.00 105.38 ?  16  DA  I "C4'" 1 
ATOM 7452  O "O4'" . DA  I 5 90  ? 65.663  39.994  64.399  1.00 105.38 ?  16  DA  I "O4'" 1 
ATOM 7453  C "C3'" . DA  I 5 90  ? 64.514  41.833  63.433  1.00 105.38 ?  16  DA  I "C3'" 1 
ATOM 7454  O "O3'" . DA  I 5 90  ? 65.537  42.718  63.001  1.00 105.38 ?  16  DA  I "O3'" 1 
ATOM 7455  C "C2'" . DA  I 5 90  ? 64.476  40.625  62.503  1.00 105.38 ?  16  DA  I "C2'" 1 
ATOM 7456  C "C1'" . DA  I 5 90  ? 65.709  39.892  62.994  1.00 105.38 ?  16  DA  I "C1'" 1 
ATOM 7457  N N9    . DA  I 5 90  ? 65.745  38.486  62.654  1.00 105.38 ?  16  DA  I N9    1 
ATOM 7458  C C8    . DA  I 5 90  ? 64.682  37.657  62.486  1.00 105.38 ?  16  DA  I C8    1 
ATOM 7459  N N7    . DA  I 5 90  ? 65.017  36.422  62.211  1.00 105.38 ?  16  DA  I N7    1 
ATOM 7460  C C5    . DA  I 5 90  ? 66.394  36.443  62.219  1.00 105.38 ?  16  DA  I C5    1 
ATOM 7461  C C6    . DA  I 5 90  ? 67.352  35.445  61.994  1.00 105.38 ?  16  DA  I C6    1 
ATOM 7462  N N6    . DA  I 5 90  ? 67.033  34.181  61.726  1.00 105.38 ?  16  DA  I N6    1 
ATOM 7463  N N1    . DA  I 5 90  ? 68.653  35.795  62.064  1.00 105.38 ?  16  DA  I N1    1 
ATOM 7464  C C2    . DA  I 5 90  ? 68.961  37.069  62.337  1.00 105.38 ?  16  DA  I C2    1 
ATOM 7465  N N3    . DA  I 5 90  ? 68.142  38.095  62.563  1.00 105.38 ?  16  DA  I N3    1 
ATOM 7466  C C4    . DA  I 5 90  ? 66.862  37.708  62.487  1.00 105.38 ?  16  DA  I C4    1 
ATOM 7467  P P     . DA  I 5 91  ? 65.658  44.236  63.516  1.00 96.39  ?  17  DA  I P     1 
ATOM 7468  O OP1   . DA  I 5 91  ? 65.125  44.406  64.883  1.00 96.39  ?  17  DA  I OP1   1 
ATOM 7469  O OP2   . DA  I 5 91  ? 65.146  45.089  62.428  1.00 96.39  -1 17  DA  I OP2   1 
ATOM 7470  O "O5'" . DA  I 5 91  ? 67.238  44.439  63.566  1.00 96.39  ?  17  DA  I "O5'" 1 
ATOM 7471  C "C5'" . DA  I 5 91  ? 68.072  43.286  63.608  1.00 96.39  ?  17  DA  I "C5'" 1 
ATOM 7472  C "C4'" . DA  I 5 91  ? 69.472  43.584  63.111  1.00 96.39  ?  17  DA  I "C4'" 1 
ATOM 7473  O "O4'" . DA  I 5 91  ? 69.964  42.446  62.370  1.00 96.39  ?  17  DA  I "O4'" 1 
ATOM 7474  C "C3'" . DA  I 5 91  ? 69.586  44.721  62.132  1.00 96.39  ?  17  DA  I "C3'" 1 
ATOM 7475  O "O3'" . DA  I 5 91  ? 70.935  45.126  62.063  1.00 96.39  ?  17  DA  I "O3'" 1 
ATOM 7476  C "C2'" . DA  I 5 91  ? 69.140  44.049  60.838  1.00 96.39  ?  17  DA  I "C2'" 1 
ATOM 7477  C "C1'" . DA  I 5 91  ? 69.746  42.653  60.983  1.00 96.39  ?  17  DA  I "C1'" 1 
ATOM 7478  N N9    . DA  I 5 91  ? 68.870  41.592  60.508  1.00 96.39  ?  17  DA  I N9    1 
ATOM 7479  C C8    . DA  I 5 91  ? 67.511  41.608  60.483  1.00 96.39  ?  17  DA  I C8    1 
ATOM 7480  N N7    . DA  I 5 91  ? 66.979  40.507  60.015  1.00 96.39  ?  17  DA  I N7    1 
ATOM 7481  C C5    . DA  I 5 91  ? 68.063  39.708  59.732  1.00 96.39  ?  17  DA  I C5    1 
ATOM 7482  C C6    . DA  I 5 91  ? 68.166  38.407  59.209  1.00 96.39  ?  17  DA  I C6    1 
ATOM 7483  N N6    . DA  I 5 91  ? 67.107  37.669  58.882  1.00 96.39  ?  17  DA  I N6    1 
ATOM 7484  N N1    . DA  I 5 91  ? 69.404  37.897  59.024  1.00 96.39  ?  17  DA  I N1    1 
ATOM 7485  C C2    . DA  I 5 91  ? 70.459  38.649  59.364  1.00 96.39  ?  17  DA  I C2    1 
ATOM 7486  N N3    . DA  I 5 91  ? 70.482  39.886  59.863  1.00 96.39  ?  17  DA  I N3    1 
ATOM 7487  C C4    . DA  I 5 91  ? 69.240  40.360  60.024  1.00 96.39  ?  17  DA  I C4    1 
ATOM 7488  P P     . DC  I 5 92  ? 71.414  46.193  60.971  1.00 102.81 ?  18  DC  I P     1 
ATOM 7489  O OP1   . DC  I 5 92  ? 72.497  47.002  61.563  1.00 102.81 ?  18  DC  I OP1   1 
ATOM 7490  O OP2   . DC  I 5 92  ? 70.208  46.851  60.448  1.00 102.81 -1 18  DC  I OP2   1 
ATOM 7491  O "O5'" . DC  I 5 92  ? 72.036  45.296  59.811  1.00 102.81 ?  18  DC  I "O5'" 1 
ATOM 7492  C "C5'" . DC  I 5 92  ? 72.993  44.305  60.135  1.00 102.81 ?  18  DC  I "C5'" 1 
ATOM 7493  C "C4'" . DC  I 5 92  ? 73.486  43.583  58.891  1.00 102.81 ?  18  DC  I "C4'" 1 
ATOM 7494  O "O4'" . DC  I 5 92  ? 72.545  42.546  58.500  1.00 102.81 ?  18  DC  I "O4'" 1 
ATOM 7495  C "C3'" . DC  I 5 92  ? 73.688  44.457  57.659  1.00 102.81 ?  18  DC  I "C3'" 1 
ATOM 7496  O "O3'" . DC  I 5 92  ? 74.871  44.054  57.011  1.00 102.81 ?  18  DC  I "O3'" 1 
ATOM 7497  C "C2'" . DC  I 5 92  ? 72.453  44.144  56.817  1.00 102.81 ?  18  DC  I "C2'" 1 
ATOM 7498  C "C1'" . DC  I 5 92  ? 72.245  42.675  57.129  1.00 102.81 ?  18  DC  I "C1'" 1 
ATOM 7499  N N1    . DC  I 5 92  ? 70.853  42.208  56.927  1.00 102.81 ?  18  DC  I N1    1 
ATOM 7500  C C2    . DC  I 5 92  ? 70.608  41.008  56.255  1.00 102.81 ?  18  DC  I C2    1 
ATOM 7501  O O2    . DC  I 5 92  ? 71.561  40.354  55.814  1.00 102.81 ?  18  DC  I O2    1 
ATOM 7502  N N3    . DC  I 5 92  ? 69.327  40.597  56.100  1.00 102.81 ?  18  DC  I N3    1 
ATOM 7503  C C4    . DC  I 5 92  ? 68.330  41.331  56.592  1.00 102.81 ?  18  DC  I C4    1 
ATOM 7504  N N4    . DC  I 5 92  ? 67.082  40.891  56.417  1.00 102.81 ?  18  DC  I N4    1 
ATOM 7505  C C5    . DC  I 5 92  ? 68.565  42.550  57.280  1.00 102.81 ?  18  DC  I C5    1 
ATOM 7506  C C6    . DC  I 5 92  ? 69.828  42.946  57.419  1.00 102.81 ?  18  DC  I C6    1 
ATOM 7507  P P     . DC  I 5 93  ? 75.526  44.942  55.847  1.00 121.77 ?  19  DC  I P     1 
ATOM 7508  O OP1   . DC  I 5 93  ? 76.611  45.737  56.462  1.00 121.77 ?  19  DC  I OP1   1 
ATOM 7509  O OP2   . DC  I 5 93  ? 74.456  45.633  55.095  1.00 121.77 -1 19  DC  I OP2   1 
ATOM 7510  O "O5'" . DC  I 5 93  ? 76.167  43.840  54.886  1.00 121.77 ?  19  DC  I "O5'" 1 
ATOM 7511  C "C5'" . DC  I 5 93  ? 75.674  42.505  54.933  1.00 121.77 ?  19  DC  I "C5'" 1 
ATOM 7512  C "C4'" . DC  I 5 93  ? 75.772  41.841  53.577  1.00 121.77 ?  19  DC  I "C4'" 1 
ATOM 7513  O "O4'" . DC  I 5 93  ? 74.503  41.221  53.246  1.00 121.77 ?  19  DC  I "O4'" 1 
ATOM 7514  C "C3'" . DC  I 5 93  ? 76.073  42.782  52.430  1.00 121.77 ?  19  DC  I "C3'" 1 
ATOM 7515  O "O3'" . DC  I 5 93  ? 76.761  42.085  51.422  1.00 121.77 ?  19  DC  I "O3'" 1 
ATOM 7516  C "C2'" . DC  I 5 93  ? 74.679  43.200  51.975  1.00 121.77 ?  19  DC  I "C2'" 1 
ATOM 7517  C "C1'" . DC  I 5 93  ? 73.880  41.917  52.183  1.00 121.77 ?  19  DC  I "C1'" 1 
ATOM 7518  N N1    . DC  I 5 93  ? 72.451  42.154  52.557  1.00 121.77 ?  19  DC  I N1    1 
ATOM 7519  C C2    . DC  I 5 93  ? 71.453  41.300  52.076  1.00 121.77 ?  19  DC  I C2    1 
ATOM 7520  O O2    . DC  I 5 93  ? 71.763  40.367  51.338  1.00 121.77 ?  19  DC  I O2    1 
ATOM 7521  N N3    . DC  I 5 93  ? 70.169  41.524  52.433  1.00 121.77 ?  19  DC  I N3    1 
ATOM 7522  C C4    . DC  I 5 93  ? 69.869  42.543  53.234  1.00 121.77 ?  19  DC  I C4    1 
ATOM 7523  N N4    . DC  I 5 93  ? 68.590  42.727  53.561  1.00 121.77 ?  19  DC  I N4    1 
ATOM 7524  C C5    . DC  I 5 93  ? 70.867  43.421  53.732  1.00 121.77 ?  19  DC  I C5    1 
ATOM 7525  C C6    . DC  I 5 93  ? 72.132  43.191  53.375  1.00 121.77 ?  19  DC  I C6    1 
ATOM 7526  P P     . DG  I 5 94  ? 77.674  42.884  50.373  1.00 131.15 ?  20  DG  I P     1 
ATOM 7527  O OP1   . DG  I 5 94  ? 79.019  42.270  50.392  1.00 131.15 ?  20  DG  I OP1   1 
ATOM 7528  O OP2   . DG  I 5 94  ? 77.510  44.329  50.640  1.00 131.15 -1 20  DG  I OP2   1 
ATOM 7529  O "O5'" . DG  I 5 94  ? 76.986  42.564  48.975  1.00 131.15 ?  20  DG  I "O5'" 1 
ATOM 7530  C "C5'" . DG  I 5 94  ? 76.525  41.255  48.712  1.00 131.15 ?  20  DG  I "C5'" 1 
ATOM 7531  C "C4'" . DG  I 5 94  ? 75.315  41.292  47.809  1.00 131.15 ?  20  DG  I "C4'" 1 
ATOM 7532  O "O4'" . DG  I 5 94  ? 74.117  41.461  48.598  1.00 131.15 ?  20  DG  I "O4'" 1 
ATOM 7533  C "C3'" . DG  I 5 94  ? 75.310  42.441  46.796  1.00 131.15 ?  20  DG  I "C3'" 1 
ATOM 7534  O "O3'" . DG  I 5 94  ? 75.462  41.928  45.478  1.00 131.15 ?  20  DG  I "O3'" 1 
ATOM 7535  C "C2'" . DG  I 5 94  ? 73.943  43.115  46.994  1.00 131.15 ?  20  DG  I "C2'" 1 
ATOM 7536  C "C1'" . DG  I 5 94  ? 73.167  42.071  47.778  1.00 131.15 ?  20  DG  I "C1'" 1 
ATOM 7537  N N9    . DG  I 5 94  ? 72.105  42.644  48.594  1.00 131.15 ?  20  DG  I N9    1 
ATOM 7538  C C8    . DG  I 5 94  ? 72.221  43.649  49.518  1.00 131.15 ?  20  DG  I C8    1 
ATOM 7539  N N7    . DG  I 5 94  ? 71.092  43.969  50.080  1.00 131.15 ?  20  DG  I N7    1 
ATOM 7540  C C5    . DG  I 5 94  ? 70.166  43.133  49.476  1.00 131.15 ?  20  DG  I C5    1 
ATOM 7541  C C6    . DG  I 5 94  ? 68.774  43.026  49.674  1.00 131.15 ?  20  DG  I C6    1 
ATOM 7542  O O6    . DG  I 5 94  ? 68.062  43.669  50.450  1.00 131.15 ?  20  DG  I O6    1 
ATOM 7543  N N1    . DG  I 5 94  ? 68.211  42.054  48.858  1.00 131.15 ?  20  DG  I N1    1 
ATOM 7544  C C2    . DG  I 5 94  ? 68.907  41.282  47.962  1.00 131.15 ?  20  DG  I C2    1 
ATOM 7545  N N2    . DG  I 5 94  ? 68.194  40.392  47.258  1.00 131.15 ?  20  DG  I N2    1 
ATOM 7546  N N3    . DG  I 5 94  ? 70.213  41.375  47.766  1.00 131.15 ?  20  DG  I N3    1 
ATOM 7547  C C4    . DG  I 5 94  ? 70.774  42.317  48.555  1.00 131.15 ?  20  DG  I C4    1 
ATOM 7548  P P     . DC  I 5 95  ? 75.363  42.904  44.204  1.00 132.29 ?  21  DC  I P     1 
ATOM 7549  O OP1   . DC  I 5 95  ? 76.251  42.355  43.158  1.00 132.29 ?  21  DC  I OP1   1 
ATOM 7550  O OP2   . DC  I 5 95  ? 75.554  44.294  44.671  1.00 132.29 -1 21  DC  I OP2   1 
ATOM 7551  O "O5'" . DC  I 5 95  ? 73.847  42.741  43.723  1.00 132.29 ?  21  DC  I "O5'" 1 
ATOM 7552  C "C5'" . DC  I 5 95  ? 73.243  41.456  43.742  1.00 132.29 ?  21  DC  I "C5'" 1 
ATOM 7553  C "C4'" . DC  I 5 95  ? 71.738  41.556  43.582  1.00 132.29 ?  21  DC  I "C4'" 1 
ATOM 7554  O "O4'" . DC  I 5 95  ? 71.149  42.164  44.757  1.00 132.29 ?  21  DC  I "O4'" 1 
ATOM 7555  C "C3'" . DC  I 5 95  ? 71.265  42.390  42.389  1.00 132.29 ?  21  DC  I "C3'" 1 
ATOM 7556  O "O3'" . DC  I 5 95  ? 70.394  41.610  41.594  1.00 132.29 ?  21  DC  I "O3'" 1 
ATOM 7557  C "C2'" . DC  I 5 95  ? 70.535  43.575  43.034  1.00 132.29 ?  21  DC  I "C2'" 1 
ATOM 7558  C "C1'" . DC  I 5 95  ? 70.075  42.965  44.343  1.00 132.29 ?  21  DC  I "C1'" 1 
ATOM 7559  N N1    . DC  I 5 95  ? 69.779  43.955  45.415  1.00 132.29 ?  21  DC  I N1    1 
ATOM 7560  C C2    . DC  I 5 95  ? 68.456  44.167  45.809  1.00 132.29 ?  21  DC  I C2    1 
ATOM 7561  O O2    . DC  I 5 95  ? 67.558  43.543  45.249  1.00 132.29 ?  21  DC  I O2    1 
ATOM 7562  N N3    . DC  I 5 95  ? 68.197  45.056  46.792  1.00 132.29 ?  21  DC  I N3    1 
ATOM 7563  C C4    . DC  I 5 95  ? 69.200  45.716  47.373  1.00 132.29 ?  21  DC  I C4    1 
ATOM 7564  N N4    . DC  I 5 95  ? 68.899  46.588  48.339  1.00 132.29 ?  21  DC  I N4    1 
ATOM 7565  C C5    . DC  I 5 95  ? 70.558  45.511  46.989  1.00 132.29 ?  21  DC  I C5    1 
ATOM 7566  C C6    . DC  I 5 95  ? 70.798  44.628  46.016  1.00 132.29 ?  21  DC  I C6    1 
ATOM 7567  P P     . DC  I 5 96  ? 70.385  41.776  39.998  1.00 128.84 ?  22  DC  I P     1 
ATOM 7568  O OP1   . DC  I 5 96  ? 70.277  40.425  39.405  1.00 128.84 ?  22  DC  I OP1   1 
ATOM 7569  O OP2   . DC  I 5 96  ? 71.521  42.649  39.630  1.00 128.84 -1 22  DC  I OP2   1 
ATOM 7570  O "O5'" . DC  I 5 96  ? 69.033  42.579  39.718  1.00 128.84 ?  22  DC  I "O5'" 1 
ATOM 7571  C "C5'" . DC  I 5 96  ? 67.820  42.136  40.304  1.00 128.84 ?  22  DC  I "C5'" 1 
ATOM 7572  C "C4'" . DC  I 5 96  ? 66.791  43.248  40.311  1.00 128.84 ?  22  DC  I "C4'" 1 
ATOM 7573  O "O4'" . DC  I 5 96  ? 66.868  43.978  41.549  1.00 128.84 ?  22  DC  I "O4'" 1 
ATOM 7574  C "C3'" . DC  I 5 96  ? 66.955  44.287  39.200  1.00 128.84 ?  22  DC  I "C3'" 1 
ATOM 7575  O "O3'" . DC  I 5 96  ? 65.884  44.163  38.276  1.00 128.84 ?  22  DC  I "O3'" 1 
ATOM 7576  C "C2'" . DC  I 5 96  ? 66.939  45.643  39.932  1.00 128.84 ?  22  DC  I "C2'" 1 
ATOM 7577  C "C1'" . DC  I 5 96  ? 66.419  45.281  41.313  1.00 128.84 ?  22  DC  I "C1'" 1 
ATOM 7578  N N1    . DC  I 5 96  ? 66.935  46.157  42.396  1.00 128.84 ?  22  DC  I N1    1 
ATOM 7579  C C2    . DC  I 5 96  ? 66.036  46.779  43.260  1.00 128.84 ?  22  DC  I C2    1 
ATOM 7580  O O2    . DC  I 5 96  ? 64.828  46.596  43.099  1.00 128.84 ?  22  DC  I O2    1 
ATOM 7581  N N3    . DC  I 5 96  ? 66.514  47.573  44.246  1.00 128.84 ?  22  DC  I N3    1 
ATOM 7582  C C4    . DC  I 5 96  ? 67.827  47.747  44.384  1.00 128.84 ?  22  DC  I C4    1 
ATOM 7583  N N4    . DC  I 5 96  ? 68.251  48.536  45.374  1.00 128.84 ?  22  DC  I N4    1 
ATOM 7584  C C5    . DC  I 5 96  ? 68.764  47.117  43.515  1.00 128.84 ?  22  DC  I C5    1 
ATOM 7585  C C6    . DC  I 5 96  ? 68.278  46.339  42.543  1.00 128.84 ?  22  DC  I C6    1 
ATOM 7586  P P     . DA  I 5 97  ? 65.632  45.273  37.142  1.00 122.94 ?  23  DA  I P     1 
ATOM 7587  O OP1   . DA  I 5 97  ? 65.045  44.573  35.980  1.00 122.94 ?  23  DA  I OP1   1 
ATOM 7588  O OP2   . DA  I 5 97  ? 66.858  46.079  36.955  1.00 122.94 -1 23  DA  I OP2   1 
ATOM 7589  O "O5'" . DA  I 5 97  ? 64.498  46.195  37.779  1.00 122.94 ?  23  DA  I "O5'" 1 
ATOM 7590  C "C5'" . DA  I 5 97  ? 63.329  45.591  38.314  1.00 122.94 ?  23  DA  I "C5'" 1 
ATOM 7591  C "C4'" . DA  I 5 97  ? 62.372  46.633  38.864  1.00 122.94 ?  23  DA  I "C4'" 1 
ATOM 7592  O "O4'" . DA  I 5 97  ? 62.894  47.173  40.100  1.00 122.94 ?  23  DA  I "O4'" 1 
ATOM 7593  C "C3'" . DA  I 5 97  ? 62.111  47.824  37.947  1.00 122.94 ?  23  DA  I "C3'" 1 
ATOM 7594  O "O3'" . DA  I 5 97  ? 60.731  48.119  37.945  1.00 122.94 ?  23  DA  I "O3'" 1 
ATOM 7595  C "C2'" . DA  I 5 97  ? 62.929  48.951  38.578  1.00 122.94 ?  23  DA  I "C2'" 1 
ATOM 7596  C "C1'" . DA  I 5 97  ? 62.892  48.580  40.051  1.00 122.94 ?  23  DA  I "C1'" 1 
ATOM 7597  N N9    . DA  I 5 97  ? 64.048  49.048  40.804  1.00 122.94 ?  23  DA  I N9    1 
ATOM 7598  C C8    . DA  I 5 97  ? 65.361  48.786  40.539  1.00 122.94 ?  23  DA  I C8    1 
ATOM 7599  N N7    . DA  I 5 97  ? 66.191  49.325  41.397  1.00 122.94 ?  23  DA  I N7    1 
ATOM 7600  C C5    . DA  I 5 97  ? 65.362  49.972  42.294  1.00 122.94 ?  23  DA  I C5    1 
ATOM 7601  C C6    . DA  I 5 97  ? 65.625  50.730  43.445  1.00 122.94 ?  23  DA  I C6    1 
ATOM 7602  N N6    . DA  I 5 97  ? 66.856  50.970  43.893  1.00 122.94 ?  23  DA  I N6    1 
ATOM 7603  N N1    . DA  I 5 97  ? 64.571  51.244  44.113  1.00 122.94 ?  23  DA  I N1    1 
ATOM 7604  C C2    . DA  I 5 97  ? 63.339  51.003  43.657  1.00 122.94 ?  23  DA  I C2    1 
ATOM 7605  N N3    . DA  I 5 97  ? 62.969  50.304  42.587  1.00 122.94 ?  23  DA  I N3    1 
ATOM 7606  C C4    . DA  I 5 97  ? 64.038  49.811  41.945  1.00 122.94 ?  23  DA  I C4    1 
ATOM 7607  P P     . DA  I 5 98  ? 60.109  49.069  36.812  1.00 118.61 ?  24  DA  I P     1 
ATOM 7608  O OP1   . DA  I 5 98  ? 59.010  48.329  36.154  1.00 118.61 ?  24  DA  I OP1   1 
ATOM 7609  O OP2   . DA  I 5 98  ? 61.231  49.599  36.007  1.00 118.61 -1 24  DA  I OP2   1 
ATOM 7610  O "O5'" . DA  I 5 98  ? 59.490  50.279  37.647  1.00 118.61 ?  24  DA  I "O5'" 1 
ATOM 7611  C "C5'" . DA  I 5 98  ? 59.356  50.163  39.059  1.00 118.61 ?  24  DA  I "C5'" 1 
ATOM 7612  C "C4'" . DA  I 5 98  ? 59.419  51.522  39.729  1.00 118.61 ?  24  DA  I "C4'" 1 
ATOM 7613  O "O4'" . DA  I 5 98  ? 60.684  51.668  40.434  1.00 118.61 ?  24  DA  I "O4'" 1 
ATOM 7614  C "C3'" . DA  I 5 98  ? 59.341  52.725  38.782  1.00 118.61 ?  24  DA  I "C3'" 1 
ATOM 7615  O "O3'" . DA  I 5 98  ? 58.669  53.780  39.430  1.00 118.61 ?  24  DA  I "O3'" 1 
ATOM 7616  C "C2'" . DA  I 5 98  ? 60.809  53.080  38.620  1.00 118.61 ?  24  DA  I "C2'" 1 
ATOM 7617  C "C1'" . DA  I 5 98  ? 61.243  52.900  40.057  1.00 118.61 ?  24  DA  I "C1'" 1 
ATOM 7618  N N9    . DA  I 5 98  ? 62.683  52.876  40.259  1.00 118.61 ?  24  DA  I N9    1 
ATOM 7619  C C8    . DA  I 5 98  ? 63.624  52.286  39.468  1.00 118.61 ?  24  DA  I C8    1 
ATOM 7620  N N7    . DA  I 5 98  ? 64.851  52.442  39.904  1.00 118.61 ?  24  DA  I N7    1 
ATOM 7621  C C5    . DA  I 5 98  ? 64.697  53.192  41.054  1.00 118.61 ?  24  DA  I C5    1 
ATOM 7622  C C6    . DA  I 5 98  ? 65.616  53.701  41.984  1.00 118.61 ?  24  DA  I C6    1 
ATOM 7623  N N6    . DA  I 5 98  ? 66.930  53.508  41.888  1.00 118.61 ?  24  DA  I N6    1 
ATOM 7624  N N1    . DA  I 5 98  ? 65.130  54.410  43.026  1.00 118.61 ?  24  DA  I N1    1 
ATOM 7625  C C2    . DA  I 5 98  ? 63.811  54.595  43.120  1.00 118.61 ?  24  DA  I C2    1 
ATOM 7626  N N3    . DA  I 5 98  ? 62.853  54.171  42.303  1.00 118.61 ?  24  DA  I N3    1 
ATOM 7627  C C4    . DA  I 5 98  ? 63.368  53.470  41.283  1.00 118.61 ?  24  DA  I C4    1 
ATOM 7628  P P     . DG  I 5 99  ? 57.111  54.063  39.175  1.00 113.58 ?  25  DG  I P     1 
ATOM 7629  O OP1   . DG  I 5 99  ? 56.348  52.914  39.709  1.00 113.58 ?  25  DG  I OP1   1 
ATOM 7630  O OP2   . DG  I 5 99  ? 56.941  54.470  37.763  1.00 113.58 -1 25  DG  I OP2   1 
ATOM 7631  O "O5'" . DG  I 5 99  ? 56.830  55.334  40.103  1.00 113.58 ?  25  DG  I "O5'" 1 
ATOM 7632  C "C5'" . DG  I 5 99  ? 57.308  55.341  41.449  1.00 113.58 ?  25  DG  I "C5'" 1 
ATOM 7633  C "C4'" . DG  I 5 99  ? 58.045  56.632  41.773  1.00 113.58 ?  25  DG  I "C4'" 1 
ATOM 7634  O "O4'" . DG  I 5 99  ? 59.484  56.410  41.755  1.00 113.58 ?  25  DG  I "O4'" 1 
ATOM 7635  C "C3'" . DG  I 5 99  ? 57.790  57.798  40.810  1.00 113.58 ?  25  DG  I "C3'" 1 
ATOM 7636  O "O3'" . DG  I 5 99  ? 57.705  59.006  41.546  1.00 113.58 ?  25  DG  I "O3'" 1 
ATOM 7637  C "C2'" . DG  I 5 99  ? 59.062  57.792  39.965  1.00 113.58 ?  25  DG  I "C2'" 1 
ATOM 7638  C "C1'" . DG  I 5 99  ? 60.076  57.464  41.043  1.00 113.58 ?  25  DG  I "C1'" 1 
ATOM 7639  N N9    . DG  I 5 99  ? 61.382  57.045  40.546  1.00 113.58 ?  25  DG  I N9    1 
ATOM 7640  C C8    . DG  I 5 99  ? 61.647  56.364  39.390  1.00 113.58 ?  25  DG  I C8    1 
ATOM 7641  N N7    . DG  I 5 99  ? 62.914  56.121  39.207  1.00 113.58 ?  25  DG  I N7    1 
ATOM 7642  C C5    . DG  I 5 99  ? 63.532  56.689  40.310  1.00 113.58 ?  25  DG  I C5    1 
ATOM 7643  C C6    . DG  I 5 99  ? 64.901  56.744  40.658  1.00 113.58 ?  25  DG  I C6    1 
ATOM 7644  O O6    . DG  I 5 99  ? 65.867  56.289  40.039  1.00 113.58 ?  25  DG  I O6    1 
ATOM 7645  N N1    . DG  I 5 99  ? 65.102  57.409  41.860  1.00 113.58 ?  25  DG  I N1    1 
ATOM 7646  C C2    . DG  I 5 99  ? 64.106  57.956  42.627  1.00 113.58 ?  25  DG  I C2    1 
ATOM 7647  N N2    . DG  I 5 99  ? 64.491  58.552  43.763  1.00 113.58 ?  25  DG  I N2    1 
ATOM 7648  N N3    . DG  I 5 99  ? 62.817  57.910  42.314  1.00 113.58 ?  25  DG  I N3    1 
ATOM 7649  C C4    . DG  I 5 99  ? 62.605  57.263  41.144  1.00 113.58 ?  25  DG  I C4    1 
ATOM 7650  P P     . DG  I 5 100 ? 56.325  59.535  42.177  1.00 110.46 ?  26  DG  I P     1 
ATOM 7651  O OP1   . DG  I 5 100 ? 55.338  58.436  42.237  1.00 110.46 ?  26  DG  I OP1   1 
ATOM 7652  O OP2   . DG  I 5 100 ? 55.983  60.779  41.457  1.00 110.46 -1 26  DG  I OP2   1 
ATOM 7653  O "O5'" . DG  I 5 100 ? 56.750  59.961  43.662  1.00 110.46 ?  26  DG  I "O5'" 1 
ATOM 7654  C "C5'" . DG  I 5 100 ? 58.024  59.551  44.173  1.00 110.46 ?  26  DG  I "C5'" 1 
ATOM 7655  C "C4'" . DG  I 5 100 ? 58.586  60.551  45.174  1.00 110.46 ?  26  DG  I "C4'" 1 
ATOM 7656  O "O4'" . DG  I 5 100 ? 59.974  60.815  44.873  1.00 110.46 ?  26  DG  I "O4'" 1 
ATOM 7657  C "C3'" . DG  I 5 100 ? 57.957  61.920  45.163  1.00 110.46 ?  26  DG  I "C3'" 1 
ATOM 7658  O "O3'" . DG  I 5 100 ? 58.268  62.563  46.391  1.00 110.46 ?  26  DG  I "O3'" 1 
ATOM 7659  C "C2'" . DG  I 5 100 ? 58.669  62.579  43.979  1.00 110.46 ?  26  DG  I "C2'" 1 
ATOM 7660  C "C1'" . DG  I 5 100 ? 60.073  61.972  44.054  1.00 110.46 ?  26  DG  I "C1'" 1 
ATOM 7661  N N9    . DG  I 5 100 ? 60.596  61.533  42.767  1.00 110.46 ?  26  DG  I N9    1 
ATOM 7662  C C8    . DG  I 5 100 ? 59.870  61.126  41.685  1.00 110.46 ?  26  DG  I C8    1 
ATOM 7663  N N7    . DG  I 5 100 ? 60.598  60.743  40.682  1.00 110.46 ?  26  DG  I N7    1 
ATOM 7664  C C5    . DG  I 5 100 ? 61.894  60.892  41.130  1.00 110.46 ?  26  DG  I C5    1 
ATOM 7665  C C6    . DG  I 5 100 ? 63.111  60.635  40.471  1.00 110.46 ?  26  DG  I C6    1 
ATOM 7666  O O6    . DG  I 5 100 ? 63.289  60.203  39.325  1.00 110.46 ?  26  DG  I O6    1 
ATOM 7667  N N1    . DG  I 5 100 ? 64.198  60.932  41.275  1.00 110.46 ?  26  DG  I N1    1 
ATOM 7668  C C2    . DG  I 5 100 ? 64.121  61.415  42.556  1.00 110.46 ?  26  DG  I C2    1 
ATOM 7669  N N2    . DG  I 5 100 ? 65.287  61.638  43.173  1.00 110.46 ?  26  DG  I N2    1 
ATOM 7670  N N3    . DG  I 5 100 ? 62.984  61.661  43.188  1.00 110.46 ?  26  DG  I N3    1 
ATOM 7671  C C4    . DG  I 5 100 ? 61.914  61.375  42.415  1.00 110.46 ?  26  DG  I C4    1 
ATOM 7672  P P     . DG  I 5 101 ? 57.983  64.127  46.607  1.00 105.84 ?  27  DG  I P     1 
ATOM 7673  O OP1   . DG  I 5 101 ? 57.694  64.313  48.044  1.00 105.84 ?  27  DG  I OP1   1 
ATOM 7674  O OP2   . DG  I 5 101 ? 57.004  64.575  45.594  1.00 105.84 -1 27  DG  I OP2   1 
ATOM 7675  O "O5'" . DG  I 5 101 ? 59.385  64.817  46.283  1.00 105.84 ?  27  DG  I "O5'" 1 
ATOM 7676  C "C5'" . DG  I 5 101 ? 60.537  64.481  47.047  1.00 105.84 ?  27  DG  I "C5'" 1 
ATOM 7677  C "C4'" . DG  I 5 101 ? 61.812  65.059  46.438  1.00 105.84 ?  27  DG  I "C4'" 1 
ATOM 7678  O "O4'" . DG  I 5 101 ? 62.040  64.505  45.119  1.00 105.84 ?  27  DG  I "O4'" 1 
ATOM 7679  C "C3'" . DG  I 5 101 ? 61.846  66.577  46.247  1.00 105.84 ?  27  DG  I "C3'" 1 
ATOM 7680  O "O3'" . DG  I 5 101 ? 63.173  67.022  46.428  1.00 105.84 ?  27  DG  I "O3'" 1 
ATOM 7681  C "C2'" . DG  I 5 101 ? 61.454  66.714  44.779  1.00 105.84 ?  27  DG  I "C2'" 1 
ATOM 7682  C "C1'" . DG  I 5 101 ? 62.265  65.567  44.219  1.00 105.84 ?  27  DG  I "C1'" 1 
ATOM 7683  N N9    . DG  I 5 101 ? 61.886  65.117  42.893  1.00 105.84 ?  27  DG  I N9    1 
ATOM 7684  C C8    . DG  I 5 101 ? 60.622  64.980  42.390  1.00 105.84 ?  27  DG  I C8    1 
ATOM 7685  N N7    . DG  I 5 101 ? 60.597  64.501  41.181  1.00 105.84 ?  27  DG  I N7    1 
ATOM 7686  C C5    . DG  I 5 101 ? 61.931  64.314  40.866  1.00 105.84 ?  27  DG  I C5    1 
ATOM 7687  C C6    . DG  I 5 101 ? 62.525  63.828  39.685  1.00 105.84 ?  27  DG  I C6    1 
ATOM 7688  O O6    . DG  I 5 101 ? 61.971  63.448  38.645  1.00 105.84 ?  27  DG  I O6    1 
ATOM 7689  N N1    . DG  I 5 101 ? 63.908  63.793  39.785  1.00 105.84 ?  27  DG  I N1    1 
ATOM 7690  C C2    . DG  I 5 101 ? 64.627  64.190  40.886  1.00 105.84 ?  27  DG  I C2    1 
ATOM 7691  N N2    . DG  I 5 101 ? 65.958  64.084  40.797  1.00 105.84 ?  27  DG  I N2    1 
ATOM 7692  N N3    . DG  I 5 101 ? 64.081  64.644  41.998  1.00 105.84 ?  27  DG  I N3    1 
ATOM 7693  C C4    . DG  I 5 101 ? 62.734  64.679  41.914  1.00 105.84 ?  27  DG  I C4    1 
ATOM 7694  P P     . DG  I 5 102 ? 63.688  67.574  47.843  1.00 98.49  ?  28  DG  I P     1 
ATOM 7695  O OP1   . DG  I 5 102 ? 63.302  66.633  48.912  1.00 98.49  ?  28  DG  I OP1   1 
ATOM 7696  O OP2   . DG  I 5 102 ? 63.263  68.984  47.918  1.00 98.49  -1 28  DG  I OP2   1 
ATOM 7697  O "O5'" . DG  I 5 102 ? 65.275  67.529  47.685  1.00 98.49  ?  28  DG  I "O5'" 1 
ATOM 7698  C "C5'" . DG  I 5 102 ? 65.847  66.583  46.798  1.00 98.49  ?  28  DG  I "C5'" 1 
ATOM 7699  C "C4'" . DG  I 5 102 ? 67.264  66.960  46.389  1.00 98.49  ?  28  DG  I "C4'" 1 
ATOM 7700  O "O4'" . DG  I 5 102 ? 67.381  66.902  44.952  1.00 98.49  ?  28  DG  I "O4'" 1 
ATOM 7701  C "C3'" . DG  I 5 102 ? 67.712  68.360  46.733  1.00 98.49  ?  28  DG  I "C3'" 1 
ATOM 7702  O "O3'" . DG  I 5 102 ? 69.134  68.394  46.722  1.00 98.49  ?  28  DG  I "O3'" 1 
ATOM 7703  C "C2'" . DG  I 5 102 ? 67.121  69.173  45.582  1.00 98.49  ?  28  DG  I "C2'" 1 
ATOM 7704  C "C1'" . DG  I 5 102 ? 67.195  68.196  44.406  1.00 98.49  ?  28  DG  I "C1'" 1 
ATOM 7705  N N9    . DG  I 5 102 ? 65.981  68.160  43.601  1.00 98.49  ?  28  DG  I N9    1 
ATOM 7706  C C8    . DG  I 5 102 ? 64.710  68.432  44.023  1.00 98.49  ?  28  DG  I C8    1 
ATOM 7707  N N7    . DG  I 5 102 ? 63.815  68.298  43.091  1.00 98.49  ?  28  DG  I N7    1 
ATOM 7708  C C5    . DG  I 5 102 ? 64.530  67.886  41.987  1.00 98.49  ?  28  DG  I C5    1 
ATOM 7709  C C6    . DG  I 5 102 ? 64.083  67.582  40.686  1.00 98.49  ?  28  DG  I C6    1 
ATOM 7710  O O6    . DG  I 5 102 ? 62.926  67.607  40.249  1.00 98.49  ?  28  DG  I O6    1 
ATOM 7711  N N1    . DG  I 5 102 ? 65.132  67.218  39.856  1.00 98.49  ?  28  DG  I N1    1 
ATOM 7712  C C2    . DG  I 5 102 ? 66.452  67.160  40.240  1.00 98.49  ?  28  DG  I C2    1 
ATOM 7713  N N2    . DG  I 5 102 ? 67.330  66.784  39.298  1.00 98.49  ?  28  DG  I N2    1 
ATOM 7714  N N3    . DG  I 5 102 ? 66.882  67.442  41.462  1.00 98.49  ?  28  DG  I N3    1 
ATOM 7715  C C4    . DG  I 5 102 ? 65.868  67.795  42.279  1.00 98.49  ?  28  DG  I C4    1 
ATOM 7716  P P     . DA  I 5 103 ? 69.937  69.783  46.768  1.00 104.43 ?  29  DA  I P     1 
ATOM 7717  O OP1   . DA  I 5 103 ? 71.194  69.519  47.497  1.00 104.43 ?  29  DA  I OP1   1 
ATOM 7718  O OP2   . DA  I 5 103 ? 69.030  70.846  47.244  1.00 104.43 -1 29  DA  I OP2   1 
ATOM 7719  O "O5'" . DA  I 5 103 ? 70.297  70.073  45.238  1.00 104.43 ?  29  DA  I "O5'" 1 
ATOM 7720  C "C5'" . DA  I 5 103 ? 71.279  69.281  44.584  1.00 104.43 ?  29  DA  I "C5'" 1 
ATOM 7721  C "C4'" . DA  I 5 103 ? 71.487  69.726  43.143  1.00 104.43 ?  29  DA  I "C4'" 1 
ATOM 7722  O "O4'" . DA  I 5 103 ? 70.254  69.582  42.399  1.00 104.43 ?  29  DA  I "O4'" 1 
ATOM 7723  C "C3'" . DA  I 5 103 ? 71.932  71.172  42.954  1.00 104.43 ?  29  DA  I "C3'" 1 
ATOM 7724  O "O3'" . DA  I 5 103 ? 72.913  71.233  41.938  1.00 104.43 ?  29  DA  I "O3'" 1 
ATOM 7725  C "C2'" . DA  I 5 103 ? 70.649  71.884  42.533  1.00 104.43 ?  29  DA  I "C2'" 1 
ATOM 7726  C "C1'" . DA  I 5 103 ? 69.934  70.795  41.755  1.00 104.43 ?  29  DA  I "C1'" 1 
ATOM 7727  N N9    . DA  I 5 103 ? 68.486  70.920  41.768  1.00 104.43 ?  29  DA  I N9    1 
ATOM 7728  C C8    . DA  I 5 103 ? 67.701  71.216  42.836  1.00 104.43 ?  29  DA  I C8    1 
ATOM 7729  N N7    . DA  I 5 103 ? 66.423  71.239  42.565  1.00 104.43 ?  29  DA  I N7    1 
ATOM 7730  C C5    . DA  I 5 103 ? 66.369  70.921  41.227  1.00 104.43 ?  29  DA  I C5    1 
ATOM 7731  C C6    . DA  I 5 103 ? 65.299  70.771  40.334  1.00 104.43 ?  29  DA  I C6    1 
ATOM 7732  N N6    . DA  I 5 103 ? 64.023  70.942  40.684  1.00 104.43 ?  29  DA  I N6    1 
ATOM 7733  N N1    . DA  I 5 103 ? 65.589  70.446  39.060  1.00 104.43 ?  29  DA  I N1    1 
ATOM 7734  C C2    . DA  I 5 103 ? 66.867  70.273  38.716  1.00 104.43 ?  29  DA  I C2    1 
ATOM 7735  N N3    . DA  I 5 103 ? 67.954  70.386  39.468  1.00 104.43 ?  29  DA  I N3    1 
ATOM 7736  C C4    . DA  I 5 103 ? 67.632  70.712  40.722  1.00 104.43 ?  29  DA  I C4    1 
ATOM 7737  P P     . DT  I 5 104 ? 73.671  72.611  41.626  1.00 114.43 ?  30  DT  I P     1 
ATOM 7738  O OP1   . DT  I 5 104 ? 75.104  72.301  41.435  1.00 114.43 ?  30  DT  I OP1   1 
ATOM 7739  O OP2   . DT  I 5 104 ? 73.261  73.589  42.656  1.00 114.43 -1 30  DT  I OP2   1 
ATOM 7740  O "O5'" . DT  I 5 104 ? 73.055  73.078  40.228  1.00 114.43 ?  30  DT  I "O5'" 1 
ATOM 7741  C "C5'" . DT  I 5 104 ? 73.215  72.263  39.076  1.00 114.43 ?  30  DT  I "C5'" 1 
ATOM 7742  C "C4'" . DT  I 5 104 ? 72.419  72.821  37.914  1.00 114.43 ?  30  DT  I "C4'" 1 
ATOM 7743  O "O4'" . DT  I 5 104 ? 71.013  72.629  38.167  1.00 114.43 ?  30  DT  I "O4'" 1 
ATOM 7744  C "C3'" . DT  I 5 104 ? 72.610  74.319  37.678  1.00 114.43 ?  30  DT  I "C3'" 1 
ATOM 7745  O "O3'" . DT  I 5 104 ? 73.207  74.549  36.416  1.00 114.43 ?  30  DT  I "O3'" 1 
ATOM 7746  C "C2'" . DT  I 5 104 ? 71.201  74.908  37.743  1.00 114.43 ?  30  DT  I "C2'" 1 
ATOM 7747  C "C1'" . DT  I 5 104 ? 70.300  73.694  37.609  1.00 114.43 ?  30  DT  I "C1'" 1 
ATOM 7748  N N1    . DT  I 5 104 ? 69.023  73.839  38.351  1.00 114.43 ?  30  DT  I N1    1 
ATOM 7749  C C2    . DT  I 5 104 ? 67.837  73.760  37.671  1.00 114.43 ?  30  DT  I C2    1 
ATOM 7750  O O2    . DT  I 5 104 ? 67.767  73.566  36.474  1.00 114.43 ?  30  DT  I O2    1 
ATOM 7751  N N3    . DT  I 5 104 ? 66.723  73.910  38.446  1.00 114.43 ?  30  DT  I N3    1 
ATOM 7752  C C4    . DT  I 5 104 ? 66.679  74.129  39.802  1.00 114.43 ?  30  DT  I C4    1 
ATOM 7753  O O4    . DT  I 5 104 ? 65.626  74.254  40.411  1.00 114.43 ?  30  DT  I O4    1 
ATOM 7754  C C5    . DT  I 5 104 ? 67.957  74.206  40.452  1.00 114.43 ?  30  DT  I C5    1 
ATOM 7755  C C7    . DT  I 5 104 ? 68.035  74.463  41.921  1.00 114.43 ?  30  DT  I C7    1 
ATOM 7756  C C6    . DT  I 5 104 ? 69.054  74.049  39.707  1.00 114.43 ?  30  DT  I C6    1 
ATOM 7757  P P     . DT  I 5 105 ? 73.651  76.037  36.002  1.00 123.68 ?  31  DT  I P     1 
ATOM 7758  O OP1   . DT  I 5 105 ? 74.835  75.940  35.120  1.00 123.68 ?  31  DT  I OP1   1 
ATOM 7759  O OP2   . DT  I 5 105 ? 73.717  76.838  37.242  1.00 123.68 -1 31  DT  I OP2   1 
ATOM 7760  O "O5'" . DT  I 5 105 ? 72.422  76.578  35.140  1.00 123.68 ?  31  DT  I "O5'" 1 
ATOM 7761  C "C5'" . DT  I 5 105 ? 71.960  75.835  34.021  1.00 123.68 ?  31  DT  I "C5'" 1 
ATOM 7762  C "C4'" . DT  I 5 105 ? 70.751  76.499  33.386  1.00 123.68 ?  31  DT  I "C4'" 1 
ATOM 7763  O "O4'" . DT  I 5 105 ? 69.587  76.315  34.235  1.00 123.68 ?  31  DT  I "O4'" 1 
ATOM 7764  C "C3'" . DT  I 5 105 ? 70.880  78.008  33.159  1.00 123.68 ?  31  DT  I "C3'" 1 
ATOM 7765  O "O3'" . DT  I 5 105 ? 70.396  78.335  31.863  1.00 123.68 ?  31  DT  I "O3'" 1 
ATOM 7766  C "C2'" . DT  I 5 105 ? 69.996  78.602  34.256  1.00 123.68 ?  31  DT  I "C2'" 1 
ATOM 7767  C "C1'" . DT  I 5 105 ? 68.917  77.545  34.368  1.00 123.68 ?  31  DT  I "C1'" 1 
ATOM 7768  N N1    . DT  I 5 105 ? 68.206  77.557  35.667  1.00 123.68 ?  31  DT  I N1    1 
ATOM 7769  C C2    . DT  I 5 105 ? 66.838  77.581  35.675  1.00 123.68 ?  31  DT  I C2    1 
ATOM 7770  O O2    . DT  I 5 105 ? 66.167  77.600  34.662  1.00 123.68 ?  31  DT  I O2    1 
ATOM 7771  N N3    . DT  I 5 105 ? 66.276  77.593  36.917  1.00 123.68 ?  31  DT  I N3    1 
ATOM 7772  C C4    . DT  I 5 105 ? 66.929  77.571  38.129  1.00 123.68 ?  31  DT  I C4    1 
ATOM 7773  O O4    . DT  I 5 105 ? 66.327  77.585  39.196  1.00 123.68 ?  31  DT  I O4    1 
ATOM 7774  C C5    . DT  I 5 105 ? 68.363  77.548  38.053  1.00 123.68 ?  31  DT  I C5    1 
ATOM 7775  C C7    . DT  I 5 105 ? 69.178  77.545  39.309  1.00 123.68 ?  31  DT  I C7    1 
ATOM 7776  C C6    . DT  I 5 105 ? 68.929  77.543  36.838  1.00 123.68 ?  31  DT  I C6    1 
ATOM 7777  P P     . DA  I 5 106 ? 70.618  79.801  31.243  1.00 120.71 ?  32  DA  I P     1 
ATOM 7778  O OP1   . DA  I 5 106 ? 71.568  79.660  30.120  1.00 120.71 ?  32  DA  I OP1   1 
ATOM 7779  O OP2   . DA  I 5 106 ? 70.922  80.753  32.332  1.00 120.71 -1 32  DA  I OP2   1 
ATOM 7780  O "O5'" . DA  I 5 106 ? 69.178  80.175  30.659  1.00 120.71 ?  32  DA  I "O5'" 1 
ATOM 7781  C "C5'" . DA  I 5 106 ? 68.014  79.732  31.339  1.00 120.71 ?  32  DA  I "C5'" 1 
ATOM 7782  C "C4'" . DA  I 5 106 ? 66.776  80.424  30.811  1.00 120.71 ?  32  DA  I "C4'" 1 
ATOM 7783  O "O4'" . DA  I 5 106 ? 65.754  80.399  31.832  1.00 120.71 ?  32  DA  I "O4'" 1 
ATOM 7784  C "C3'" . DA  I 5 106 ? 66.943  81.895  30.527  1.00 120.71 ?  32  DA  I "C3'" 1 
ATOM 7785  O "O3'" . DA  I 5 106 ? 65.821  82.336  29.786  1.00 120.71 ?  32  DA  I "O3'" 1 
ATOM 7786  C "C2'" . DA  I 5 106 ? 66.918  82.448  31.943  1.00 120.71 ?  32  DA  I "C2'" 1 
ATOM 7787  C "C1'" . DA  I 5 106 ? 65.790  81.621  32.555  1.00 120.71 ?  32  DA  I "C1'" 1 
ATOM 7788  N N9    . DA  I 5 106 ? 65.986  81.298  33.958  1.00 120.71 ?  32  DA  I N9    1 
ATOM 7789  C C8    . DA  I 5 106 ? 67.164  81.008  34.581  1.00 120.71 ?  32  DA  I C8    1 
ATOM 7790  N N7    . DA  I 5 106 ? 67.032  80.727  35.853  1.00 120.71 ?  32  DA  I N7    1 
ATOM 7791  C C5    . DA  I 5 106 ? 65.672  80.823  36.071  1.00 120.71 ?  32  DA  I C5    1 
ATOM 7792  C C6    . DA  I 5 106 ? 64.882  80.644  37.217  1.00 120.71 ?  32  DA  I C6    1 
ATOM 7793  N N6    . DA  I 5 106 ? 65.385  80.310  38.404  1.00 120.71 ?  32  DA  I N6    1 
ATOM 7794  N N1    . DA  I 5 106 ? 63.551  80.830  37.098  1.00 120.71 ?  32  DA  I N1    1 
ATOM 7795  C C2    . DA  I 5 106 ? 63.051  81.160  35.905  1.00 120.71 ?  32  DA  I C2    1 
ATOM 7796  N N3    . DA  I 5 106 ? 63.695  81.361  34.759  1.00 120.71 ?  32  DA  I N3    1 
ATOM 7797  C C4    . DA  I 5 106 ? 65.013  81.174  34.914  1.00 120.71 ?  32  DA  I C4    1 
ATOM 7798  P P     . DC  I 5 107 ? 65.747  83.822  29.186  1.00 119.16 ?  33  DC  I P     1 
ATOM 7799  O OP1   . DC  I 5 107 ? 66.013  83.715  27.736  1.00 119.16 ?  33  DC  I OP1   1 
ATOM 7800  O OP2   . DC  I 5 107 ? 66.561  84.737  30.013  1.00 119.16 -1 33  DC  I OP2   1 
ATOM 7801  O "O5'" . DC  I 5 107 ? 64.213  84.214  29.390  1.00 119.16 ?  33  DC  I "O5'" 1 
ATOM 7802  C "C5'" . DC  I 5 107 ? 63.477  83.646  30.468  1.00 119.16 ?  33  DC  I "C5'" 1 
ATOM 7803  C "C4'" . DC  I 5 107 ? 62.629  84.699  31.144  1.00 119.16 ?  33  DC  I "C4'" 1 
ATOM 7804  O "O4'" . DC  I 5 107 ? 62.696  84.525  32.587  1.00 119.16 ?  33  DC  I "O4'" 1 
ATOM 7805  C "C3'" . DC  I 5 107 ? 63.093  86.122  30.900  1.00 119.16 ?  33  DC  I "C3'" 1 
ATOM 7806  O "O3'" . DC  I 5 107 ? 62.006  87.002  31.062  1.00 119.16 ?  33  DC  I "O3'" 1 
ATOM 7807  C "C2'" . DC  I 5 107 ? 64.110  86.298  32.013  1.00 119.16 ?  33  DC  I "C2'" 1 
ATOM 7808  C "C1'" . DC  I 5 107 ? 63.378  85.627  33.164  1.00 119.16 ?  33  DC  I "C1'" 1 
ATOM 7809  N N1    . DC  I 5 107 ? 64.270  85.118  34.253  1.00 119.16 ?  33  DC  I N1    1 
ATOM 7810  C C2    . DC  I 5 107 ? 63.709  84.733  35.469  1.00 119.16 ?  33  DC  I C2    1 
ATOM 7811  O O2    . DC  I 5 107 ? 62.493  84.845  35.634  1.00 119.16 ?  33  DC  I O2    1 
ATOM 7812  N N3    . DC  I 5 107 ? 64.515  84.275  36.452  1.00 119.16 ?  33  DC  I N3    1 
ATOM 7813  C C4    . DC  I 5 107 ? 65.827  84.177  36.244  1.00 119.16 ?  33  DC  I C4    1 
ATOM 7814  N N4    . DC  I 5 107 ? 66.580  83.713  37.244  1.00 119.16 ?  33  DC  I N4    1 
ATOM 7815  C C5    . DC  I 5 107 ? 66.421  84.558  35.009  1.00 119.16 ?  33  DC  I C5    1 
ATOM 7816  C C6    . DC  I 5 107 ? 65.613  85.021  34.051  1.00 119.16 ?  33  DC  I C6    1 
ATOM 7817  P P     . DT  I 5 108 ? 61.919  88.350  30.197  1.00 115.96 ?  34  DT  I P     1 
ATOM 7818  O OP1   . DT  I 5 108 ? 61.380  87.998  28.866  1.00 115.96 ?  34  DT  I OP1   1 
ATOM 7819  O OP2   . DT  I 5 108 ? 63.223  89.038  30.308  1.00 115.96 -1 34  DT  I OP2   1 
ATOM 7820  O "O5'" . DT  I 5 108 ? 60.831  89.216  30.981  1.00 115.96 ?  34  DT  I "O5'" 1 
ATOM 7821  C "C5'" . DT  I 5 108 ? 59.647  88.588  31.456  1.00 115.96 ?  34  DT  I "C5'" 1 
ATOM 7822  C "C4'" . DT  I 5 108 ? 59.436  88.838  32.943  1.00 115.96 ?  34  DT  I "C4'" 1 
ATOM 7823  O "O4'" . DT  I 5 108 ? 60.530  88.273  33.721  1.00 115.96 ?  34  DT  I "O4'" 1 
ATOM 7824  C "C3'" . DT  I 5 108 ? 59.346  90.304  33.363  1.00 115.96 ?  34  DT  I "C3'" 1 
ATOM 7825  O "O3'" . DT  I 5 108 ? 58.367  90.419  34.375  1.00 115.96 ?  34  DT  I "O3'" 1 
ATOM 7826  C "C2'" . DT  I 5 108 ? 60.741  90.560  33.927  1.00 115.96 ?  34  DT  I "C2'" 1 
ATOM 7827  C "C1'" . DT  I 5 108 ? 60.968  89.246  34.645  1.00 115.96 ?  34  DT  I "C1'" 1 
ATOM 7828  N N1    . DT  I 5 108 ? 62.390  88.952  35.018  1.00 115.96 ?  34  DT  I N1    1 
ATOM 7829  C C2    . DT  I 5 108 ? 62.657  88.410  36.255  1.00 115.96 ?  34  DT  I C2    1 
ATOM 7830  O O2    . DT  I 5 108 ? 61.794  88.171  37.077  1.00 115.96 ?  34  DT  I O2    1 
ATOM 7831  N N3    . DT  I 5 108 ? 63.979  88.157  36.500  1.00 115.96 ?  34  DT  I N3    1 
ATOM 7832  C C4    . DT  I 5 108 ? 65.039  88.383  35.646  1.00 115.96 ?  34  DT  I C4    1 
ATOM 7833  O O4    . DT  I 5 108 ? 66.195  88.122  35.952  1.00 115.96 ?  34  DT  I O4    1 
ATOM 7834  C C5    . DT  I 5 108 ? 64.693  88.948  34.366  1.00 115.96 ?  34  DT  I C5    1 
ATOM 7835  C C7    . DT  I 5 108 ? 65.768  89.243  33.363  1.00 115.96 ?  34  DT  I C7    1 
ATOM 7836  C C6    . DT  I 5 108 ? 63.399  89.201  34.115  1.00 115.96 ?  34  DT  I C6    1 
ATOM 7837  P P     . DC  I 5 109 ? 57.430  91.717  34.484  1.00 111.78 ?  35  DC  I P     1 
ATOM 7838  O OP1   . DC  I 5 109 ? 56.408  91.626  33.419  1.00 111.78 ?  35  DC  I OP1   1 
ATOM 7839  O OP2   . DC  I 5 109 ? 58.305  92.907  34.566  1.00 111.78 -1 35  DC  I OP2   1 
ATOM 7840  O "O5'" . DC  I 5 109 ? 56.712  91.526  35.898  1.00 111.78 ?  35  DC  I "O5'" 1 
ATOM 7841  C "C5'" . DC  I 5 109 ? 57.233  90.576  36.830  1.00 111.78 ?  35  DC  I "C5'" 1 
ATOM 7842  C "C4'" . DC  I 5 109 ? 57.721  91.255  38.098  1.00 111.78 ?  35  DC  I "C4'" 1 
ATOM 7843  O "O4'" . DC  I 5 109 ? 59.133  90.962  38.303  1.00 111.78 ?  35  DC  I "O4'" 1 
ATOM 7844  C "C3'" . DC  I 5 109 ? 57.629  92.781  38.095  1.00 111.78 ?  35  DC  I "C3'" 1 
ATOM 7845  O "O3'" . DC  I 5 109 ? 57.498  93.254  39.434  1.00 111.78 ?  35  DC  I "O3'" 1 
ATOM 7846  C "C2'" . DC  I 5 109 ? 59.002  93.142  37.558  1.00 111.78 ?  35  DC  I "C2'" 1 
ATOM 7847  C "C1'" . DC  I 5 109 ? 59.823  92.187  38.400  1.00 111.78 ?  35  DC  I "C1'" 1 
ATOM 7848  N N1    . DC  I 5 109 ? 61.229  92.002  37.959  1.00 111.78 ?  35  DC  I N1    1 
ATOM 7849  C C2    . DC  I 5 109 ? 62.135  91.390  38.822  1.00 111.78 ?  35  DC  I C2    1 
ATOM 7850  O O2    . DC  I 5 109 ? 61.751  91.017  39.932  1.00 111.78 ?  35  DC  I O2    1 
ATOM 7851  N N3    . DC  I 5 109 ? 63.416  91.230  38.425  1.00 111.78 ?  35  DC  I N3    1 
ATOM 7852  C C4    . DC  I 5 109 ? 63.796  91.648  37.221  1.00 111.78 ?  35  DC  I C4    1 
ATOM 7853  N N4    . DC  I 5 109 ? 65.070  91.463  36.873  1.00 111.78 ?  35  DC  I N4    1 
ATOM 7854  C C5    . DC  I 5 109 ? 62.888  92.278  36.326  1.00 111.78 ?  35  DC  I C5    1 
ATOM 7855  C C6    . DC  I 5 109 ? 61.628  92.443  36.739  1.00 111.78 ?  35  DC  I C6    1 
ATOM 7856  P P     . DC  I 5 110 ? 56.071  93.341  40.173  1.00 109.55 ?  36  DC  I P     1 
ATOM 7857  O OP1   . DC  I 5 110 ? 55.043  92.622  39.390  1.00 109.55 ?  36  DC  I OP1   1 
ATOM 7858  O OP2   . DC  I 5 110 ? 55.858  94.768  40.499  1.00 109.55 -1 36  DC  I OP2   1 
ATOM 7859  O "O5'" . DC  I 5 110 ? 56.330  92.572  41.556  1.00 109.55 ?  36  DC  I "O5'" 1 
ATOM 7860  C "C5'" . DC  I 5 110 ? 57.593  91.925  41.785  1.00 109.55 ?  36  DC  I "C5'" 1 
ATOM 7861  C "C4'" . DC  I 5 110 ? 58.326  92.509  42.987  1.00 109.55 ?  36  DC  I "C4'" 1 
ATOM 7862  O "O4'" . DC  I 5 110 ? 59.697  92.822  42.615  1.00 109.55 ?  36  DC  I "O4'" 1 
ATOM 7863  C "C3'" . DC  I 5 110 ? 57.775  93.819  43.517  1.00 109.55 ?  36  DC  I "C3'" 1 
ATOM 7864  O "O3'" . DC  I 5 110 ? 58.255  94.026  44.845  1.00 109.55 ?  36  DC  I "O3'" 1 
ATOM 7865  C "C2'" . DC  I 5 110 ? 58.448  94.792  42.566  1.00 109.55 ?  36  DC  I "C2'" 1 
ATOM 7866  C "C1'" . DC  I 5 110 ? 59.863  94.229  42.596  1.00 109.55 ?  36  DC  I "C1'" 1 
ATOM 7867  N N1    . DC  I 5 110 ? 60.699  94.585  41.417  1.00 109.55 ?  36  DC  I N1    1 
ATOM 7868  C C2    . DC  I 5 110 ? 62.050  94.228  41.400  1.00 109.55 ?  36  DC  I C2    1 
ATOM 7869  O O2    . DC  I 5 110 ? 62.534  93.645  42.371  1.00 109.55 ?  36  DC  I O2    1 
ATOM 7870  N N3    . DC  I 5 110 ? 62.798  94.541  40.318  1.00 109.55 ?  36  DC  I N3    1 
ATOM 7871  C C4    . DC  I 5 110 ? 62.247  95.172  39.289  1.00 109.55 ?  36  DC  I C4    1 
ATOM 7872  N N4    . DC  I 5 110 ? 63.024  95.458  38.242  1.00 109.55 ?  36  DC  I N4    1 
ATOM 7873  C C5    . DC  I 5 110 ? 60.877  95.551  39.288  1.00 109.55 ?  36  DC  I C5    1 
ATOM 7874  C C6    . DC  I 5 110 ? 60.144  95.232  40.357  1.00 109.55 ?  36  DC  I C6    1 
ATOM 7875  P P     . DC  I 5 111 ? 57.422  93.542  46.134  1.00 101.39 ?  37  DC  I P     1 
ATOM 7876  O OP1   . DC  I 5 111 ? 56.693  92.293  45.827  1.00 101.39 ?  37  DC  I OP1   1 
ATOM 7877  O OP2   . DC  I 5 111 ? 56.668  94.713  46.627  1.00 101.39 -1 37  DC  I OP2   1 
ATOM 7878  O "O5'" . DC  I 5 111 ? 58.567  93.221  47.208  1.00 101.39 ?  37  DC  I "O5'" 1 
ATOM 7879  C "C5'" . DC  I 5 111 ? 59.850  92.773  46.761  1.00 101.39 ?  37  DC  I "C5'" 1 
ATOM 7880  C "C4'" . DC  I 5 111 ? 60.992  93.526  47.436  1.00 101.39 ?  37  DC  I "C4'" 1 
ATOM 7881  O "O4'" . DC  I 5 111 ? 61.743  94.277  46.445  1.00 101.39 ?  37  DC  I "O4'" 1 
ATOM 7882  C "C3'" . DC  I 5 111 ? 60.593  94.551  48.481  1.00 101.39 ?  37  DC  I "C3'" 1 
ATOM 7883  O "O3'" . DC  I 5 111 ? 61.662  94.716  49.391  1.00 101.39 ?  37  DC  I "O3'" 1 
ATOM 7884  C "C2'" . DC  I 5 111 ? 60.423  95.798  47.632  1.00 101.39 ?  37  DC  I "C2'" 1 
ATOM 7885  C "C1'" . DC  I 5 111 ? 61.616  95.667  46.699  1.00 101.39 ?  37  DC  I "C1'" 1 
ATOM 7886  N N1    . DC  I 5 111 ? 61.442  96.353  45.394  1.00 101.39 ?  37  DC  I N1    1 
ATOM 7887  C C2    . DC  I 5 111 ? 62.492  96.356  44.481  1.00 101.39 ?  37  DC  I C2    1 
ATOM 7888  O O2    . DC  I 5 111 ? 63.559  95.826  44.787  1.00 101.39 ?  37  DC  I O2    1 
ATOM 7889  N N3    . DC  I 5 111 ? 62.324  96.964  43.289  1.00 101.39 ?  37  DC  I N3    1 
ATOM 7890  C C4    . DC  I 5 111 ? 61.165  97.540  42.991  1.00 101.39 ?  37  DC  I C4    1 
ATOM 7891  N N4    . DC  I 5 111 ? 61.051  98.123  41.796  1.00 101.39 ?  37  DC  I N4    1 
ATOM 7892  C C5    . DC  I 5 111 ? 60.079  97.559  43.910  1.00 101.39 ?  37  DC  I C5    1 
ATOM 7893  C C6    . DC  I 5 111 ? 60.253  96.940  45.081  1.00 101.39 ?  37  DC  I C6    1 
ATOM 7894  P P     . DT  I 5 112 ? 61.379  94.862  50.962  1.00 88.72  ?  38  DT  I P     1 
ATOM 7895  O OP1   . DT  I 5 112 ? 60.943  93.542  51.461  1.00 88.72  ?  38  DT  I OP1   1 
ATOM 7896  O OP2   . DT  I 5 112 ? 60.522  96.050  51.154  1.00 88.72  -1 38  DT  I OP2   1 
ATOM 7897  O "O5'" . DT  I 5 112 ? 62.812  95.195  51.573  1.00 88.72  ?  38  DT  I "O5'" 1 
ATOM 7898  C "C5'" . DT  I 5 112 ? 63.919  94.396  51.230  1.00 88.72  ?  38  DT  I "C5'" 1 
ATOM 7899  C "C4'" . DT  I 5 112 ? 65.030  95.240  50.643  1.00 88.72  ?  38  DT  I "C4'" 1 
ATOM 7900  O "O4'" . DT  I 5 112 ? 64.591  95.817  49.389  1.00 88.72  ?  38  DT  I "O4'" 1 
ATOM 7901  C "C3'" . DT  I 5 112 ? 65.492  96.417  51.511  1.00 88.72  ?  38  DT  I "C3'" 1 
ATOM 7902  O "O3'" . DT  I 5 112 ? 66.911  96.479  51.507  1.00 88.72  ?  38  DT  I "O3'" 1 
ATOM 7903  C "C2'" . DT  I 5 112 ? 64.883  97.622  50.799  1.00 88.72  ?  38  DT  I "C2'" 1 
ATOM 7904  C "C1'" . DT  I 5 112 ? 64.969  97.171  49.358  1.00 88.72  ?  38  DT  I "C1'" 1 
ATOM 7905  N N1    . DT  I 5 112 ? 64.050  97.885  48.438  1.00 88.72  ?  38  DT  I N1    1 
ATOM 7906  C C2    . DT  I 5 112 ? 64.453  98.134  47.150  1.00 88.72  ?  38  DT  I C2    1 
ATOM 7907  O O2    . DT  I 5 112 ? 65.540  97.809  46.719  1.00 88.72  ?  38  DT  I O2    1 
ATOM 7908  N N3    . DT  I 5 112 ? 63.535  98.784  46.378  1.00 88.72  ?  38  DT  I N3    1 
ATOM 7909  C C4    . DT  I 5 112 ? 62.273  99.189  46.757  1.00 88.72  ?  38  DT  I C4    1 
ATOM 7910  O O4    . DT  I 5 112 ? 61.518  99.774  45.995  1.00 88.72  ?  38  DT  I O4    1 
ATOM 7911  C C5    . DT  I 5 112 ? 61.917  98.908  48.122  1.00 88.72  ?  38  DT  I C5    1 
ATOM 7912  C C7    . DT  I 5 112 ? 60.572  99.313  48.645  1.00 88.72  ?  38  DT  I C7    1 
ATOM 7913  C C6    . DT  I 5 112 ? 62.810  98.268  48.886  1.00 88.72  ?  38  DT  I C6    1 
ATOM 7914  P P     . DA  I 5 113 ? 67.697  97.319  52.629  1.00 91.42  ?  39  DA  I P     1 
ATOM 7915  O OP1   . DA  I 5 113 ? 68.104  96.383  53.693  1.00 91.42  ?  39  DA  I OP1   1 
ATOM 7916  O OP2   . DA  I 5 113 ? 66.896  98.512  52.953  1.00 91.42  -1 39  DA  I OP2   1 
ATOM 7917  O "O5'" . DA  I 5 113 ? 69.015  97.803  51.876  1.00 91.42  ?  39  DA  I "O5'" 1 
ATOM 7918  C "C5'" . DA  I 5 113 ? 68.998  97.936  50.470  1.00 91.42  ?  39  DA  I "C5'" 1 
ATOM 7919  C "C4'" . DA  I 5 113 ? 70.082  98.882  49.991  1.00 91.42  ?  39  DA  I "C4'" 1 
ATOM 7920  O "O4'" . DA  I 5 113 ? 69.561  99.727  48.944  1.00 91.42  ?  39  DA  I "O4'" 1 
ATOM 7921  C "C3'" . DA  I 5 113 ? 70.589  99.860  51.019  1.00 91.42  ?  39  DA  I "C3'" 1 
ATOM 7922  O "O3'" . DA  I 5 113 ? 71.842  100.346 50.593  1.00 91.42  ?  39  DA  I "O3'" 1 
ATOM 7923  C "C2'" . DA  I 5 113 ? 69.512  100.945 50.972  1.00 91.42  ?  39  DA  I "C2'" 1 
ATOM 7924  C "C1'" . DA  I 5 113 ? 69.129  100.962 49.492  1.00 91.42  ?  39  DA  I "C1'" 1 
ATOM 7925  N N9    . DA  I 5 113 ? 67.699  101.061 49.240  1.00 91.42  ?  39  DA  I N9    1 
ATOM 7926  C C8    . DA  I 5 113 ? 66.701  100.461 49.943  1.00 91.42  ?  39  DA  I C8    1 
ATOM 7927  N N7    . DA  I 5 113 ? 65.508  100.684 49.462  1.00 91.42  ?  39  DA  I N7    1 
ATOM 7928  C C5    . DA  I 5 113 ? 65.740  101.479 48.363  1.00 91.42  ?  39  DA  I C5    1 
ATOM 7929  C C6    . DA  I 5 113 ? 64.878  102.061 47.424  1.00 91.42  ?  39  DA  I C6    1 
ATOM 7930  N N6    . DA  I 5 113 ? 63.558  101.919 47.467  1.00 91.42  ?  39  DA  I N6    1 
ATOM 7931  N N1    . DA  I 5 113 ? 65.424  102.806 46.442  1.00 91.42  ?  39  DA  I N1    1 
ATOM 7932  C C2    . DA  I 5 113 ? 66.755  102.949 46.410  1.00 91.42  ?  39  DA  I C2    1 
ATOM 7933  N N3    . DA  I 5 113 ? 67.667  102.447 47.243  1.00 91.42  ?  39  DA  I N3    1 
ATOM 7934  C C4    . DA  I 5 113 ? 67.086  101.716 48.204  1.00 91.42  ?  39  DA  I C4    1 
ATOM 7935  P P     . DG  I 5 114 ? 72.586  101.506 51.408  1.00 102.58 ?  40  DG  I P     1 
ATOM 7936  O OP1   . DG  I 5 114 ? 74.035  101.223 51.345  1.00 102.58 ?  40  DG  I OP1   1 
ATOM 7937  O OP2   . DG  I 5 114 ? 71.922  101.639 52.720  1.00 102.58 -1 40  DG  I OP2   1 
ATOM 7938  O "O5'" . DG  I 5 114 ? 72.266  102.822 50.562  1.00 102.58 ?  40  DG  I "O5'" 1 
ATOM 7939  C "C5'" . DG  I 5 114 ? 72.360  102.795 49.139  1.00 102.58 ?  40  DG  I "C5'" 1 
ATOM 7940  C "C4'" . DG  I 5 114 ? 72.633  104.182 48.565  1.00 102.58 ?  40  DG  I "C4'" 1 
ATOM 7941  O "O4'" . DG  I 5 114 ? 71.427  104.730 47.996  1.00 102.58 ?  40  DG  I "O4'" 1 
ATOM 7942  C "C3'" . DG  I 5 114 ? 73.135  105.222 49.550  1.00 102.58 ?  40  DG  I "C3'" 1 
ATOM 7943  O "O3'" . DG  I 5 114 ? 74.033  106.105 48.902  1.00 102.58 ?  40  DG  I "O3'" 1 
ATOM 7944  C "C2'" . DG  I 5 114 ? 71.863  105.948 49.997  1.00 102.58 ?  40  DG  I "C2'" 1 
ATOM 7945  C "C1'" . DG  I 5 114 ? 70.879  105.714 48.850  1.00 102.58 ?  40  DG  I "C1'" 1 
ATOM 7946  N N9    . DG  I 5 114 ? 69.577  105.238 49.293  1.00 102.58 ?  40  DG  I N9    1 
ATOM 7947  C C8    . DG  I 5 114 ? 69.321  104.371 50.321  1.00 102.58 ?  40  DG  I C8    1 
ATOM 7948  N N7    . DG  I 5 114 ? 68.055  104.114 50.482  1.00 102.58 ?  40  DG  I N7    1 
ATOM 7949  C C5    . DG  I 5 114 ? 67.434  104.844 49.483  1.00 102.58 ?  40  DG  I C5    1 
ATOM 7950  C C6    . DG  I 5 114 ? 66.067  104.951 49.151  1.00 102.58 ?  40  DG  I C6    1 
ATOM 7951  O O6    . DG  I 5 114 ? 65.095  104.418 49.702  1.00 102.58 ?  40  DG  I O6    1 
ATOM 7952  N N1    . DG  I 5 114 ? 65.866  105.803 48.068  1.00 102.58 ?  40  DG  I N1    1 
ATOM 7953  C C2    . DG  I 5 114 ? 66.867  106.454 47.386  1.00 102.58 ?  40  DG  I C2    1 
ATOM 7954  N N2    . DG  I 5 114 ? 66.489  107.232 46.357  1.00 102.58 ?  40  DG  I N2    1 
ATOM 7955  N N3    . DG  I 5 114 ? 68.151  106.355 47.688  1.00 102.58 ?  40  DG  I N3    1 
ATOM 7956  C C4    . DG  I 5 114 ? 68.359  105.538 48.741  1.00 102.58 ?  40  DG  I C4    1 
ATOM 7957  P P     . DT  I 5 115 ? 74.722  107.300 49.725  1.00 106.72 ?  41  DT  I P     1 
ATOM 7958  O OP1   . DT  I 5 115 ? 76.061  107.540 49.146  1.00 106.72 ?  41  DT  I OP1   1 
ATOM 7959  O OP2   . DT  I 5 115 ? 74.595  106.966 51.160  1.00 106.72 -1 41  DT  I OP2   1 
ATOM 7960  O "O5'" . DT  I 5 115 ? 73.784  108.565 49.430  1.00 106.72 ?  41  DT  I "O5'" 1 
ATOM 7961  C "C5'" . DT  I 5 115 ? 73.421  108.882 48.091  1.00 106.72 ?  41  DT  I "C5'" 1 
ATOM 7962  C "C4'" . DT  I 5 115 ? 72.453  110.051 48.055  1.00 106.72 ?  41  DT  I "C4'" 1 
ATOM 7963  O "O4'" . DT  I 5 115 ? 71.097  109.568 48.215  1.00 106.72 ?  41  DT  I "O4'" 1 
ATOM 7964  C "C3'" . DT  I 5 115 ? 72.673  111.105 49.141  1.00 106.72 ?  41  DT  I "C3'" 1 
ATOM 7965  O "O3'" . DT  I 5 115 ? 72.769  112.393 48.553  1.00 106.72 ?  41  DT  I "O3'" 1 
ATOM 7966  C "C2'" . DT  I 5 115 ? 71.440  110.982 50.034  1.00 106.72 ?  41  DT  I "C2'" 1 
ATOM 7967  C "C1'" . DT  I 5 115 ? 70.397  110.420 49.083  1.00 106.72 ?  41  DT  I "C1'" 1 
ATOM 7968  N N1    . DT  I 5 115 ? 69.360  109.620 49.777  1.00 106.72 ?  41  DT  I N1    1 
ATOM 7969  C C2    . DT  I 5 115 ? 68.035  109.784 49.445  1.00 106.72 ?  41  DT  I C2    1 
ATOM 7970  O O2    . DT  I 5 115 ? 67.651  110.563 48.594  1.00 106.72 ?  41  DT  I O2    1 
ATOM 7971  N N3    . DT  I 5 115 ? 67.170  108.996 50.155  1.00 106.72 ?  41  DT  I N3    1 
ATOM 7972  C C4    . DT  I 5 115 ? 67.495  108.082 51.138  1.00 106.72 ?  41  DT  I C4    1 
ATOM 7973  O O4    . DT  I 5 115 ? 66.654  107.419 51.721  1.00 106.72 ?  41  DT  I O4    1 
ATOM 7974  C C5    . DT  I 5 115 ? 68.893  107.966 51.435  1.00 106.72 ?  41  DT  I C5    1 
ATOM 7975  C C7    . DT  I 5 115 ? 69.356  107.018 52.496  1.00 106.72 ?  41  DT  I C7    1 
ATOM 7976  C C6    . DT  I 5 115 ? 69.748  108.730 50.750  1.00 106.72 ?  41  DT  I C6    1 
ATOM 7977  P P     . DC  I 5 116 ? 72.983  113.696 49.470  1.00 107.81 ?  42  DC  I P     1 
ATOM 7978  O OP1   . DC  I 5 116 ? 73.874  114.617 48.732  1.00 107.81 ?  42  DC  I OP1   1 
ATOM 7979  O OP2   . DC  I 5 116 ? 73.352  113.255 50.832  1.00 107.81 -1 42  DC  I OP2   1 
ATOM 7980  O "O5'" . DC  I 5 116 ? 71.528  114.350 49.537  1.00 107.81 ?  42  DC  I "O5'" 1 
ATOM 7981  C "C5'" . DC  I 5 116 ? 70.829  114.623 48.334  1.00 107.81 ?  42  DC  I "C5'" 1 
ATOM 7982  C "C4'" . DC  I 5 116 ? 69.415  115.085 48.623  1.00 107.81 ?  42  DC  I "C4'" 1 
ATOM 7983  O "O4'" . DC  I 5 116 ? 68.631  113.972 49.119  1.00 107.81 ?  42  DC  I "O4'" 1 
ATOM 7984  C "C3'" . DC  I 5 116 ? 69.304  116.193 49.673  1.00 107.81 ?  42  DC  I "C3'" 1 
ATOM 7985  O "O3'" . DC  I 5 116 ? 68.522  117.261 49.167  1.00 107.81 ?  42  DC  I "O3'" 1 
ATOM 7986  C "C2'" . DC  I 5 116 ? 68.623  115.508 50.859  1.00 107.81 ?  42  DC  I "C2'" 1 
ATOM 7987  C "C1'" . DC  I 5 116 ? 67.821  114.419 50.173  1.00 107.81 ?  42  DC  I "C1'" 1 
ATOM 7988  N N1    . DC  I 5 116 ? 67.518  113.267 51.055  1.00 107.81 ?  42  DC  I N1    1 
ATOM 7989  C C2    . DC  I 5 116 ? 66.193  112.959 51.352  1.00 107.81 ?  42  DC  I C2    1 
ATOM 7990  O O2    . DC  I 5 116 ? 65.294  113.653 50.868  1.00 107.81 ?  42  DC  I O2    1 
ATOM 7991  N N3    . DC  I 5 116 ? 65.933  111.905 52.158  1.00 107.81 ?  42  DC  I N3    1 
ATOM 7992  C C4    . DC  I 5 116 ? 66.933  111.185 52.657  1.00 107.81 ?  42  DC  I C4    1 
ATOM 7993  N N4    . DC  I 5 116 ? 66.628  110.157 53.448  1.00 107.81 ?  42  DC  I N4    1 
ATOM 7994  C C5    . DC  I 5 116 ? 68.290  111.489 52.372  1.00 107.81 ?  42  DC  I C5    1 
ATOM 7995  C C6    . DC  I 5 116 ? 68.534  112.522 51.564  1.00 107.81 ?  42  DC  I C6    1 
ATOM 7996  P P     . DT  I 5 117 ? 68.427  118.644 49.976  1.00 108.10 ?  43  DT  I P     1 
ATOM 7997  O OP1   . DT  I 5 117 ? 68.216  119.726 48.991  1.00 108.10 ?  43  DT  I OP1   1 
ATOM 7998  O OP2   . DT  I 5 117 ? 69.577  118.705 50.904  1.00 108.10 -1 43  DT  I OP2   1 
ATOM 7999  O "O5'" . DT  I 5 117 ? 67.103  118.479 50.854  1.00 108.10 ?  43  DT  I "O5'" 1 
ATOM 8000  C "C5'" . DT  I 5 117 ? 65.899  118.046 50.238  1.00 108.10 ?  43  DT  I "C5'" 1 
ATOM 8001  C "C4'" . DT  I 5 117 ? 64.751  118.027 51.233  1.00 108.10 ?  43  DT  I "C4'" 1 
ATOM 8002  O "O4'" . DT  I 5 117 ? 64.690  116.736 51.893  1.00 108.10 ?  43  DT  I "O4'" 1 
ATOM 8003  C "C3'" . DT  I 5 117 ? 64.836  119.071 52.346  1.00 108.10 ?  43  DT  I "C3'" 1 
ATOM 8004  O "O3'" . DT  I 5 117 ? 63.560  119.655 52.546  1.00 108.10 ?  43  DT  I "O3'" 1 
ATOM 8005  C "C2'" . DT  I 5 117 ? 65.271  118.251 53.558  1.00 108.10 ?  43  DT  I "C2'" 1 
ATOM 8006  C "C1'" . DT  I 5 117 ? 64.581  116.928 53.282  1.00 108.10 ?  43  DT  I "C1'" 1 
ATOM 8007  N N1    . DT  I 5 117 ? 65.212  115.770 53.958  1.00 108.10 ?  43  DT  I N1    1 
ATOM 8008  C C2    . DT  I 5 117 ? 64.416  114.839 54.575  1.00 108.10 ?  43  DT  I C2    1 
ATOM 8009  O O2    . DT  I 5 117 ? 63.204  114.915 54.609  1.00 108.10 ?  43  DT  I O2    1 
ATOM 8010  N N3    . DT  I 5 117 ? 65.092  113.805 55.155  1.00 108.10 ?  43  DT  I N3    1 
ATOM 8011  C C4    . DT  I 5 117 ? 66.455  113.611 55.178  1.00 108.10 ?  43  DT  I C4    1 
ATOM 8012  O O4    . DT  I 5 117 ? 66.969  112.646 55.730  1.00 108.10 ?  43  DT  I O4    1 
ATOM 8013  C C5    . DT  I 5 117 ? 67.233  114.623 54.513  1.00 108.10 ?  43  DT  I C5    1 
ATOM 8014  C C7    . DT  I 5 117 ? 68.727  114.525 54.482  1.00 108.10 ?  43  DT  I C7    1 
ATOM 8015  C C6    . DT  I 5 117 ? 66.581  115.642 53.940  1.00 108.10 ?  43  DT  I C6    1 
ATOM 8016  P P     . DC  I 5 118 ? 63.400  120.971 53.453  1.00 107.31 ?  44  DC  I P     1 
ATOM 8017  O OP1   . DC  I 5 118 ? 62.728  121.997 52.628  1.00 107.31 ?  44  DC  I OP1   1 
ATOM 8018  O OP2   . DC  I 5 118 ? 64.707  121.265 54.078  1.00 107.31 -1 44  DC  I OP2   1 
ATOM 8019  O "O5'" . DC  I 5 118 ? 62.394  120.512 54.603  1.00 107.31 ?  44  DC  I "O5'" 1 
ATOM 8020  C "C5'" . DC  I 5 118 ? 61.141  119.949 54.258  1.00 107.31 ?  44  DC  I "C5'" 1 
ATOM 8021  C "C4'" . DC  I 5 118 ? 60.533  119.229 55.444  1.00 107.31 ?  44  DC  I "C4'" 1 
ATOM 8022  O "O4'" . DC  I 5 118 ? 61.303  118.037 55.733  1.00 107.31 ?  44  DC  I "O4'" 1 
ATOM 8023  C "C3'" . DC  I 5 118 ? 60.492  120.043 56.736  1.00 107.31 ?  44  DC  I "C3'" 1 
ATOM 8024  O "O3'" . DC  I 5 118 ? 59.204  119.971 57.315  1.00 107.31 ?  44  DC  I "O3'" 1 
ATOM 8025  C "C2'" . DC  I 5 118 ? 61.544  119.379 57.624  1.00 107.31 ?  44  DC  I "C2'" 1 
ATOM 8026  C "C1'" . DC  I 5 118 ? 61.534  117.949 57.116  1.00 107.31 ?  44  DC  I "C1'" 1 
ATOM 8027  N N1    . DC  I 5 118 ? 62.822  117.258 57.319  1.00 107.31 ?  44  DC  I N1    1 
ATOM 8028  C C2    . DC  I 5 118 ? 62.858  116.029 57.980  1.00 107.31 ?  44  DC  I C2    1 
ATOM 8029  O O2    . DC  I 5 118 ? 61.802  115.532 58.383  1.00 107.31 ?  44  DC  I O2    1 
ATOM 8030  N N3    . DC  I 5 118 ? 64.054  115.415 58.154  1.00 107.31 ?  44  DC  I N3    1 
ATOM 8031  C C4    . DC  I 5 118 ? 65.168  115.991 57.702  1.00 107.31 ?  44  DC  I C4    1 
ATOM 8032  N N4    . DC  I 5 118 ? 66.327  115.357 57.895  1.00 107.31 ?  44  DC  I N4    1 
ATOM 8033  C C5    . DC  I 5 118 ? 65.146  117.244 57.031  1.00 107.31 ?  44  DC  I C5    1 
ATOM 8034  C C6    . DC  I 5 118 ? 63.964  117.835 56.866  1.00 107.31 ?  44  DC  I C6    1 
ATOM 8035  P P     . DC  I 5 119 ? 58.810  120.962 58.513  1.00 105.55 ?  45  DC  I P     1 
ATOM 8036  O OP1   . DC  I 5 119 ? 57.434  121.444 58.267  1.00 105.55 ?  45  DC  I OP1   1 
ATOM 8037  O OP2   . DC  I 5 119 ? 59.922  121.923 58.676  1.00 105.55 -1 45  DC  I OP2   1 
ATOM 8038  O "O5'" . DC  I 5 119 ? 58.797  120.019 59.798  1.00 105.55 ?  45  DC  I "O5'" 1 
ATOM 8039  C "C5'" . DC  I 5 119 ? 57.903  118.922 59.858  1.00 105.55 ?  45  DC  I "C5'" 1 
ATOM 8040  C "C4'" . DC  I 5 119 ? 58.186  118.051 61.069  1.00 105.55 ?  45  DC  I "C4'" 1 
ATOM 8041  O "O4'" . DC  I 5 119 ? 59.544  117.546 61.007  1.00 105.55 ?  45  DC  I "O4'" 1 
ATOM 8042  C "C3'" . DC  I 5 119 ? 58.058  118.748 62.423  1.00 105.55 ?  45  DC  I "C3'" 1 
ATOM 8043  O "O3'" . DC  I 5 119 ? 57.437  117.868 63.344  1.00 105.55 ?  45  DC  I "O3'" 1 
ATOM 8044  C "C2'" . DC  I 5 119 ? 59.514  119.010 62.807  1.00 105.55 ?  45  DC  I "C2'" 1 
ATOM 8045  C "C1'" . DC  I 5 119 ? 60.174  117.767 62.245  1.00 105.55 ?  45  DC  I "C1'" 1 
ATOM 8046  N N1    . DC  I 5 119 ? 61.630  117.900 62.005  1.00 105.55 ?  45  DC  I N1    1 
ATOM 8047  C C2    . DC  I 5 119 ? 62.490  116.907 62.469  1.00 105.55 ?  45  DC  I C2    1 
ATOM 8048  O O2    . DC  I 5 119 ? 62.019  115.947 63.085  1.00 105.55 ?  45  DC  I O2    1 
ATOM 8049  N N3    . DC  I 5 119 ? 63.817  117.025 62.235  1.00 105.55 ?  45  DC  I N3    1 
ATOM 8050  C C4    . DC  I 5 119 ? 64.283  118.080 61.566  1.00 105.55 ?  45  DC  I C4    1 
ATOM 8051  N N4    . DC  I 5 119 ? 65.599  118.155 61.359  1.00 105.55 ?  45  DC  I N4    1 
ATOM 8052  C C5    . DC  I 5 119 ? 63.420  119.101 61.079  1.00 105.55 ?  45  DC  I C5    1 
ATOM 8053  C C6    . DC  I 5 119 ? 62.112  118.970 61.317  1.00 105.55 ?  45  DC  I C6    1 
ATOM 8054  P P     . DA  I 5 120 ? 55.872  118.002 63.678  1.00 96.17  ?  46  DA  I P     1 
ATOM 8055  O OP1   . DA  I 5 120 ? 55.121  117.885 62.411  1.00 96.17  ?  46  DA  I OP1   1 
ATOM 8056  O OP2   . DA  I 5 120 ? 55.694  119.192 64.536  1.00 96.17  -1 46  DA  I OP2   1 
ATOM 8057  O "O5'" . DA  I 5 120 ? 55.565  116.713 64.570  1.00 96.17  ?  46  DA  I "O5'" 1 
ATOM 8058  C "C5'" . DA  I 5 120 ? 55.619  115.416 63.986  1.00 96.17  ?  46  DA  I "C5'" 1 
ATOM 8059  C "C4'" . DA  I 5 120 ? 56.471  114.463 64.815  1.00 96.17  ?  46  DA  I "C4'" 1 
ATOM 8060  O "O4'" . DA  I 5 120 ? 57.856  114.891 64.796  1.00 96.17  ?  46  DA  I "O4'" 1 
ATOM 8061  C "C3'" . DA  I 5 120 ? 56.087  114.335 66.286  1.00 96.17  ?  46  DA  I "C3'" 1 
ATOM 8062  O "O3'" . DA  I 5 120 ? 56.213  112.983 66.685  1.00 96.17  ?  46  DA  I "O3'" 1 
ATOM 8063  C "C2'" . DA  I 5 120 ? 57.112  115.222 66.991  1.00 96.17  ?  46  DA  I "C2'" 1 
ATOM 8064  C "C1'" . DA  I 5 120 ? 58.339  115.027 66.116  1.00 96.17  ?  46  DA  I "C1'" 1 
ATOM 8065  N N9    . DA  I 5 120 ? 59.255  116.158 66.130  1.00 96.17  ?  46  DA  I N9    1 
ATOM 8066  C C8    . DA  I 5 120 ? 58.928  117.476 66.028  1.00 96.17  ?  46  DA  I C8    1 
ATOM 8067  N N7    . DA  I 5 120 ? 59.960  118.280 66.046  1.00 96.17  ?  46  DA  I N7    1 
ATOM 8068  C C5    . DA  I 5 120 ? 61.041  117.430 66.158  1.00 96.17  ?  46  DA  I C5    1 
ATOM 8069  C C6    . DA  I 5 120 ? 62.424  117.664 66.230  1.00 96.17  ?  46  DA  I C6    1 
ATOM 8070  N N6    . DA  I 5 120 ? 62.959  118.882 66.185  1.00 96.17  ?  46  DA  I N6    1 
ATOM 8071  N N1    . DA  I 5 120 ? 63.239  116.593 66.338  1.00 96.17  ?  46  DA  I N1    1 
ATOM 8072  C C2    . DA  I 5 120 ? 62.692  115.372 66.375  1.00 96.17  ?  46  DA  I C2    1 
ATOM 8073  N N3    . DA  I 5 120 ? 61.405  115.029 66.316  1.00 96.17  ?  46  DA  I N3    1 
ATOM 8074  C C4    . DA  I 5 120 ? 60.626  116.116 66.207  1.00 96.17  ?  46  DA  I C4    1 
ATOM 8075  P P     . DG  I 5 121 ? 55.530  112.467 68.041  1.00 90.22  ?  47  DG  I P     1 
ATOM 8076  O OP1   . DG  I 5 121 ? 54.432  111.550 67.676  1.00 90.22  ?  47  DG  I OP1   1 
ATOM 8077  O OP2   . DG  I 5 121 ? 55.258  113.643 68.891  1.00 90.22  -1 47  DG  I OP2   1 
ATOM 8078  O "O5'" . DG  I 5 121 ? 56.683  111.618 68.738  1.00 90.22  ?  47  DG  I "O5'" 1 
ATOM 8079  C "C5'" . DG  I 5 121 ? 57.389  110.641 67.989  1.00 90.22  ?  47  DG  I "C5'" 1 
ATOM 8080  C "C4'" . DG  I 5 121 ? 58.795  110.414 68.533  1.00 90.22  ?  47  DG  I "C4'" 1 
ATOM 8081  O "O4'" . DG  I 5 121 ? 59.599  111.616 68.394  1.00 90.22  ?  47  DG  I "O4'" 1 
ATOM 8082  C "C3'" . DG  I 5 121 ? 58.891  110.024 69.999  1.00 90.22  ?  47  DG  I "C3'" 1 
ATOM 8083  O "O3'" . DG  I 5 121 ? 59.954  109.116 70.146  1.00 90.22  ?  47  DG  I "O3'" 1 
ATOM 8084  C "C2'" . DG  I 5 121 ? 59.217  111.357 70.669  1.00 90.22  ?  47  DG  I "C2'" 1 
ATOM 8085  C "C1'" . DG  I 5 121 ? 60.154  111.962 69.646  1.00 90.22  ?  47  DG  I "C1'" 1 
ATOM 8086  N N9    . DG  I 5 121 ? 60.243  113.413 69.685  1.00 90.22  ?  47  DG  I N9    1 
ATOM 8087  C C8    . DG  I 5 121 ? 59.203  114.299 69.621  1.00 90.22  ?  47  DG  I C8    1 
ATOM 8088  N N7    . DG  I 5 121 ? 59.579  115.545 69.630  1.00 90.22  ?  47  DG  I N7    1 
ATOM 8089  C C5    . DG  I 5 121 ? 60.962  115.482 69.691  1.00 90.22  ?  47  DG  I C5    1 
ATOM 8090  C C6    . DG  I 5 121 ? 61.920  116.522 69.729  1.00 90.22  ?  47  DG  I C6    1 
ATOM 8091  O O6    . DG  I 5 121 ? 61.729  117.743 69.714  1.00 90.22  ?  47  DG  I O6    1 
ATOM 8092  N N1    . DG  I 5 121 ? 63.217  116.029 69.789  1.00 90.22  ?  47  DG  I N1    1 
ATOM 8093  C C2    . DG  I 5 121 ? 63.547  114.699 69.809  1.00 90.22  ?  47  DG  I C2    1 
ATOM 8094  N N2    . DG  I 5 121 ? 64.855  114.413 69.868  1.00 90.22  ?  47  DG  I N2    1 
ATOM 8095  N N3    . DG  I 5 121 ? 62.657  113.711 69.774  1.00 90.22  ?  47  DG  I N3    1 
ATOM 8096  C C4    . DG  I 5 121 ? 61.388  114.177 69.716  1.00 90.22  ?  47  DG  I C4    1 
ATOM 8097  P P     . DG  I 5 122 ? 59.830  107.858 71.130  1.00 83.18  ?  48  DG  I P     1 
ATOM 8098  O OP1   . DG  I 5 122 ? 59.783  106.640 70.294  1.00 83.18  ?  48  DG  I OP1   1 
ATOM 8099  O OP2   . DG  I 5 122 ? 58.736  108.133 72.085  1.00 83.18  -1 48  DG  I OP2   1 
ATOM 8100  O "O5'" . DG  I 5 122 ? 61.221  107.877 71.915  1.00 83.18  ?  48  DG  I "O5'" 1 
ATOM 8101  C "C5'" . DG  I 5 122 ? 62.438  107.840 71.183  1.00 83.18  ?  48  DG  I "C5'" 1 
ATOM 8102  C "C4'" . DG  I 5 122 ? 63.588  108.464 71.957  1.00 83.18  ?  48  DG  I "C4'" 1 
ATOM 8103  O "O4'" . DG  I 5 122 ? 63.456  109.902 71.970  1.00 83.18  ?  48  DG  I "O4'" 1 
ATOM 8104  C "C3'" . DG  I 5 122 ? 63.730  108.036 73.411  1.00 83.18  ?  48  DG  I "C3'" 1 
ATOM 8105  O "O3'" . DG  I 5 122 ? 65.106  107.905 73.708  1.00 83.18  ?  48  DG  I "O3'" 1 
ATOM 8106  C "C2'" . DG  I 5 122 ? 63.101  109.200 74.173  1.00 83.18  ?  48  DG  I "C2'" 1 
ATOM 8107  C "C1'" . DG  I 5 122 ? 63.477  110.379 73.295  1.00 83.18  ?  48  DG  I "C1'" 1 
ATOM 8108  N N9    . DG  I 5 122 ? 62.535  111.484 73.367  1.00 83.18  ?  48  DG  I N9    1 
ATOM 8109  C C8    . DG  I 5 122 ? 61.177  111.395 73.471  1.00 83.18  ?  48  DG  I C8    1 
ATOM 8110  N N7    . DG  I 5 122 ? 60.581  112.552 73.480  1.00 83.18  ?  48  DG  I N7    1 
ATOM 8111  C C5    . DG  I 5 122 ? 61.615  113.466 73.375  1.00 83.18  ?  48  DG  I C5    1 
ATOM 8112  C C6    . DG  I 5 122 ? 61.579  114.874 73.341  1.00 83.18  ?  48  DG  I C6    1 
ATOM 8113  O O6    . DG  I 5 122 ? 60.594  115.618 73.397  1.00 83.18  ?  48  DG  I O6    1 
ATOM 8114  N N1    . DG  I 5 122 ? 62.849  115.418 73.230  1.00 83.18  ?  48  DG  I N1    1 
ATOM 8115  C C2    . DG  I 5 122 ? 64.007  114.691 73.163  1.00 83.18  ?  48  DG  I C2    1 
ATOM 8116  N N2    . DG  I 5 122 ? 65.141  115.392 73.058  1.00 83.18  ?  48  DG  I N2    1 
ATOM 8117  N N3    . DG  I 5 122 ? 64.055  113.371 73.195  1.00 83.18  ?  48  DG  I N3    1 
ATOM 8118  C C4    . DG  I 5 122 ? 62.823  112.827 73.294  1.00 83.18  ?  48  DG  I C4    1 
ATOM 8119  P P     . DC  I 5 123 ? 65.607  107.301 75.108  1.00 85.36  ?  49  DC  I P     1 
ATOM 8120  O OP1   . DC  I 5 123 ? 66.319  106.041 74.816  1.00 85.36  ?  49  DC  I OP1   1 
ATOM 8121  O OP2   . DC  I 5 123 ? 64.482  107.285 76.064  1.00 85.36  -1 49  DC  I OP2   1 
ATOM 8122  O "O5'" . DC  I 5 123 ? 66.672  108.381 75.602  1.00 85.36  ?  49  DC  I "O5'" 1 
ATOM 8123  C "C5'" . DC  I 5 123 ? 67.575  108.954 74.664  1.00 85.36  ?  49  DC  I "C5'" 1 
ATOM 8124  C "C4'" . DC  I 5 123 ? 68.209  110.223 75.206  1.00 85.36  ?  49  DC  I "C4'" 1 
ATOM 8125  O "O4'" . DC  I 5 123 ? 67.289  111.334 75.060  1.00 85.36  ?  49  DC  I "O4'" 1 
ATOM 8126  C "C3'" . DC  I 5 123 ? 68.594  110.177 76.680  1.00 85.36  ?  49  DC  I "C3'" 1 
ATOM 8127  O "O3'" . DC  I 5 123 ? 69.866  110.767 76.863  1.00 85.36  ?  49  DC  I "O3'" 1 
ATOM 8128  C "C2'" . DC  I 5 123 ? 67.499  110.994 77.355  1.00 85.36  ?  49  DC  I "C2'" 1 
ATOM 8129  C "C1'" . DC  I 5 123 ? 67.167  112.016 76.285  1.00 85.36  ?  49  DC  I "C1'" 1 
ATOM 8130  N N1    . DC  I 5 123 ? 65.785  112.528 76.380  1.00 85.36  ?  49  DC  I N1    1 
ATOM 8131  C C2    . DC  I 5 123 ? 65.547  113.904 76.417  1.00 85.36  ?  49  DC  I C2    1 
ATOM 8132  O O2    . DC  I 5 123 ? 66.501  114.683 76.377  1.00 85.36  ?  49  DC  I O2    1 
ATOM 8133  N N3    . DC  I 5 123 ? 64.270  114.345 76.496  1.00 85.36  ?  49  DC  I N3    1 
ATOM 8134  C C4    . DC  I 5 123 ? 63.269  113.472 76.541  1.00 85.36  ?  49  DC  I C4    1 
ATOM 8135  N N4    . DC  I 5 123 ? 62.025  113.946 76.617  1.00 85.36  ?  49  DC  I N4    1 
ATOM 8136  C C5    . DC  I 5 123 ? 63.496  112.070 76.510  1.00 85.36  ?  49  DC  I C5    1 
ATOM 8137  C C6    . DC  I 5 123 ? 64.755  111.648 76.426  1.00 85.36  ?  49  DC  I C6    1 
ATOM 8138  P P     . DA  I 5 124 ? 70.674  110.527 78.229  1.00 97.92  ?  50  DA  I P     1 
ATOM 8139  O OP1   . DA  I 5 124 ? 72.031  110.074 77.868  1.00 97.92  ?  50  DA  I OP1   1 
ATOM 8140  O OP2   . DA  I 5 124 ? 69.835  109.686 79.106  1.00 97.92  -1 50  DA  I OP2   1 
ATOM 8141  O "O5'" . DA  I 5 124 ? 70.776  111.985 78.876  1.00 97.92  ?  50  DA  I "O5'" 1 
ATOM 8142  C "C5'" . DA  I 5 124 ? 71.566  112.983 78.242  1.00 97.92  ?  50  DA  I "C5'" 1 
ATOM 8143  C "C4'" . DA  I 5 124 ? 71.372  114.345 78.891  1.00 97.92  ?  50  DA  I "C4'" 1 
ATOM 8144  O "O4'" . DA  I 5 124 ? 69.998  114.773 78.732  1.00 97.92  ?  50  DA  I "O4'" 1 
ATOM 8145  C "C3'" . DA  I 5 124 ? 71.673  114.409 80.384  1.00 97.92  ?  50  DA  I "C3'" 1 
ATOM 8146  O "O3'" . DA  I 5 124 ? 72.370  115.601 80.678  1.00 97.92  ?  50  DA  I "O3'" 1 
ATOM 8147  C "C2'" . DA  I 5 124 ? 70.291  114.402 81.025  1.00 97.92  ?  50  DA  I "C2'" 1 
ATOM 8148  C "C1'" . DA  I 5 124 ? 69.450  115.118 79.982  1.00 97.92  ?  50  DA  I "C1'" 1 
ATOM 8149  N N9    . DA  I 5 124 ? 68.069  114.679 79.987  1.00 97.92  ?  50  DA  I N9    1 
ATOM 8150  C C8    . DA  I 5 124 ? 67.632  113.399 79.863  1.00 97.92  ?  50  DA  I C8    1 
ATOM 8151  N N7    . DA  I 5 124 ? 66.334  113.277 79.896  1.00 97.92  ?  50  DA  I N7    1 
ATOM 8152  C C5    . DA  I 5 124 ? 65.886  114.569 80.057  1.00 97.92  ?  50  DA  I C5    1 
ATOM 8153  C C6    . DA  I 5 124 ? 64.599  115.107 80.164  1.00 97.92  ?  50  DA  I C6    1 
ATOM 8154  N N6    . DA  I 5 124 ? 63.499  114.362 80.122  1.00 97.92  ?  50  DA  I N6    1 
ATOM 8155  N N1    . DA  I 5 124 ? 64.485  116.441 80.317  1.00 97.92  ?  50  DA  I N1    1 
ATOM 8156  C C2    . DA  I 5 124 ? 65.598  117.184 80.365  1.00 97.92  ?  50  DA  I C2    1 
ATOM 8157  N N3    . DA  I 5 124 ? 66.869  116.786 80.267  1.00 97.92  ?  50  DA  I N3    1 
ATOM 8158  C C4    . DA  I 5 124 ? 66.941  115.453 80.111  1.00 97.92  ?  50  DA  I C4    1 
ATOM 8159  P P     . DC  I 5 125 ? 72.812  115.923 82.186  1.00 106.35 ?  51  DC  I P     1 
ATOM 8160  O OP1   . DC  I 5 125 ? 74.064  116.709 82.127  1.00 106.35 ?  51  DC  I OP1   1 
ATOM 8161  O OP2   . DC  I 5 125 ? 72.770  114.650 82.936  1.00 106.35 -1 51  DC  I OP2   1 
ATOM 8162  O "O5'" . DC  I 5 125 ? 71.638  116.859 82.738  1.00 106.35 ?  51  DC  I "O5'" 1 
ATOM 8163  C "C5'" . DC  I 5 125 ? 71.152  117.930 81.939  1.00 106.35 ?  51  DC  I "C5'" 1 
ATOM 8164  C "C4'" . DC  I 5 125 ? 70.131  118.759 82.698  1.00 106.35 ?  51  DC  I "C4'" 1 
ATOM 8165  O "O4'" . DC  I 5 125 ? 68.806  118.202 82.510  1.00 106.35 ?  51  DC  I "O4'" 1 
ATOM 8166  C "C3'" . DC  I 5 125 ? 70.354  118.838 84.207  1.00 106.35 ?  51  DC  I "C3'" 1 
ATOM 8167  O "O3'" . DC  I 5 125 ? 70.169  120.170 84.651  1.00 106.35 ?  51  DC  I "O3'" 1 
ATOM 8168  C "C2'" . DC  I 5 125 ? 69.285  117.907 84.770  1.00 106.35 ?  51  DC  I "C2'" 1 
ATOM 8169  C "C1'" . DC  I 5 125 ? 68.167  118.077 83.758  1.00 106.35 ?  51  DC  I "C1'" 1 
ATOM 8170  N N1    . DC  I 5 125 ? 67.257  116.915 83.689  1.00 106.35 ?  51  DC  I N1    1 
ATOM 8171  C C2    . DC  I 5 125 ? 65.879  117.098 83.840  1.00 106.35 ?  51  DC  I C2    1 
ATOM 8172  O O2    . DC  I 5 125 ? 65.439  118.233 84.035  1.00 106.35 ?  51  DC  I O2    1 
ATOM 8173  N N3    . DC  I 5 125 ? 65.064  116.020 83.769  1.00 106.35 ?  51  DC  I N3    1 
ATOM 8174  C C4    . DC  I 5 125 ? 65.578  114.811 83.555  1.00 106.35 ?  51  DC  I C4    1 
ATOM 8175  N N4    . DC  I 5 125 ? 64.739  113.774 83.491  1.00 106.35 ?  51  DC  I N4    1 
ATOM 8176  C C5    . DC  I 5 125 ? 66.979  114.606 83.402  1.00 106.35 ?  51  DC  I C5    1 
ATOM 8177  C C6    . DC  I 5 125 ? 67.772  115.676 83.473  1.00 106.35 ?  51  DC  I C6    1 
ATOM 8178  P P     . DG  I 5 126 ? 70.518  120.565 86.166  1.00 113.40 ?  52  DG  I P     1 
ATOM 8179  O OP1   . DG  I 5 126 ? 71.121  121.916 86.150  1.00 113.40 ?  52  DG  I OP1   1 
ATOM 8180  O OP2   . DG  I 5 126 ? 71.248  119.431 86.773  1.00 113.40 -1 52  DG  I OP2   1 
ATOM 8181  O "O5'" . DG  I 5 126 ? 69.091  120.648 86.872  1.00 113.40 ?  52  DG  I "O5'" 1 
ATOM 8182  C "C5'" . DG  I 5 126 ? 68.121  121.557 86.387  1.00 113.40 ?  52  DG  I "C5'" 1 
ATOM 8183  C "C4'" . DG  I 5 126 ? 66.798  121.396 87.116  1.00 113.40 ?  52  DG  I "C4'" 1 
ATOM 8184  O "O4'" . DG  I 5 126 ? 66.152  120.166 86.705  1.00 113.40 ?  52  DG  I "O4'" 1 
ATOM 8185  C "C3'" . DG  I 5 126 ? 66.884  121.338 88.641  1.00 113.40 ?  52  DG  I "C3'" 1 
ATOM 8186  O "O3'" . DG  I 5 126 ? 65.825  122.103 89.181  1.00 113.40 ?  52  DG  I "O3'" 1 
ATOM 8187  C "C2'" . DG  I 5 126 ? 66.706  119.848 88.939  1.00 113.40 ?  52  DG  I "C2'" 1 
ATOM 8188  C "C1'" . DG  I 5 126 ? 65.732  119.457 87.847  1.00 113.40 ?  52  DG  I "C1'" 1 
ATOM 8189  N N9    . DG  I 5 126 ? 65.727  118.040 87.516  1.00 113.40 ?  52  DG  I N9    1 
ATOM 8190  C C8    . DG  I 5 126 ? 66.798  117.266 87.152  1.00 113.40 ?  52  DG  I C8    1 
ATOM 8191  N N7    . DG  I 5 126 ? 66.478  116.032 86.883  1.00 113.40 ?  52  DG  I N7    1 
ATOM 8192  C C5    . DG  I 5 126 ? 65.107  115.991 87.076  1.00 113.40 ?  52  DG  I C5    1 
ATOM 8193  C C6    . DG  I 5 126 ? 64.198  114.919 86.938  1.00 113.40 ?  52  DG  I C6    1 
ATOM 8194  O O6    . DG  I 5 126 ? 64.430  113.752 86.606  1.00 113.40 ?  52  DG  I O6    1 
ATOM 8195  N N1    . DG  I 5 126 ? 62.896  115.308 87.230  1.00 113.40 ?  52  DG  I N1    1 
ATOM 8196  C C2    . DG  I 5 126 ? 62.522  116.573 87.606  1.00 113.40 ?  52  DG  I C2    1 
ATOM 8197  N N2    . DG  I 5 126 ? 61.219  116.763 87.847  1.00 113.40 ?  52  DG  I N2    1 
ATOM 8198  N N3    . DG  I 5 126 ? 63.365  117.585 87.740  1.00 113.40 ?  52  DG  I N3    1 
ATOM 8199  C C4    . DG  I 5 126 ? 64.633  117.222 87.460  1.00 113.40 ?  52  DG  I C4    1 
ATOM 8200  P P     . DT  I 5 127 ? 65.805  122.506 90.734  1.00 116.35 ?  53  DT  I P     1 
ATOM 8201  O OP1   . DT  I 5 127 ? 66.173  123.936 90.812  1.00 116.35 ?  53  DT  I OP1   1 
ATOM 8202  O OP2   . DT  I 5 127 ? 66.579  121.505 91.499  1.00 116.35 -1 53  DT  I OP2   1 
ATOM 8203  O "O5'" . DT  I 5 127 ? 64.266  122.342 91.133  1.00 116.35 ?  53  DT  I "O5'" 1 
ATOM 8204  C "C5'" . DT  I 5 127 ? 63.431  121.477 90.372  1.00 116.35 ?  53  DT  I "C5'" 1 
ATOM 8205  C "C4'" . DT  I 5 127 ? 62.253  121.007 91.197  1.00 116.35 ?  53  DT  I "C4'" 1 
ATOM 8206  O "O4'" . DT  I 5 127 ? 61.960  119.623 90.864  1.00 116.35 ?  53  DT  I "O4'" 1 
ATOM 8207  C "C3'" . DT  I 5 127 ? 62.500  121.002 92.693  1.00 116.35 ?  53  DT  I "C3'" 1 
ATOM 8208  O "O3'" . DT  I 5 127 ? 61.261  121.081 93.384  1.00 116.35 ?  53  DT  I "O3'" 1 
ATOM 8209  C "C2'" . DT  I 5 127 ? 63.151  119.643 92.880  1.00 116.35 ?  53  DT  I "C2'" 1 
ATOM 8210  C "C1'" . DT  I 5 127 ? 62.275  118.796 91.970  1.00 116.35 ?  53  DT  I "C1'" 1 
ATOM 8211  N N1    . DT  I 5 127 ? 62.938  117.564 91.468  1.00 116.35 ?  53  DT  I N1    1 
ATOM 8212  C C2    . DT  I 5 127 ? 62.176  116.449 91.205  1.00 116.35 ?  53  DT  I C2    1 
ATOM 8213  O O2    . DT  I 5 127 ? 60.971  116.414 91.364  1.00 116.35 ?  53  DT  I O2    1 
ATOM 8214  N N3    . DT  I 5 127 ? 62.880  115.370 90.745  1.00 116.35 ?  53  DT  I N3    1 
ATOM 8215  C C4    . DT  I 5 127 ? 64.242  115.298 90.528  1.00 116.35 ?  53  DT  I C4    1 
ATOM 8216  O O4    . DT  I 5 127 ? 64.788  114.284 90.115  1.00 116.35 ?  53  DT  I O4    1 
ATOM 8217  C C5    . DT  I 5 127 ? 64.980  116.500 90.825  1.00 116.35 ?  53  DT  I C5    1 
ATOM 8218  C C7    . DT  I 5 127 ? 66.464  116.536 90.631  1.00 116.35 ?  53  DT  I C7    1 
ATOM 8219  C C6    . DT  I 5 127 ? 64.301  117.562 91.274  1.00 116.35 ?  53  DT  I C6    1 
ATOM 8220  P P     . DG  I 5 128 ? 61.172  121.840 94.797  1.00 118.02 ?  54  DG  I P     1 
ATOM 8221  O OP1   . DG  I 5 128 ? 60.823  123.252 94.524  1.00 118.02 ?  54  DG  I OP1   1 
ATOM 8222  O OP2   . DG  I 5 128 ? 62.398  121.519 95.558  1.00 118.02 -1 54  DG  I OP2   1 
ATOM 8223  O "O5'" . DG  I 5 128 ? 59.940  121.138 95.536  1.00 118.02 ?  54  DG  I "O5'" 1 
ATOM 8224  C "C5'" . DG  I 5 128 ? 58.606  121.497 95.197  1.00 118.02 ?  54  DG  I "C5'" 1 
ATOM 8225  C "C4'" . DG  I 5 128 ? 57.743  120.265 94.974  1.00 118.02 ?  54  DG  I "C4'" 1 
ATOM 8226  O "O4'" . DG  I 5 128 ? 58.535  119.218 94.355  1.00 118.02 ?  54  DG  I "O4'" 1 
ATOM 8227  C "C3'" . DG  I 5 128 ? 57.152  119.638 96.232  1.00 118.02 ?  54  DG  I "C3'" 1 
ATOM 8228  O "O3'" . DG  I 5 128 ? 55.904  119.037 95.912  1.00 118.02 ?  54  DG  I "O3'" 1 
ATOM 8229  C "C2'" . DG  I 5 128 ? 58.196  118.589 96.584  1.00 118.02 ?  54  DG  I "C2'" 1 
ATOM 8230  C "C1'" . DG  I 5 128 ? 58.583  118.086 95.204  1.00 118.02 ?  54  DG  I "C1'" 1 
ATOM 8231  N N9    . DG  I 5 128 ? 59.927  117.525 95.124  1.00 118.02 ?  54  DG  I N9    1 
ATOM 8232  C C8    . DG  I 5 128 ? 61.108  118.181 95.360  1.00 118.02 ?  54  DG  I C8    1 
ATOM 8233  N N7    . DG  I 5 128 ? 62.159  117.434 95.189  1.00 118.02 ?  54  DG  I N7    1 
ATOM 8234  C C5    . DG  I 5 128 ? 61.646  116.209 94.803  1.00 118.02 ?  54  DG  I C5    1 
ATOM 8235  C C6    . DG  I 5 128 ? 62.313  115.011 94.481  1.00 118.02 ?  54  DG  I C6    1 
ATOM 8236  O O6    . DG  I 5 128 ? 63.527  114.793 94.470  1.00 118.02 ?  54  DG  I O6    1 
ATOM 8237  N N1    . DG  I 5 128 ? 61.425  113.997 94.147  1.00 118.02 ?  54  DG  I N1    1 
ATOM 8238  C C2    . DG  I 5 128 ? 60.059  114.126 94.124  1.00 118.02 ?  54  DG  I C2    1 
ATOM 8239  N N2    . DG  I 5 128 ? 59.368  113.032 93.773  1.00 118.02 ?  54  DG  I N2    1 
ATOM 8240  N N3    . DG  I 5 128 ? 59.416  115.248 94.425  1.00 118.02 ?  54  DG  I N3    1 
ATOM 8241  C C4    . DG  I 5 128 ? 60.273  116.245 94.754  1.00 118.02 ?  54  DG  I C4    1 
ATOM 8242  P P     . DT  I 5 129 ? 54.945  118.447 97.059  1.00 121.09 ?  55  DT  I P     1 
ATOM 8243  O OP1   . DT  I 5 129 ? 53.777  119.346 97.156  1.00 121.09 ?  55  DT  I OP1   1 
ATOM 8244  O OP2   . DT  I 5 129 ? 55.740  118.145 98.269  1.00 121.09 -1 55  DT  I OP2   1 
ATOM 8245  O "O5'" . DT  I 5 129 ? 54.459  117.055 96.452  1.00 121.09 ?  55  DT  I "O5'" 1 
ATOM 8246  C "C5'" . DT  I 5 129 ? 55.396  116.203 95.817  1.00 121.09 ?  55  DT  I "C5'" 1 
ATOM 8247  C "C4'" . DT  I 5 129 ? 55.297  114.798 96.368  1.00 121.09 ?  55  DT  I "C4'" 1 
ATOM 8248  O "O4'" . DT  I 5 129 ? 56.625  114.208 96.419  1.00 121.09 ?  55  DT  I "O4'" 1 
ATOM 8249  C "C3'" . DT  I 5 129 ? 54.793  114.714 97.798  1.00 121.09 ?  55  DT  I "C3'" 1 
ATOM 8250  O "O3'" . DT  I 5 129 ? 54.317  113.404 98.036  1.00 121.09 ?  55  DT  I "O3'" 1 
ATOM 8251  C "C2'" . DT  I 5 129 ? 56.084  114.955 98.556  1.00 121.09 ?  55  DT  I "C2'" 1 
ATOM 8252  C "C1'" . DT  I 5 129 ? 56.988  114.018 97.774  1.00 121.09 ?  55  DT  I "C1'" 1 
ATOM 8253  N N1    . DT  I 5 129 ? 58.436  114.282 97.917  1.00 121.09 ?  55  DT  I N1    1 
ATOM 8254  C C2    . DT  I 5 129 ? 59.316  113.277 97.621  1.00 121.09 ?  55  DT  I C2    1 
ATOM 8255  O O2    . DT  I 5 129 ? 58.966  112.173 97.252  1.00 121.09 ?  55  DT  I O2    1 
ATOM 8256  N N3    . DT  I 5 129 ? 60.628  113.606 97.767  1.00 121.09 ?  55  DT  I N3    1 
ATOM 8257  C C4    . DT  I 5 129 ? 61.141  114.819 98.173  1.00 121.09 ?  55  DT  I C4    1 
ATOM 8258  O O4    . DT  I 5 129 ? 62.343  115.016 98.276  1.00 121.09 ?  55  DT  I O4    1 
ATOM 8259  C C5    . DT  I 5 129 ? 60.168  115.832 98.471  1.00 121.09 ?  55  DT  I C5    1 
ATOM 8260  C C7    . DT  I 5 129 ? 60.618  117.185 98.927  1.00 121.09 ?  55  DT  I C7    1 
ATOM 8261  C C6    . DT  I 5 129 ? 58.873  115.522 98.330  1.00 121.09 ?  55  DT  I C6    1 
ATOM 8262  P P     . DC  I 5 130 ? 52.794  113.146 98.465  1.00 118.76 ?  56  DC  I P     1 
ATOM 8263  O OP1   . DC  I 5 130 ? 51.930  113.724 97.413  1.00 118.76 ?  56  DC  I OP1   1 
ATOM 8264  O OP2   . DC  I 5 130 ? 52.645  113.588 99.868  1.00 118.76 -1 56  DC  I OP2   1 
ATOM 8265  O "O5'" . DC  I 5 130 ? 52.658  111.552 98.437  1.00 118.76 ?  56  DC  I "O5'" 1 
ATOM 8266  C "C5'" . DC  I 5 130 ? 52.652  110.852 97.191  1.00 118.76 ?  56  DC  I "C5'" 1 
ATOM 8267  C "C4'" . DC  I 5 130 ? 53.594  109.648 97.205  1.00 118.76 ?  56  DC  I "C4'" 1 
ATOM 8268  O "O4'" . DC  I 5 130 ? 54.941  110.066 97.547  1.00 118.76 ?  56  DC  I "O4'" 1 
ATOM 8269  C "C3'" . DC  I 5 130 ? 53.248  108.528 98.182  1.00 118.76 ?  56  DC  I "C3'" 1 
ATOM 8270  O "O3'" . DC  I 5 130 ? 53.606  107.281 97.598  1.00 118.76 ?  56  DC  I "O3'" 1 
ATOM 8271  C "C2'" . DC  I 5 130 ? 54.134  108.854 99.381  1.00 118.76 ?  56  DC  I "C2'" 1 
ATOM 8272  C "C1'" . DC  I 5 130 ? 55.390  109.363 98.690  1.00 118.76 ?  56  DC  I "C1'" 1 
ATOM 8273  N N1    . DC  I 5 130 ? 56.200  110.314 99.496  1.00 118.76 ?  56  DC  I N1    1 
ATOM 8274  C C2    . DC  I 5 130 ? 57.587  110.157 99.574  1.00 118.76 ?  56  DC  I C2    1 
ATOM 8275  O O2    . DC  I 5 130 ? 58.121  109.203 99.008  1.00 118.76 ?  56  DC  I O2    1 
ATOM 8276  N N3    . DC  I 5 130 ? 58.306  111.049 100.289 1.00 118.76 ?  56  DC  I N3    1 
ATOM 8277  C C4    . DC  I 5 130 ? 57.699  112.065 100.890 1.00 118.76 ?  56  DC  I C4    1 
ATOM 8278  N N4    . DC  I 5 130 ? 58.456  112.920 101.580 1.00 118.76 ?  56  DC  I N4    1 
ATOM 8279  C C5    . DC  I 5 130 ? 56.291  112.246 100.819 1.00 118.76 ?  56  DC  I C5    1 
ATOM 8280  C C6    . DC  I 5 130 ? 55.590  111.364 100.106 1.00 118.76 ?  56  DC  I C6    1 
ATOM 8281  P P     . DA  I 5 131 ? 53.017  105.899 98.165  1.00 114.75 ?  57  DA  I P     1 
ATOM 8282  O OP1   . DA  I 5 131 ? 51.751  105.622 97.455  1.00 114.75 ?  57  DA  I OP1   1 
ATOM 8283  O OP2   . DA  I 5 131 ? 53.036  105.967 99.642  1.00 114.75 -1 57  DA  I OP2   1 
ATOM 8284  O "O5'" . DA  I 5 131 ? 54.101  104.820 97.700  1.00 114.75 ?  57  DA  I "O5'" 1 
ATOM 8285  C "C5'" . DA  I 5 131 ? 55.426  105.247 97.410  1.00 114.75 ?  57  DA  I "C5'" 1 
ATOM 8286  C "C4'" . DA  I 5 131 ? 56.428  104.119 97.576  1.00 114.75 ?  57  DA  I "C4'" 1 
ATOM 8287  O "O4'" . DA  I 5 131 ? 57.559  104.589 98.336  1.00 114.75 ?  57  DA  I "O4'" 1 
ATOM 8288  C "C3'" . DA  I 5 131 ? 55.942  102.920 98.350  1.00 114.75 ?  57  DA  I "C3'" 1 
ATOM 8289  O "O3'" . DA  I 5 131 ? 56.763  101.810 98.034  1.00 114.75 ?  57  DA  I "O3'" 1 
ATOM 8290  C "C2'" . DA  I 5 131 ? 56.140  103.372 99.795  1.00 114.75 ?  57  DA  I "C2'" 1 
ATOM 8291  C "C1'" . DA  I 5 131 ? 57.381  104.263 99.704  1.00 114.75 ?  57  DA  I "C1'" 1 
ATOM 8292  N N9    . DA  I 5 131 ? 57.256  105.516 100.442 1.00 114.75 ?  57  DA  I N9    1 
ATOM 8293  C C8    . DA  I 5 131 ? 56.109  106.211 100.683 1.00 114.75 ?  57  DA  I C8    1 
ATOM 8294  N N7    . DA  I 5 131 ? 56.294  107.319 101.352 1.00 114.75 ?  57  DA  I N7    1 
ATOM 8295  C C5    . DA  I 5 131 ? 57.652  107.362 101.556 1.00 114.75 ?  57  DA  I C5    1 
ATOM 8296  C C6    . DA  I 5 131 ? 58.475  108.292 102.205 1.00 114.75 ?  57  DA  I C6    1 
ATOM 8297  N N6    . DA  I 5 131 ? 58.007  109.400 102.780 1.00 114.75 ?  57  DA  I N6    1 
ATOM 8298  N N1    . DA  I 5 131 ? 59.797  108.043 102.240 1.00 114.75 ?  57  DA  I N1    1 
ATOM 8299  C C2    . DA  I 5 131 ? 60.257  106.926 101.665 1.00 114.75 ?  57  DA  I C2    1 
ATOM 8300  N N3    . DA  I 5 131 ? 59.578  105.979 101.021 1.00 114.75 ?  57  DA  I N3    1 
ATOM 8301  C C4    . DA  I 5 131 ? 58.268  106.261 101.002 1.00 114.75 ?  57  DA  I C4    1 
ATOM 8302  P P     . DG  I 5 132 ? 56.626  100.430 98.838  1.00 119.86 ?  58  DG  I P     1 
ATOM 8303  O OP1   . DG  I 5 132 ? 56.897  99.335  97.884  1.00 119.86 ?  58  DG  I OP1   1 
ATOM 8304  O OP2   . DG  I 5 132 ? 55.344  100.452 99.570  1.00 119.86 -1 58  DG  I OP2   1 
ATOM 8305  O "O5'" . DG  I 5 132 ? 57.816  100.495 99.903  1.00 119.86 ?  58  DG  I "O5'" 1 
ATOM 8306  C "C5'" . DG  I 5 132 ? 59.172  100.431 99.465  1.00 119.86 ?  58  DG  I "C5'" 1 
ATOM 8307  C "C4'" . DG  I 5 132 ? 60.158  100.780 100.581 1.00 119.86 ?  58  DG  I "C4'" 1 
ATOM 8308  O "O4'" . DG  I 5 132 ? 59.848  102.081 101.151 1.00 119.86 ?  58  DG  I "O4'" 1 
ATOM 8309  C "C3'" . DG  I 5 132 ? 60.199  99.821  101.775 1.00 119.86 ?  58  DG  I "C3'" 1 
ATOM 8310  O "O3'" . DG  I 5 132 ? 61.510  99.819  102.313 1.00 119.86 ?  58  DG  I "O3'" 1 
ATOM 8311  C "C2'" . DG  I 5 132 ? 59.264  100.523 102.750 1.00 119.86 ?  58  DG  I "C2'" 1 
ATOM 8312  C "C1'" . DG  I 5 132 ? 59.768  101.938 102.553 1.00 119.86 ?  58  DG  I "C1'" 1 
ATOM 8313  N N9    . DG  I 5 132 ? 58.909  102.987 103.077 1.00 119.86 ?  58  DG  I N9    1 
ATOM 8314  C C8    . DG  I 5 132 ? 57.549  103.078 102.963 1.00 119.86 ?  58  DG  I C8    1 
ATOM 8315  N N7    . DG  I 5 132 ? 57.055  104.156 103.497 1.00 119.86 ?  58  DG  I N7    1 
ATOM 8316  C C5    . DG  I 5 132 ? 58.159  104.817 104.007 1.00 119.86 ?  58  DG  I C5    1 
ATOM 8317  C C6    . DG  I 5 132 ? 58.239  106.038 104.707 1.00 119.86 ?  58  DG  I C6    1 
ATOM 8318  O O6    . DG  I 5 132 ? 57.318  106.798 105.022 1.00 119.86 ?  58  DG  I O6    1 
ATOM 8319  N N1    . DG  I 5 132 ? 59.551  106.354 105.047 1.00 119.86 ?  58  DG  I N1    1 
ATOM 8320  C C2    . DG  I 5 132 ? 60.648  105.580 104.749 1.00 119.86 ?  58  DG  I C2    1 
ATOM 8321  N N2    . DG  I 5 132 ? 61.838  106.050 105.158 1.00 119.86 ?  58  DG  I N2    1 
ATOM 8322  N N3    . DG  I 5 132 ? 60.584  104.433 104.085 1.00 119.86 ?  58  DG  I N3    1 
ATOM 8323  C C4    . DG  I 5 132 ? 59.310  104.114 103.751 1.00 119.86 ?  58  DG  I C4    1 
ATOM 8324  P P     . DA  I 5 133 ? 62.635  98.777  101.834 1.00 133.45 ?  59  DA  I P     1 
ATOM 8325  O OP1   . DA  I 5 133 ? 62.885  98.949  100.387 1.00 133.45 ?  59  DA  I OP1   1 
ATOM 8326  O OP2   . DA  I 5 133 ? 62.264  97.448  102.364 1.00 133.45 -1 59  DA  I OP2   1 
ATOM 8327  O "O5'" . DA  I 5 133 ? 63.930  99.287  102.622 1.00 133.45 ?  59  DA  I "O5'" 1 
ATOM 8328  C "C5'" . DA  I 5 133 ? 64.055  100.679 102.933 1.00 133.45 ?  59  DA  I "C5'" 1 
ATOM 8329  C "C4'" . DA  I 5 133 ? 64.801  100.896 104.239 1.00 133.45 ?  59  DA  I "C4'" 1 
ATOM 8330  O "O4'" . DA  I 5 133 ? 64.070  101.840 105.070 1.00 133.45 ?  59  DA  I "O4'" 1 
ATOM 8331  C "C3'" . DA  I 5 133 ? 64.957  99.664  105.104 1.00 133.45 ?  59  DA  I "C3'" 1 
ATOM 8332  O "O3'" . DA  I 5 133 ? 66.064  99.837  105.964 1.00 133.45 ?  59  DA  I "O3'" 1 
ATOM 8333  C "C2'" . DA  I 5 133 ? 63.654  99.674  105.882 1.00 133.45 ?  59  DA  I "C2'" 1 
ATOM 8334  C "C1'" . DA  I 5 133 ? 63.484  101.161 106.171 1.00 133.45 ?  59  DA  I "C1'" 1 
ATOM 8335  N N9    . DA  I 5 133 ? 62.087  101.564 106.255 1.00 133.45 ?  59  DA  I N9    1 
ATOM 8336  C C8    . DA  I 5 133 ? 61.027  100.915 105.707 1.00 133.45 ?  59  DA  I C8    1 
ATOM 8337  N N7    . DA  I 5 133 ? 59.877  101.499 105.917 1.00 133.45 ?  59  DA  I N7    1 
ATOM 8338  C C5    . DA  I 5 133 ? 60.203  102.614 106.655 1.00 133.45 ?  59  DA  I C5    1 
ATOM 8339  C C6    . DA  I 5 133 ? 59.421  103.647 107.189 1.00 133.45 ?  59  DA  I C6    1 
ATOM 8340  N N6    . DA  I 5 133 ? 58.097  103.707 107.046 1.00 133.45 ?  59  DA  I N6    1 
ATOM 8341  N N1    . DA  I 5 133 ? 60.052  104.619 107.876 1.00 133.45 ?  59  DA  I N1    1 
ATOM 8342  C C2    . DA  I 5 133 ? 61.382  104.551 108.018 1.00 133.45 ?  59  DA  I C2    1 
ATOM 8343  N N3    . DA  I 5 133 ? 62.226  103.627 107.553 1.00 133.45 ?  59  DA  I N3    1 
ATOM 8344  C C4    . DA  I 5 133 ? 61.564  102.678 106.874 1.00 133.45 ?  59  DA  I C4    1 
ATOM 8345  P P     . DT  I 5 134 ? 66.620  98.614  106.843 1.00 152.56 ?  60  DT  I P     1 
ATOM 8346  O OP1   . DT  I 5 134 ? 67.351  97.704  105.936 1.00 152.56 ?  60  DT  I OP1   1 
ATOM 8347  O OP2   . DT  I 5 134 ? 65.518  98.083  107.674 1.00 152.56 -1 60  DT  I OP2   1 
ATOM 8348  O "O5'" . DT  I 5 134 ? 67.659  99.322  107.834 1.00 152.56 ?  60  DT  I "O5'" 1 
ATOM 8349  C "C5'" . DT  I 5 134 ? 67.459  100.683 108.222 1.00 152.56 ?  60  DT  I "C5'" 1 
ATOM 8350  C "C4'" . DT  I 5 134 ? 66.740  100.773 109.559 1.00 152.56 ?  60  DT  I "C4'" 1 
ATOM 8351  O "O4'" . DT  I 5 134 ? 65.353  101.101 109.351 1.00 152.56 ?  60  DT  I "O4'" 1 
ATOM 8352  C "C3'" . DT  I 5 134 ? 66.734  99.481  110.378 1.00 152.56 ?  60  DT  I "C3'" 1 
ATOM 8353  O "O3'" . DT  I 5 134 ? 67.706  99.558  111.466 1.00 152.56 ?  60  DT  I "O3'" 1 
ATOM 8354  C "C2'" . DT  I 5 134 ? 65.269  99.305  110.830 1.00 152.56 ?  60  DT  I "C2'" 1 
ATOM 8355  C "C1'" . DT  I 5 134 ? 64.638  100.643 110.463 1.00 152.56 ?  60  DT  I "C1'" 1 
ATOM 8356  N N1    . DT  I 5 134 ? 63.193  100.573 110.115 1.00 152.56 ?  60  DT  I N1    1 
ATOM 8357  C C2    . DT  I 5 134 ? 62.346  101.528 110.612 1.00 152.56 ?  60  DT  I C2    1 
ATOM 8358  O O2    . DT  I 5 134 ? 62.714  102.434 111.334 1.00 152.56 ?  60  DT  I O2    1 
ATOM 8359  N N3    . DT  I 5 134 ? 61.043  101.389 110.236 1.00 152.56 ?  60  DT  I N3    1 
ATOM 8360  C C4    . DT  I 5 134 ? 60.508  100.408 109.427 1.00 152.56 ?  60  DT  I C4    1 
ATOM 8361  O O4    . DT  I 5 134 ? 59.317  100.368 109.148 1.00 152.56 ?  60  DT  I O4    1 
ATOM 8362  C C5    . DT  I 5 134 ? 61.448  99.434  108.937 1.00 152.56 ?  60  DT  I C5    1 
ATOM 8363  C C7    . DT  I 5 134 ? 60.980  98.317  108.054 1.00 152.56 ?  60  DT  I C7    1 
ATOM 8364  C C6    . DT  I 5 134 ? 62.732  99.557  109.307 1.00 152.56 ?  60  DT  I C6    1 
ATOM 8365  P P     . DA  I 5 135 ? 67.326  99.933  112.989 1.00 169.26 ?  61  DA  I P     1 
ATOM 8366  O OP1   . DA  I 5 135 ? 68.622  100.113 113.675 1.00 169.26 ?  61  DA  I OP1   1 
ATOM 8367  O OP2   . DA  I 5 135 ? 66.371  98.958  113.562 1.00 169.26 -1 61  DA  I OP2   1 
ATOM 8368  O "O5'" . DA  I 5 135 ? 66.637  101.376 112.909 1.00 169.26 ?  61  DA  I "O5'" 1 
ATOM 8369  C "C5'" . DA  I 5 135 ? 66.631  102.235 114.045 1.00 169.26 ?  61  DA  I "C5'" 1 
ATOM 8370  C "C4'" . DA  I 5 135 ? 65.388  102.030 114.904 1.00 169.26 ?  61  DA  I "C4'" 1 
ATOM 8371  O "O4'" . DA  I 5 135 ? 64.251  101.714 114.084 1.00 169.26 ?  61  DA  I "O4'" 1 
ATOM 8372  C "C3'" . DA  I 5 135 ? 65.477  100.901 115.928 1.00 169.26 ?  61  DA  I "C3'" 1 
ATOM 8373  O "O3'" . DA  I 5 135 ? 65.712  101.454 117.215 1.00 169.26 ?  61  DA  I "O3'" 1 
ATOM 8374  C "C2'" . DA  I 5 135 ? 64.114  100.180 115.834 1.00 169.26 ?  61  DA  I "C2'" 1 
ATOM 8375  C "C1'" . DA  I 5 135 ? 63.305  101.065 114.891 1.00 169.26 ?  61  DA  I "C1'" 1 
ATOM 8376  N N9    . DA  I 5 135 ? 62.383  100.338 114.016 1.00 169.26 ?  61  DA  I N9    1 
ATOM 8377  C C8    . DA  I 5 135 ? 62.690  99.321  113.157 1.00 169.26 ?  61  DA  I C8    1 
ATOM 8378  N N7    . DA  I 5 135 ? 61.664  98.875  112.469 1.00 169.26 ?  61  DA  I N7    1 
ATOM 8379  C C5    . DA  I 5 135 ? 60.610  99.657  112.904 1.00 169.26 ?  61  DA  I C5    1 
ATOM 8380  C C6    . DA  I 5 135 ? 59.242  99.689  112.562 1.00 169.26 ?  61  DA  I C6    1 
ATOM 8381  N N6    . DA  I 5 135 ? 58.687  98.871  111.662 1.00 169.26 ?  61  DA  I N6    1 
ATOM 8382  N N1    . DA  I 5 135 ? 58.463  100.596 113.184 1.00 169.26 ?  61  DA  I N1    1 
ATOM 8383  C C2    . DA  I 5 135 ? 59.014  101.410 114.091 1.00 169.26 ?  61  DA  I C2    1 
ATOM 8384  N N3    . DA  I 5 135 ? 60.283  101.483 114.488 1.00 169.26 ?  61  DA  I N3    1 
ATOM 8385  C C4    . DA  I 5 135 ? 61.036  100.570 113.853 1.00 169.26 ?  61  DA  I C4    1 
ATOM 8386  P P     . DT  I 5 136 ? 65.675  100.538 118.533 1.00 181.17 ?  62  DT  I P     1 
ATOM 8387  O OP1   . DT  I 5 136 ? 66.654  101.103 119.488 1.00 181.17 ?  62  DT  I OP1   1 
ATOM 8388  O OP2   . DT  I 5 136 ? 65.780  99.115  118.138 1.00 181.17 -1 62  DT  I OP2   1 
ATOM 8389  O "O5'" . DT  I 5 136 ? 64.213  100.801 119.108 1.00 181.17 ?  62  DT  I "O5'" 1 
ATOM 8390  C "C5'" . DT  I 5 136 ? 63.644  102.100 119.002 1.00 181.17 ?  62  DT  I "C5'" 1 
ATOM 8391  C "C4'" . DT  I 5 136 ? 62.196  102.088 119.438 1.00 181.17 ?  62  DT  I "C4'" 1 
ATOM 8392  O "O4'" . DT  I 5 136 ? 61.365  101.564 118.371 1.00 181.17 ?  62  DT  I "O4'" 1 
ATOM 8393  C "C3'" . DT  I 5 136 ? 61.908  101.231 120.668 1.00 181.17 ?  62  DT  I "C3'" 1 
ATOM 8394  O "O3'" . DT  I 5 136 ? 61.087  101.948 121.562 1.00 181.17 ?  62  DT  I "O3'" 1 
ATOM 8395  C "C2'" . DT  I 5 136 ? 61.188  100.008 120.095 1.00 181.17 ?  62  DT  I "C2'" 1 
ATOM 8396  C "C1'" . DT  I 5 136 ? 60.476  100.608 118.897 1.00 181.17 ?  62  DT  I "C1'" 1 
ATOM 8397  N N1    . DT  I 5 136 ? 60.160  99.626  117.817 1.00 181.17 ?  62  DT  I N1    1 
ATOM 8398  C C2    . DT  I 5 136 ? 58.878  99.552  117.333 1.00 181.17 ?  62  DT  I C2    1 
ATOM 8399  O O2    . DT  I 5 136 ? 57.965  100.240 117.750 1.00 181.17 ?  62  DT  I O2    1 
ATOM 8400  N N3    . DT  I 5 136 ? 58.697  98.633  116.339 1.00 181.17 ?  62  DT  I N3    1 
ATOM 8401  C C4    . DT  I 5 136 ? 59.645  97.801  115.787 1.00 181.17 ?  62  DT  I C4    1 
ATOM 8402  O O4    . DT  I 5 136 ? 59.378  97.007  114.894 1.00 181.17 ?  62  DT  I O4    1 
ATOM 8403  C C5    . DT  I 5 136 ? 60.968  97.930  116.332 1.00 181.17 ?  62  DT  I C5    1 
ATOM 8404  C C7    . DT  I 5 136 ? 62.080  97.073  115.810 1.00 181.17 ?  62  DT  I C7    1 
ATOM 8405  C C6    . DT  I 5 136 ? 61.162  98.826  117.312 1.00 181.17 ?  62  DT  I C6    1 
ATOM 8406  P P     . DA  I 5 137 ? 60.792  101.366 123.027 1.00 190.44 ?  63  DA  I P     1 
ATOM 8407  O OP1   . DA  I 5 137 ? 60.794  102.508 123.966 1.00 190.44 ?  63  DA  I OP1   1 
ATOM 8408  O OP2   . DA  I 5 137 ? 61.703  100.222 123.253 1.00 190.44 -1 63  DA  I OP2   1 
ATOM 8409  O "O5'" . DA  I 5 137 ? 59.309  100.793 122.904 1.00 190.44 ?  63  DA  I "O5'" 1 
ATOM 8410  C "C5'" . DA  I 5 137 ? 58.292  101.593 122.323 1.00 190.44 ?  63  DA  I "C5'" 1 
ATOM 8411  C "C4'" . DA  I 5 137 ? 57.042  100.772 122.093 1.00 190.44 ?  63  DA  I "C4'" 1 
ATOM 8412  O "O4'" . DA  I 5 137 ? 57.178  100.023 120.862 1.00 190.44 ?  63  DA  I "O4'" 1 
ATOM 8413  C "C3'" . DA  I 5 137 ? 56.743  99.751  123.194 1.00 190.44 ?  63  DA  I "C3'" 1 
ATOM 8414  O "O3'" . DA  I 5 137 ? 55.425  99.931  123.686 1.00 190.44 ?  63  DA  I "O3'" 1 
ATOM 8415  C "C2'" . DA  I 5 137 ? 56.914  98.394  122.509 1.00 190.44 ?  63  DA  I "C2'" 1 
ATOM 8416  C "C1'" . DA  I 5 137 ? 56.678  98.725  121.046 1.00 190.44 ?  63  DA  I "C1'" 1 
ATOM 8417  N N9    . DA  I 5 137 ? 57.386  97.832  120.140 1.00 190.44 ?  63  DA  I N9    1 
ATOM 8418  C C8    . DA  I 5 137 ? 58.723  97.564  120.129 1.00 190.44 ?  63  DA  I C8    1 
ATOM 8419  N N7    . DA  I 5 137 ? 59.088  96.717  119.198 1.00 190.44 ?  63  DA  I N7    1 
ATOM 8420  C C5    . DA  I 5 137 ? 57.905  96.409  118.557 1.00 190.44 ?  63  DA  I C5    1 
ATOM 8421  C C6    . DA  I 5 137 ? 57.608  95.566  117.474 1.00 190.44 ?  63  DA  I C6    1 
ATOM 8422  N N6    . DA  I 5 137 ? 58.531  94.852  116.826 1.00 190.44 ?  63  DA  I N6    1 
ATOM 8423  N N1    . DA  I 5 137 ? 56.321  95.487  117.081 1.00 190.44 ?  63  DA  I N1    1 
ATOM 8424  C C2    . DA  I 5 137 ? 55.400  96.208  117.729 1.00 190.44 ?  63  DA  I C2    1 
ATOM 8425  N N3    . DA  I 5 137 ? 55.559  97.031  118.759 1.00 190.44 ?  63  DA  I N3    1 
ATOM 8426  C C4    . DA  I 5 137 ? 56.846  97.088  119.126 1.00 190.44 ?  63  DA  I C4    1 
ATOM 8427  P P     . DT  I 5 138 ? 54.869  98.994  124.866 1.00 195.46 ?  64  DT  I P     1 
ATOM 8428  O OP1   . DT  I 5 138 ? 54.060  99.843  125.767 1.00 195.46 ?  64  DT  I OP1   1 
ATOM 8429  O OP2   . DT  I 5 138 ? 56.005  98.225  125.419 1.00 195.46 -1 64  DT  I OP2   1 
ATOM 8430  O "O5'" . DT  I 5 138 ? 53.898  97.977  124.109 1.00 195.46 ?  64  DT  I "O5'" 1 
ATOM 8431  C "C5'" . DT  I 5 138 ? 52.860  98.484  123.281 1.00 195.46 ?  64  DT  I "C5'" 1 
ATOM 8432  C "C4'" . DT  I 5 138 ? 52.217  97.378  122.466 1.00 195.46 ?  64  DT  I "C4'" 1 
ATOM 8433  O "O4'" . DT  I 5 138 ? 53.189  96.816  121.542 1.00 195.46 ?  64  DT  I "O4'" 1 
ATOM 8434  C "C3'" . DT  I 5 138 ? 51.677  96.194  123.279 1.00 195.46 ?  64  DT  I "C3'" 1 
ATOM 8435  O "O3'" . DT  I 5 138 ? 50.390  95.820  122.788 1.00 195.46 ?  64  DT  I "O3'" 1 
ATOM 8436  C "C2'" . DT  I 5 138 ? 52.708  95.103  123.012 1.00 195.46 ?  64  DT  I "C2'" 1 
ATOM 8437  C "C1'" . DT  I 5 138 ? 53.067  95.419  121.575 1.00 195.46 ?  64  DT  I "C1'" 1 
ATOM 8438  N N1    . DT  I 5 138 ? 54.337  94.800  121.112 1.00 195.46 ?  64  DT  I N1    1 
ATOM 8439  C C2    . DT  I 5 138 ? 54.308  93.968  120.022 1.00 195.46 ?  64  DT  I C2    1 
ATOM 8440  O O2    . DT  I 5 138 ? 53.290  93.714  119.404 1.00 195.46 ?  64  DT  I O2    1 
ATOM 8441  N N3    . DT  I 5 138 ? 55.517  93.444  119.668 1.00 195.46 ?  64  DT  I N3    1 
ATOM 8442  C C4    . DT  I 5 138 ? 56.730  93.658  120.287 1.00 195.46 ?  64  DT  I C4    1 
ATOM 8443  O O4    . DT  I 5 138 ? 57.765  93.135  119.891 1.00 195.46 ?  64  DT  I O4    1 
ATOM 8444  C C5    . DT  I 5 138 ? 56.693  94.538  121.429 1.00 195.46 ?  64  DT  I C5    1 
ATOM 8445  C C7    . DT  I 5 138 ? 57.951  94.840  122.184 1.00 195.46 ?  64  DT  I C7    1 
ATOM 8446  C C6    . DT  I 5 138 ? 55.511  95.061  121.784 1.00 195.46 ?  64  DT  I C6    1 
ATOM 8447  P P     . DA  I 5 139 ? 49.421  94.890  123.670 1.00 199.08 ?  65  DA  I P     1 
ATOM 8448  O OP1   . DA  I 5 139 ? 48.190  95.660  123.949 1.00 199.08 ?  65  DA  I OP1   1 
ATOM 8449  O OP2   . DA  I 5 139 ? 50.222  94.344  124.788 1.00 199.08 -1 65  DA  I OP2   1 
ATOM 8450  O "O5'" . DA  I 5 139 ? 49.054  93.674  122.697 1.00 199.08 ?  65  DA  I "O5'" 1 
ATOM 8451  C "C5'" . DA  I 5 139 ? 47.776  93.617  122.065 1.00 199.08 ?  65  DA  I "C5'" 1 
ATOM 8452  C "C4'" . DA  I 5 139 ? 47.771  92.599  120.933 1.00 199.08 ?  65  DA  I "C4'" 1 
ATOM 8453  O "O4'" . DA  I 5 139 ? 49.105  92.500  120.372 1.00 199.08 ?  65  DA  I "O4'" 1 
ATOM 8454  C "C3'" . DA  I 5 139 ? 47.390  91.175  121.333 1.00 199.08 ?  65  DA  I "C3'" 1 
ATOM 8455  O "O3'" . DA  I 5 139 ? 46.753  90.520  120.243 1.00 199.08 ?  65  DA  I "O3'" 1 
ATOM 8456  C "C2'" . DA  I 5 139 ? 48.743  90.551  121.626 1.00 199.08 ?  65  DA  I "C2'" 1 
ATOM 8457  C "C1'" . DA  I 5 139 ? 49.595  91.185  120.538 1.00 199.08 ?  65  DA  I "C1'" 1 
ATOM 8458  N N9    . DA  I 5 139 ? 51.002  91.262  120.889 1.00 199.08 ?  65  DA  I N9    1 
ATOM 8459  C C8    . DA  I 5 139 ? 51.561  92.001  121.889 1.00 199.08 ?  65  DA  I C8    1 
ATOM 8460  N N7    . DA  I 5 139 ? 52.861  91.871  121.978 1.00 199.08 ?  65  DA  I N7    1 
ATOM 8461  C C5    . DA  I 5 139 ? 53.170  90.983  120.968 1.00 199.08 ?  65  DA  I C5    1 
ATOM 8462  C C6    . DA  I 5 139 ? 54.383  90.435  120.530 1.00 199.08 ?  65  DA  I C6    1 
ATOM 8463  N N6    . DA  I 5 139 ? 55.561  90.716  121.092 1.00 199.08 ?  65  DA  I N6    1 
ATOM 8464  N N1    . DA  I 5 139 ? 54.341  89.578  119.491 1.00 199.08 ?  65  DA  I N1    1 
ATOM 8465  C C2    . DA  I 5 139 ? 53.162  89.296  118.930 1.00 199.08 ?  65  DA  I C2    1 
ATOM 8466  N N3    . DA  I 5 139 ? 51.958  89.751  119.252 1.00 199.08 ?  65  DA  I N3    1 
ATOM 8467  C C4    . DA  I 5 139 ? 52.035  90.603  120.284 1.00 199.08 ?  65  DA  I C4    1 
ATOM 8468  P P     . DC  I 5 140 ? 46.177  89.029  120.418 1.00 201.70 ?  66  DC  I P     1 
ATOM 8469  O OP1   . DC  I 5 140 ? 44.823  89.004  119.823 1.00 201.70 ?  66  DC  I OP1   1 
ATOM 8470  O OP2   . DC  I 5 140 ? 46.361  88.633  121.832 1.00 201.70 -1 66  DC  I OP2   1 
ATOM 8471  O "O5'" . DC  I 5 140 ? 47.149  88.122  119.523 1.00 201.70 ?  66  DC  I "O5'" 1 
ATOM 8472  C "C5'" . DC  I 5 140 ? 46.884  86.724  119.379 1.00 201.70 ?  66  DC  I "C5'" 1 
ATOM 8473  C "C4'" . DC  I 5 140 ? 47.886  86.069  118.444 1.00 201.70 ?  66  DC  I "C4'" 1 
ATOM 8474  O "O4'" . DC  I 5 140 ? 49.192  86.675  118.640 1.00 201.70 ?  66  DC  I "O4'" 1 
ATOM 8475  C "C3'" . DC  I 5 140 ? 48.096  84.575  118.678 1.00 201.70 ?  66  DC  I "C3'" 1 
ATOM 8476  O "O3'" . DC  I 5 140 ? 48.480  83.936  117.461 1.00 201.70 ?  66  DC  I "O3'" 1 
ATOM 8477  C "C2'" . DC  I 5 140 ? 49.241  84.581  119.678 1.00 201.70 ?  66  DC  I "C2'" 1 
ATOM 8478  C "C1'" . DC  I 5 140 ? 50.097  85.691  119.097 1.00 201.70 ?  66  DC  I "C1'" 1 
ATOM 8479  N N1    . DC  I 5 140 ? 51.022  86.310  120.074 1.00 201.70 ?  66  DC  I N1    1 
ATOM 8480  C C2    . DC  I 5 140 ? 52.380  86.015  120.002 1.00 201.70 ?  66  DC  I C2    1 
ATOM 8481  O O2    . DC  I 5 140 ? 52.770  85.240  119.124 1.00 201.70 ?  66  DC  I O2    1 
ATOM 8482  N N3    . DC  I 5 140 ? 53.224  86.582  120.894 1.00 201.70 ?  66  DC  I N3    1 
ATOM 8483  C C4    . DC  I 5 140 ? 52.751  87.414  121.822 1.00 201.70 ?  66  DC  I C4    1 
ATOM 8484  N N4    . DC  I 5 140 ? 53.622  87.954  122.681 1.00 201.70 ?  66  DC  I N4    1 
ATOM 8485  C C5    . DC  I 5 140 ? 51.363  87.725  121.912 1.00 201.70 ?  66  DC  I C5    1 
ATOM 8486  C C6    . DC  I 5 140 ? 50.543  87.160  121.022 1.00 201.70 ?  66  DC  I C6    1 
ATOM 8487  P P     . DA  I 5 141 ? 48.418  82.333  117.328 1.00 208.73 ?  67  DA  I P     1 
ATOM 8488  O OP1   . DA  I 5 141 ? 47.082  81.981  116.800 1.00 208.73 ?  67  DA  I OP1   1 
ATOM 8489  O OP2   . DA  I 5 141 ? 48.890  81.745  118.601 1.00 208.73 -1 67  DA  I OP2   1 
ATOM 8490  O "O5'" . DA  I 5 141 ? 49.515  81.990  116.215 1.00 208.73 ?  67  DA  I "O5'" 1 
ATOM 8491  C "C5'" . DA  I 5 141 ? 50.882  82.292  116.454 1.00 208.73 ?  67  DA  I "C5'" 1 
ATOM 8492  C "C4'" . DA  I 5 141 ? 51.762  81.077  116.213 1.00 208.73 ?  67  DA  I "C4'" 1 
ATOM 8493  O "O4'" . DA  I 5 141 ? 52.950  81.194  117.023 1.00 208.73 ?  67  DA  I "O4'" 1 
ATOM 8494  C "C3'" . DA  I 5 141 ? 51.161  79.755  116.642 1.00 208.73 ?  67  DA  I "C3'" 1 
ATOM 8495  O "O3'" . DA  I 5 141 ? 51.865  78.682  116.019 1.00 208.73 ?  67  DA  I "O3'" 1 
ATOM 8496  C "C2'" . DA  I 5 141 ? 51.405  79.787  118.144 1.00 208.73 ?  67  DA  I "C2'" 1 
ATOM 8497  C "C1'" . DA  I 5 141 ? 52.757  80.495  118.240 1.00 208.73 ?  67  DA  I "C1'" 1 
ATOM 8498  N N9    . DA  I 5 141 ? 52.815  81.454  119.334 1.00 208.73 ?  67  DA  I N9    1 
ATOM 8499  C C8    . DA  I 5 141 ? 51.765  82.127  119.891 1.00 208.73 ?  67  DA  I C8    1 
ATOM 8500  N N7    . DA  I 5 141 ? 52.107  82.929  120.868 1.00 208.73 ?  67  DA  I N7    1 
ATOM 8501  C C5    . DA  I 5 141 ? 53.480  82.774  120.956 1.00 208.73 ?  67  DA  I C5    1 
ATOM 8502  C C6    . DA  I 5 141 ? 54.448  83.354  121.796 1.00 208.73 ?  67  DA  I C6    1 
ATOM 8503  N N6    . DA  I 5 141 ? 54.156  84.246  122.747 1.00 208.73 ?  67  DA  I N6    1 
ATOM 8504  N N1    . DA  I 5 141 ? 55.734  82.978  121.623 1.00 208.73 ?  67  DA  I N1    1 
ATOM 8505  C C2    . DA  I 5 141 ? 56.027  82.084  120.671 1.00 208.73 ?  67  DA  I C2    1 
ATOM 8506  N N3    . DA  I 5 141 ? 55.203  81.473  119.820 1.00 208.73 ?  67  DA  I N3    1 
ATOM 8507  C C4    . DA  I 5 141 ? 53.933  81.867  120.018 1.00 208.73 ?  67  DA  I C4    1 
ATOM 8508  P P     . DT  I 5 142 ? 51.695  77.167  116.535 1.00 210.76 ?  68  DT  I P     1 
ATOM 8509  O OP1   . DT  I 5 142 ? 51.841  76.296  115.350 1.00 210.76 ?  68  DT  I OP1   1 
ATOM 8510  O OP2   . DT  I 5 142 ? 50.470  77.046  117.356 1.00 210.76 -1 68  DT  I OP2   1 
ATOM 8511  O "O5'" . DT  I 5 142 ? 52.967  76.943  117.480 1.00 210.76 ?  68  DT  I "O5'" 1 
ATOM 8512  C "C5'" . DT  I 5 142 ? 54.278  77.051  116.933 1.00 210.76 ?  68  DT  I "C5'" 1 
ATOM 8513  C "C4'" . DT  I 5 142 ? 55.344  76.759  117.979 1.00 210.76 ?  68  DT  I "C4'" 1 
ATOM 8514  O "O4'" . DT  I 5 142 ? 55.337  77.800  118.988 1.00 210.76 ?  68  DT  I "O4'" 1 
ATOM 8515  C "C3'" . DT  I 5 142 ? 55.184  75.435  118.729 1.00 210.76 ?  68  DT  I "C3'" 1 
ATOM 8516  O "O3'" . DT  I 5 142 ? 56.450  74.795  118.856 1.00 210.76 ?  68  DT  I "O3'" 1 
ATOM 8517  C "C2'" . DT  I 5 142 ? 54.641  75.871  120.089 1.00 210.76 ?  68  DT  I "C2'" 1 
ATOM 8518  C "C1'" . DT  I 5 142 ? 55.332  77.210  120.264 1.00 210.76 ?  68  DT  I "C1'" 1 
ATOM 8519  N N1    . DT  I 5 142 ? 54.631  78.124  121.192 1.00 210.76 ?  68  DT  I N1    1 
ATOM 8520  C C2    . DT  I 5 142 ? 55.363  78.820  122.120 1.00 210.76 ?  68  DT  I C2    1 
ATOM 8521  O O2    . DT  I 5 142 ? 56.572  78.725  122.227 1.00 210.76 ?  68  DT  I O2    1 
ATOM 8522  N N3    . DT  I 5 142 ? 54.628  79.640  122.926 1.00 210.76 ?  68  DT  I N3    1 
ATOM 8523  C C4    . DT  I 5 142 ? 53.261  79.831  122.899 1.00 210.76 ?  68  DT  I C4    1 
ATOM 8524  O O4    . DT  I 5 142 ? 52.691  80.594  123.669 1.00 210.76 ?  68  DT  I O4    1 
ATOM 8525  C C5    . DT  I 5 142 ? 52.551  79.072  121.901 1.00 210.76 ?  68  DT  I C5    1 
ATOM 8526  C C7    . DT  I 5 142 ? 51.063  79.196  121.780 1.00 210.76 ?  68  DT  I C7    1 
ATOM 8527  C C6    . DT  I 5 142 ? 53.263  78.263  121.103 1.00 210.76 ?  68  DT  I C6    1 
ATOM 8528  P P     . DC  I 5 143 ? 56.746  73.426  118.069 1.00 210.76 ?  69  DC  I P     1 
ATOM 8529  O OP1   . DC  I 5 143 ? 57.371  73.778  116.777 1.00 210.76 ?  69  DC  I OP1   1 
ATOM 8530  O OP2   . DC  I 5 143 ? 55.497  72.635  118.084 1.00 210.76 -1 69  DC  I OP2   1 
ATOM 8531  O "O5'" . DC  I 5 143 ? 57.823  72.670  118.984 1.00 210.76 ?  69  DC  I "O5'" 1 
ATOM 8532  C "C5'" . DC  I 5 143 ? 59.219  72.942  118.833 1.00 210.76 ?  69  DC  I "C5'" 1 
ATOM 8533  C "C4'" . DC  I 5 143 ? 59.995  72.652  120.117 1.00 210.76 ?  69  DC  I "C4'" 1 
ATOM 8534  O "O4'" . DC  I 5 143 ? 59.432  73.406  121.219 1.00 210.76 ?  69  DC  I "O4'" 1 
ATOM 8535  C "C3'" . DC  I 5 143 ? 60.022  71.195  120.566 1.00 210.76 ?  69  DC  I "C3'" 1 
ATOM 8536  O "O3'" . DC  I 5 143 ? 61.292  70.884  121.123 1.00 210.76 ?  69  DC  I "O3'" 1 
ATOM 8537  C "C2'" . DC  I 5 143 ? 58.918  71.125  121.622 1.00 210.76 ?  69  DC  I "C2'" 1 
ATOM 8538  C "C1'" . DC  I 5 143 ? 58.919  72.536  122.210 1.00 210.76 ?  69  DC  I "C1'" 1 
ATOM 8539  N N1    . DC  I 5 143 ? 57.564  73.026  122.577 1.00 210.76 ?  69  DC  I N1    1 
ATOM 8540  C C2    . DC  I 5 143 ? 57.417  73.945  123.618 1.00 210.76 ?  69  DC  I C2    1 
ATOM 8541  O O2    . DC  I 5 143 ? 58.418  74.332  124.230 1.00 210.76 ?  69  DC  I O2    1 
ATOM 8542  N N3    . DC  I 5 143 ? 56.178  74.391  123.927 1.00 210.76 ?  69  DC  I N3    1 
ATOM 8543  C C4    . DC  I 5 143 ? 55.121  73.955  123.244 1.00 210.76 ?  69  DC  I C4    1 
ATOM 8544  N N4    . DC  I 5 143 ? 53.920  74.426  123.586 1.00 210.76 ?  69  DC  I N4    1 
ATOM 8545  C C5    . DC  I 5 143 ? 55.250  73.020  122.178 1.00 210.76 ?  69  DC  I C5    1 
ATOM 8546  C C6    . DC  I 5 143 ? 56.477  72.591  121.879 1.00 210.76 ?  69  DC  I C6    1 
ATOM 8547  P P     . DG  J 6 5   ? 53.859  76.911  130.818 1.00 211.90 ?  -69 DG  J P     1 
ATOM 8548  O OP1   . DG  J 6 5   ? 53.006  77.965  130.226 1.00 211.90 ?  -69 DG  J OP1   1 
ATOM 8549  O OP2   . DG  J 6 5   ? 53.950  75.583  130.171 1.00 211.90 -1 -69 DG  J OP2   1 
ATOM 8550  O "O5'" . DG  J 6 5   ? 55.340  77.489  130.992 1.00 211.90 ?  -69 DG  J "O5'" 1 
ATOM 8551  C "C5'" . DG  J 6 5   ? 55.566  78.613  131.831 1.00 211.90 ?  -69 DG  J "C5'" 1 
ATOM 8552  C "C4'" . DG  J 6 5   ? 56.687  79.478  131.285 1.00 211.90 ?  -69 DG  J "C4'" 1 
ATOM 8553  O "O4'" . DG  J 6 5   ? 56.899  79.162  129.890 1.00 211.90 ?  -69 DG  J "O4'" 1 
ATOM 8554  C "C3'" . DG  J 6 5   ? 56.404  80.969  131.301 1.00 211.90 ?  -69 DG  J "C3'" 1 
ATOM 8555  O "O3'" . DG  J 6 5   ? 57.622  81.691  131.249 1.00 211.90 ?  -69 DG  J "O3'" 1 
ATOM 8556  C "C2'" . DG  J 6 5   ? 55.613  81.140  130.015 1.00 211.90 ?  -69 DG  J "C2'" 1 
ATOM 8557  C "C1'" . DG  J 6 5   ? 56.359  80.192  129.081 1.00 211.90 ?  -69 DG  J "C1'" 1 
ATOM 8558  N N9    . DG  J 6 5   ? 55.503  79.579  128.078 1.00 211.90 ?  -69 DG  J N9    1 
ATOM 8559  C C8    . DG  J 6 5   ? 54.158  79.790  127.894 1.00 211.90 ?  -69 DG  J C8    1 
ATOM 8560  N N7    . DG  J 6 5   ? 53.654  79.094  126.915 1.00 211.90 ?  -69 DG  J N7    1 
ATOM 8561  C C5    . DG  J 6 5   ? 54.733  78.375  126.421 1.00 211.90 ?  -69 DG  J C5    1 
ATOM 8562  C C6    . DG  J 6 5   ? 54.800  77.451  125.357 1.00 211.90 ?  -69 DG  J C6    1 
ATOM 8563  O O6    . DG  J 6 5   ? 53.889  77.065  124.618 1.00 211.90 ?  -69 DG  J O6    1 
ATOM 8564  N N1    . DG  J 6 5   ? 56.086  76.951  125.190 1.00 211.90 ?  -69 DG  J N1    1 
ATOM 8565  C C2    . DG  J 6 5   ? 57.173  77.301  125.954 1.00 211.90 ?  -69 DG  J C2    1 
ATOM 8566  N N2    . DG  J 6 5   ? 58.335  76.711  125.641 1.00 211.90 ?  -69 DG  J N2    1 
ATOM 8567  N N3    . DG  J 6 5   ? 57.125  78.168  126.953 1.00 211.90 ?  -69 DG  J N3    1 
ATOM 8568  C C4    . DG  J 6 5   ? 55.877  78.663  127.128 1.00 211.90 ?  -69 DG  J C4    1 
ATOM 8569  P P     . DA  J 6 6   ? 57.655  83.246  131.650 1.00 209.78 ?  -68 DA  J P     1 
ATOM 8570  O OP1   . DA  J 6 6   ? 57.636  83.333  133.127 1.00 209.78 ?  -68 DA  J OP1   1 
ATOM 8571  O OP2   . DA  J 6 6   ? 56.608  83.933  130.863 1.00 209.78 -1 -68 DA  J OP2   1 
ATOM 8572  O "O5'" . DA  J 6 6   ? 59.075  83.746  131.112 1.00 209.78 ?  -68 DA  J "O5'" 1 
ATOM 8573  C "C5'" . DA  J 6 6   ? 60.225  82.923  131.267 1.00 209.78 ?  -68 DA  J "C5'" 1 
ATOM 8574  C "C4'" . DA  J 6 6   ? 60.866  82.617  129.923 1.00 209.78 ?  -68 DA  J "C4'" 1 
ATOM 8575  O "O4'" . DA  J 6 6   ? 59.877  82.056  129.023 1.00 209.78 ?  -68 DA  J "O4'" 1 
ATOM 8576  C "C3'" . DA  J 6 6   ? 61.473  83.816  129.199 1.00 209.78 ?  -68 DA  J "C3'" 1 
ATOM 8577  O "O3'" . DA  J 6 6   ? 62.695  83.432  128.590 1.00 209.78 ?  -68 DA  J "O3'" 1 
ATOM 8578  C "C2'" . DA  J 6 6   ? 60.412  84.180  128.159 1.00 209.78 ?  -68 DA  J "C2'" 1 
ATOM 8579  C "C1'" . DA  J 6 6   ? 59.796  82.826  127.839 1.00 209.78 ?  -68 DA  J "C1'" 1 
ATOM 8580  N N9    . DA  J 6 6   ? 58.391  82.902  127.459 1.00 209.78 ?  -68 DA  J N9    1 
ATOM 8581  C C8    . DA  J 6 6   ? 57.425  83.680  128.033 1.00 209.78 ?  -68 DA  J C8    1 
ATOM 8582  N N7    . DA  J 6 6   ? 56.239  83.535  127.496 1.00 209.78 ?  -68 DA  J N7    1 
ATOM 8583  C C5    . DA  J 6 6   ? 56.439  82.594  126.503 1.00 209.78 ?  -68 DA  J C5    1 
ATOM 8584  C C6    . DA  J 6 6   ? 55.571  82.001  125.572 1.00 209.78 ?  -68 DA  J C6    1 
ATOM 8585  N N6    . DA  J 6 6   ? 54.271  82.295  125.491 1.00 209.78 ?  -68 DA  J N6    1 
ATOM 8586  N N1    . DA  J 6 6   ? 56.091  81.092  124.723 1.00 209.78 ?  -68 DA  J N1    1 
ATOM 8587  C C2    . DA  J 6 6   ? 57.392  80.796  124.804 1.00 209.78 ?  -68 DA  J C2    1 
ATOM 8588  N N3    . DA  J 6 6   ? 58.307  81.285  125.638 1.00 209.78 ?  -68 DA  J N3    1 
ATOM 8589  C C4    . DA  J 6 6   ? 57.759  82.187  126.470 1.00 209.78 ?  -68 DA  J C4    1 
ATOM 8590  P P     . DT  J 6 7   ? 63.569  84.504  127.774 1.00 208.35 ?  -67 DT  J P     1 
ATOM 8591  O OP1   . DT  J 6 7   ? 64.989  84.272  128.120 1.00 208.35 ?  -67 DT  J OP1   1 
ATOM 8592  O OP2   . DT  J 6 7   ? 62.973  85.842  127.980 1.00 208.35 -1 -67 DT  J OP2   1 
ATOM 8593  O "O5'" . DT  J 6 7   ? 63.341  84.092  126.248 1.00 208.35 ?  -67 DT  J "O5'" 1 
ATOM 8594  C "C5'" . DT  J 6 7   ? 63.715  82.794  125.799 1.00 208.35 ?  -67 DT  J "C5'" 1 
ATOM 8595  C "C4'" . DT  J 6 7   ? 63.330  82.586  124.343 1.00 208.35 ?  -67 DT  J "C4'" 1 
ATOM 8596  O "O4'" . DT  J 6 7   ? 61.883  82.565  124.219 1.00 208.35 ?  -67 DT  J "O4'" 1 
ATOM 8597  C "C3'" . DT  J 6 7   ? 63.823  83.668  123.377 1.00 208.35 ?  -67 DT  J "C3'" 1 
ATOM 8598  O "O3'" . DT  J 6 7   ? 64.301  83.070  122.178 1.00 208.35 ?  -67 DT  J "O3'" 1 
ATOM 8599  C "C2'" . DT  J 6 7   ? 62.568  84.493  123.117 1.00 208.35 ?  -67 DT  J "C2'" 1 
ATOM 8600  C "C1'" . DT  J 6 7   ? 61.503  83.415  123.163 1.00 208.35 ?  -67 DT  J "C1'" 1 
ATOM 8601  N N1    . DT  J 6 7   ? 60.140  83.934  123.436 1.00 208.35 ?  -67 DT  J N1    1 
ATOM 8602  C C2    . DT  J 6 7   ? 59.080  83.439  122.718 1.00 208.35 ?  -67 DT  J C2    1 
ATOM 8603  O O2    . DT  J 6 7   ? 59.195  82.582  121.862 1.00 208.35 ?  -67 DT  J O2    1 
ATOM 8604  N N3    . DT  J 6 7   ? 57.870  83.981  123.041 1.00 208.35 ?  -67 DT  J N3    1 
ATOM 8605  C C4    . DT  J 6 7   ? 57.617  84.952  123.988 1.00 208.35 ?  -67 DT  J C4    1 
ATOM 8606  O O4    . DT  J 6 7   ? 56.489  85.375  124.204 1.00 208.35 ?  -67 DT  J O4    1 
ATOM 8607  C C5    . DT  J 6 7   ? 58.773  85.432  124.704 1.00 208.35 ?  -67 DT  J C5    1 
ATOM 8608  C C7    . DT  J 6 7   ? 58.622  86.488  125.757 1.00 208.35 ?  -67 DT  J C7    1 
ATOM 8609  C C6    . DT  J 6 7   ? 59.966  84.907  124.396 1.00 208.35 ?  -67 DT  J C6    1 
ATOM 8610  P P     . DG  J 6 8   ? 65.274  83.892  121.198 1.00 201.13 ?  -66 DG  J P     1 
ATOM 8611  O OP1   . DG  J 6 8   ? 65.933  82.918  120.301 1.00 201.13 ?  -66 DG  J OP1   1 
ATOM 8612  O OP2   . DG  J 6 8   ? 66.090  84.791  122.043 1.00 201.13 -1 -66 DG  J OP2   1 
ATOM 8613  O "O5'" . DG  J 6 8   ? 64.284  84.801  120.329 1.00 201.13 ?  -66 DG  J "O5'" 1 
ATOM 8614  C "C5'" . DG  J 6 8   ? 64.018  84.474  118.969 1.00 201.13 ?  -66 DG  J "C5'" 1 
ATOM 8615  C "C4'" . DG  J 6 8   ? 62.734  83.675  118.844 1.00 201.13 ?  -66 DG  J "C4'" 1 
ATOM 8616  O "O4'" . DG  J 6 8   ? 61.804  84.083  119.886 1.00 201.13 ?  -66 DG  J "O4'" 1 
ATOM 8617  C "C3'" . DG  J 6 8   ? 61.978  83.867  117.523 1.00 201.13 ?  -66 DG  J "C3'" 1 
ATOM 8618  O "O3'" . DG  J 6 8   ? 61.360  82.644  117.138 1.00 201.13 ?  -66 DG  J "O3'" 1 
ATOM 8619  C "C2'" . DG  J 6 8   ? 60.934  84.899  117.909 1.00 201.13 ?  -66 DG  J "C2'" 1 
ATOM 8620  C "C1'" . DG  J 6 8   ? 60.571  84.379  119.280 1.00 201.13 ?  -66 DG  J "C1'" 1 
ATOM 8621  N N9    . DG  J 6 8   ? 59.826  85.323  120.103 1.00 201.13 ?  -66 DG  J N9    1 
ATOM 8622  C C8    . DG  J 6 8   ? 60.315  86.171  121.065 1.00 201.13 ?  -66 DG  J C8    1 
ATOM 8623  N N7    . DG  J 6 8   ? 59.390  86.892  121.636 1.00 201.13 ?  -66 DG  J N7    1 
ATOM 8624  C C5    . DG  J 6 8   ? 58.216  86.492  121.010 1.00 201.13 ?  -66 DG  J C5    1 
ATOM 8625  C C6    . DG  J 6 8   ? 56.883  86.918  121.205 1.00 201.13 ?  -66 DG  J C6    1 
ATOM 8626  O O6    . DG  J 6 8   ? 56.454  87.766  121.997 1.00 201.13 ?  -66 DG  J O6    1 
ATOM 8627  N N1    . DG  J 6 8   ? 56.001  86.251  120.360 1.00 201.13 ?  -66 DG  J N1    1 
ATOM 8628  C C2    . DG  J 6 8   ? 56.363  85.292  119.446 1.00 201.13 ?  -66 DG  J C2    1 
ATOM 8629  N N2    . DG  J 6 8   ? 55.380  84.754  118.716 1.00 201.13 ?  -66 DG  J N2    1 
ATOM 8630  N N3    . DG  J 6 8   ? 57.605  84.886  119.256 1.00 201.13 ?  -66 DG  J N3    1 
ATOM 8631  C C4    . DG  J 6 8   ? 58.474  85.526  120.069 1.00 201.13 ?  -66 DG  J C4    1 
ATOM 8632  P P     . DT  J 6 9   ? 60.983  82.370  115.600 1.00 192.98 ?  -65 DT  J P     1 
ATOM 8633  O OP1   . DT  J 6 9   ? 60.494  80.977  115.506 1.00 192.98 ?  -65 DT  J OP1   1 
ATOM 8634  O OP2   . DT  J 6 9   ? 62.122  82.819  114.772 1.00 192.98 -1 -65 DT  J OP2   1 
ATOM 8635  O "O5'" . DT  J 6 9   ? 59.740  83.337  115.311 1.00 192.98 ?  -65 DT  J "O5'" 1 
ATOM 8636  C "C5'" . DT  J 6 9   ? 58.439  82.955  115.734 1.00 192.98 ?  -65 DT  J "C5'" 1 
ATOM 8637  C "C4'" . DT  J 6 9   ? 57.375  83.859  115.135 1.00 192.98 ?  -65 DT  J "C4'" 1 
ATOM 8638  O "O4'" . DT  J 6 9   ? 56.947  84.831  116.124 1.00 192.98 ?  -65 DT  J "O4'" 1 
ATOM 8639  C "C3'" . DT  J 6 9   ? 57.805  84.666  113.905 1.00 192.98 ?  -65 DT  J "C3'" 1 
ATOM 8640  O "O3'" . DT  J 6 9   ? 56.751  84.659  112.944 1.00 192.98 ?  -65 DT  J "O3'" 1 
ATOM 8641  C "C2'" . DT  J 6 9   ? 58.029  86.063  114.482 1.00 192.98 ?  -65 DT  J "C2'" 1 
ATOM 8642  C "C1'" . DT  J 6 9   ? 56.947  86.108  115.538 1.00 192.98 ?  -65 DT  J "C1'" 1 
ATOM 8643  N N1    . DT  J 6 9   ? 57.188  87.107  116.596 1.00 192.98 ?  -65 DT  J N1    1 
ATOM 8644  C C2    . DT  J 6 9   ? 56.120  87.764  117.136 1.00 192.98 ?  -65 DT  J C2    1 
ATOM 8645  O O2    . DT  J 6 9   ? 54.971  87.570  116.784 1.00 192.98 ?  -65 DT  J O2    1 
ATOM 8646  N N3    . DT  J 6 9   ? 56.438  88.666  118.109 1.00 192.98 ?  -65 DT  J N3    1 
ATOM 8647  C C4    . DT  J 6 9   ? 57.694  88.971  118.588 1.00 192.98 ?  -65 DT  J C4    1 
ATOM 8648  O O4    . DT  J 6 9   ? 57.874  89.801  119.469 1.00 192.98 ?  -65 DT  J O4    1 
ATOM 8649  C C5    . DT  J 6 9   ? 58.775  88.245  117.979 1.00 192.98 ?  -65 DT  J C5    1 
ATOM 8650  C C7    . DT  J 6 9   ? 60.186  88.495  118.417 1.00 192.98 ?  -65 DT  J C7    1 
ATOM 8651  C C6    . DT  J 6 9   ? 58.475  87.356  117.021 1.00 192.98 ?  -65 DT  J C6    1 
ATOM 8652  P P     . DA  J 6 10  ? 56.905  85.418  111.534 1.00 189.48 ?  -64 DA  J P     1 
ATOM 8653  O OP1   . DA  J 6 10  ? 56.572  84.435  110.482 1.00 189.48 ?  -64 DA  J OP1   1 
ATOM 8654  O OP2   . DA  J 6 10  ? 58.210  86.111  111.483 1.00 189.48 -1 -64 DA  J OP2   1 
ATOM 8655  O "O5'" . DA  J 6 10  ? 55.748  86.523  111.573 1.00 189.48 ?  -64 DA  J "O5'" 1 
ATOM 8656  C "C5'" . DA  J 6 10  ? 54.384  86.114  111.615 1.00 189.48 ?  -64 DA  J "C5'" 1 
ATOM 8657  C "C4'" . DA  J 6 10  ? 53.498  87.214  112.176 1.00 189.48 ?  -64 DA  J "C4'" 1 
ATOM 8658  O "O4'" . DA  J 6 10  ? 54.084  87.737  113.398 1.00 189.48 ?  -64 DA  J "O4'" 1 
ATOM 8659  C "C3'" . DA  J 6 10  ? 53.288  88.415  111.250 1.00 189.48 ?  -64 DA  J "C3'" 1 
ATOM 8660  O "O3'" . DA  J 6 10  ? 51.908  88.758  111.188 1.00 189.48 ?  -64 DA  J "O3'" 1 
ATOM 8661  C "C2'" . DA  J 6 10  ? 54.110  89.523  111.901 1.00 189.48 ?  -64 DA  J "C2'" 1 
ATOM 8662  C "C1'" . DA  J 6 10  ? 54.049  89.142  113.370 1.00 189.48 ?  -64 DA  J "C1'" 1 
ATOM 8663  N N9    . DA  J 6 10  ? 55.175  89.645  114.151 1.00 189.48 ?  -64 DA  J N9    1 
ATOM 8664  C C8    . DA  J 6 10  ? 56.488  89.282  114.034 1.00 189.48 ?  -64 DA  J C8    1 
ATOM 8665  N N7    . DA  J 6 10  ? 57.285  89.900  114.875 1.00 189.48 ?  -64 DA  J N7    1 
ATOM 8666  C C5    . DA  J 6 10  ? 56.434  90.723  115.593 1.00 189.48 ?  -64 DA  J C5    1 
ATOM 8667  C C6    . DA  J 6 10  ? 56.655  91.637  116.643 1.00 189.48 ?  -64 DA  J C6    1 
ATOM 8668  N N6    . DA  J 6 10  ? 57.861  91.879  117.164 1.00 189.48 ?  -64 DA  J N6    1 
ATOM 8669  N N1    . DA  J 6 10  ? 55.584  92.293  117.140 1.00 189.48 ?  -64 DA  J N1    1 
ATOM 8670  C C2    . DA  J 6 10  ? 54.378  92.046  116.618 1.00 189.48 ?  -64 DA  J C2    1 
ATOM 8671  N N3    . DA  J 6 10  ? 54.047  91.213  115.634 1.00 189.48 ?  -64 DA  J N3    1 
ATOM 8672  C C4    . DA  J 6 10  ? 55.130  90.575  115.162 1.00 189.48 ?  -64 DA  J C4    1 
ATOM 8673  P P     . DT  J 6 11  ? 51.403  89.866  110.139 1.00 181.98 ?  -63 DT  J P     1 
ATOM 8674  O OP1   . DT  J 6 11  ? 50.048  89.480  109.693 1.00 181.98 ?  -63 DT  J OP1   1 
ATOM 8675  O OP2   . DT  J 6 11  ? 52.475  90.050  109.139 1.00 181.98 -1 -63 DT  J OP2   1 
ATOM 8676  O "O5'" . DT  J 6 11  ? 51.298  91.206  111.008 1.00 181.98 ?  -63 DT  J "O5'" 1 
ATOM 8677  C "C5'" . DT  J 6 11  ? 50.223  91.368  111.924 1.00 181.98 ?  -63 DT  J "C5'" 1 
ATOM 8678  C "C4'" . DT  J 6 11  ? 50.348  92.664  112.710 1.00 181.98 ?  -63 DT  J "C4'" 1 
ATOM 8679  O "O4'" . DT  J 6 11  ? 51.626  92.712  113.396 1.00 181.98 ?  -63 DT  J "O4'" 1 
ATOM 8680  C "C3'" . DT  J 6 11  ? 50.269  93.959  111.889 1.00 181.98 ?  -63 DT  J "C3'" 1 
ATOM 8681  O "O3'" . DT  J 6 11  ? 49.462  94.901  112.592 1.00 181.98 ?  -63 DT  J "O3'" 1 
ATOM 8682  C "C2'" . DT  J 6 11  ? 51.730  94.411  111.841 1.00 181.98 ?  -63 DT  J "C2'" 1 
ATOM 8683  C "C1'" . DT  J 6 11  ? 52.155  94.004  113.232 1.00 181.98 ?  -63 DT  J "C1'" 1 
ATOM 8684  N N1    . DT  J 6 11  ? 53.620  93.963  113.472 1.00 181.98 ?  -63 DT  J N1    1 
ATOM 8685  C C2    . DT  J 6 11  ? 54.131  94.726  114.486 1.00 181.98 ?  -63 DT  J C2    1 
ATOM 8686  O O2    . DT  J 6 11  ? 53.445  95.449  115.184 1.00 181.98 ?  -63 DT  J O2    1 
ATOM 8687  N N3    . DT  J 6 11  ? 55.476  94.612  114.669 1.00 181.98 ?  -63 DT  J N3    1 
ATOM 8688  C C4    . DT  J 6 11  ? 56.355  93.835  113.948 1.00 181.98 ?  -63 DT  J C4    1 
ATOM 8689  O O4    . DT  J 6 11  ? 57.557  93.811  114.191 1.00 181.98 ?  -63 DT  J O4    1 
ATOM 8690  C C5    . DT  J 6 11  ? 55.761  93.050  112.896 1.00 181.98 ?  -63 DT  J C5    1 
ATOM 8691  C C7    . DT  J 6 11  ? 56.625  92.168  112.046 1.00 181.98 ?  -63 DT  J C7    1 
ATOM 8692  C C6    . DT  J 6 11  ? 54.430  93.144  112.710 1.00 181.98 ?  -63 DT  J C6    1 
ATOM 8693  P P     . DA  J 6 12  ? 48.923  96.232  111.871 1.00 175.62 ?  -62 DA  J P     1 
ATOM 8694  O OP1   . DA  J 6 12  ? 47.692  95.866  111.139 1.00 175.62 ?  -62 DA  J OP1   1 
ATOM 8695  O OP2   . DA  J 6 12  ? 50.048  96.865  111.150 1.00 175.62 -1 -62 DA  J OP2   1 
ATOM 8696  O "O5'" . DA  J 6 12  ? 48.534  97.194  113.091 1.00 175.62 ?  -62 DA  J "O5'" 1 
ATOM 8697  C "C5'" . DA  J 6 12  ? 49.413  97.312  114.205 1.00 175.62 ?  -62 DA  J "C5'" 1 
ATOM 8698  C "C4'" . DA  J 6 12  ? 49.384  98.715  114.783 1.00 175.62 ?  -62 DA  J "C4'" 1 
ATOM 8699  O "O4'" . DA  J 6 12  ? 50.707  99.064  115.239 1.00 175.62 ?  -62 DA  J "O4'" 1 
ATOM 8700  C "C3'" . DA  J 6 12  ? 49.051  99.810  113.797 1.00 175.62 ?  -62 DA  J "C3'" 1 
ATOM 8701  O "O3'" . DA  J 6 12  ? 48.681  100.983 114.502 1.00 175.62 ?  -62 DA  J "O3'" 1 
ATOM 8702  C "C2'" . DA  J 6 12  ? 50.385  99.992  113.080 1.00 175.62 ?  -62 DA  J "C2'" 1 
ATOM 8703  C "C1'" . DA  J 6 12  ? 51.389  99.765  114.214 1.00 175.62 ?  -62 DA  J "C1'" 1 
ATOM 8704  N N9    . DA  J 6 12  ? 52.545  98.971  113.821 1.00 175.62 ?  -62 DA  J N9    1 
ATOM 8705  C C8    . DA  J 6 12  ? 52.603  98.011  112.848 1.00 175.62 ?  -62 DA  J C8    1 
ATOM 8706  N N7    . DA  J 6 12  ? 53.783  97.447  112.732 1.00 175.62 ?  -62 DA  J N7    1 
ATOM 8707  C C5    . DA  J 6 12  ? 54.542  98.073  113.703 1.00 175.62 ?  -62 DA  J C5    1 
ATOM 8708  C C6    . DA  J 6 12  ? 55.888  97.940  114.094 1.00 175.62 ?  -62 DA  J C6    1 
ATOM 8709  N N6    . DA  J 6 12  ? 56.737  97.080  113.527 1.00 175.62 ?  -62 DA  J N6    1 
ATOM 8710  N N1    . DA  J 6 12  ? 56.328  98.728  115.097 1.00 175.62 ?  -62 DA  J N1    1 
ATOM 8711  C C2    . DA  J 6 12  ? 55.481  99.591  115.660 1.00 175.62 ?  -62 DA  J C2    1 
ATOM 8712  N N3    . DA  J 6 12  ? 54.203  99.812  115.377 1.00 175.62 ?  -62 DA  J N3    1 
ATOM 8713  C C4    . DA  J 6 12  ? 53.793  99.016  114.379 1.00 175.62 ?  -62 DA  J C4    1 
ATOM 8714  P P     . DT  J 6 13  ? 48.282  102.315 113.701 1.00 167.02 ?  -61 DT  J P     1 
ATOM 8715  O OP1   . DT  J 6 13  ? 47.227  103.014 114.464 1.00 167.02 ?  -61 DT  J OP1   1 
ATOM 8716  O OP2   . DT  J 6 13  ? 48.055  101.938 112.290 1.00 167.02 -1 -61 DT  J OP2   1 
ATOM 8717  O "O5'" . DT  J 6 13  ? 49.606  103.197 113.746 1.00 167.02 ?  -61 DT  J "O5'" 1 
ATOM 8718  C "C5'" . DT  J 6 13  ? 50.161  103.588 114.990 1.00 167.02 ?  -61 DT  J "C5'" 1 
ATOM 8719  C "C4'" . DT  J 6 13  ? 51.517  104.219 114.771 1.00 167.02 ?  -61 DT  J "C4'" 1 
ATOM 8720  O "O4'" . DT  J 6 13  ? 52.475  103.179 114.488 1.00 167.02 ?  -61 DT  J "O4'" 1 
ATOM 8721  C "C3'" . DT  J 6 13  ? 51.571  105.176 113.575 1.00 167.02 ?  -61 DT  J "C3'" 1 
ATOM 8722  O "O3'" . DT  J 6 13  ? 51.715  106.608 113.956 1.00 167.02 ?  -61 DT  J "O3'" 1 
ATOM 8723  C "C2'" . DT  J 6 13  ? 52.709  104.651 112.687 1.00 167.02 ?  -61 DT  J "C2'" 1 
ATOM 8724  C "C1'" . DT  J 6 13  ? 53.439  103.684 113.610 1.00 167.02 ?  -61 DT  J "C1'" 1 
ATOM 8725  N N1    . DT  J 6 13  ? 54.081  102.558 112.907 1.00 167.02 ?  -61 DT  J N1    1 
ATOM 8726  C C2    . DT  J 6 13  ? 55.333  102.169 113.292 1.00 167.02 ?  -61 DT  J C2    1 
ATOM 8727  O O2    . DT  J 6 13  ? 55.949  102.707 114.190 1.00 167.02 ?  -61 DT  J O2    1 
ATOM 8728  N N3    . DT  J 6 13  ? 55.849  101.125 112.589 1.00 167.02 ?  -61 DT  J N3    1 
ATOM 8729  C C4    . DT  J 6 13  ? 55.251  100.444 111.551 1.00 167.02 ?  -61 DT  J C4    1 
ATOM 8730  O O4    . DT  J 6 13  ? 55.804  99.511  110.981 1.00 167.02 ?  -61 DT  J O4    1 
ATOM 8731  C C5    . DT  J 6 13  ? 53.929  100.901 111.195 1.00 167.02 ?  -61 DT  J C5    1 
ATOM 8732  C C7    . DT  J 6 13  ? 53.173  100.236 110.085 1.00 167.02 ?  -61 DT  J C7    1 
ATOM 8733  C C6    . DT  J 6 13  ? 53.415  101.927 111.882 1.00 167.02 ?  -61 DT  J C6    1 
ATOM 8734  P P     . DA  J 6 14  ? 52.653  107.169 115.152 1.00 157.91 ?  -60 DA  J P     1 
ATOM 8735  O OP1   . DA  J 6 14  ? 52.154  106.826 116.504 1.00 157.91 ?  -60 DA  J OP1   1 
ATOM 8736  O OP2   . DA  J 6 14  ? 52.780  108.608 114.845 1.00 157.91 -1 -60 DA  J OP2   1 
ATOM 8737  O "O5'" . DA  J 6 14  ? 54.110  106.568 114.880 1.00 157.91 ?  -60 DA  J "O5'" 1 
ATOM 8738  C "C5'" . DA  J 6 14  ? 55.080  106.522 115.927 1.00 157.91 ?  -60 DA  J "C5'" 1 
ATOM 8739  C "C4'" . DA  J 6 14  ? 56.235  107.503 115.701 1.00 157.91 ?  -60 DA  J "C4'" 1 
ATOM 8740  O "O4'" . DA  J 6 14  ? 57.307  106.879 114.961 1.00 157.91 ?  -60 DA  J "O4'" 1 
ATOM 8741  C "C3'" . DA  J 6 14  ? 55.913  108.784 114.956 1.00 157.91 ?  -60 DA  J "C3'" 1 
ATOM 8742  O "O3'" . DA  J 6 14  ? 56.705  109.830 115.489 1.00 157.91 ?  -60 DA  J "O3'" 1 
ATOM 8743  C "C2'" . DA  J 6 14  ? 56.290  108.465 113.501 1.00 157.91 ?  -60 DA  J "C2'" 1 
ATOM 8744  C "C1'" . DA  J 6 14  ? 57.346  107.362 113.630 1.00 157.91 ?  -60 DA  J "C1'" 1 
ATOM 8745  N N9    . DA  J 6 14  ? 57.105  106.219 112.766 1.00 157.91 ?  -60 DA  J N9    1 
ATOM 8746  C C8    . DA  J 6 14  ? 55.918  105.843 112.217 1.00 157.91 ?  -60 DA  J C8    1 
ATOM 8747  N N7    . DA  J 6 14  ? 55.984  104.741 111.511 1.00 157.91 ?  -60 DA  J N7    1 
ATOM 8748  C C5    . DA  J 6 14  ? 57.307  104.359 111.622 1.00 157.91 ?  -60 DA  J C5    1 
ATOM 8749  C C6    . DA  J 6 14  ? 58.027  103.277 111.094 1.00 157.91 ?  -60 DA  J C6    1 
ATOM 8750  N N6    . DA  J 6 14  ? 57.479  102.337 110.322 1.00 157.91 ?  -60 DA  J N6    1 
ATOM 8751  N N1    . DA  J 6 14  ? 59.339  103.197 111.388 1.00 157.91 ?  -60 DA  J N1    1 
ATOM 8752  C C2    . DA  J 6 14  ? 59.892  104.142 112.156 1.00 157.91 ?  -60 DA  J C2    1 
ATOM 8753  N N3    . DA  J 6 14  ? 59.316  105.207 112.707 1.00 157.91 ?  -60 DA  J N3    1 
ATOM 8754  C C4    . DA  J 6 14  ? 58.012  105.258 112.396 1.00 157.91 ?  -60 DA  J C4    1 
ATOM 8755  P P     . DT  J 6 15  ? 56.551  111.333 114.951 1.00 150.77 ?  -59 DT  J P     1 
ATOM 8756  O OP1   . DT  J 6 15  ? 56.584  112.233 116.125 1.00 150.77 ?  -59 DT  J OP1   1 
ATOM 8757  O OP2   . DT  J 6 15  ? 55.395  111.372 114.027 1.00 150.77 -1 -59 DT  J OP2   1 
ATOM 8758  O "O5'" . DT  J 6 15  ? 57.882  111.557 114.098 1.00 150.77 ?  -59 DT  J "O5'" 1 
ATOM 8759  C "C5'" . DT  J 6 15  ? 59.034  110.747 114.344 1.00 150.77 ?  -59 DT  J "C5'" 1 
ATOM 8760  C "C4'" . DT  J 6 15  ? 59.905  110.665 113.105 1.00 150.77 ?  -59 DT  J "C4'" 1 
ATOM 8761  O "O4'" . DT  J 6 15  ? 59.679  109.410 112.407 1.00 150.77 ?  -59 DT  J "O4'" 1 
ATOM 8762  C "C3'" . DT  J 6 15  ? 59.658  111.770 112.070 1.00 150.77 ?  -59 DT  J "C3'" 1 
ATOM 8763  O "O3'" . DT  J 6 15  ? 60.887  112.170 111.495 1.00 150.77 ?  -59 DT  J "O3'" 1 
ATOM 8764  C "C2'" . DT  J 6 15  ? 58.808  111.045 111.032 1.00 150.77 ?  -59 DT  J "C2'" 1 
ATOM 8765  C "C1'" . DT  J 6 15  ? 59.504  109.696 111.042 1.00 150.77 ?  -59 DT  J "C1'" 1 
ATOM 8766  N N1    . DT  J 6 15  ? 58.741  108.586 110.401 1.00 150.77 ?  -59 DT  J N1    1 
ATOM 8767  C C2    . DT  J 6 15  ? 59.396  107.417 110.102 1.00 150.77 ?  -59 DT  J C2    1 
ATOM 8768  O O2    . DT  J 6 15  ? 60.576  107.235 110.336 1.00 150.77 ?  -59 DT  J O2    1 
ATOM 8769  N N3    . DT  J 6 15  ? 58.622  106.461 109.511 1.00 150.77 ?  -59 DT  J N3    1 
ATOM 8770  C C4    . DT  J 6 15  ? 57.280  106.557 109.196 1.00 150.77 ?  -59 DT  J C4    1 
ATOM 8771  O O4    . DT  J 6 15  ? 56.665  105.636 108.676 1.00 150.77 ?  -59 DT  J O4    1 
ATOM 8772  C C5    . DT  J 6 15  ? 56.652  107.807 109.538 1.00 150.77 ?  -59 DT  J C5    1 
ATOM 8773  C C7    . DT  J 6 15  ? 55.199  108.025 109.244 1.00 150.77 ?  -59 DT  J C7    1 
ATOM 8774  C C6    . DT  J 6 15  ? 57.405  108.754 110.110 1.00 150.77 ?  -59 DT  J C6    1 
ATOM 8775  P P     . DC  J 6 16  ? 61.880  113.202 112.228 1.00 140.40 ?  -58 DC  J P     1 
ATOM 8776  O OP1   . DC  J 6 16  ? 61.579  113.360 113.667 1.00 140.40 ?  -58 DC  J OP1   1 
ATOM 8777  O OP2   . DC  J 6 16  ? 61.896  114.413 111.381 1.00 140.40 -1 -58 DC  J OP2   1 
ATOM 8778  O "O5'" . DC  J 6 16  ? 63.305  112.490 112.050 1.00 140.40 ?  -58 DC  J "O5'" 1 
ATOM 8779  C "C5'" . DC  J 6 16  ? 63.374  111.096 111.689 1.00 140.40 ?  -58 DC  J "C5'" 1 
ATOM 8780  C "C4'" . DC  J 6 16  ? 63.871  110.917 110.259 1.00 140.40 ?  -58 DC  J "C4'" 1 
ATOM 8781  O "O4'" . DC  J 6 16  ? 62.984  110.025 109.552 1.00 140.40 ?  -58 DC  J "O4'" 1 
ATOM 8782  C "C3'" . DC  J 6 16  ? 63.929  112.203 109.444 1.00 140.40 ?  -58 DC  J "C3'" 1 
ATOM 8783  O "O3'" . DC  J 6 16  ? 65.303  112.669 109.315 1.00 140.40 ?  -58 DC  J "O3'" 1 
ATOM 8784  C "C2'" . DC  J 6 16  ? 63.232  111.888 108.112 1.00 140.40 ?  -58 DC  J "C2'" 1 
ATOM 8785  C "C1'" . DC  J 6 16  ? 62.877  110.402 108.198 1.00 140.40 ?  -58 DC  J "C1'" 1 
ATOM 8786  N N1    . DC  J 6 16  ? 61.476  110.094 107.758 1.00 140.40 ?  -58 DC  J N1    1 
ATOM 8787  C C2    . DC  J 6 16  ? 61.150  108.811 107.292 1.00 140.40 ?  -58 DC  J C2    1 
ATOM 8788  O O2    . DC  J 6 16  ? 62.027  107.950 107.205 1.00 140.40 ?  -58 DC  J O2    1 
ATOM 8789  N N3    . DC  J 6 16  ? 59.876  108.553 106.918 1.00 140.40 ?  -58 DC  J N3    1 
ATOM 8790  C C4    . DC  J 6 16  ? 58.950  109.502 107.012 1.00 140.40 ?  -58 DC  J C4    1 
ATOM 8791  N N4    . DC  J 6 16  ? 57.706  109.200 106.638 1.00 140.40 ?  -58 DC  J N4    1 
ATOM 8792  C C5    . DC  J 6 16  ? 59.256  110.806 107.490 1.00 140.40 ?  -58 DC  J C5    1 
ATOM 8793  C C6    . DC  J 6 16  ? 60.516  111.055 107.850 1.00 140.40 ?  -58 DC  J C6    1 
ATOM 8794  P P     . DT  J 6 17  ? 66.249  112.321 108.057 1.00 129.72 ?  -57 DT  J P     1 
ATOM 8795  O OP1   . DT  J 6 17  ? 67.611  112.718 108.473 1.00 129.72 ?  -57 DT  J OP1   1 
ATOM 8796  O OP2   . DT  J 6 17  ? 65.704  112.905 106.811 1.00 129.72 -1 -57 DT  J OP2   1 
ATOM 8797  O "O5'" . DT  J 6 17  ? 66.236  110.723 107.953 1.00 129.72 ?  -57 DT  J "O5'" 1 
ATOM 8798  C "C5'" . DT  J 6 17  ? 67.299  110.039 107.294 1.00 129.72 ?  -57 DT  J "C5'" 1 
ATOM 8799  C "C4'" . DT  J 6 17  ? 66.957  109.759 105.840 1.00 129.72 ?  -57 DT  J "C4'" 1 
ATOM 8800  O "O4'" . DT  J 6 17  ? 65.551  109.514 105.712 1.00 129.72 ?  -57 DT  J "O4'" 1 
ATOM 8801  C "C3'" . DT  J 6 17  ? 67.244  110.902 104.875 1.00 129.72 ?  -57 DT  J "C3'" 1 
ATOM 8802  O "O3'" . DT  J 6 17  ? 68.520  110.719 104.286 1.00 129.72 ?  -57 DT  J "O3'" 1 
ATOM 8803  C "C2'" . DT  J 6 17  ? 66.110  110.816 103.834 1.00 129.72 ?  -57 DT  J "C2'" 1 
ATOM 8804  C "C1'" . DT  J 6 17  ? 65.196  109.711 104.370 1.00 129.72 ?  -57 DT  J "C1'" 1 
ATOM 8805  N N1    . DT  J 6 17  ? 63.759  110.056 104.319 1.00 129.72 ?  -57 DT  J N1    1 
ATOM 8806  C C2    . DT  J 6 17  ? 62.851  109.094 103.960 1.00 129.72 ?  -57 DT  J C2    1 
ATOM 8807  O O2    . DT  J 6 17  ? 63.167  107.957 103.671 1.00 129.72 ?  -57 DT  J O2    1 
ATOM 8808  N N3    . DT  J 6 17  ? 61.551  109.509 103.951 1.00 129.72 ?  -57 DT  J N3    1 
ATOM 8809  C C4    . DT  J 6 17  ? 61.081  110.770 104.263 1.00 129.72 ?  -57 DT  J C4    1 
ATOM 8810  O O4    . DT  J 6 17  ? 59.891  111.053 104.229 1.00 129.72 ?  -57 DT  J O4    1 
ATOM 8811  C C5    . DT  J 6 17  ? 62.087  111.730 104.630 1.00 129.72 ?  -57 DT  J C5    1 
ATOM 8812  C C7    . DT  J 6 17  ? 61.693  113.132 104.985 1.00 129.72 ?  -57 DT  J C7    1 
ATOM 8813  C C6    . DT  J 6 17  ? 63.363  111.333 104.633 1.00 129.72 ?  -57 DT  J C6    1 
ATOM 8814  P P     . DG  J 6 18  ? 69.040  111.713 103.137 1.00 120.17 ?  -56 DG  J P     1 
ATOM 8815  O OP1   . DG  J 6 18  ? 70.508  111.821 103.275 1.00 120.17 ?  -56 DG  J OP1   1 
ATOM 8816  O OP2   . DG  J 6 18  ? 68.215  112.939 103.183 1.00 120.17 -1 -56 DG  J OP2   1 
ATOM 8817  O "O5'" . DG  J 6 18  ? 68.700  110.929 101.787 1.00 120.17 ?  -56 DG  J "O5'" 1 
ATOM 8818  C "C5'" . DG  J 6 18  ? 68.917  109.524 101.718 1.00 120.17 ?  -56 DG  J "C5'" 1 
ATOM 8819  C "C4'" . DG  J 6 18  ? 68.013  108.880 100.682 1.00 120.17 ?  -56 DG  J "C4'" 1 
ATOM 8820  O "O4'" . DG  J 6 18  ? 66.639  109.281 100.914 1.00 120.17 ?  -56 DG  J "O4'" 1 
ATOM 8821  C "C3'" . DG  J 6 18  ? 68.323  109.248 99.234  1.00 120.17 ?  -56 DG  J "C3'" 1 
ATOM 8822  O "O3'" . DG  J 6 18  ? 68.223  108.094 98.419  1.00 120.17 ?  -56 DG  J "O3'" 1 
ATOM 8823  C "C2'" . DG  J 6 18  ? 67.241  110.269 98.894  1.00 120.17 ?  -56 DG  J "C2'" 1 
ATOM 8824  C "C1'" . DG  J 6 18  ? 66.076  109.753 99.714  1.00 120.17 ?  -56 DG  J "C1'" 1 
ATOM 8825  N N9    . DG  J 6 18  ? 65.101  110.778 100.046 1.00 120.17 ?  -56 DG  J N9    1 
ATOM 8826  C C8    . DG  J 6 18  ? 65.360  112.038 100.519 1.00 120.17 ?  -56 DG  J C8    1 
ATOM 8827  N N7    . DG  J 6 18  ? 64.285  112.742 100.734 1.00 120.17 ?  -56 DG  J N7    1 
ATOM 8828  C C5    . DG  J 6 18  ? 63.248  111.890 100.386 1.00 120.17 ?  -56 DG  J C5    1 
ATOM 8829  C C6    . DG  J 6 18  ? 61.851  112.099 100.410 1.00 120.17 ?  -56 DG  J C6    1 
ATOM 8830  O O6    . DG  J 6 18  ? 61.229  113.107 100.761 1.00 120.17 ?  -56 DG  J O6    1 
ATOM 8831  N N1    . DG  J 6 18  ? 61.155  110.978 99.976  1.00 120.17 ?  -56 DG  J N1    1 
ATOM 8832  C C2    . DG  J 6 18  ? 61.732  109.804 99.572  1.00 120.17 ?  -56 DG  J C2    1 
ATOM 8833  N N2    . DG  J 6 18  ? 60.896  108.836 99.181  1.00 120.17 ?  -56 DG  J N2    1 
ATOM 8834  N N3    . DG  J 6 18  ? 63.041  109.594 99.542  1.00 120.17 ?  -56 DG  J N3    1 
ATOM 8835  C C4    . DG  J 6 18  ? 63.734  110.677 99.961  1.00 120.17 ?  -56 DG  J C4    1 
ATOM 8836  P P     . DA  J 6 19  ? 69.079  107.982 97.066  1.00 102.42 ?  -55 DA  J P     1 
ATOM 8837  O OP1   . DA  J 6 19  ? 70.150  106.989 97.290  1.00 102.42 ?  -55 DA  J OP1   1 
ATOM 8838  O OP2   . DA  J 6 19  ? 69.427  109.355 96.643  1.00 102.42 -1 -55 DA  J OP2   1 
ATOM 8839  O "O5'" . DA  J 6 19  ? 68.040  107.386 96.009  1.00 102.42 ?  -55 DA  J "O5'" 1 
ATOM 8840  C "C5'" . DA  J 6 19  ? 67.606  106.039 96.127  1.00 102.42 ?  -55 DA  J "C5'" 1 
ATOM 8841  C "C4'" . DA  J 6 19  ? 66.174  105.872 95.644  1.00 102.42 ?  -55 DA  J "C4'" 1 
ATOM 8842  O "O4'" . DA  J 6 19  ? 65.358  106.966 96.127  1.00 102.42 ?  -55 DA  J "O4'" 1 
ATOM 8843  C "C3'" . DA  J 6 19  ? 65.983  105.848 94.134  1.00 102.42 ?  -55 DA  J "C3'" 1 
ATOM 8844  O "O3'" . DA  J 6 19  ? 64.907  104.985 93.820  1.00 102.42 ?  -55 DA  J "O3'" 1 
ATOM 8845  C "C2'" . DA  J 6 19  ? 65.645  107.302 93.821  1.00 102.42 ?  -55 DA  J "C2'" 1 
ATOM 8846  C "C1'" . DA  J 6 19  ? 64.833  107.702 95.041  1.00 102.42 ?  -55 DA  J "C1'" 1 
ATOM 8847  N N9    . DA  J 6 19  ? 64.949  109.108 95.381  1.00 102.42 ?  -55 DA  J N9    1 
ATOM 8848  C C8    . DA  J 6 19  ? 66.100  109.828 95.495  1.00 102.42 ?  -55 DA  J C8    1 
ATOM 8849  N N7    . DA  J 6 19  ? 65.910  111.076 95.839  1.00 102.42 ?  -55 DA  J N7    1 
ATOM 8850  C C5    . DA  J 6 19  ? 64.540  111.177 95.969  1.00 102.42 ?  -55 DA  J C5    1 
ATOM 8851  C C6    . DA  J 6 19  ? 63.704  112.244 96.316  1.00 102.42 ?  -55 DA  J C6    1 
ATOM 8852  N N6    . DA  J 6 19  ? 64.160  113.462 96.605  1.00 102.42 ?  -55 DA  J N6    1 
ATOM 8853  N N1    . DA  J 6 19  ? 62.377  112.015 96.356  1.00 102.42 ?  -55 DA  J N1    1 
ATOM 8854  C C2    . DA  J 6 19  ? 61.925  110.792 96.066  1.00 102.42 ?  -55 DA  J C2    1 
ATOM 8855  N N3    . DA  J 6 19  ? 62.617  109.708 95.726  1.00 102.42 ?  -55 DA  J N3    1 
ATOM 8856  C C4    . DA  J 6 19  ? 63.931  109.972 95.696  1.00 102.42 ?  -55 DA  J C4    1 
ATOM 8857  P P     . DC  J 6 20  ? 64.594  104.566 92.303  1.00 90.16  ?  -54 DC  J P     1 
ATOM 8858  O OP1   . DC  J 6 20  ? 65.021  103.160 92.138  1.00 90.16  ?  -54 DC  J OP1   1 
ATOM 8859  O OP2   . DC  J 6 20  ? 65.107  105.607 91.390  1.00 90.16  -1 -54 DC  J OP2   1 
ATOM 8860  O "O5'" . DC  J 6 20  ? 63.005  104.627 92.238  1.00 90.16  ?  -54 DC  J "O5'" 1 
ATOM 8861  C "C5'" . DC  J 6 20  ? 62.314  105.502 93.105  1.00 90.16  ?  -54 DC  J "C5'" 1 
ATOM 8862  C "C4'" . DC  J 6 20  ? 61.231  106.243 92.364  1.00 90.16  ?  -54 DC  J "C4'" 1 
ATOM 8863  O "O4'" . DC  J 6 20  ? 61.300  107.657 92.703  1.00 90.16  ?  -54 DC  J "O4'" 1 
ATOM 8864  C "C3'" . DC  J 6 20  ? 61.359  106.194 90.853  1.00 90.16  ?  -54 DC  J "C3'" 1 
ATOM 8865  O "O3'" . DC  J 6 20  ? 60.090  106.398 90.270  1.00 90.16  ?  -54 DC  J "O3'" 1 
ATOM 8866  C "C2'" . DC  J 6 20  ? 62.253  107.389 90.608  1.00 90.16  ?  -54 DC  J "C2'" 1 
ATOM 8867  C "C1'" . DC  J 6 20  ? 61.581  108.389 91.533  1.00 90.16  ?  -54 DC  J "C1'" 1 
ATOM 8868  N N1    . DC  J 6 20  ? 62.425  109.567 91.877  1.00 90.16  ?  -54 DC  J N1    1 
ATOM 8869  C C2    . DC  J 6 20  ? 61.830  110.739 92.361  1.00 90.16  ?  -54 DC  J C2    1 
ATOM 8870  O O2    . DC  J 6 20  ? 60.605  110.780 92.510  1.00 90.16  ?  -54 DC  J O2    1 
ATOM 8871  N N3    . DC  J 6 20  ? 62.620  111.798 92.660  1.00 90.16  ?  -54 DC  J N3    1 
ATOM 8872  C C4    . DC  J 6 20  ? 63.937  111.714 92.487  1.00 90.16  ?  -54 DC  J C4    1 
ATOM 8873  N N4    . DC  J 6 20  ? 64.679  112.779 92.790  1.00 90.16  ?  -54 DC  J N4    1 
ATOM 8874  C C5    . DC  J 6 20  ? 64.555  110.536 91.991  1.00 90.16  ?  -54 DC  J C5    1 
ATOM 8875  C C6    . DC  J 6 20  ? 63.769  109.501 91.700  1.00 90.16  ?  -54 DC  J C6    1 
ATOM 8876  P P     . DA  J 6 21  ? 59.204  105.153 89.781  1.00 94.89  ?  -53 DA  J P     1 
ATOM 8877  O OP1   . DA  J 6 21  ? 58.768  104.412 90.983  1.00 94.89  ?  -53 DA  J OP1   1 
ATOM 8878  O OP2   . DA  J 6 21  ? 59.949  104.458 88.713  1.00 94.89  -1 -53 DA  J OP2   1 
ATOM 8879  O "O5'" . DA  J 6 21  ? 57.922  105.837 89.118  1.00 94.89  ?  -53 DA  J "O5'" 1 
ATOM 8880  C "C5'" . DA  J 6 21  ? 56.888  106.338 89.943  1.00 94.89  ?  -53 DA  J "C5'" 1 
ATOM 8881  C "C4'" . DA  J 6 21  ? 56.531  107.764 89.564  1.00 94.89  ?  -53 DA  J "C4'" 1 
ATOM 8882  O "O4'" . DA  J 6 21  ? 57.650  108.639 89.835  1.00 94.89  ?  -53 DA  J "O4'" 1 
ATOM 8883  C "C3'" . DA  J 6 21  ? 56.161  107.977 88.098  1.00 94.89  ?  -53 DA  J "C3'" 1 
ATOM 8884  O "O3'" . DA  J 6 21  ? 54.915  108.656 88.021  1.00 94.89  ?  -53 DA  J "O3'" 1 
ATOM 8885  C "C2'" . DA  J 6 21  ? 57.313  108.822 87.541  1.00 94.89  ?  -53 DA  J "C2'" 1 
ATOM 8886  C "C1'" . DA  J 6 21  ? 57.803  109.550 88.778  1.00 94.89  ?  -53 DA  J "C1'" 1 
ATOM 8887  N N9    . DA  J 6 21  ? 59.209  109.913 88.718  1.00 94.89  ?  -53 DA  J N9    1 
ATOM 8888  C C8    . DA  J 6 21  ? 60.239  109.117 88.324  1.00 94.89  ?  -53 DA  J C8    1 
ATOM 8889  N N7    . DA  J 6 21  ? 61.410  109.698 88.385  1.00 94.89  ?  -53 DA  J N7    1 
ATOM 8890  C C5    . DA  J 6 21  ? 61.130  110.956 88.873  1.00 94.89  ?  -53 DA  J C5    1 
ATOM 8891  C C6    . DA  J 6 21  ? 61.948  112.063 89.158  1.00 94.89  ?  -53 DA  J C6    1 
ATOM 8892  N N6    . DA  J 6 21  ? 63.271  112.053 88.998  1.00 94.89  ?  -53 DA  J N6    1 
ATOM 8893  N N1    . DA  J 6 21  ? 61.354  113.183 89.616  1.00 94.89  ?  -53 DA  J N1    1 
ATOM 8894  C C2    . DA  J 6 21  ? 60.025  113.187 89.775  1.00 94.89  ?  -53 DA  J C2    1 
ATOM 8895  N N3    . DA  J 6 21  ? 59.152  112.207 89.533  1.00 94.89  ?  -53 DA  J N3    1 
ATOM 8896  C C4    . DA  J 6 21  ? 59.776  111.111 89.081  1.00 94.89  ?  -53 DA  J C4    1 
ATOM 8897  P P     . DC  J 6 22  ? 54.309  109.108 86.605  1.00 103.52 ?  -52 DC  J P     1 
ATOM 8898  O OP1   . DC  J 6 22  ? 52.838  109.023 86.709  1.00 103.52 ?  -52 DC  J OP1   1 
ATOM 8899  O OP2   . DC  J 6 22  ? 55.014  108.378 85.531  1.00 103.52 -1 -52 DC  J OP2   1 
ATOM 8900  O "O5'" . DC  J 6 22  ? 54.714  110.646 86.507  1.00 103.52 ?  -52 DC  J "O5'" 1 
ATOM 8901  C "C5'" . DC  J 6 22  ? 54.564  111.479 87.643  1.00 103.52 ?  -52 DC  J "C5'" 1 
ATOM 8902  C "C4'" . DC  J 6 22  ? 55.103  112.866 87.364  1.00 103.52 ?  -52 DC  J "C4'" 1 
ATOM 8903  O "O4'" . DC  J 6 22  ? 56.544  112.871 87.520  1.00 103.52 ?  -52 DC  J "O4'" 1 
ATOM 8904  C "C3'" . DC  J 6 22  ? 54.823  113.392 85.954  1.00 103.52 ?  -52 DC  J "C3'" 1 
ATOM 8905  O "O3'" . DC  J 6 22  ? 54.321  114.711 86.027  1.00 103.52 ?  -52 DC  J "O3'" 1 
ATOM 8906  C "C2'" . DC  J 6 22  ? 56.194  113.351 85.283  1.00 103.52 ?  -52 DC  J "C2'" 1 
ATOM 8907  C "C1'" . DC  J 6 22  ? 57.107  113.602 86.465  1.00 103.52 ?  -52 DC  J "C1'" 1 
ATOM 8908  N N1    . DC  J 6 22  ? 58.494  113.136 86.253  1.00 103.52 ?  -52 DC  J N1    1 
ATOM 8909  C C2    . DC  J 6 22  ? 59.552  114.020 86.461  1.00 103.52 ?  -52 DC  J C2    1 
ATOM 8910  O O2    . DC  J 6 22  ? 59.302  115.176 86.810  1.00 103.52 ?  -52 DC  J O2    1 
ATOM 8911  N N3    . DC  J 6 22  ? 60.817  113.590 86.258  1.00 103.52 ?  -52 DC  J N3    1 
ATOM 8912  C C4    . DC  J 6 22  ? 61.037  112.336 85.869  1.00 103.52 ?  -52 DC  J C4    1 
ATOM 8913  N N4    . DC  J 6 22  ? 62.304  111.951 85.688  1.00 103.52 ?  -52 DC  J N4    1 
ATOM 8914  C C5    . DC  J 6 22  ? 59.969  111.415 85.657  1.00 103.52 ?  -52 DC  J C5    1 
ATOM 8915  C C6    . DC  J 6 22  ? 58.725  111.855 85.858  1.00 103.52 ?  -52 DC  J C6    1 
ATOM 8916  P P     . DG  J 6 23  ? 53.488  115.329 84.801  1.00 109.10 ?  -51 DG  J P     1 
ATOM 8917  O OP1   . DG  J 6 23  ? 52.054  115.260 85.159  1.00 109.10 ?  -51 DG  J OP1   1 
ATOM 8918  O OP2   . DG  J 6 23  ? 53.965  114.685 83.558  1.00 109.10 -1 -51 DG  J OP2   1 
ATOM 8919  O "O5'" . DG  J 6 23  ? 53.952  116.858 84.772  1.00 109.10 ?  -51 DG  J "O5'" 1 
ATOM 8920  C "C5'" . DG  J 6 23  ? 55.148  117.233 85.436  1.00 109.10 ?  -51 DG  J "C5'" 1 
ATOM 8921  C "C4'" . DG  J 6 23  ? 55.625  118.599 84.985  1.00 109.10 ?  -51 DG  J "C4'" 1 
ATOM 8922  O "O4'" . DG  J 6 23  ? 57.067  118.593 84.950  1.00 109.10 ?  -51 DG  J "O4'" 1 
ATOM 8923  C "C3'" . DG  J 6 23  ? 55.226  118.984 83.577  1.00 109.10 ?  -51 DG  J "C3'" 1 
ATOM 8924  O "O3'" . DG  J 6 23  ? 55.382  120.390 83.404  1.00 109.10 ?  -51 DG  J "O3'" 1 
ATOM 8925  C "C2'" . DG  J 6 23  ? 56.248  118.214 82.765  1.00 109.10 ?  -51 DG  J "C2'" 1 
ATOM 8926  C "C1'" . DG  J 6 23  ? 57.502  118.368 83.621  1.00 109.10 ?  -51 DG  J "C1'" 1 
ATOM 8927  N N9    . DG  J 6 23  ? 58.345  117.182 83.603  1.00 109.10 ?  -51 DG  J N9    1 
ATOM 8928  C C8    . DG  J 6 23  ? 57.928  115.878 83.586  1.00 109.10 ?  -51 DG  J C8    1 
ATOM 8929  N N7    . DG  J 6 23  ? 58.905  115.022 83.553  1.00 109.10 ?  -51 DG  J N7    1 
ATOM 8930  C C5    . DG  J 6 23  ? 60.043  115.810 83.560  1.00 109.10 ?  -51 DG  J C5    1 
ATOM 8931  C C6    . DG  J 6 23  ? 61.400  115.438 83.544  1.00 109.10 ?  -51 DG  J C6    1 
ATOM 8932  O O6    . DG  J 6 23  ? 61.879  114.299 83.522  1.00 109.10 ?  -51 DG  J O6    1 
ATOM 8933  N N1    . DG  J 6 23  ? 62.239  116.547 83.552  1.00 109.10 ?  -51 DG  J N1    1 
ATOM 8934  C C2    . DG  J 6 23  ? 61.814  117.852 83.579  1.00 109.10 ?  -51 DG  J C2    1 
ATOM 8935  N N2    . DG  J 6 23  ? 62.770  118.793 83.583  1.00 109.10 ?  -51 DG  J N2    1 
ATOM 8936  N N3    . DG  J 6 23  ? 60.541  118.213 83.593  1.00 109.10 ?  -51 DG  J N3    1 
ATOM 8937  C C4    . DG  J 6 23  ? 59.715  117.142 83.587  1.00 109.10 ?  -51 DG  J C4    1 
ATOM 8938  P P     . DT  J 6 24  ? 55.345  121.055 81.938  1.00 109.80 ?  -50 DT  J P     1 
ATOM 8939  O OP1   . DT  J 6 24  ? 54.736  122.394 82.093  1.00 109.80 ?  -50 DT  J OP1   1 
ATOM 8940  O OP2   . DT  J 6 24  ? 54.752  120.102 80.973  1.00 109.80 -1 -50 DT  J OP2   1 
ATOM 8941  O "O5'" . DT  J 6 24  ? 56.888  121.262 81.569  1.00 109.80 ?  -50 DT  J "O5'" 1 
ATOM 8942  C "C5'" . DT  J 6 24  ? 57.665  122.200 82.303  1.00 109.80 ?  -50 DT  J "C5'" 1 
ATOM 8943  C "C4'" . DT  J 6 24  ? 58.978  122.512 81.602  1.00 109.80 ?  -50 DT  J "C4'" 1 
ATOM 8944  O "O4'" . DT  J 6 24  ? 59.877  121.377 81.695  1.00 109.80 ?  -50 DT  J "O4'" 1 
ATOM 8945  C "C3'" . DT  J 6 24  ? 58.877  122.858 80.118  1.00 109.80 ?  -50 DT  J "C3'" 1 
ATOM 8946  O "O3'" . DT  J 6 24  ? 59.747  123.949 79.845  1.00 109.80 ?  -50 DT  J "O3'" 1 
ATOM 8947  C "C2'" . DT  J 6 24  ? 59.346  121.572 79.432  1.00 109.80 ?  -50 DT  J "C2'" 1 
ATOM 8948  C "C1'" . DT  J 6 24  ? 60.381  121.060 80.417  1.00 109.80 ?  -50 DT  J "C1'" 1 
ATOM 8949  N N1    . DT  J 6 24  ? 60.575  119.593 80.368  1.00 109.80 ?  -50 DT  J N1    1 
ATOM 8950  C C2    . DT  J 6 24  ? 61.848  119.075 80.409  1.00 109.80 ?  -50 DT  J C2    1 
ATOM 8951  O O2    . DT  J 6 24  ? 62.848  119.764 80.463  1.00 109.80 ?  -50 DT  J O2    1 
ATOM 8952  N N3    . DT  J 6 24  ? 61.905  117.708 80.376  1.00 109.80 ?  -50 DT  J N3    1 
ATOM 8953  C C4    . DT  J 6 24  ? 60.840  116.834 80.319  1.00 109.80 ?  -50 DT  J C4    1 
ATOM 8954  O O4    . DT  J 6 24  ? 60.982  115.622 80.292  1.00 109.80 ?  -50 DT  J O4    1 
ATOM 8955  C C5    . DT  J 6 24  ? 59.543  117.443 80.281  1.00 109.80 ?  -50 DT  J C5    1 
ATOM 8956  C C7    . DT  J 6 24  ? 58.321  116.585 80.207  1.00 109.80 ?  -50 DT  J C7    1 
ATOM 8957  C C6    . DT  J 6 24  ? 59.471  118.777 80.314  1.00 109.80 ?  -50 DT  J C6    1 
ATOM 8958  P P     . DG  J 6 25  ? 59.781  124.666 78.407  1.00 104.95 ?  -49 DG  J P     1 
ATOM 8959  O OP1   . DG  J 6 25  ? 59.203  126.016 78.580  1.00 104.95 ?  -49 DG  J OP1   1 
ATOM 8960  O OP2   . DG  J 6 25  ? 59.227  123.768 77.372  1.00 104.95 -1 -49 DG  J OP2   1 
ATOM 8961  O "O5'" . DG  J 6 25  ? 61.344  124.818 78.132  1.00 104.95 ?  -49 DG  J "O5'" 1 
ATOM 8962  C "C5'" . DG  J 6 25  ? 62.253  123.976 78.831  1.00 104.95 ?  -49 DG  J "C5'" 1 
ATOM 8963  C "C4'" . DG  J 6 25  ? 63.638  124.031 78.220  1.00 104.95 ?  -49 DG  J "C4'" 1 
ATOM 8964  O "O4'" . DG  J 6 25  ? 64.176  122.693 78.145  1.00 104.95 ?  -49 DG  J "O4'" 1 
ATOM 8965  C "C3'" . DG  J 6 25  ? 63.691  124.540 76.796  1.00 104.95 ?  -49 DG  J "C3'" 1 
ATOM 8966  O "O3'" . DG  J 6 25  ? 65.000  125.006 76.506  1.00 104.95 ?  -49 DG  J "O3'" 1 
ATOM 8967  C "C2'" . DG  J 6 25  ? 63.351  123.285 75.999  1.00 104.95 ?  -49 DG  J "C2'" 1 
ATOM 8968  C "C1'" . DG  J 6 25  ? 63.989  122.177 76.841  1.00 104.95 ?  -49 DG  J "C1'" 1 
ATOM 8969  N N9    . DG  J 6 25  ? 63.164  120.985 76.943  1.00 104.95 ?  -49 DG  J N9    1 
ATOM 8970  C C8    . DG  J 6 25  ? 61.797  120.935 76.980  1.00 104.95 ?  -49 DG  J C8    1 
ATOM 8971  N N7    . DG  J 6 25  ? 61.324  119.728 77.085  1.00 104.95 ?  -49 DG  J N7    1 
ATOM 8972  C C5    . DG  J 6 25  ? 62.453  118.925 77.118  1.00 104.95 ?  -49 DG  J C5    1 
ATOM 8973  C C6    . DG  J 6 25  ? 62.565  117.523 77.226  1.00 104.95 ?  -49 DG  J C6    1 
ATOM 8974  O O6    . DG  J 6 25  ? 61.660  116.688 77.312  1.00 104.95 ?  -49 DG  J O6    1 
ATOM 8975  N N1    . DG  J 6 25  ? 63.890  117.110 77.228  1.00 104.95 ?  -49 DG  J N1    1 
ATOM 8976  C C2    . DG  J 6 25  ? 64.972  117.947 77.133  1.00 104.95 ?  -49 DG  J C2    1 
ATOM 8977  N N2    . DG  J 6 25  ? 66.175  117.360 77.151  1.00 104.95 ?  -49 DG  J N2    1 
ATOM 8978  N N3    . DG  J 6 25  ? 64.882  119.268 77.035  1.00 104.95 ?  -49 DG  J N3    1 
ATOM 8979  C C4    . DG  J 6 25  ? 63.594  119.684 77.033  1.00 104.95 ?  -49 DG  J C4    1 
ATOM 8980  P P     . DC  J 6 26  ? 65.364  125.545 75.039  1.00 106.38 ?  -48 DC  J P     1 
ATOM 8981  O OP1   . DC  J 6 26  ? 66.363  126.624 75.190  1.00 106.38 ?  -48 DC  J OP1   1 
ATOM 8982  O OP2   . DC  J 6 26  ? 64.095  125.809 74.326  1.00 106.38 -1 -48 DC  J OP2   1 
ATOM 8983  O "O5'" . DC  J 6 26  ? 66.064  124.292 74.340  1.00 106.38 ?  -48 DC  J "O5'" 1 
ATOM 8984  C "C5'" . DC  J 6 26  ? 67.011  123.512 75.060  1.00 106.38 ?  -48 DC  J "C5'" 1 
ATOM 8985  C "C4'" . DC  J 6 26  ? 67.294  122.212 74.331  1.00 106.38 ?  -48 DC  J "C4'" 1 
ATOM 8986  O "O4'" . DC  J 6 26  ? 66.259  121.240 74.634  1.00 106.38 ?  -48 DC  J "O4'" 1 
ATOM 8987  C "C3'" . DC  J 6 26  ? 67.329  122.337 72.807  1.00 106.38 ?  -48 DC  J "C3'" 1 
ATOM 8988  O "O3'" . DC  J 6 26  ? 68.496  121.733 72.299  1.00 106.38 ?  -48 DC  J "O3'" 1 
ATOM 8989  C "C2'" . DC  J 6 26  ? 66.074  121.595 72.355  1.00 106.38 ?  -48 DC  J "C2'" 1 
ATOM 8990  C "C1'" . DC  J 6 26  ? 65.920  120.565 73.455  1.00 106.38 ?  -48 DC  J "C1'" 1 
ATOM 8991  N N1    . DC  J 6 26  ? 64.535  120.033 73.566  1.00 106.38 ?  -48 DC  J N1    1 
ATOM 8992  C C2    . DC  J 6 26  ? 64.334  118.677 73.821  1.00 106.38 ?  -48 DC  J C2    1 
ATOM 8993  O O2    . DC  J 6 26  ? 65.307  117.938 73.965  1.00 106.38 ?  -48 DC  J O2    1 
ATOM 8994  N N3    . DC  J 6 26  ? 63.073  118.200 73.889  1.00 106.38 ?  -48 DC  J N3    1 
ATOM 8995  C C4    . DC  J 6 26  ? 62.041  119.021 73.720  1.00 106.38 ?  -48 DC  J C4    1 
ATOM 8996  N N4    . DC  J 6 26  ? 60.813  118.504 73.802  1.00 106.38 ?  -48 DC  J N4    1 
ATOM 8997  C C5    . DC  J 6 26  ? 62.222  120.408 73.454  1.00 106.38 ?  -48 DC  J C5    1 
ATOM 8998  C C6    . DC  J 6 26  ? 63.475  120.864 73.378  1.00 106.38 ?  -48 DC  J C6    1 
ATOM 8999  P P     . DC  J 6 27  ? 69.338  122.468 71.148  1.00 101.91 ?  -47 DC  J P     1 
ATOM 9000  O OP1   . DC  J 6 27  ? 70.233  123.447 71.801  1.00 101.91 ?  -47 DC  J OP1   1 
ATOM 9001  O OP2   . DC  J 6 27  ? 68.381  122.915 70.114  1.00 101.91 -1 -47 DC  J OP2   1 
ATOM 9002  O "O5'" . DC  J 6 27  ? 70.225  121.299 70.527  1.00 101.91 ?  -47 DC  J "O5'" 1 
ATOM 9003  C "C5'" . DC  J 6 27  ? 70.941  120.431 71.385  1.00 101.91 ?  -47 DC  J "C5'" 1 
ATOM 9004  C "C4'" . DC  J 6 27  ? 70.839  118.996 70.909  1.00 101.91 ?  -47 DC  J "C4'" 1 
ATOM 9005  O "O4'" . DC  J 6 27  ? 69.458  118.563 70.962  1.00 101.91 ?  -47 DC  J "O4'" 1 
ATOM 9006  C "C3'" . DC  J 6 27  ? 71.314  118.755 69.482  1.00 101.91 ?  -47 DC  J "C3'" 1 
ATOM 9007  O "O3'" . DC  J 6 27  ? 72.087  117.577 69.431  1.00 101.91 ?  -47 DC  J "O3'" 1 
ATOM 9008  C "C2'" . DC  J 6 27  ? 70.020  118.616 68.682  1.00 101.91 ?  -47 DC  J "C2'" 1 
ATOM 9009  C "C1'" . DC  J 6 27  ? 69.052  118.056 69.712  1.00 101.91 ?  -47 DC  J "C1'" 1 
ATOM 9010  N N1    . DC  J 6 27  ? 67.656  118.488 69.489  1.00 101.91 ?  -47 DC  J N1    1 
ATOM 9011  C C2    . DC  J 6 27  ? 66.621  117.549 69.511  1.00 101.91 ?  -47 DC  J C2    1 
ATOM 9012  O O2    . DC  J 6 27  ? 66.890  116.360 69.710  1.00 101.91 ?  -47 DC  J O2    1 
ATOM 9013  N N3    . DC  J 6 27  ? 65.350  117.972 69.311  1.00 101.91 ?  -47 DC  J N3    1 
ATOM 9014  C C4    . DC  J 6 27  ? 65.107  119.265 69.103  1.00 101.91 ?  -47 DC  J C4    1 
ATOM 9015  N N4    . DC  J 6 27  ? 63.842  119.641 68.920  1.00 101.91 ?  -47 DC  J N4    1 
ATOM 9016  C C5    . DC  J 6 27  ? 66.148  120.232 69.077  1.00 101.91 ?  -47 DC  J C5    1 
ATOM 9017  C C6    . DC  J 6 27  ? 67.393  119.805 69.279  1.00 101.91 ?  -47 DC  J C6    1 
ATOM 9018  P P     . DT  J 6 28  ? 72.945  117.238 68.120  1.00 98.77  ?  -46 DT  J P     1 
ATOM 9019  O OP1   . DT  J 6 28  ? 74.275  116.766 68.560  1.00 98.77  ?  -46 DT  J OP1   1 
ATOM 9020  O OP2   . DT  J 6 28  ? 72.831  118.390 67.201  1.00 98.77  -1 -46 DT  J OP2   1 
ATOM 9021  O "O5'" . DT  J 6 28  ? 72.156  116.019 67.464  1.00 98.77  ?  -46 DT  J "O5'" 1 
ATOM 9022  C "C5'" . DT  J 6 28  ? 71.718  114.943 68.278  1.00 98.77  ?  -46 DT  J "C5'" 1 
ATOM 9023  C "C4'" . DT  J 6 28  ? 70.682  114.096 67.559  1.00 98.77  ?  -46 DT  J "C4'" 1 
ATOM 9024  O "O4'" . DT  J 6 28  ? 69.429  114.824 67.451  1.00 98.77  ?  -46 DT  J "O4'" 1 
ATOM 9025  C "C3'" . DT  J 6 28  ? 71.047  113.686 66.131  1.00 98.77  ?  -46 DT  J "C3'" 1 
ATOM 9026  O "O3'" . DT  J 6 28  ? 70.638  112.346 65.908  1.00 98.77  ?  -46 DT  J "O3'" 1 
ATOM 9027  C "C2'" . DT  J 6 28  ? 70.215  114.654 65.293  1.00 98.77  ?  -46 DT  J "C2'" 1 
ATOM 9028  C "C1'" . DT  J 6 28  ? 68.961  114.702 66.132  1.00 98.77  ?  -46 DT  J "C1'" 1 
ATOM 9029  N N1    . DT  J 6 28  ? 68.067  115.841 65.833  1.00 98.77  ?  -46 DT  J N1    1 
ATOM 9030  C C2    . DT  J 6 28  ? 66.732  115.602 65.656  1.00 98.77  ?  -46 DT  J C2    1 
ATOM 9031  O O2    . DT  J 6 28  ? 66.243  114.496 65.735  1.00 98.77  ?  -46 DT  J O2    1 
ATOM 9032  N N3    . DT  J 6 28  ? 65.978  116.709 65.395  1.00 98.77  ?  -46 DT  J N3    1 
ATOM 9033  C C4    . DT  J 6 28  ? 66.426  118.007 65.285  1.00 98.77  ?  -46 DT  J C4    1 
ATOM 9034  O O4    . DT  J 6 28  ? 65.672  118.939 65.044  1.00 98.77  ?  -46 DT  J O4    1 
ATOM 9035  C C5    . DT  J 6 28  ? 67.842  118.190 65.482  1.00 98.77  ?  -46 DT  J C5    1 
ATOM 9036  C C7    . DT  J 6 28  ? 68.443  119.558 65.390  1.00 98.77  ?  -46 DT  J C7    1 
ATOM 9037  C C6    . DT  J 6 28  ? 68.587  117.109 65.742  1.00 98.77  ?  -46 DT  J C6    1 
ATOM 9038  P P     . DG  J 6 29  ? 71.689  111.137 66.028  1.00 95.69  ?  -45 DG  J P     1 
ATOM 9039  O OP1   . DG  J 6 29  ? 72.164  111.088 67.425  1.00 95.69  ?  -45 DG  J OP1   1 
ATOM 9040  O OP2   . DG  J 6 29  ? 72.658  111.258 64.920  1.00 95.69  -1 -45 DG  J OP2   1 
ATOM 9041  O "O5'" . DG  J 6 29  ? 70.799  109.840 65.768  1.00 95.69  ?  -45 DG  J "O5'" 1 
ATOM 9042  C "C5'" . DG  J 6 29  ? 69.904  109.390 66.772  1.00 95.69  ?  -45 DG  J "C5'" 1 
ATOM 9043  C "C4'" . DG  J 6 29  ? 68.479  109.298 66.248  1.00 95.69  ?  -45 DG  J "C4'" 1 
ATOM 9044  O "O4'" . DG  J 6 29  ? 68.049  110.587 65.742  1.00 95.69  ?  -45 DG  J "O4'" 1 
ATOM 9045  C "C3'" . DG  J 6 29  ? 68.257  108.311 65.106  1.00 95.69  ?  -45 DG  J "C3'" 1 
ATOM 9046  O "O3'" . DG  J 6 29  ? 67.029  107.653 65.298  1.00 95.69  ?  -45 DG  J "O3'" 1 
ATOM 9047  C "C2'" . DG  J 6 29  ? 68.207  109.216 63.881  1.00 95.69  ?  -45 DG  J "C2'" 1 
ATOM 9048  C "C1'" . DG  J 6 29  ? 67.491  110.417 64.461  1.00 95.69  ?  -45 DG  J "C1'" 1 
ATOM 9049  N N9    . DG  J 6 29  ? 67.696  111.649 63.719  1.00 95.69  ?  -45 DG  J N9    1 
ATOM 9050  C C8    . DG  J 6 29  ? 68.885  112.147 63.263  1.00 95.69  ?  -45 DG  J C8    1 
ATOM 9051  N N7    . DG  J 6 29  ? 68.767  113.287 62.645  1.00 95.69  ?  -45 DG  J N7    1 
ATOM 9052  C C5    . DG  J 6 29  ? 67.413  113.567 62.708  1.00 95.69  ?  -45 DG  J C5    1 
ATOM 9053  C C6    . DG  J 6 29  ? 66.692  114.673 62.212  1.00 95.69  ?  -45 DG  J C6    1 
ATOM 9054  O O6    . DG  J 6 29  ? 67.121  115.655 61.594  1.00 95.69  ?  -45 DG  J O6    1 
ATOM 9055  N N1    . DG  J 6 29  ? 65.334  114.563 62.480  1.00 95.69  ?  -45 DG  J N1    1 
ATOM 9056  C C2    . DG  J 6 29  ? 64.751  113.518 63.152  1.00 95.69  ?  -45 DG  J C2    1 
ATOM 9057  N N2    . DG  J 6 29  ? 63.425  113.587 63.318  1.00 95.69  ?  -45 DG  J N2    1 
ATOM 9058  N N3    . DG  J 6 29  ? 65.418  112.477 63.626  1.00 95.69  ?  -45 DG  J N3    1 
ATOM 9059  C C4    . DG  J 6 29  ? 66.740  112.568 63.366  1.00 95.69  ?  -45 DG  J C4    1 
ATOM 9060  P P     . DG  J 6 30  ? 66.777  106.228 64.613  1.00 88.19  ?  -44 DG  J P     1 
ATOM 9061  O OP1   . DG  J 6 30  ? 66.829  105.202 65.676  1.00 88.19  ?  -44 DG  J OP1   1 
ATOM 9062  O OP2   . DG  J 6 30  ? 67.688  106.155 63.454  1.00 88.19  -1 -44 DG  J OP2   1 
ATOM 9063  O "O5'" . DG  J 6 30  ? 65.296  106.333 64.029  1.00 88.19  ?  -44 DG  J "O5'" 1 
ATOM 9064  C "C5'" . DG  J 6 30  ? 64.203  106.613 64.889  1.00 88.19  ?  -44 DG  J "C5'" 1 
ATOM 9065  C "C4'" . DG  J 6 30  ? 63.053  107.247 64.124  1.00 88.19  ?  -44 DG  J "C4'" 1 
ATOM 9066  O "O4'" . DG  J 6 30  ? 63.444  108.566 63.665  1.00 88.19  ?  -44 DG  J "O4'" 1 
ATOM 9067  C "C3'" . DG  J 6 30  ? 62.592  106.487 62.882  1.00 88.19  ?  -44 DG  J "C3'" 1 
ATOM 9068  O "O3'" . DG  J 6 30  ? 61.170  106.521 62.791  1.00 88.19  ?  -44 DG  J "O3'" 1 
ATOM 9069  C "C2'" . DG  J 6 30  ? 63.240  107.268 61.749  1.00 88.19  ?  -44 DG  J "C2'" 1 
ATOM 9070  C "C1'" . DG  J 6 30  ? 63.179  108.683 62.290  1.00 88.19  ?  -44 DG  J "C1'" 1 
ATOM 9071  N N9    . DG  J 6 30  ? 64.178  109.568 61.706  1.00 88.19  ?  -44 DG  J N9    1 
ATOM 9072  C C8    . DG  J 6 30  ? 65.526  109.359 61.663  1.00 88.19  ?  -44 DG  J C8    1 
ATOM 9073  N N7    . DG  J 6 30  ? 66.184  110.320 61.085  1.00 88.19  ?  -44 DG  J N7    1 
ATOM 9074  C C5    . DG  J 6 30  ? 65.206  111.222 60.711  1.00 88.19  ?  -44 DG  J C5    1 
ATOM 9075  C C6    . DG  J 6 30  ? 65.325  112.463 60.056  1.00 88.19  ?  -44 DG  J C6    1 
ATOM 9076  O O6    . DG  J 6 30  ? 66.349  113.008 59.639  1.00 88.19  ?  -44 DG  J O6    1 
ATOM 9077  N N1    . DG  J 6 30  ? 64.091  113.069 59.869  1.00 88.19  ?  -44 DG  J N1    1 
ATOM 9078  C C2    . DG  J 6 30  ? 62.894  112.546 60.281  1.00 88.19  ?  -44 DG  J C2    1 
ATOM 9079  N N2    . DG  J 6 30  ? 61.802  113.275 60.020  1.00 88.19  ?  -44 DG  J N2    1 
ATOM 9080  N N3    . DG  J 6 30  ? 62.771  111.384 60.909  1.00 88.19  ?  -44 DG  J N3    1 
ATOM 9081  C C4    . DG  J 6 30  ? 63.967  110.786 61.100  1.00 88.19  ?  -44 DG  J C4    1 
ATOM 9082  P P     . DA  J 6 31  ? 60.396  105.629 61.697  1.00 91.05  ?  -43 DA  J P     1 
ATOM 9083  O OP1   . DA  J 6 31  ? 59.319  104.894 62.391  1.00 91.05  ?  -43 DA  J OP1   1 
ATOM 9084  O OP2   . DA  J 6 31  ? 61.399  104.881 60.915  1.00 91.05  -1 -43 DA  J OP2   1 
ATOM 9085  O "O5'" . DA  J 6 31  ? 59.724  106.703 60.723  1.00 91.05  ?  -43 DA  J "O5'" 1 
ATOM 9086  C "C5'" . DA  J 6 31  ? 58.519  107.350 61.109  1.00 91.05  ?  -43 DA  J "C5'" 1 
ATOM 9087  C "C4'" . DA  J 6 31  ? 58.152  108.461 60.139  1.00 91.05  ?  -43 DA  J "C4'" 1 
ATOM 9088  O "O4'" . DA  J 6 31  ? 59.285  109.346 59.960  1.00 91.05  ?  -43 DA  J "O4'" 1 
ATOM 9089  C "C3'" . DA  J 6 31  ? 57.745  107.998 58.744  1.00 91.05  ?  -43 DA  J "C3'" 1 
ATOM 9090  O "O3'" . DA  J 6 31  ? 56.643  108.770 58.276  1.00 91.05  ?  -43 DA  J "O3'" 1 
ATOM 9091  C "C2'" . DA  J 6 31  ? 58.997  108.252 57.915  1.00 91.05  ?  -43 DA  J "C2'" 1 
ATOM 9092  C "C1'" . DA  J 6 31  ? 59.580  109.481 58.591  1.00 91.05  ?  -43 DA  J "C1'" 1 
ATOM 9093  N N9    . DA  J 6 31  ? 61.024  109.569 58.454  1.00 91.05  ?  -43 DA  J N9    1 
ATOM 9094  C C8    . DA  J 6 31  ? 61.935  108.690 58.939  1.00 91.05  ?  -43 DA  J C8    1 
ATOM 9095  N N7    . DA  J 6 31  ? 63.175  109.003 58.671  1.00 91.05  ?  -43 DA  J N7    1 
ATOM 9096  C C5    . DA  J 6 31  ? 63.068  110.171 57.952  1.00 91.05  ?  -43 DA  J C5    1 
ATOM 9097  C C6    . DA  J 6 31  ? 64.026  111.017 57.380  1.00 91.05  ?  -43 DA  J C6    1 
ATOM 9098  N N6    . DA  J 6 31  ? 65.337  110.781 57.435  1.00 91.05  ?  -43 DA  J N6    1 
ATOM 9099  N N1    . DA  J 6 31  ? 63.585  112.110 56.724  1.00 91.05  ?  -43 DA  J N1    1 
ATOM 9100  C C2    . DA  J 6 31  ? 62.271  112.344 56.674  1.00 91.05  ?  -43 DA  J C2    1 
ATOM 9101  N N3    . DA  J 6 31  ? 61.275  111.613 57.167  1.00 91.05  ?  -43 DA  J N3    1 
ATOM 9102  C C4    . DA  J 6 31  ? 61.747  110.541 57.815  1.00 91.05  ?  -43 DA  J C4    1 
ATOM 9103  P P     . DG  J 6 32  ? 55.647  108.172 57.166  1.00 102.37 ?  -42 DG  J P     1 
ATOM 9104  O OP1   . DG  J 6 32  ? 54.338  107.933 57.809  1.00 102.37 ?  -42 DG  J OP1   1 
ATOM 9105  O OP2   . DG  J 6 32  ? 56.347  107.060 56.492  1.00 102.37 -1 -42 DG  J OP2   1 
ATOM 9106  O "O5'" . DG  J 6 32  ? 55.494  109.363 56.113  1.00 102.37 ?  -42 DG  J "O5'" 1 
ATOM 9107  C "C5'" . DG  J 6 32  ? 56.555  110.284 55.950  1.00 102.37 ?  -42 DG  J "C5'" 1 
ATOM 9108  C "C4'" . DG  J 6 32  ? 56.348  111.158 54.730  1.00 102.37 ?  -42 DG  J "C4'" 1 
ATOM 9109  O "O4'" . DG  J 6 32  ? 57.613  111.748 54.361  1.00 102.37 ?  -42 DG  J "O4'" 1 
ATOM 9110  C "C3'" . DG  J 6 32  ? 55.927  110.421 53.482  1.00 102.37 ?  -42 DG  J "C3'" 1 
ATOM 9111  O "O3'" . DG  J 6 32  ? 55.467  111.359 52.520  1.00 102.37 ?  -42 DG  J "O3'" 1 
ATOM 9112  C "C2'" . DG  J 6 32  ? 57.251  109.810 53.058  1.00 102.37 ?  -42 DG  J "C2'" 1 
ATOM 9113  C "C1'" . DG  J 6 32  ? 58.207  110.969 53.336  1.00 102.37 ?  -42 DG  J "C1'" 1 
ATOM 9114  N N9    . DG  J 6 32  ? 59.513  110.543 53.800  1.00 102.37 ?  -42 DG  J N9    1 
ATOM 9115  C C8    . DG  J 6 32  ? 59.776  109.613 54.767  1.00 102.37 ?  -42 DG  J C8    1 
ATOM 9116  N N7    . DG  J 6 32  ? 61.042  109.441 54.988  1.00 102.37 ?  -42 DG  J N7    1 
ATOM 9117  C C5    . DG  J 6 32  ? 61.659  110.316 54.113  1.00 102.37 ?  -42 DG  J C5    1 
ATOM 9118  C C6    . DG  J 6 32  ? 63.026  110.582 53.920  1.00 102.37 ?  -42 DG  J C6    1 
ATOM 9119  O O6    . DG  J 6 32  ? 63.992  110.058 54.481  1.00 102.37 ?  -42 DG  J O6    1 
ATOM 9120  N N1    . DG  J 6 32  ? 63.229  111.543 52.943  1.00 102.37 ?  -42 DG  J N1    1 
ATOM 9121  C C2    . DG  J 6 32  ? 62.235  112.174 52.243  1.00 102.37 ?  -42 DG  J C2    1 
ATOM 9122  N N2    . DG  J 6 32  ? 62.627  113.076 51.335  1.00 102.37 ?  -42 DG  J N2    1 
ATOM 9123  N N3    . DG  J 6 32  ? 60.943  111.944 52.426  1.00 102.37 ?  -42 DG  J N3    1 
ATOM 9124  C C4    . DG  J 6 32  ? 60.732  111.008 53.379  1.00 102.37 ?  -42 DG  J C4    1 
ATOM 9125  P P     . DA  J 6 33  ? 54.860  110.860 51.119  1.00 111.39 ?  -41 DA  J P     1 
ATOM 9126  O OP1   . DA  J 6 33  ? 53.916  111.899 50.657  1.00 111.39 ?  -41 DA  J OP1   1 
ATOM 9127  O OP2   . DA  J 6 33  ? 54.391  109.471 51.311  1.00 111.39 -1 -41 DA  J OP2   1 
ATOM 9128  O "O5'" . DA  J 6 33  ? 56.120  110.827 50.131  1.00 111.39 ?  -41 DA  J "O5'" 1 
ATOM 9129  C "C5'" . DA  J 6 33  ? 56.953  111.975 49.994  1.00 111.39 ?  -41 DA  J "C5'" 1 
ATOM 9130  C "C4'" . DA  J 6 33  ? 57.814  111.887 48.744  1.00 111.39 ?  -41 DA  J "C4'" 1 
ATOM 9131  O "O4'" . DA  J 6 33  ? 59.199  111.651 49.100  1.00 111.39 ?  -41 DA  J "O4'" 1 
ATOM 9132  C "C3'" . DA  J 6 33  ? 57.445  110.787 47.762  1.00 111.39 ?  -41 DA  J "C3'" 1 
ATOM 9133  O "O3'" . DA  J 6 33  ? 57.655  111.263 46.450  1.00 111.39 ?  -41 DA  J "O3'" 1 
ATOM 9134  C "C2'" . DA  J 6 33  ? 58.427  109.669 48.116  1.00 111.39 ?  -41 DA  J "C2'" 1 
ATOM 9135  C "C1'" . DA  J 6 33  ? 59.667  110.463 48.488  1.00 111.39 ?  -41 DA  J "C1'" 1 
ATOM 9136  N N9    . DA  J 6 33  ? 60.527  109.799 49.456  1.00 111.39 ?  -41 DA  J N9    1 
ATOM 9137  C C8    . DA  J 6 33  ? 60.138  108.964 50.463  1.00 111.39 ?  -41 DA  J C8    1 
ATOM 9138  N N7    . DA  J 6 33  ? 61.127  108.541 51.210  1.00 111.39 ?  -41 DA  J N7    1 
ATOM 9139  C C5    . DA  J 6 33  ? 62.240  109.152 50.662  1.00 111.39 ?  -41 DA  J C5    1 
ATOM 9140  C C6    . DA  J 6 33  ? 63.604  109.106 50.994  1.00 111.39 ?  -41 DA  J C6    1 
ATOM 9141  N N6    . DA  J 6 33  ? 64.082  108.390 52.010  1.00 111.39 ?  -41 DA  J N6    1 
ATOM 9142  N N1    . DA  J 6 33  ? 64.459  109.839 50.252  1.00 111.39 ?  -41 DA  J N1    1 
ATOM 9143  C C2    . DA  J 6 33  ? 63.977  110.555 49.231  1.00 111.39 ?  -41 DA  J C2    1 
ATOM 9144  N N3    . DA  J 6 33  ? 62.714  110.672 48.819  1.00 111.39 ?  -41 DA  J N3    1 
ATOM 9145  C C4    . DA  J 6 33  ? 61.889  109.937 49.586  1.00 111.39 ?  -41 DA  J C4    1 
ATOM 9146  P P     . DC  J 6 34  ? 57.002  110.513 45.192  1.00 114.97 ?  -40 DC  J P     1 
ATOM 9147  O OP1   . DC  J 6 34  ? 56.104  111.476 44.517  1.00 114.97 ?  -40 DC  J OP1   1 
ATOM 9148  O OP2   . DC  J 6 34  ? 56.471  109.215 45.663  1.00 114.97 -1 -40 DC  J OP2   1 
ATOM 9149  O "O5'" . DC  J 6 34  ? 58.258  110.222 44.251  1.00 114.97 ?  -40 DC  J "O5'" 1 
ATOM 9150  C "C5'" . DC  J 6 34  ? 59.555  110.643 44.659  1.00 114.97 ?  -40 DC  J "C5'" 1 
ATOM 9151  C "C4'" . DC  J 6 34  ? 60.626  109.935 43.858  1.00 114.97 ?  -40 DC  J "C4'" 1 
ATOM 9152  O "O4'" . DC  J 6 34  ? 61.611  109.371 44.763  1.00 114.97 ?  -40 DC  J "O4'" 1 
ATOM 9153  C "C3'" . DC  J 6 34  ? 60.127  108.764 43.023  1.00 114.97 ?  -40 DC  J "C3'" 1 
ATOM 9154  O "O3'" . DC  J 6 34  ? 60.954  108.607 41.890  1.00 114.97 ?  -40 DC  J "O3'" 1 
ATOM 9155  C "C2'" . DC  J 6 34  ? 60.291  107.599 43.986  1.00 114.97 ?  -40 DC  J "C2'" 1 
ATOM 9156  C "C1'" . DC  J 6 34  ? 61.617  107.962 44.638  1.00 114.97 ?  -40 DC  J "C1'" 1 
ATOM 9157  N N1    . DC  J 6 34  ? 61.818  107.368 45.990  1.00 114.97 ?  -40 DC  J N1    1 
ATOM 9158  C C2    . DC  J 6 34  ? 63.036  107.553 46.641  1.00 114.97 ?  -40 DC  J C2    1 
ATOM 9159  O O2    . DC  J 6 34  ? 63.937  108.172 46.079  1.00 114.97 ?  -40 DC  J O2    1 
ATOM 9160  N N3    . DC  J 6 34  ? 63.224  107.003 47.852  1.00 114.97 ?  -40 DC  J N3    1 
ATOM 9161  C C4    . DC  J 6 34  ? 62.237  106.334 48.439  1.00 114.97 ?  -40 DC  J C4    1 
ATOM 9162  N N4    . DC  J 6 34  ? 62.482  105.812 49.639  1.00 114.97 ?  -40 DC  J N4    1 
ATOM 9163  C C5    . DC  J 6 34  ? 60.981  106.131 47.800  1.00 114.97 ?  -40 DC  J C5    1 
ATOM 9164  C C6    . DC  J 6 34  ? 60.814  106.665 46.588  1.00 114.97 ?  -40 DC  J C6    1 
ATOM 9165  P P     . DT  J 6 35  ? 60.411  107.834 40.593  1.00 114.60 ?  -39 DT  J P     1 
ATOM 9166  O OP1   . DT  J 6 35  ? 59.531  108.767 39.858  1.00 114.60 ?  -39 DT  J OP1   1 
ATOM 9167  O OP2   . DT  J 6 35  ? 59.887  106.522 41.032  1.00 114.60 -1 -39 DT  J OP2   1 
ATOM 9168  O "O5'" . DT  J 6 35  ? 61.734  107.574 39.734  1.00 114.60 ?  -39 DT  J "O5'" 1 
ATOM 9169  C "C5'" . DT  J 6 35  ? 62.754  108.565 39.691  1.00 114.60 ?  -39 DT  J "C5'" 1 
ATOM 9170  C "C4'" . DT  J 6 35  ? 64.077  108.003 40.179  1.00 114.60 ?  -39 DT  J "C4'" 1 
ATOM 9171  O "O4'" . DT  J 6 35  ? 63.949  107.579 41.563  1.00 114.60 ?  -39 DT  J "O4'" 1 
ATOM 9172  C "C3'" . DT  J 6 35  ? 64.588  106.783 39.407  1.00 114.60 ?  -39 DT  J "C3'" 1 
ATOM 9173  O "O3'" . DT  J 6 35  ? 65.972  106.931 39.122  1.00 114.60 ?  -39 DT  J "O3'" 1 
ATOM 9174  C "C2'" . DT  J 6 35  ? 64.339  105.627 40.371  1.00 114.60 ?  -39 DT  J "C2'" 1 
ATOM 9175  C "C1'" . DT  J 6 35  ? 64.535  106.310 41.709  1.00 114.60 ?  -39 DT  J "C1'" 1 
ATOM 9176  N N1    . DT  J 6 35  ? 63.871  105.601 42.825  1.00 114.60 ?  -39 DT  J N1    1 
ATOM 9177  C C2    . DT  J 6 35  ? 64.529  105.464 44.022  1.00 114.60 ?  -39 DT  J C2    1 
ATOM 9178  O O2    . DT  J 6 35  ? 65.644  105.908 44.224  1.00 114.60 ?  -39 DT  J O2    1 
ATOM 9179  N N3    . DT  J 6 35  ? 63.834  104.782 44.982  1.00 114.60 ?  -39 DT  J N3    1 
ATOM 9180  C C4    . DT  J 6 35  ? 62.566  104.244 44.862  1.00 114.60 ?  -39 DT  J C4    1 
ATOM 9181  O O4    . DT  J 6 35  ? 62.017  103.654 45.778  1.00 114.60 ?  -39 DT  J O4    1 
ATOM 9182  C C5    . DT  J 6 35  ? 61.938  104.420 43.579  1.00 114.60 ?  -39 DT  J C5    1 
ATOM 9183  C C7    . DT  J 6 35  ? 60.564  103.876 43.331  1.00 114.60 ?  -39 DT  J C7    1 
ATOM 9184  C C6    . DT  J 6 35  ? 62.614  105.078 42.633  1.00 114.60 ?  -39 DT  J C6    1 
ATOM 9185  P P     . DA  J 6 36  ? 66.687  105.979 38.041  1.00 109.00 ?  -38 DA  J P     1 
ATOM 9186  O OP1   . DA  J 6 36  ? 67.115  106.834 36.914  1.00 109.00 ?  -38 DA  J OP1   1 
ATOM 9187  O OP2   . DA  J 6 36  ? 65.801  104.824 37.780  1.00 109.00 -1 -38 DA  J OP2   1 
ATOM 9188  O "O5'" . DA  J 6 36  ? 67.983  105.433 38.807  1.00 109.00 ?  -38 DA  J "O5'" 1 
ATOM 9189  C "C5'" . DA  J 6 36  ? 67.838  104.564 39.929  1.00 109.00 ?  -38 DA  J "C5'" 1 
ATOM 9190  C "C4'" . DA  J 6 36  ? 68.579  103.264 39.693  1.00 109.00 ?  -38 DA  J "C4'" 1 
ATOM 9191  O "O4'" . DA  J 6 36  ? 68.177  102.287 40.680  1.00 109.00 ?  -38 DA  J "O4'" 1 
ATOM 9192  C "C3'" . DA  J 6 36  ? 68.332  102.639 38.330  1.00 109.00 ?  -38 DA  J "C3'" 1 
ATOM 9193  O "O3'" . DA  J 6 36  ? 69.596  102.259 37.690  1.00 109.00 ?  -38 DA  J "O3'" 1 
ATOM 9194  C "C2'" . DA  J 6 36  ? 67.359  101.478 38.584  1.00 109.00 ?  -38 DA  J "C2'" 1 
ATOM 9195  C "C1'" . DA  J 6 36  ? 67.373  101.277 40.104  1.00 109.00 ?  -38 DA  J "C1'" 1 
ATOM 9196  N N9    . DA  J 6 36  ? 66.056  101.333 40.722  1.00 109.00 ?  -38 DA  J N9    1 
ATOM 9197  C C8    . DA  J 6 36  ? 64.888  101.729 40.138  1.00 109.00 ?  -38 DA  J C8    1 
ATOM 9198  N N7    . DA  J 6 36  ? 63.855  101.681 40.942  1.00 109.00 ?  -38 DA  J N7    1 
ATOM 9199  C C5    . DA  J 6 36  ? 64.384  101.224 42.133  1.00 109.00 ?  -38 DA  J C5    1 
ATOM 9200  C C6    . DA  J 6 36  ? 63.805  100.956 43.386  1.00 109.00 ?  -38 DA  J C6    1 
ATOM 9201  N N6    . DA  J 6 36  ? 62.509  101.122 43.640  1.00 109.00 ?  -38 DA  J N6    1 
ATOM 9202  N N1    . DA  J 6 36  ? 64.612  100.506 44.370  1.00 109.00 ?  -38 DA  J N1    1 
ATOM 9203  C C2    . DA  J 6 36  ? 65.913  100.343 44.108  1.00 109.00 ?  -38 DA  J C2    1 
ATOM 9204  N N3    . DA  J 6 36  ? 66.569  100.561 42.969  1.00 109.00 ?  -38 DA  J N3    1 
ATOM 9205  C C4    . DA  J 6 36  ? 65.738  101.004 42.015  1.00 109.00 ?  -38 DA  J C4    1 
ATOM 9206  P P     . DG  J 6 37  ? 70.248  100.785 37.788  1.00 107.10 ?  -37 DG  J P     1 
ATOM 9207  O OP1   . DG  J 6 37  ? 71.600  100.928 37.211  1.00 107.10 ?  -37 DG  J OP1   1 
ATOM 9208  O OP2   . DG  J 6 37  ? 69.348  99.767  37.206  1.00 107.10 -1 -37 DG  J OP2   1 
ATOM 9209  O "O5'" . DG  J 6 37  ? 70.430  100.519 39.354  1.00 107.10 ?  -37 DG  J "O5'" 1 
ATOM 9210  C "C5'" . DG  J 6 37  ? 71.618  99.921  39.845  1.00 107.10 ?  -37 DG  J "C5'" 1 
ATOM 9211  C "C4'" . DG  J 6 37  ? 71.355  98.509  40.330  1.00 107.10 ?  -37 DG  J "C4'" 1 
ATOM 9212  O "O4'" . DG  J 6 37  ? 69.956  98.373  40.696  1.00 107.10 ?  -37 DG  J "O4'" 1 
ATOM 9213  C "C3'" . DG  J 6 37  ? 71.613  97.419  39.296  1.00 107.10 ?  -37 DG  J "C3'" 1 
ATOM 9214  O "O3'" . DG  J 6 37  ? 72.078  96.251  39.944  1.00 107.10 ?  -37 DG  J "O3'" 1 
ATOM 9215  C "C2'" . DG  J 6 37  ? 70.229  97.203  38.713  1.00 107.10 ?  -37 DG  J "C2'" 1 
ATOM 9216  C "C1'" . DG  J 6 37  ? 69.394  97.305  39.972  1.00 107.10 ?  -37 DG  J "C1'" 1 
ATOM 9217  N N9    . DG  J 6 37  ? 67.995  97.601  39.722  1.00 107.10 ?  -37 DG  J N9    1 
ATOM 9218  C C8    . DG  J 6 37  ? 67.437  98.005  38.538  1.00 107.10 ?  -37 DG  J C8    1 
ATOM 9219  N N7    . DG  J 6 37  ? 66.151  98.205  38.613  1.00 107.10 ?  -37 DG  J N7    1 
ATOM 9220  C C5    . DG  J 6 37  ? 65.840  97.908  39.931  1.00 107.10 ?  -37 DG  J C5    1 
ATOM 9221  C C6    . DG  J 6 37  ? 64.600  97.937  40.601  1.00 107.10 ?  -37 DG  J C6    1 
ATOM 9222  O O6    . DG  J 6 37  ? 63.489  98.242  40.151  1.00 107.10 ?  -37 DG  J O6    1 
ATOM 9223  N N1    . DG  J 6 37  ? 64.727  97.565  41.929  1.00 107.10 ?  -37 DG  J N1    1 
ATOM 9224  C C2    . DG  J 6 37  ? 65.902  97.208  42.536  1.00 107.10 ?  -37 DG  J C2    1 
ATOM 9225  N N2    . DG  J 6 37  ? 65.821  96.873  43.827  1.00 107.10 ?  -37 DG  J N2    1 
ATOM 9226  N N3    . DG  J 6 37  ? 67.071  97.172  41.921  1.00 107.10 ?  -37 DG  J N3    1 
ATOM 9227  C C4    . DG  J 6 37  ? 66.965  97.536  40.626  1.00 107.10 ?  -37 DG  J C4    1 
ATOM 9228  P P     . DG  J 6 38  ? 73.211  95.343  39.261  1.00 103.67 ?  -36 DG  J P     1 
ATOM 9229  O OP1   . DG  J 6 38  ? 74.457  96.137  39.201  1.00 103.67 ?  -36 DG  J OP1   1 
ATOM 9230  O OP2   . DG  J 6 38  ? 72.640  94.768  38.025  1.00 103.67 -1 -36 DG  J OP2   1 
ATOM 9231  O "O5'" . DG  J 6 38  ? 73.413  94.149  40.300  1.00 103.67 ?  -36 DG  J "O5'" 1 
ATOM 9232  C "C5'" . DG  J 6 38  ? 73.641  94.435  41.673  1.00 103.67 ?  -36 DG  J "C5'" 1 
ATOM 9233  C "C4'" . DG  J 6 38  ? 72.579  93.802  42.562  1.00 103.67 ?  -36 DG  J "C4'" 1 
ATOM 9234  O "O4'" . DG  J 6 38  ? 71.260  94.266  42.177  1.00 103.67 ?  -36 DG  J "O4'" 1 
ATOM 9235  C "C3'" . DG  J 6 38  ? 72.507  92.279  42.530  1.00 103.67 ?  -36 DG  J "C3'" 1 
ATOM 9236  O "O3'" . DG  J 6 38  ? 72.195  91.811  43.822  1.00 103.67 ?  -36 DG  J "O3'" 1 
ATOM 9237  C "C2'" . DG  J 6 38  ? 71.359  92.024  41.561  1.00 103.67 ?  -36 DG  J "C2'" 1 
ATOM 9238  C "C1'" . DG  J 6 38  ? 70.424  93.159  41.919  1.00 103.67 ?  -36 DG  J "C1'" 1 
ATOM 9239  N N9    . DG  J 6 38  ? 69.519  93.543  40.850  1.00 103.67 ?  -36 DG  J N9    1 
ATOM 9240  C C8    . DG  J 6 38  ? 69.850  93.804  39.548  1.00 103.67 ?  -36 DG  J C8    1 
ATOM 9241  N N7    . DG  J 6 38  ? 68.832  94.153  38.815  1.00 103.67 ?  -36 DG  J N7    1 
ATOM 9242  C C5    . DG  J 6 38  ? 67.762  94.142  39.694  1.00 103.67 ?  -36 DG  J C5    1 
ATOM 9243  C C6    . DG  J 6 38  ? 66.402  94.434  39.469  1.00 103.67 ?  -36 DG  J C6    1 
ATOM 9244  O O6    . DG  J 6 38  ? 65.858  94.780  38.415  1.00 103.67 ?  -36 DG  J O6    1 
ATOM 9245  N N1    . DG  J 6 38  ? 65.650  94.297  40.625  1.00 103.67 ?  -36 DG  J N1    1 
ATOM 9246  C C2    . DG  J 6 38  ? 66.148  93.919  41.845  1.00 103.67 ?  -36 DG  J C2    1 
ATOM 9247  N N2    . DG  J 6 38  ? 65.264  93.839  42.847  1.00 103.67 ?  -36 DG  J N2    1 
ATOM 9248  N N3    . DG  J 6 38  ? 67.422  93.639  42.070  1.00 103.67 ?  -36 DG  J N3    1 
ATOM 9249  C C4    . DG  J 6 38  ? 68.169  93.773  40.952  1.00 103.67 ?  -36 DG  J C4    1 
ATOM 9250  P P     . DG  J 6 39  ? 72.345  90.259  44.197  1.00 98.42  ?  -35 DG  J P     1 
ATOM 9251  O OP1   . DG  J 6 39  ? 73.734  90.044  44.652  1.00 98.42  ?  -35 DG  J OP1   1 
ATOM 9252  O OP2   . DG  J 6 39  ? 71.786  89.440  43.102  1.00 98.42  -1 -35 DG  J OP2   1 
ATOM 9253  O "O5'" . DG  J 6 39  ? 71.365  90.102  45.439  1.00 98.42  ?  -35 DG  J "O5'" 1 
ATOM 9254  C "C5'" . DG  J 6 39  ? 70.205  90.900  45.493  1.00 98.42  ?  -35 DG  J "C5'" 1 
ATOM 9255  C "C4'" . DG  J 6 39  ? 69.091  90.194  46.232  1.00 98.42  ?  -35 DG  J "C4'" 1 
ATOM 9256  O "O4'" . DG  J 6 39  ? 67.874  90.302  45.470  1.00 98.42  ?  -35 DG  J "O4'" 1 
ATOM 9257  C "C3'" . DG  J 6 39  ? 69.282  88.709  46.423  1.00 98.42  ?  -35 DG  J "C3'" 1 
ATOM 9258  O "O3'" . DG  J 6 39  ? 68.487  88.280  47.509  1.00 98.42  ?  -35 DG  J "O3'" 1 
ATOM 9259  C "C2'" . DG  J 6 39  ? 68.782  88.142  45.094  1.00 98.42  ?  -35 DG  J "C2'" 1 
ATOM 9260  C "C1'" . DG  J 6 39  ? 67.715  89.153  44.662  1.00 98.42  ?  -35 DG  J "C1'" 1 
ATOM 9261  N N9    . DG  J 6 39  ? 67.826  89.569  43.267  1.00 98.42  ?  -35 DG  J N9    1 
ATOM 9262  C C8    . DG  J 6 39  ? 68.955  89.572  42.495  1.00 98.42  ?  -35 DG  J C8    1 
ATOM 9263  N N7    . DG  J 6 39  ? 68.755  90.014  41.289  1.00 98.42  ?  -35 DG  J N7    1 
ATOM 9264  C C5    . DG  J 6 39  ? 67.414  90.338  41.262  1.00 98.42  ?  -35 DG  J C5    1 
ATOM 9265  C C6    . DG  J 6 39  ? 66.634  90.869  40.217  1.00 98.42  ?  -35 DG  J C6    1 
ATOM 9266  O O6    . DG  J 6 39  ? 66.987  91.162  39.070  1.00 98.42  ?  -35 DG  J O6    1 
ATOM 9267  N N1    . DG  J 6 39  ? 65.315  91.040  40.599  1.00 98.42  ?  -35 DG  J N1    1 
ATOM 9268  C C2    . DG  J 6 39  ? 64.815  90.745  41.839  1.00 98.42  ?  -35 DG  J C2    1 
ATOM 9269  N N2    . DG  J 6 39  ? 63.511  90.982  42.024  1.00 98.42  ?  -35 DG  J N2    1 
ATOM 9270  N N3    . DG  J 6 39  ? 65.537  90.246  42.829  1.00 98.42  ?  -35 DG  J N3    1 
ATOM 9271  C C4    . DG  J 6 39  ? 66.825  90.071  42.470  1.00 98.42  ?  -35 DG  J C4    1 
ATOM 9272  P P     . DA  J 6 40  ? 68.389  86.726  47.888  1.00 99.58  ?  -34 DA  J P     1 
ATOM 9273  O OP1   . DA  J 6 40  ? 68.290  86.619  49.356  1.00 99.58  ?  -34 DA  J OP1   1 
ATOM 9274  O OP2   . DA  J 6 40  ? 69.458  86.007  47.170  1.00 99.58  -1 -34 DA  J OP2   1 
ATOM 9275  O "O5'" . DA  J 6 40  ? 66.993  86.285  47.271  1.00 99.58  ?  -34 DA  J "O5'" 1 
ATOM 9276  C "C5'" . DA  J 6 40  ? 65.897  87.189  47.280  1.00 99.58  ?  -34 DA  J "C5'" 1 
ATOM 9277  C "C4'" . DA  J 6 40  ? 64.781  86.721  46.354  1.00 99.58  ?  -34 DA  J "C4'" 1 
ATOM 9278  O "O4'" . DA  J 6 40  ? 64.981  87.245  45.011  1.00 99.58  ?  -34 DA  J "O4'" 1 
ATOM 9279  C "C3'" . DA  J 6 40  ? 64.649  85.207  46.189  1.00 99.58  ?  -34 DA  J "C3'" 1 
ATOM 9280  O "O3'" . DA  J 6 40  ? 63.291  84.875  46.078  1.00 99.58  ?  -34 DA  J "O3'" 1 
ATOM 9281  C "C2'" . DA  J 6 40  ? 65.353  84.974  44.859  1.00 99.58  ?  -34 DA  J "C2'" 1 
ATOM 9282  C "C1'" . DA  J 6 40  ? 64.858  86.183  44.095  1.00 99.58  ?  -34 DA  J "C1'" 1 
ATOM 9283  N N9    . DA  J 6 40  ? 65.634  86.498  42.907  1.00 99.58  ?  -34 DA  J N9    1 
ATOM 9284  C C8    . DA  J 6 40  ? 66.970  86.320  42.729  1.00 99.58  ?  -34 DA  J C8    1 
ATOM 9285  N N7    . DA  J 6 40  ? 67.404  86.705  41.557  1.00 99.58  ?  -34 DA  J N7    1 
ATOM 9286  C C5    . DA  J 6 40  ? 66.269  87.156  40.918  1.00 99.58  ?  -34 DA  J C5    1 
ATOM 9287  C C6    . DA  J 6 40  ? 66.054  87.686  39.635  1.00 99.58  ?  -34 DA  J C6    1 
ATOM 9288  N N6    . DA  J 6 40  ? 67.032  87.861  38.746  1.00 99.58  ?  -34 DA  J N6    1 
ATOM 9289  N N1    . DA  J 6 40  ? 64.795  88.045  39.303  1.00 99.58  ?  -34 DA  J N1    1 
ATOM 9290  C C2    . DA  J 6 40  ? 63.822  87.873  40.205  1.00 99.58  ?  -34 DA  J C2    1 
ATOM 9291  N N3    . DA  J 6 40  ? 63.905  87.377  41.440  1.00 99.58  ?  -34 DA  J N3    1 
ATOM 9292  C C4    . DA  J 6 40  ? 65.168  87.039  41.736  1.00 99.58  ?  -34 DA  J C4    1 
ATOM 9293  P P     . DG  J 6 41  ? 62.441  84.398  47.351  1.00 104.70 ?  -33 DG  J P     1 
ATOM 9294  O OP1   . DG  J 6 41  ? 62.482  85.463  48.375  1.00 104.70 ?  -33 DG  J OP1   1 
ATOM 9295  O OP2   . DG  J 6 41  ? 62.905  83.041  47.705  1.00 104.70 -1 -33 DG  J OP2   1 
ATOM 9296  O "O5'" . DG  J 6 41  ? 60.954  84.313  46.765  1.00 104.70 ?  -33 DG  J "O5'" 1 
ATOM 9297  C "C5'" . DG  J 6 41  ? 60.462  85.382  45.948  1.00 104.70 ?  -33 DG  J "C5'" 1 
ATOM 9298  C "C4'" . DG  J 6 41  ? 59.519  84.889  44.855  1.00 104.70 ?  -33 DG  J "C4'" 1 
ATOM 9299  O "O4'" . DG  J 6 41  ? 60.152  85.008  43.555  1.00 104.70 ?  -33 DG  J "O4'" 1 
ATOM 9300  C "C3'" . DG  J 6 41  ? 59.060  83.447  44.961  1.00 104.70 ?  -33 DG  J "C3'" 1 
ATOM 9301  O "O3'" . DG  J 6 41  ? 57.737  83.354  44.469  1.00 104.70 ?  -33 DG  J "O3'" 1 
ATOM 9302  C "C2'" . DG  J 6 41  ? 60.049  82.707  44.061  1.00 104.70 ?  -33 DG  J "C2'" 1 
ATOM 9303  C "C1'" . DG  J 6 41  ? 60.332  83.731  42.969  1.00 104.70 ?  -33 DG  J "C1'" 1 
ATOM 9304  N N9    . DG  J 6 41  ? 61.699  83.680  42.463  1.00 104.70 ?  -33 DG  J N9    1 
ATOM 9305  C C8    . DG  J 6 41  ? 62.803  83.222  43.129  1.00 104.70 ?  -33 DG  J C8    1 
ATOM 9306  N N7    . DG  J 6 41  ? 63.901  83.318  42.438  1.00 104.70 ?  -33 DG  J N7    1 
ATOM 9307  C C5    . DG  J 6 41  ? 63.510  83.905  41.253  1.00 104.70 ?  -33 DG  J C5    1 
ATOM 9308  C C6    . DG  J 6 41  ? 64.273  84.250  40.120  1.00 104.70 ?  -33 DG  J C6    1 
ATOM 9309  O O6    . DG  J 6 41  ? 65.489  84.117  39.942  1.00 104.70 ?  -33 DG  J O6    1 
ATOM 9310  N N1    . DG  J 6 41  ? 63.488  84.801  39.122  1.00 104.70 ?  -33 DG  J N1    1 
ATOM 9311  C C2    . DG  J 6 41  ? 62.135  85.001  39.210  1.00 104.70 ?  -33 DG  J C2    1 
ATOM 9312  N N2    . DG  J 6 41  ? 61.553  85.544  38.134  1.00 104.70 ?  -33 DG  J N2    1 
ATOM 9313  N N3    . DG  J 6 41  ? 61.401  84.673  40.265  1.00 104.70 ?  -33 DG  J N3    1 
ATOM 9314  C C4    . DG  J 6 41  ? 62.155  84.132  41.246  1.00 104.70 ?  -33 DG  J C4    1 
ATOM 9315  P P     . DT  J 6 42  ? 56.911  81.982  44.581  1.00 114.92 ?  -32 DT  J P     1 
ATOM 9316  O OP1   . DT  J 6 42  ? 55.615  82.293  45.220  1.00 114.92 ?  -32 DT  J OP1   1 
ATOM 9317  O OP2   . DT  J 6 42  ? 57.796  80.961  45.179  1.00 114.92 -1 -32 DT  J OP2   1 
ATOM 9318  O "O5'" . DT  J 6 42  ? 56.639  81.591  43.058  1.00 114.92 ?  -32 DT  J "O5'" 1 
ATOM 9319  C "C5'" . DT  J 6 42  ? 56.078  82.553  42.176  1.00 114.92 ?  -32 DT  J "C5'" 1 
ATOM 9320  C "C4'" . DT  J 6 42  ? 56.356  82.196  40.728  1.00 114.92 ?  -32 DT  J "C4'" 1 
ATOM 9321  O "O4'" . DT  J 6 42  ? 57.761  82.408  40.428  1.00 114.92 ?  -32 DT  J "O4'" 1 
ATOM 9322  C "C3'" . DT  J 6 42  ? 56.052  80.745  40.345  1.00 114.92 ?  -32 DT  J "C3'" 1 
ATOM 9323  O "O3'" . DT  J 6 42  ? 55.356  80.713  39.111  1.00 114.92 ?  -32 DT  J "O3'" 1 
ATOM 9324  C "C2'" . DT  J 6 42  ? 57.440  80.121  40.218  1.00 114.92 ?  -32 DT  J "C2'" 1 
ATOM 9325  C "C1'" . DT  J 6 42  ? 58.245  81.301  39.712  1.00 114.92 ?  -32 DT  J "C1'" 1 
ATOM 9326  N N1    . DT  J 6 42  ? 59.699  81.176  39.959  1.00 114.92 ?  -32 DT  J N1    1 
ATOM 9327  C C2    . DT  J 6 42  ? 60.575  81.662  39.026  1.00 114.92 ?  -32 DT  J C2    1 
ATOM 9328  O O2    . DT  J 6 42  ? 60.218  82.198  37.996  1.00 114.92 ?  -32 DT  J O2    1 
ATOM 9329  N N3    . DT  J 6 42  ? 61.894  81.494  39.338  1.00 114.92 ?  -32 DT  J N3    1 
ATOM 9330  C C4    . DT  J 6 42  ? 62.409  80.906  40.475  1.00 114.92 ?  -32 DT  J C4    1 
ATOM 9331  O O4    . DT  J 6 42  ? 63.611  80.805  40.670  1.00 114.92 ?  -32 DT  J O4    1 
ATOM 9332  C C5    . DT  J 6 42  ? 61.437  80.418  41.412  1.00 114.92 ?  -32 DT  J C5    1 
ATOM 9333  C C7    . DT  J 6 42  ? 61.883  79.756  42.679  1.00 114.92 ?  -32 DT  J C7    1 
ATOM 9334  C C6    . DT  J 6 42  ? 60.143  80.571  41.112  1.00 114.92 ?  -32 DT  J C6    1 
ATOM 9335  P P     . DA  J 6 43  ? 54.604  79.377  38.634  1.00 123.67 ?  -31 DA  J P     1 
ATOM 9336  O OP1   . DA  J 6 43  ? 53.151  79.639  38.710  1.00 123.67 ?  -31 DA  J OP1   1 
ATOM 9337  O OP2   . DA  J 6 43  ? 55.182  78.227  39.362  1.00 123.67 -1 -31 DA  J OP2   1 
ATOM 9338  O "O5'" . DA  J 6 43  ? 55.027  79.235  37.101  1.00 123.67 ?  -31 DA  J "O5'" 1 
ATOM 9339  C "C5'" . DA  J 6 43  ? 56.356  79.526  36.717  1.00 123.67 ?  -31 DA  J "C5'" 1 
ATOM 9340  C "C4'" . DA  J 6 43  ? 56.702  78.859  35.404  1.00 123.67 ?  -31 DA  J "C4'" 1 
ATOM 9341  O "O4'" . DA  J 6 43  ? 58.138  78.833  35.265  1.00 123.67 ?  -31 DA  J "O4'" 1 
ATOM 9342  C "C3'" . DA  J 6 43  ? 56.296  77.404  35.304  1.00 123.67 ?  -31 DA  J "C3'" 1 
ATOM 9343  O "O3'" . DA  J 6 43  ? 56.294  77.000  33.940  1.00 123.67 ?  -31 DA  J "O3'" 1 
ATOM 9344  C "C2'" . DA  J 6 43  ? 57.415  76.727  36.079  1.00 123.67 ?  -31 DA  J "C2'" 1 
ATOM 9345  C "C1'" . DA  J 6 43  ? 58.626  77.567  35.671  1.00 123.67 ?  -31 DA  J "C1'" 1 
ATOM 9346  N N9    . DA  J 6 43  ? 59.580  77.764  36.752  1.00 123.67 ?  -31 DA  J N9    1 
ATOM 9347  C C8    . DA  J 6 43  ? 59.302  78.027  38.062  1.00 123.67 ?  -31 DA  J C8    1 
ATOM 9348  N N7    . DA  J 6 43  ? 60.369  78.156  38.812  1.00 123.67 ?  -31 DA  J N7    1 
ATOM 9349  C C5    . DA  J 6 43  ? 61.414  77.961  37.930  1.00 123.67 ?  -31 DA  J C5    1 
ATOM 9350  C C6    . DA  J 6 43  ? 62.807  77.969  38.094  1.00 123.67 ?  -31 DA  J C6    1 
ATOM 9351  N N6    . DA  J 6 43  ? 63.407  78.181  39.264  1.00 123.67 ?  -31 DA  J N6    1 
ATOM 9352  N N1    . DA  J 6 43  ? 63.567  77.739  37.005  1.00 123.67 ?  -31 DA  J N1    1 
ATOM 9353  C C2    . DA  J 6 43  ? 62.969  77.525  35.833  1.00 123.67 ?  -31 DA  J C2    1 
ATOM 9354  N N3    . DA  J 6 43  ? 61.670  77.487  35.557  1.00 123.67 ?  -31 DA  J N3    1 
ATOM 9355  C C4    . DA  J 6 43  ? 60.943  77.721  36.657  1.00 123.67 ?  -31 DA  J C4    1 
ATOM 9356  P P     . DA  J 6 44  ? 55.844  75.513  33.532  1.00 126.26 ?  -30 DA  J P     1 
ATOM 9357  O OP1   . DA  J 6 44  ? 55.057  75.626  32.287  1.00 126.26 ?  -30 DA  J OP1   1 
ATOM 9358  O OP2   . DA  J 6 44  ? 55.248  74.866  34.720  1.00 126.26 -1 -30 DA  J OP2   1 
ATOM 9359  O "O5'" . DA  J 6 44  ? 57.221  74.766  33.202  1.00 126.26 ?  -30 DA  J "O5'" 1 
ATOM 9360  C "C5'" . DA  J 6 44  ? 57.887  75.028  31.973  1.00 126.26 ?  -30 DA  J "C5'" 1 
ATOM 9361  C "C4'" . DA  J 6 44  ? 59.242  74.342  31.915  1.00 126.26 ?  -30 DA  J "C4'" 1 
ATOM 9362  O "O4'" . DA  J 6 44  ? 60.077  74.789  33.015  1.00 126.26 ?  -30 DA  J "O4'" 1 
ATOM 9363  C "C3'" . DA  J 6 44  ? 59.218  72.813  32.002  1.00 126.26 ?  -30 DA  J "C3'" 1 
ATOM 9364  O "O3'" . DA  J 6 44  ? 60.159  72.286  31.080  1.00 126.26 ?  -30 DA  J "O3'" 1 
ATOM 9365  C "C2'" . DA  J 6 44  ? 59.651  72.555  33.444  1.00 126.26 ?  -30 DA  J "C2'" 1 
ATOM 9366  C "C1'" . DA  J 6 44  ? 60.664  73.664  33.624  1.00 126.26 ?  -30 DA  J "C1'" 1 
ATOM 9367  N N9    . DA  J 6 44  ? 60.968  73.997  35.010  1.00 126.26 ?  -30 DA  J N9    1 
ATOM 9368  C C8    . DA  J 6 44  ? 60.085  74.291  36.008  1.00 126.26 ?  -30 DA  J C8    1 
ATOM 9369  N N7    . DA  J 6 44  ? 60.660  74.576  37.153  1.00 126.26 ?  -30 DA  J N7    1 
ATOM 9370  C C5    . DA  J 6 44  ? 62.010  74.473  36.878  1.00 126.26 ?  -30 DA  J C5    1 
ATOM 9371  C C6    . DA  J 6 44  ? 63.161  74.654  37.669  1.00 126.26 ?  -30 DA  J C6    1 
ATOM 9372  N N6    . DA  J 6 44  ? 63.121  74.990  38.960  1.00 126.26 ?  -30 DA  J N6    1 
ATOM 9373  N N1    . DA  J 6 44  ? 64.362  74.473  37.079  1.00 126.26 ?  -30 DA  J N1    1 
ATOM 9374  C C2    . DA  J 6 44  ? 64.401  74.136  35.788  1.00 126.26 ?  -30 DA  J C2    1 
ATOM 9375  N N3    . DA  J 6 44  ? 63.392  73.933  34.949  1.00 126.26 ?  -30 DA  J N3    1 
ATOM 9376  C C4    . DA  J 6 44  ? 62.215  74.122  35.562  1.00 126.26 ?  -30 DA  J C4    1 
ATOM 9377  P P     . DT  J 6 45  ? 60.172  70.724  30.705  1.00 124.17 ?  -29 DT  J P     1 
ATOM 9378  O OP1   . DT  J 6 45  ? 59.311  70.545  29.516  1.00 124.17 ?  -29 DT  J OP1   1 
ATOM 9379  O OP2   . DT  J 6 45  ? 59.905  69.930  31.923  1.00 124.17 -1 -29 DT  J OP2   1 
ATOM 9380  O "O5'" . DT  J 6 45  ? 61.692  70.464  30.287  1.00 124.17 ?  -29 DT  J "O5'" 1 
ATOM 9381  C "C5'" . DT  J 6 45  ? 62.735  71.143  30.976  1.00 124.17 ?  -29 DT  J "C5'" 1 
ATOM 9382  C "C4'" . DT  J 6 45  ? 63.843  70.186  31.367  1.00 124.17 ?  -29 DT  J "C4'" 1 
ATOM 9383  O "O4'" . DT  J 6 45  ? 64.295  70.508  32.707  1.00 124.17 ?  -29 DT  J "O4'" 1 
ATOM 9384  C "C3'" . DT  J 6 45  ? 63.425  68.729  31.455  1.00 124.17 ?  -29 DT  J "C3'" 1 
ATOM 9385  O "O3'" . DT  J 6 45  ? 64.583  67.910  31.419  1.00 124.17 ?  -29 DT  J "O3'" 1 
ATOM 9386  C "C2'" . DT  J 6 45  ? 62.818  68.705  32.845  1.00 124.17 ?  -29 DT  J "C2'" 1 
ATOM 9387  C "C1'" . DT  J 6 45  ? 63.902  69.469  33.587  1.00 124.17 ?  -29 DT  J "C1'" 1 
ATOM 9388  N N1    . DT  J 6 45  ? 63.479  70.074  34.871  1.00 124.17 ?  -29 DT  J N1    1 
ATOM 9389  C C2    . DT  J 6 45  ? 64.445  70.542  35.717  1.00 124.17 ?  -29 DT  J C2    1 
ATOM 9390  O O2    . DT  J 6 45  ? 65.634  70.472  35.470  1.00 124.17 ?  -29 DT  J O2    1 
ATOM 9391  N N3    . DT  J 6 45  ? 63.981  71.080  36.878  1.00 124.17 ?  -29 DT  J N3    1 
ATOM 9392  C C4    . DT  J 6 45  ? 62.666  71.216  37.262  1.00 124.17 ?  -29 DT  J C4    1 
ATOM 9393  O O4    . DT  J 6 45  ? 62.351  71.717  38.331  1.00 124.17 ?  -29 DT  J O4    1 
ATOM 9394  C C5    . DT  J 6 45  ? 61.695  70.709  36.330  1.00 124.17 ?  -29 DT  J C5    1 
ATOM 9395  C C7    . DT  J 6 45  ? 60.236  70.793  36.651  1.00 124.17 ?  -29 DT  J C7    1 
ATOM 9396  C C6    . DT  J 6 45  ? 62.141  70.168  35.188  1.00 124.17 ?  -29 DT  J C6    1 
ATOM 9397  P P     . DC  J 6 46  ? 65.111  67.271  30.043  1.00 121.53 ?  -28 DC  J P     1 
ATOM 9398  O OP1   . DC  J 6 46  ? 65.610  68.367  29.187  1.00 121.53 ?  -28 DC  J OP1   1 
ATOM 9399  O OP2   . DC  J 6 46  ? 64.061  66.362  29.538  1.00 121.53 -1 -28 DC  J OP2   1 
ATOM 9400  O "O5'" . DC  J 6 46  ? 66.360  66.385  30.506  1.00 121.53 ?  -28 DC  J "O5'" 1 
ATOM 9401  C "C5'" . DC  J 6 46  ? 67.401  66.978  31.283  1.00 121.53 ?  -28 DC  J "C5'" 1 
ATOM 9402  C "C4'" . DC  J 6 46  ? 67.762  66.125  32.495  1.00 121.53 ?  -28 DC  J "C4'" 1 
ATOM 9403  O "O4'" . DC  J 6 46  ? 67.087  66.623  33.683  1.00 121.53 ?  -28 DC  J "O4'" 1 
ATOM 9404  C "C3'" . DC  J 6 46  ? 67.393  64.642  32.408  1.00 121.53 ?  -28 DC  J "C3'" 1 
ATOM 9405  O "O3'" . DC  J 6 46  ? 68.387  63.878  33.067  1.00 121.53 ?  -28 DC  J "O3'" 1 
ATOM 9406  C "C2'" . DC  J 6 46  ? 66.091  64.599  33.199  1.00 121.53 ?  -28 DC  J "C2'" 1 
ATOM 9407  C "C1'" . DC  J 6 46  ? 66.461  65.537  34.327  1.00 121.53 ?  -28 DC  J "C1'" 1 
ATOM 9408  N N1    . DC  J 6 46  ? 65.315  66.050  35.122  1.00 121.53 ?  -28 DC  J N1    1 
ATOM 9409  C C2    . DC  J 6 46  ? 65.571  66.810  36.259  1.00 121.53 ?  -28 DC  J C2    1 
ATOM 9410  O O2    . DC  J 6 46  ? 66.735  67.013  36.602  1.00 121.53 ?  -28 DC  J O2    1 
ATOM 9411  N N3    . DC  J 6 46  ? 64.541  67.265  36.996  1.00 121.53 ?  -28 DC  J N3    1 
ATOM 9412  C C4    . DC  J 6 46  ? 63.292  67.021  36.611  1.00 121.53 ?  -28 DC  J C4    1 
ATOM 9413  N N4    . DC  J 6 46  ? 62.310  67.505  37.370  1.00 121.53 ?  -28 DC  J N4    1 
ATOM 9414  C C5    . DC  J 6 46  ? 62.999  66.249  35.450  1.00 121.53 ?  -28 DC  J C5    1 
ATOM 9415  C C6    . DC  J 6 46  ? 64.033  65.790  34.737  1.00 121.53 ?  -28 DC  J C6    1 
ATOM 9416  P P     . DC  J 6 47  ? 69.571  63.169  32.247  1.00 115.76 ?  -27 DC  J P     1 
ATOM 9417  O OP1   . DC  J 6 47  ? 70.268  64.208  31.458  1.00 115.76 ?  -27 DC  J OP1   1 
ATOM 9418  O OP2   . DC  J 6 47  ? 69.010  61.977  31.576  1.00 115.76 -1 -27 DC  J OP2   1 
ATOM 9419  O "O5'" . DC  J 6 47  ? 70.563  62.668  33.394  1.00 115.76 ?  -27 DC  J "O5'" 1 
ATOM 9420  C "C5'" . DC  J 6 47  ? 71.255  63.621  34.188  1.00 115.76 ?  -27 DC  J "C5'" 1 
ATOM 9421  C "C4'" . DC  J 6 47  ? 70.882  63.495  35.657  1.00 115.76 ?  -27 DC  J "C4'" 1 
ATOM 9422  O "O4'" . DC  J 6 47  ? 69.469  63.776  35.846  1.00 115.76 ?  -27 DC  J "O4'" 1 
ATOM 9423  C "C3'" . DC  J 6 47  ? 71.121  62.115  36.285  1.00 115.76 ?  -27 DC  J "C3'" 1 
ATOM 9424  O "O3'" . DC  J 6 47  ? 71.688  62.279  37.573  1.00 115.76 ?  -27 DC  J "O3'" 1 
ATOM 9425  C "C2'" . DC  J 6 47  ? 69.706  61.552  36.396  1.00 115.76 ?  -27 DC  J "C2'" 1 
ATOM 9426  C "C1'" . DC  J 6 47  ? 68.957  62.821  36.740  1.00 115.76 ?  -27 DC  J "C1'" 1 
ATOM 9427  N N1    . DC  J 6 47  ? 67.487  62.738  36.580  1.00 115.76 ?  -27 DC  J N1    1 
ATOM 9428  C C2    . DC  J 6 47  ? 66.670  63.454  37.449  1.00 115.76 ?  -27 DC  J C2    1 
ATOM 9429  O O2    . DC  J 6 47  ? 67.179  64.121  38.347  1.00 115.76 ?  -27 DC  J O2    1 
ATOM 9430  N N3    . DC  J 6 47  ? 65.334  63.371  37.316  1.00 115.76 ?  -27 DC  J N3    1 
ATOM 9431  C C4    . DC  J 6 47  ? 64.809  62.630  36.349  1.00 115.76 ?  -27 DC  J C4    1 
ATOM 9432  N N4    . DC  J 6 47  ? 63.479  62.590  36.255  1.00 115.76 ?  -27 DC  J N4    1 
ATOM 9433  C C5    . DC  J 6 47  ? 65.622  61.889  35.444  1.00 115.76 ?  -27 DC  J C5    1 
ATOM 9434  C C6    . DC  J 6 47  ? 66.947  61.975  35.593  1.00 115.76 ?  -27 DC  J C6    1 
ATOM 9435  P P     . DC  J 6 48  ? 73.279  62.247  37.790  1.00 114.76 ?  -26 DC  J P     1 
ATOM 9436  O OP1   . DC  J 6 48  ? 73.894  63.353  37.023  1.00 114.76 ?  -26 DC  J OP1   1 
ATOM 9437  O OP2   . DC  J 6 48  ? 73.728  60.855  37.569  1.00 114.76 -1 -26 DC  J OP2   1 
ATOM 9438  O "O5'" . DC  J 6 48  ? 73.435  62.571  39.346  1.00 114.76 ?  -26 DC  J "O5'" 1 
ATOM 9439  C "C5'" . DC  J 6 48  ? 72.443  63.352  40.004  1.00 114.76 ?  -26 DC  J "C5'" 1 
ATOM 9440  C "C4'" . DC  J 6 48  ? 71.863  62.604  41.186  1.00 114.76 ?  -26 DC  J "C4'" 1 
ATOM 9441  O "O4'" . DC  J 6 48  ? 70.471  62.270  40.925  1.00 114.76 ?  -26 DC  J "O4'" 1 
ATOM 9442  C "C3'" . DC  J 6 48  ? 72.546  61.273  41.511  1.00 114.76 ?  -26 DC  J "C3'" 1 
ATOM 9443  O "O3'" . DC  J 6 48  ? 72.539  61.076  42.909  1.00 114.76 ?  -26 DC  J "O3'" 1 
ATOM 9444  C "C2'" . DC  J 6 48  ? 71.617  60.275  40.835  1.00 114.76 ?  -26 DC  J "C2'" 1 
ATOM 9445  C "C1'" . DC  J 6 48  ? 70.290  60.903  41.201  1.00 114.76 ?  -26 DC  J "C1'" 1 
ATOM 9446  N N1    . DC  J 6 48  ? 69.117  60.390  40.442  1.00 114.76 ?  -26 DC  J N1    1 
ATOM 9447  C C2    . DC  J 6 48  ? 67.834  60.769  40.837  1.00 114.76 ?  -26 DC  J C2    1 
ATOM 9448  O O2    . DC  J 6 48  ? 67.700  61.526  41.801  1.00 114.76 ?  -26 DC  J O2    1 
ATOM 9449  N N3    . DC  J 6 48  ? 66.771  60.300  40.152  1.00 114.76 ?  -26 DC  J N3    1 
ATOM 9450  C C4    . DC  J 6 48  ? 66.951  59.485  39.118  1.00 114.76 ?  -26 DC  J C4    1 
ATOM 9451  N N4    . DC  J 6 48  ? 65.865  59.051  38.473  1.00 114.76 ?  -26 DC  J N4    1 
ATOM 9452  C C5    . DC  J 6 48  ? 68.251  59.080  38.699  1.00 114.76 ?  -26 DC  J C5    1 
ATOM 9453  C C6    . DC  J 6 48  ? 69.296  59.549  39.387  1.00 114.76 ?  -26 DC  J C6    1 
ATOM 9454  P P     . DC  J 6 49  ? 73.843  61.369  43.796  1.00 104.97 ?  -25 DC  J P     1 
ATOM 9455  O OP1   . DC  J 6 49  ? 74.317  62.730  43.472  1.00 104.97 ?  -25 DC  J OP1   1 
ATOM 9456  O OP2   . DC  J 6 49  ? 74.763  60.221  43.665  1.00 104.97 -1 -25 DC  J OP2   1 
ATOM 9457  O "O5'" . DC  J 6 49  ? 73.270  61.364  45.285  1.00 104.97 ?  -25 DC  J "O5'" 1 
ATOM 9458  C "C5'" . DC  J 6 49  ? 72.192  62.222  45.623  1.00 104.97 ?  -25 DC  J "C5'" 1 
ATOM 9459  C "C4'" . DC  J 6 49  ? 70.980  61.430  46.082  1.00 104.97 ?  -25 DC  J "C4'" 1 
ATOM 9460  O "O4'" . DC  J 6 49  ? 70.316  60.837  44.947  1.00 104.97 ?  -25 DC  J "O4'" 1 
ATOM 9461  C "C3'" . DC  J 6 49  ? 71.282  60.276  47.038  1.00 104.97 ?  -25 DC  J "C3'" 1 
ATOM 9462  O "O3'" . DC  J 6 49  ? 70.790  60.587  48.331  1.00 104.97 ?  -25 DC  J "O3'" 1 
ATOM 9463  C "C2'" . DC  J 6 49  ? 70.551  59.070  46.426  1.00 104.97 ?  -25 DC  J "C2'" 1 
ATOM 9464  C "C1'" . DC  J 6 49  ? 69.635  59.696  45.390  1.00 104.97 ?  -25 DC  J "C1'" 1 
ATOM 9465  N N1    . DC  J 6 49  ? 69.372  58.817  44.213  1.00 104.97 ?  -25 DC  J N1    1 
ATOM 9466  C C2    . DC  J 6 49  ? 68.061  58.626  43.763  1.00 104.97 ?  -25 DC  J C2    1 
ATOM 9467  O O2    . DC  J 6 49  ? 67.135  59.184  44.353  1.00 104.97 ?  -25 DC  J O2    1 
ATOM 9468  N N3    . DC  J 6 49  ? 67.845  57.832  42.686  1.00 104.97 ?  -25 DC  J N3    1 
ATOM 9469  C C4    . DC  J 6 49  ? 68.870  57.249  42.076  1.00 104.97 ?  -25 DC  J C4    1 
ATOM 9470  N N4    . DC  J 6 49  ? 68.613  56.473  41.020  1.00 104.97 ?  -25 DC  J N4    1 
ATOM 9471  C C5    . DC  J 6 49  ? 70.210  57.429  42.521  1.00 104.97 ?  -25 DC  J C5    1 
ATOM 9472  C C6    . DC  J 6 49  ? 70.411  58.212  43.583  1.00 104.97 ?  -25 DC  J C6    1 
ATOM 9473  P P     . DT  J 6 50  ? 70.797  59.489  49.504  1.00 91.86  ?  -24 DT  J P     1 
ATOM 9474  O OP1   . DT  J 6 50  ? 71.085  60.220  50.749  1.00 91.86  ?  -24 DT  J OP1   1 
ATOM 9475  O OP2   . DT  J 6 50  ? 71.663  58.353  49.133  1.00 91.86  -1 -24 DT  J OP2   1 
ATOM 9476  O "O5'" . DT  J 6 50  ? 69.286  58.981  49.554  1.00 91.86  ?  -24 DT  J "O5'" 1 
ATOM 9477  C "C5'" . DT  J 6 50  ? 68.235  59.923  49.681  1.00 91.86  ?  -24 DT  J "C5'" 1 
ATOM 9478  C "C4'" . DT  J 6 50  ? 66.889  59.264  49.474  1.00 91.86  ?  -24 DT  J "C4'" 1 
ATOM 9479  O "O4'" . DT  J 6 50  ? 66.831  58.692  48.140  1.00 91.86  ?  -24 DT  J "O4'" 1 
ATOM 9480  C "C3'" . DT  J 6 50  ? 66.577  58.124  50.445  1.00 91.86  ?  -24 DT  J "C3'" 1 
ATOM 9481  O "O3'" . DT  J 6 50  ? 65.258  58.232  50.927  1.00 91.86  ?  -24 DT  J "O3'" 1 
ATOM 9482  C "C2'" . DT  J 6 50  ? 66.733  56.887  49.588  1.00 91.86  ?  -24 DT  J "C2'" 1 
ATOM 9483  C "C1'" . DT  J 6 50  ? 66.312  57.391  48.221  1.00 91.86  ?  -24 DT  J "C1'" 1 
ATOM 9484  N N1    . DT  J 6 50  ? 66.867  56.573  47.102  1.00 91.86  ?  -24 DT  J N1    1 
ATOM 9485  C C2    . DT  J 6 50  ? 66.014  56.007  46.188  1.00 91.86  ?  -24 DT  J C2    1 
ATOM 9486  O O2    . DT  J 6 50  ? 64.809  56.144  46.225  1.00 91.86  ?  -24 DT  J O2    1 
ATOM 9487  N N3    . DT  J 6 50  ? 66.632  55.271  45.217  1.00 91.86  ?  -24 DT  J N3    1 
ATOM 9488  C C4    . DT  J 6 50  ? 67.982  55.048  45.072  1.00 91.86  ?  -24 DT  J C4    1 
ATOM 9489  O O4    . DT  J 6 50  ? 68.446  54.369  44.165  1.00 91.86  ?  -24 DT  J O4    1 
ATOM 9490  C C5    . DT  J 6 50  ? 68.816  55.661  46.062  1.00 91.86  ?  -24 DT  J C5    1 
ATOM 9491  C C7    . DT  J 6 50  ? 70.300  55.472  46.002  1.00 91.86  ?  -24 DT  J C7    1 
ATOM 9492  C C6    . DT  J 6 50  ? 68.228  56.389  47.017  1.00 91.86  ?  -24 DT  J C6    1 
ATOM 9493  P P     . DT  J 6 51  ? 64.821  57.454  52.263  1.00 98.71  ?  -23 DT  J P     1 
ATOM 9494  O OP1   . DT  J 6 51  ? 64.274  58.435  53.220  1.00 98.71  ?  -23 DT  J OP1   1 
ATOM 9495  O OP2   . DT  J 6 51  ? 65.926  56.561  52.663  1.00 98.71  -1 -23 DT  J OP2   1 
ATOM 9496  O "O5'" . DT  J 6 51  ? 63.619  56.538  51.778  1.00 98.71  ?  -23 DT  J "O5'" 1 
ATOM 9497  C "C5'" . DT  J 6 51  ? 62.624  57.081  50.942  1.00 98.71  ?  -23 DT  J "C5'" 1 
ATOM 9498  C "C4'" . DT  J 6 51  ? 61.884  55.980  50.216  1.00 98.71  ?  -23 DT  J "C4'" 1 
ATOM 9499  O "O4'" . DT  J 6 51  ? 62.705  55.468  49.133  1.00 98.71  ?  -23 DT  J "O4'" 1 
ATOM 9500  C "C3'" . DT  J 6 51  ? 61.530  54.772  51.085  1.00 98.71  ?  -23 DT  J "C3'" 1 
ATOM 9501  O "O3'" . DT  J 6 51  ? 60.181  54.407  50.868  1.00 98.71  ?  -23 DT  J "O3'" 1 
ATOM 9502  C "C2'" . DT  J 6 51  ? 62.490  53.692  50.589  1.00 98.71  ?  -23 DT  J "C2'" 1 
ATOM 9503  C "C1'" . DT  J 6 51  ? 62.607  54.070  49.129  1.00 98.71  ?  -23 DT  J "C1'" 1 
ATOM 9504  N N1    . DT  J 6 51  ? 63.796  53.491  48.426  1.00 98.71  ?  -23 DT  J N1    1 
ATOM 9505  C C2    . DT  J 6 51  ? 63.594  52.758  47.284  1.00 98.71  ?  -23 DT  J C2    1 
ATOM 9506  O O2    . DT  J 6 51  ? 62.491  52.523  46.830  1.00 98.71  ?  -23 DT  J O2    1 
ATOM 9507  N N3    . DT  J 6 51  ? 64.733  52.260  46.717  1.00 98.71  ?  -23 DT  J N3    1 
ATOM 9508  C C4    . DT  J 6 51  ? 66.025  52.445  47.146  1.00 98.71  ?  -23 DT  J C4    1 
ATOM 9509  O O4    . DT  J 6 51  ? 66.987  51.969  46.563  1.00 98.71  ?  -23 DT  J O4    1 
ATOM 9510  C C5    . DT  J 6 51  ? 66.174  53.230  48.330  1.00 98.71  ?  -23 DT  J C5    1 
ATOM 9511  C C7    . DT  J 6 51  ? 67.544  53.464  48.880  1.00 98.71  ?  -23 DT  J C7    1 
ATOM 9512  C C6    . DT  J 6 51  ? 65.066  53.717  48.915  1.00 98.71  ?  -23 DT  J C6    1 
ATOM 9513  P P     . DG  J 6 52  ? 59.387  53.568  51.981  1.00 118.98 ?  -22 DG  J P     1 
ATOM 9514  O OP1   . DG  J 6 52  ? 58.085  54.230  52.207  1.00 118.98 ?  -22 DG  J OP1   1 
ATOM 9515  O OP2   . DG  J 6 52  ? 60.313  53.338  53.108  1.00 118.98 -1 -22 DG  J OP2   1 
ATOM 9516  O "O5'" . DG  J 6 52  ? 59.127  52.159  51.282  1.00 118.98 ?  -22 DG  J "O5'" 1 
ATOM 9517  C "C5'" . DG  J 6 52  ? 58.417  52.103  50.059  1.00 118.98 ?  -22 DG  J "C5'" 1 
ATOM 9518  C "C4'" . DG  J 6 52  ? 58.617  50.761  49.388  1.00 118.98 ?  -22 DG  J "C4'" 1 
ATOM 9519  O "O4'" . DG  J 6 52  ? 59.891  50.747  48.699  1.00 118.98 ?  -22 DG  J "O4'" 1 
ATOM 9520  C "C3'" . DG  J 6 52  ? 58.629  49.564  50.342  1.00 118.98 ?  -22 DG  J "C3'" 1 
ATOM 9521  O "O3'" . DG  J 6 52  ? 57.696  48.596  49.908  1.00 118.98 ?  -22 DG  J "O3'" 1 
ATOM 9522  C "C2'" . DG  J 6 52  ? 60.064  49.039  50.261  1.00 118.98 ?  -22 DG  J "C2'" 1 
ATOM 9523  C "C1'" . DG  J 6 52  ? 60.491  49.495  48.879  1.00 118.98 ?  -22 DG  J "C1'" 1 
ATOM 9524  N N9    . DG  J 6 52  ? 61.933  49.646  48.747  1.00 118.98 ?  -22 DG  J N9    1 
ATOM 9525  C C8    . DG  J 6 52  ? 62.753  50.430  49.512  1.00 118.98 ?  -22 DG  J C8    1 
ATOM 9526  N N7    . DG  J 6 52  ? 64.008  50.359  49.173  1.00 118.98 ?  -22 DG  J N7    1 
ATOM 9527  C C5    . DG  J 6 52  ? 64.016  49.473  48.111  1.00 118.98 ?  -22 DG  J C5    1 
ATOM 9528  C C6    . DG  J 6 52  ? 65.091  49.006  47.326  1.00 118.98 ?  -22 DG  J C6    1 
ATOM 9529  O O6    . DG  J 6 52  ? 66.290  49.291  47.418  1.00 118.98 ?  -22 DG  J O6    1 
ATOM 9530  N N1    . DG  J 6 52  ? 64.666  48.103  46.360  1.00 118.98 ?  -22 DG  J N1    1 
ATOM 9531  C C2    . DG  J 6 52  ? 63.363  47.709  46.172  1.00 118.98 ?  -22 DG  J C2    1 
ATOM 9532  N N2    . DG  J 6 52  ? 63.143  46.830  45.187  1.00 118.98 ?  -22 DG  J N2    1 
ATOM 9533  N N3    . DG  J 6 52  ? 62.347  48.142  46.899  1.00 118.98 ?  -22 DG  J N3    1 
ATOM 9534  C C4    . DG  J 6 52  ? 62.745  49.028  47.836  1.00 118.98 ?  -22 DG  J C4    1 
ATOM 9535  P P     . DG  J 6 53  ? 57.255  47.400  50.884  1.00 129.07 ?  -21 DG  J P     1 
ATOM 9536  O OP1   . DG  J 6 53  ? 55.794  47.502  51.087  1.00 129.07 ?  -21 DG  J OP1   1 
ATOM 9537  O OP2   . DG  J 6 53  ? 58.158  47.410  52.053  1.00 129.07 -1 -21 DG  J OP2   1 
ATOM 9538  O "O5'" . DG  J 6 53  ? 57.581  46.089  50.034  1.00 129.07 ?  -21 DG  J "O5'" 1 
ATOM 9539  C "C5'" . DG  J 6 53  ? 57.813  46.197  48.637  1.00 129.07 ?  -21 DG  J "C5'" 1 
ATOM 9540  C "C4'" . DG  J 6 53  ? 58.699  45.070  48.148  1.00 129.07 ?  -21 DG  J "C4'" 1 
ATOM 9541  O "O4'" . DG  J 6 53  ? 60.052  45.560  47.926  1.00 129.07 ?  -21 DG  J "O4'" 1 
ATOM 9542  C "C3'" . DG  J 6 53  ? 58.835  43.890  49.112  1.00 129.07 ?  -21 DG  J "C3'" 1 
ATOM 9543  O "O3'" . DG  J 6 53  ? 58.805  42.687  48.379  1.00 129.07 ?  -21 DG  J "O3'" 1 
ATOM 9544  C "C2'" . DG  J 6 53  ? 60.209  44.123  49.727  1.00 129.07 ?  -21 DG  J "C2'" 1 
ATOM 9545  C "C1'" . DG  J 6 53  ? 60.953  44.664  48.527  1.00 129.07 ?  -21 DG  J "C1'" 1 
ATOM 9546  N N9    . DG  J 6 53  ? 62.185  45.369  48.866  1.00 129.07 ?  -21 DG  J N9    1 
ATOM 9547  C C8    . DG  J 6 53  ? 62.336  46.389  49.770  1.00 129.07 ?  -21 DG  J C8    1 
ATOM 9548  N N7    . DG  J 6 53  ? 63.564  46.815  49.870  1.00 129.07 ?  -21 DG  J N7    1 
ATOM 9549  C C5    . DG  J 6 53  ? 64.269  46.031  48.966  1.00 129.07 ?  -21 DG  J C5    1 
ATOM 9550  C C6    . DG  J 6 53  ? 65.648  46.025  48.639  1.00 129.07 ?  -21 DG  J C6    1 
ATOM 9551  O O6    . DG  J 6 53  ? 66.544  46.754  49.083  1.00 129.07 ?  -21 DG  J O6    1 
ATOM 9552  N N1    . DG  J 6 53  ? 65.948  45.060  47.681  1.00 129.07 ?  -21 DG  J N1    1 
ATOM 9553  C C2    . DG  J 6 53  ? 65.036  44.209  47.121  1.00 129.07 ?  -21 DG  J C2    1 
ATOM 9554  N N2    . DG  J 6 53  ? 65.511  43.347  46.223  1.00 129.07 ?  -21 DG  J N2    1 
ATOM 9555  N N3    . DG  J 6 53  ? 63.745  44.200  47.420  1.00 129.07 ?  -21 DG  J N3    1 
ATOM 9556  C C4    . DG  J 6 53  ? 63.435  45.135  48.347  1.00 129.07 ?  -21 DG  J C4    1 
ATOM 9557  P P     . DC  J 6 54  ? 58.703  41.268  49.123  1.00 131.27 ?  -20 DC  J P     1 
ATOM 9558  O OP1   . DC  J 6 54  ? 57.300  41.092  49.557  1.00 131.27 ?  -20 DC  J OP1   1 
ATOM 9559  O OP2   . DC  J 6 54  ? 59.798  41.152  50.111  1.00 131.27 -1 -20 DC  J OP2   1 
ATOM 9560  O "O5'" . DC  J 6 54  ? 59.026  40.232  47.956  1.00 131.27 ?  -20 DC  J "O5'" 1 
ATOM 9561  C "C5'" . DC  J 6 54  ? 60.012  40.563  46.987  1.00 131.27 ?  -20 DC  J "C5'" 1 
ATOM 9562  C "C4'" . DC  J 6 54  ? 60.854  39.353  46.644  1.00 131.27 ?  -20 DC  J "C4'" 1 
ATOM 9563  O "O4'" . DC  J 6 54  ? 62.255  39.710  46.685  1.00 131.27 ?  -20 DC  J "O4'" 1 
ATOM 9564  C "C3'" . DC  J 6 54  ? 60.715  38.187  47.600  1.00 131.27 ?  -20 DC  J "C3'" 1 
ATOM 9565  O "O3'" . DC  J 6 54  ? 61.013  36.984  46.925  1.00 131.27 ?  -20 DC  J "O3'" 1 
ATOM 9566  C "C2'" . DC  J 6 54  ? 61.756  38.508  48.669  1.00 131.27 ?  -20 DC  J "C2'" 1 
ATOM 9567  C "C1'" . DC  J 6 54  ? 62.854  39.203  47.865  1.00 131.27 ?  -20 DC  J "C1'" 1 
ATOM 9568  N N1    . DC  J 6 54  ? 63.473  40.342  48.584  1.00 131.27 ?  -20 DC  J N1    1 
ATOM 9569  C C2    . DC  J 6 54  ? 64.847  40.571  48.476  1.00 131.27 ?  -20 DC  J C2    1 
ATOM 9570  O O2    . DC  J 6 54  ? 65.537  39.798  47.805  1.00 131.27 ?  -20 DC  J O2    1 
ATOM 9571  N N3    . DC  J 6 54  ? 65.387  41.623  49.142  1.00 131.27 ?  -20 DC  J N3    1 
ATOM 9572  C C4    . DC  J 6 54  ? 64.613  42.411  49.882  1.00 131.27 ?  -20 DC  J C4    1 
ATOM 9573  N N4    . DC  J 6 54  ? 65.185  43.437  50.513  1.00 131.27 ?  -20 DC  J N4    1 
ATOM 9574  C C5    . DC  J 6 54  ? 63.212  42.200  49.989  1.00 131.27 ?  -20 DC  J C5    1 
ATOM 9575  C C6    . DC  J 6 54  ? 62.689  41.168  49.328  1.00 131.27 ?  -20 DC  J C6    1 
ATOM 9576  P P     . DG  J 6 55  ? 60.789  35.573  47.654  1.00 132.88 ?  -19 DG  J P     1 
ATOM 9577  O OP1   . DG  J 6 55  ? 60.316  34.612  46.633  1.00 132.88 ?  -19 DG  J OP1   1 
ATOM 9578  O OP2   . DG  J 6 55  ? 59.983  35.822  48.869  1.00 132.88 -1 -19 DG  J OP2   1 
ATOM 9579  O "O5'" . DG  J 6 55  ? 62.257  35.159  48.118  1.00 132.88 ?  -19 DG  J "O5'" 1 
ATOM 9580  C "C5'" . DG  J 6 55  ? 63.371  35.459  47.288  1.00 132.88 ?  -19 DG  J "C5'" 1 
ATOM 9581  C "C4'" . DG  J 6 55  ? 64.673  35.203  48.021  1.00 132.88 ?  -19 DG  J "C4'" 1 
ATOM 9582  O "O4'" . DG  J 6 55  ? 65.247  36.459  48.473  1.00 132.88 ?  -19 DG  J "O4'" 1 
ATOM 9583  C "C3'" . DG  J 6 55  ? 64.551  34.330  49.271  1.00 132.88 ?  -19 DG  J "C3'" 1 
ATOM 9584  O "O3'" . DG  J 6 55  ? 65.655  33.463  49.334  1.00 132.88 ?  -19 DG  J "O3'" 1 
ATOM 9585  C "C2'" . DG  J 6 55  ? 64.603  35.356  50.397  1.00 132.88 ?  -19 DG  J "C2'" 1 
ATOM 9586  C "C1'" . DG  J 6 55  ? 65.619  36.318  49.822  1.00 132.88 ?  -19 DG  J "C1'" 1 
ATOM 9587  N N9    . DG  J 6 55  ? 65.620  37.631  50.449  1.00 132.88 ?  -19 DG  J N9    1 
ATOM 9588  C C8    . DG  J 6 55  ? 64.536  38.337  50.902  1.00 132.88 ?  -19 DG  J C8    1 
ATOM 9589  N N7    . DG  J 6 55  ? 64.850  39.494  51.412  1.00 132.88 ?  -19 DG  J N7    1 
ATOM 9590  C C5    . DG  J 6 55  ? 66.231  39.552  51.294  1.00 132.88 ?  -19 DG  J C5    1 
ATOM 9591  C C6    . DG  J 6 55  ? 67.131  40.571  51.667  1.00 132.88 ?  -19 DG  J C6    1 
ATOM 9592  O O6    . DG  J 6 55  ? 66.878  41.655  52.204  1.00 132.88 ?  -19 DG  J O6    1 
ATOM 9593  N N1    . DG  J 6 55  ? 68.447  40.230  51.373  1.00 132.88 ?  -19 DG  J N1    1 
ATOM 9594  C C2    . DG  J 6 55  ? 68.834  39.057  50.783  1.00 132.88 ?  -19 DG  J C2    1 
ATOM 9595  N N2    . DG  J 6 55  ? 70.144  38.906  50.575  1.00 132.88 ?  -19 DG  J N2    1 
ATOM 9596  N N3    . DG  J 6 55  ? 67.999  38.097  50.422  1.00 132.88 ?  -19 DG  J N3    1 
ATOM 9597  C C4    . DG  J 6 55  ? 66.717  38.415  50.704  1.00 132.88 ?  -19 DG  J C4    1 
ATOM 9598  P P     . DG  J 6 56  ? 65.456  31.906  49.659  1.00 127.83 ?  -18 DG  J P     1 
ATOM 9599  O OP1   . DG  J 6 56  ? 65.161  31.212  48.386  1.00 127.83 ?  -18 DG  J OP1   1 
ATOM 9600  O OP2   . DG  J 6 56  ? 64.517  31.790  50.797  1.00 127.83 -1 -18 DG  J OP2   1 
ATOM 9601  O "O5'" . DG  J 6 56  ? 66.901  31.463  50.163  1.00 127.83 ?  -18 DG  J "O5'" 1 
ATOM 9602  C "C5'" . DG  J 6 56  ? 68.049  32.065  49.590  1.00 127.83 ?  -18 DG  J "C5'" 1 
ATOM 9603  C "C4'" . DG  J 6 56  ? 69.097  32.343  50.649  1.00 127.83 ?  -18 DG  J "C4'" 1 
ATOM 9604  O "O4'" . DG  J 6 56  ? 68.973  33.706  51.125  1.00 127.83 ?  -18 DG  J "O4'" 1 
ATOM 9605  C "C3'" . DG  J 6 56  ? 69.025  31.445  51.878  1.00 127.83 ?  -18 DG  J "C3'" 1 
ATOM 9606  O "O3'" . DG  J 6 56  ? 70.328  30.966  52.174  1.00 127.83 ?  -18 DG  J "O3'" 1 
ATOM 9607  C "C2'" . DG  J 6 56  ? 68.473  32.372  52.973  1.00 127.83 ?  -18 DG  J "C2'" 1 
ATOM 9608  C "C1'" . DG  J 6 56  ? 68.997  33.728  52.535  1.00 127.83 ?  -18 DG  J "C1'" 1 
ATOM 9609  N N9    . DG  J 6 56  ? 68.169  34.848  52.962  1.00 127.83 ?  -18 DG  J N9    1 
ATOM 9610  C C8    . DG  J 6 56  ? 66.802  34.872  53.053  1.00 127.83 ?  -18 DG  J C8    1 
ATOM 9611  N N7    . DG  J 6 56  ? 66.325  36.025  53.429  1.00 127.83 ?  -18 DG  J N7    1 
ATOM 9612  C C5    . DG  J 6 56  ? 67.449  36.820  53.591  1.00 127.83 ?  -18 DG  J C5    1 
ATOM 9613  C C6    . DG  J 6 56  ? 67.557  38.170  53.988  1.00 127.83 ?  -18 DG  J C6    1 
ATOM 9614  O O6    . DG  J 6 56  ? 66.655  38.956  54.293  1.00 127.83 ?  -18 DG  J O6    1 
ATOM 9615  N N1    . DG  J 6 56  ? 68.877  38.593  54.026  1.00 127.83 ?  -18 DG  J N1    1 
ATOM 9616  C C2    . DG  J 6 56  ? 69.959  37.813  53.714  1.00 127.83 ?  -18 DG  J C2    1 
ATOM 9617  N N2    . DG  J 6 56  ? 71.154  38.408  53.819  1.00 127.83 ?  -18 DG  J N2    1 
ATOM 9618  N N3    . DG  J 6 56  ? 69.878  36.542  53.342  1.00 127.83 ?  -18 DG  J N3    1 
ATOM 9619  C C4    . DG  J 6 56  ? 68.593  36.114  53.302  1.00 127.83 ?  -18 DG  J C4    1 
ATOM 9620  P P     . DT  J 6 57  ? 70.643  30.210  53.553  1.00 125.57 ?  -17 DT  J P     1 
ATOM 9621  O OP1   . DT  J 6 57  ? 71.742  29.257  53.286  1.00 125.57 ?  -17 DT  J OP1   1 
ATOM 9622  O OP2   . DT  J 6 57  ? 69.374  29.707  54.121  1.00 125.57 -1 -17 DT  J OP2   1 
ATOM 9623  O "O5'" . DT  J 6 57  ? 71.195  31.377  54.490  1.00 125.57 ?  -17 DT  J "O5'" 1 
ATOM 9624  C "C5'" . DT  J 6 57  ? 72.142  32.316  53.976  1.00 125.57 ?  -17 DT  J "C5'" 1 
ATOM 9625  C "C4'" . DT  J 6 57  ? 73.346  32.429  54.891  1.00 125.57 ?  -17 DT  J "C4'" 1 
ATOM 9626  O "O4'" . DT  J 6 57  ? 73.320  33.695  55.576  1.00 125.57 ?  -17 DT  J "O4'" 1 
ATOM 9627  C "C3'" . DT  J 6 57  ? 73.418  31.376  55.984  1.00 125.57 ?  -17 DT  J "C3'" 1 
ATOM 9628  O "O3'" . DT  J 6 57  ? 74.799  30.843  56.204  1.00 125.57 ?  -17 DT  J "O3'" 1 
ATOM 9629  C "C2'" . DT  J 6 57  ? 72.788  32.045  57.218  1.00 125.57 ?  -17 DT  J "C2'" 1 
ATOM 9630  C "C1'" . DT  J 6 57  ? 72.760  33.540  56.864  1.00 125.57 ?  -17 DT  J "C1'" 1 
ATOM 9631  N N1    . DT  J 6 57  ? 71.389  34.149  56.859  1.00 125.57 ?  -17 DT  J N1    1 
ATOM 9632  C C2    . DT  J 6 57  ? 71.267  35.519  56.821  1.00 125.57 ?  -17 DT  J C2    1 
ATOM 9633  O O2    . DT  J 6 57  ? 72.222  36.272  56.804  1.00 125.57 ?  -17 DT  J O2    1 
ATOM 9634  N N3    . DT  J 6 57  ? 69.979  35.984  56.826  1.00 125.57 ?  -17 DT  J N3    1 
ATOM 9635  C C4    . DT  J 6 57  ? 68.824  35.225  56.834  1.00 125.57 ?  -17 DT  J C4    1 
ATOM 9636  O O4    . DT  J 6 57  ? 67.712  35.730  56.828  1.00 125.57 ?  -17 DT  J O4    1 
ATOM 9637  C C5    . DT  J 6 57  ? 69.021  33.797  56.873  1.00 125.57 ?  -17 DT  J C5    1 
ATOM 9638  C C7    . DT  J 6 57  ? 67.841  32.878  56.899  1.00 125.57 ?  -17 DT  J C7    1 
ATOM 9639  C C6    . DT  J 6 57  ? 70.278  33.333  56.884  1.00 125.57 ?  -17 DT  J C6    1 
ATOM 9640  P P     . DT  J 6 58  ? 76.135  31.738  56.428  1.00 119.43 ?  -16 DT  J P     1 
ATOM 9641  O OP1   . DT  J 6 58  ? 76.499  32.601  55.284  1.00 119.43 ?  -16 DT  J OP1   1 
ATOM 9642  O OP2   . DT  J 6 58  ? 77.144  30.745  56.842  1.00 119.43 -1 -16 DT  J OP2   1 
ATOM 9643  O "O5'" . DT  J 6 58  ? 75.859  32.611  57.736  1.00 119.43 ?  -16 DT  J "O5'" 1 
ATOM 9644  C "C5'" . DT  J 6 58  ? 76.453  33.888  57.877  1.00 119.43 ?  -16 DT  J "C5'" 1 
ATOM 9645  C "C4'" . DT  J 6 58  ? 76.131  34.484  59.233  1.00 119.43 ?  -16 DT  J "C4'" 1 
ATOM 9646  O "O4'" . DT  J 6 58  ? 74.694  34.637  59.375  1.00 119.43 ?  -16 DT  J "O4'" 1 
ATOM 9647  C "C3'" . DT  J 6 58  ? 76.591  33.647  60.432  1.00 119.43 ?  -16 DT  J "C3'" 1 
ATOM 9648  O "O3'" . DT  J 6 58  ? 77.240  34.478  61.373  1.00 119.43 ?  -16 DT  J "O3'" 1 
ATOM 9649  C "C2'" . DT  J 6 58  ? 75.287  33.092  60.996  1.00 119.43 ?  -16 DT  J "C2'" 1 
ATOM 9650  C "C1'" . DT  J 6 58  ? 74.322  34.215  60.660  1.00 119.43 ?  -16 DT  J "C1'" 1 
ATOM 9651  N N1    . DT  J 6 58  ? 72.891  33.795  60.642  1.00 119.43 ?  -16 DT  J N1    1 
ATOM 9652  C C2    . DT  J 6 58  ? 71.910  34.752  60.576  1.00 119.43 ?  -16 DT  J C2    1 
ATOM 9653  O O2    . DT  J 6 58  ? 72.145  35.943  60.517  1.00 119.43 ?  -16 DT  J O2    1 
ATOM 9654  N N3    . DT  J 6 58  ? 70.630  34.260  60.576  1.00 119.43 ?  -16 DT  J N3    1 
ATOM 9655  C C4    . DT  J 6 58  ? 70.252  32.933  60.637  1.00 119.43 ?  -16 DT  J C4    1 
ATOM 9656  O O4    . DT  J 6 58  ? 69.082  32.582  60.628  1.00 119.43 ?  -16 DT  J O4    1 
ATOM 9657  C C5    . DT  J 6 58  ? 71.330  31.987  60.711  1.00 119.43 ?  -16 DT  J C5    1 
ATOM 9658  C C7    . DT  J 6 58  ? 71.040  30.520  60.784  1.00 119.43 ?  -16 DT  J C7    1 
ATOM 9659  C C6    . DT  J 6 58  ? 72.580  32.457  60.720  1.00 119.43 ?  -16 DT  J C6    1 
ATOM 9660  P P     . DA  J 6 59  ? 78.125  33.843  62.554  1.00 105.88 ?  -15 DA  J P     1 
ATOM 9661  O OP1   . DA  J 6 59  ? 79.474  33.590  62.005  1.00 105.88 ?  -15 DA  J OP1   1 
ATOM 9662  O OP2   . DA  J 6 59  ? 77.365  32.740  63.181  1.00 105.88 -1 -15 DA  J OP2   1 
ATOM 9663  O "O5'" . DA  J 6 59  ? 78.221  35.027  63.620  1.00 105.88 ?  -15 DA  J "O5'" 1 
ATOM 9664  C "C5'" . DA  J 6 59  ? 78.639  36.312  63.199  1.00 105.88 ?  -15 DA  J "C5'" 1 
ATOM 9665  C "C4'" . DA  J 6 59  ? 77.602  37.366  63.540  1.00 105.88 ?  -15 DA  J "C4'" 1 
ATOM 9666  O "O4'" . DA  J 6 59  ? 76.267  36.823  63.369  1.00 105.88 ?  -15 DA  J "O4'" 1 
ATOM 9667  C "C3'" . DA  J 6 59  ? 77.660  37.891  64.965  1.00 105.88 ?  -15 DA  J "C3'" 1 
ATOM 9668  O "O3'" . DA  J 6 59  ? 77.345  39.271  64.968  1.00 105.88 ?  -15 DA  J "O3'" 1 
ATOM 9669  C "C2'" . DA  J 6 59  ? 76.596  37.063  65.682  1.00 105.88 ?  -15 DA  J "C2'" 1 
ATOM 9670  C "C1'" . DA  J 6 59  ? 75.553  36.884  64.588  1.00 105.88 ?  -15 DA  J "C1'" 1 
ATOM 9671  N N9    . DA  J 6 59  ? 74.783  35.652  64.709  1.00 105.88 ?  -15 DA  J N9    1 
ATOM 9672  C C8    . DA  J 6 59  ? 75.277  34.380  64.744  1.00 105.88 ?  -15 DA  J C8    1 
ATOM 9673  N N7    . DA  J 6 59  ? 74.355  33.456  64.844  1.00 105.88 ?  -15 DA  J N7    1 
ATOM 9674  C C5    . DA  J 6 59  ? 73.173  34.170  64.869  1.00 105.88 ?  -15 DA  J C5    1 
ATOM 9675  C C6    . DA  J 6 59  ? 71.831  33.768  64.960  1.00 105.88 ?  -15 DA  J C6    1 
ATOM 9676  N N6    . DA  J 6 59  ? 71.456  32.492  65.053  1.00 105.88 ?  -15 DA  J N6    1 
ATOM 9677  N N1    . DA  J 6 59  ? 70.885  34.730  64.963  1.00 105.88 ?  -15 DA  J N1    1 
ATOM 9678  C C2    . DA  J 6 59  ? 71.265  36.008  64.871  1.00 105.88 ?  -15 DA  J C2    1 
ATOM 9679  N N3    . DA  J 6 59  ? 72.500  36.507  64.779  1.00 105.88 ?  -15 DA  J N3    1 
ATOM 9680  C C4    . DA  J 6 59  ? 73.414  35.525  64.782  1.00 105.88 ?  -15 DA  J C4    1 
ATOM 9681  P P     . DA  J 6 60  ? 77.552  40.150  66.294  1.00 94.94  ?  -14 DA  J P     1 
ATOM 9682  O OP1   . DA  J 6 60  ? 77.870  41.529  65.867  1.00 94.94  ?  -14 DA  J OP1   1 
ATOM 9683  O OP2   . DA  J 6 60  ? 78.467  39.418  67.196  1.00 94.94  -1 -14 DA  J OP2   1 
ATOM 9684  O "O5'" . DA  J 6 60  ? 76.108  40.148  66.963  1.00 94.94  ?  -14 DA  J "O5'" 1 
ATOM 9685  C "C5'" . DA  J 6 60  ? 74.967  40.354  66.156  1.00 94.94  ?  -14 DA  J "C5'" 1 
ATOM 9686  C "C4'" . DA  J 6 60  ? 73.705  40.220  66.975  1.00 94.94  ?  -14 DA  J "C4'" 1 
ATOM 9687  O "O4'" . DA  J 6 60  ? 73.212  38.864  66.889  1.00 94.94  ?  -14 DA  J "O4'" 1 
ATOM 9688  C "C3'" . DA  J 6 60  ? 73.871  40.520  68.462  1.00 94.94  ?  -14 DA  J "C3'" 1 
ATOM 9689  O "O3'" . DA  J 6 60  ? 72.798  41.321  68.898  1.00 94.94  ?  -14 DA  J "O3'" 1 
ATOM 9690  C "C2'" . DA  J 6 60  ? 73.833  39.137  69.103  1.00 94.94  ?  -14 DA  J "C2'" 1 
ATOM 9691  C "C1'" . DA  J 6 60  ? 72.877  38.420  68.176  1.00 94.94  ?  -14 DA  J "C1'" 1 
ATOM 9692  N N9    . DA  J 6 60  ? 73.004  36.975  68.202  1.00 94.94  ?  -14 DA  J N9    1 
ATOM 9693  C C8    . DA  J 6 60  ? 74.157  36.247  68.184  1.00 94.94  ?  -14 DA  J C8    1 
ATOM 9694  N N7    . DA  J 6 60  ? 73.961  34.951  68.209  1.00 94.94  ?  -14 DA  J N7    1 
ATOM 9695  C C5    . DA  J 6 60  ? 72.585  34.827  68.242  1.00 94.94  ?  -14 DA  J C5    1 
ATOM 9696  C C6    . DA  J 6 60  ? 71.733  33.710  68.280  1.00 94.94  ?  -14 DA  J C6    1 
ATOM 9697  N N6    . DA  J 6 60  ? 72.172  32.451  68.289  1.00 94.94  ?  -14 DA  J N6    1 
ATOM 9698  N N1    . DA  J 6 60  ? 70.404  33.936  68.305  1.00 94.94  ?  -14 DA  J N1    1 
ATOM 9699  C C2    . DA  J 6 60  ? 69.965  35.196  68.288  1.00 94.94  ?  -14 DA  J C2    1 
ATOM 9700  N N3    . DA  J 6 60  ? 70.669  36.322  68.261  1.00 94.94  ?  -14 DA  J N3    1 
ATOM 9701  C C4    . DA  J 6 60  ? 71.983  36.064  68.236  1.00 94.94  ?  -14 DA  J C4    1 
ATOM 9702  P P     . DA  J 6 61  ? 72.898  42.122  70.282  1.00 88.53  ?  -13 DA  J P     1 
ATOM 9703  O OP1   . DA  J 6 61  ? 72.929  43.566  69.967  1.00 88.53  ?  -13 DA  J OP1   1 
ATOM 9704  O OP2   . DA  J 6 61  ? 73.992  41.516  71.064  1.00 88.53  -1 -13 DA  J OP2   1 
ATOM 9705  O "O5'" . DA  J 6 61  ? 71.522  41.775  71.008  1.00 88.53  ?  -13 DA  J "O5'" 1 
ATOM 9706  C "C5'" . DA  J 6 61  ? 70.305  42.048  70.353  1.00 88.53  ?  -13 DA  J "C5'" 1 
ATOM 9707  C "C4'" . DA  J 6 61  ? 69.257  41.019  70.715  1.00 88.53  ?  -13 DA  J "C4'" 1 
ATOM 9708  O "O4'" . DA  J 6 61  ? 69.756  39.692  70.424  1.00 88.53  ?  -13 DA  J "O4'" 1 
ATOM 9709  C "C3'" . DA  J 6 61  ? 68.847  41.004  72.188  1.00 88.53  ?  -13 DA  J "C3'" 1 
ATOM 9710  O "O3'" . DA  J 6 61  ? 67.439  41.057  72.287  1.00 88.53  ?  -13 DA  J "O3'" 1 
ATOM 9711  C "C2'" . DA  J 6 61  ? 69.399  39.673  72.705  1.00 88.53  ?  -13 DA  J "C2'" 1 
ATOM 9712  C "C1'" . DA  J 6 61  ? 69.355  38.827  71.451  1.00 88.53  ?  -13 DA  J "C1'" 1 
ATOM 9713  N N9    . DA  J 6 61  ? 70.256  37.680  71.467  1.00 88.53  ?  -13 DA  J N9    1 
ATOM 9714  C C8    . DA  J 6 61  ? 71.618  37.706  71.444  1.00 88.53  ?  -13 DA  J C8    1 
ATOM 9715  N N7    . DA  J 6 61  ? 72.169  36.518  71.452  1.00 88.53  ?  -13 DA  J N7    1 
ATOM 9716  C C5    . DA  J 6 61  ? 71.094  35.653  71.480  1.00 88.53  ?  -13 DA  J C5    1 
ATOM 9717  C C6    . DA  J 6 61  ? 71.005  34.249  71.501  1.00 88.53  ?  -13 DA  J C6    1 
ATOM 9718  N N6    . DA  J 6 61  ? 72.071  33.449  71.499  1.00 88.53  ?  -13 DA  J N6    1 
ATOM 9719  N N1    . DA  J 6 61  ? 69.774  33.695  71.524  1.00 88.53  ?  -13 DA  J N1    1 
ATOM 9720  C C2    . DA  J 6 61  ? 68.707  34.500  71.520  1.00 88.53  ?  -13 DA  J C2    1 
ATOM 9721  N N3    . DA  J 6 61  ? 68.668  35.833  71.508  1.00 88.53  ?  -13 DA  J N3    1 
ATOM 9722  C C4    . DA  J 6 61  ? 69.906  36.351  71.486  1.00 88.53  ?  -13 DA  J C4    1 
ATOM 9723  P P     . DA  J 6 62  ? 66.743  41.396  73.690  1.00 100.45 ?  -12 DA  J P     1 
ATOM 9724  O OP1   . DA  J 6 62  ? 65.651  42.356  73.438  1.00 100.45 ?  -12 DA  J OP1   1 
ATOM 9725  O OP2   . DA  J 6 62  ? 67.811  41.729  74.650  1.00 100.45 -1 -12 DA  J OP2   1 
ATOM 9726  O "O5'" . DA  J 6 62  ? 66.099  40.009  74.134  1.00 100.45 ?  -12 DA  J "O5'" 1 
ATOM 9727  C "C5'" . DA  J 6 62  ? 65.101  39.412  73.327  1.00 100.45 ?  -12 DA  J "C5'" 1 
ATOM 9728  C "C4'" . DA  J 6 62  ? 64.671  38.059  73.876  1.00 100.45 ?  -12 DA  J "C4'" 1 
ATOM 9729  O "O4'" . DA  J 6 62  ? 65.712  37.076  73.661  1.00 100.45 ?  -12 DA  J "O4'" 1 
ATOM 9730  C "C3'" . DA  J 6 62  ? 64.350  38.018  75.365  1.00 100.45 ?  -12 DA  J "C3'" 1 
ATOM 9731  O "O3'" . DA  J 6 62  ? 63.215  37.207  75.558  1.00 100.45 ?  -12 DA  J "O3'" 1 
ATOM 9732  C "C2'" . DA  J 6 62  ? 65.604  37.385  75.976  1.00 100.45 ?  -12 DA  J "C2'" 1 
ATOM 9733  C "C1'" . DA  J 6 62  ? 66.016  36.424  74.875  1.00 100.45 ?  -12 DA  J "C1'" 1 
ATOM 9734  N N9    . DA  J 6 62  ? 67.438  36.098  74.850  1.00 100.45 ?  -12 DA  J N9    1 
ATOM 9735  C C8    . DA  J 6 62  ? 68.484  36.969  74.761  1.00 100.45 ?  -12 DA  J C8    1 
ATOM 9736  N N7    . DA  J 6 62  ? 69.657  36.385  74.721  1.00 100.45 ?  -12 DA  J N7    1 
ATOM 9737  C C5    . DA  J 6 62  ? 69.356  35.038  74.775  1.00 100.45 ?  -12 DA  J C5    1 
ATOM 9738  C C6    . DA  J 6 62  ? 70.159  33.881  74.771  1.00 100.45 ?  -12 DA  J C6    1 
ATOM 9739  N N6    . DA  J 6 62  ? 71.490  33.912  74.707  1.00 100.45 ?  -12 DA  J N6    1 
ATOM 9740  N N1    . DA  J 6 62  ? 69.537  32.684  74.837  1.00 100.45 ?  -12 DA  J N1    1 
ATOM 9741  C C2    . DA  J 6 62  ? 68.203  32.654  74.899  1.00 100.45 ?  -12 DA  J C2    1 
ATOM 9742  N N3    . DA  J 6 62  ? 67.346  33.671  74.912  1.00 100.45 ?  -12 DA  J N3    1 
ATOM 9743  C C4    . DA  J 6 62  ? 67.992  34.844  74.845  1.00 100.45 ?  -12 DA  J C4    1 
ATOM 9744  P P     . DC  J 6 63  ? 62.354  37.319  76.904  1.00 112.94 ?  -11 DC  J P     1 
ATOM 9745  O OP1   . DC  J 6 63  ? 60.928  37.352  76.512  1.00 112.94 ?  -11 DC  J OP1   1 
ATOM 9746  O OP2   . DC  J 6 63  ? 62.921  38.420  77.712  1.00 112.94 -1 -11 DC  J OP2   1 
ATOM 9747  O "O5'" . DC  J 6 63  ? 62.658  35.940  77.651  1.00 112.94 ?  -11 DC  J "O5'" 1 
ATOM 9748  C "C5'" . DC  J 6 63  ? 62.609  34.717  76.925  1.00 112.94 ?  -11 DC  J "C5'" 1 
ATOM 9749  C "C4'" . DC  J 6 63  ? 63.175  33.575  77.748  1.00 112.94 ?  -11 DC  J "C4'" 1 
ATOM 9750  O "O4'" . DC  J 6 63  ? 64.584  33.398  77.441  1.00 112.94 ?  -11 DC  J "O4'" 1 
ATOM 9751  C "C3'" . DC  J 6 63  ? 63.094  33.772  79.262  1.00 112.94 ?  -11 DC  J "C3'" 1 
ATOM 9752  O "O3'" . DC  J 6 63  ? 62.673  32.570  79.885  1.00 112.94 ?  -11 DC  J "O3'" 1 
ATOM 9753  C "C2'" . DC  J 6 63  ? 64.529  34.120  79.640  1.00 112.94 ?  -11 DC  J "C2'" 1 
ATOM 9754  C "C1'" . DC  J 6 63  ? 65.298  33.276  78.646  1.00 112.94 ?  -11 DC  J "C1'" 1 
ATOM 9755  N N1    . DC  J 6 63  ? 66.690  33.737  78.427  1.00 112.94 ?  -11 DC  J N1    1 
ATOM 9756  C C2    . DC  J 6 63  ? 67.715  32.800  78.282  1.00 112.94 ?  -11 DC  J C2    1 
ATOM 9757  O O2    . DC  J 6 63  ? 67.438  31.601  78.335  1.00 112.94 ?  -11 DC  J O2    1 
ATOM 9758  N N3    . DC  J 6 63  ? 68.980  33.238  78.081  1.00 112.94 ?  -11 DC  J N3    1 
ATOM 9759  C C4    . DC  J 6 63  ? 69.230  34.546  78.030  1.00 112.94 ?  -11 DC  J C4    1 
ATOM 9760  N N4    . DC  J 6 63  ? 70.492  34.938  77.832  1.00 112.94 ?  -11 DC  J N4    1 
ATOM 9761  C C5    . DC  J 6 63  ? 68.198  35.515  78.183  1.00 112.94 ?  -11 DC  J C5    1 
ATOM 9762  C C6    . DC  J 6 63  ? 66.956  35.069  78.378  1.00 112.94 ?  -11 DC  J C6    1 
ATOM 9763  P P     . DG  J 6 64  ? 62.166  32.589  81.409  1.00 119.47 ?  -10 DG  J P     1 
ATOM 9764  O OP1   . DG  J 6 64  ? 60.756  32.147  81.410  1.00 119.47 ?  -10 DG  J OP1   1 
ATOM 9765  O OP2   . DG  J 6 64  ? 62.523  33.896  81.998  1.00 119.47 -1 -10 DG  J OP2   1 
ATOM 9766  O "O5'" . DG  J 6 64  ? 63.057  31.473  82.124  1.00 119.47 ?  -10 DG  J "O5'" 1 
ATOM 9767  C "C5'" . DG  J 6 64  ? 62.648  30.115  82.085  1.00 119.47 ?  -10 DG  J "C5'" 1 
ATOM 9768  C "C4'" . DG  J 6 64  ? 63.753  29.188  82.566  1.00 119.47 ?  -10 DG  J "C4'" 1 
ATOM 9769  O "O4'" . DG  J 6 64  ? 65.000  29.520  81.904  1.00 119.47 ?  -10 DG  J "O4'" 1 
ATOM 9770  C "C3'" . DG  J 6 64  ? 64.048  29.225  84.061  1.00 119.47 ?  -10 DG  J "C3'" 1 
ATOM 9771  O "O3'" . DG  J 6 64  ? 64.356  27.897  84.504  1.00 119.47 ?  -10 DG  J "O3'" 1 
ATOM 9772  C "C2'" . DG  J 6 64  ? 65.248  30.168  84.143  1.00 119.47 ?  -10 DG  J "C2'" 1 
ATOM 9773  C "C1'" . DG  J 6 64  ? 65.991  29.834  82.862  1.00 119.47 ?  -10 DG  J "C1'" 1 
ATOM 9774  N N9    . DG  J 6 64  ? 66.773  30.940  82.332  1.00 119.47 ?  -10 DG  J N9    1 
ATOM 9775  C C8    . DG  J 6 64  ? 66.290  32.132  81.869  1.00 119.47 ?  -10 DG  J C8    1 
ATOM 9776  N N7    . DG  J 6 64  ? 67.215  32.933  81.428  1.00 119.47 ?  -10 DG  J N7    1 
ATOM 9777  C C5    . DG  J 6 64  ? 68.390  32.221  81.602  1.00 119.47 ?  -10 DG  J C5    1 
ATOM 9778  C C6    . DG  J 6 64  ? 69.722  32.580  81.302  1.00 119.47 ?  -10 DG  J C6    1 
ATOM 9779  O O6    . DG  J 6 64  ? 70.139  33.637  80.818  1.00 119.47 ?  -10 DG  J O6    1 
ATOM 9780  N N1    . DG  J 6 64  ? 70.614  31.575  81.644  1.00 119.47 ?  -10 DG  J N1    1 
ATOM 9781  C C2    . DG  J 6 64  ? 70.266  30.367  82.198  1.00 119.47 ?  -10 DG  J C2    1 
ATOM 9782  N N2    . DG  J 6 64  ? 71.271  29.520  82.452  1.00 119.47 ?  -10 DG  J N2    1 
ATOM 9783  N N3    . DG  J 6 64  ? 69.018  30.015  82.482  1.00 119.47 ?  -10 DG  J N3    1 
ATOM 9784  C C4    . DG  J 6 64  ? 68.136  30.989  82.156  1.00 119.47 ?  -10 DG  J C4    1 
ATOM 9785  P P     . DC  J 6 65  ? 65.230  27.612  85.824  1.00 122.97 ?  -9  DC  J P     1 
ATOM 9786  O OP1   . DC  J 6 65  ? 64.816  26.279  86.312  1.00 122.97 ?  -9  DC  J OP1   1 
ATOM 9787  O OP2   . DC  J 6 65  ? 65.157  28.757  86.757  1.00 122.97 -1 -9  DC  J OP2   1 
ATOM 9788  O "O5'" . DC  J 6 65  ? 66.720  27.476  85.263  1.00 122.97 ?  -9  DC  J "O5'" 1 
ATOM 9789  C "C5'" . DC  J 6 65  ? 67.561  26.431  85.729  1.00 122.97 ?  -9  DC  J "C5'" 1 
ATOM 9790  C "C4'" . DC  J 6 65  ? 68.684  26.972  86.597  1.00 122.97 ?  -9  DC  J "C4'" 1 
ATOM 9791  O "O4'" . DC  J 6 65  ? 69.287  28.131  85.965  1.00 122.97 ?  -9  DC  J "O4'" 1 
ATOM 9792  C "C3'" . DC  J 6 65  ? 68.271  27.441  87.994  1.00 122.97 ?  -9  DC  J "C3'" 1 
ATOM 9793  O "O3'" . DC  J 6 65  ? 69.327  27.176  88.901  1.00 122.97 ?  -9  DC  J "O3'" 1 
ATOM 9794  C "C2'" . DC  J 6 65  ? 68.115  28.943  87.787  1.00 122.97 ?  -9  DC  J "C2'" 1 
ATOM 9795  C "C1'" . DC  J 6 65  ? 69.317  29.185  86.898  1.00 122.97 ?  -9  DC  J "C1'" 1 
ATOM 9796  N N1    . DC  J 6 65  ? 69.315  30.467  86.162  1.00 122.97 ?  -9  DC  J N1    1 
ATOM 9797  C C2    . DC  J 6 65  ? 70.519  30.948  85.668  1.00 122.97 ?  -9  DC  J C2    1 
ATOM 9798  O O2    . DC  J 6 65  ? 71.541  30.293  85.878  1.00 122.97 ?  -9  DC  J O2    1 
ATOM 9799  N N3    . DC  J 6 65  ? 70.534  32.114  84.988  1.00 122.97 ?  -9  DC  J N3    1 
ATOM 9800  C C4    . DC  J 6 65  ? 69.401  32.782  84.794  1.00 122.97 ?  -9  DC  J C4    1 
ATOM 9801  N N4    . DC  J 6 65  ? 69.465  33.935  84.123  1.00 122.97 ?  -9  DC  J N4    1 
ATOM 9802  C C5    . DC  J 6 65  ? 68.153  32.305  85.293  1.00 122.97 ?  -9  DC  J C5    1 
ATOM 9803  C C6    . DC  J 6 65  ? 68.158  31.151  85.964  1.00 122.97 ?  -9  DC  J C6    1 
ATOM 9804  P P     . DG  J 6 66  ? 69.387  25.795  89.718  1.00 122.63 ?  -8  DG  J P     1 
ATOM 9805  O OP1   . DG  J 6 66  ? 69.635  24.693  88.765  1.00 122.63 ?  -8  DG  J OP1   1 
ATOM 9806  O OP2   . DG  J 6 66  ? 68.208  25.753  90.609  1.00 122.63 -1 -8  DG  J OP2   1 
ATOM 9807  O "O5'" . DG  J 6 66  ? 70.695  25.955  90.620  1.00 122.63 ?  -8  DG  J "O5'" 1 
ATOM 9808  C "C5'" . DG  J 6 66  ? 71.978  26.013  90.004  1.00 122.63 ?  -8  DG  J "C5'" 1 
ATOM 9809  C "C4'" . DG  J 6 66  ? 72.771  27.225  90.472  1.00 122.63 ?  -8  DG  J "C4'" 1 
ATOM 9810  O "O4'" . DG  J 6 66  ? 72.427  28.388  89.675  1.00 122.63 ?  -8  DG  J "O4'" 1 
ATOM 9811  C "C3'" . DG  J 6 66  ? 72.551  27.650  91.933  1.00 122.63 ?  -8  DG  J "C3'" 1 
ATOM 9812  O "O3'" . DG  J 6 66  ? 73.780  28.076  92.482  1.00 122.63 ?  -8  DG  J "O3'" 1 
ATOM 9813  C "C2'" . DG  J 6 66  ? 71.621  28.844  91.777  1.00 122.63 ?  -8  DG  J "C2'" 1 
ATOM 9814  C "C1'" . DG  J 6 66  ? 72.254  29.464  90.556  1.00 122.63 ?  -8  DG  J "C1'" 1 
ATOM 9815  N N9    . DG  J 6 66  ? 71.464  30.498  89.917  1.00 122.63 ?  -8  DG  J N9    1 
ATOM 9816  C C8    . DG  J 6 66  ? 70.112  30.701  90.009  1.00 122.63 ?  -8  DG  J C8    1 
ATOM 9817  N N7    . DG  J 6 66  ? 69.697  31.729  89.323  1.00 122.63 ?  -8  DG  J N7    1 
ATOM 9818  C C5    . DG  J 6 66  ? 70.856  32.243  88.758  1.00 122.63 ?  -8  DG  J C5    1 
ATOM 9819  C C6    . DG  J 6 66  ? 71.046  33.358  87.915  1.00 122.63 ?  -8  DG  J C6    1 
ATOM 9820  O O6    . DG  J 6 66  ? 70.203  34.145  87.481  1.00 122.63 ?  -8  DG  J O6    1 
ATOM 9821  N N1    . DG  J 6 66  ? 72.383  33.519  87.572  1.00 122.63 ?  -8  DG  J N1    1 
ATOM 9822  C C2    . DG  J 6 66  ? 73.404  32.709  87.994  1.00 122.63 ?  -8  DG  J C2    1 
ATOM 9823  N N2    . DG  J 6 66  ? 74.631  33.022  87.562  1.00 122.63 ?  -8  DG  J N2    1 
ATOM 9824  N N3    . DG  J 6 66  ? 73.239  31.666  88.783  1.00 122.63 ?  -8  DG  J N3    1 
ATOM 9825  C C4    . DG  J 6 66  ? 71.945  31.495  89.123  1.00 122.63 ?  -8  DG  J C4    1 
ATOM 9826  P P     . DG  J 6 67  ? 74.706  27.075  93.325  1.00 118.52 ?  -7  DG  J P     1 
ATOM 9827  O OP1   . DG  J 6 67  ? 74.421  25.686  92.904  1.00 118.52 ?  -7  DG  J OP1   1 
ATOM 9828  O OP2   . DG  J 6 67  ? 74.575  27.463  94.746  1.00 118.52 -1 -7  DG  J OP2   1 
ATOM 9829  O "O5'" . DG  J 6 67  ? 76.182  27.473  92.860  1.00 118.52 ?  -7  DG  J "O5'" 1 
ATOM 9830  C "C5'" . DG  J 6 67  ? 76.359  28.411  91.800  1.00 118.52 ?  -7  DG  J "C5'" 1 
ATOM 9831  C "C4'" . DG  J 6 67  ? 77.009  29.685  92.307  1.00 118.52 ?  -7  DG  J "C4'" 1 
ATOM 9832  O "O4'" . DG  J 6 67  ? 76.191  30.828  91.939  1.00 118.52 ?  -7  DG  J "O4'" 1 
ATOM 9833  C "C3'" . DG  J 6 67  ? 77.170  29.765  93.819  1.00 118.52 ?  -7  DG  J "C3'" 1 
ATOM 9834  O "O3'" . DG  J 6 67  ? 78.339  30.491  94.140  1.00 118.52 ?  -7  DG  J "O3'" 1 
ATOM 9835  C "C2'" . DG  J 6 67  ? 75.916  30.518  94.239  1.00 118.52 ?  -7  DG  J "C2'" 1 
ATOM 9836  C "C1'" . DG  J 6 67  ? 75.784  31.517  93.103  1.00 118.52 ?  -7  DG  J "C1'" 1 
ATOM 9837  N N9    . DG  J 6 67  ? 74.421  31.984  92.904  1.00 118.52 ?  -7  DG  J N9    1 
ATOM 9838  C C8    . DG  J 6 67  ? 73.285  31.464  93.465  1.00 118.52 ?  -7  DG  J C8    1 
ATOM 9839  N N7    . DG  J 6 67  ? 72.198  32.083  93.104  1.00 118.52 ?  -7  DG  J N7    1 
ATOM 9840  C C5    . DG  J 6 67  ? 72.642  33.076  92.247  1.00 118.52 ?  -7  DG  J C5    1 
ATOM 9841  C C6    . DG  J 6 67  ? 71.915  34.058  91.544  1.00 118.52 ?  -7  DG  J C6    1 
ATOM 9842  O O6    . DG  J 6 67  ? 70.697  34.257  91.541  1.00 118.52 ?  -7  DG  J O6    1 
ATOM 9843  N N1    . DG  J 6 67  ? 72.747  34.869  90.788  1.00 118.52 ?  -7  DG  J N1    1 
ATOM 9844  C C2    . DG  J 6 67  ? 74.108  34.740  90.709  1.00 118.52 ?  -7  DG  J C2    1 
ATOM 9845  N N2    . DG  J 6 67  ? 74.733  35.635  89.933  1.00 118.52 ?  -7  DG  J N2    1 
ATOM 9846  N N3    . DG  J 6 67  ? 74.808  33.828  91.369  1.00 118.52 ?  -7  DG  J N3    1 
ATOM 9847  C C4    . DG  J 6 67  ? 74.009  33.030  92.113  1.00 118.52 ?  -7  DG  J C4    1 
ATOM 9848  P P     . DG  J 6 68  ? 79.257  30.036  95.376  1.00 119.54 ?  -6  DG  J P     1 
ATOM 9849  O OP1   . DG  J 6 68  ? 80.094  28.906  94.919  1.00 119.54 ?  -6  DG  J OP1   1 
ATOM 9850  O OP2   . DG  J 6 68  ? 78.377  29.876  96.554  1.00 119.54 -1 -6  DG  J OP2   1 
ATOM 9851  O "O5'" . DG  J 6 68  ? 80.200  31.299  95.633  1.00 119.54 ?  -6  DG  J "O5'" 1 
ATOM 9852  C "C5'" . DG  J 6 68  ? 80.998  31.808  94.577  1.00 119.54 ?  -6  DG  J "C5'" 1 
ATOM 9853  C "C4'" . DG  J 6 68  ? 80.574  33.218  94.213  1.00 119.54 ?  -6  DG  J "C4'" 1 
ATOM 9854  O "O4'" . DG  J 6 68  ? 79.127  33.278  94.119  1.00 119.54 ?  -6  DG  J "O4'" 1 
ATOM 9855  C "C3'" . DG  J 6 68  ? 80.979  34.293  95.220  1.00 119.54 ?  -6  DG  J "C3'" 1 
ATOM 9856  O "O3'" . DG  J 6 68  ? 81.414  35.449  94.536  1.00 119.54 ?  -6  DG  J "O3'" 1 
ATOM 9857  C "C2'" . DG  J 6 68  ? 79.689  34.557  95.984  1.00 119.54 ?  -6  DG  J "C2'" 1 
ATOM 9858  C "C1'" . DG  J 6 68  ? 78.653  34.348  94.896  1.00 119.54 ?  -6  DG  J "C1'" 1 
ATOM 9859  N N9    . DG  J 6 68  ? 77.340  33.998  95.416  1.00 119.54 ?  -6  DG  J N9    1 
ATOM 9860  C C8    . DG  J 6 68  ? 77.055  33.059  96.373  1.00 119.54 ?  -6  DG  J C8    1 
ATOM 9861  N N7    . DG  J 6 68  ? 75.784  32.970  96.648  1.00 119.54 ?  -6  DG  J N7    1 
ATOM 9862  C C5    . DG  J 6 68  ? 75.192  33.912  95.820  1.00 119.54 ?  -6  DG  J C5    1 
ATOM 9863  C C6    . DG  J 6 68  ? 73.835  34.269  95.673  1.00 119.54 ?  -6  DG  J C6    1 
ATOM 9864  O O6    . DG  J 6 68  ? 72.849  33.813  96.264  1.00 119.54 ?  -6  DG  J O6    1 
ATOM 9865  N N1    . DG  J 6 68  ? 73.669  35.270  94.726  1.00 119.54 ?  -6  DG  J N1    1 
ATOM 9866  C C2    . DG  J 6 68  ? 74.683  35.850  94.008  1.00 119.54 ?  -6  DG  J C2    1 
ATOM 9867  N N2    . DG  J 6 68  ? 74.320  36.809  93.150  1.00 119.54 ?  -6  DG  J N2    1 
ATOM 9868  N N3    . DG  J 6 68  ? 75.959  35.529  94.139  1.00 119.54 ?  -6  DG  J N3    1 
ATOM 9869  C C4    . DG  J 6 68  ? 76.139  34.554  95.058  1.00 119.54 ?  -6  DG  J C4    1 
ATOM 9870  P P     . DG  J 6 69  ? 82.254  36.575  95.311  1.00 108.11 ?  -5  DG  J P     1 
ATOM 9871  O OP1   . DG  J 6 69  ? 83.576  36.006  95.644  1.00 108.11 ?  -5  DG  J OP1   1 
ATOM 9872  O OP2   . DG  J 6 69  ? 81.401  37.124  96.383  1.00 108.11 -1 -5  DG  J OP2   1 
ATOM 9873  O "O5'" . DG  J 6 69  ? 82.448  37.717  94.215  1.00 108.11 ?  -5  DG  J "O5'" 1 
ATOM 9874  C "C5'" . DG  J 6 69  ? 81.412  37.980  93.283  1.00 108.11 ?  -5  DG  J "C5'" 1 
ATOM 9875  C "C4'" . DG  J 6 69  ? 80.479  39.057  93.800  1.00 108.11 ?  -5  DG  J "C4'" 1 
ATOM 9876  O "O4'" . DG  J 6 69  ? 79.408  38.460  94.548  1.00 108.11 ?  -5  DG  J "O4'" 1 
ATOM 9877  C "C3'" . DG  J 6 69  ? 81.127  40.074  94.734  1.00 108.11 ?  -5  DG  J "C3'" 1 
ATOM 9878  O "O3'" . DG  J 6 69  ? 81.222  41.318  94.070  1.00 108.11 ?  -5  DG  J "O3'" 1 
ATOM 9879  C "C2'" . DG  J 6 69  ? 80.192  40.136  95.962  1.00 108.11 ?  -5  DG  J "C2'" 1 
ATOM 9880  C "C1'" . DG  J 6 69  ? 78.952  39.389  95.491  1.00 108.11 ?  -5  DG  J "C1'" 1 
ATOM 9881  N N9    . DG  J 6 69  ? 78.259  38.645  96.539  1.00 108.11 ?  -5  DG  J N9    1 
ATOM 9882  C C8    . DG  J 6 69  ? 78.805  37.740  97.411  1.00 108.11 ?  -5  DG  J C8    1 
ATOM 9883  N N7    . DG  J 6 69  ? 77.937  37.210  98.222  1.00 108.11 ?  -5  DG  J N7    1 
ATOM 9884  C C5    . DG  J 6 69  ? 76.735  37.789  97.854  1.00 108.11 ?  -5  DG  J C5    1 
ATOM 9885  C C6    . DG  J 6 69  ? 75.439  37.604  98.379  1.00 108.11 ?  -5  DG  J C6    1 
ATOM 9886  O O6    . DG  J 6 69  ? 75.078  36.862  99.299  1.00 108.11 ?  -5  DG  J O6    1 
ATOM 9887  N N1    . DG  J 6 69  ? 74.503  38.383  97.719  1.00 108.11 ?  -5  DG  J N1    1 
ATOM 9888  C C2    . DG  J 6 69  ? 74.780  39.235  96.684  1.00 108.11 ?  -5  DG  J C2    1 
ATOM 9889  N N2    . DG  J 6 69  ? 73.740  39.907  96.172  1.00 108.11 ?  -5  DG  J N2    1 
ATOM 9890  N N3    . DG  J 6 69  ? 75.991  39.421  96.183  1.00 108.11 ?  -5  DG  J N3    1 
ATOM 9891  C C4    . DG  J 6 69  ? 76.915  38.668  96.815  1.00 108.11 ?  -5  DG  J C4    1 
ATOM 9892  P P     . DG  J 6 70  ? 81.861  42.588  94.809  1.00 101.61 ?  -4  DG  J P     1 
ATOM 9893  O OP1   . DG  J 6 70  ? 82.572  43.391  93.791  1.00 101.61 ?  -4  DG  J OP1   1 
ATOM 9894  O OP2   . DG  J 6 70  ? 82.583  42.106  96.004  1.00 101.61 -1 -4  DG  J OP2   1 
ATOM 9895  O "O5'" . DG  J 6 70  ? 80.581  43.398  95.296  1.00 101.61 ?  -4  DG  J "O5'" 1 
ATOM 9896  C "C5'" . DG  J 6 70  ? 79.445  43.444  94.464  1.00 101.61 ?  -4  DG  J "C5'" 1 
ATOM 9897  C "C4'" . DG  J 6 70  ? 78.219  43.826  95.256  1.00 101.61 ?  -4  DG  J "C4'" 1 
ATOM 9898  O "O4'" . DG  J 6 70  ? 77.828  42.736  96.119  1.00 101.61 ?  -4  DG  J "O4'" 1 
ATOM 9899  C "C3'" . DG  J 6 70  ? 78.395  45.045  96.159  1.00 101.61 ?  -4  DG  J "C3'" 1 
ATOM 9900  O "O3'" . DG  J 6 70  ? 77.456  46.023  95.791  1.00 101.61 ?  -4  DG  J "O3'" 1 
ATOM 9901  C "C2'" . DG  J 6 70  ? 78.132  44.504  97.571  1.00 101.61 ?  -4  DG  J "C2'" 1 
ATOM 9902  C "C1'" . DG  J 6 70  ? 77.285  43.277  97.289  1.00 101.61 ?  -4  DG  J "C1'" 1 
ATOM 9903  N N9    . DG  J 6 70  ? 77.347  42.261  98.333  1.00 101.61 ?  -4  DG  J N9    1 
ATOM 9904  C C8    . DG  J 6 70  ? 78.467  41.615  98.784  1.00 101.61 ?  -4  DG  J C8    1 
ATOM 9905  N N7    . DG  J 6 70  ? 78.224  40.745  99.721  1.00 101.61 ?  -4  DG  J N7    1 
ATOM 9906  C C5    . DG  J 6 70  ? 76.852  40.812  99.899  1.00 101.61 ?  -4  DG  J C5    1 
ATOM 9907  C C6    . DG  J 6 70  ? 76.015  40.097  100.786 1.00 101.61 ?  -4  DG  J C6    1 
ATOM 9908  O O6    . DG  J 6 70  ? 76.332  39.234  101.610 1.00 101.61 ?  -4  DG  J O6    1 
ATOM 9909  N N1    . DG  J 6 70  ? 74.682  40.463  100.650 1.00 101.61 ?  -4  DG  J N1    1 
ATOM 9910  C C2    . DG  J 6 70  ? 74.215  41.404  99.770  1.00 101.61 ?  -4  DG  J C2    1 
ATOM 9911  N N2    . DG  J 6 70  ? 72.892  41.621  99.786  1.00 101.61 ?  -4  DG  J N2    1 
ATOM 9912  N N3    . DG  J 6 70  ? 74.989  42.087  98.932  1.00 101.61 ?  -4  DG  J N3    1 
ATOM 9913  C C4    . DG  J 6 70  ? 76.293  41.738  99.052  1.00 101.61 ?  -4  DG  J C4    1 
ATOM 9914  P P     . DA  J 6 71  ? 77.577  47.520  96.345  1.00 103.18 ?  -3  DA  J P     1 
ATOM 9915  O OP1   . DA  J 6 71  ? 77.698  48.427  95.187  1.00 103.18 ?  -3  DA  J OP1   1 
ATOM 9916  O OP2   . DA  J 6 71  ? 78.601  47.526  97.408  1.00 103.18 -1 -3  DA  J OP2   1 
ATOM 9917  O "O5'" . DA  J 6 71  ? 76.156  47.769  97.014  1.00 103.18 ?  -3  DA  J "O5'" 1 
ATOM 9918  C "C5'" . DA  J 6 71  ? 74.985  47.371  96.325  1.00 103.18 ?  -3  DA  J "C5'" 1 
ATOM 9919  C "C4'" . DA  J 6 71  ? 73.784  47.347  97.251  1.00 103.18 ?  -3  DA  J "C4'" 1 
ATOM 9920  O "O4'" . DA  J 6 71  ? 73.865  46.196  98.125  1.00 103.18 ?  -3  DA  J "O4'" 1 
ATOM 9921  C "C3'" . DA  J 6 71  ? 73.637  48.567  98.150  1.00 103.18 ?  -3  DA  J "C3'" 1 
ATOM 9922  O "O3'" . DA  J 6 71  ? 72.286  48.974  98.194  1.00 103.18 ?  -3  DA  J "O3'" 1 
ATOM 9923  C "C2'" . DA  J 6 71  ? 74.120  48.077  99.509  1.00 103.18 ?  -3  DA  J "C2'" 1 
ATOM 9924  C "C1'" . DA  J 6 71  ? 73.778  46.594  99.472  1.00 103.18 ?  -3  DA  J "C1'" 1 
ATOM 9925  N N9    . DA  J 6 71  ? 74.714  45.780  100.229 1.00 103.18 ?  -3  DA  J N9    1 
ATOM 9926  C C8    . DA  J 6 71  ? 76.068  45.771  100.097 1.00 103.18 ?  -3  DA  J C8    1 
ATOM 9927  N N7    . DA  J 6 71  ? 76.674  44.938  100.901 1.00 103.18 ?  -3  DA  J N7    1 
ATOM 9928  C C5    . DA  J 6 71  ? 75.645  44.359  101.610 1.00 103.18 ?  -3  DA  J C5    1 
ATOM 9929  C C6    . DA  J 6 71  ? 75.632  43.393  102.621 1.00 103.18 ?  -3  DA  J C6    1 
ATOM 9930  N N6    . DA  J 6 71  ? 76.738  42.829  103.098 1.00 103.18 ?  -3  DA  J N6    1 
ATOM 9931  N N1    . DA  J 6 71  ? 74.439  43.028  103.127 1.00 103.18 ?  -3  DA  J N1    1 
ATOM 9932  C C2    . DA  J 6 71  ? 73.330  43.596  102.641 1.00 103.18 ?  -3  DA  J C2    1 
ATOM 9933  N N3    . DA  J 6 71  ? 73.219  44.524  101.689 1.00 103.18 ?  -3  DA  J N3    1 
ATOM 9934  C C4    . DA  J 6 71  ? 74.426  44.861  101.210 1.00 103.18 ?  -3  DA  J C4    1 
ATOM 9935  P P     . DC  J 6 72  ? 71.872  50.282  99.026  1.00 113.01 ?  -2  DC  J P     1 
ATOM 9936  O OP1   . DC  J 6 72  ? 70.739  50.921  98.327  1.00 113.01 ?  -2  DC  J OP1   1 
ATOM 9937  O OP2   . DC  J 6 72  ? 73.105  51.052  99.292  1.00 113.01 -1 -2  DC  J OP2   1 
ATOM 9938  O "O5'" . DC  J 6 72  ? 71.346  49.693  100.411 1.00 113.01 ?  -2  DC  J "O5'" 1 
ATOM 9939  C "C5'" . DC  J 6 72  ? 70.484  48.562  100.411 1.00 113.01 ?  -2  DC  J "C5'" 1 
ATOM 9940  C "C4'" . DC  J 6 72  ? 70.210  48.082  101.826 1.00 113.01 ?  -2  DC  J "C4'" 1 
ATOM 9941  O "O4'" . DC  J 6 72  ? 71.289  47.222  102.280 1.00 113.01 ?  -2  DC  J "O4'" 1 
ATOM 9942  C "C3'" . DC  J 6 72  ? 70.081  49.187  102.873 1.00 113.01 ?  -2  DC  J "C3'" 1 
ATOM 9943  O "O3'" . DC  J 6 72  ? 68.993  48.898  103.729 1.00 113.01 ?  -2  DC  J "O3'" 1 
ATOM 9944  C "C2'" . DC  J 6 72  ? 71.410  49.108  103.618 1.00 113.01 ?  -2  DC  J "C2'" 1 
ATOM 9945  C "C1'" . DC  J 6 72  ? 71.670  47.615  103.575 1.00 113.01 ?  -2  DC  J "C1'" 1 
ATOM 9946  N N1    . DC  J 6 72  ? 73.094  47.237  103.787 1.00 113.01 ?  -2  DC  J N1    1 
ATOM 9947  C C2    . DC  J 6 72  ? 73.417  46.290  104.757 1.00 113.01 ?  -2  DC  J C2    1 
ATOM 9948  O O2    . DC  J 6 72  ? 72.513  45.788  105.426 1.00 113.01 ?  -2  DC  J O2    1 
ATOM 9949  N N3    . DC  J 6 72  ? 74.713  45.948  104.936 1.00 113.01 ?  -2  DC  J N3    1 
ATOM 9950  C C4    . DC  J 6 72  ? 75.659  46.517  104.192 1.00 113.01 ?  -2  DC  J C4    1 
ATOM 9951  N N4    . DC  J 6 72  ? 76.925  46.149  104.405 1.00 113.01 ?  -2  DC  J N4    1 
ATOM 9952  C C5    . DC  J 6 72  ? 75.350  47.486  103.198 1.00 113.01 ?  -2  DC  J C5    1 
ATOM 9953  C C6    . DC  J 6 72  ? 74.067  47.813  103.034 1.00 113.01 ?  -2  DC  J C6    1 
ATOM 9954  P P     . DA  J 6 73  ? 68.313  50.062  104.599 1.00 122.39 ?  -1  DA  J P     1 
ATOM 9955  O OP1   . DA  J 6 73  ? 66.874  50.084  104.258 1.00 122.39 ?  -1  DA  J OP1   1 
ATOM 9956  O OP2   . DA  J 6 73  ? 69.135  51.282  104.440 1.00 122.39 -1 -1  DA  J OP2   1 
ATOM 9957  O "O5'" . DA  J 6 73  ? 68.469  49.549  106.103 1.00 122.39 ?  -1  DA  J "O5'" 1 
ATOM 9958  C "C5'" . DA  J 6 73  ? 67.980  48.265  106.462 1.00 122.39 ?  -1  DA  J "C5'" 1 
ATOM 9959  C "C4'" . DA  J 6 73  ? 68.522  47.832  107.812 1.00 122.39 ?  -1  DA  J "C4'" 1 
ATOM 9960  O "O4'" . DA  J 6 73  ? 69.887  47.364  107.666 1.00 122.39 ?  -1  DA  J "O4'" 1 
ATOM 9961  C "C3'" . DA  J 6 73  ? 68.551  48.923  108.878 1.00 122.39 ?  -1  DA  J "C3'" 1 
ATOM 9962  O "O3'" . DA  J 6 73  ? 68.074  48.408  110.108 1.00 122.39 ?  -1  DA  J "O3'" 1 
ATOM 9963  C "C2'" . DA  J 6 73  ? 70.027  49.301  108.964 1.00 122.39 ?  -1  DA  J "C2'" 1 
ATOM 9964  C "C1'" . DA  J 6 73  ? 70.713  47.989  108.619 1.00 122.39 ?  -1  DA  J "C1'" 1 
ATOM 9965  N N9    . DA  J 6 73  ? 72.021  48.175  108.015 1.00 122.39 ?  -1  DA  J N9    1 
ATOM 9966  C C8    . DA  J 6 73  ? 72.310  48.957  106.942 1.00 122.39 ?  -1  DA  J C8    1 
ATOM 9967  N N7    . DA  J 6 73  ? 73.570  48.941  106.593 1.00 122.39 ?  -1  DA  J N7    1 
ATOM 9968  C C5    . DA  J 6 73  ? 74.152  48.089  107.507 1.00 122.39 ?  -1  DA  J C5    1 
ATOM 9969  C C6    . DA  J 6 73  ? 75.474  47.651  107.676 1.00 122.39 ?  -1  DA  J C6    1 
ATOM 9970  N N6    . DA  J 6 73  ? 76.480  48.046  106.892 1.00 122.39 ?  -1  DA  J N6    1 
ATOM 9971  N N1    . DA  J 6 73  ? 75.727  46.797  108.688 1.00 122.39 ?  -1  DA  J N1    1 
ATOM 9972  C C2    . DA  J 6 73  ? 74.713  46.403  109.471 1.00 122.39 ?  -1  DA  J C2    1 
ATOM 9973  N N3    . DA  J 6 73  ? 73.427  46.752  109.409 1.00 122.39 ?  -1  DA  J N3    1 
ATOM 9974  C C4    . DA  J 6 73  ? 73.211  47.598  108.390 1.00 122.39 ?  -1  DA  J C4    1 
ATOM 9975  P P     . DG  J 6 74  ? 67.742  49.404  111.321 1.00 128.67 ?  0   DG  J P     1 
ATOM 9976  O OP1   . DG  J 6 74  ? 66.415  49.025  111.852 1.00 128.67 ?  0   DG  J OP1   1 
ATOM 9977  O OP2   . DG  J 6 74  ? 67.976  50.783  110.843 1.00 128.67 -1 0   DG  J OP2   1 
ATOM 9978  O "O5'" . DG  J 6 74  ? 68.856  49.058  112.414 1.00 128.67 ?  0   DG  J "O5'" 1 
ATOM 9979  C "C5'" . DG  J 6 74  ? 68.871  47.773  113.016 1.00 128.67 ?  0   DG  J "C5'" 1 
ATOM 9980  C "C4'" . DG  J 6 74  ? 70.185  47.515  113.731 1.00 128.67 ?  0   DG  J "C4'" 1 
ATOM 9981  O "O4'" . DG  J 6 74  ? 71.283  47.564  112.784 1.00 128.67 ?  0   DG  J "O4'" 1 
ATOM 9982  C "C3'" . DG  J 6 74  ? 70.538  48.509  114.842 1.00 128.67 ?  0   DG  J "C3'" 1 
ATOM 9983  O "O3'" . DG  J 6 74  ? 71.031  47.792  115.966 1.00 128.67 ?  0   DG  J "O3'" 1 
ATOM 9984  C "C2'" . DG  J 6 74  ? 71.631  49.364  114.201 1.00 128.67 ?  0   DG  J "C2'" 1 
ATOM 9985  C "C1'" . DG  J 6 74  ? 72.324  48.332  113.335 1.00 128.67 ?  0   DG  J "C1'" 1 
ATOM 9986  N N9    . DG  J 6 74  ? 73.111  48.899  112.248 1.00 128.67 ?  0   DG  J N9    1 
ATOM 9987  C C8    . DG  J 6 74  ? 72.657  49.665  111.208 1.00 128.67 ?  0   DG  J C8    1 
ATOM 9988  N N7    . DG  J 6 74  ? 73.594  50.023  110.378 1.00 128.67 ?  0   DG  J N7    1 
ATOM 9989  C C5    . DG  J 6 74  ? 74.743  49.455  110.903 1.00 128.67 ?  0   DG  J C5    1 
ATOM 9990  C C6    . DG  J 6 74  ? 76.074  49.494  110.434 1.00 128.67 ?  0   DG  J C6    1 
ATOM 9991  O O6    . DG  J 6 74  ? 76.517  50.059  109.430 1.00 128.67 ?  0   DG  J O6    1 
ATOM 9992  N N1    . DG  J 6 74  ? 76.933  48.783  111.264 1.00 128.67 ?  0   DG  J N1    1 
ATOM 9993  C C2    . DG  J 6 74  ? 76.552  48.118  112.404 1.00 128.67 ?  0   DG  J C2    1 
ATOM 9994  N N2    . DG  J 6 74  ? 77.525  47.484  113.076 1.00 128.67 ?  0   DG  J N2    1 
ATOM 9995  N N3    . DG  J 6 74  ? 75.307  48.070  112.851 1.00 128.67 ?  0   DG  J N3    1 
ATOM 9996  C C4    . DG  J 6 74  ? 74.459  48.752  112.049 1.00 128.67 ?  0   DG  J C4    1 
ATOM 9997  P P     . DC  J 6 75  ? 71.229  48.509  117.390 1.00 128.45 ?  1   DC  J P     1 
ATOM 9998  O OP1   . DC  J 6 75  ? 70.109  48.089  118.256 1.00 128.45 ?  1   DC  J OP1   1 
ATOM 9999  O OP2   . DC  J 6 75  ? 71.489  49.949  117.185 1.00 128.45 -1 1   DC  J OP2   1 
ATOM 10000 O "O5'" . DC  J 6 75  ? 72.573  47.851  117.941 1.00 128.45 ?  1   DC  J "O5'" 1 
ATOM 10001 C "C5'" . DC  J 6 75  ? 73.590  47.475  117.027 1.00 128.45 ?  1   DC  J "C5'" 1 
ATOM 10002 C "C4'" . DC  J 6 75  ? 74.923  48.054  117.447 1.00 128.45 ?  1   DC  J "C4'" 1 
ATOM 10003 O "O4'" . DC  J 6 75  ? 75.629  48.550  116.276 1.00 128.45 ?  1   DC  J "O4'" 1 
ATOM 10004 C "C3'" . DC  J 6 75  ? 74.831  49.244  118.400 1.00 128.45 ?  1   DC  J "C3'" 1 
ATOM 10005 O "O3'" . DC  J 6 75  ? 75.944  49.232  119.268 1.00 128.45 ?  1   DC  J "O3'" 1 
ATOM 10006 C "C2'" . DC  J 6 75  ? 74.908  50.420  117.441 1.00 128.45 ?  1   DC  J "C2'" 1 
ATOM 10007 C "C1'" . DC  J 6 75  ? 75.966  49.900  116.492 1.00 128.45 ?  1   DC  J "C1'" 1 
ATOM 10008 N N1    . DC  J 6 75  ? 76.017  50.601  115.192 1.00 128.45 ?  1   DC  J N1    1 
ATOM 10009 C C2    . DC  J 6 75  ? 77.241  50.727  114.541 1.00 128.45 ?  1   DC  J C2    1 
ATOM 10010 O O2    . DC  J 6 75  ? 78.250  50.251  115.068 1.00 128.45 ?  1   DC  J O2    1 
ATOM 10011 N N3    . DC  J 6 75  ? 77.291  51.368  113.353 1.00 128.45 ?  1   DC  J N3    1 
ATOM 10012 C C4    . DC  J 6 75  ? 76.177  51.870  112.823 1.00 128.45 ?  1   DC  J C4    1 
ATOM 10013 N N4    . DC  J 6 75  ? 76.275  52.494  111.647 1.00 128.45 ?  1   DC  J N4    1 
ATOM 10014 C C5    . DC  J 6 75  ? 74.915  51.757  113.476 1.00 128.45 ?  1   DC  J C5    1 
ATOM 10015 C C6    . DC  J 6 75  ? 74.882  51.116  114.647 1.00 128.45 ?  1   DC  J C6    1 
ATOM 10016 P P     . DG  J 6 76  ? 75.758  49.505  120.838 1.00 123.90 ?  2   DG  J P     1 
ATOM 10017 O OP1   . DG  J 6 76  ? 75.066  48.335  121.422 1.00 123.90 ?  2   DG  J OP1   1 
ATOM 10018 O OP2   . DG  J 6 76  ? 75.188  50.860  120.999 1.00 123.90 -1 2   DG  J OP2   1 
ATOM 10019 O "O5'" . DG  J 6 76  ? 77.258  49.542  121.381 1.00 123.90 ?  2   DG  J "O5'" 1 
ATOM 10020 C "C5'" . DG  J 6 76  ? 78.246  48.720  120.773 1.00 123.90 ?  2   DG  J "C5'" 1 
ATOM 10021 C "C4'" . DG  J 6 76  ? 79.574  49.451  120.646 1.00 123.90 ?  2   DG  J "C4'" 1 
ATOM 10022 O "O4'" . DG  J 6 76  ? 79.684  50.066  119.338 1.00 123.90 ?  2   DG  J "O4'" 1 
ATOM 10023 C "C3'" . DG  J 6 76  ? 79.823  50.556  121.663 1.00 123.90 ?  2   DG  J "C3'" 1 
ATOM 10024 O "O3'" . DG  J 6 76  ? 81.178  50.499  122.073 1.00 123.90 ?  2   DG  J "O3'" 1 
ATOM 10025 C "C2'" . DG  J 6 76  ? 79.514  51.836  120.878 1.00 123.90 ?  2   DG  J "C2'" 1 
ATOM 10026 C "C1'" . DG  J 6 76  ? 79.907  51.457  119.459 1.00 123.90 ?  2   DG  J "C1'" 1 
ATOM 10027 N N9    . DG  J 6 76  ? 79.100  52.112  118.438 1.00 123.90 ?  2   DG  J N9    1 
ATOM 10028 C C8    . DG  J 6 76  ? 77.744  52.303  118.464 1.00 123.90 ?  2   DG  J C8    1 
ATOM 10029 N N7    . DG  J 6 76  ? 77.284  52.895  117.400 1.00 123.90 ?  2   DG  J N7    1 
ATOM 10030 C C5    . DG  J 6 76  ? 78.403  53.097  116.612 1.00 123.90 ?  2   DG  J C5    1 
ATOM 10031 C C6    . DG  J 6 76  ? 78.520  53.699  115.344 1.00 123.90 ?  2   DG  J C6    1 
ATOM 10032 O O6    . DG  J 6 76  ? 77.622  54.179  114.641 1.00 123.90 ?  2   DG  J O6    1 
ATOM 10033 N N1    . DG  J 6 76  ? 79.833  53.707  114.897 1.00 123.90 ?  2   DG  J N1    1 
ATOM 10034 C C2    . DG  J 6 76  ? 80.901  53.199  115.595 1.00 123.90 ?  2   DG  J C2    1 
ATOM 10035 N N2    . DG  J 6 76  ? 82.099  53.295  115.007 1.00 123.90 ?  2   DG  J N2    1 
ATOM 10036 N N3    . DG  J 6 76  ? 80.805  52.635  116.790 1.00 123.90 ?  2   DG  J N3    1 
ATOM 10037 C C4    . DG  J 6 76  ? 79.531  52.617  117.234 1.00 123.90 ?  2   DG  J C4    1 
ATOM 10038 P P     . DC  J 6 77  ? 81.736  51.428  123.259 1.00 120.68 ?  3   DC  J P     1 
ATOM 10039 O OP1   . DC  J 6 77  ? 82.095  50.531  124.380 1.00 120.68 ?  3   DC  J OP1   1 
ATOM 10040 O OP2   . DC  J 6 77  ? 80.809  52.555  123.498 1.00 120.68 -1 3   DC  J OP2   1 
ATOM 10041 O "O5'" . DC  J 6 77  ? 83.075  52.022  122.629 1.00 120.68 ?  3   DC  J "O5'" 1 
ATOM 10042 C "C5'" . DC  J 6 77  ? 83.260  51.960  121.220 1.00 120.68 ?  3   DC  J "C5'" 1 
ATOM 10043 C "C4'" . DC  J 6 77  ? 84.513  52.692  120.799 1.00 120.68 ?  3   DC  J "C4'" 1 
ATOM 10044 O "O4'" . DC  J 6 77  ? 84.240  53.448  119.602 1.00 120.68 ?  3   DC  J "O4'" 1 
ATOM 10045 C "C3'" . DC  J 6 77  ? 85.014  53.722  121.781 1.00 120.68 ?  3   DC  J "C3'" 1 
ATOM 10046 O "O3'" . DC  J 6 77  ? 86.377  53.993  121.500 1.00 120.68 ?  3   DC  J "O3'" 1 
ATOM 10047 C "C2'" . DC  J 6 77  ? 84.118  54.919  121.461 1.00 120.68 ?  3   DC  J "C2'" 1 
ATOM 10048 C "C1'" . DC  J 6 77  ? 83.948  54.793  119.945 1.00 120.68 ?  3   DC  J "C1'" 1 
ATOM 10049 N N1    . DC  J 6 77  ? 82.579  55.102  119.449 1.00 120.68 ?  3   DC  J N1    1 
ATOM 10050 C C2    . DC  J 6 77  ? 82.419  55.527  118.134 1.00 120.68 ?  3   DC  J C2    1 
ATOM 10051 O O2    . DC  J 6 77  ? 83.421  55.652  117.429 1.00 120.68 ?  3   DC  J O2    1 
ATOM 10052 N N3    . DC  J 6 77  ? 81.175  55.789  117.674 1.00 120.68 ?  3   DC  J N3    1 
ATOM 10053 C C4    . DC  J 6 77  ? 80.126  55.636  118.477 1.00 120.68 ?  3   DC  J C4    1 
ATOM 10054 N N4    . DC  J 6 77  ? 78.917  55.910  117.985 1.00 120.68 ?  3   DC  J N4    1 
ATOM 10055 C C5    . DC  J 6 77  ? 80.268  55.199  119.823 1.00 120.68 ?  3   DC  J C5    1 
ATOM 10056 C C6    . DC  J 6 77  ? 81.501  54.942  120.263 1.00 120.68 ?  3   DC  J C6    1 
ATOM 10057 P P     . DG  J 6 78  ? 87.213  55.034  122.389 1.00 115.87 ?  4   DG  J P     1 
ATOM 10058 O OP1   . DG  J 6 78  ? 88.548  54.444  122.620 1.00 115.87 ?  4   DG  J OP1   1 
ATOM 10059 O OP2   . DG  J 6 78  ? 86.376  55.438  123.539 1.00 115.87 -1 4   DG  J OP2   1 
ATOM 10060 O "O5'" . DG  J 6 78  ? 87.373  56.295  121.423 1.00 115.87 ?  4   DG  J "O5'" 1 
ATOM 10061 C "C5'" . DG  J 6 78  ? 87.445  56.103  120.012 1.00 115.87 ?  4   DG  J "C5'" 1 
ATOM 10062 C "C4'" . DG  J 6 78  ? 87.120  57.389  119.272 1.00 115.87 ?  4   DG  J "C4'" 1 
ATOM 10063 O "O4'" . DG  J 6 78  ? 85.696  57.457  118.986 1.00 115.87 ?  4   DG  J "O4'" 1 
ATOM 10064 C "C3'" . DG  J 6 78  ? 87.457  58.673  120.034 1.00 115.87 ?  4   DG  J "C3'" 1 
ATOM 10065 O "O3'" . DG  J 6 78  ? 88.030  59.608  119.151 1.00 115.87 ?  4   DG  J "O3'" 1 
ATOM 10066 C "C2'" . DG  J 6 78  ? 86.089  59.149  120.510 1.00 115.87 ?  4   DG  J "C2'" 1 
ATOM 10067 C "C1'" . DG  J 6 78  ? 85.233  58.737  119.334 1.00 115.87 ?  4   DG  J "C1'" 1 
ATOM 10068 N N9    . DG  J 6 78  ? 83.816  58.663  119.648 1.00 115.87 ?  4   DG  J N9    1 
ATOM 10069 C C8    . DG  J 6 78  ? 83.255  58.344  120.856 1.00 115.87 ?  4   DG  J C8    1 
ATOM 10070 N N7    . DG  J 6 78  ? 81.953  58.370  120.847 1.00 115.87 ?  4   DG  J N7    1 
ATOM 10071 C C5    . DG  J 6 78  ? 81.632  58.733  119.548 1.00 115.87 ?  4   DG  J C5    1 
ATOM 10072 C C6    . DG  J 6 78  ? 80.371  58.923  118.941 1.00 115.87 ?  4   DG  J C6    1 
ATOM 10073 O O6    . DG  J 6 78  ? 79.249  58.803  119.445 1.00 115.87 ?  4   DG  J O6    1 
ATOM 10074 N N1    . DG  J 6 78  ? 80.492  59.286  117.607 1.00 115.87 ?  4   DG  J N1    1 
ATOM 10075 C C2    . DG  J 6 78  ? 81.678  59.446  116.941 1.00 115.87 ?  4   DG  J C2    1 
ATOM 10076 N N2    . DG  J 6 78  ? 81.582  59.824  115.662 1.00 115.87 ?  4   DG  J N2    1 
ATOM 10077 N N3    . DG  J 6 78  ? 82.870  59.280  117.497 1.00 115.87 ?  4   DG  J N3    1 
ATOM 10078 C C4    . DG  J 6 78  ? 82.769  58.922  118.799 1.00 115.87 ?  4   DG  J C4    1 
ATOM 10079 P P     . DT  J 6 79  ? 89.613  59.865  119.148 1.00 112.19 ?  5   DT  J P     1 
ATOM 10080 O OP1   . DT  J 6 79  ? 90.288  58.567  118.943 1.00 112.19 ?  5   DT  J OP1   1 
ATOM 10081 O OP2   . DT  J 6 79  ? 89.945  60.687  120.330 1.00 112.19 -1 5   DT  J OP2   1 
ATOM 10082 O "O5'" . DT  J 6 79  ? 89.820  60.758  117.846 1.00 112.19 ?  5   DT  J "O5'" 1 
ATOM 10083 C "C5'" . DT  J 6 79  ? 89.050  60.481  116.687 1.00 112.19 ?  5   DT  J "C5'" 1 
ATOM 10084 C "C4'" . DT  J 6 79  ? 88.159  61.656  116.329 1.00 112.19 ?  5   DT  J "C4'" 1 
ATOM 10085 O "O4'" . DT  J 6 79  ? 86.873  61.543  117.002 1.00 112.19 ?  5   DT  J "O4'" 1 
ATOM 10086 C "C3'" . DT  J 6 79  ? 88.712  63.030  116.715 1.00 112.19 ?  5   DT  J "C3'" 1 
ATOM 10087 O "O3'" . DT  J 6 79  ? 88.511  63.932  115.650 1.00 112.19 ?  5   DT  J "O3'" 1 
ATOM 10088 C "C2'" . DT  J 6 79  ? 87.847  63.411  117.908 1.00 112.19 ?  5   DT  J "C2'" 1 
ATOM 10089 C "C1'" . DT  J 6 79  ? 86.528  62.819  117.470 1.00 112.19 ?  5   DT  J "C1'" 1 
ATOM 10090 N N1    . DT  J 6 79  ? 85.526  62.702  118.555 1.00 112.19 ?  5   DT  J N1    1 
ATOM 10091 C C2    . DT  J 6 79  ? 84.189  62.675  118.236 1.00 112.19 ?  5   DT  J C2    1 
ATOM 10092 O O2    . DT  J 6 79  ? 83.777  62.722  117.095 1.00 112.19 ?  5   DT  J O2    1 
ATOM 10093 N N3    . DT  J 6 79  ? 83.347  62.579  119.308 1.00 112.19 ?  5   DT  J N3    1 
ATOM 10094 C C4    . DT  J 6 79  ? 83.704  62.517  120.641 1.00 112.19 ?  5   DT  J C4    1 
ATOM 10095 O O4    . DT  J 6 79  ? 82.874  62.433  121.539 1.00 112.19 ?  5   DT  J O4    1 
ATOM 10096 C C5    . DT  J 6 79  ? 85.121  62.561  120.904 1.00 112.19 ?  5   DT  J C5    1 
ATOM 10097 C C7    . DT  J 6 79  ? 85.629  62.499  122.312 1.00 112.19 ?  5   DT  J C7    1 
ATOM 10098 C C6    . DT  J 6 79  ? 85.951  62.657  119.861 1.00 112.19 ?  5   DT  J C6    1 
ATOM 10099 P P     . DA  J 6 80  ? 89.742  64.397  114.734 1.00 106.17 ?  6   DA  J P     1 
ATOM 10100 O OP1   . DA  J 6 80  ? 90.278  63.195  114.059 1.00 106.17 ?  6   DA  J OP1   1 
ATOM 10101 O OP2   . DA  J 6 80  ? 90.635  65.242  115.556 1.00 106.17 -1 6   DA  J OP2   1 
ATOM 10102 O "O5'" . DA  J 6 80  ? 89.050  65.333  113.644 1.00 106.17 ?  6   DA  J "O5'" 1 
ATOM 10103 C "C5'" . DA  J 6 80  ? 87.947  64.840  112.901 1.00 106.17 ?  6   DA  J "C5'" 1 
ATOM 10104 C "C4'" . DA  J 6 80  ? 86.718  65.720  113.075 1.00 106.17 ?  6   DA  J "C4'" 1 
ATOM 10105 O "O4'" . DA  J 6 80  ? 86.195  65.594  114.420 1.00 106.17 ?  6   DA  J "O4'" 1 
ATOM 10106 C "C3'" . DA  J 6 80  ? 86.932  67.215  112.849 1.00 106.17 ?  6   DA  J "C3'" 1 
ATOM 10107 O "O3'" . DA  J 6 80  ? 85.833  67.720  112.133 1.00 106.17 ?  6   DA  J "O3'" 1 
ATOM 10108 C "C2'" . DA  J 6 80  ? 86.965  67.774  114.269 1.00 106.17 ?  6   DA  J "C2'" 1 
ATOM 10109 C "C1'" . DA  J 6 80  ? 85.942  66.881  114.935 1.00 106.17 ?  6   DA  J "C1'" 1 
ATOM 10110 N N9    . DA  J 6 80  ? 86.066  66.808  116.374 1.00 106.17 ?  6   DA  J N9    1 
ATOM 10111 C C8    . DA  J 6 80  ? 87.218  66.731  117.092 1.00 106.17 ?  6   DA  J C8    1 
ATOM 10112 N N7    . DA  J 6 80  ? 87.027  66.647  118.384 1.00 106.17 ?  6   DA  J N7    1 
ATOM 10113 C C5    . DA  J 6 80  ? 85.653  66.661  118.515 1.00 106.17 ?  6   DA  J C5    1 
ATOM 10114 C C6    . DA  J 6 80  ? 84.810  66.607  119.636 1.00 106.17 ?  6   DA  J C6    1 
ATOM 10115 N N6    . DA  J 6 80  ? 85.264  66.515  120.886 1.00 106.17 ?  6   DA  J N6    1 
ATOM 10116 N N1    . DA  J 6 80  ? 83.478  66.651  119.423 1.00 106.17 ?  6   DA  J N1    1 
ATOM 10117 C C2    . DA  J 6 80  ? 83.028  66.741  118.166 1.00 106.17 ?  6   DA  J C2    1 
ATOM 10118 N N3    . DA  J 6 80  ? 83.728  66.804  117.035 1.00 106.17 ?  6   DA  J N3    1 
ATOM 10119 C C4    . DA  J 6 80  ? 85.045  66.756  117.285 1.00 106.17 ?  6   DA  J C4    1 
ATOM 10120 P P     . DC  J 6 81  ? 85.867  69.198  111.517 1.00 97.95  ?  7   DC  J P     1 
ATOM 10121 O OP1   . DC  J 6 81  ? 85.685  69.025  110.063 1.00 97.95  ?  7   DC  J OP1   1 
ATOM 10122 O OP2   . DC  J 6 81  ? 87.043  69.920  112.053 1.00 97.95  -1 7   DC  J OP2   1 
ATOM 10123 O "O5'" . DC  J 6 81  ? 84.545  69.874  112.098 1.00 97.95  ?  7   DC  J "O5'" 1 
ATOM 10124 C "C5'" . DC  J 6 81  ? 83.285  69.284  111.830 1.00 97.95  ?  7   DC  J "C5'" 1 
ATOM 10125 C "C4'" . DC  J 6 81  ? 82.211  69.847  112.738 1.00 97.95  ?  7   DC  J "C4'" 1 
ATOM 10126 O "O4'" . DC  J 6 81  ? 82.464  69.443  114.106 1.00 97.95  ?  7   DC  J "O4'" 1 
ATOM 10127 C "C3'" . DC  J 6 81  ? 82.103  71.369  112.756 1.00 97.95  ?  7   DC  J "C3'" 1 
ATOM 10128 O "O3'" . DC  J 6 81  ? 80.743  71.741  112.726 1.00 97.95  ?  7   DC  J "O3'" 1 
ATOM 10129 C "C2'" . DC  J 6 81  ? 82.754  71.749  114.081 1.00 97.95  ?  7   DC  J "C2'" 1 
ATOM 10130 C "C1'" . DC  J 6 81  ? 82.379  70.564  114.949 1.00 97.95  ?  7   DC  J "C1'" 1 
ATOM 10131 N N1    . DC  J 6 81  ? 83.297  70.353  116.094 1.00 97.95  ?  7   DC  J N1    1 
ATOM 10132 C C2    . DC  J 6 81  ? 82.773  70.188  117.375 1.00 97.95  ?  7   DC  J C2    1 
ATOM 10133 O O2    . DC  J 6 81  ? 81.551  70.235  117.531 1.00 97.95  ?  7   DC  J O2    1 
ATOM 10134 N N3    . DC  J 6 81  ? 83.621  69.991  118.411 1.00 97.95  ?  7   DC  J N3    1 
ATOM 10135 C C4    . DC  J 6 81  ? 84.935  69.958  118.195 1.00 97.95  ?  7   DC  J C4    1 
ATOM 10136 N N4    . DC  J 6 81  ? 85.737  69.765  119.243 1.00 97.95  ?  7   DC  J N4    1 
ATOM 10137 C C5    . DC  J 6 81  ? 85.486  70.121  116.893 1.00 97.95  ?  7   DC  J C5    1 
ATOM 10138 C C6    . DC  J 6 81  ? 84.638  70.313  115.883 1.00 97.95  ?  7   DC  J C6    1 
ATOM 10139 P P     . DG  J 6 82  ? 80.323  73.259  112.425 1.00 99.61  ?  8   DG  J P     1 
ATOM 10140 O OP1   . DG  J 6 82  ? 79.480  73.247  111.216 1.00 99.61  ?  8   DG  J OP1   1 
ATOM 10141 O OP2   . DG  J 6 82  ? 81.541  74.093  112.457 1.00 99.61  -1 8   DG  J OP2   1 
ATOM 10142 O "O5'" . DG  J 6 82  ? 79.395  73.645  113.665 1.00 99.61  ?  8   DG  J "O5'" 1 
ATOM 10143 C "C5'" . DG  J 6 82  ? 78.144  72.983  113.843 1.00 99.61  ?  8   DG  J "C5'" 1 
ATOM 10144 C "C4'" . DG  J 6 82  ? 77.476  73.370  115.157 1.00 99.61  ?  8   DG  J "C4'" 1 
ATOM 10145 O "O4'" . DG  J 6 82  ? 78.288  72.949  116.275 1.00 99.61  ?  8   DG  J "O4'" 1 
ATOM 10146 C "C3'" . DG  J 6 82  ? 77.213  74.853  115.360 1.00 99.61  ?  8   DG  J "C3'" 1 
ATOM 10147 O "O3'" . DG  J 6 82  ? 75.983  75.018  116.034 1.00 99.61  ?  8   DG  J "O3'" 1 
ATOM 10148 C "C2'" . DG  J 6 82  ? 78.393  75.315  116.216 1.00 99.61  ?  8   DG  J "C2'" 1 
ATOM 10149 C "C1'" . DG  J 6 82  ? 78.741  74.064  117.016 1.00 99.61  ?  8   DG  J "C1'" 1 
ATOM 10150 N N9    . DG  J 6 82  ? 80.168  73.879  117.226 1.00 99.61  ?  8   DG  J N9    1 
ATOM 10151 C C8    . DG  J 6 82  ? 81.159  74.024  116.296 1.00 99.61  ?  8   DG  J C8    1 
ATOM 10152 N N7    . DG  J 6 82  ? 82.347  73.765  116.759 1.00 99.61  ?  8   DG  J N7    1 
ATOM 10153 C C5    . DG  J 6 82  ? 82.125  73.404  118.074 1.00 99.61  ?  8   DG  J C5    1 
ATOM 10154 C C6    . DG  J 6 82  ? 83.041  73.025  119.075 1.00 99.61  ?  8   DG  J C6    1 
ATOM 10155 O O6    . DG  J 6 82  ? 84.266  72.911  118.986 1.00 99.61  ?  8   DG  J O6    1 
ATOM 10156 N N1    . DG  J 6 82  ? 82.405  72.741  120.275 1.00 99.61  ?  8   DG  J N1    1 
ATOM 10157 C C2    . DG  J 6 82  ? 81.054  72.828  120.484 1.00 99.61  ?  8   DG  J C2    1 
ATOM 10158 N N2    . DG  J 6 82  ? 80.627  72.522  121.715 1.00 99.61  ?  8   DG  J N2    1 
ATOM 10159 N N3    . DG  J 6 82  ? 80.182  73.193  119.555 1.00 99.61  ?  8   DG  J N3    1 
ATOM 10160 C C4    . DG  J 6 82  ? 80.789  73.465  118.378 1.00 99.61  ?  8   DG  J C4    1 
ATOM 10161 P P     . DT  J 6 83  ? 75.277  76.457  116.093 1.00 105.34 ?  9   DT  J P     1 
ATOM 10162 O OP1   . DT  J 6 83  ? 73.854  76.277  115.735 1.00 105.34 ?  9   DT  J OP1   1 
ATOM 10163 O OP2   . DT  J 6 83  ? 76.119  77.402  115.326 1.00 105.34 -1 9   DT  J OP2   1 
ATOM 10164 O "O5'" . DT  J 6 83  ? 75.379  76.853  117.634 1.00 105.34 ?  9   DT  J "O5'" 1 
ATOM 10165 C "C5'" . DT  J 6 83  ? 75.433  75.830  118.620 1.00 105.34 ?  9   DT  J "C5'" 1 
ATOM 10166 C "C4'" . DT  J 6 83  ? 75.885  76.382  119.960 1.00 105.34 ?  9   DT  J "C4'" 1 
ATOM 10167 O "O4'" . DT  J 6 83  ? 77.257  75.978  120.229 1.00 105.34 ?  9   DT  J "O4'" 1 
ATOM 10168 C "C3'" . DT  J 6 83  ? 75.870  77.903  120.081 1.00 105.34 ?  9   DT  J "C3'" 1 
ATOM 10169 O "O3'" . DT  J 6 83  ? 75.479  78.253  121.395 1.00 105.34 ?  9   DT  J "O3'" 1 
ATOM 10170 C "C2'" . DT  J 6 83  ? 77.330  78.257  119.826 1.00 105.34 ?  9   DT  J "C2'" 1 
ATOM 10171 C "C1'" . DT  J 6 83  ? 78.015  77.119  120.557 1.00 105.34 ?  9   DT  J "C1'" 1 
ATOM 10172 N N1    . DT  J 6 83  ? 79.429  76.888  120.143 1.00 105.34 ?  9   DT  J N1    1 
ATOM 10173 C C2    . DT  J 6 83  ? 80.305  76.316  121.034 1.00 105.34 ?  9   DT  J C2    1 
ATOM 10174 O O2    . DT  J 6 83  ? 79.989  75.987  122.159 1.00 105.34 ?  9   DT  J O2    1 
ATOM 10175 N N3    . DT  J 6 83  ? 81.574  76.140  120.558 1.00 105.34 ?  9   DT  J N3    1 
ATOM 10176 C C4    . DT  J 6 83  ? 82.041  76.472  119.306 1.00 105.34 ?  9   DT  J C4    1 
ATOM 10177 O O4    . DT  J 6 83  ? 83.196  76.273  118.965 1.00 105.34 ?  9   DT  J O4    1 
ATOM 10178 C C5    . DT  J 6 83  ? 81.075  77.065  118.423 1.00 105.34 ?  9   DT  J C5    1 
ATOM 10179 C C7    . DT  J 6 83  ? 81.475  77.467  117.036 1.00 105.34 ?  9   DT  J C7    1 
ATOM 10180 C C6    . DT  J 6 83  ? 79.830  77.245  118.879 1.00 105.34 ?  9   DT  J C6    1 
ATOM 10181 P P     . DG  J 6 84  ? 75.081  79.762  121.773 1.00 116.96 ?  10  DG  J P     1 
ATOM 10182 O OP1   . DG  J 6 84  ? 73.650  79.943  121.447 1.00 116.96 ?  10  DG  J OP1   1 
ATOM 10183 O OP2   . DG  J 6 84  ? 76.086  80.683  121.204 1.00 116.96 -1 10  DG  J OP2   1 
ATOM 10184 O "O5'" . DG  J 6 84  ? 75.267  79.792  123.357 1.00 116.96 ?  10  DG  J "O5'" 1 
ATOM 10185 C "C5'" . DG  J 6 84  ? 76.284  78.993  123.951 1.00 116.96 ?  10  DG  J "C5'" 1 
ATOM 10186 C "C4'" . DG  J 6 84  ? 76.892  79.688  125.153 1.00 116.96 ?  10  DG  J "C4'" 1 
ATOM 10187 O "O4'" . DG  J 6 84  ? 78.332  79.578  125.097 1.00 116.96 ?  10  DG  J "O4'" 1 
ATOM 10188 C "C3'" . DG  J 6 84  ? 76.626  81.175  125.234 1.00 116.96 ?  10  DG  J "C3'" 1 
ATOM 10189 O "O3'" . DG  J 6 84  ? 76.741  81.603  126.578 1.00 116.96 ?  10  DG  J "O3'" 1 
ATOM 10190 C "C2'" . DG  J 6 84  ? 77.734  81.757  124.357 1.00 116.96 ?  10  DG  J "C2'" 1 
ATOM 10191 C "C1'" . DG  J 6 84  ? 78.887  80.770  124.565 1.00 116.96 ?  10  DG  J "C1'" 1 
ATOM 10192 N N9    . DG  J 6 84  ? 79.589  80.428  123.331 1.00 116.96 ?  10  DG  J N9    1 
ATOM 10193 C C8    . DG  J 6 84  ? 79.035  80.235  122.095 1.00 116.96 ?  10  DG  J C8    1 
ATOM 10194 N N7    . DG  J 6 84  ? 79.904  79.922  121.176 1.00 116.96 ?  10  DG  J N7    1 
ATOM 10195 C C5    . DG  J 6 84  ? 81.110  79.901  121.848 1.00 116.96 ?  10  DG  J C5    1 
ATOM 10196 C C6    . DG  J 6 84  ? 82.410  79.634  121.370 1.00 116.96 ?  10  DG  J C6    1 
ATOM 10197 O O6    . DG  J 6 84  ? 82.765  79.345  120.221 1.00 116.96 ?  10  DG  J O6    1 
ATOM 10198 N N1    . DG  J 6 84  ? 83.357  79.731  122.381 1.00 116.96 ?  10  DG  J N1    1 
ATOM 10199 C C2    . DG  J 6 84  ? 83.082  80.048  123.688 1.00 116.96 ?  10  DG  J C2    1 
ATOM 10200 N N2    . DG  J 6 84  ? 84.126  80.094  124.524 1.00 116.96 ?  10  DG  J N2    1 
ATOM 10201 N N3    . DG  J 6 84  ? 81.868  80.307  124.147 1.00 116.96 ?  10  DG  J N3    1 
ATOM 10202 C C4    . DG  J 6 84  ? 80.936  80.215  123.176 1.00 116.96 ?  10  DG  J C4    1 
ATOM 10203 P P     . DC  J 6 85  ? 76.537  83.148  126.954 1.00 121.88 ?  11  DC  J P     1 
ATOM 10204 O OP1   . DC  J 6 85  ? 75.942  83.204  128.308 1.00 121.88 ?  11  DC  J OP1   1 
ATOM 10205 O OP2   . DC  J 6 85  ? 75.850  83.801  125.818 1.00 121.88 -1 11  DC  J OP2   1 
ATOM 10206 O "O5'" . DC  J 6 85  ? 78.027  83.716  127.018 1.00 121.88 ?  11  DC  J "O5'" 1 
ATOM 10207 C "C5'" . DC  J 6 85  ? 79.030  82.986  127.711 1.00 121.88 ?  11  DC  J "C5'" 1 
ATOM 10208 C "C4'" . DC  J 6 85  ? 80.386  83.649  127.560 1.00 121.88 ?  11  DC  J "C4'" 1 
ATOM 10209 O "O4'" . DC  J 6 85  ? 81.055  83.132  126.383 1.00 121.88 ?  11  DC  J "O4'" 1 
ATOM 10210 C "C3'" . DC  J 6 85  ? 80.349  85.170  127.392 1.00 121.88 ?  11  DC  J "C3'" 1 
ATOM 10211 O "O3'" . DC  J 6 85  ? 81.363  85.766  128.183 1.00 121.88 ?  11  DC  J "O3'" 1 
ATOM 10212 C "C2'" . DC  J 6 85  ? 80.626  85.357  125.903 1.00 121.88 ?  11  DC  J "C2'" 1 
ATOM 10213 C "C1'" . DC  J 6 85  ? 81.580  84.209  125.649 1.00 121.88 ?  11  DC  J "C1'" 1 
ATOM 10214 N N1    . DC  J 6 85  ? 81.680  83.808  124.224 1.00 121.88 ?  11  DC  J N1    1 
ATOM 10215 C C2    . DC  J 6 85  ? 82.917  83.422  123.709 1.00 121.88 ?  11  DC  J C2    1 
ATOM 10216 O O2    . DC  J 6 85  ? 83.901  83.426  124.453 1.00 121.88 ?  11  DC  J O2    1 
ATOM 10217 N N3    . DC  J 6 85  ? 82.999  83.051  122.412 1.00 121.88 ?  11  DC  J N3    1 
ATOM 10218 C C4    . DC  J 6 85  ? 81.909  83.067  121.645 1.00 121.88 ?  11  DC  J C4    1 
ATOM 10219 N N4    . DC  J 6 85  ? 82.041  82.696  120.369 1.00 121.88 ?  11  DC  J N4    1 
ATOM 10220 C C5    . DC  J 6 85  ? 80.638  83.459  122.152 1.00 121.88 ?  11  DC  J C5    1 
ATOM 10221 C C6    . DC  J 6 85  ? 80.571  83.818  123.435 1.00 121.88 ?  11  DC  J C6    1 
ATOM 10222 P P     . DG  J 6 86  ? 81.199  87.281  128.689 1.00 123.35 ?  12  DG  J P     1 
ATOM 10223 O OP1   . DG  J 6 86  ? 80.928  87.238  130.142 1.00 123.35 ?  12  DG  J OP1   1 
ATOM 10224 O OP2   . DG  J 6 86  ? 80.245  87.953  127.781 1.00 123.35 -1 12  DG  J OP2   1 
ATOM 10225 O "O5'" . DG  J 6 86  ? 82.642  87.925  128.450 1.00 123.35 ?  12  DG  J "O5'" 1 
ATOM 10226 C "C5'" . DG  J 6 86  ? 83.681  87.708  129.393 1.00 123.35 ?  12  DG  J "C5'" 1 
ATOM 10227 C "C4'" . DG  J 6 86  ? 85.051  87.835  128.746 1.00 123.35 ?  12  DG  J "C4'" 1 
ATOM 10228 O "O4'" . DG  J 6 86  ? 85.083  87.084  127.507 1.00 123.35 ?  12  DG  J "O4'" 1 
ATOM 10229 C "C3'" . DG  J 6 86  ? 85.483  89.251  128.386 1.00 123.35 ?  12  DG  J "C3'" 1 
ATOM 10230 O "O3'" . DG  J 6 86  ? 86.881  89.375  128.595 1.00 123.35 ?  12  DG  J "O3'" 1 
ATOM 10231 C "C2'" . DG  J 6 86  ? 85.120  89.352  126.903 1.00 123.35 ?  12  DG  J "C2'" 1 
ATOM 10232 C "C1'" . DG  J 6 86  ? 85.410  87.939  126.428 1.00 123.35 ?  12  DG  J "C1'" 1 
ATOM 10233 N N9    . DG  J 6 86  ? 84.623  87.512  125.273 1.00 123.35 ?  12  DG  J N9    1 
ATOM 10234 C C8    . DG  J 6 86  ? 83.259  87.552  125.136 1.00 123.35 ?  12  DG  J C8    1 
ATOM 10235 N N7    . DG  J 6 86  ? 82.837  87.069  124.002 1.00 123.35 ?  12  DG  J N7    1 
ATOM 10236 C C5    . DG  J 6 86  ? 83.993  86.668  123.356 1.00 123.35 ?  12  DG  J C5    1 
ATOM 10237 C C6    . DG  J 6 86  ? 84.168  86.070  122.090 1.00 123.35 ?  12  DG  J C6    1 
ATOM 10238 O O6    . DG  J 6 86  ? 83.310  85.772  121.257 1.00 123.35 ?  12  DG  J O6    1 
ATOM 10239 N N1    . DG  J 6 86  ? 85.508  85.833  121.812 1.00 123.35 ?  12  DG  J N1    1 
ATOM 10240 C C2    . DG  J 6 86  ? 86.546  86.125  122.658 1.00 123.35 ?  12  DG  J C2    1 
ATOM 10241 N N2    . DG  J 6 86  ? 87.773  85.824  122.211 1.00 123.35 ?  12  DG  J N2    1 
ATOM 10242 N N3    . DG  J 6 86  ? 86.399  86.691  123.845 1.00 123.35 ?  12  DG  J N3    1 
ATOM 10243 C C4    . DG  J 6 86  ? 85.099  86.931  124.127 1.00 123.35 ?  12  DG  J C4    1 
ATOM 10244 P P     . DT  J 6 87  ? 87.667  90.700  128.142 1.00 122.03 ?  13  DT  J P     1 
ATOM 10245 O OP1   . DT  J 6 87  ? 88.748  90.927  129.125 1.00 122.03 ?  13  DT  J OP1   1 
ATOM 10246 O OP2   . DT  J 6 87  ? 86.681  91.771  127.881 1.00 122.03 -1 13  DT  J OP2   1 
ATOM 10247 O "O5'" . DT  J 6 87  ? 88.340  90.285  126.755 1.00 122.03 ?  13  DT  J "O5'" 1 
ATOM 10248 C "C5'" . DT  J 6 87  ? 89.750  90.099  126.677 1.00 122.03 ?  13  DT  J "C5'" 1 
ATOM 10249 C "C4'" . DT  J 6 87  ? 90.232  90.152  125.237 1.00 122.03 ?  13  DT  J "C4'" 1 
ATOM 10250 O "O4'" . DT  J 6 87  ? 89.238  89.551  124.365 1.00 122.03 ?  13  DT  J "O4'" 1 
ATOM 10251 C "C3'" . DT  J 6 87  ? 90.458  91.555  124.673 1.00 122.03 ?  13  DT  J "C3'" 1 
ATOM 10252 O "O3'" . DT  J 6 87  ? 91.453  91.497  123.671 1.00 122.03 ?  13  DT  J "O3'" 1 
ATOM 10253 C "C2'" . DT  J 6 87  ? 89.108  91.847  124.041 1.00 122.03 ?  13  DT  J "C2'" 1 
ATOM 10254 C "C1'" . DT  J 6 87  ? 88.856  90.501  123.393 1.00 122.03 ?  13  DT  J "C1'" 1 
ATOM 10255 N N1    . DT  J 6 87  ? 87.455  90.242  123.008 1.00 122.03 ?  13  DT  J N1    1 
ATOM 10256 C C2    . DT  J 6 87  ? 87.214  89.321  122.030 1.00 122.03 ?  13  DT  J C2    1 
ATOM 10257 O O2    . DT  J 6 87  ? 88.099  88.720  121.453 1.00 122.03 ?  13  DT  J O2    1 
ATOM 10258 N N3    . DT  J 6 87  ? 85.903  89.144  121.717 1.00 122.03 ?  13  DT  J N3    1 
ATOM 10259 C C4    . DT  J 6 87  ? 84.821  89.759  122.311 1.00 122.03 ?  13  DT  J C4    1 
ATOM 10260 O O4    . DT  J 6 87  ? 83.672  89.523  121.970 1.00 122.03 ?  13  DT  J O4    1 
ATOM 10261 C C5    . DT  J 6 87  ? 85.140  90.715  123.339 1.00 122.03 ?  13  DT  J C5    1 
ATOM 10262 C C7    . DT  J 6 87  ? 84.046  91.459  124.038 1.00 122.03 ?  13  DT  J C7    1 
ATOM 10263 C C6    . DT  J 6 87  ? 86.430  90.909  123.638 1.00 122.03 ?  13  DT  J C6    1 
ATOM 10264 P P     . DT  J 6 88  ? 92.998  91.769  124.008 1.00 116.98 ?  14  DT  J P     1 
ATOM 10265 O OP1   . DT  J 6 88  ? 93.510  90.630  124.800 1.00 116.98 ?  14  DT  J OP1   1 
ATOM 10266 O OP2   . DT  J 6 88  ? 93.109  93.146  124.536 1.00 116.98 -1 14  DT  J OP2   1 
ATOM 10267 O "O5'" . DT  J 6 88  ? 93.689  91.733  122.568 1.00 116.98 ?  14  DT  J "O5'" 1 
ATOM 10268 C "C5'" . DT  J 6 88  ? 93.247  90.783  121.597 1.00 116.98 ?  14  DT  J "C5'" 1 
ATOM 10269 C "C4'" . DT  J 6 88  ? 92.825