data_6C1U
# 
_entry.id   6C1U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6C1U         
WWPDB D_1000230209 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6C1U 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-05 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lei, M.'                              1 ? 
'Tempel, W.'                           2 ? 
'Arrowsmith, C.H.'                     3 ? 
'Bountra, C.'                          4 ? 
'Edwards, A.M.'                        5 ? 
'Min, J.'                              6 ? 
'Structural Genomics Consortium (SGC)' 7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                7344 
_citation.page_last                 7354 
_citation.title                     'Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.001785 
_citation.pdbx_database_id_PubMed   29567833 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, K.'      1 
primary 'Xu, C.'       2 
primary 'Lei, M.'      3 
primary 'Yang, A.'     4 
primary 'Loppnau, P.'  5 
primary 'Hughes, T.R.' 6 
primary 'Min, J.'      7 
# 
_cell.angle_alpha                  84.480 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   85.910 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  62.770 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6C1U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     36.912 
_cell.length_a_esd                 ? 
_cell.length_b                     40.015 
_cell.length_b_esd                 ? 
_cell.length_c                     105.890 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6C1U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Methyl-CpG-binding domain protein 2' 8791.171 4  ? ? ? ? 
2 polymer     syn '12-mer DNA'                          3759.439 2  ? ? ? ? 
3 polymer     syn '12-mer DNA'                          3582.360 2  ? ? ? ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'                 ?        42 ? ? ? ? 
5 water       nat water                                 18.015   25 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Demethylase,DMTase,Methyl-CpG-binding protein MBD2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK 
GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK A,B,E,F ? 
2 polydeoxyribonucleotide no no  '(DC)(DG)(DG)(DA)(DG)(DT)(DG)(DT)(DG)(DG)(DG)(DC)'                              CGGAGTGTGGGC C,G 
? 
3 polydeoxyribonucleotide no yes '(DG)(DC)(DC)(DC)(DA)(5CM)(DA)(DC)(DT)(DC)(DC)(DG)'                             GCCCACACTCCG D,H 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  THR n 
1 4  GLU n 
1 5  SER n 
1 6  GLY n 
1 7  LYS n 
1 8  ARG n 
1 9  MET n 
1 10 ASP n 
1 11 CYS n 
1 12 PRO n 
1 13 ALA n 
1 14 LEU n 
1 15 PRO n 
1 16 PRO n 
1 17 GLY n 
1 18 TRP n 
1 19 LYS n 
1 20 LYS n 
1 21 GLU n 
1 22 GLU n 
1 23 VAL n 
1 24 ILE n 
1 25 ARG n 
1 26 LYS n 
1 27 SER n 
1 28 GLY n 
1 29 LEU n 
1 30 SER n 
1 31 ALA n 
1 32 GLY n 
1 33 LYS n 
1 34 SER n 
1 35 ASP n 
1 36 VAL n 
1 37 TYR n 
1 38 TYR n 
1 39 PHE n 
1 40 SER n 
1 41 PRO n 
1 42 SER n 
1 43 GLY n 
1 44 LYS n 
1 45 LYS n 
1 46 PHE n 
1 47 ARG n 
1 48 SER n 
1 49 LYS n 
1 50 PRO n 
1 51 GLN n 
1 52 LEU n 
1 53 ALA n 
1 54 ARG n 
1 55 TYR n 
1 56 LEU n 
1 57 GLY n 
1 58 ASN n 
1 59 THR n 
1 60 VAL n 
1 61 ASP n 
1 62 LEU n 
1 63 SER n 
1 64 SER n 
1 65 PHE n 
1 66 ASP n 
1 67 PHE n 
1 68 ARG n 
1 69 THR n 
1 70 GLY n 
1 71 LYS n 
1 72 MET n 
1 73 MET n 
1 74 PRO n 
1 75 SER n 
1 76 LYS n 
1 77 LEU n 
1 78 GLN n 
1 79 LYS n 
2 1  DC  n 
2 2  DG  n 
2 3  DG  n 
2 4  DA  n 
2 5  DG  n 
2 6  DT  n 
2 7  DG  n 
2 8  DT  n 
2 9  DG  n 
2 10 DG  n 
2 11 DG  n 
2 12 DC  n 
3 1  DG  n 
3 2  DC  n 
3 3  DC  n 
3 4  DC  n 
3 5  DA  n 
3 6  5CM n 
3 7  DA  n 
3 8  DC  n 
3 9  DT  n 
3 10 DC  n 
3 11 DC  n 
3 12 DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   79 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MBD2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 ? 
3 1 sample 1 12 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MBD2_HUMAN Q9UBB5 ? 1 ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK 143 
2 PDB 6C1U       6C1U   ? 2 ?                                                                              1   
3 PDB 6C1U       6C1U   ? 3 ?                                                                              1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6C1U A 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
2 1 6C1U B 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
3 2 6C1U C 1 ? 12 ? 6C1U   1   ? 12  ? 1   12  
4 3 6C1U D 1 ? 12 ? 6C1U   1   ? 12  ? 1   12  
5 1 6C1U E 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
6 1 6C1U F 2 ? 79 ? Q9UBB5 143 ? 220 ? 143 220 
7 2 6C1U G 1 ? 12 ? 6C1U   1   ? 12  ? 1   12  
8 3 6C1U H 1 ? 12 ? 6C1U   1   ? 12  ? 1   12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6C1U GLY A 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 1 
2 6C1U GLY B 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 2 
5 6C1U GLY E 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 3 
6 6C1U GLY F 1 ? UNP Q9UBB5 ? ? 'expression tag' 142 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5CM 'DNA linking'       n "5-METHYL-2'-DEOXY-CYTIDINE-5'-MONOPHOSPHATE" ? 'C10 H16 N3 O7 P' 321.224 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'      75.067  
HOH non-polymer         . WATER                                         ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'     181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                         ? ?                 ?       
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6C1U 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.08 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.330 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% PEG-3350, 0.2 M potassium dihydrogen phosphate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-09-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97934 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6C1U 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.990 
_reflns.d_resolution_low                 35.490 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33843 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.900 
_reflns.pdbx_Rmerge_I_obs                0.036 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             0 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.049 
_reflns.pdbx_Rpim_I_all                  0.033 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         64867 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.990 2.050  ? ? 2842 ? ? ? 1691 63.000 ? ? ? ? 0.578 ? ? ? ? ? ? ? ? 1.700 ? ? ? 1.100  0.786 0.530 ? 1 1 0.588 ? 
8.920 35.490 ? ? 765  ? ? ? 388  93.900 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? 2.000 ? ? ? 31.900 0.031 0.020 ? 2 1 0.997 ? 
# 
_refine.aniso_B[1][1]                            -0.5300 
_refine.aniso_B[1][2]                            -0.8300 
_refine.aniso_B[1][3]                            0.9800 
_refine.aniso_B[2][2]                            0.8700 
_refine.aniso_B[2][3]                            -0.7800 
_refine.aniso_B[3][3]                            -1.6800 
_refine.B_iso_max                                109.670 
_refine.B_iso_mean                               48.2930 
_refine.B_iso_min                                13.410 
_refine.correlation_coeff_Fo_to_Fc               0.9280 
_refine.correlation_coeff_Fo_to_Fc_free          0.8990 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6C1U 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             35.1000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     21914 
_refine.ls_number_reflns_R_free                  808 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.3900 
_refine.ls_percent_reflns_R_free                 3.6000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2331 
_refine.ls_R_factor_R_free                       0.2717 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2316 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      
;rigid body refinement (refmac5/dimple) of a currently unpublished, isomorphous structure of a similar MBD2-DNA complex against current data.
;
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            'thin resolution shells (sftools)' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.3100 
_refine.pdbx_overall_ESU_R_Free                  0.2410 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             17.7140 
_refine.overall_SU_ML                            0.2140 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        35.1000 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             25 
_refine_hist.number_atoms_total               3076 
_refine_hist.pdbx_number_residues_total       322 
_refine_hist.pdbx_B_iso_mean_ligand           30.47 
_refine_hist.pdbx_B_iso_mean_solvent          34.84 
_refine_hist.pdbx_number_atoms_protein        2035 
_refine_hist.pdbx_number_atoms_nucleic_acid   974 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.014  0.017  3176 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  2407 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.793  1.696  4484 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.219  3.000  5571 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.669  5.000  269  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 28.992 21.139 79   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 14.053 15.000 329  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 18.842 15.000 19   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.100  0.200  427  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.013  0.021  2922 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  717  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 1.353  3.113  1084 ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 1.352  3.111  1082 ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 2.170  4.658  1350 ? r_mcangle_it           ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.3000 
_refine_ls_shell.d_res_low                        2.3590 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             1698 
_refine_ls_shell.percent_reflns_obs               95.8200 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2660 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6C1U 
_struct.title                        'MBD2 in complex with a deoxy-oligonucleotide' 
_struct.pdbx_descriptor              'Methyl-CpG-binding domain protein 2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6C1U 
_struct_keywords.text            
'MBD, DNA-binding, Structural Genomics, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 5 ? 
ZA N N 5 ? 
AB N N 5 ? 
BB N N 5 ? 
CB N N 5 ? 
DB N N 5 ? 
EB N N 5 ? 
FB N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 48 ? GLY A 57 ? SER A 189 GLY A 198 1 ? 10 
HELX_P HELX_P2 AA2 ASN A 58 ? VAL A 60 ? ASN A 199 VAL A 201 5 ? 3  
HELX_P HELX_P3 AA3 SER B 48 ? GLY B 57 ? SER B 189 GLY B 198 1 ? 10 
HELX_P HELX_P4 AA4 SER E 48 ? GLY E 57 ? SER E 189 GLY E 198 1 ? 10 
HELX_P HELX_P5 AA5 ASN E 58 ? VAL E 60 ? ASN E 199 VAL E 201 5 ? 3  
HELX_P HELX_P6 AA6 SER F 48 ? GLY F 57 ? SER F 189 GLY F 198 1 ? 10 
HELX_P HELX_P7 AA7 ASN F 58 ? VAL F 60 ? ASN F 199 VAL F 201 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? D DA  5  "O3'" ? ? ? 1_555 D 5CM 6  P  ? ? D DA  5  D 5CM 6  1_555 ? ? ? ? ? ? ?            1.629 ? 
covale2  covale both ? D 5CM 6  "O3'" ? ? ? 1_555 D DA  7  P  ? ? D 5CM 6  D DA  7  1_555 ? ? ? ? ? ? ?            1.609 ? 
covale3  covale both ? H DA  5  "O3'" ? ? ? 1_555 H 5CM 6  P  ? ? H DA  5  H 5CM 6  1_555 ? ? ? ? ? ? ?            1.584 ? 
covale4  covale both ? H 5CM 6  "O3'" ? ? ? 1_555 H DA  7  P  ? ? H 5CM 6  H DA  7  1_555 ? ? ? ? ? ? ?            1.589 ? 
hydrog1  hydrog ?    ? C DC  1  N3    ? ? ? 1_555 D DG  12 N1 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? C DC  1  N4    ? ? ? 1_555 D DG  12 O6 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? C DC  1  O2    ? ? ? 1_555 D DG  12 N2 ? ? C DC  1  D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? C DG  2  N1    ? ? ? 1_555 D DC  11 N3 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? C DG  2  N2    ? ? ? 1_555 D DC  11 O2 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? C DG  2  O6    ? ? ? 1_555 D DC  11 N4 ? ? C DG  2  D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? C DG  3  N1    ? ? ? 1_555 D DC  10 N3 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? C DG  3  N2    ? ? ? 1_555 D DC  10 O2 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? C DG  3  O6    ? ? ? 1_555 D DC  10 N4 ? ? C DG  3  D DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? C DA  4  N1    ? ? ? 1_555 D DT  9  N3 ? ? C DA  4  D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? C DA  4  N6    ? ? ? 1_555 D DT  9  O4 ? ? C DA  4  D DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? C DG  5  N1    ? ? ? 1_555 D DC  8  N3 ? ? C DG  5  D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? C DG  5  N2    ? ? ? 1_555 D DC  8  O2 ? ? C DG  5  D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? C DG  5  O6    ? ? ? 1_555 D DC  8  N4 ? ? C DG  5  D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? C DT  6  N3    ? ? ? 1_555 D DA  7  N1 ? ? C DT  6  D DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? C DT  6  O4    ? ? ? 1_555 D DA  7  N6 ? ? C DT  6  D DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? C DG  7  N1    ? ? ? 1_555 D 5CM 6  N3 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? C DG  7  N2    ? ? ? 1_555 D 5CM 6  O2 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? C DG  7  O6    ? ? ? 1_555 D 5CM 6  N4 ? ? C DG  7  D 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? C DT  8  N3    ? ? ? 1_555 D DA  5  N1 ? ? C DT  8  D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? C DT  8  O4    ? ? ? 1_555 D DA  5  N6 ? ? C DT  8  D DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? C DG  9  N1    ? ? ? 1_555 D DC  4  N3 ? ? C DG  9  D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? C DG  9  N2    ? ? ? 1_555 D DC  4  O2 ? ? C DG  9  D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? C DG  9  O6    ? ? ? 1_555 D DC  4  N4 ? ? C DG  9  D DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? C DG  10 N1    ? ? ? 1_555 D DC  3  N3 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? C DG  10 N2    ? ? ? 1_555 D DC  3  O2 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? C DG  10 O6    ? ? ? 1_555 D DC  3  N4 ? ? C DG  10 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? C DG  11 N1    ? ? ? 1_555 D DC  2  N3 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? C DG  11 N2    ? ? ? 1_555 D DC  2  O2 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? C DG  11 O6    ? ? ? 1_555 D DC  2  N4 ? ? C DG  11 D DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? C DC  12 N3    ? ? ? 1_555 D DG  1  N1 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? C DC  12 N4    ? ? ? 1_555 D DG  1  O6 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? C DC  12 O2    ? ? ? 1_555 D DG  1  N2 ? ? C DC  12 D DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? G DC  1  N3    ? ? ? 1_555 H DG  12 N1 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? G DC  1  N4    ? ? ? 1_555 H DG  12 O6 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? G DC  1  O2    ? ? ? 1_555 H DG  12 N2 ? ? G DC  1  H DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? G DG  2  N1    ? ? ? 1_555 H DC  11 N3 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? G DG  2  N2    ? ? ? 1_555 H DC  11 O2 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? G DG  2  O6    ? ? ? 1_555 H DC  11 N4 ? ? G DG  2  H DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? G DG  3  N1    ? ? ? 1_555 H DC  10 N3 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? G DG  3  N2    ? ? ? 1_555 H DC  10 O2 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? G DG  3  O6    ? ? ? 1_555 H DC  10 N4 ? ? G DG  3  H DC  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? G DA  4  N1    ? ? ? 1_555 H DT  9  N3 ? ? G DA  4  H DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? G DA  4  N6    ? ? ? 1_555 H DT  9  O4 ? ? G DA  4  H DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? G DG  5  N1    ? ? ? 1_555 H DC  8  N3 ? ? G DG  5  H DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? G DG  5  N2    ? ? ? 1_555 H DC  8  O2 ? ? G DG  5  H DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? G DG  5  O6    ? ? ? 1_555 H DC  8  N4 ? ? G DG  5  H DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? G DT  6  N3    ? ? ? 1_555 H DA  7  N1 ? ? G DT  6  H DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? G DT  6  O4    ? ? ? 1_555 H DA  7  N6 ? ? G DT  6  H DA  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? G DG  7  N1    ? ? ? 1_555 H 5CM 6  N3 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? G DG  7  N2    ? ? ? 1_555 H 5CM 6  O2 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? G DG  7  O6    ? ? ? 1_555 H 5CM 6  N4 ? ? G DG  7  H 5CM 6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? G DT  8  N3    ? ? ? 1_555 H DA  5  N1 ? ? G DT  8  H DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? G DT  8  O4    ? ? ? 1_555 H DA  5  N6 ? ? G DT  8  H DA  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? G DG  9  N1    ? ? ? 1_555 H DC  4  N3 ? ? G DG  9  H DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? G DG  9  N2    ? ? ? 1_555 H DC  4  O2 ? ? G DG  9  H DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? G DG  9  O6    ? ? ? 1_555 H DC  4  N4 ? ? G DG  9  H DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? G DG  10 N1    ? ? ? 1_555 H DC  3  N3 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? G DG  10 N2    ? ? ? 1_555 H DC  3  O2 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? G DG  10 O6    ? ? ? 1_555 H DC  3  N4 ? ? G DG  10 H DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? G DG  11 N1    ? ? ? 1_555 H DC  2  N3 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? G DG  11 N2    ? ? ? 1_555 H DC  2  O2 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?    ? G DG  11 O6    ? ? ? 1_555 H DC  2  N4 ? ? G DG  11 H DC  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?    ? G DC  12 N3    ? ? ? 1_555 H DG  1  N1 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?    ? G DC  12 N4    ? ? ? 1_555 H DG  1  O6 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?    ? G DC  12 O2    ? ? ? 1_555 H DG  1  N2 ? ? G DC  12 H DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 9  ? ASP A 10 ? MET A 150 ASP A 151 
AA1 2 LYS A 19 ? ILE A 24 ? LYS A 160 ILE A 165 
AA1 3 SER A 34 ? PHE A 39 ? SER A 175 PHE A 180 
AA1 4 LYS A 45 ? PHE A 46 ? LYS A 186 PHE A 187 
AA2 1 PHE A 65 ? ASP A 66 ? PHE A 206 ASP A 207 
AA2 2 LYS A 71 ? MET A 72 ? LYS A 212 MET A 213 
AA3 1 MET B 9  ? ASP B 10 ? MET B 150 ASP B 151 
AA3 2 LYS B 19 ? ILE B 24 ? LYS B 160 ILE B 165 
AA3 3 SER B 34 ? PHE B 39 ? SER B 175 PHE B 180 
AA3 4 LYS B 45 ? PHE B 46 ? LYS B 186 PHE B 187 
AA4 1 PHE B 65 ? ASP B 66 ? PHE B 206 ASP B 207 
AA4 2 LYS B 71 ? MET B 72 ? LYS B 212 MET B 213 
AA5 1 MET E 9  ? ASP E 10 ? MET E 150 ASP E 151 
AA5 2 LYS E 19 ? ILE E 24 ? LYS E 160 ILE E 165 
AA5 3 SER E 34 ? PHE E 39 ? SER E 175 PHE E 180 
AA5 4 LYS E 45 ? PHE E 46 ? LYS E 186 PHE E 187 
AA6 1 MET F 9  ? ASP F 10 ? MET F 150 ASP F 151 
AA6 2 LYS F 19 ? ILE F 24 ? LYS F 160 ILE F 165 
AA6 3 SER F 34 ? PHE F 39 ? SER F 175 PHE F 180 
AA6 4 LYS F 45 ? PHE F 46 ? LYS F 186 PHE F 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 9  ? N MET A 150 O LYS A 20 ? O LYS A 161 
AA1 2 3 N LYS A 19 ? N LYS A 160 O PHE A 39 ? O PHE A 180 
AA1 3 4 N TYR A 38 ? N TYR A 179 O PHE A 46 ? O PHE A 187 
AA2 1 2 N ASP A 66 ? N ASP A 207 O LYS A 71 ? O LYS A 212 
AA3 1 2 N MET B 9  ? N MET B 150 O LYS B 20 ? O LYS B 161 
AA3 2 3 N GLU B 21 ? N GLU B 162 O TYR B 37 ? O TYR B 178 
AA3 3 4 N TYR B 38 ? N TYR B 179 O PHE B 46 ? O PHE B 187 
AA4 1 2 N ASP B 66 ? N ASP B 207 O LYS B 71 ? O LYS B 212 
AA5 1 2 N MET E 9  ? N MET E 150 O LYS E 20 ? O LYS E 161 
AA5 2 3 N LYS E 19 ? N LYS E 160 O PHE E 39 ? O PHE E 180 
AA5 3 4 N TYR E 38 ? N TYR E 179 O PHE E 46 ? O PHE E 187 
AA6 1 2 N MET F 9  ? N MET F 150 O LYS F 20 ? O LYS F 161 
AA6 2 3 N VAL F 23 ? N VAL F 164 O ASP F 35 ? O ASP F 176 
AA6 3 4 N TYR F 38 ? N TYR F 179 O PHE F 46 ? O PHE F 187 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D DA  5 ? 9  'binding site for Di-nucleotide DA D 5 and 5CM D 6' 
AC2 Software D 5CM 6 ? 8  'binding site for Di-nucleotide 5CM D 6 and DA D 7' 
AC3 Software H DA  5 ? 10 'binding site for Di-nucleotide DA H 5 and 5CM H 6' 
AC4 Software H 5CM 6 ? 9  'binding site for Di-nucleotide 5CM H 6 and DA H 7' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ARG A  47 ? ARG A 188 . ? 1_555 ? 
2  AC1 9  SER A  48 ? SER A 189 . ? 1_555 ? 
3  AC1 9  PRO A  50 ? PRO A 191 . ? 1_555 ? 
4  AC1 9  ARG A  54 ? ARG A 195 . ? 1_555 ? 
5  AC1 9  DG  C  7  ? DG  C 7   . ? 1_555 ? 
6  AC1 9  DT  C  8  ? DT  C 8   . ? 1_555 ? 
7  AC1 9  DG  C  9  ? DG  C 9   . ? 1_555 ? 
8  AC1 9  DC  D  4  ? DC  D 4   . ? 1_555 ? 
9  AC1 9  DA  D  7  ? DA  D 7   . ? 1_555 ? 
10 AC2 8  ARG A  47 ? ARG A 188 . ? 1_555 ? 
11 AC2 8  SER A  48 ? SER A 189 . ? 1_555 ? 
12 AC2 8  ARG A  54 ? ARG A 195 . ? 1_555 ? 
13 AC2 8  DG  C  5  ? DG  C 5   . ? 1_555 ? 
14 AC2 8  DT  C  6  ? DT  C 6   . ? 1_555 ? 
15 AC2 8  DG  C  7  ? DG  C 7   . ? 1_555 ? 
16 AC2 8  DA  D  5  ? DA  D 5   . ? 1_555 ? 
17 AC2 8  DC  D  8  ? DC  D 8   . ? 1_555 ? 
18 AC3 10 ARG E  47 ? ARG E 188 . ? 1_555 ? 
19 AC3 10 SER E  48 ? SER E 189 . ? 1_555 ? 
20 AC3 10 PRO E  50 ? PRO E 191 . ? 1_555 ? 
21 AC3 10 ARG E  54 ? ARG E 195 . ? 1_555 ? 
22 AC3 10 HOH CB .  ? HOH E 403 . ? 1_555 ? 
23 AC3 10 DG  G  7  ? DG  G 7   . ? 1_555 ? 
24 AC3 10 DT  G  8  ? DT  G 8   . ? 1_555 ? 
25 AC3 10 DG  G  9  ? DG  G 9   . ? 1_555 ? 
26 AC3 10 DC  H  4  ? DC  H 4   . ? 1_555 ? 
27 AC3 10 DA  H  7  ? DA  H 7   . ? 1_555 ? 
28 AC4 9  ARG E  47 ? ARG E 188 . ? 1_555 ? 
29 AC4 9  SER E  48 ? SER E 189 . ? 1_555 ? 
30 AC4 9  ARG E  54 ? ARG E 195 . ? 1_555 ? 
31 AC4 9  HOH CB .  ? HOH E 403 . ? 1_555 ? 
32 AC4 9  DG  G  5  ? DG  G 5   . ? 1_555 ? 
33 AC4 9  DT  G  6  ? DT  G 6   . ? 1_555 ? 
34 AC4 9  DG  G  7  ? DG  G 7   . ? 1_555 ? 
35 AC4 9  DA  H  5  ? DA  H 5   . ? 1_555 ? 
36 AC4 9  DC  H  8  ? DC  H 8   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6C1U 
_atom_sites.fract_transf_matrix[1][1]   0.027091 
_atom_sites.fract_transf_matrix[1][2]   -0.013941 
_atom_sites.fract_transf_matrix[1][3]   -0.000943 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028105 
_atom_sites.fract_transf_matrix[2][3]   -0.002018 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009492 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C CA    . GLY A  1 6  ? -23.037 4.690  -31.283 1.00 66.98  ? 147 GLY A CA    1 
ATOM   2    C C     . GLY A  1 6  ? -22.736 4.785  -29.781 1.00 66.40  ? 147 GLY A C     1 
ATOM   3    O O     . GLY A  1 6  ? -23.567 4.352  -28.966 1.00 65.76  ? 147 GLY A O     1 
ATOM   4    N N     . LYS A  1 7  ? -21.557 5.338  -29.422 1.00 64.91  ? 148 LYS A N     1 
ATOM   5    C CA    . LYS A  1 7  ? -21.039 5.351  -28.017 1.00 62.74  ? 148 LYS A CA    1 
ATOM   6    C C     . LYS A  1 7  ? -21.861 6.317  -27.166 1.00 57.44  ? 148 LYS A C     1 
ATOM   7    O O     . LYS A  1 7  ? -21.983 7.482  -27.516 1.00 56.61  ? 148 LYS A O     1 
ATOM   8    C CB    . LYS A  1 7  ? -19.547 5.752  -27.953 1.00 62.38  ? 148 LYS A CB    1 
ATOM   9    N N     . ARG A  1 8  ? -22.448 5.837  -26.070 1.00 55.43  ? 149 ARG A N     1 
ATOM   10   C CA    . ARG A  1 8  ? -23.207 6.722  -25.158 1.00 50.59  ? 149 ARG A CA    1 
ATOM   11   C C     . ARG A  1 8  ? -22.372 7.028  -23.972 1.00 48.40  ? 149 ARG A C     1 
ATOM   12   O O     . ARG A  1 8  ? -21.902 6.124  -23.318 1.00 49.46  ? 149 ARG A O     1 
ATOM   13   C CB    . ARG A  1 8  ? -24.528 6.127  -24.749 1.00 50.83  ? 149 ARG A CB    1 
ATOM   14   C CG    . ARG A  1 8  ? -25.474 6.017  -25.913 1.00 50.04  ? 149 ARG A CG    1 
ATOM   15   C CD    . ARG A  1 8  ? -26.905 5.896  -25.443 1.00 50.59  ? 149 ARG A CD    1 
ATOM   16   N NE    . ARG A  1 8  ? -27.720 5.485  -26.560 1.00 51.18  ? 149 ARG A NE    1 
ATOM   17   C CZ    . ARG A  1 8  ? -29.017 5.192  -26.501 1.00 52.51  ? 149 ARG A CZ    1 
ATOM   18   N NH1   . ARG A  1 8  ? -29.717 5.269  -25.357 1.00 49.91  ? 149 ARG A NH1   1 
ATOM   19   N NH2   . ARG A  1 8  ? -29.617 4.818  -27.639 1.00 52.90  ? 149 ARG A NH2   1 
ATOM   20   N N     . MET A  1 9  ? -22.147 8.321  -23.752 1.00 45.22  ? 150 MET A N     1 
ATOM   21   C CA    . MET A  1 9  ? -21.200 8.812  -22.789 1.00 46.03  ? 150 MET A CA    1 
ATOM   22   C C     . MET A  1 9  ? -21.944 9.565  -21.733 1.00 43.05  ? 150 MET A C     1 
ATOM   23   O O     . MET A  1 9  ? -22.669 10.509 -22.040 1.00 38.75  ? 150 MET A O     1 
ATOM   24   C CB    . MET A  1 9  ? -20.244 9.812  -23.450 1.00 47.38  ? 150 MET A CB    1 
ATOM   25   C CG    . MET A  1 9  ? -19.414 9.195  -24.535 1.00 49.52  ? 150 MET A CG    1 
ATOM   26   S SD    . MET A  1 9  ? -18.586 7.675  -24.004 1.00 56.19  ? 150 MET A SD    1 
ATOM   27   C CE    . MET A  1 9  ? -17.363 8.273  -22.828 1.00 58.14  ? 150 MET A CE    1 
ATOM   28   N N     . ASP A  1 10 ? -21.716 9.191  -20.488 1.00 44.68  ? 151 ASP A N     1 
ATOM   29   C CA    . ASP A  1 10 ? -22.166 9.973  -19.366 1.00 44.62  ? 151 ASP A CA    1 
ATOM   30   C C     . ASP A  1 10 ? -21.763 11.441 -19.587 1.00 44.38  ? 151 ASP A C     1 
ATOM   31   O O     . ASP A  1 10 ? -20.729 11.755 -20.188 1.00 44.86  ? 151 ASP A O     1 
ATOM   32   C CB    . ASP A  1 10 ? -21.540 9.459  -18.067 1.00 47.96  ? 151 ASP A CB    1 
ATOM   33   C CG    . ASP A  1 10 ? -22.105 8.102  -17.591 1.00 49.62  ? 151 ASP A CG    1 
ATOM   34   O OD1   . ASP A  1 10 ? -23.328 8.009  -17.346 1.00 50.09  ? 151 ASP A OD1   1 
ATOM   35   O OD2   . ASP A  1 10 ? -21.306 7.157  -17.356 1.00 50.91  ? 151 ASP A OD2   1 
ATOM   36   N N     . CYS A  1 11 ? -22.599 12.337 -19.095 1.00 45.64  ? 152 CYS A N     1 
ATOM   37   C CA    . CYS A  1 11 ? -22.417 13.784 -19.258 1.00 46.57  ? 152 CYS A CA    1 
ATOM   38   C C     . CYS A  1 11 ? -22.343 14.316 -17.847 1.00 48.95  ? 152 CYS A C     1 
ATOM   39   O O     . CYS A  1 11 ? -23.378 14.504 -17.187 1.00 50.71  ? 152 CYS A O     1 
ATOM   40   C CB    . CYS A  1 11 ? -23.566 14.462 -20.011 1.00 44.32  ? 152 CYS A CB    1 
ATOM   41   S SG    . CYS A  1 11 ? -23.277 16.256 -20.083 1.00 45.06  ? 152 CYS A SG    1 
ATOM   42   N N     . PRO A  1 12 ? -21.127 14.532 -17.362 1.00 51.06  ? 153 PRO A N     1 
ATOM   43   C CA    . PRO A  1 12 ? -20.985 14.896 -15.958 1.00 51.79  ? 153 PRO A CA    1 
ATOM   44   C C     . PRO A  1 12 ? -21.671 16.198 -15.551 1.00 52.71  ? 153 PRO A C     1 
ATOM   45   O O     . PRO A  1 12 ? -22.050 16.380 -14.364 1.00 55.11  ? 153 PRO A O     1 
ATOM   46   C CB    . PRO A  1 12 ? -19.476 15.031 -15.783 1.00 54.33  ? 153 PRO A CB    1 
ATOM   47   C CG    . PRO A  1 12 ? -18.845 14.391 -16.963 1.00 54.32  ? 153 PRO A CG    1 
ATOM   48   C CD    . PRO A  1 12 ? -19.833 14.490 -18.073 1.00 51.18  ? 153 PRO A CD    1 
ATOM   49   N N     . ALA A  1 13 ? -21.812 17.113 -16.505 1.00 53.02  ? 154 ALA A N     1 
ATOM   50   C CA    . ALA A  1 13 ? -22.434 18.421 -16.251 1.00 52.88  ? 154 ALA A CA    1 
ATOM   51   C C     . ALA A  1 13 ? -23.931 18.298 -15.995 1.00 49.51  ? 154 ALA A C     1 
ATOM   52   O O     . ALA A  1 13 ? -24.535 19.226 -15.511 1.00 49.58  ? 154 ALA A O     1 
ATOM   53   C CB    . ALA A  1 13 ? -22.152 19.391 -17.406 1.00 52.47  ? 154 ALA A CB    1 
ATOM   54   N N     . LEU A  1 14 ? -24.516 17.141 -16.284 1.00 48.40  ? 155 LEU A N     1 
ATOM   55   C CA    . LEU A  1 14 ? -25.939 16.904 -16.088 1.00 46.27  ? 155 LEU A CA    1 
ATOM   56   C C     . LEU A  1 14 ? -26.109 15.896 -14.993 1.00 48.62  ? 155 LEU A C     1 
ATOM   57   O O     . LEU A  1 14 ? -25.148 15.152 -14.706 1.00 50.12  ? 155 LEU A O     1 
ATOM   58   C CB    . LEU A  1 14 ? -26.541 16.319 -17.377 1.00 43.50  ? 155 LEU A CB    1 
ATOM   59   C CG    . LEU A  1 14 ? -26.748 17.266 -18.518 1.00 41.80  ? 155 LEU A CG    1 
ATOM   60   C CD1   . LEU A  1 14 ? -27.147 16.459 -19.748 1.00 40.92  ? 155 LEU A CD1   1 
ATOM   61   C CD2   . LEU A  1 14 ? -27.806 18.290 -18.223 1.00 41.45  ? 155 LEU A CD2   1 
ATOM   62   N N     . PRO A  1 15 ? -27.343 15.792 -14.433 1.00 50.28  ? 156 PRO A N     1 
ATOM   63   C CA    . PRO A  1 15 ? -27.674 14.821 -13.372 1.00 52.46  ? 156 PRO A CA    1 
ATOM   64   C C     . PRO A  1 15 ? -27.321 13.346 -13.665 1.00 53.97  ? 156 PRO A C     1 
ATOM   65   O O     . PRO A  1 15 ? -26.957 12.986 -14.800 1.00 52.64  ? 156 PRO A O     1 
ATOM   66   C CB    . PRO A  1 15 ? -29.213 14.958 -13.227 1.00 52.32  ? 156 PRO A CB    1 
ATOM   67   C CG    . PRO A  1 15 ? -29.473 16.359 -13.623 1.00 51.37  ? 156 PRO A CG    1 
ATOM   68   C CD    . PRO A  1 15 ? -28.561 16.528 -14.840 1.00 49.78  ? 156 PRO A CD    1 
ATOM   69   N N     . PRO A  1 16 ? -27.406 12.495 -12.639 1.00 56.08  ? 157 PRO A N     1 
ATOM   70   C CA    . PRO A  1 16 ? -26.919 11.130 -12.836 1.00 57.21  ? 157 PRO A CA    1 
ATOM   71   C C     . PRO A  1 16 ? -27.699 10.397 -13.888 1.00 54.76  ? 157 PRO A C     1 
ATOM   72   O O     . PRO A  1 16 ? -28.903 10.601 -13.962 1.00 53.99  ? 157 PRO A O     1 
ATOM   73   C CB    . PRO A  1 16 ? -27.129 10.448 -11.460 1.00 60.08  ? 157 PRO A CB    1 
ATOM   74   C CG    . PRO A  1 16 ? -27.492 11.535 -10.502 1.00 60.85  ? 157 PRO A CG    1 
ATOM   75   C CD    . PRO A  1 16 ? -27.522 12.852 -11.207 1.00 58.53  ? 157 PRO A CD    1 
ATOM   76   N N     . GLY A  1 17 ? -26.989 9.594  -14.693 1.00 54.05  ? 158 GLY A N     1 
ATOM   77   C CA    . GLY A  1 17 ? -27.565 8.701  -15.703 1.00 53.42  ? 158 GLY A CA    1 
ATOM   78   C C     . GLY A  1 17 ? -27.903 9.278  -17.082 1.00 50.81  ? 158 GLY A C     1 
ATOM   79   O O     . GLY A  1 17 ? -28.360 8.536  -17.977 1.00 50.16  ? 158 GLY A O     1 
ATOM   80   N N     . TRP A  1 18 ? -27.705 10.586 -17.237 1.00 48.14  ? 159 TRP A N     1 
ATOM   81   C CA    . TRP A  1 18 ? -27.886 11.276 -18.495 1.00 46.95  ? 159 TRP A CA    1 
ATOM   82   C C     . TRP A  1 18 ? -26.670 11.007 -19.381 1.00 46.01  ? 159 TRP A C     1 
ATOM   83   O O     . TRP A  1 18 ? -25.542 11.203 -18.962 1.00 46.94  ? 159 TRP A O     1 
ATOM   84   C CB    . TRP A  1 18 ? -28.025 12.812 -18.289 1.00 45.93  ? 159 TRP A CB    1 
ATOM   85   C CG    . TRP A  1 18 ? -29.386 13.269 -17.850 1.00 46.24  ? 159 TRP A CG    1 
ATOM   86   C CD1   . TRP A  1 18 ? -29.843 13.352 -16.569 1.00 48.71  ? 159 TRP A CD1   1 
ATOM   87   C CD2   . TRP A  1 18 ? -30.455 13.723 -18.675 1.00 45.39  ? 159 TRP A CD2   1 
ATOM   88   N NE1   . TRP A  1 18 ? -31.128 13.805 -16.538 1.00 47.81  ? 159 TRP A NE1   1 
ATOM   89   C CE2   . TRP A  1 18 ? -31.540 14.039 -17.814 1.00 48.00  ? 159 TRP A CE2   1 
ATOM   90   C CE3   . TRP A  1 18 ? -30.619 13.861 -20.047 1.00 43.70  ? 159 TRP A CE3   1 
ATOM   91   C CZ2   . TRP A  1 18 ? -32.762 14.513 -18.286 1.00 48.06  ? 159 TRP A CZ2   1 
ATOM   92   C CZ3   . TRP A  1 18 ? -31.823 14.315 -20.529 1.00 43.52  ? 159 TRP A CZ3   1 
ATOM   93   C CH2   . TRP A  1 18 ? -32.890 14.631 -19.659 1.00 45.82  ? 159 TRP A CH2   1 
ATOM   94   N N     . LYS A  1 19 ? -26.887 10.605 -20.614 1.00 43.25  ? 160 LYS A N     1 
ATOM   95   C CA    . LYS A  1 19 ? -25.767 10.341 -21.492 1.00 43.29  ? 160 LYS A CA    1 
ATOM   96   C C     . LYS A  1 19 ? -25.885 11.202 -22.736 1.00 40.84  ? 160 LYS A C     1 
ATOM   97   O O     . LYS A  1 19 ? -26.957 11.671 -23.020 1.00 39.61  ? 160 LYS A O     1 
ATOM   98   C CB    . LYS A  1 19 ? -25.653 8.833  -21.775 1.00 45.29  ? 160 LYS A CB    1 
ATOM   99   C CG    . LYS A  1 19 ? -25.564 7.941  -20.522 1.00 45.89  ? 160 LYS A CG    1 
ATOM   100  C CD    . LYS A  1 19 ? -25.239 6.457  -20.806 1.00 48.01  ? 160 LYS A CD    1 
ATOM   101  C CE    . LYS A  1 19 ? -25.191 5.556  -19.542 1.00 48.20  ? 160 LYS A CE    1 
ATOM   102  N N     . LYS A  1 20 ? -24.752 11.472 -23.390 1.00 42.18  ? 161 LYS A N     1 
ATOM   103  C CA    . LYS A  1 20 ? -24.606 12.342 -24.583 1.00 41.42  ? 161 LYS A CA    1 
ATOM   104  C C     . LYS A  1 20 ? -24.050 11.432 -25.646 1.00 42.39  ? 161 LYS A C     1 
ATOM   105  O O     . LYS A  1 20 ? -23.233 10.588 -25.319 1.00 41.50  ? 161 LYS A O     1 
ATOM   106  C CB    . LYS A  1 20 ? -23.588 13.448 -24.303 1.00 44.20  ? 161 LYS A CB    1 
ATOM   107  C CG    . LYS A  1 20 ? -23.166 14.323 -25.466 1.00 44.91  ? 161 LYS A CG    1 
ATOM   108  C CD    . LYS A  1 20 ? -22.065 15.304 -25.060 1.00 47.48  ? 161 LYS A CD    1 
ATOM   109  C CE    . LYS A  1 20 ? -21.348 15.951 -26.252 1.00 48.70  ? 161 LYS A CE    1 
ATOM   110  N N     . GLU A  1 21 ? -24.519 11.576 -26.888 1.00 41.07  ? 162 GLU A N     1 
ATOM   111  C CA    . GLU A  1 21 ? -23.999 10.830 -28.055 1.00 43.21  ? 162 GLU A CA    1 
ATOM   112  C C     . GLU A  1 21 ? -23.762 11.802 -29.201 1.00 40.97  ? 162 GLU A C     1 
ATOM   113  O O     . GLU A  1 21 ? -24.547 12.736 -29.368 1.00 38.77  ? 162 GLU A O     1 
ATOM   114  C CB    . GLU A  1 21 ? -25.038 9.783  -28.526 1.00 44.30  ? 162 GLU A CB    1 
ATOM   115  C CG    . GLU A  1 21 ? -24.534 8.693  -29.466 1.00 45.34  ? 162 GLU A CG    1 
ATOM   116  C CD    . GLU A  1 21 ? -25.656 7.909  -30.167 1.00 47.31  ? 162 GLU A CD    1 
ATOM   117  O OE1   . GLU A  1 21 ? -26.856 8.265  -30.119 1.00 45.05  ? 162 GLU A OE1   1 
ATOM   118  O OE2   . GLU A  1 21 ? -25.319 6.907  -30.840 1.00 57.51  ? 162 GLU A OE2   1 
ATOM   119  N N     . GLU A  1 22 ? -22.713 11.573 -29.984 1.00 41.75  ? 163 GLU A N     1 
ATOM   120  C CA    . GLU A  1 22 ? -22.399 12.406 -31.139 1.00 44.05  ? 163 GLU A CA    1 
ATOM   121  C C     . GLU A  1 22 ? -22.426 11.447 -32.290 1.00 44.53  ? 163 GLU A C     1 
ATOM   122  O O     . GLU A  1 22 ? -21.708 10.467 -32.262 1.00 46.63  ? 163 GLU A O     1 
ATOM   123  C CB    . GLU A  1 22 ? -21.040 13.130 -31.033 1.00 48.56  ? 163 GLU A CB    1 
ATOM   124  C CG    . GLU A  1 22 ? -20.761 14.007 -32.264 1.00 52.31  ? 163 GLU A CG    1 
ATOM   125  C CD    . GLU A  1 22 ? -19.603 15.012 -32.156 1.00 56.94  ? 163 GLU A CD    1 
ATOM   126  O OE1   . GLU A  1 22 ? -19.416 15.780 -33.115 1.00 57.31  ? 163 GLU A OE1   1 
ATOM   127  O OE2   . GLU A  1 22 ? -18.879 15.066 -31.136 1.00 62.20  ? 163 GLU A OE2   1 
ATOM   128  N N     . VAL A  1 23 ? -23.283 11.731 -33.281 1.00 43.35  ? 164 VAL A N     1 
ATOM   129  C CA    . VAL A  1 23 ? -23.485 10.908 -34.454 1.00 41.21  ? 164 VAL A CA    1 
ATOM   130  C C     . VAL A  1 23 ? -23.012 11.716 -35.682 1.00 41.46  ? 164 VAL A C     1 
ATOM   131  O O     . VAL A  1 23 ? -23.516 12.789 -36.018 1.00 41.21  ? 164 VAL A O     1 
ATOM   132  C CB    . VAL A  1 23 ? -24.968 10.425 -34.555 1.00 40.78  ? 164 VAL A CB    1 
ATOM   133  C CG1   . VAL A  1 23 ? -25.210 9.512  -35.749 1.00 41.27  ? 164 VAL A CG1   1 
ATOM   134  C CG2   . VAL A  1 23 ? -25.368 9.645  -33.289 1.00 42.50  ? 164 VAL A CG2   1 
ATOM   135  N N     . ILE A  1 24 ? -22.020 11.194 -36.376 1.00 43.20  ? 165 ILE A N     1 
ATOM   136  C CA    . ILE A  1 24 ? -21.564 11.830 -37.619 1.00 43.96  ? 165 ILE A CA    1 
ATOM   137  C C     . ILE A  1 24 ? -22.524 11.427 -38.738 1.00 42.73  ? 165 ILE A C     1 
ATOM   138  O O     . ILE A  1 24 ? -22.765 10.247 -38.921 1.00 44.12  ? 165 ILE A O     1 
ATOM   139  C CB    . ILE A  1 24 ? -20.167 11.324 -38.048 1.00 46.23  ? 165 ILE A CB    1 
ATOM   140  C CG1   . ILE A  1 24 ? -19.123 11.506 -36.944 1.00 47.33  ? 165 ILE A CG1   1 
ATOM   141  C CG2   . ILE A  1 24 ? -19.764 12.023 -39.327 1.00 47.69  ? 165 ILE A CG2   1 
ATOM   142  C CD1   . ILE A  1 24 ? -19.169 12.839 -36.224 1.00 47.00  ? 165 ILE A CD1   1 
ATOM   143  N N     . ARG A  1 25 ? -23.018 12.385 -39.515 1.00 42.57  ? 166 ARG A N     1 
ATOM   144  C CA    . ARG A  1 25 ? -23.851 12.072 -40.689 1.00 43.55  ? 166 ARG A CA    1 
ATOM   145  C C     . ARG A  1 25 ? -23.072 11.399 -41.786 1.00 47.51  ? 166 ARG A C     1 
ATOM   146  O O     . ARG A  1 25 ? -22.070 11.920 -42.191 1.00 50.29  ? 166 ARG A O     1 
ATOM   147  C CB    . ARG A  1 25 ? -24.460 13.356 -41.274 1.00 43.04  ? 166 ARG A CB    1 
ATOM   148  C CG    . ARG A  1 25 ? -25.407 14.041 -40.318 1.00 40.00  ? 166 ARG A CG    1 
ATOM   149  C CD    . ARG A  1 25 ? -26.311 14.995 -41.030 1.00 40.26  ? 166 ARG A CD    1 
ATOM   150  N NE    . ARG A  1 25 ? -27.131 15.709 -40.060 1.00 38.62  ? 166 ARG A NE    1 
ATOM   151  C CZ    . ARG A  1 25 ? -28.167 16.512 -40.344 1.00 37.94  ? 166 ARG A CZ    1 
ATOM   152  N NH1   . ARG A  1 25 ? -28.541 16.764 -41.610 1.00 38.09  ? 166 ARG A NH1   1 
ATOM   153  N NH2   . ARG A  1 25 ? -28.837 17.076 -39.323 1.00 36.74  ? 166 ARG A NH2   1 
ATOM   154  N N     . LYS A  1 26 ? -23.582 10.265 -42.279 1.00 51.35  ? 167 LYS A N     1 
ATOM   155  C CA    . LYS A  1 26 ? -22.893 9.376  -43.218 1.00 53.22  ? 167 LYS A CA    1 
ATOM   156  C C     . LYS A  1 26 ? -23.091 9.778  -44.665 1.00 54.75  ? 167 LYS A C     1 
ATOM   157  O O     . LYS A  1 26 ? -22.229 9.501  -45.478 1.00 53.84  ? 167 LYS A O     1 
ATOM   158  C CB    . LYS A  1 26 ? -23.369 7.902  -43.046 1.00 54.14  ? 167 LYS A CB    1 
ATOM   159  C CG    . LYS A  1 26 ? -23.243 7.324  -41.621 1.00 54.24  ? 167 LYS A CG    1 
ATOM   160  N N     . SER A  1 27 ? -24.214 10.420 -44.997 1.00 55.08  ? 168 SER A N     1 
ATOM   161  C CA    . SER A  1 27 ? -24.570 10.622 -46.408 1.00 56.16  ? 168 SER A CA    1 
ATOM   162  C C     . SER A  1 27 ? -25.358 11.897 -46.695 1.00 55.28  ? 168 SER A C     1 
ATOM   163  O O     . SER A  1 27 ? -25.777 12.613 -45.808 1.00 51.99  ? 168 SER A O     1 
ATOM   164  C CB    . SER A  1 27 ? -25.315 9.376  -46.956 1.00 57.24  ? 168 SER A CB    1 
ATOM   165  O OG    . SER A  1 27 ? -26.608 9.256  -46.409 1.00 55.69  ? 168 SER A OG    1 
ATOM   166  N N     . GLY A  1 28 ? -25.541 12.151 -47.987 1.00 59.26  ? 169 GLY A N     1 
ATOM   167  C CA    . GLY A  1 28 ? -26.253 13.320 -48.499 1.00 60.38  ? 169 GLY A CA    1 
ATOM   168  C C     . GLY A  1 28 ? -25.449 14.605 -48.359 1.00 61.91  ? 169 GLY A C     1 
ATOM   169  O O     . GLY A  1 28 ? -24.234 14.588 -48.148 1.00 62.66  ? 169 GLY A O     1 
ATOM   170  N N     . LEU A  1 29 ? -26.156 15.720 -48.458 1.00 63.09  ? 170 LEU A N     1 
ATOM   171  C CA    . LEU A  1 29 ? -25.531 17.039 -48.577 1.00 65.15  ? 170 LEU A CA    1 
ATOM   172  C C     . LEU A  1 29 ? -24.884 17.482 -47.309 1.00 61.77  ? 170 LEU A C     1 
ATOM   173  O O     . LEU A  1 29 ? -23.926 18.262 -47.361 1.00 62.84  ? 170 LEU A O     1 
ATOM   174  C CB    . LEU A  1 29 ? -26.565 18.097 -48.972 1.00 67.42  ? 170 LEU A CB    1 
ATOM   175  C CG    . LEU A  1 29 ? -27.173 17.901 -50.356 1.00 70.77  ? 170 LEU A CG    1 
ATOM   176  C CD1   . LEU A  1 29 ? -28.506 18.658 -50.427 1.00 71.69  ? 170 LEU A CD1   1 
ATOM   177  C CD2   . LEU A  1 29 ? -26.185 18.298 -51.459 1.00 73.77  ? 170 LEU A CD2   1 
ATOM   178  N N     . SER A  1 30 ? -25.408 16.986 -46.183 1.00 56.99  ? 171 SER A N     1 
ATOM   179  C CA    . SER A  1 30 ? -24.906 17.341 -44.859 1.00 54.35  ? 171 SER A CA    1 
ATOM   180  C C     . SER A  1 30 ? -23.824 16.391 -44.302 1.00 53.53  ? 171 SER A C     1 
ATOM   181  O O     . SER A  1 30 ? -23.473 16.532 -43.145 1.00 52.17  ? 171 SER A O     1 
ATOM   182  C CB    . SER A  1 30 ? -26.099 17.435 -43.891 1.00 51.82  ? 171 SER A CB    1 
ATOM   183  O OG    . SER A  1 30 ? -26.961 16.312 -44.045 1.00 50.03  ? 171 SER A OG    1 
ATOM   184  N N     . ALA A  1 31 ? -23.261 15.480 -45.120 1.00 54.32  ? 172 ALA A N     1 
ATOM   185  C CA    . ALA A  1 31 ? -22.332 14.414 -44.656 1.00 53.01  ? 172 ALA A CA    1 
ATOM   186  C C     . ALA A  1 31 ? -21.028 14.934 -44.030 1.00 53.89  ? 172 ALA A C     1 
ATOM   187  O O     . ALA A  1 31 ? -20.394 15.835 -44.558 1.00 53.77  ? 172 ALA A O     1 
ATOM   188  C CB    . ALA A  1 31 ? -21.990 13.452 -45.789 1.00 54.96  ? 172 ALA A CB    1 
ATOM   189  N N     . GLY A  1 32 ? -20.660 14.344 -42.883 1.00 52.94  ? 173 GLY A N     1 
ATOM   190  C CA    . GLY A  1 32 ? -19.475 14.740 -42.102 1.00 54.14  ? 173 GLY A CA    1 
ATOM   191  C C     . GLY A  1 32 ? -19.748 15.692 -40.960 1.00 53.05  ? 173 GLY A C     1 
ATOM   192  O O     . GLY A  1 32 ? -18.964 15.790 -40.026 1.00 53.59  ? 173 GLY A O     1 
ATOM   193  N N     . LYS A  1 33 ? -20.871 16.395 -41.050 1.00 52.85  ? 174 LYS A N     1 
ATOM   194  C CA    . LYS A  1 33 ? -21.402 17.213 -39.954 1.00 51.58  ? 174 LYS A CA    1 
ATOM   195  C C     . LYS A  1 33 ? -21.933 16.228 -38.870 1.00 48.25  ? 174 LYS A C     1 
ATOM   196  O O     . LYS A  1 33 ? -22.229 15.074 -39.189 1.00 46.88  ? 174 LYS A O     1 
ATOM   197  C CB    . LYS A  1 33 ? -22.503 18.154 -40.500 1.00 51.22  ? 174 LYS A CB    1 
ATOM   198  C CG    . LYS A  1 33 ? -22.108 18.940 -41.777 1.00 54.50  ? 174 LYS A CG    1 
ATOM   199  N N     . SER A  1 34 ? -22.036 16.680 -37.623 1.00 45.61  ? 175 SER A N     1 
ATOM   200  C CA    . SER A  1 34 ? -22.523 15.842 -36.513 1.00 43.36  ? 175 SER A CA    1 
ATOM   201  C C     . SER A  1 34 ? -23.790 16.345 -35.817 1.00 40.25  ? 175 SER A C     1 
ATOM   202  O O     . SER A  1 34 ? -24.096 17.513 -35.835 1.00 40.19  ? 175 SER A O     1 
ATOM   203  C CB    . SER A  1 34 ? -21.415 15.642 -35.487 1.00 44.93  ? 175 SER A CB    1 
ATOM   204  O OG    . SER A  1 34 ? -21.204 16.805 -34.732 1.00 45.20  ? 175 SER A OG    1 
ATOM   205  N N     . ASP A  1 35 ? -24.584 15.422 -35.322 1.00 37.13  ? 176 ASP A N     1 
ATOM   206  C CA    . ASP A  1 35 ? -25.686 15.744 -34.502 1.00 35.56  ? 176 ASP A CA    1 
ATOM   207  C C     . ASP A  1 35 ? -25.338 15.223 -33.100 1.00 34.40  ? 176 ASP A C     1 
ATOM   208  O O     . ASP A  1 35 ? -24.729 14.137 -32.924 1.00 34.56  ? 176 ASP A O     1 
ATOM   209  C CB    . ASP A  1 35 ? -26.987 15.137 -35.017 1.00 35.70  ? 176 ASP A CB    1 
ATOM   210  C CG    . ASP A  1 35 ? -27.285 15.508 -36.497 1.00 37.22  ? 176 ASP A CG    1 
ATOM   211  O OD1   . ASP A  1 35 ? -26.777 14.796 -37.342 1.00 37.66  ? 176 ASP A OD1   1 
ATOM   212  O OD2   . ASP A  1 35 ? -28.032 16.480 -36.817 1.00 37.01  ? 176 ASP A OD2   1 
ATOM   213  N N     . VAL A  1 36 ? -25.714 16.009 -32.101 1.00 32.98  ? 177 VAL A N     1 
ATOM   214  C CA    . VAL A  1 36 ? -25.538 15.613 -30.672 1.00 33.17  ? 177 VAL A CA    1 
ATOM   215  C C     . VAL A  1 36 ? -26.888 15.274 -30.090 1.00 31.63  ? 177 VAL A C     1 
ATOM   216  O O     . VAL A  1 36 ? -27.833 16.037 -30.207 1.00 31.87  ? 177 VAL A O     1 
ATOM   217  C CB    . VAL A  1 36 ? -24.885 16.740 -29.879 1.00 33.53  ? 177 VAL A CB    1 
ATOM   218  C CG1   . VAL A  1 36 ? -24.774 16.390 -28.397 1.00 34.73  ? 177 VAL A CG1   1 
ATOM   219  C CG2   . VAL A  1 36 ? -23.507 17.034 -30.461 1.00 35.46  ? 177 VAL A CG2   1 
ATOM   220  N N     . TYR A  1 37 ? -26.998 14.096 -29.510 1.00 32.32  ? 178 TYR A N     1 
ATOM   221  C CA    . TYR A  1 37 ? -28.226 13.709 -28.838 1.00 32.70  ? 178 TYR A CA    1 
ATOM   222  C C     . TYR A  1 37 ? -27.912 13.514 -27.366 1.00 33.61  ? 178 TYR A C     1 
ATOM   223  O O     . TYR A  1 37 ? -26.780 13.196 -27.032 1.00 35.70  ? 178 TYR A O     1 
ATOM   224  C CB    . TYR A  1 37 ? -28.813 12.440 -29.464 1.00 32.96  ? 178 TYR A CB    1 
ATOM   225  C CG    . TYR A  1 37 ? -28.982 12.535 -30.964 1.00 32.27  ? 178 TYR A CG    1 
ATOM   226  C CD1   . TYR A  1 37 ? -29.742 13.548 -31.504 1.00 32.70  ? 178 TYR A CD1   1 
ATOM   227  C CD2   . TYR A  1 37 ? -28.408 11.612 -31.828 1.00 32.89  ? 178 TYR A CD2   1 
ATOM   228  C CE1   . TYR A  1 37 ? -29.946 13.662 -32.868 1.00 33.61  ? 178 TYR A CE1   1 
ATOM   229  C CE2   . TYR A  1 37 ? -28.599 11.699 -33.220 1.00 33.52  ? 178 TYR A CE2   1 
ATOM   230  C CZ    . TYR A  1 37 ? -29.369 12.759 -33.735 1.00 34.19  ? 178 TYR A CZ    1 
ATOM   231  O OH    . TYR A  1 37 ? -29.612 12.975 -35.079 1.00 35.54  ? 178 TYR A OH    1 
ATOM   232  N N     . TYR A  1 38 ? -28.890 13.756 -26.495 1.00 34.65  ? 179 TYR A N     1 
ATOM   233  C CA    . TYR A  1 38 ? -28.786 13.392 -25.078 1.00 36.29  ? 179 TYR A CA    1 
ATOM   234  C C     . TYR A  1 38 ? -29.876 12.364 -24.782 1.00 37.84  ? 179 TYR A C     1 
ATOM   235  O O     . TYR A  1 38 ? -30.968 12.402 -25.403 1.00 36.36  ? 179 TYR A O     1 
ATOM   236  C CB    . TYR A  1 38 ? -28.967 14.614 -24.169 1.00 36.16  ? 179 TYR A CB    1 
ATOM   237  C CG    . TYR A  1 38 ? -27.750 15.507 -24.191 1.00 36.80  ? 179 TYR A CG    1 
ATOM   238  C CD1   . TYR A  1 38 ? -27.634 16.494 -25.135 1.00 36.88  ? 179 TYR A CD1   1 
ATOM   239  C CD2   . TYR A  1 38 ? -26.715 15.376 -23.277 1.00 38.67  ? 179 TYR A CD2   1 
ATOM   240  C CE1   . TYR A  1 38 ? -26.523 17.306 -25.212 1.00 36.99  ? 179 TYR A CE1   1 
ATOM   241  C CE2   . TYR A  1 38 ? -25.572 16.201 -23.369 1.00 39.31  ? 179 TYR A CE2   1 
ATOM   242  C CZ    . TYR A  1 38 ? -25.503 17.133 -24.373 1.00 38.01  ? 179 TYR A CZ    1 
ATOM   243  O OH    . TYR A  1 38 ? -24.461 17.980 -24.535 1.00 41.38  ? 179 TYR A OH    1 
ATOM   244  N N     . PHE A  1 39 ? -29.576 11.468 -23.839 1.00 37.90  ? 180 PHE A N     1 
ATOM   245  C CA    . PHE A  1 39 ? -30.529 10.460 -23.384 1.00 39.80  ? 180 PHE A CA    1 
ATOM   246  C C     . PHE A  1 39 ? -30.752 10.574 -21.879 1.00 40.45  ? 180 PHE A C     1 
ATOM   247  O O     . PHE A  1 39 ? -29.801 10.748 -21.137 1.00 41.05  ? 180 PHE A O     1 
ATOM   248  C CB    . PHE A  1 39 ? -30.014 9.063  -23.715 1.00 41.47  ? 180 PHE A CB    1 
ATOM   249  C CG    . PHE A  1 39 ? -29.901 8.816  -25.181 1.00 40.80  ? 180 PHE A CG    1 
ATOM   250  C CD1   . PHE A  1 39 ? -28.769 9.202  -25.859 1.00 39.37  ? 180 PHE A CD1   1 
ATOM   251  C CD2   . PHE A  1 39 ? -30.959 8.267  -25.886 1.00 40.80  ? 180 PHE A CD2   1 
ATOM   252  C CE1   . PHE A  1 39 ? -28.663 9.013  -27.207 1.00 38.55  ? 180 PHE A CE1   1 
ATOM   253  C CE2   . PHE A  1 39 ? -30.860 8.049  -27.237 1.00 39.75  ? 180 PHE A CE2   1 
ATOM   254  C CZ    . PHE A  1 39 ? -29.706 8.412  -27.898 1.00 38.54  ? 180 PHE A CZ    1 
ATOM   255  N N     . SER A  1 40 ? -32.002 10.482 -21.444 1.00 39.60  ? 181 SER A N     1 
ATOM   256  C CA    . SER A  1 40 ? -32.350 10.540 -19.999 1.00 41.45  ? 181 SER A CA    1 
ATOM   257  C C     . SER A  1 40 ? -31.998 9.234  -19.323 1.00 43.44  ? 181 SER A C     1 
ATOM   258  O O     . SER A  1 40 ? -31.694 8.232  -20.012 1.00 43.48  ? 181 SER A O     1 
ATOM   259  C CB    . SER A  1 40 ? -33.837 10.819 -19.806 1.00 40.30  ? 181 SER A CB    1 
ATOM   260  O OG    . SER A  1 40 ? -34.622 9.668  -20.111 1.00 42.49  ? 181 SER A OG    1 
ATOM   261  N N     . PRO A  1 41 ? -32.077 9.218  -17.979 1.00 45.70  ? 182 PRO A N     1 
ATOM   262  C CA    . PRO A  1 41 ? -31.807 7.939  -17.367 1.00 48.40  ? 182 PRO A CA    1 
ATOM   263  C C     . PRO A  1 41 ? -32.859 6.935  -17.815 1.00 50.98  ? 182 PRO A C     1 
ATOM   264  O O     . PRO A  1 41 ? -32.504 5.765  -18.043 1.00 51.50  ? 182 PRO A O     1 
ATOM   265  C CB    . PRO A  1 41 ? -31.833 8.220  -15.855 1.00 49.80  ? 182 PRO A CB    1 
ATOM   266  C CG    . PRO A  1 41 ? -32.200 9.650  -15.672 1.00 47.70  ? 182 PRO A CG    1 
ATOM   267  C CD    . PRO A  1 41 ? -32.129 10.322 -17.002 1.00 45.58  ? 182 PRO A CD    1 
ATOM   268  N N     . SER A  1 42 ? -34.110 7.384  -17.980 1.00 53.70  ? 183 SER A N     1 
ATOM   269  C CA    . SER A  1 42 ? -35.182 6.527  -18.586 1.00 57.56  ? 183 SER A CA    1 
ATOM   270  C C     . SER A  1 42 ? -34.713 5.892  -19.936 1.00 56.85  ? 183 SER A C     1 
ATOM   271  O O     . SER A  1 42 ? -34.855 4.682  -20.135 1.00 60.34  ? 183 SER A O     1 
ATOM   272  C CB    . SER A  1 42 ? -36.494 7.319  -18.767 1.00 57.24  ? 183 SER A CB    1 
ATOM   273  N N     . GLY A  1 43 ? -34.088 6.690  -20.807 1.00 52.62  ? 184 GLY A N     1 
ATOM   274  C CA    . GLY A  1 43 ? -33.730 6.278  -22.209 1.00 51.28  ? 184 GLY A CA    1 
ATOM   275  C C     . GLY A  1 43 ? -34.276 7.177  -23.356 1.00 47.65  ? 184 GLY A C     1 
ATOM   276  O O     . GLY A  1 43 ? -33.983 6.952  -24.507 1.00 46.33  ? 184 GLY A O     1 
ATOM   277  N N     . LYS A  1 44 ? -35.059 8.197  -23.000 1.00 46.27  ? 185 LYS A N     1 
ATOM   278  C CA    . LYS A  1 44 ? -35.662 9.188  -23.877 1.00 43.99  ? 185 LYS A CA    1 
ATOM   279  C C     . LYS A  1 44 ? -34.603 10.080 -24.542 1.00 40.53  ? 185 LYS A C     1 
ATOM   280  O O     . LYS A  1 44 ? -33.634 10.520 -23.926 1.00 36.99  ? 185 LYS A O     1 
ATOM   281  C CB    . LYS A  1 44 ? -36.670 10.050 -23.043 1.00 45.72  ? 185 LYS A CB    1 
ATOM   282  C CG    . LYS A  1 44 ? -37.850 10.687 -23.795 1.00 47.65  ? 185 LYS A CG    1 
ATOM   283  N N     . LYS A  1 45 ? -34.847 10.415 -25.795 1.00 39.08  ? 186 LYS A N     1 
ATOM   284  C CA    . LYS A  1 45 ? -33.853 11.034 -26.635 1.00 37.97  ? 186 LYS A CA    1 
ATOM   285  C C     . LYS A  1 45 ? -34.199 12.498 -26.754 1.00 36.15  ? 186 LYS A C     1 
ATOM   286  O O     . LYS A  1 45 ? -35.331 12.783 -26.984 1.00 35.55  ? 186 LYS A O     1 
ATOM   287  C CB    . LYS A  1 45 ? -33.888 10.352 -27.997 1.00 38.76  ? 186 LYS A CB    1 
ATOM   288  C CG    . LYS A  1 45 ? -32.763 10.712 -28.933 1.00 36.74  ? 186 LYS A CG    1 
ATOM   289  C CD    . LYS A  1 45 ? -32.928 9.940  -30.247 1.00 36.86  ? 186 LYS A CD    1 
ATOM   290  C CE    . LYS A  1 45 ? -32.149 10.627 -31.355 1.00 35.23  ? 186 LYS A CE    1 
ATOM   291  N NZ    . LYS A  1 45 ? -31.995 9.655  -32.419 1.00 36.62  ? 186 LYS A NZ    1 
ATOM   292  N N     . PHE A  1 46 ? -33.227 13.386 -26.551 1.00 33.42  ? 187 PHE A N     1 
ATOM   293  C CA    . PHE A  1 46 ? -33.397 14.824 -26.708 1.00 33.27  ? 187 PHE A CA    1 
ATOM   294  C C     . PHE A  1 46 ? -32.419 15.293 -27.790 1.00 33.04  ? 187 PHE A C     1 
ATOM   295  O O     . PHE A  1 46 ? -31.296 14.817 -27.843 1.00 33.30  ? 187 PHE A O     1 
ATOM   296  C CB    . PHE A  1 46 ? -33.133 15.557 -25.374 1.00 34.55  ? 187 PHE A CB    1 
ATOM   297  C CG    . PHE A  1 46 ? -34.070 15.119 -24.276 1.00 35.70  ? 187 PHE A CG    1 
ATOM   298  C CD1   . PHE A  1 46 ? -33.802 13.992 -23.542 1.00 35.79  ? 187 PHE A CD1   1 
ATOM   299  C CD2   . PHE A  1 46 ? -35.273 15.768 -24.087 1.00 36.27  ? 187 PHE A CD2   1 
ATOM   300  C CE1   . PHE A  1 46 ? -34.700 13.548 -22.582 1.00 38.10  ? 187 PHE A CE1   1 
ATOM   301  C CE2   . PHE A  1 46 ? -36.192 15.312 -23.181 1.00 37.71  ? 187 PHE A CE2   1 
ATOM   302  C CZ    . PHE A  1 46 ? -35.906 14.212 -22.409 1.00 39.27  ? 187 PHE A CZ    1 
ATOM   303  N N     . ARG A  1 47 ? -32.867 16.216 -28.638 1.00 32.46  ? 188 ARG A N     1 
ATOM   304  C CA    . ARG A  1 47 ? -32.121 16.656 -29.809 1.00 32.90  ? 188 ARG A CA    1 
ATOM   305  C C     . ARG A  1 47 ? -31.801 18.118 -29.822 1.00 34.09  ? 188 ARG A C     1 
ATOM   306  O O     . ARG A  1 47 ? -31.192 18.570 -30.785 1.00 37.37  ? 188 ARG A O     1 
ATOM   307  C CB    . ARG A  1 47 ? -32.955 16.397 -31.060 1.00 32.37  ? 188 ARG A CB    1 
ATOM   308  C CG    . ARG A  1 47 ? -33.285 14.950 -31.316 1.00 32.21  ? 188 ARG A CG    1 
ATOM   309  C CD    . ARG A  1 47 ? -33.880 14.744 -32.728 1.00 33.27  ? 188 ARG A CD    1 
ATOM   310  N NE    . ARG A  1 47 ? -34.586 13.454 -32.858 1.00 32.60  ? 188 ARG A NE    1 
ATOM   311  C CZ    . ARG A  1 47 ? -34.886 12.846 -34.010 1.00 33.40  ? 188 ARG A CZ    1 
ATOM   312  N NH1   . ARG A  1 47 ? -34.545 13.369 -35.177 1.00 32.11  ? 188 ARG A NH1   1 
ATOM   313  N NH2   . ARG A  1 47 ? -35.526 11.674 -33.991 1.00 34.54  ? 188 ARG A NH2   1 
ATOM   314  N N     . SER A  1 48 ? -32.206 18.863 -28.807 1.00 32.67  ? 189 SER A N     1 
ATOM   315  C CA    . SER A  1 48 ? -31.813 20.281 -28.695 1.00 34.08  ? 189 SER A CA    1 
ATOM   316  C C     . SER A  1 48 ? -31.883 20.773 -27.219 1.00 36.10  ? 189 SER A C     1 
ATOM   317  O O     . SER A  1 48 ? -32.594 20.180 -26.347 1.00 33.95  ? 189 SER A O     1 
ATOM   318  C CB    . SER A  1 48 ? -32.776 21.168 -29.482 1.00 33.73  ? 189 SER A CB    1 
ATOM   319  O OG    . SER A  1 48 ? -34.106 21.161 -28.857 1.00 34.65  ? 189 SER A OG    1 
ATOM   320  N N     . LYS A  1 49 ? -31.241 21.902 -26.996 1.00 36.82  ? 190 LYS A N     1 
ATOM   321  C CA    . LYS A  1 49 ? -31.229 22.538 -25.697 1.00 39.76  ? 190 LYS A CA    1 
ATOM   322  C C     . LYS A  1 49 ? -32.612 22.915 -25.201 1.00 41.39  ? 190 LYS A C     1 
ATOM   323  O O     . LYS A  1 49 ? -32.905 22.676 -24.009 1.00 42.01  ? 190 LYS A O     1 
ATOM   324  C CB    . LYS A  1 49 ? -30.321 23.779 -25.720 1.00 42.27  ? 190 LYS A CB    1 
ATOM   325  C CG    . LYS A  1 49 ? -30.094 24.433 -24.369 1.00 43.35  ? 190 LYS A CG    1 
ATOM   326  C CD    . LYS A  1 49 ? -29.036 25.523 -24.481 1.00 45.01  ? 190 LYS A CD    1 
ATOM   327  C CE    . LYS A  1 49 ? -28.705 26.040 -23.107 1.00 47.36  ? 190 LYS A CE    1 
ATOM   328  N NZ    . LYS A  1 49 ? -27.734 27.180 -23.189 1.00 50.64  ? 190 LYS A NZ    1 
ATOM   329  N N     . PRO A  1 50 ? -33.441 23.551 -26.064 1.00 40.95  ? 191 PRO A N     1 
ATOM   330  C CA    . PRO A  1 50 ? -34.752 23.918 -25.503 1.00 41.97  ? 191 PRO A CA    1 
ATOM   331  C C     . PRO A  1 50 ? -35.646 22.719 -25.243 1.00 42.02  ? 191 PRO A C     1 
ATOM   332  O O     . PRO A  1 50 ? -36.532 22.810 -24.373 1.00 42.16  ? 191 PRO A O     1 
ATOM   333  C CB    . PRO A  1 50 ? -35.380 24.852 -26.529 1.00 42.32  ? 191 PRO A CB    1 
ATOM   334  C CG    . PRO A  1 50 ? -34.281 25.238 -27.429 1.00 43.37  ? 191 PRO A CG    1 
ATOM   335  C CD    . PRO A  1 50 ? -33.146 24.271 -27.313 1.00 41.02  ? 191 PRO A CD    1 
ATOM   336  N N     . GLN A  1 51 ? -35.409 21.607 -25.941 1.00 40.52  ? 192 GLN A N     1 
ATOM   337  C CA    . GLN A  1 51 ? -36.170 20.392 -25.659 1.00 41.40  ? 192 GLN A CA    1 
ATOM   338  C C     . GLN A  1 51 ? -35.749 19.882 -24.279 1.00 42.63  ? 192 GLN A C     1 
ATOM   339  O O     . GLN A  1 51 ? -36.563 19.477 -23.456 1.00 38.66  ? 192 GLN A O     1 
ATOM   340  C CB    . GLN A  1 51 ? -35.907 19.344 -26.731 1.00 42.93  ? 192 GLN A CB    1 
ATOM   341  C CG    . GLN A  1 51 ? -36.937 18.238 -26.904 1.00 45.33  ? 192 GLN A CG    1 
ATOM   342  C CD    . GLN A  1 51 ? -36.474 17.174 -27.934 1.00 47.65  ? 192 GLN A CD    1 
ATOM   343  O OE1   . GLN A  1 51 ? -35.510 17.390 -28.692 1.00 44.16  ? 192 GLN A OE1   1 
ATOM   344  N NE2   . GLN A  1 51 ? -37.146 15.998 -27.934 1.00 47.22  ? 192 GLN A NE2   1 
ATOM   345  N N     . LEU A  1 52 ? -34.448 19.941 -24.050 1.00 41.29  ? 193 LEU A N     1 
ATOM   346  C CA    . LEU A  1 52 ? -33.867 19.498 -22.830 1.00 42.74  ? 193 LEU A CA    1 
ATOM   347  C C     . LEU A  1 52 ? -34.359 20.341 -21.667 1.00 43.94  ? 193 LEU A C     1 
ATOM   348  O O     . LEU A  1 52 ? -34.620 19.803 -20.619 1.00 42.63  ? 193 LEU A O     1 
ATOM   349  C CB    . LEU A  1 52 ? -32.349 19.580 -22.940 1.00 43.03  ? 193 LEU A CB    1 
ATOM   350  C CG    . LEU A  1 52 ? -31.455 18.804 -22.013 1.00 44.40  ? 193 LEU A CG    1 
ATOM   351  C CD1   . LEU A  1 52 ? -31.766 17.331 -22.133 1.00 45.18  ? 193 LEU A CD1   1 
ATOM   352  C CD2   . LEU A  1 52 ? -30.007 19.061 -22.425 1.00 44.91  ? 193 LEU A CD2   1 
ATOM   353  N N     . ALA A  1 53 ? -34.471 21.656 -21.864 1.00 45.25  ? 194 ALA A N     1 
ATOM   354  C CA    . ALA A  1 53 ? -34.940 22.566 -20.801 1.00 45.87  ? 194 ALA A CA    1 
ATOM   355  C C     . ALA A  1 53 ? -36.437 22.416 -20.449 1.00 46.93  ? 194 ALA A C     1 
ATOM   356  O O     . ALA A  1 53 ? -36.841 22.522 -19.243 1.00 48.62  ? 194 ALA A O     1 
ATOM   357  C CB    . ALA A  1 53 ? -34.630 24.004 -21.158 1.00 46.04  ? 194 ALA A CB    1 
ATOM   358  N N     . ARG A  1 54 ? -37.239 22.160 -21.475 1.00 46.09  ? 195 ARG A N     1 
ATOM   359  C CA    . ARG A  1 54 ? -38.674 21.912 -21.318 1.00 48.06  ? 195 ARG A CA    1 
ATOM   360  C C     . ARG A  1 54 ? -38.878 20.704 -20.447 1.00 46.89  ? 195 ARG A C     1 
ATOM   361  O O     . ARG A  1 54 ? -39.681 20.755 -19.518 1.00 49.79  ? 195 ARG A O     1 
ATOM   362  C CB    . ARG A  1 54 ? -39.382 21.706 -22.664 1.00 50.55  ? 195 ARG A CB    1 
ATOM   363  C CG    . ARG A  1 54 ? -39.570 22.999 -23.456 1.00 54.37  ? 195 ARG A CG    1 
ATOM   364  C CD    . ARG A  1 54 ? -40.544 22.858 -24.648 1.00 57.05  ? 195 ARG A CD    1 
ATOM   365  N NE    . ARG A  1 54 ? -40.220 21.798 -25.622 1.00 54.65  ? 195 ARG A NE    1 
ATOM   366  C CZ    . ARG A  1 54 ? -39.479 21.939 -26.720 1.00 55.08  ? 195 ARG A CZ    1 
ATOM   367  N NH1   . ARG A  1 54 ? -38.906 23.107 -27.025 1.00 54.70  ? 195 ARG A NH1   1 
ATOM   368  N NH2   . ARG A  1 54 ? -39.288 20.877 -27.528 1.00 54.67  ? 195 ARG A NH2   1 
ATOM   369  N N     . TYR A  1 55 ? -38.119 19.632 -20.687 1.00 42.56  ? 196 TYR A N     1 
ATOM   370  C CA    . TYR A  1 55 ? -38.239 18.401 -19.846 1.00 41.39  ? 196 TYR A CA    1 
ATOM   371  C C     . TYR A  1 55 ? -37.687 18.618 -18.415 1.00 41.08  ? 196 TYR A C     1 
ATOM   372  O O     . TYR A  1 55 ? -38.326 18.238 -17.442 1.00 43.65  ? 196 TYR A O     1 
ATOM   373  C CB    . TYR A  1 55 ? -37.571 17.235 -20.546 1.00 38.92  ? 196 TYR A CB    1 
ATOM   374  C CG    . TYR A  1 55 ? -37.641 15.905 -19.886 1.00 38.85  ? 196 TYR A CG    1 
ATOM   375  C CD1   . TYR A  1 55 ? -38.715 15.087 -20.061 1.00 41.32  ? 196 TYR A CD1   1 
ATOM   376  C CD2   . TYR A  1 55 ? -36.561 15.424 -19.136 1.00 38.79  ? 196 TYR A CD2   1 
ATOM   377  C CE1   . TYR A  1 55 ? -38.791 13.828 -19.399 1.00 43.13  ? 196 TYR A CE1   1 
ATOM   378  C CE2   . TYR A  1 55 ? -36.605 14.193 -18.503 1.00 40.50  ? 196 TYR A CE2   1 
ATOM   379  C CZ    . TYR A  1 55 ? -37.708 13.384 -18.651 1.00 42.87  ? 196 TYR A CZ    1 
ATOM   380  O OH    . TYR A  1 55 ? -37.731 12.160 -18.032 1.00 45.84  ? 196 TYR A OH    1 
ATOM   381  N N     . LEU A  1 56 ? -36.510 19.215 -18.279 1.00 39.92  ? 197 LEU A N     1 
ATOM   382  C CA    . LEU A  1 56 ? -35.853 19.309 -16.937 1.00 41.57  ? 197 LEU A CA    1 
ATOM   383  C C     . LEU A  1 56 ? -36.429 20.397 -16.046 1.00 42.81  ? 197 LEU A C     1 
ATOM   384  O O     . LEU A  1 56 ? -36.457 20.247 -14.826 1.00 44.78  ? 197 LEU A O     1 
ATOM   385  C CB    . LEU A  1 56 ? -34.324 19.485 -17.056 1.00 40.23  ? 197 LEU A CB    1 
ATOM   386  C CG    . LEU A  1 56 ? -33.549 18.189 -17.363 1.00 38.63  ? 197 LEU A CG    1 
ATOM   387  C CD1   . LEU A  1 56 ? -32.166 18.465 -17.913 1.00 37.22  ? 197 LEU A CD1   1 
ATOM   388  C CD2   . LEU A  1 56 ? -33.392 17.396 -16.106 1.00 39.26  ? 197 LEU A CD2   1 
ATOM   389  N N     . GLY A  1 57 ? -36.828 21.502 -16.677 1.00 42.01  ? 198 GLY A N     1 
ATOM   390  C CA    . GLY A  1 57 ? -37.403 22.637 -16.006 1.00 43.27  ? 198 GLY A CA    1 
ATOM   391  C C     . GLY A  1 57 ? -36.420 23.203 -14.999 1.00 44.27  ? 198 GLY A C     1 
ATOM   392  O O     . GLY A  1 57 ? -35.227 23.325 -15.295 1.00 42.35  ? 198 GLY A O     1 
ATOM   393  N N     . ASN A  1 58 ? -36.913 23.471 -13.785 1.00 44.70  ? 199 ASN A N     1 
ATOM   394  C CA    . ASN A  1 58 ? -36.115 24.181 -12.840 1.00 46.61  ? 199 ASN A CA    1 
ATOM   395  C C     . ASN A  1 58 ? -35.283 23.247 -11.959 1.00 47.06  ? 199 ASN A C     1 
ATOM   396  O O     . ASN A  1 58 ? -34.731 23.666 -10.968 1.00 46.96  ? 199 ASN A O     1 
ATOM   397  C CB    . ASN A  1 58 ? -36.962 25.182 -12.063 1.00 48.52  ? 199 ASN A CB    1 
ATOM   398  C CG    . ASN A  1 58 ? -37.935 24.522 -11.094 1.00 50.37  ? 199 ASN A CG    1 
ATOM   399  O OD1   . ASN A  1 58 ? -37.966 23.293 -10.929 1.00 49.36  ? 199 ASN A OD1   1 
ATOM   400  N ND2   . ASN A  1 58 ? -38.717 25.350 -10.425 1.00 52.81  ? 199 ASN A ND2   1 
ATOM   401  N N     . THR A  1 59 ? -35.130 21.991 -12.371 1.00 47.36  ? 200 THR A N     1 
ATOM   402  C CA    . THR A  1 59 ? -34.261 21.093 -11.648 1.00 47.98  ? 200 THR A CA    1 
ATOM   403  C C     . THR A  1 59 ? -32.789 21.275 -12.027 1.00 47.32  ? 200 THR A C     1 
ATOM   404  O O     . THR A  1 59 ? -31.913 20.808 -11.326 1.00 46.86  ? 200 THR A O     1 
ATOM   405  C CB    . THR A  1 59 ? -34.676 19.653 -11.880 1.00 46.98  ? 200 THR A CB    1 
ATOM   406  O OG1   . THR A  1 59 ? -34.607 19.386 -13.272 1.00 45.75  ? 200 THR A OG1   1 
ATOM   407  C CG2   . THR A  1 59 ? -36.104 19.450 -11.399 1.00 48.53  ? 200 THR A CG2   1 
ATOM   408  N N     . VAL A  1 60 ? -32.513 21.942 -13.137 1.00 49.74  ? 201 VAL A N     1 
ATOM   409  C CA    . VAL A  1 60 ? -31.134 22.090 -13.606 1.00 51.10  ? 201 VAL A CA    1 
ATOM   410  C C     . VAL A  1 60 ? -31.069 23.411 -14.310 1.00 53.05  ? 201 VAL A C     1 
ATOM   411  O O     . VAL A  1 60 ? -31.919 23.687 -15.155 1.00 54.10  ? 201 VAL A O     1 
ATOM   412  C CB    . VAL A  1 60 ? -30.743 20.989 -14.630 1.00 49.78  ? 201 VAL A CB    1 
ATOM   413  C CG1   . VAL A  1 60 ? -29.257 21.042 -14.973 1.00 50.17  ? 201 VAL A CG1   1 
ATOM   414  C CG2   . VAL A  1 60 ? -31.048 19.607 -14.089 1.00 49.97  ? 201 VAL A CG2   1 
ATOM   415  N N     . ASP A  1 61 ? -30.053 24.210 -13.992 1.00 54.74  ? 202 ASP A N     1 
ATOM   416  C CA    . ASP A  1 61 ? -29.829 25.489 -14.671 1.00 55.98  ? 202 ASP A CA    1 
ATOM   417  C C     . ASP A  1 61 ? -29.054 25.277 -15.981 1.00 52.82  ? 202 ASP A C     1 
ATOM   418  O O     . ASP A  1 61 ? -27.870 25.006 -15.984 1.00 54.36  ? 202 ASP A O     1 
ATOM   419  C CB    . ASP A  1 61 ? -29.064 26.453 -13.755 1.00 59.03  ? 202 ASP A CB    1 
ATOM   420  C CG    . ASP A  1 61 ? -28.973 27.881 -14.332 1.00 62.77  ? 202 ASP A CG    1 
ATOM   421  O OD1   . ASP A  1 61 ? -29.176 28.080 -15.556 1.00 61.92  ? 202 ASP A OD1   1 
ATOM   422  O OD2   . ASP A  1 61 ? -28.677 28.820 -13.546 1.00 67.93  ? 202 ASP A OD2   1 
ATOM   423  N N     . LEU A  1 62 ? -29.715 25.441 -17.096 1.00 51.98  ? 203 LEU A N     1 
ATOM   424  C CA    . LEU A  1 62 ? -29.061 25.218 -18.373 1.00 51.45  ? 203 LEU A CA    1 
ATOM   425  C C     . LEU A  1 62 ? -28.634 26.517 -19.066 1.00 52.93  ? 203 LEU A C     1 
ATOM   426  O O     . LEU A  1 62 ? -28.249 26.479 -20.238 1.00 51.93  ? 203 LEU A O     1 
ATOM   427  C CB    . LEU A  1 62 ? -30.009 24.421 -19.297 1.00 48.78  ? 203 LEU A CB    1 
ATOM   428  C CG    . LEU A  1 62 ? -30.267 22.990 -18.892 1.00 47.83  ? 203 LEU A CG    1 
ATOM   429  C CD1   . LEU A  1 62 ? -31.277 22.363 -19.827 1.00 47.77  ? 203 LEU A CD1   1 
ATOM   430  C CD2   . LEU A  1 62 ? -29.001 22.163 -18.916 1.00 48.61  ? 203 LEU A CD2   1 
ATOM   431  N N     . SER A  1 63 ? -28.696 27.659 -18.377 1.00 54.27  ? 204 SER A N     1 
ATOM   432  C CA    . SER A  1 63 ? -28.434 28.949 -19.045 1.00 56.74  ? 204 SER A CA    1 
ATOM   433  C C     . SER A  1 63 ? -27.061 28.985 -19.726 1.00 56.75  ? 204 SER A C     1 
ATOM   434  O O     . SER A  1 63 ? -26.923 29.582 -20.816 1.00 56.58  ? 204 SER A O     1 
ATOM   435  C CB    . SER A  1 63 ? -28.583 30.139 -18.080 1.00 59.46  ? 204 SER A CB    1 
ATOM   436  O OG    . SER A  1 63 ? -27.620 30.073 -17.038 1.00 61.26  ? 204 SER A OG    1 
ATOM   437  N N     . SER A  1 64 ? -26.072 28.327 -19.109 1.00 56.53  ? 205 SER A N     1 
ATOM   438  C CA    . SER A  1 64 ? -24.670 28.379 -19.580 1.00 58.71  ? 205 SER A CA    1 
ATOM   439  C C     . SER A  1 64 ? -24.184 27.067 -20.197 1.00 54.28  ? 205 SER A C     1 
ATOM   440  O O     . SER A  1 64 ? -22.998 26.921 -20.494 1.00 55.01  ? 205 SER A O     1 
ATOM   441  C CB    . SER A  1 64 ? -23.766 28.756 -18.405 1.00 62.92  ? 205 SER A CB    1 
ATOM   442  O OG    . SER A  1 64 ? -23.751 27.681 -17.473 1.00 64.18  ? 205 SER A OG    1 
ATOM   443  N N     . PHE A  1 65 ? -25.124 26.146 -20.416 1.00 49.75  ? 206 PHE A N     1 
ATOM   444  C CA    . PHE A  1 65 ? -24.862 24.771 -20.889 1.00 46.05  ? 206 PHE A CA    1 
ATOM   445  C C     . PHE A  1 65 ? -24.700 24.783 -22.405 1.00 44.53  ? 206 PHE A C     1 
ATOM   446  O O     . PHE A  1 65 ? -25.584 25.219 -23.121 1.00 41.87  ? 206 PHE A O     1 
ATOM   447  C CB    . PHE A  1 65 ? -26.036 23.864 -20.483 1.00 43.98  ? 206 PHE A CB    1 
ATOM   448  C CG    . PHE A  1 65 ? -25.857 22.434 -20.836 1.00 42.03  ? 206 PHE A CG    1 
ATOM   449  C CD1   . PHE A  1 65 ? -24.907 21.656 -20.173 1.00 42.09  ? 206 PHE A CD1   1 
ATOM   450  C CD2   . PHE A  1 65 ? -26.647 21.851 -21.818 1.00 39.63  ? 206 PHE A CD2   1 
ATOM   451  C CE1   . PHE A  1 65 ? -24.742 20.323 -20.519 1.00 42.36  ? 206 PHE A CE1   1 
ATOM   452  C CE2   . PHE A  1 65 ? -26.498 20.512 -22.165 1.00 39.02  ? 206 PHE A CE2   1 
ATOM   453  C CZ    . PHE A  1 65 ? -25.549 19.743 -21.540 1.00 40.61  ? 206 PHE A CZ    1 
ATOM   454  N N     . ASP A  1 66 ? -23.543 24.337 -22.882 1.00 44.97  ? 207 ASP A N     1 
ATOM   455  C CA    . ASP A  1 66 ? -23.260 24.286 -24.325 1.00 44.02  ? 207 ASP A CA    1 
ATOM   456  C C     . ASP A  1 66 ? -23.723 22.926 -24.821 1.00 40.57  ? 207 ASP A C     1 
ATOM   457  O O     . ASP A  1 66 ? -23.042 21.907 -24.595 1.00 38.31  ? 207 ASP A O     1 
ATOM   458  C CB    . ASP A  1 66 ? -21.748 24.455 -24.586 1.00 45.98  ? 207 ASP A CB    1 
ATOM   459  C CG    . ASP A  1 66 ? -21.382 24.385 -26.077 1.00 45.52  ? 207 ASP A CG    1 
ATOM   460  O OD1   . ASP A  1 66 ? -20.484 25.055 -26.486 1.00 49.11  ? 207 ASP A OD1   1 
ATOM   461  O OD2   . ASP A  1 66 ? -21.942 23.657 -26.861 1.00 44.15  ? 207 ASP A OD2   1 
ATOM   462  N N     . PHE A  1 67 ? -24.879 22.917 -25.472 1.00 39.80  ? 208 PHE A N     1 
ATOM   463  C CA    . PHE A  1 67 ? -25.454 21.661 -25.993 1.00 39.28  ? 208 PHE A CA    1 
ATOM   464  C C     . PHE A  1 67 ? -24.438 20.796 -26.757 1.00 40.28  ? 208 PHE A C     1 
ATOM   465  O O     . PHE A  1 67 ? -24.384 19.593 -26.520 1.00 39.94  ? 208 PHE A O     1 
ATOM   466  C CB    . PHE A  1 67 ? -26.695 21.927 -26.846 1.00 36.83  ? 208 PHE A CB    1 
ATOM   467  C CG    . PHE A  1 67 ? -27.508 20.699 -27.120 1.00 35.91  ? 208 PHE A CG    1 
ATOM   468  C CD1   . PHE A  1 67 ? -28.439 20.244 -26.214 1.00 35.50  ? 208 PHE A CD1   1 
ATOM   469  C CD2   . PHE A  1 67 ? -27.410 20.034 -28.342 1.00 37.48  ? 208 PHE A CD2   1 
ATOM   470  C CE1   . PHE A  1 67 ? -29.245 19.114 -26.471 1.00 33.84  ? 208 PHE A CE1   1 
ATOM   471  C CE2   . PHE A  1 67 ? -28.218 18.896 -28.599 1.00 37.76  ? 208 PHE A CE2   1 
ATOM   472  C CZ    . PHE A  1 67 ? -29.147 18.449 -27.641 1.00 33.45  ? 208 PHE A CZ    1 
ATOM   473  N N     . ARG A  1 68 ? -23.605 21.394 -27.617 1.00 43.58  ? 209 ARG A N     1 
ATOM   474  C CA    . ARG A  1 68 ? -22.717 20.574 -28.463 1.00 46.50  ? 209 ARG A CA    1 
ATOM   475  C C     . ARG A  1 68 ? -21.660 19.787 -27.708 1.00 45.73  ? 209 ARG A C     1 
ATOM   476  O O     . ARG A  1 68 ? -21.407 18.604 -27.997 1.00 45.51  ? 209 ARG A O     1 
ATOM   477  C CB    . ARG A  1 68 ? -22.002 21.409 -29.541 1.00 53.22  ? 209 ARG A CB    1 
ATOM   478  C CG    . ARG A  1 68 ? -22.873 21.745 -30.732 1.00 55.69  ? 209 ARG A CG    1 
ATOM   479  C CD    . ARG A  1 68 ? -22.125 21.666 -32.063 1.00 60.45  ? 209 ARG A CD    1 
ATOM   480  N NE    . ARG A  1 68 ? -23.143 21.375 -33.070 1.00 61.69  ? 209 ARG A NE    1 
ATOM   481  C CZ    . ARG A  1 68 ? -23.227 20.295 -33.850 1.00 60.29  ? 209 ARG A CZ    1 
ATOM   482  N NH1   . ARG A  1 68 ? -22.289 19.349 -33.870 1.00 60.15  ? 209 ARG A NH1   1 
ATOM   483  N NH2   . ARG A  1 68 ? -24.288 20.180 -34.648 1.00 60.23  ? 209 ARG A NH2   1 
ATOM   484  N N     . THR A  1 69 ? -21.023 20.454 -26.768 1.00 44.94  ? 210 THR A N     1 
ATOM   485  C CA    . THR A  1 69 ? -19.908 19.869 -26.021 1.00 48.33  ? 210 THR A CA    1 
ATOM   486  C C     . THR A  1 69 ? -20.340 19.217 -24.732 1.00 50.04  ? 210 THR A C     1 
ATOM   487  O O     . THR A  1 69 ? -19.569 18.495 -24.136 1.00 58.71  ? 210 THR A O     1 
ATOM   488  C CB    . THR A  1 69 ? -18.925 20.977 -25.572 1.00 50.35  ? 210 THR A CB    1 
ATOM   489  O OG1   . THR A  1 69 ? -19.702 22.040 -25.007 1.00 49.48  ? 210 THR A OG1   1 
ATOM   490  C CG2   . THR A  1 69 ? -18.093 21.510 -26.727 1.00 51.09  ? 210 THR A CG2   1 
ATOM   491  N N     . GLY A  1 70 ? -21.521 19.545 -24.239 1.00 47.75  ? 211 GLY A N     1 
ATOM   492  C CA    . GLY A  1 70 ? -21.976 19.022 -22.994 1.00 47.98  ? 211 GLY A CA    1 
ATOM   493  C C     . GLY A  1 70 ? -21.303 19.635 -21.800 1.00 50.38  ? 211 GLY A C     1 
ATOM   494  O O     . GLY A  1 70 ? -21.410 19.065 -20.718 1.00 53.29  ? 211 GLY A O     1 
ATOM   495  N N     . LYS A  1 71 ? -20.661 20.798 -21.972 1.00 51.98  ? 212 LYS A N     1 
ATOM   496  C CA    . LYS A  1 71 ? -19.954 21.486 -20.900 1.00 53.32  ? 212 LYS A CA    1 
ATOM   497  C C     . LYS A  1 71 ? -20.687 22.790 -20.566 1.00 55.06  ? 212 LYS A C     1 
ATOM   498  O O     . LYS A  1 71 ? -21.243 23.419 -21.445 1.00 53.73  ? 212 LYS A O     1 
ATOM   499  C CB    . LYS A  1 71 ? -18.464 21.714 -21.257 1.00 55.57  ? 212 LYS A CB    1 
ATOM   500  C CG    . LYS A  1 71 ? -17.610 20.428 -21.173 1.00 56.49  ? 212 LYS A CG    1 
ATOM   501  C CD    . LYS A  1 71 ? -16.132 20.572 -21.550 1.00 59.77  ? 212 LYS A CD    1 
ATOM   502  N N     . MET A  1 72 ? -20.767 23.113 -19.265 1.00 57.61  ? 213 MET A N     1 
ATOM   503  C CA    . MET A  1 72 ? -21.092 24.458 -18.761 1.00 62.12  ? 213 MET A CA    1 
ATOM   504  C C     . MET A  1 72 ? -19.935 25.417 -19.059 1.00 67.25  ? 213 MET A C     1 
ATOM   505  O O     . MET A  1 72 ? -18.771 25.001 -19.057 1.00 69.18  ? 213 MET A O     1 
ATOM   506  C CB    . MET A  1 72 ? -21.292 24.435 -17.239 1.00 63.14  ? 213 MET A CB    1 
ATOM   507  C CG    . MET A  1 72 ? -22.451 23.559 -16.762 1.00 60.74  ? 213 MET A CG    1 
ATOM   508  S SD    . MET A  1 72 ? -24.040 24.159 -17.371 1.00 59.35  ? 213 MET A SD    1 
ATOM   509  C CE    . MET A  1 72 ? -25.178 23.305 -16.293 1.00 57.75  ? 213 MET A CE    1 
ATOM   510  N N     . MET A  1 73 ? -20.259 26.692 -19.285 1.00 70.50  ? 214 MET A N     1 
ATOM   511  C CA    . MET A  1 73 ? -19.306 27.675 -19.801 1.00 76.61  ? 214 MET A CA    1 
ATOM   512  C C     . MET A  1 73 ? -19.171 28.897 -18.886 1.00 80.42  ? 214 MET A C     1 
ATOM   513  O O     . MET A  1 73 ? -20.031 29.772 -18.872 1.00 81.72  ? 214 MET A O     1 
ATOM   514  C CB    . MET A  1 73 ? -19.730 28.072 -21.227 1.00 78.42  ? 214 MET A CB    1 
ATOM   515  C CG    . MET A  1 73 ? -19.594 26.952 -22.272 1.00 77.34  ? 214 MET A CG    1 
ATOM   516  S SD    . MET A  1 73 ? -17.877 26.590 -22.763 1.00 87.43  ? 214 MET A SD    1 
ATOM   517  C CE    . MET A  1 73 ? -18.019 25.161 -23.852 1.00 83.38  ? 214 MET A CE    1 
ATOM   518  C CA    . LYS B  1 7  ? -58.791 6.324  -53.600 1.00 81.11  ? 148 LYS B CA    1 
ATOM   519  C C     . LYS B  1 7  ? -57.510 6.624  -54.361 1.00 79.30  ? 148 LYS B C     1 
ATOM   520  O O     . LYS B  1 7  ? -56.651 7.293  -53.865 1.00 77.94  ? 148 LYS B O     1 
ATOM   521  N N     . ARG B  1 8  ? -57.434 6.143  -55.601 1.00 84.74  ? 149 ARG B N     1 
ATOM   522  C CA    . ARG B  1 8  ? -56.235 6.196  -56.493 1.00 83.03  ? 149 ARG B CA    1 
ATOM   523  C C     . ARG B  1 8  ? -56.391 7.153  -57.724 1.00 82.29  ? 149 ARG B C     1 
ATOM   524  O O     . ARG B  1 8  ? -57.130 6.822  -58.663 1.00 86.73  ? 149 ARG B O     1 
ATOM   525  C CB    . ARG B  1 8  ? -55.994 4.750  -56.996 1.00 86.51  ? 149 ARG B CB    1 
ATOM   526  C CG    . ARG B  1 8  ? -54.610 4.442  -57.553 1.00 86.12  ? 149 ARG B CG    1 
ATOM   527  C CD    . ARG B  1 8  ? -54.376 2.936  -57.696 1.00 88.40  ? 149 ARG B CD    1 
ATOM   528  N NE    . ARG B  1 8  ? -54.353 2.271  -56.389 1.00 87.91  ? 149 ARG B NE    1 
ATOM   529  C CZ    . ARG B  1 8  ? -53.983 1.006  -56.158 1.00 88.13  ? 149 ARG B CZ    1 
ATOM   530  N NH1   . ARG B  1 8  ? -53.571 0.202  -57.156 1.00 88.45  ? 149 ARG B NH1   1 
ATOM   531  N NH2   . ARG B  1 8  ? -54.015 0.546  -54.894 1.00 85.11  ? 149 ARG B NH2   1 
ATOM   532  N N     . MET B  1 9  ? -55.677 8.294  -57.739 1.00 76.95  ? 150 MET B N     1 
ATOM   533  C CA    . MET B  1 9  ? -55.819 9.352  -58.796 1.00 77.42  ? 150 MET B CA    1 
ATOM   534  C C     . MET B  1 9  ? -54.731 9.376  -59.924 1.00 76.00  ? 150 MET B C     1 
ATOM   535  O O     . MET B  1 9  ? -53.564 9.107  -59.683 1.00 72.27  ? 150 MET B O     1 
ATOM   536  C CB    . MET B  1 9  ? -55.914 10.732 -58.132 1.00 75.43  ? 150 MET B CB    1 
ATOM   537  N N     . ASP B  1 10 ? -55.128 9.687  -61.159 1.00 77.98  ? 151 ASP B N     1 
ATOM   538  C CA    . ASP B  1 10 ? -54.193 9.831  -62.280 1.00 77.89  ? 151 ASP B CA    1 
ATOM   539  C C     . ASP B  1 10 ? -53.179 10.967 -62.028 1.00 75.30  ? 151 ASP B C     1 
ATOM   540  O O     . ASP B  1 10 ? -53.565 12.127 -61.886 1.00 76.66  ? 151 ASP B O     1 
ATOM   541  C CB    . ASP B  1 10 ? -54.960 10.089 -63.613 1.00 82.41  ? 151 ASP B CB    1 
ATOM   542  N N     . CYS B  1 11 ? -51.890 10.620 -61.975 1.00 72.53  ? 152 CYS B N     1 
ATOM   543  C CA    . CYS B  1 11 ? -50.778 11.596 -61.883 1.00 70.20  ? 152 CYS B CA    1 
ATOM   544  C C     . CYS B  1 11 ? -50.189 12.014 -63.262 1.00 71.75  ? 152 CYS B C     1 
ATOM   545  O O     . CYS B  1 11 ? -49.335 11.310 -63.801 1.00 69.86  ? 152 CYS B O     1 
ATOM   546  C CB    . CYS B  1 11 ? -49.649 10.987 -61.058 1.00 66.57  ? 152 CYS B CB    1 
ATOM   547  S SG    . CYS B  1 11 ? -48.186 12.049 -60.938 1.00 66.36  ? 152 CYS B SG    1 
ATOM   548  N N     . PRO B  1 12 ? -50.616 13.175 -63.805 1.00 74.15  ? 153 PRO B N     1 
ATOM   549  C CA    . PRO B  1 12 ? -50.351 13.738 -65.142 1.00 76.71  ? 153 PRO B CA    1 
ATOM   550  C C     . PRO B  1 12 ? -48.882 14.072 -65.498 1.00 74.90  ? 153 PRO B C     1 
ATOM   551  O O     . PRO B  1 12 ? -48.524 14.069 -66.679 1.00 77.44  ? 153 PRO B O     1 
ATOM   552  N N     . ALA B  1 13 ? -48.054 14.394 -64.505 1.00 71.11  ? 154 ALA B N     1 
ATOM   553  C CA    . ALA B  1 13 ? -46.648 14.788 -64.752 1.00 69.58  ? 154 ALA B CA    1 
ATOM   554  C C     . ALA B  1 13 ? -45.663 13.583 -64.890 1.00 66.87  ? 154 ALA B C     1 
ATOM   555  O O     . ALA B  1 13 ? -44.473 13.754 -65.221 1.00 63.89  ? 154 ALA B O     1 
ATOM   556  C CB    . ALA B  1 13 ? -46.184 15.766 -63.673 1.00 68.28  ? 154 ALA B CB    1 
ATOM   557  N N     . LEU B  1 14 ? -46.180 12.382 -64.608 1.00 67.30  ? 155 LEU B N     1 
ATOM   558  C CA    . LEU B  1 14 ? -45.529 11.101 -64.899 1.00 67.19  ? 155 LEU B CA    1 
ATOM   559  C C     . LEU B  1 14 ? -46.178 10.586 -66.190 1.00 69.89  ? 155 LEU B C     1 
ATOM   560  O O     . LEU B  1 14 ? -47.189 11.176 -66.627 1.00 69.46  ? 155 LEU B O     1 
ATOM   561  C CB    . LEU B  1 14 ? -45.729 10.088 -63.735 1.00 65.55  ? 155 LEU B CB    1 
ATOM   562  C CG    . LEU B  1 14 ? -45.009 10.355 -62.415 1.00 63.82  ? 155 LEU B CG    1 
ATOM   563  C CD1   . LEU B  1 14 ? -45.194 9.159  -61.464 1.00 62.65  ? 155 LEU B CD1   1 
ATOM   564  C CD2   . LEU B  1 14 ? -43.525 10.696 -62.582 1.00 62.91  ? 155 LEU B CD2   1 
ATOM   565  N N     . PRO B  1 15 ? -45.605 9.505  -66.799 1.00 71.43  ? 156 PRO B N     1 
ATOM   566  C CA    . PRO B  1 15 ? -46.113 8.890  -68.043 1.00 75.55  ? 156 PRO B CA    1 
ATOM   567  C C     . PRO B  1 15 ? -47.539 8.348  -67.933 1.00 78.57  ? 156 PRO B C     1 
ATOM   568  O O     . PRO B  1 15 ? -48.050 8.234  -66.807 1.00 79.37  ? 156 PRO B O     1 
ATOM   569  C CB    . PRO B  1 15 ? -45.133 7.733  -68.278 1.00 74.76  ? 156 PRO B CB    1 
ATOM   570  C CG    . PRO B  1 15 ? -43.867 8.193  -67.649 1.00 71.48  ? 156 PRO B CG    1 
ATOM   571  C CD    . PRO B  1 15 ? -44.314 8.897  -66.414 1.00 69.39  ? 156 PRO B CD    1 
ATOM   572  N N     . PRO B  1 16 ? -48.167 8.003  -69.080 1.00 80.84  ? 157 PRO B N     1 
ATOM   573  C CA    . PRO B  1 16 ? -49.499 7.406  -69.233 1.00 83.08  ? 157 PRO B CA    1 
ATOM   574  C C     . PRO B  1 16 ? -49.750 6.191  -68.318 1.00 80.98  ? 157 PRO B C     1 
ATOM   575  O O     . PRO B  1 16 ? -49.030 5.140  -68.414 1.00 78.11  ? 157 PRO B O     1 
ATOM   576  N N     . GLY B  1 17 ? -50.741 6.364  -67.415 1.00 81.51  ? 158 GLY B N     1 
ATOM   577  C CA    . GLY B  1 17 ? -51.229 5.284  -66.512 1.00 81.21  ? 158 GLY B CA    1 
ATOM   578  C C     . GLY B  1 17 ? -50.645 5.147  -65.106 1.00 76.52  ? 158 GLY B C     1 
ATOM   579  O O     . GLY B  1 17 ? -51.071 4.262  -64.349 1.00 75.67  ? 158 GLY B O     1 
ATOM   580  N N     . TRP B  1 18 ? -49.663 5.996  -64.768 1.00 73.90  ? 159 TRP B N     1 
ATOM   581  C CA    . TRP B  1 18 ? -49.173 6.154  -63.377 1.00 69.94  ? 159 TRP B CA    1 
ATOM   582  C C     . TRP B  1 18 ? -50.280 6.767  -62.519 1.00 70.23  ? 159 TRP B C     1 
ATOM   583  O O     . TRP B  1 18 ? -51.045 7.620  -63.006 1.00 72.83  ? 159 TRP B O     1 
ATOM   584  C CB    . TRP B  1 18 ? -47.898 7.030  -63.292 1.00 66.80  ? 159 TRP B CB    1 
ATOM   585  C CG    . TRP B  1 18 ? -46.716 6.314  -63.761 1.00 65.68  ? 159 TRP B CG    1 
ATOM   586  C CD1   . TRP B  1 18 ? -46.309 6.179  -65.053 1.00 67.98  ? 159 TRP B CD1   1 
ATOM   587  C CD2   . TRP B  1 18 ? -45.801 5.551  -62.973 1.00 63.85  ? 159 TRP B CD2   1 
ATOM   588  N NE1   . TRP B  1 18 ? -45.188 5.399  -65.123 1.00 66.71  ? 159 TRP B NE1   1 
ATOM   589  C CE2   . TRP B  1 18 ? -44.847 4.996  -63.864 1.00 64.34  ? 159 TRP B CE2   1 
ATOM   590  C CE3   . TRP B  1 18 ? -45.688 5.275  -61.604 1.00 60.23  ? 159 TRP B CE3   1 
ATOM   591  C CZ2   . TRP B  1 18 ? -43.785 4.191  -63.424 1.00 63.17  ? 159 TRP B CZ2   1 
ATOM   592  C CZ3   . TRP B  1 18 ? -44.640 4.481  -61.165 1.00 58.50  ? 159 TRP B CZ3   1 
ATOM   593  C CH2   . TRP B  1 18 ? -43.696 3.952  -62.067 1.00 60.23  ? 159 TRP B CH2   1 
ATOM   594  N N     . LYS B  1 19 ? -50.375 6.323  -61.263 1.00 65.70  ? 160 LYS B N     1 
ATOM   595  C CA    . LYS B  1 19 ? -51.327 6.904  -60.318 1.00 65.31  ? 160 LYS B CA    1 
ATOM   596  C C     . LYS B  1 19 ? -50.629 7.208  -58.976 1.00 60.84  ? 160 LYS B C     1 
ATOM   597  O O     . LYS B  1 19 ? -49.708 6.506  -58.589 1.00 57.92  ? 160 LYS B O     1 
ATOM   598  C CB    . LYS B  1 19 ? -52.558 5.983  -60.142 1.00 67.53  ? 160 LYS B CB    1 
ATOM   599  C CG    . LYS B  1 19 ? -53.617 6.044  -61.258 1.00 70.07  ? 160 LYS B CG    1 
ATOM   600  N N     . LYS B  1 20 ? -51.054 8.294  -58.332 1.00 60.66  ? 161 LYS B N     1 
ATOM   601  C CA    . LYS B  1 20 ? -50.657 8.706  -56.965 1.00 59.07  ? 161 LYS B CA    1 
ATOM   602  C C     . LYS B  1 20 ? -51.753 8.302  -55.978 1.00 58.32  ? 161 LYS B C     1 
ATOM   603  O O     . LYS B  1 20 ? -52.915 8.228  -56.327 1.00 59.49  ? 161 LYS B O     1 
ATOM   604  C CB    . LYS B  1 20 ? -50.462 10.227 -56.948 1.00 59.85  ? 161 LYS B CB    1 
ATOM   605  C CG    . LYS B  1 20 ? -50.039 10.880 -55.645 1.00 57.59  ? 161 LYS B CG    1 
ATOM   606  C CD    . LYS B  1 20 ? -50.127 12.408 -55.773 1.00 59.64  ? 161 LYS B CD    1 
ATOM   607  C CE    . LYS B  1 20 ? -50.037 13.130 -54.425 1.00 58.12  ? 161 LYS B CE    1 
ATOM   608  N N     . GLU B  1 21 ? -51.369 8.032  -54.745 1.00 55.98  ? 162 GLU B N     1 
ATOM   609  C CA    . GLU B  1 21 ? -52.328 7.785  -53.659 1.00 56.62  ? 162 GLU B CA    1 
ATOM   610  C C     . GLU B  1 21 ? -51.788 8.401  -52.348 1.00 53.23  ? 162 GLU B C     1 
ATOM   611  O O     . GLU B  1 21 ? -50.584 8.342  -52.076 1.00 50.69  ? 162 GLU B O     1 
ATOM   612  C CB    . GLU B  1 21 ? -52.623 6.267  -53.486 1.00 57.98  ? 162 GLU B CB    1 
ATOM   613  C CG    . GLU B  1 21 ? -53.049 5.867  -52.063 1.00 57.46  ? 162 GLU B CG    1 
ATOM   614  C CD    . GLU B  1 21 ? -53.658 4.490  -51.938 1.00 59.44  ? 162 GLU B CD    1 
ATOM   615  O OE1   . GLU B  1 21 ? -54.690 4.287  -52.573 1.00 65.90  ? 162 GLU B OE1   1 
ATOM   616  O OE2   . GLU B  1 21 ? -53.157 3.624  -51.186 1.00 58.92  ? 162 GLU B OE2   1 
ATOM   617  N N     . GLU B  1 22 ? -52.690 8.967  -51.541 1.00 53.33  ? 163 GLU B N     1 
ATOM   618  C CA    . GLU B  1 22 ? -52.340 9.521  -50.268 1.00 51.06  ? 163 GLU B CA    1 
ATOM   619  C C     . GLU B  1 22 ? -53.173 8.812  -49.246 1.00 50.74  ? 163 GLU B C     1 
ATOM   620  O O     . GLU B  1 22 ? -54.376 8.597  -49.465 1.00 52.19  ? 163 GLU B O     1 
ATOM   621  C CB    . GLU B  1 22 ? -52.631 10.984 -50.276 1.00 52.91  ? 163 GLU B CB    1 
ATOM   622  C CG    . GLU B  1 22 ? -51.943 11.700 -49.152 1.00 53.32  ? 163 GLU B CG    1 
ATOM   623  C CD    . GLU B  1 22 ? -51.641 13.166 -49.431 1.00 56.25  ? 163 GLU B CD    1 
ATOM   624  O OE1   . GLU B  1 22 ? -51.635 13.926 -48.437 1.00 58.47  ? 163 GLU B OE1   1 
ATOM   625  O OE2   . GLU B  1 22 ? -51.391 13.560 -50.604 1.00 61.71  ? 163 GLU B OE2   1 
ATOM   626  N N     . VAL B  1 23 ? -52.533 8.412  -48.153 1.00 47.74  ? 164 VAL B N     1 
ATOM   627  C CA    . VAL B  1 23 ? -53.195 7.715  -47.053 1.00 47.66  ? 164 VAL B CA    1 
ATOM   628  C C     . VAL B  1 23 ? -52.878 8.394  -45.717 1.00 45.91  ? 164 VAL B C     1 
ATOM   629  O O     . VAL B  1 23 ? -51.756 8.300  -45.212 1.00 47.57  ? 164 VAL B O     1 
ATOM   630  C CB    . VAL B  1 23 ? -52.788 6.239  -46.947 1.00 47.44  ? 164 VAL B CB    1 
ATOM   631  C CG1   . VAL B  1 23 ? -53.664 5.532  -45.897 1.00 48.21  ? 164 VAL B CG1   1 
ATOM   632  C CG2   . VAL B  1 23 ? -52.911 5.545  -48.295 1.00 50.07  ? 164 VAL B CG2   1 
ATOM   633  N N     . ILE B  1 24 ? -53.892 9.022  -45.131 1.00 45.46  ? 165 ILE B N     1 
ATOM   634  C CA    . ILE B  1 24 ? -53.786 9.745  -43.855 1.00 44.13  ? 165 ILE B CA    1 
ATOM   635  C C     . ILE B  1 24 ? -53.430 8.773  -42.760 1.00 42.35  ? 165 ILE B C     1 
ATOM   636  O O     . ILE B  1 24 ? -53.941 7.679  -42.768 1.00 41.97  ? 165 ILE B O     1 
ATOM   637  C CB    . ILE B  1 24 ? -55.139 10.412 -43.496 1.00 45.78  ? 165 ILE B CB    1 
ATOM   638  C CG1   . ILE B  1 24 ? -55.505 11.463 -44.579 1.00 47.51  ? 165 ILE B CG1   1 
ATOM   639  C CG2   . ILE B  1 24 ? -55.124 11.029 -42.100 1.00 44.56  ? 165 ILE B CG2   1 
ATOM   640  C CD1   . ILE B  1 24 ? -54.622 12.698 -44.645 1.00 46.58  ? 165 ILE B CD1   1 
ATOM   641  N N     . ARG B  1 25 ? -52.482 9.150  -41.883 1.00 41.54  ? 166 ARG B N     1 
ATOM   642  C CA    . ARG B  1 25 ? -52.114 8.385  -40.690 1.00 38.71  ? 166 ARG B CA    1 
ATOM   643  C C     . ARG B  1 25 ? -53.132 8.598  -39.569 1.00 39.86  ? 166 ARG B C     1 
ATOM   644  O O     . ARG B  1 25 ? -53.392 9.723  -39.199 1.00 37.59  ? 166 ARG B O     1 
ATOM   645  C CB    . ARG B  1 25 ? -50.756 8.817  -40.184 1.00 37.15  ? 166 ARG B CB    1 
ATOM   646  C CG    . ARG B  1 25 ? -49.668 8.061  -40.891 1.00 37.66  ? 166 ARG B CG    1 
ATOM   647  C CD    . ARG B  1 25 ? -48.282 8.516  -40.506 1.00 36.93  ? 166 ARG B CD    1 
ATOM   648  N NE    . ARG B  1 25 ? -47.266 7.962  -41.417 1.00 35.18  ? 166 ARG B NE    1 
ATOM   649  C CZ    . ARG B  1 25 ? -46.020 7.722  -41.067 1.00 32.67  ? 166 ARG B CZ    1 
ATOM   650  N NH1   . ARG B  1 25 ? -45.624 7.983  -39.842 1.00 32.44  ? 166 ARG B NH1   1 
ATOM   651  N NH2   . ARG B  1 25 ? -45.169 7.183  -41.932 1.00 32.17  ? 166 ARG B NH2   1 
ATOM   652  N N     . LYS B  1 26 ? -53.636 7.502  -39.001 1.00 40.80  ? 167 LYS B N     1 
ATOM   653  C CA    . LYS B  1 26 ? -54.870 7.554  -38.198 1.00 42.23  ? 167 LYS B CA    1 
ATOM   654  C C     . LYS B  1 26 ? -54.621 7.820  -36.745 1.00 42.93  ? 167 LYS B C     1 
ATOM   655  O O     . LYS B  1 26 ? -55.511 8.318  -36.079 1.00 43.06  ? 167 LYS B O     1 
ATOM   656  C CB    . LYS B  1 26 ? -55.667 6.271  -38.340 1.00 44.07  ? 167 LYS B CB    1 
ATOM   657  C CG    . LYS B  1 26 ? -56.194 6.009  -39.763 1.00 46.00  ? 167 LYS B CG    1 
ATOM   658  N N     . SER B  1 27 ? -53.410 7.525  -36.265 1.00 42.45  ? 168 SER B N     1 
ATOM   659  C CA    . SER B  1 27 ? -53.120 7.507  -34.863 1.00 42.72  ? 168 SER B CA    1 
ATOM   660  C C     . SER B  1 27 ? -51.641 7.750  -34.602 1.00 40.97  ? 168 SER B C     1 
ATOM   661  O O     . SER B  1 27 ? -50.835 7.779  -35.512 1.00 41.47  ? 168 SER B O     1 
ATOM   662  C CB    . SER B  1 27 ? -53.567 6.152  -34.265 1.00 45.49  ? 168 SER B CB    1 
ATOM   663  O OG    . SER B  1 27 ? -52.639 5.098  -34.496 1.00 48.37  ? 168 SER B OG    1 
ATOM   664  N N     . GLY B  1 28 ? -51.322 7.998  -33.344 1.00 39.82  ? 169 GLY B N     1 
ATOM   665  C CA    . GLY B  1 28 ? -49.959 7.996  -32.842 1.00 38.05  ? 169 GLY B CA    1 
ATOM   666  C C     . GLY B  1 28 ? -49.410 9.388  -32.924 1.00 37.72  ? 169 GLY B C     1 
ATOM   667  O O     . GLY B  1 28 ? -50.146 10.334 -33.243 1.00 37.89  ? 169 GLY B O     1 
ATOM   668  N N     . LEU B  1 29 ? -48.110 9.525  -32.637 1.00 38.27  ? 170 LEU B N     1 
ATOM   669  C CA    . LEU B  1 29 ? -47.437 10.821 -32.714 1.00 40.02  ? 170 LEU B CA    1 
ATOM   670  C C     . LEU B  1 29 ? -47.571 11.534 -34.082 1.00 38.88  ? 170 LEU B C     1 
ATOM   671  O O     . LEU B  1 29 ? -47.683 12.758 -34.094 1.00 37.58  ? 170 LEU B O     1 
ATOM   672  C CB    . LEU B  1 29 ? -45.939 10.712 -32.405 1.00 42.50  ? 170 LEU B CB    1 
ATOM   673  C CG    . LEU B  1 29 ? -45.456 10.230 -31.033 1.00 46.95  ? 170 LEU B CG    1 
ATOM   674  C CD1   . LEU B  1 29 ? -43.926 10.426 -31.015 1.00 48.65  ? 170 LEU B CD1   1 
ATOM   675  C CD2   . LEU B  1 29 ? -46.152 10.902 -29.834 1.00 46.70  ? 170 LEU B CD2   1 
ATOM   676  N N     . SER B  1 30 ? -47.556 10.782 -35.203 1.00 37.54  ? 171 SER B N     1 
ATOM   677  C CA    . SER B  1 30 ? -47.737 11.398 -36.558 1.00 35.93  ? 171 SER B CA    1 
ATOM   678  C C     . SER B  1 30 ? -49.166 11.367 -37.064 1.00 35.83  ? 171 SER B C     1 
ATOM   679  O O     . SER B  1 30 ? -49.377 11.478 -38.255 1.00 35.04  ? 171 SER B O     1 
ATOM   680  C CB    . SER B  1 30 ? -46.837 10.721 -37.574 1.00 35.20  ? 171 SER B CB    1 
ATOM   681  O OG    . SER B  1 30 ? -47.145 9.339  -37.679 1.00 35.78  ? 171 SER B OG    1 
ATOM   682  N N     . ALA B  1 31 ? -50.142 11.247 -36.164 1.00 36.00  ? 172 ALA B N     1 
ATOM   683  C CA    . ALA B  1 31 ? -51.557 11.240 -36.549 1.00 37.41  ? 172 ALA B CA    1 
ATOM   684  C C     . ALA B  1 31 ? -51.862 12.425 -37.436 1.00 36.36  ? 172 ALA B C     1 
ATOM   685  O O     . ALA B  1 31 ? -51.342 13.481 -37.198 1.00 37.92  ? 172 ALA B O     1 
ATOM   686  C CB    . ALA B  1 31 ? -52.480 11.299 -35.290 1.00 37.51  ? 172 ALA B CB    1 
ATOM   687  N N     . GLY B  1 32 ? -52.683 12.274 -38.455 1.00 36.13  ? 173 GLY B N     1 
ATOM   688  C CA    . GLY B  1 32 ? -52.961 13.437 -39.312 1.00 38.16  ? 173 GLY B CA    1 
ATOM   689  C C     . GLY B  1 32 ? -51.973 13.752 -40.447 1.00 38.49  ? 173 GLY B C     1 
ATOM   690  O O     . GLY B  1 32 ? -52.381 14.388 -41.402 1.00 39.27  ? 173 GLY B O     1 
ATOM   691  N N     . LYS B  1 33 ? -50.704 13.306 -40.369 1.00 38.76  ? 174 LYS B N     1 
ATOM   692  C CA    . LYS B  1 33 ? -49.770 13.362 -41.550 1.00 40.04  ? 174 LYS B CA    1 
ATOM   693  C C     . LYS B  1 33 ? -50.208 12.230 -42.534 1.00 39.55  ? 174 LYS B C     1 
ATOM   694  O O     . LYS B  1 33 ? -51.028 11.405 -42.189 1.00 40.60  ? 174 LYS B O     1 
ATOM   695  C CB    . LYS B  1 33 ? -48.285 13.144 -41.194 1.00 40.56  ? 174 LYS B CB    1 
ATOM   696  C CG    . LYS B  1 33 ? -47.708 13.933 -40.004 1.00 42.90  ? 174 LYS B CG    1 
ATOM   697  C CD    . LYS B  1 33 ? -47.480 15.357 -40.442 1.00 45.97  ? 174 LYS B CD    1 
ATOM   698  C CE    . LYS B  1 33 ? -47.261 16.361 -39.309 1.00 47.56  ? 174 LYS B CE    1 
ATOM   699  N NZ    . LYS B  1 33 ? -46.837 17.622 -40.052 1.00 51.15  ? 174 LYS B NZ    1 
ATOM   700  N N     . SER B  1 34 ? -49.657 12.215 -43.745 1.00 40.53  ? 175 SER B N     1 
ATOM   701  C CA    . SER B  1 34 ? -49.999 11.246 -44.798 1.00 40.23  ? 175 SER B CA    1 
ATOM   702  C C     . SER B  1 34 ? -48.760 10.580 -45.410 1.00 39.30  ? 175 SER B C     1 
ATOM   703  O O     . SER B  1 34 ? -47.709 11.183 -45.471 1.00 38.32  ? 175 SER B O     1 
ATOM   704  C CB    . SER B  1 34 ? -50.735 11.976 -45.906 1.00 42.54  ? 175 SER B CB    1 
ATOM   705  O OG    . SER B  1 34 ? -49.861 12.890 -46.534 1.00 42.66  ? 175 SER B OG    1 
ATOM   706  N N     . ASP B  1 35 ? -48.885 9.321  -45.797 1.00 38.91  ? 176 ASP B N     1 
ATOM   707  C CA    . ASP B  1 35 ? -47.932 8.675  -46.667 1.00 40.00  ? 176 ASP B CA    1 
ATOM   708  C C     . ASP B  1 35 ? -48.433 8.734  -48.130 1.00 41.21  ? 176 ASP B C     1 
ATOM   709  O O     . ASP B  1 35 ? -49.618 8.517  -48.409 1.00 41.14  ? 176 ASP B O     1 
ATOM   710  C CB    . ASP B  1 35 ? -47.775 7.232  -46.240 1.00 41.47  ? 176 ASP B CB    1 
ATOM   711  C CG    . ASP B  1 35 ? -47.301 7.095  -44.808 1.00 42.87  ? 176 ASP B CG    1 
ATOM   712  O OD1   . ASP B  1 35 ? -46.070 7.164  -44.569 1.00 44.15  ? 176 ASP B OD1   1 
ATOM   713  O OD2   . ASP B  1 35 ? -48.154 6.941  -43.923 1.00 43.35  ? 176 ASP B OD2   1 
ATOM   714  N N     . VAL B  1 36 ? -47.524 8.995  -49.058 1.00 42.18  ? 177 VAL B N     1 
ATOM   715  C CA    . VAL B  1 36 ? -47.841 9.058  -50.464 1.00 44.61  ? 177 VAL B CA    1 
ATOM   716  C C     . VAL B  1 36 ? -47.277 7.792  -51.111 1.00 46.79  ? 177 VAL B C     1 
ATOM   717  O O     . VAL B  1 36 ? -46.124 7.399  -50.848 1.00 47.21  ? 177 VAL B O     1 
ATOM   718  C CB    . VAL B  1 36 ? -47.249 10.279 -51.107 1.00 46.12  ? 177 VAL B CB    1 
ATOM   719  C CG1   . VAL B  1 36 ? -47.520 10.276 -52.621 1.00 47.90  ? 177 VAL B CG1   1 
ATOM   720  C CG2   . VAL B  1 36 ? -47.811 11.533 -50.448 1.00 46.87  ? 177 VAL B CG2   1 
ATOM   721  N N     . TYR B  1 37 ? -48.114 7.117  -51.892 1.00 48.28  ? 178 TYR B N     1 
ATOM   722  C CA    . TYR B  1 37 ? -47.688 5.926  -52.634 1.00 51.33  ? 178 TYR B CA    1 
ATOM   723  C C     . TYR B  1 37 ? -47.872 6.149  -54.134 1.00 53.27  ? 178 TYR B C     1 
ATOM   724  O O     . TYR B  1 37 ? -48.802 6.858  -54.564 1.00 55.32  ? 178 TYR B O     1 
ATOM   725  C CB    . TYR B  1 37 ? -48.470 4.672  -52.197 1.00 52.61  ? 178 TYR B CB    1 
ATOM   726  C CG    . TYR B  1 37 ? -48.452 4.437  -50.701 1.00 51.47  ? 178 TYR B CG    1 
ATOM   727  C CD1   . TYR B  1 37 ? -47.284 4.096  -50.055 1.00 49.30  ? 178 TYR B CD1   1 
ATOM   728  C CD2   . TYR B  1 37 ? -49.604 4.617  -49.940 1.00 52.47  ? 178 TYR B CD2   1 
ATOM   729  C CE1   . TYR B  1 37 ? -47.265 3.898  -48.702 1.00 50.14  ? 178 TYR B CE1   1 
ATOM   730  C CE2   . TYR B  1 37 ? -49.604 4.438  -48.567 1.00 51.00  ? 178 TYR B CE2   1 
ATOM   731  C CZ    . TYR B  1 37 ? -48.450 4.065  -47.949 1.00 50.33  ? 178 TYR B CZ    1 
ATOM   732  O OH    . TYR B  1 37 ? -48.474 3.906  -46.578 1.00 51.68  ? 178 TYR B OH    1 
ATOM   733  N N     . TYR B  1 38 ? -47.008 5.536  -54.937 1.00 53.60  ? 179 TYR B N     1 
ATOM   734  C CA    . TYR B  1 38 ? -47.279 5.493  -56.374 1.00 55.54  ? 179 TYR B CA    1 
ATOM   735  C C     . TYR B  1 38 ? -47.483 4.074  -56.924 1.00 58.62  ? 179 TYR B C     1 
ATOM   736  O O     . TYR B  1 38 ? -47.005 3.059  -56.383 1.00 58.84  ? 179 TYR B O     1 
ATOM   737  C CB    . TYR B  1 38 ? -46.239 6.270  -57.187 1.00 54.71  ? 179 TYR B CB    1 
ATOM   738  C CG    . TYR B  1 38 ? -46.264 7.772  -57.013 1.00 51.70  ? 179 TYR B CG    1 
ATOM   739  C CD1   . TYR B  1 38 ? -46.991 8.613  -57.877 1.00 51.91  ? 179 TYR B CD1   1 
ATOM   740  C CD2   . TYR B  1 38 ? -45.531 8.348  -55.994 1.00 49.68  ? 179 TYR B CD2   1 
ATOM   741  C CE1   . TYR B  1 38 ? -46.989 10.002 -57.717 1.00 51.28  ? 179 TYR B CE1   1 
ATOM   742  C CE2   . TYR B  1 38 ? -45.518 9.723  -55.803 1.00 48.76  ? 179 TYR B CE2   1 
ATOM   743  C CZ    . TYR B  1 38 ? -46.245 10.551 -56.653 1.00 50.90  ? 179 TYR B CZ    1 
ATOM   744  O OH    . TYR B  1 38 ? -46.178 11.904 -56.380 1.00 49.96  ? 179 TYR B OH    1 
ATOM   745  N N     . PHE B  1 39 ? -48.251 4.025  -57.999 1.00 61.54  ? 180 PHE B N     1 
ATOM   746  C CA    . PHE B  1 39 ? -48.475 2.808  -58.712 1.00 66.08  ? 180 PHE B CA    1 
ATOM   747  C C     . PHE B  1 39 ? -48.211 3.037  -60.198 1.00 67.36  ? 180 PHE B C     1 
ATOM   748  O O     . PHE B  1 39 ? -48.772 3.949  -60.807 1.00 68.95  ? 180 PHE B O     1 
ATOM   749  C CB    . PHE B  1 39 ? -49.898 2.380  -58.496 1.00 69.74  ? 180 PHE B CB    1 
ATOM   750  C CG    . PHE B  1 39 ? -50.241 2.160  -57.059 1.00 69.50  ? 180 PHE B CG    1 
ATOM   751  C CD1   . PHE B  1 39 ? -49.958 0.937  -56.453 1.00 70.59  ? 180 PHE B CD1   1 
ATOM   752  C CD2   . PHE B  1 39 ? -50.861 3.160  -56.314 1.00 67.73  ? 180 PHE B CD2   1 
ATOM   753  C CE1   . PHE B  1 39 ? -50.298 0.701  -55.140 1.00 68.99  ? 180 PHE B CE1   1 
ATOM   754  C CE2   . PHE B  1 39 ? -51.205 2.930  -54.995 1.00 68.07  ? 180 PHE B CE2   1 
ATOM   755  C CZ    . PHE B  1 39 ? -50.905 1.710  -54.400 1.00 68.43  ? 180 PHE B CZ    1 
ATOM   756  N N     . SER B  1 40 ? -47.349 2.205  -60.769 1.00 68.27  ? 181 SER B N     1 
ATOM   757  C CA    . SER B  1 40 ? -47.130 2.153  -62.221 1.00 70.08  ? 181 SER B CA    1 
ATOM   758  C C     . SER B  1 40 ? -48.363 1.536  -62.928 1.00 74.68  ? 181 SER B C     1 
ATOM   759  O O     . SER B  1 40 ? -49.350 1.160  -62.274 1.00 74.24  ? 181 SER B O     1 
ATOM   760  C CB    . SER B  1 40 ? -45.864 1.322  -62.507 1.00 69.58  ? 181 SER B CB    1 
ATOM   761  O OG    . SER B  1 40 ? -46.041 -0.058 -62.164 1.00 71.46  ? 181 SER B OG    1 
ATOM   762  N N     . PRO B  1 41 ? -48.329 1.458  -64.276 1.00 79.48  ? 182 PRO B N     1 
ATOM   763  C CA    . PRO B  1 41 ? -49.415 0.726  -64.966 1.00 83.98  ? 182 PRO B CA    1 
ATOM   764  C C     . PRO B  1 41 ? -49.604 -0.751 -64.529 1.00 86.65  ? 182 PRO B C     1 
ATOM   765  O O     . PRO B  1 41 ? -50.742 -1.220 -64.466 1.00 88.28  ? 182 PRO B O     1 
ATOM   766  C CB    . PRO B  1 41 ? -49.022 0.846  -66.435 1.00 86.00  ? 182 PRO B CB    1 
ATOM   767  C CG    . PRO B  1 41 ? -48.335 2.175  -66.521 1.00 83.31  ? 182 PRO B CG    1 
ATOM   768  C CD    . PRO B  1 41 ? -47.583 2.332  -65.213 1.00 78.83  ? 182 PRO B CD    1 
ATOM   769  N N     . SER B  1 42 ? -48.511 -1.446 -64.193 1.00 87.30  ? 183 SER B N     1 
ATOM   770  C CA    . SER B  1 42 ? -48.573 -2.819 -63.627 1.00 89.02  ? 183 SER B CA    1 
ATOM   771  C C     . SER B  1 42 ? -49.339 -2.896 -62.292 1.00 88.44  ? 183 SER B C     1 
ATOM   772  O O     . SER B  1 42 ? -50.068 -3.854 -62.050 1.00 89.83  ? 183 SER B O     1 
ATOM   773  C CB    . SER B  1 42 ? -47.156 -3.387 -63.432 1.00 87.23  ? 183 SER B CB    1 
ATOM   774  N N     . GLY B  1 43 ? -49.165 -1.877 -61.437 1.00 85.59  ? 184 GLY B N     1 
ATOM   775  C CA    . GLY B  1 43 ? -49.697 -1.872 -60.078 1.00 83.36  ? 184 GLY B CA    1 
ATOM   776  C C     . GLY B  1 43 ? -48.655 -2.234 -59.025 1.00 81.78  ? 184 GLY B C     1 
ATOM   777  O O     . GLY B  1 43 ? -49.015 -2.584 -57.893 1.00 79.62  ? 184 GLY B O     1 
ATOM   778  N N     . LYS B  1 44 ? -47.367 -2.163 -59.393 1.00 81.28  ? 185 LYS B N     1 
ATOM   779  C CA    . LYS B  1 44 ? -46.259 -2.209 -58.416 1.00 78.62  ? 185 LYS B CA    1 
ATOM   780  C C     . LYS B  1 44 ? -46.260 -0.910 -57.596 1.00 73.68  ? 185 LYS B C     1 
ATOM   781  O O     . LYS B  1 44 ? -46.273 0.184  -58.168 1.00 73.84  ? 185 LYS B O     1 
ATOM   782  C CB    . LYS B  1 44 ? -44.900 -2.384 -59.117 1.00 78.74  ? 185 LYS B CB    1 
ATOM   783  N N     . LYS B  1 45 ? -46.252 -1.049 -56.267 1.00 68.97  ? 186 LYS B N     1 
ATOM   784  C CA    . LYS B  1 45 ? -46.383 0.073  -55.334 1.00 63.22  ? 186 LYS B CA    1 
ATOM   785  C C     . LYS B  1 45 ? -45.006 0.654  -55.045 1.00 58.02  ? 186 LYS B C     1 
ATOM   786  O O     . LYS B  1 45 ? -44.060 -0.093 -54.813 1.00 57.80  ? 186 LYS B O     1 
ATOM   787  C CB    . LYS B  1 45 ? -47.026 -0.425 -54.020 1.00 63.38  ? 186 LYS B CB    1 
ATOM   788  C CG    . LYS B  1 45 ? -47.468 0.637  -53.005 1.00 61.33  ? 186 LYS B CG    1 
ATOM   789  C CD    . LYS B  1 45 ? -47.988 -0.018 -51.708 1.00 61.74  ? 186 LYS B CD    1 
ATOM   790  C CE    . LYS B  1 45 ? -48.554 0.981  -50.695 1.00 59.89  ? 186 LYS B CE    1 
ATOM   791  N N     . PHE B  1 46 ? -44.906 1.979  -55.017 1.00 53.25  ? 187 PHE B N     1 
ATOM   792  C CA    . PHE B  1 46 ? -43.643 2.678  -54.720 1.00 50.88  ? 187 PHE B CA    1 
ATOM   793  C C     . PHE B  1 46 ? -43.822 3.633  -53.543 1.00 47.40  ? 187 PHE B C     1 
ATOM   794  O O     . PHE B  1 46 ? -44.818 4.376  -53.517 1.00 47.33  ? 187 PHE B O     1 
ATOM   795  C CB    . PHE B  1 46 ? -43.130 3.406  -55.968 1.00 50.92  ? 187 PHE B CB    1 
ATOM   796  C CG    . PHE B  1 46 ? -42.795 2.463  -57.078 1.00 53.78  ? 187 PHE B CG    1 
ATOM   797  C CD1   . PHE B  1 46 ? -43.637 2.309  -58.155 1.00 56.32  ? 187 PHE B CD1   1 
ATOM   798  C CD2   . PHE B  1 46 ? -41.665 1.670  -56.992 1.00 54.51  ? 187 PHE B CD2   1 
ATOM   799  C CE1   . PHE B  1 46 ? -43.322 1.405  -59.180 1.00 60.01  ? 187 PHE B CE1   1 
ATOM   800  C CE2   . PHE B  1 46 ? -41.339 0.759  -57.986 1.00 58.16  ? 187 PHE B CE2   1 
ATOM   801  C CZ    . PHE B  1 46 ? -42.169 0.619  -59.092 1.00 59.78  ? 187 PHE B CZ    1 
ATOM   802  N N     . ARG B  1 47 ? -42.897 3.583  -52.578 1.00 44.02  ? 188 ARG B N     1 
ATOM   803  C CA    . ARG B  1 47 ? -43.045 4.351  -51.325 1.00 42.45  ? 188 ARG B CA    1 
ATOM   804  C C     . ARG B  1 47 ? -42.056 5.486  -51.147 1.00 41.66  ? 188 ARG B C     1 
ATOM   805  O O     . ARG B  1 47 ? -42.146 6.242  -50.159 1.00 41.03  ? 188 ARG B O     1 
ATOM   806  C CB    . ARG B  1 47 ? -42.965 3.444  -50.110 1.00 41.55  ? 188 ARG B CB    1 
ATOM   807  C CG    . ARG B  1 47 ? -43.776 2.178  -50.225 1.00 42.65  ? 188 ARG B CG    1 
ATOM   808  C CD    . ARG B  1 47 ? -44.011 1.565  -48.872 1.00 42.58  ? 188 ARG B CD    1 
ATOM   809  N NE    . ARG B  1 47 ? -42.810 0.981  -48.250 1.00 42.27  ? 188 ARG B NE    1 
ATOM   810  C CZ    . ARG B  1 47 ? -42.581 0.908  -46.947 1.00 41.13  ? 188 ARG B CZ    1 
ATOM   811  N NH1   . ARG B  1 47 ? -43.417 1.473  -46.068 1.00 40.05  ? 188 ARG B NH1   1 
ATOM   812  N NH2   . ARG B  1 47 ? -41.473 0.295  -46.506 1.00 41.97  ? 188 ARG B NH2   1 
ATOM   813  N N     . SER B  1 48 ? -41.167 5.662  -52.109 1.00 42.22  ? 189 SER B N     1 
ATOM   814  C CA    . SER B  1 48 ? -40.187 6.709  -52.038 1.00 42.85  ? 189 SER B CA    1 
ATOM   815  C C     . SER B  1 48 ? -39.641 7.044  -53.403 1.00 45.52  ? 189 SER B C     1 
ATOM   816  O O     . SER B  1 48 ? -39.745 6.258  -54.347 1.00 44.30  ? 189 SER B O     1 
ATOM   817  C CB    . SER B  1 48 ? -39.011 6.246  -51.172 1.00 42.79  ? 189 SER B CB    1 
ATOM   818  O OG    . SER B  1 48 ? -38.126 5.389  -51.857 1.00 43.02  ? 189 SER B OG    1 
ATOM   819  N N     . LYS B  1 49 ? -39.031 8.217  -53.485 1.00 48.56  ? 190 LYS B N     1 
ATOM   820  C CA    . LYS B  1 49 ? -38.480 8.681  -54.741 1.00 51.25  ? 190 LYS B CA    1 
ATOM   821  C C     . LYS B  1 49 ? -37.241 7.872  -55.188 1.00 52.26  ? 190 LYS B C     1 
ATOM   822  O O     . LYS B  1 49 ? -37.131 7.605  -56.363 1.00 54.24  ? 190 LYS B O     1 
ATOM   823  C CB    . LYS B  1 49 ? -38.178 10.154 -54.657 1.00 53.79  ? 190 LYS B CB    1 
ATOM   824  C CG    . LYS B  1 49 ? -37.521 10.714 -55.894 1.00 55.34  ? 190 LYS B CG    1 
ATOM   825  C CD    . LYS B  1 49 ? -37.568 12.236 -55.873 1.00 56.99  ? 190 LYS B CD    1 
ATOM   826  C CE    . LYS B  1 49 ? -37.197 12.761 -57.238 1.00 58.30  ? 190 LYS B CE    1 
ATOM   827  N NZ    . LYS B  1 49 ? -36.882 14.190 -57.100 1.00 61.24  ? 190 LYS B NZ    1 
ATOM   828  N N     . PRO B  1 50 ? -36.328 7.458  -54.263 1.00 53.34  ? 191 PRO B N     1 
ATOM   829  C CA    . PRO B  1 50 ? -35.256 6.543  -54.729 1.00 53.96  ? 191 PRO B CA    1 
ATOM   830  C C     . PRO B  1 50 ? -35.719 5.199  -55.287 1.00 53.26  ? 191 PRO B C     1 
ATOM   831  O O     . PRO B  1 50 ? -35.093 4.714  -56.203 1.00 54.91  ? 191 PRO B O     1 
ATOM   832  C CB    . PRO B  1 50 ? -34.408 6.318  -53.481 1.00 55.12  ? 191 PRO B CB    1 
ATOM   833  C CG    . PRO B  1 50 ? -34.556 7.596  -52.707 1.00 55.49  ? 191 PRO B CG    1 
ATOM   834  C CD    . PRO B  1 50 ? -36.015 7.996  -52.922 1.00 53.96  ? 191 PRO B CD    1 
ATOM   835  N N     . GLN B  1 51 ? -36.768 4.597  -54.730 1.00 51.93  ? 192 GLN B N     1 
ATOM   836  C CA    . GLN B  1 51 ? -37.296 3.302  -55.238 1.00 52.89  ? 192 GLN B CA    1 
ATOM   837  C C     . GLN B  1 51 ? -37.927 3.445  -56.636 1.00 51.87  ? 192 GLN B C     1 
ATOM   838  O O     . GLN B  1 51 ? -37.787 2.595  -57.517 1.00 52.67  ? 192 GLN B O     1 
ATOM   839  C CB    . GLN B  1 51 ? -38.362 2.813  -54.282 1.00 53.07  ? 192 GLN B CB    1 
ATOM   840  C CG    . GLN B  1 51 ? -38.874 1.398  -54.468 1.00 55.69  ? 192 GLN B CG    1 
ATOM   841  C CD    . GLN B  1 51 ? -40.003 1.051  -53.468 1.00 56.61  ? 192 GLN B CD    1 
ATOM   842  O OE1   . GLN B  1 51 ? -40.582 1.929  -52.770 1.00 54.12  ? 192 GLN B OE1   1 
ATOM   843  N NE2   . GLN B  1 51 ? -40.317 -0.234 -53.393 1.00 57.85  ? 192 GLN B NE2   1 
ATOM   844  N N     . LEU B  1 52 ? -38.682 4.522  -56.773 1.00 49.97  ? 193 LEU B N     1 
ATOM   845  C CA    . LEU B  1 52 ? -39.295 4.907  -58.006 1.00 50.66  ? 193 LEU B CA    1 
ATOM   846  C C     . LEU B  1 52 ? -38.225 5.170  -59.091 1.00 52.56  ? 193 LEU B C     1 
ATOM   847  O O     . LEU B  1 52 ? -38.341 4.690  -60.226 1.00 51.55  ? 193 LEU B O     1 
ATOM   848  C CB    . LEU B  1 52 ? -40.156 6.144  -57.748 1.00 49.23  ? 193 LEU B CB    1 
ATOM   849  C CG    . LEU B  1 52 ? -41.011 6.691  -58.873 1.00 50.81  ? 193 LEU B CG    1 
ATOM   850  C CD1   . LEU B  1 52 ? -42.025 5.647  -59.331 1.00 51.73  ? 193 LEU B CD1   1 
ATOM   851  C CD2   . LEU B  1 52 ? -41.702 7.968  -58.416 1.00 50.31  ? 193 LEU B CD2   1 
ATOM   852  N N     . ALA B  1 53 ? -37.193 5.922  -58.712 1.00 53.08  ? 194 ALA B N     1 
ATOM   853  C CA    . ALA B  1 53 ? -36.111 6.287  -59.608 1.00 56.05  ? 194 ALA B CA    1 
ATOM   854  C C     . ALA B  1 53 ? -35.339 5.053  -60.008 1.00 58.89  ? 194 ALA B C     1 
ATOM   855  O O     . ALA B  1 53 ? -34.944 4.933  -61.158 1.00 61.41  ? 194 ALA B O     1 
ATOM   856  C CB    . ALA B  1 53 ? -35.184 7.311  -58.964 1.00 55.36  ? 194 ALA B CB    1 
ATOM   857  N N     . ARG B  1 54 ? -35.141 4.139  -59.070 1.00 60.29  ? 195 ARG B N     1 
ATOM   858  C CA    . ARG B  1 54 ? -34.449 2.894  -59.352 1.00 64.15  ? 195 ARG B CA    1 
ATOM   859  C C     . ARG B  1 54 ? -35.196 2.048  -60.384 1.00 63.36  ? 195 ARG B C     1 
ATOM   860  O O     . ARG B  1 54 ? -34.585 1.567  -61.331 1.00 64.02  ? 195 ARG B O     1 
ATOM   861  C CB    . ARG B  1 54 ? -34.227 2.079  -58.071 1.00 67.10  ? 195 ARG B CB    1 
ATOM   862  C CG    . ARG B  1 54 ? -32.915 2.353  -57.341 1.00 70.90  ? 195 ARG B CG    1 
ATOM   863  C CD    . ARG B  1 54 ? -32.534 1.181  -56.427 1.00 74.45  ? 195 ARG B CD    1 
ATOM   864  N NE    . ARG B  1 54 ? -33.687 0.568  -55.728 1.00 75.28  ? 195 ARG B NE    1 
ATOM   865  C CZ    . ARG B  1 54 ? -34.242 1.004  -54.587 1.00 73.89  ? 195 ARG B CZ    1 
ATOM   866  N NH1   . ARG B  1 54 ? -35.275 0.340  -54.071 1.00 70.90  ? 195 ARG B NH1   1 
ATOM   867  N NH2   . ARG B  1 54 ? -33.782 2.093  -53.958 1.00 73.37  ? 195 ARG B NH2   1 
ATOM   868  N N     . TYR B  1 55 ? -36.506 1.891  -60.183 1.00 61.74  ? 196 TYR B N     1 
ATOM   869  C CA    . TYR B  1 55 ? -37.390 1.194  -61.127 1.00 62.68  ? 196 TYR B CA    1 
ATOM   870  C C     . TYR B  1 55 ? -37.399 1.815  -62.552 1.00 63.28  ? 196 TYR B C     1 
ATOM   871  O O     . TYR B  1 55 ? -37.305 1.078  -63.553 1.00 64.17  ? 196 TYR B O     1 
ATOM   872  C CB    . TYR B  1 55 ? -38.833 1.122  -60.573 1.00 62.27  ? 196 TYR B CB    1 
ATOM   873  C CG    . TYR B  1 55 ? -39.813 0.402  -61.502 1.00 64.75  ? 196 TYR B CG    1 
ATOM   874  C CD1   . TYR B  1 55 ? -39.739 -0.992 -61.676 1.00 66.70  ? 196 TYR B CD1   1 
ATOM   875  C CD2   . TYR B  1 55 ? -40.806 1.113  -62.215 1.00 64.19  ? 196 TYR B CD2   1 
ATOM   876  C CE1   . TYR B  1 55 ? -40.612 -1.666 -62.536 1.00 70.51  ? 196 TYR B CE1   1 
ATOM   877  C CE2   . TYR B  1 55 ? -41.691 0.449  -63.079 1.00 67.50  ? 196 TYR B CE2   1 
ATOM   878  C CZ    . TYR B  1 55 ? -41.589 -0.947 -63.249 1.00 70.78  ? 196 TYR B CZ    1 
ATOM   879  O OH    . TYR B  1 55 ? -42.449 -1.652 -64.089 1.00 73.24  ? 196 TYR B OH    1 
ATOM   880  N N     . LEU B  1 56 ? -37.501 3.151  -62.617 1.00 60.73  ? 197 LEU B N     1 
ATOM   881  C CA    . LEU B  1 56 ? -37.536 3.914  -63.882 1.00 61.51  ? 197 LEU B CA    1 
ATOM   882  C C     . LEU B  1 56 ? -36.147 4.163  -64.559 1.00 63.58  ? 197 LEU B C     1 
ATOM   883  O O     . LEU B  1 56 ? -36.048 4.234  -65.797 1.00 65.74  ? 197 LEU B O     1 
ATOM   884  C CB    . LEU B  1 56 ? -38.321 5.222  -63.702 1.00 58.41  ? 197 LEU B CB    1 
ATOM   885  C CG    . LEU B  1 56 ? -39.855 5.056  -63.612 1.00 57.94  ? 197 LEU B CG    1 
ATOM   886  C CD1   . LEU B  1 56 ? -40.491 6.321  -63.061 1.00 56.59  ? 197 LEU B CD1   1 
ATOM   887  C CD2   . LEU B  1 56 ? -40.515 4.697  -64.944 1.00 60.93  ? 197 LEU B CD2   1 
ATOM   888  N N     . GLY B  1 57 ? -35.087 4.284  -63.762 1.00 62.81  ? 198 GLY B N     1 
ATOM   889  C CA    . GLY B  1 57 ? -33.712 4.365  -64.288 1.00 63.78  ? 198 GLY B CA    1 
ATOM   890  C C     . GLY B  1 57 ? -33.354 5.671  -64.980 1.00 63.53  ? 198 GLY B C     1 
ATOM   891  O O     . GLY B  1 57 ? -33.569 6.768  -64.441 1.00 61.16  ? 198 GLY B O     1 
ATOM   892  N N     . ASN B  1 58 ? -32.754 5.530  -66.160 1.00 65.45  ? 199 ASN B N     1 
ATOM   893  C CA    . ASN B  1 58 ? -32.549 6.638  -67.085 1.00 65.34  ? 199 ASN B CA    1 
ATOM   894  C C     . ASN B  1 58 ? -33.859 7.009  -67.817 1.00 66.21  ? 199 ASN B C     1 
ATOM   895  O O     . ASN B  1 58 ? -33.954 8.121  -68.319 1.00 67.36  ? 199 ASN B O     1 
ATOM   896  C CB    . ASN B  1 58 ? -31.434 6.305  -68.119 1.00 67.08  ? 199 ASN B CB    1 
ATOM   897  C CG    . ASN B  1 58 ? -31.737 5.066  -68.958 1.00 66.49  ? 199 ASN B CG    1 
ATOM   898  N N     . THR B  1 59 ? -34.857 6.110  -67.871 1.00 65.47  ? 200 THR B N     1 
ATOM   899  C CA    . THR B  1 59 ? -36.005 6.254  -68.806 1.00 66.21  ? 200 THR B CA    1 
ATOM   900  C C     . THR B  1 59 ? -36.921 7.457  -68.539 1.00 65.28  ? 200 THR B C     1 
ATOM   901  O O     . THR B  1 59 ? -37.518 7.988  -69.468 1.00 65.77  ? 200 THR B O     1 
ATOM   902  C CB    . THR B  1 59 ? -36.907 4.993  -68.828 1.00 67.34  ? 200 THR B CB    1 
ATOM   903  O OG1   . THR B  1 59 ? -37.504 4.814  -67.539 1.00 66.99  ? 200 THR B OG1   1 
ATOM   904  C CG2   . THR B  1 59 ? -36.137 3.743  -69.199 1.00 67.77  ? 200 THR B CG2   1 
ATOM   905  N N     . VAL B  1 60 ? -37.032 7.866  -67.271 1.00 63.98  ? 201 VAL B N     1 
ATOM   906  C CA    . VAL B  1 60 ? -37.854 9.010  -66.875 1.00 63.59  ? 201 VAL B CA    1 
ATOM   907  C C     . VAL B  1 60 ? -36.984 9.949  -66.031 1.00 63.06  ? 201 VAL B C     1 
ATOM   908  O O     . VAL B  1 60 ? -36.272 9.492  -65.140 1.00 61.86  ? 201 VAL B O     1 
ATOM   909  C CB    . VAL B  1 60 ? -39.114 8.544  -66.104 1.00 62.03  ? 201 VAL B CB    1 
ATOM   910  C CG1   . VAL B  1 60 ? -39.844 9.727  -65.485 1.00 61.12  ? 201 VAL B CG1   1 
ATOM   911  C CG2   . VAL B  1 60 ? -40.068 7.792  -67.034 1.00 64.04  ? 201 VAL B CG2   1 
ATOM   912  N N     . ASP B  1 61 ? -37.012 11.255 -66.329 1.00 64.45  ? 202 ASP B N     1 
ATOM   913  C CA    . ASP B  1 61 ? -36.187 12.243 -65.571 1.00 64.10  ? 202 ASP B CA    1 
ATOM   914  C C     . ASP B  1 61 ? -36.948 12.726 -64.350 1.00 62.04  ? 202 ASP B C     1 
ATOM   915  O O     . ASP B  1 61 ? -37.923 13.464 -64.482 1.00 62.61  ? 202 ASP B O     1 
ATOM   916  C CB    . ASP B  1 61 ? -35.735 13.451 -66.429 1.00 66.32  ? 202 ASP B CB    1 
ATOM   917  C CG    . ASP B  1 61 ? -34.700 14.361 -65.701 1.00 66.37  ? 202 ASP B CG    1 
ATOM   918  O OD1   . ASP B  1 61 ? -34.469 14.207 -64.464 1.00 64.88  ? 202 ASP B OD1   1 
ATOM   919  O OD2   . ASP B  1 61 ? -34.115 15.241 -66.379 1.00 67.46  ? 202 ASP B OD2   1 
ATOM   920  N N     . LEU B  1 62 ? -36.482 12.313 -63.173 1.00 59.93  ? 203 LEU B N     1 
ATOM   921  C CA    . LEU B  1 62 ? -37.109 12.692 -61.920 1.00 58.88  ? 203 LEU B CA    1 
ATOM   922  C C     . LEU B  1 62 ? -36.322 13.782 -61.171 1.00 59.97  ? 203 LEU B C     1 
ATOM   923  O O     . LEU B  1 62 ? -36.683 14.127 -60.032 1.00 57.14  ? 203 LEU B O     1 
ATOM   924  C CB    . LEU B  1 62 ? -37.333 11.442 -61.060 1.00 55.82  ? 203 LEU B CB    1 
ATOM   925  C CG    . LEU B  1 62 ? -38.250 10.379 -61.705 1.00 55.76  ? 203 LEU B CG    1 
ATOM   926  C CD1   . LEU B  1 62 ? -38.462 9.162  -60.812 1.00 53.93  ? 203 LEU B CD1   1 
ATOM   927  C CD2   . LEU B  1 62 ? -39.600 10.944 -62.114 1.00 56.27  ? 203 LEU B CD2   1 
ATOM   928  N N     . SER B  1 63 ? -35.314 14.376 -61.828 1.00 62.77  ? 204 SER B N     1 
ATOM   929  C CA    . SER B  1 63 ? -34.550 15.495 -61.232 1.00 65.01  ? 204 SER B CA    1 
ATOM   930  C C     . SER B  1 63 ? -35.498 16.374 -60.424 1.00 64.47  ? 204 SER B C     1 
ATOM   931  O O     . SER B  1 63 ? -35.387 16.434 -59.205 1.00 62.04  ? 204 SER B O     1 
ATOM   932  C CB    . SER B  1 63 ? -33.812 16.335 -62.295 1.00 67.32  ? 204 SER B CB    1 
ATOM   933  N N     . SER B  1 64 ? -36.476 16.955 -61.126 1.00 65.79  ? 205 SER B N     1 
ATOM   934  C CA    . SER B  1 64 ? -37.400 17.967 -60.595 1.00 66.31  ? 205 SER B CA    1 
ATOM   935  C C     . SER B  1 64 ? -38.667 17.421 -59.920 1.00 63.66  ? 205 SER B C     1 
ATOM   936  O O     . SER B  1 64 ? -39.509 18.207 -59.499 1.00 64.11  ? 205 SER B O     1 
ATOM   937  C CB    . SER B  1 64 ? -37.819 18.910 -61.751 1.00 68.89  ? 205 SER B CB    1 
ATOM   938  N N     . PHE B  1 65 ? -38.798 16.093 -59.799 1.00 61.50  ? 206 PHE B N     1 
ATOM   939  C CA    . PHE B  1 65 ? -40.048 15.459 -59.378 1.00 58.92  ? 206 PHE B CA    1 
ATOM   940  C C     . PHE B  1 65 ? -40.186 15.566 -57.865 1.00 58.02  ? 206 PHE B C     1 
ATOM   941  O O     . PHE B  1 65 ? -39.314 15.100 -57.138 1.00 56.04  ? 206 PHE B O     1 
ATOM   942  C CB    . PHE B  1 65 ? -40.082 13.996 -59.826 1.00 57.75  ? 206 PHE B CB    1 
ATOM   943  C CG    . PHE B  1 65 ? -41.405 13.334 -59.609 1.00 56.53  ? 206 PHE B CG    1 
ATOM   944  C CD1   . PHE B  1 65 ? -42.522 13.751 -60.303 1.00 57.66  ? 206 PHE B CD1   1 
ATOM   945  C CD2   . PHE B  1 65 ? -41.543 12.302 -58.701 1.00 55.64  ? 206 PHE B CD2   1 
ATOM   946  C CE1   . PHE B  1 65 ? -43.756 13.159 -60.098 1.00 56.78  ? 206 PHE B CE1   1 
ATOM   947  C CE2   . PHE B  1 65 ? -42.786 11.716 -58.470 1.00 55.04  ? 206 PHE B CE2   1 
ATOM   948  C CZ    . PHE B  1 65 ? -43.893 12.152 -59.184 1.00 56.19  ? 206 PHE B CZ    1 
ATOM   949  N N     . ASP B  1 66 ? -41.234 16.232 -57.390 1.00 57.93  ? 207 ASP B N     1 
ATOM   950  C CA    . ASP B  1 66 ? -41.475 16.321 -55.949 1.00 59.13  ? 207 ASP B CA    1 
ATOM   951  C C     . ASP B  1 66 ? -42.384 15.143 -55.546 1.00 55.80  ? 207 ASP B C     1 
ATOM   952  O O     . ASP B  1 66 ? -43.544 15.043 -56.004 1.00 53.93  ? 207 ASP B O     1 
ATOM   953  C CB    . ASP B  1 66 ? -42.103 17.657 -55.569 1.00 63.00  ? 207 ASP B CB    1 
ATOM   954  C CG    . ASP B  1 66 ? -42.393 17.745 -54.081 1.00 64.40  ? 207 ASP B CG    1 
ATOM   955  O OD1   . ASP B  1 66 ? -41.437 17.634 -53.278 1.00 66.72  ? 207 ASP B OD1   1 
ATOM   956  O OD2   . ASP B  1 66 ? -43.578 17.890 -53.717 1.00 65.38  ? 207 ASP B OD2   1 
ATOM   957  N N     . PHE B  1 67 ? -41.858 14.234 -54.729 1.00 53.21  ? 208 PHE B N     1 
ATOM   958  C CA    . PHE B  1 67 ? -42.590 12.980 -54.471 1.00 53.19  ? 208 PHE B CA    1 
ATOM   959  C C     . PHE B  1 67 ? -43.953 13.153 -53.760 1.00 53.28  ? 208 PHE B C     1 
ATOM   960  O O     . PHE B  1 67 ? -44.936 12.472 -54.095 1.00 52.40  ? 208 PHE B O     1 
ATOM   961  C CB    . PHE B  1 67 ? -41.714 11.988 -53.680 1.00 50.74  ? 208 PHE B CB    1 
ATOM   962  C CG    . PHE B  1 67 ? -42.320 10.607 -53.546 1.00 48.08  ? 208 PHE B CG    1 
ATOM   963  C CD1   . PHE B  1 67 ? -43.218 10.328 -52.510 1.00 47.10  ? 208 PHE B CD1   1 
ATOM   964  C CD2   . PHE B  1 67 ? -41.977 9.591  -54.415 1.00 47.27  ? 208 PHE B CD2   1 
ATOM   965  C CE1   . PHE B  1 67 ? -43.757 9.044  -52.358 1.00 45.99  ? 208 PHE B CE1   1 
ATOM   966  C CE2   . PHE B  1 67 ? -42.513 8.322  -54.279 1.00 47.03  ? 208 PHE B CE2   1 
ATOM   967  C CZ    . PHE B  1 67 ? -43.393 8.040  -53.234 1.00 45.73  ? 208 PHE B CZ    1 
ATOM   968  N N     . ARG B  1 68 ? -43.989 14.044 -52.778 1.00 54.80  ? 209 ARG B N     1 
ATOM   969  C CA    . ARG B  1 68 ? -45.218 14.316 -52.012 1.00 54.71  ? 209 ARG B CA    1 
ATOM   970  C C     . ARG B  1 68 ? -46.376 14.872 -52.871 1.00 56.11  ? 209 ARG B C     1 
ATOM   971  O O     . ARG B  1 68 ? -47.482 14.320 -52.810 1.00 56.86  ? 209 ARG B O     1 
ATOM   972  C CB    . ARG B  1 68 ? -44.933 15.244 -50.813 1.00 54.10  ? 209 ARG B CB    1 
ATOM   973  C CG    . ARG B  1 68 ? -46.177 15.575 -49.966 1.00 55.23  ? 209 ARG B CG    1 
ATOM   974  C CD    . ARG B  1 68 ? -45.882 15.914 -48.499 1.00 53.78  ? 209 ARG B CD    1 
ATOM   975  N NE    . ARG B  1 68 ? -45.337 14.765 -47.752 1.00 50.54  ? 209 ARG B NE    1 
ATOM   976  C CZ    . ARG B  1 68 ? -46.059 13.804 -47.170 1.00 48.87  ? 209 ARG B CZ    1 
ATOM   977  N NH1   . ARG B  1 68 ? -47.397 13.772 -47.225 1.00 46.90  ? 209 ARG B NH1   1 
ATOM   978  N NH2   . ARG B  1 68 ? -45.414 12.835 -46.543 1.00 47.40  ? 209 ARG B NH2   1 
ATOM   979  N N     . THR B  1 69 ? -46.133 15.943 -53.639 1.00 56.93  ? 210 THR B N     1 
ATOM   980  C CA    . THR B  1 69 ? -47.215 16.623 -54.394 1.00 58.77  ? 210 THR B CA    1 
ATOM   981  C C     . THR B  1 69 ? -47.542 15.935 -55.714 1.00 60.30  ? 210 THR B C     1 
ATOM   982  O O     . THR B  1 69 ? -48.649 16.070 -56.228 1.00 60.92  ? 210 THR B O     1 
ATOM   983  C CB    . THR B  1 69 ? -46.868 18.083 -54.749 1.00 60.78  ? 210 THR B CB    1 
ATOM   984  O OG1   . THR B  1 69 ? -45.633 18.136 -55.470 1.00 59.39  ? 210 THR B OG1   1 
ATOM   985  C CG2   . THR B  1 69 ? -46.754 18.947 -53.495 1.00 61.64  ? 210 THR B CG2   1 
ATOM   986  N N     . GLY B  1 70 ? -46.558 15.247 -56.293 1.00 61.30  ? 211 GLY B N     1 
ATOM   987  C CA    . GLY B  1 70 ? -46.739 14.557 -57.597 1.00 63.12  ? 211 GLY B CA    1 
ATOM   988  C C     . GLY B  1 70 ? -46.637 15.417 -58.842 1.00 64.14  ? 211 GLY B C     1 
ATOM   989  O O     . GLY B  1 70 ? -47.328 15.181 -59.827 1.00 65.44  ? 211 GLY B O     1 
ATOM   990  N N     . LYS B  1 71 ? -45.720 16.373 -58.790 1.00 64.36  ? 212 LYS B N     1 
ATOM   991  C CA    . LYS B  1 71 ? -45.633 17.465 -59.747 1.00 66.34  ? 212 LYS B CA    1 
ATOM   992  C C     . LYS B  1 71 ? -44.155 17.841 -59.855 1.00 65.77  ? 212 LYS B C     1 
ATOM   993  O O     . LYS B  1 71 ? -43.402 17.681 -58.898 1.00 64.99  ? 212 LYS B O     1 
ATOM   994  C CB    . LYS B  1 71 ? -46.463 18.694 -59.256 1.00 68.27  ? 212 LYS B CB    1 
ATOM   995  C CG    . LYS B  1 71 ? -47.988 18.500 -59.142 1.00 68.29  ? 212 LYS B CG    1 
ATOM   996  N N     . MET B  1 72 ? -43.759 18.340 -61.018 1.00 67.15  ? 213 MET B N     1 
ATOM   997  C CA    . MET B  1 72 ? -42.398 18.804 -61.303 1.00 67.00  ? 213 MET B CA    1 
ATOM   998  C C     . MET B  1 72 ? -42.344 20.269 -60.878 1.00 70.87  ? 213 MET B C     1 
ATOM   999  O O     . MET B  1 72 ? -43.292 20.993 -61.126 1.00 74.33  ? 213 MET B O     1 
ATOM   1000 C CB    . MET B  1 72 ? -42.124 18.687 -62.812 1.00 66.88  ? 213 MET B CB    1 
ATOM   1001 C CG    . MET B  1 72 ? -42.339 17.301 -63.415 1.00 63.41  ? 213 MET B CG    1 
ATOM   1002 S SD    . MET B  1 72 ? -41.101 16.109 -62.852 1.00 59.20  ? 213 MET B SD    1 
ATOM   1003 C CE    . MET B  1 72 ? -41.368 14.787 -64.057 1.00 59.24  ? 213 MET B CE    1 
ATOM   1004 N N     . MET B  1 73 ? -41.259 20.697 -60.238 1.00 73.01  ? 214 MET B N     1 
ATOM   1005 C CA    . MET B  1 73 ? -41.163 22.041 -59.625 1.00 78.03  ? 214 MET B CA    1 
ATOM   1006 C C     . MET B  1 73 ? -39.868 22.710 -60.119 1.00 82.72  ? 214 MET B C     1 
ATOM   1007 O O     . MET B  1 73 ? -38.857 22.019 -60.289 1.00 83.08  ? 214 MET B O     1 
ATOM   1008 C CB    . MET B  1 73 ? -41.206 21.934 -58.076 1.00 75.71  ? 214 MET B CB    1 
ATOM   1009 N N     . PRO B  1 74 ? -39.888 24.038 -60.386 1.00 88.48  ? 215 PRO B N     1 
ATOM   1010 C CA    . PRO B  1 74 ? -38.668 24.688 -60.939 1.00 92.43  ? 215 PRO B CA    1 
ATOM   1011 C C     . PRO B  1 74 ? -37.466 24.757 -59.982 1.00 92.96  ? 215 PRO B C     1 
ATOM   1012 O O     . PRO B  1 74 ? -36.344 24.999 -60.440 1.00 95.20  ? 215 PRO B O     1 
ATOM   1013 C CB    . PRO B  1 74 ? -39.148 26.101 -61.312 1.00 96.75  ? 215 PRO B CB    1 
ATOM   1014 C CG    . PRO B  1 74 ? -40.411 26.300 -60.542 1.00 95.75  ? 215 PRO B CG    1 
ATOM   1015 C CD    . PRO B  1 74 ? -41.047 24.949 -60.415 1.00 91.01  ? 215 PRO B CD    1 
ATOM   1016 O "O5'" . DC  C  2 1  ? -50.195 5.689  -38.301 1.00 43.87  ? 1   DC  C "O5'" 1 
ATOM   1017 C "C5'" . DC  C  2 1  ? -50.274 4.769  -37.180 1.00 42.13  ? 1   DC  C "C5'" 1 
ATOM   1018 C "C4'" . DC  C  2 1  ? -48.935 4.612  -36.481 1.00 38.44  ? 1   DC  C "C4'" 1 
ATOM   1019 O "O4'" . DC  C  2 1  ? -48.031 3.805  -37.277 1.00 33.83  ? 1   DC  C "O4'" 1 
ATOM   1020 C "C3'" . DC  C  2 1  ? -48.182 5.896  -36.179 1.00 36.20  ? 1   DC  C "C3'" 1 
ATOM   1021 O "O3'" . DC  C  2 1  ? -47.594 5.756  -34.876 1.00 36.28  ? 1   DC  C "O3'" 1 
ATOM   1022 C "C2'" . DC  C  2 1  ? -47.253 6.001  -37.372 1.00 34.32  ? 1   DC  C "C2'" 1 
ATOM   1023 C "C1'" . DC  C  2 1  ? -46.905 4.548  -37.669 1.00 33.35  ? 1   DC  C "C1'" 1 
ATOM   1024 N N1    . DC  C  2 1  ? -46.593 4.215  -39.089 1.00 30.31  ? 1   DC  C N1    1 
ATOM   1025 C C2    . DC  C  2 1  ? -45.425 3.491  -39.381 1.00 30.22  ? 1   DC  C C2    1 
ATOM   1026 O O2    . DC  C  2 1  ? -44.654 3.177  -38.447 1.00 30.41  ? 1   DC  C O2    1 
ATOM   1027 N N3    . DC  C  2 1  ? -45.112 3.232  -40.679 1.00 28.28  ? 1   DC  C N3    1 
ATOM   1028 C C4    . DC  C  2 1  ? -45.913 3.666  -41.658 1.00 30.32  ? 1   DC  C C4    1 
ATOM   1029 N N4    . DC  C  2 1  ? -45.570 3.391  -42.913 1.00 29.50  ? 1   DC  C N4    1 
ATOM   1030 C C5    . DC  C  2 1  ? -47.112 4.396  -41.387 1.00 31.39  ? 1   DC  C C5    1 
ATOM   1031 C C6    . DC  C  2 1  ? -47.399 4.660  -40.099 1.00 31.92  ? 1   DC  C C6    1 
ATOM   1032 P P     . DG  C  2 2  ? -46.544 6.837  -34.294 1.00 36.70  ? 2   DG  C P     1 
ATOM   1033 O OP1   . DG  C  2 2  ? -46.823 6.996  -32.844 1.00 40.64  ? 2   DG  C OP1   1 
ATOM   1034 O OP2   . DG  C  2 2  ? -46.551 8.080  -35.105 1.00 35.36  ? 2   DG  C OP2   1 
ATOM   1035 O "O5'" . DG  C  2 2  ? -45.153 6.084  -34.440 1.00 36.15  ? 2   DG  C "O5'" 1 
ATOM   1036 C "C5'" . DG  C  2 2  ? -45.028 4.704  -34.075 1.00 38.00  ? 2   DG  C "C5'" 1 
ATOM   1037 C "C4'" . DG  C  2 2  ? -43.579 4.303  -33.950 1.00 38.80  ? 2   DG  C "C4'" 1 
ATOM   1038 O "O4'" . DG  C  2 2  ? -43.011 3.995  -35.257 1.00 36.73  ? 2   DG  C "O4'" 1 
ATOM   1039 C "C3'" . DG  C  2 2  ? -42.655 5.358  -33.336 1.00 36.97  ? 2   DG  C "C3'" 1 
ATOM   1040 O "O3'" . DG  C  2 2  ? -41.689 4.560  -32.671 1.00 39.73  ? 2   DG  C "O3'" 1 
ATOM   1041 C "C2'" . DG  C  2 2  ? -42.030 6.041  -34.540 1.00 35.20  ? 2   DG  C "C2'" 1 
ATOM   1042 C "C1'" . DG  C  2 2  ? -42.041 4.982  -35.635 1.00 33.66  ? 2   DG  C "C1'" 1 
ATOM   1043 N N9    . DG  C  2 2  ? -42.415 5.435  -36.968 1.00 31.12  ? 2   DG  C N9    1 
ATOM   1044 C C8    . DG  C  2 2  ? -43.513 6.187  -37.305 1.00 31.33  ? 2   DG  C C8    1 
ATOM   1045 N N7    . DG  C  2 2  ? -43.673 6.311  -38.594 1.00 30.07  ? 2   DG  C N7    1 
ATOM   1046 C C5    . DG  C  2 2  ? -42.643 5.562  -39.142 1.00 29.22  ? 2   DG  C C5    1 
ATOM   1047 C C6    . DG  C  2 2  ? -42.309 5.320  -40.497 1.00 28.85  ? 2   DG  C C6    1 
ATOM   1048 O O6    . DG  C  2 2  ? -42.889 5.708  -41.507 1.00 30.77  ? 2   DG  C O6    1 
ATOM   1049 N N1    . DG  C  2 2  ? -41.184 4.516  -40.615 1.00 29.40  ? 2   DG  C N1    1 
ATOM   1050 C C2    . DG  C  2 2  ? -40.471 3.993  -39.556 1.00 31.54  ? 2   DG  C C2    1 
ATOM   1051 N N2    . DG  C  2 2  ? -39.416 3.238  -39.877 1.00 31.98  ? 2   DG  C N2    1 
ATOM   1052 N N3    . DG  C  2 2  ? -40.780 4.199  -38.281 1.00 29.49  ? 2   DG  C N3    1 
ATOM   1053 C C4    . DG  C  2 2  ? -41.863 5.004  -38.151 1.00 30.51  ? 2   DG  C C4    1 
ATOM   1054 P P     . DG  C  2 3  ? -40.615 5.189  -31.698 1.00 39.30  ? 3   DG  C P     1 
ATOM   1055 O OP1   . DG  C  2 3  ? -40.150 4.064  -30.866 1.00 40.96  ? 3   DG  C OP1   1 
ATOM   1056 O OP2   . DG  C  2 3  ? -41.156 6.438  -31.142 1.00 36.65  ? 3   DG  C OP2   1 
ATOM   1057 O "O5'" . DG  C  2 3  ? -39.430 5.623  -32.682 1.00 37.04  ? 3   DG  C "O5'" 1 
ATOM   1058 C "C5'" . DG  C  2 3  ? -38.478 4.637  -33.147 1.00 35.69  ? 3   DG  C "C5'" 1 
ATOM   1059 C "C4'" . DG  C  2 3  ? -37.486 5.298  -34.075 1.00 34.03  ? 3   DG  C "C4'" 1 
ATOM   1060 O "O4'" . DG  C  2 3  ? -38.126 5.698  -35.314 1.00 31.43  ? 3   DG  C "O4'" 1 
ATOM   1061 C "C3'" . DG  C  2 3  ? -36.879 6.570  -33.489 1.00 34.61  ? 3   DG  C "C3'" 1 
ATOM   1062 O "O3'" . DG  C  2 3  ? -35.528 6.600  -33.921 1.00 36.71  ? 3   DG  C "O3'" 1 
ATOM   1063 C "C2'" . DG  C  2 3  ? -37.669 7.687  -34.141 1.00 32.87  ? 3   DG  C "C2'" 1 
ATOM   1064 C "C1'" . DG  C  2 3  ? -37.893 7.094  -35.518 1.00 31.32  ? 3   DG  C "C1'" 1 
ATOM   1065 N N9    . DG  C  2 3  ? -38.954 7.623  -36.368 1.00 29.35  ? 3   DG  C N9    1 
ATOM   1066 C C8    . DG  C  2 3  ? -40.026 8.428  -36.046 1.00 29.07  ? 3   DG  C C8    1 
ATOM   1067 N N7    . DG  C  2 3  ? -40.777 8.714  -37.078 1.00 28.36  ? 3   DG  C N7    1 
ATOM   1068 C C5    . DG  C  2 3  ? -40.120 8.122  -38.156 1.00 27.46  ? 3   DG  C C5    1 
ATOM   1069 C C6    . DG  C  2 3  ? -40.425 8.125  -39.551 1.00 27.12  ? 3   DG  C C6    1 
ATOM   1070 O O6    . DG  C  2 3  ? -41.373 8.646  -40.135 1.00 26.61  ? 3   DG  C O6    1 
ATOM   1071 N N1    . DG  C  2 3  ? -39.503 7.387  -40.276 1.00 27.00  ? 3   DG  C N1    1 
ATOM   1072 C C2    . DG  C  2 3  ? -38.404 6.766  -39.751 1.00 26.93  ? 3   DG  C C2    1 
ATOM   1073 N N2    . DG  C  2 3  ? -37.604 6.151  -40.627 1.00 26.97  ? 3   DG  C N2    1 
ATOM   1074 N N3    . DG  C  2 3  ? -38.080 6.793  -38.471 1.00 28.52  ? 3   DG  C N3    1 
ATOM   1075 C C4    . DG  C  2 3  ? -38.993 7.454  -37.733 1.00 28.56  ? 3   DG  C C4    1 
ATOM   1076 P P     . DA  C  2 4  ? -34.396 6.817  -32.877 1.00 40.58  ? 4   DA  C P     1 
ATOM   1077 O OP1   . DA  C  2 4  ? -34.529 5.774  -31.877 1.00 40.19  ? 4   DA  C OP1   1 
ATOM   1078 O OP2   . DA  C  2 4  ? -34.381 8.256  -32.502 1.00 41.31  ? 4   DA  C OP2   1 
ATOM   1079 O "O5'" . DA  C  2 4  ? -33.087 6.523  -33.736 1.00 41.34  ? 4   DA  C "O5'" 1 
ATOM   1080 C "C5'" . DA  C  2 4  ? -32.953 5.259  -34.414 1.00 41.01  ? 4   DA  C "C5'" 1 
ATOM   1081 C "C4'" . DA  C  2 4  ? -32.330 5.433  -35.780 1.00 39.16  ? 4   DA  C "C4'" 1 
ATOM   1082 O "O4'" . DA  C  2 4  ? -33.248 6.052  -36.716 1.00 34.55  ? 4   DA  C "O4'" 1 
ATOM   1083 C "C3'" . DA  C  2 4  ? -31.077 6.306  -35.782 1.00 39.73  ? 4   DA  C "C3'" 1 
ATOM   1084 O "O3'" . DA  C  2 4  ? -30.210 5.730  -36.756 1.00 41.65  ? 4   DA  C "O3'" 1 
ATOM   1085 C "C2'" . DA  C  2 4  ? -31.613 7.673  -36.171 1.00 36.60  ? 4   DA  C "C2'" 1 
ATOM   1086 C "C1'" . DA  C  2 4  ? -32.754 7.326  -37.125 1.00 33.36  ? 4   DA  C "C1'" 1 
ATOM   1087 N N9    . DA  C  2 4  ? -33.881 8.251  -37.117 1.00 32.11  ? 4   DA  C N9    1 
ATOM   1088 C C8    . DA  C  2 4  ? -34.429 8.948  -36.070 1.00 30.96  ? 4   DA  C C8    1 
ATOM   1089 N N7    . DA  C  2 4  ? -35.484 9.658  -36.401 1.00 32.94  ? 4   DA  C N7    1 
ATOM   1090 C C5    . DA  C  2 4  ? -35.660 9.387  -37.750 1.00 30.94  ? 4   DA  C C5    1 
ATOM   1091 C C6    . DA  C  2 4  ? -36.617 9.813  -38.689 1.00 30.28  ? 4   DA  C C6    1 
ATOM   1092 N N6    . DA  C  2 4  ? -37.621 10.645 -38.413 1.00 27.64  ? 4   DA  C N6    1 
ATOM   1093 N N1    . DA  C  2 4  ? -36.472 9.388  -39.962 1.00 33.26  ? 4   DA  C N1    1 
ATOM   1094 C C2    . DA  C  2 4  ? -35.480 8.538  -40.246 1.00 31.71  ? 4   DA  C C2    1 
ATOM   1095 N N3    . DA  C  2 4  ? -34.556 8.026  -39.442 1.00 32.09  ? 4   DA  C N3    1 
ATOM   1096 C C4    . DA  C  2 4  ? -34.676 8.527  -38.205 1.00 32.48  ? 4   DA  C C4    1 
ATOM   1097 P P     . DG  C  2 5  ? -28.817 6.431  -37.148 1.00 47.49  ? 5   DG  C P     1 
ATOM   1098 O OP1   . DG  C  2 5  ? -27.954 5.374  -37.723 1.00 47.07  ? 5   DG  C OP1   1 
ATOM   1099 O OP2   . DG  C  2 5  ? -28.375 7.356  -36.034 1.00 45.54  ? 5   DG  C OP2   1 
ATOM   1100 O "O5'" . DG  C  2 5  ? -29.212 7.361  -38.381 1.00 44.72  ? 5   DG  C "O5'" 1 
ATOM   1101 C "C5'" . DG  C  2 5  ? -29.700 6.778  -39.627 1.00 41.89  ? 5   DG  C "C5'" 1 
ATOM   1102 C "C4'" . DG  C  2 5  ? -29.960 7.889  -40.618 1.00 37.87  ? 5   DG  C "C4'" 1 
ATOM   1103 O "O4'" . DG  C  2 5  ? -31.126 8.611  -40.180 1.00 31.89  ? 5   DG  C "O4'" 1 
ATOM   1104 C "C3'" . DG  C  2 5  ? -28.823 8.921  -40.726 1.00 37.79  ? 5   DG  C "C3'" 1 
ATOM   1105 O "O3'" . DG  C  2 5  ? -28.387 8.978  -42.094 1.00 40.94  ? 5   DG  C "O3'" 1 
ATOM   1106 C "C2'" . DG  C  2 5  ? -29.425 10.182 -40.133 1.00 34.61  ? 5   DG  C "C2'" 1 
ATOM   1107 C "C1'" . DG  C  2 5  ? -30.902 9.985  -40.356 1.00 32.08  ? 5   DG  C "C1'" 1 
ATOM   1108 N N9    . DG  C  2 5  ? -31.788 10.697 -39.448 1.00 31.29  ? 5   DG  C N9    1 
ATOM   1109 C C8    . DG  C  2 5  ? -31.685 10.774 -38.080 1.00 30.29  ? 5   DG  C C8    1 
ATOM   1110 N N7    . DG  C  2 5  ? -32.661 11.444 -37.531 1.00 28.58  ? 5   DG  C N7    1 
ATOM   1111 C C5    . DG  C  2 5  ? -33.488 11.776 -38.589 1.00 27.45  ? 5   DG  C C5    1 
ATOM   1112 C C6    . DG  C  2 5  ? -34.684 12.522 -38.608 1.00 29.03  ? 5   DG  C C6    1 
ATOM   1113 O O6    . DG  C  2 5  ? -35.330 12.970 -37.644 1.00 29.52  ? 5   DG  C O6    1 
ATOM   1114 N N1    . DG  C  2 5  ? -35.177 12.666 -39.905 1.00 28.55  ? 5   DG  C N1    1 
ATOM   1115 C C2    . DG  C  2 5  ? -34.613 12.114 -41.027 1.00 28.89  ? 5   DG  C C2    1 
ATOM   1116 N N2    . DG  C  2 5  ? -35.244 12.330 -42.184 1.00 27.98  ? 5   DG  C N2    1 
ATOM   1117 N N3    . DG  C  2 5  ? -33.482 11.430 -41.022 1.00 32.42  ? 5   DG  C N3    1 
ATOM   1118 C C4    . DG  C  2 5  ? -32.972 11.311 -39.779 1.00 30.50  ? 5   DG  C C4    1 
ATOM   1119 P P     . DT  C  2 6  ? -27.349 10.076 -42.675 1.00 43.02  ? 6   DT  C P     1 
ATOM   1120 O OP1   . DT  C  2 6  ? -26.498 9.392  -43.680 1.00 46.70  ? 6   DT  C OP1   1 
ATOM   1121 O OP2   . DT  C  2 6  ? -26.657 10.808 -41.583 1.00 49.18  ? 6   DT  C OP2   1 
ATOM   1122 O "O5'" . DT  C  2 6  ? -28.335 11.210 -43.215 1.00 41.29  ? 6   DT  C "O5'" 1 
ATOM   1123 C "C5'" . DT  C  2 6  ? -29.105 10.929 -44.386 1.00 41.21  ? 6   DT  C "C5'" 1 
ATOM   1124 C "C4'" . DT  C  2 6  ? -29.967 12.103 -44.783 1.00 39.71  ? 6   DT  C "C4'" 1 
ATOM   1125 O "O4'" . DT  C  2 6  ? -30.879 12.417 -43.703 1.00 36.81  ? 6   DT  C "O4'" 1 
ATOM   1126 C "C3'" . DT  C  2 6  ? -29.253 13.412 -45.149 1.00 39.94  ? 6   DT  C "C3'" 1 
ATOM   1127 O "O3'" . DT  C  2 6  ? -29.816 13.915 -46.385 1.00 40.93  ? 6   DT  C "O3'" 1 
ATOM   1128 C "C2'" . DT  C  2 6  ? -29.513 14.285 -43.937 1.00 36.25  ? 6   DT  C "C2'" 1 
ATOM   1129 C "C1'" . DT  C  2 6  ? -30.883 13.811 -43.498 1.00 35.22  ? 6   DT  C "C1'" 1 
ATOM   1130 N N1    . DT  C  2 6  ? -31.225 14.066 -42.067 1.00 33.70  ? 6   DT  C N1    1 
ATOM   1131 C C2    . DT  C  2 6  ? -32.428 14.690 -41.819 1.00 31.66  ? 6   DT  C C2    1 
ATOM   1132 O O2    . DT  C  2 6  ? -33.173 15.066 -42.707 1.00 34.65  ? 6   DT  C O2    1 
ATOM   1133 N N3    . DT  C  2 6  ? -32.683 14.938 -40.494 1.00 30.85  ? 6   DT  C N3    1 
ATOM   1134 C C4    . DT  C  2 6  ? -31.881 14.607 -39.416 1.00 30.06  ? 6   DT  C C4    1 
ATOM   1135 O O4    . DT  C  2 6  ? -32.231 14.900 -38.288 1.00 28.97  ? 6   DT  C O4    1 
ATOM   1136 C C5    . DT  C  2 6  ? -30.669 13.902 -39.741 1.00 32.86  ? 6   DT  C C5    1 
ATOM   1137 C C7    . DT  C  2 6  ? -29.751 13.496 -38.629 1.00 32.88  ? 6   DT  C C7    1 
ATOM   1138 C C6    . DT  C  2 6  ? -30.380 13.709 -41.039 1.00 31.71  ? 6   DT  C C6    1 
ATOM   1139 P P     . DG  C  2 7  ? -29.502 15.391 -46.952 1.00 40.86  ? 7   DG  C P     1 
ATOM   1140 O OP1   . DG  C  2 7  ? -29.266 15.270 -48.445 1.00 45.93  ? 7   DG  C OP1   1 
ATOM   1141 O OP2   . DG  C  2 7  ? -28.506 16.089 -46.079 1.00 41.00  ? 7   DG  C OP2   1 
ATOM   1142 O "O5'" . DG  C  2 7  ? -30.880 16.171 -46.746 1.00 41.08  ? 7   DG  C "O5'" 1 
ATOM   1143 C "C5'" . DG  C  2 7  ? -32.156 15.577 -47.121 1.00 41.90  ? 7   DG  C "C5'" 1 
ATOM   1144 C "C4'" . DG  C  2 7  ? -33.282 16.583 -46.982 1.00 41.49  ? 7   DG  C "C4'" 1 
ATOM   1145 O "O4'" . DG  C  2 7  ? -33.574 16.813 -45.575 1.00 39.32  ? 7   DG  C "O4'" 1 
ATOM   1146 C "C3'" . DG  C  2 7  ? -33.047 17.976 -47.570 1.00 42.62  ? 7   DG  C "C3'" 1 
ATOM   1147 O "O3'" . DG  C  2 7  ? -34.369 18.434 -47.918 1.00 43.39  ? 7   DG  C "O3'" 1 
ATOM   1148 C "C2'" . DG  C  2 7  ? -32.431 18.723 -46.393 1.00 41.18  ? 7   DG  C "C2'" 1 
ATOM   1149 C "C1'" . DG  C  2 7  ? -33.218 18.155 -45.193 1.00 38.10  ? 7   DG  C "C1'" 1 
ATOM   1150 N N9    . DG  C  2 7  ? -32.550 18.080 -43.878 1.00 36.50  ? 7   DG  C N9    1 
ATOM   1151 C C8    . DG  C  2 7  ? -31.384 17.402 -43.614 1.00 35.52  ? 7   DG  C C8    1 
ATOM   1152 N N7    . DG  C  2 7  ? -31.037 17.450 -42.358 1.00 35.16  ? 7   DG  C N7    1 
ATOM   1153 C C5    . DG  C  2 7  ? -32.051 18.173 -41.746 1.00 33.66  ? 7   DG  C C5    1 
ATOM   1154 C C6    . DG  C  2 7  ? -32.251 18.503 -40.369 1.00 31.43  ? 7   DG  C C6    1 
ATOM   1155 O O6    . DG  C  2 7  ? -31.517 18.264 -39.407 1.00 32.41  ? 7   DG  C O6    1 
ATOM   1156 N N1    . DG  C  2 7  ? -33.413 19.243 -40.183 1.00 29.68  ? 7   DG  C N1    1 
ATOM   1157 C C2    . DG  C  2 7  ? -34.295 19.593 -41.185 1.00 31.79  ? 7   DG  C C2    1 
ATOM   1158 N N2    . DG  C  2 7  ? -35.365 20.316 -40.813 1.00 29.78  ? 7   DG  C N2    1 
ATOM   1159 N N3    . DG  C  2 7  ? -34.094 19.331 -42.472 1.00 33.12  ? 7   DG  C N3    1 
ATOM   1160 C C4    . DG  C  2 7  ? -32.987 18.581 -42.672 1.00 32.24  ? 7   DG  C C4    1 
ATOM   1161 P P     . DT  C  2 8  ? -34.672 19.784 -48.813 1.00 47.01  ? 8   DT  C P     1 
ATOM   1162 O OP1   . DT  C  2 8  ? -35.987 19.580 -49.490 1.00 50.19  ? 8   DT  C OP1   1 
ATOM   1163 O OP2   . DT  C  2 8  ? -33.459 20.159 -49.624 1.00 49.70  ? 8   DT  C OP2   1 
ATOM   1164 O "O5'" . DT  C  2 8  ? -34.955 20.909 -47.731 1.00 47.71  ? 8   DT  C "O5'" 1 
ATOM   1165 C "C5'" . DT  C  2 8  ? -35.943 20.728 -46.697 1.00 46.57  ? 8   DT  C "C5'" 1 
ATOM   1166 C "C4'" . DT  C  2 8  ? -35.976 21.938 -45.786 1.00 48.01  ? 8   DT  C "C4'" 1 
ATOM   1167 O "O4'" . DT  C  2 8  ? -35.159 21.733 -44.606 1.00 44.49  ? 8   DT  C "O4'" 1 
ATOM   1168 C "C3'" . DT  C  2 8  ? -35.517 23.263 -46.406 1.00 50.59  ? 8   DT  C "C3'" 1 
ATOM   1169 O "O3'" . DT  C  2 8  ? -36.595 24.173 -46.190 1.00 55.41  ? 8   DT  C "O3'" 1 
ATOM   1170 C "C2'" . DT  C  2 8  ? -34.272 23.645 -45.611 1.00 48.41  ? 8   DT  C "C2'" 1 
ATOM   1171 C "C1'" . DT  C  2 8  ? -34.494 22.943 -44.268 1.00 44.70  ? 8   DT  C "C1'" 1 
ATOM   1172 N N1    . DT  C  2 8  ? -33.295 22.579 -43.460 1.00 39.79  ? 8   DT  C N1    1 
ATOM   1173 C C2    . DT  C  2 8  ? -33.318 22.777 -42.093 1.00 36.54  ? 8   DT  C C2    1 
ATOM   1174 O O2    . DT  C  2 8  ? -34.228 23.340 -41.513 1.00 37.82  ? 8   DT  C O2    1 
ATOM   1175 N N3    . DT  C  2 8  ? -32.199 22.339 -41.434 1.00 33.06  ? 8   DT  C N3    1 
ATOM   1176 C C4    . DT  C  2 8  ? -31.122 21.674 -41.975 1.00 34.22  ? 8   DT  C C4    1 
ATOM   1177 O O4    . DT  C  2 8  ? -30.194 21.330 -41.255 1.00 35.95  ? 8   DT  C O4    1 
ATOM   1178 C C5    . DT  C  2 8  ? -31.161 21.492 -43.410 1.00 35.29  ? 8   DT  C C5    1 
ATOM   1179 C C7    . DT  C  2 8  ? -29.997 20.844 -44.091 1.00 34.68  ? 8   DT  C C7    1 
ATOM   1180 C C6    . DT  C  2 8  ? -32.242 21.925 -44.069 1.00 37.54  ? 8   DT  C C6    1 
ATOM   1181 P P     . DG  C  2 9  ? -36.854 25.425 -47.168 1.00 59.14  ? 9   DG  C P     1 
ATOM   1182 O OP1   . DG  C  2 9  ? -38.200 25.222 -47.754 1.00 60.22  ? 9   DG  C OP1   1 
ATOM   1183 O OP2   . DG  C  2 9  ? -35.658 25.617 -48.019 1.00 58.49  ? 9   DG  C OP2   1 
ATOM   1184 O "O5'" . DG  C  2 9  ? -36.845 26.687 -46.196 1.00 58.92  ? 9   DG  C "O5'" 1 
ATOM   1185 C "C5'" . DG  C  2 9  ? -37.531 26.694 -44.933 1.00 57.31  ? 9   DG  C "C5'" 1 
ATOM   1186 C "C4'" . DG  C  2 9  ? -36.842 27.640 -43.977 1.00 57.73  ? 9   DG  C "C4'" 1 
ATOM   1187 O "O4'" . DG  C  2 9  ? -35.721 26.982 -43.348 1.00 54.23  ? 9   DG  C "O4'" 1 
ATOM   1188 C "C3'" . DG  C  2 9  ? -36.260 28.913 -44.592 1.00 60.59  ? 9   DG  C "C3'" 1 
ATOM   1189 O "O3'" . DG  C  2 9  ? -36.429 29.950 -43.623 1.00 63.66  ? 9   DG  C "O3'" 1 
ATOM   1190 C "C2'" . DG  C  2 9  ? -34.779 28.598 -44.698 1.00 57.51  ? 9   DG  C "C2'" 1 
ATOM   1191 C "C1'" . DG  C  2 9  ? -34.613 27.855 -43.393 1.00 52.25  ? 9   DG  C "C1'" 1 
ATOM   1192 N N9    . DG  C  2 9  ? -33.414 27.050 -43.202 1.00 48.24  ? 9   DG  C N9    1 
ATOM   1193 C C8    . DG  C  2 9  ? -32.603 26.485 -44.159 1.00 46.96  ? 9   DG  C C8    1 
ATOM   1194 N N7    . DG  C  2 9  ? -31.622 25.789 -43.648 1.00 45.74  ? 9   DG  C N7    1 
ATOM   1195 C C5    . DG  C  2 9  ? -31.788 25.915 -42.275 1.00 41.22  ? 9   DG  C C5    1 
ATOM   1196 C C6    . DG  C  2 9  ? -31.030 25.379 -41.205 1.00 39.70  ? 9   DG  C C6    1 
ATOM   1197 O O6    . DG  C  2 9  ? -30.026 24.663 -41.257 1.00 42.38  ? 9   DG  C O6    1 
ATOM   1198 N N1    . DG  C  2 9  ? -31.543 25.759 -39.969 1.00 37.14  ? 9   DG  C N1    1 
ATOM   1199 C C2    . DG  C  2 9  ? -32.656 26.536 -39.784 1.00 39.29  ? 9   DG  C C2    1 
ATOM   1200 N N2    . DG  C  2 9  ? -33.000 26.789 -38.509 1.00 39.06  ? 9   DG  C N2    1 
ATOM   1201 N N3    . DG  C  2 9  ? -33.386 27.027 -40.776 1.00 42.07  ? 9   DG  C N3    1 
ATOM   1202 C C4    . DG  C  2 9  ? -32.895 26.680 -41.984 1.00 42.79  ? 9   DG  C C4    1 
ATOM   1203 P P     . DG  C  2 10 ? -37.308 31.250 -43.955 1.00 67.40  ? 10  DG  C P     1 
ATOM   1204 O OP1   . DG  C  2 10 ? -38.706 30.809 -44.179 1.00 67.83  ? 10  DG  C OP1   1 
ATOM   1205 O OP2   . DG  C  2 10 ? -36.575 32.064 -44.966 1.00 66.92  ? 10  DG  C OP2   1 
ATOM   1206 O "O5'" . DG  C  2 10 ? -37.340 31.979 -42.541 1.00 66.98  ? 10  DG  C "O5'" 1 
ATOM   1207 C "C5'" . DG  C  2 10 ? -37.973 31.341 -41.407 1.00 63.91  ? 10  DG  C "C5'" 1 
ATOM   1208 C "C4'" . DG  C  2 10 ? -37.161 31.593 -40.157 1.00 60.06  ? 10  DG  C "C4'" 1 
ATOM   1209 O "O4'" . DG  C  2 10 ? -35.931 30.829 -40.227 1.00 56.50  ? 10  DG  C "O4'" 1 
ATOM   1210 C "C3'" . DG  C  2 10 ? -36.759 33.055 -39.932 1.00 61.93  ? 10  DG  C "C3'" 1 
ATOM   1211 O "O3'" . DG  C  2 10 ? -37.066 33.453 -38.583 1.00 60.82  ? 10  DG  C "O3'" 1 
ATOM   1212 C "C2'" . DG  C  2 10 ? -35.294 33.097 -40.353 1.00 59.49  ? 10  DG  C "C2'" 1 
ATOM   1213 C "C1'" . DG  C  2 10 ? -34.797 31.677 -40.096 1.00 54.81  ? 10  DG  C "C1'" 1 
ATOM   1214 N N9    . DG  C  2 10 ? -33.779 31.173 -41.009 1.00 51.73  ? 10  DG  C N9    1 
ATOM   1215 C C8    . DG  C  2 10 ? -33.780 31.269 -42.379 1.00 53.95  ? 10  DG  C C8    1 
ATOM   1216 N N7    . DG  C  2 10 ? -32.746 30.695 -42.934 1.00 53.61  ? 10  DG  C N7    1 
ATOM   1217 C C5    . DG  C  2 10 ? -32.034 30.159 -41.867 1.00 49.71  ? 10  DG  C C5    1 
ATOM   1218 C C6    . DG  C  2 10 ? -30.827 29.409 -41.850 1.00 46.32  ? 10  DG  C C6    1 
ATOM   1219 O O6    . DG  C  2 10 ? -30.144 29.028 -42.805 1.00 45.87  ? 10  DG  C O6    1 
ATOM   1220 N N1    . DG  C  2 10 ? -30.454 29.069 -40.553 1.00 43.64  ? 10  DG  C N1    1 
ATOM   1221 C C2    . DG  C  2 10 ? -31.151 29.402 -39.417 1.00 43.38  ? 10  DG  C C2    1 
ATOM   1222 N N2    . DG  C  2 10 ? -30.632 28.975 -38.257 1.00 40.80  ? 10  DG  C N2    1 
ATOM   1223 N N3    . DG  C  2 10 ? -32.279 30.096 -39.420 1.00 45.96  ? 10  DG  C N3    1 
ATOM   1224 C C4    . DG  C  2 10 ? -32.658 30.443 -40.671 1.00 48.84  ? 10  DG  C C4    1 
ATOM   1225 P P     . DG  C  2 11 ? -36.738 34.917 -38.102 1.00 66.63  ? 11  DG  C P     1 
ATOM   1226 O OP1   . DG  C  2 11 ? -37.730 35.303 -37.068 1.00 69.88  ? 11  DG  C OP1   1 
ATOM   1227 O OP2   . DG  C  2 11 ? -36.523 35.783 -39.295 1.00 68.57  ? 11  DG  C OP2   1 
ATOM   1228 O "O5'" . DG  C  2 11 ? -35.336 34.746 -37.371 1.00 61.74  ? 11  DG  C "O5'" 1 
ATOM   1229 C "C5'" . DG  C  2 11 ? -35.126 33.734 -36.362 1.00 54.84  ? 11  DG  C "C5'" 1 
ATOM   1230 C "C4'" . DG  C  2 11 ? -33.713 33.835 -35.838 1.00 50.46  ? 11  DG  C "C4'" 1 
ATOM   1231 O "O4'" . DG  C  2 11 ? -32.805 33.278 -36.816 1.00 45.56  ? 11  DG  C "O4'" 1 
ATOM   1232 C "C3'" . DG  C  2 11 ? -33.228 35.265 -35.565 1.00 51.12  ? 11  DG  C "C3'" 1 
ATOM   1233 O "O3'" . DG  C  2 11 ? -32.504 35.257 -34.344 1.00 49.29  ? 11  DG  C "O3'" 1 
ATOM   1234 C "C2'" . DG  C  2 11 ? -32.356 35.591 -36.773 1.00 50.47  ? 11  DG  C "C2'" 1 
ATOM   1235 C "C1'" . DG  C  2 11 ? -31.803 34.226 -37.154 1.00 47.32  ? 11  DG  C "C1'" 1 
ATOM   1236 N N9    . DG  C  2 11 ? -31.452 34.014 -38.558 1.00 48.05  ? 11  DG  C N9    1 
ATOM   1237 C C8    . DG  C  2 11 ? -32.094 34.480 -39.680 1.00 49.93  ? 11  DG  C C8    1 
ATOM   1238 N N7    . DG  C  2 11 ? -31.562 34.045 -40.790 1.00 50.22  ? 11  DG  C N7    1 
ATOM   1239 C C5    . DG  C  2 11 ? -30.527 33.217 -40.375 1.00 46.55  ? 11  DG  C C5    1 
ATOM   1240 C C6    . DG  C  2 11 ? -29.565 32.485 -41.133 1.00 45.09  ? 11  DG  C C6    1 
ATOM   1241 O O6    . DG  C  2 11 ? -29.453 32.398 -42.363 1.00 46.92  ? 11  DG  C O6    1 
ATOM   1242 N N1    . DG  C  2 11 ? -28.672 31.808 -40.309 1.00 42.15  ? 11  DG  C N1    1 
ATOM   1243 C C2    . DG  C  2 11 ? -28.692 31.839 -38.932 1.00 43.22  ? 11  DG  C C2    1 
ATOM   1244 N N2    . DG  C  2 11 ? -27.753 31.119 -38.302 1.00 42.26  ? 11  DG  C N2    1 
ATOM   1245 N N3    . DG  C  2 11 ? -29.573 32.522 -38.220 1.00 43.75  ? 11  DG  C N3    1 
ATOM   1246 C C4    . DG  C  2 11 ? -30.444 33.193 -39.000 1.00 45.43  ? 11  DG  C C4    1 
ATOM   1247 P P     . DC  C  2 12 ? -32.066 36.610 -33.630 1.00 54.42  ? 12  DC  C P     1 
ATOM   1248 O OP1   . DC  C  2 12 ? -32.005 36.316 -32.198 1.00 60.78  ? 12  DC  C OP1   1 
ATOM   1249 O OP2   . DC  C  2 12 ? -32.888 37.762 -34.132 1.00 57.59  ? 12  DC  C OP2   1 
ATOM   1250 O "O5'" . DC  C  2 12 ? -30.518 36.724 -33.989 1.00 56.08  ? 12  DC  C "O5'" 1 
ATOM   1251 C "C5'" . DC  C  2 12 ? -29.659 35.621 -33.610 1.00 53.21  ? 12  DC  C "C5'" 1 
ATOM   1252 C "C4'" . DC  C  2 12 ? -28.424 35.553 -34.477 1.00 51.76  ? 12  DC  C "C4'" 1 
ATOM   1253 O "O4'" . DC  C  2 12 ? -28.755 35.170 -35.826 1.00 49.62  ? 12  DC  C "O4'" 1 
ATOM   1254 C "C3'" . DC  C  2 12 ? -27.668 36.859 -34.643 1.00 53.46  ? 12  DC  C "C3'" 1 
ATOM   1255 O "O3'" . DC  C  2 12 ? -26.811 37.144 -33.531 1.00 56.38  ? 12  DC  C "O3'" 1 
ATOM   1256 C "C2'" . DC  C  2 12 ? -26.914 36.636 -35.946 1.00 51.11  ? 12  DC  C "C2'" 1 
ATOM   1257 C "C1'" . DC  C  2 12 ? -27.591 35.425 -36.587 1.00 49.06  ? 12  DC  C "C1'" 1 
ATOM   1258 N N1    . DC  C  2 12 ? -27.977 35.583 -38.008 1.00 48.63  ? 12  DC  C N1    1 
ATOM   1259 C C2    . DC  C  2 12 ? -27.262 34.868 -38.980 1.00 46.15  ? 12  DC  C C2    1 
ATOM   1260 O O2    . DC  C  2 12 ? -26.338 34.126 -38.620 1.00 45.05  ? 12  DC  C O2    1 
ATOM   1261 N N3    . DC  C  2 12 ? -27.601 34.998 -40.282 1.00 46.34  ? 12  DC  C N3    1 
ATOM   1262 C C4    . DC  C  2 12 ? -28.587 35.826 -40.635 1.00 49.19  ? 12  DC  C C4    1 
ATOM   1263 N N4    . DC  C  2 12 ? -28.874 35.939 -41.933 1.00 50.63  ? 12  DC  C N4    1 
ATOM   1264 C C5    . DC  C  2 12 ? -29.326 36.574 -39.668 1.00 50.84  ? 12  DC  C C5    1 
ATOM   1265 C C6    . DC  C  2 12 ? -28.994 36.419 -38.378 1.00 49.52  ? 12  DC  C C6    1 
ATOM   1266 O "O5'" . DG  D  3 1  ? -20.326 33.424 -47.848 1.00 64.04  ? 1   DG  D "O5'" 1 
ATOM   1267 C "C5'" . DG  D  3 1  ? -20.465 31.988 -47.824 1.00 61.17  ? 1   DG  D "C5'" 1 
ATOM   1268 C "C4'" . DG  D  3 1  ? -20.374 31.464 -46.407 1.00 59.16  ? 1   DG  D "C4'" 1 
ATOM   1269 O "O4'" . DG  D  3 1  ? -21.233 32.236 -45.528 1.00 55.67  ? 1   DG  D "O4'" 1 
ATOM   1270 C "C3'" . DG  D  3 1  ? -20.832 30.017 -46.229 1.00 57.38  ? 1   DG  D "C3'" 1 
ATOM   1271 O "O3'" . DG  D  3 1  ? -20.177 29.486 -45.080 1.00 60.31  ? 1   DG  D "O3'" 1 
ATOM   1272 C "C2'" . DG  D  3 1  ? -22.312 30.185 -45.970 1.00 53.35  ? 1   DG  D "C2'" 1 
ATOM   1273 C "C1'" . DG  D  3 1  ? -22.308 31.422 -45.084 1.00 52.28  ? 1   DG  D "C1'" 1 
ATOM   1274 N N9    . DG  D  3 1  ? -23.531 32.215 -45.132 1.00 49.99  ? 1   DG  D N9    1 
ATOM   1275 C C8    . DG  D  3 1  ? -24.244 32.607 -46.239 1.00 50.79  ? 1   DG  D C8    1 
ATOM   1276 N N7    . DG  D  3 1  ? -25.311 33.298 -45.942 1.00 49.76  ? 1   DG  D N7    1 
ATOM   1277 C C5    . DG  D  3 1  ? -25.325 33.328 -44.555 1.00 47.59  ? 1   DG  D C5    1 
ATOM   1278 C C6    . DG  D  3 1  ? -26.238 33.939 -43.654 1.00 45.61  ? 1   DG  D C6    1 
ATOM   1279 O O6    . DG  D  3 1  ? -27.243 34.607 -43.913 1.00 44.00  ? 1   DG  D O6    1 
ATOM   1280 N N1    . DG  D  3 1  ? -25.852 33.753 -42.329 1.00 44.49  ? 1   DG  D N1    1 
ATOM   1281 C C2    . DG  D  3 1  ? -24.732 33.069 -41.922 1.00 45.40  ? 1   DG  D C2    1 
ATOM   1282 N N2    . DG  D  3 1  ? -24.527 32.988 -40.602 1.00 45.70  ? 1   DG  D N2    1 
ATOM   1283 N N3    . DG  D  3 1  ? -23.876 32.499 -42.748 1.00 47.47  ? 1   DG  D N3    1 
ATOM   1284 C C4    . DG  D  3 1  ? -24.229 32.670 -44.041 1.00 47.97  ? 1   DG  D C4    1 
ATOM   1285 P P     . DC  D  3 2  ? -20.295 27.904 -44.682 1.00 63.75  ? 2   DC  D P     1 
ATOM   1286 O OP1   . DC  D  3 2  ? -18.899 27.347 -44.795 1.00 66.40  ? 2   DC  D OP1   1 
ATOM   1287 O OP2   . DC  D  3 2  ? -21.449 27.262 -45.405 1.00 61.31  ? 2   DC  D OP2   1 
ATOM   1288 O "O5'" . DC  D  3 2  ? -20.753 27.944 -43.160 1.00 58.97  ? 2   DC  D "O5'" 1 
ATOM   1289 C "C5'" . DC  D  3 2  ? -20.049 28.756 -42.191 1.00 62.66  ? 2   DC  D "C5'" 1 
ATOM   1290 C "C4'" . DC  D  3 2  ? -20.840 28.806 -40.902 1.00 61.65  ? 2   DC  D "C4'" 1 
ATOM   1291 O "O4'" . DC  D  3 2  ? -22.074 29.561 -41.061 1.00 59.02  ? 2   DC  D "O4'" 1 
ATOM   1292 C "C3'" . DC  D  3 2  ? -21.247 27.430 -40.369 1.00 59.81  ? 2   DC  D "C3'" 1 
ATOM   1293 O "O3'" . DC  D  3 2  ? -20.889 27.386 -38.979 1.00 62.08  ? 2   DC  D "O3'" 1 
ATOM   1294 C "C2'" . DC  D  3 2  ? -22.724 27.326 -40.718 1.00 55.82  ? 2   DC  D "C2'" 1 
ATOM   1295 C "C1'" . DC  D  3 2  ? -23.179 28.776 -40.633 1.00 54.47  ? 2   DC  D "C1'" 1 
ATOM   1296 N N1    . DC  D  3 2  ? -24.340 29.166 -41.449 1.00 50.59  ? 2   DC  D N1    1 
ATOM   1297 C C2    . DC  D  3 2  ? -25.414 29.811 -40.826 1.00 48.04  ? 2   DC  D C2    1 
ATOM   1298 O O2    . DC  D  3 2  ? -25.383 29.979 -39.603 1.00 47.43  ? 2   DC  D O2    1 
ATOM   1299 N N3    . DC  D  3 2  ? -26.468 30.209 -41.566 1.00 46.77  ? 2   DC  D N3    1 
ATOM   1300 C C4    . DC  D  3 2  ? -26.462 30.025 -42.886 1.00 49.54  ? 2   DC  D C4    1 
ATOM   1301 N N4    . DC  D  3 2  ? -27.527 30.443 -43.580 1.00 48.61  ? 2   DC  D N4    1 
ATOM   1302 C C5    . DC  D  3 2  ? -25.378 29.375 -43.552 1.00 51.03  ? 2   DC  D C5    1 
ATOM   1303 C C6    . DC  D  3 2  ? -24.343 28.973 -42.801 1.00 50.64  ? 2   DC  D C6    1 
ATOM   1304 P P     . DC  D  3 3  ? -20.817 26.001 -38.204 1.00 61.84  ? 3   DC  D P     1 
ATOM   1305 O OP1   . DC  D  3 3  ? -19.729 26.090 -37.194 1.00 63.38  ? 3   DC  D OP1   1 
ATOM   1306 O OP2   . DC  D  3 3  ? -20.817 24.916 -39.202 1.00 62.46  ? 3   DC  D OP2   1 
ATOM   1307 O "O5'" . DC  D  3 3  ? -22.231 25.948 -37.477 1.00 57.36  ? 3   DC  D "O5'" 1 
ATOM   1308 C "C5'" . DC  D  3 3  ? -22.683 27.034 -36.643 1.00 55.99  ? 3   DC  D "C5'" 1 
ATOM   1309 C "C4'" . DC  D  3 3  ? -24.100 26.774 -36.191 1.00 54.21  ? 3   DC  D "C4'" 1 
ATOM   1310 O "O4'" . DC  D  3 3  ? -25.033 27.193 -37.223 1.00 49.23  ? 3   DC  D "O4'" 1 
ATOM   1311 C "C3'" . DC  D  3 3  ? -24.433 25.301 -35.931 1.00 54.85  ? 3   DC  D "C3'" 1 
ATOM   1312 O "O3'" . DC  D  3 3  ? -25.436 25.276 -34.914 1.00 57.45  ? 3   DC  D "O3'" 1 
ATOM   1313 C "C2'" . DC  D  3 3  ? -25.084 24.870 -37.237 1.00 50.85  ? 3   DC  D "C2'" 1 
ATOM   1314 C "C1'" . DC  D  3 3  ? -25.906 26.120 -37.521 1.00 47.12  ? 3   DC  D "C1'" 1 
ATOM   1315 N N1    . DC  D  3 3  ? -26.445 26.348 -38.870 1.00 44.49  ? 3   DC  D N1    1 
ATOM   1316 C C2    . DC  D  3 3  ? -27.588 27.148 -38.997 1.00 41.39  ? 3   DC  D C2    1 
ATOM   1317 O O2    . DC  D  3 3  ? -28.126 27.592 -37.975 1.00 40.66  ? 3   DC  D O2    1 
ATOM   1318 N N3    . DC  D  3 3  ? -28.084 27.404 -40.225 1.00 40.14  ? 3   DC  D N3    1 
ATOM   1319 C C4    . DC  D  3 3  ? -27.464 26.933 -41.305 1.00 41.97  ? 3   DC  D C4    1 
ATOM   1320 N N4    . DC  D  3 3  ? -27.993 27.210 -42.495 1.00 44.41  ? 3   DC  D N4    1 
ATOM   1321 C C5    . DC  D  3 3  ? -26.307 26.105 -41.210 1.00 43.93  ? 3   DC  D C5    1 
ATOM   1322 C C6    . DC  D  3 3  ? -25.834 25.841 -39.984 1.00 44.71  ? 3   DC  D C6    1 
ATOM   1323 P P     . DC  D  3 4  ? -25.240 24.468 -33.569 1.00 60.71  ? 4   DC  D P     1 
ATOM   1324 O OP1   . DC  D  3 4  ? -24.003 24.947 -32.946 1.00 60.60  ? 4   DC  D OP1   1 
ATOM   1325 O OP2   . DC  D  3 4  ? -25.444 23.033 -33.892 1.00 59.12  ? 4   DC  D OP2   1 
ATOM   1326 O "O5'" . DC  D  3 4  ? -26.509 24.936 -32.727 1.00 54.66  ? 4   DC  D "O5'" 1 
ATOM   1327 C "C5'" . DC  D  3 4  ? -26.815 26.330 -32.540 1.00 51.28  ? 4   DC  D "C5'" 1 
ATOM   1328 C "C4'" . DC  D  3 4  ? -28.304 26.581 -32.651 1.00 48.47  ? 4   DC  D "C4'" 1 
ATOM   1329 O "O4'" . DC  D  3 4  ? -28.762 26.516 -34.024 1.00 43.44  ? 4   DC  D "O4'" 1 
ATOM   1330 C "C3'" . DC  D  3 4  ? -29.224 25.654 -31.852 1.00 47.50  ? 4   DC  D "C3'" 1 
ATOM   1331 O "O3'" . DC  D  3 4  ? -30.148 26.538 -31.190 1.00 46.70  ? 4   DC  D "O3'" 1 
ATOM   1332 C "C2'" . DC  D  3 4  ? -29.794 24.716 -32.908 1.00 43.50  ? 4   DC  D "C2'" 1 
ATOM   1333 C "C1'" . DC  D  3 4  ? -29.813 25.583 -34.178 1.00 43.94  ? 4   DC  D "C1'" 1 
ATOM   1334 N N1    . DC  D  3 4  ? -29.571 24.925 -35.474 1.00 43.62  ? 4   DC  D N1    1 
ATOM   1335 C C2    . DC  D  3 4  ? -30.281 25.361 -36.607 1.00 44.62  ? 4   DC  D C2    1 
ATOM   1336 O O2    . DC  D  3 4  ? -31.196 26.191 -36.464 1.00 41.90  ? 4   DC  D O2    1 
ATOM   1337 N N3    . DC  D  3 4  ? -29.965 24.844 -37.821 1.00 43.09  ? 4   DC  D N3    1 
ATOM   1338 C C4    . DC  D  3 4  ? -28.963 23.963 -37.930 1.00 44.99  ? 4   DC  D C4    1 
ATOM   1339 N N4    . DC  D  3 4  ? -28.686 23.470 -39.140 1.00 45.73  ? 4   DC  D N4    1 
ATOM   1340 C C5    . DC  D  3 4  ? -28.219 23.525 -36.799 1.00 45.07  ? 4   DC  D C5    1 
ATOM   1341 C C6    . DC  D  3 4  ? -28.509 24.078 -35.615 1.00 44.11  ? 4   DC  D C6    1 
ATOM   1342 P P     . DA  D  3 5  ? -31.006 26.033 -29.969 1.00 46.63  ? 5   DA  D P     1 
ATOM   1343 O OP1   . DA  D  3 5  ? -31.556 27.188 -29.245 1.00 48.00  ? 5   DA  D OP1   1 
ATOM   1344 O OP2   . DA  D  3 5  ? -30.302 24.920 -29.282 1.00 49.00  ? 5   DA  D OP2   1 
ATOM   1345 O "O5'" . DA  D  3 5  ? -32.219 25.327 -30.697 1.00 45.20  ? 5   DA  D "O5'" 1 
ATOM   1346 C "C5'" . DA  D  3 5  ? -33.275 26.112 -31.239 1.00 44.43  ? 5   DA  D "C5'" 1 
ATOM   1347 C "C4'" . DA  D  3 5  ? -34.079 25.244 -32.171 1.00 41.68  ? 5   DA  D "C4'" 1 
ATOM   1348 O "O4'" . DA  D  3 5  ? -33.222 24.825 -33.256 1.00 37.03  ? 5   DA  D "O4'" 1 
ATOM   1349 C "C3'" . DA  D  3 5  ? -34.637 23.957 -31.554 1.00 41.46  ? 5   DA  D "C3'" 1 
ATOM   1350 O "O3'" . DA  D  3 5  ? -36.034 24.156 -31.281 1.00 44.81  ? 5   DA  D "O3'" 1 
ATOM   1351 C "C2'" . DA  D  3 5  ? -34.307 22.897 -32.590 1.00 38.61  ? 5   DA  D "C2'" 1 
ATOM   1352 C "C1'" . DA  D  3 5  ? -33.830 23.694 -33.797 1.00 36.34  ? 5   DA  D "C1'" 1 
ATOM   1353 N N9    . DA  D  3 5  ? -32.855 23.016 -34.662 1.00 36.37  ? 5   DA  D N9    1 
ATOM   1354 C C8    . DA  D  3 5  ? -31.757 22.263 -34.309 1.00 35.08  ? 5   DA  D C8    1 
ATOM   1355 N N7    . DA  D  3 5  ? -31.125 21.740 -35.328 1.00 34.19  ? 5   DA  D N7    1 
ATOM   1356 C C5    . DA  D  3 5  ? -31.864 22.156 -36.428 1.00 33.78  ? 5   DA  D C5    1 
ATOM   1357 C C6    . DA  D  3 5  ? -31.688 21.972 -37.810 1.00 33.04  ? 5   DA  D C6    1 
ATOM   1358 N N6    . DA  D  3 5  ? -30.699 21.248 -38.337 1.00 34.55  ? 5   DA  D N6    1 
ATOM   1359 N N1    . DA  D  3 5  ? -32.561 22.579 -38.643 1.00 32.63  ? 5   DA  D N1    1 
ATOM   1360 C C2    . DA  D  3 5  ? -33.570 23.287 -38.109 1.00 34.20  ? 5   DA  D C2    1 
ATOM   1361 N N3    . DA  D  3 5  ? -33.836 23.538 -36.827 1.00 34.88  ? 5   DA  D N3    1 
ATOM   1362 C C4    . DA  D  3 5  ? -32.925 22.953 -36.032 1.00 34.15  ? 5   DA  D C4    1 
HETATM 1363 N N1    . 5CM D  3 6  ? -35.787 20.441 -35.852 1.00 32.83  ? 6   5CM D N1    1 
HETATM 1364 C C2    . 5CM D  3 6  ? -35.234 20.435 -37.137 1.00 31.10  ? 6   5CM D C2    1 
HETATM 1365 N N3    . 5CM D  3 6  ? -34.052 19.853 -37.366 1.00 29.68  ? 6   5CM D N3    1 
HETATM 1366 C C4    . 5CM D  3 6  ? -33.348 19.238 -36.407 1.00 28.81  ? 6   5CM D C4    1 
HETATM 1367 C C5    . 5CM D  3 6  ? -33.927 19.260 -35.051 1.00 31.30  ? 6   5CM D C5    1 
HETATM 1368 C C5A   . 5CM D  3 6  ? -33.219 18.698 -33.850 1.00 32.53  ? 6   5CM D C5A   1 
HETATM 1369 C C6    . 5CM D  3 6  ? -35.126 19.890 -34.849 1.00 31.96  ? 6   5CM D C6    1 
HETATM 1370 O O2    . 5CM D  3 6  ? -35.869 20.966 -38.050 1.00 31.57  ? 6   5CM D O2    1 
HETATM 1371 N N4    . 5CM D  3 6  ? -32.167 18.694 -36.679 1.00 28.26  ? 6   5CM D N4    1 
HETATM 1372 C "C1'" . 5CM D  3 6  ? -37.100 21.033 -35.675 1.00 35.46  ? 6   5CM D "C1'" 1 
HETATM 1373 C "C2'" . 5CM D  3 6  ? -38.053 20.216 -34.737 1.00 36.65  ? 6   5CM D "C2'" 1 
HETATM 1374 C "C3'" . 5CM D  3 6  ? -39.029 21.313 -34.401 1.00 39.96  ? 6   5CM D "C3'" 1 
HETATM 1375 C "C4'" . 5CM D  3 6  ? -38.157 22.584 -34.487 1.00 40.57  ? 6   5CM D "C4'" 1 
HETATM 1376 O "O4'" . 5CM D  3 6  ? -36.927 22.298 -35.157 1.00 37.06  ? 6   5CM D "O4'" 1 
HETATM 1377 O "O3'" . 5CM D  3 6  ? -39.973 21.530 -35.451 1.00 40.82  ? 6   5CM D "O3'" 1 
HETATM 1378 C "C5'" . 5CM D  3 6  ? -37.829 23.336 -33.217 1.00 43.09  ? 6   5CM D "C5'" 1 
HETATM 1379 O "O5'" . 5CM D  3 6  ? -37.728 22.471 -32.121 1.00 44.83  ? 6   5CM D "O5'" 1 
HETATM 1380 P P     . 5CM D  3 6  ? -37.016 22.963 -30.765 1.00 43.72  ? 6   5CM D P     1 
HETATM 1381 O OP1   . 5CM D  3 6  ? -38.096 23.566 -29.917 1.00 51.31  ? 6   5CM D OP1   1 
HETATM 1382 O OP2   . 5CM D  3 6  ? -36.183 21.842 -30.241 1.00 44.71  ? 6   5CM D OP2   1 
ATOM   1383 P P     . DA  D  3 7  ? -41.230 20.558 -35.702 1.00 41.66  ? 7   DA  D P     1 
ATOM   1384 O OP1   . DA  D  3 7  ? -42.433 21.276 -35.262 1.00 45.84  ? 7   DA  D OP1   1 
ATOM   1385 O OP2   . DA  D  3 7  ? -40.947 19.186 -35.241 1.00 42.33  ? 7   DA  D OP2   1 
ATOM   1386 O "O5'" . DA  D  3 7  ? -41.245 20.410 -37.282 1.00 42.70  ? 7   DA  D "O5'" 1 
ATOM   1387 C "C5'" . DA  D  3 7  ? -40.718 21.417 -38.168 1.00 42.24  ? 7   DA  D "C5'" 1 
ATOM   1388 C "C4'" . DA  D  3 7  ? -40.758 20.930 -39.602 1.00 42.26  ? 7   DA  D "C4'" 1 
ATOM   1389 O "O4'" . DA  D  3 7  ? -39.507 20.296 -39.959 1.00 39.91  ? 7   DA  D "O4'" 1 
ATOM   1390 C "C3'" . DA  D  3 7  ? -41.828 19.892 -39.919 1.00 42.30  ? 7   DA  D "C3'" 1 
ATOM   1391 O "O3'" . DA  D  3 7  ? -42.191 20.084 -41.294 1.00 45.35  ? 7   DA  D "O3'" 1 
ATOM   1392 C "C2'" . DA  D  3 7  ? -41.106 18.581 -39.638 1.00 39.37  ? 7   DA  D "C2'" 1 
ATOM   1393 C "C1'" . DA  D  3 7  ? -39.673 18.884 -40.085 1.00 38.01  ? 7   DA  D "C1'" 1 
ATOM   1394 N N9    . DA  D  3 7  ? -38.618 18.246 -39.294 1.00 35.14  ? 7   DA  D N9    1 
ATOM   1395 C C8    . DA  D  3 7  ? -38.572 18.207 -37.922 1.00 34.39  ? 7   DA  D C8    1 
ATOM   1396 N N7    . DA  D  3 7  ? -37.513 17.601 -37.446 1.00 32.88  ? 7   DA  D N7    1 
ATOM   1397 C C5    . DA  D  3 7  ? -36.787 17.260 -38.573 1.00 30.13  ? 7   DA  D C5    1 
ATOM   1398 C C6    . DA  D  3 7  ? -35.554 16.620 -38.738 1.00 29.45  ? 7   DA  D C6    1 
ATOM   1399 N N6    . DA  D  3 7  ? -34.804 16.192 -37.726 1.00 28.15  ? 7   DA  D N6    1 
ATOM   1400 N N1    . DA  D  3 7  ? -35.121 16.403 -40.004 1.00 30.89  ? 7   DA  D N1    1 
ATOM   1401 C C2    . DA  D  3 7  ? -35.890 16.811 -41.021 1.00 31.07  ? 7   DA  D C2    1 
ATOM   1402 N N3    . DA  D  3 7  ? -37.064 17.445 -40.991 1.00 31.05  ? 7   DA  D N3    1 
ATOM   1403 C C4    . DA  D  3 7  ? -37.458 17.648 -39.723 1.00 32.03  ? 7   DA  D C4    1 
ATOM   1404 P P     . DC  D  3 8  ? -43.230 19.085 -42.043 1.00 47.31  ? 8   DC  D P     1 
ATOM   1405 O OP1   . DC  D  3 8  ? -44.029 19.921 -42.965 1.00 52.06  ? 8   DC  D OP1   1 
ATOM   1406 O OP2   . DC  D  3 8  ? -43.923 18.205 -41.050 1.00 44.48  ? 8   DC  D OP2   1 
ATOM   1407 O "O5'" . DC  D  3 8  ? -42.249 18.059 -42.774 1.00 46.09  ? 8   DC  D "O5'" 1 
ATOM   1408 C "C5'" . DC  D  3 8  ? -41.278 18.464 -43.745 1.00 42.38  ? 8   DC  D "C5'" 1 
ATOM   1409 C "C4'" . DC  D  3 8  ? -40.462 17.264 -44.175 1.00 40.37  ? 8   DC  D "C4'" 1 
ATOM   1410 O "O4'" . DC  D  3 8  ? -39.578 16.834 -43.108 1.00 36.68  ? 8   DC  D "O4'" 1 
ATOM   1411 C "C3'" . DC  D  3 8  ? -41.280 16.032 -44.578 1.00 39.46  ? 8   DC  D "C3'" 1 
ATOM   1412 O "O3'" . DC  D  3 8  ? -41.072 15.761 -45.974 1.00 38.89  ? 8   DC  D "O3'" 1 
ATOM   1413 C "C2'" . DC  D  3 8  ? -40.752 14.922 -43.686 1.00 37.46  ? 8   DC  D "C2'" 1 
ATOM   1414 C "C1'" . DC  D  3 8  ? -39.436 15.444 -43.135 1.00 35.93  ? 8   DC  D "C1'" 1 
ATOM   1415 N N1    . DC  D  3 8  ? -39.131 15.017 -41.762 1.00 34.89  ? 8   DC  D N1    1 
ATOM   1416 C C2    . DC  D  3 8  ? -37.938 14.337 -41.516 1.00 33.83  ? 8   DC  D C2    1 
ATOM   1417 O O2    . DC  D  3 8  ? -37.196 14.086 -42.469 1.00 33.18  ? 8   DC  D O2    1 
ATOM   1418 N N3    . DC  D  3 8  ? -37.602 14.015 -40.235 1.00 31.55  ? 8   DC  D N3    1 
ATOM   1419 C C4    . DC  D  3 8  ? -38.437 14.307 -39.239 1.00 32.97  ? 8   DC  D C4    1 
ATOM   1420 N N4    . DC  D  3 8  ? -38.086 13.951 -38.002 1.00 33.57  ? 8   DC  D N4    1 
ATOM   1421 C C5    . DC  D  3 8  ? -39.673 14.984 -39.466 1.00 35.36  ? 8   DC  D C5    1 
ATOM   1422 C C6    . DC  D  3 8  ? -39.979 15.314 -40.731 1.00 34.83  ? 8   DC  D C6    1 
ATOM   1423 P P     . DT  D  3 9  ? -41.762 14.505 -46.680 1.00 40.72  ? 9   DT  D P     1 
ATOM   1424 O OP1   . DT  D  3 9  ? -42.204 14.943 -48.035 1.00 43.14  ? 9   DT  D OP1   1 
ATOM   1425 O OP2   . DT  D  3 9  ? -42.771 13.882 -45.763 1.00 38.44  ? 9   DT  D OP2   1 
ATOM   1426 O "O5'" . DT  D  3 9  ? -40.544 13.469 -46.775 1.00 37.37  ? 9   DT  D "O5'" 1 
ATOM   1427 C "C5'" . DT  D  3 9  ? -39.216 13.938 -47.118 1.00 37.43  ? 9   DT  D "C5'" 1 
ATOM   1428 C "C4'" . DT  D  3 9  ? -38.217 12.805 -47.132 1.00 36.91  ? 9   DT  D "C4'" 1 
ATOM   1429 O "O4'" . DT  D  3 9  ? -37.911 12.350 -45.788 1.00 35.57  ? 9   DT  D "O4'" 1 
ATOM   1430 C "C3'" . DT  D  3 9  ? -38.625 11.546 -47.899 1.00 37.27  ? 9   DT  D "C3'" 1 
ATOM   1431 O "O3'" . DT  D  3 9  ? -37.403 11.139 -48.557 1.00 38.54  ? 9   DT  D "O3'" 1 
ATOM   1432 C "C2'" . DT  D  3 9  ? -39.153 10.635 -46.799 1.00 34.88  ? 9   DT  D "C2'" 1 
ATOM   1433 C "C1'" . DT  D  3 9  ? -38.245 10.966 -45.613 1.00 33.82  ? 9   DT  D "C1'" 1 
ATOM   1434 N N1    . DT  D  3 9  ? -38.724 10.825 -44.195 1.00 31.92  ? 9   DT  D N1    1 
ATOM   1435 C C2    . DT  D  3 9  ? -37.827 10.368 -43.244 1.00 31.74  ? 9   DT  D C2    1 
ATOM   1436 O O2    . DT  D  3 9  ? -36.752 9.866  -43.519 1.00 32.54  ? 9   DT  D O2    1 
ATOM   1437 N N3    . DT  D  3 9  ? -38.277 10.447 -41.950 1.00 31.41  ? 9   DT  D N3    1 
ATOM   1438 C C4    . DT  D  3 9  ? -39.460 11.008 -41.513 1.00 31.08  ? 9   DT  D C4    1 
ATOM   1439 O O4    . DT  D  3 9  ? -39.715 11.026 -40.318 1.00 33.61  ? 9   DT  D O4    1 
ATOM   1440 C C5    . DT  D  3 9  ? -40.351 11.472 -42.558 1.00 31.70  ? 9   DT  D C5    1 
ATOM   1441 C C7    . DT  D  3 9  ? -41.690 12.026 -42.178 1.00 31.99  ? 9   DT  D C7    1 
ATOM   1442 C C6    . DT  D  3 9  ? -39.916 11.412 -43.825 1.00 31.12  ? 9   DT  D C6    1 
ATOM   1443 P P     . DC  D  3 10 ? -37.349 10.098 -49.783 1.00 41.76  ? 10  DC  D P     1 
ATOM   1444 O OP1   . DC  D  3 10 ? -36.126 10.418 -50.544 1.00 45.05  ? 10  DC  D OP1   1 
ATOM   1445 O OP2   . DC  D  3 10 ? -38.679 9.957  -50.464 1.00 40.90  ? 10  DC  D OP2   1 
ATOM   1446 O "O5'" . DC  D  3 10 ? -37.189 8.727  -49.008 1.00 40.62  ? 10  DC  D "O5'" 1 
ATOM   1447 C "C5'" . DC  D  3 10 ? -36.009 8.445  -48.255 1.00 39.26  ? 10  DC  D "C5'" 1 
ATOM   1448 C "C4'" . DC  D  3 10 ? -36.248 7.155  -47.513 1.00 39.32  ? 10  DC  D "C4'" 1 
ATOM   1449 O "O4'" . DC  D  3 10 ? -37.096 7.401  -46.364 1.00 36.54  ? 10  DC  D "O4'" 1 
ATOM   1450 C "C3'" . DC  D  3 10 ? -36.976 6.094  -48.338 1.00 40.80  ? 10  DC  D "C3'" 1 
ATOM   1451 O "O3'" . DC  D  3 10 ? -36.463 4.827  -47.980 1.00 44.87  ? 10  DC  D "O3'" 1 
ATOM   1452 C "C2'" . DC  D  3 10 ? -38.384 6.099  -47.772 1.00 37.86  ? 10  DC  D "C2'" 1 
ATOM   1453 C "C1'" . DC  D  3 10 ? -38.116 6.406  -46.323 1.00 35.47  ? 10  DC  D "C1'" 1 
ATOM   1454 N N1    . DC  D  3 10 ? -39.227 6.933  -45.505 1.00 34.15  ? 10  DC  D N1    1 
ATOM   1455 C C2    . DC  D  3 10 ? -39.123 6.876  -44.103 1.00 34.50  ? 10  DC  D C2    1 
ATOM   1456 O O2    . DC  D  3 10 ? -38.150 6.299  -43.594 1.00 33.09  ? 10  DC  D O2    1 
ATOM   1457 N N3    . DC  D  3 10 ? -40.124 7.396  -43.346 1.00 33.59  ? 10  DC  D N3    1 
ATOM   1458 C C4    . DC  D  3 10 ? -41.156 8.005  -43.936 1.00 32.83  ? 10  DC  D C4    1 
ATOM   1459 N N4    . DC  D  3 10 ? -42.081 8.555  -43.162 1.00 31.88  ? 10  DC  D N4    1 
ATOM   1460 C C5    . DC  D  3 10 ? -41.240 8.145  -45.357 1.00 35.40  ? 10  DC  D C5    1 
ATOM   1461 C C6    . DC  D  3 10 ? -40.284 7.572  -46.093 1.00 34.41  ? 10  DC  D C6    1 
ATOM   1462 P P     . DC  D  3 11 ? -35.948 3.817  -49.070 1.00 50.51  ? 11  DC  D P     1 
ATOM   1463 O OP1   . DC  D  3 11 ? -34.599 4.290  -49.483 1.00 50.83  ? 11  DC  D OP1   1 
ATOM   1464 O OP2   . DC  D  3 11 ? -37.007 3.622  -50.095 1.00 50.57  ? 11  DC  D OP2   1 
ATOM   1465 O "O5'" . DC  D  3 11 ? -35.897 2.477  -48.218 1.00 47.59  ? 11  DC  D "O5'" 1 
ATOM   1466 C "C5'" . DC  D  3 11 ? -35.022 2.398  -47.078 1.00 46.45  ? 11  DC  D "C5'" 1 
ATOM   1467 C "C4'" . DC  D  3 11 ? -35.747 1.728  -45.938 1.00 45.10  ? 11  DC  D "C4'" 1 
ATOM   1468 O "O4'" . DC  D  3 11 ? -36.778 2.589  -45.405 1.00 41.31  ? 11  DC  D "O4'" 1 
ATOM   1469 C "C3'" . DC  D  3 11 ? -36.438 0.414  -46.296 1.00 46.76  ? 11  DC  D "C3'" 1 
ATOM   1470 O "O3'" . DC  D  3 11 ? -36.155 -0.404 -45.175 1.00 52.47  ? 11  DC  D "O3'" 1 
ATOM   1471 C "C2'" . DC  D  3 11 ? -37.912 0.761  -46.231 1.00 44.19  ? 11  DC  D "C2'" 1 
ATOM   1472 C "C1'" . DC  D  3 11 ? -37.888 1.786  -45.101 1.00 40.79  ? 11  DC  D "C1'" 1 
ATOM   1473 N N1    . DC  D  3 11 ? -39.058 2.671  -44.925 1.00 37.32  ? 11  DC  D N1    1 
ATOM   1474 C C2    . DC  D  3 11 ? -39.419 3.059  -43.627 1.00 37.39  ? 11  DC  D C2    1 
ATOM   1475 O O2    . DC  D  3 11 ? -38.733 2.667  -42.670 1.00 38.09  ? 11  DC  D O2    1 
ATOM   1476 N N3    . DC  D  3 11 ? -40.496 3.865  -43.449 1.00 34.41  ? 11  DC  D N3    1 
ATOM   1477 C C4    . DC  D  3 11 ? -41.226 4.240  -44.498 1.00 34.46  ? 11  DC  D C4    1 
ATOM   1478 N N4    . DC  D  3 11 ? -42.284 5.027  -44.275 1.00 35.07  ? 11  DC  D N4    1 
ATOM   1479 C C5    . DC  D  3 11 ? -40.862 3.888  -45.833 1.00 35.72  ? 11  DC  D C5    1 
ATOM   1480 C C6    . DC  D  3 11 ? -39.795 3.092  -45.996 1.00 36.48  ? 11  DC  D C6    1 
ATOM   1481 P P     . DG  D  3 12 ? -35.357 -1.780 -45.292 1.00 55.07  ? 12  DG  D P     1 
ATOM   1482 O OP1   . DG  D  3 12 ? -33.919 -1.456 -45.235 1.00 56.65  ? 12  DG  D OP1   1 
ATOM   1483 O OP2   . DG  D  3 12 ? -35.907 -2.522 -46.431 1.00 53.57  ? 12  DG  D OP2   1 
ATOM   1484 O "O5'" . DG  D  3 12 ? -35.698 -2.438 -43.870 1.00 54.26  ? 12  DG  D "O5'" 1 
ATOM   1485 C "C5'" . DG  D  3 12 ? -35.397 -1.699 -42.635 1.00 49.30  ? 12  DG  D "C5'" 1 
ATOM   1486 C "C4'" . DG  D  3 12 ? -36.399 -1.976 -41.531 1.00 49.09  ? 12  DG  D "C4'" 1 
ATOM   1487 O "O4'" . DG  D  3 12 ? -37.393 -0.921 -41.435 1.00 46.74  ? 12  DG  D "O4'" 1 
ATOM   1488 C "C3'" . DG  D  3 12 ? -37.173 -3.294 -41.655 1.00 49.40  ? 12  DG  D "C3'" 1 
ATOM   1489 O "O3'" . DG  D  3 12 ? -37.085 -4.116 -40.502 1.00 52.14  ? 12  DG  D "O3'" 1 
ATOM   1490 C "C2'" . DG  D  3 12 ? -38.634 -2.898 -41.690 1.00 47.38  ? 12  DG  D "C2'" 1 
ATOM   1491 C "C1'" . DG  D  3 12 ? -38.672 -1.483 -41.169 1.00 44.04  ? 12  DG  D "C1'" 1 
ATOM   1492 N N9    . DG  D  3 12 ? -39.665 -0.735 -41.924 1.00 40.20  ? 12  DG  D N9    1 
ATOM   1493 C C8    . DG  D  3 12 ? -39.795 -0.744 -43.290 1.00 39.58  ? 12  DG  D C8    1 
ATOM   1494 N N7    . DG  D  3 12 ? -40.815 -0.051 -43.711 1.00 37.85  ? 12  DG  D N7    1 
ATOM   1495 C C5    . DG  D  3 12 ? -41.399 0.437  -42.556 1.00 35.39  ? 12  DG  D C5    1 
ATOM   1496 C C6    . DG  D  3 12 ? -42.524 1.259  -42.394 1.00 33.99  ? 12  DG  D C6    1 
ATOM   1497 O O6    . DG  D  3 12 ? -43.261 1.719  -43.266 1.00 35.26  ? 12  DG  D O6    1 
ATOM   1498 N N1    . DG  D  3 12 ? -42.789 1.513  -41.052 1.00 33.76  ? 12  DG  D N1    1 
ATOM   1499 C C2    . DG  D  3 12 ? -42.058 1.018  -39.996 1.00 35.87  ? 12  DG  D C2    1 
ATOM   1500 N N2    . DG  D  3 12 ? -42.479 1.368  -38.755 1.00 34.74  ? 12  DG  D N2    1 
ATOM   1501 N N3    . DG  D  3 12 ? -40.991 0.237  -40.141 1.00 35.91  ? 12  DG  D N3    1 
ATOM   1502 C C4    . DG  D  3 12 ? -40.723 -0.008 -41.439 1.00 37.03  ? 12  DG  D C4    1 
ATOM   1503 C CA    . GLY E  1 6  ? -41.889 25.865 0.392   1.00 58.52  ? 147 GLY E CA    1 
ATOM   1504 C C     . GLY E  1 6  ? -41.505 25.897 -1.094  1.00 57.21  ? 147 GLY E C     1 
ATOM   1505 O O     . GLY E  1 6  ? -42.305 26.381 -1.933  1.00 56.81  ? 147 GLY E O     1 
ATOM   1506 N N     . LYS E  1 7  ? -40.278 25.433 -1.415  1.00 55.97  ? 148 LYS E N     1 
ATOM   1507 C CA    . LYS E  1 7  ? -39.762 25.463 -2.815  1.00 55.10  ? 148 LYS E CA    1 
ATOM   1508 C C     . LYS E  1 7  ? -40.401 24.296 -3.582  1.00 51.43  ? 148 LYS E C     1 
ATOM   1509 O O     . LYS E  1 7  ? -40.285 23.134 -3.184  1.00 51.00  ? 148 LYS E O     1 
ATOM   1510 C CB    . LYS E  1 7  ? -38.222 25.416 -2.899  1.00 55.51  ? 148 LYS E CB    1 
ATOM   1511 N N     . ARG E  1 8  ? -41.105 24.633 -4.659  1.00 50.28  ? 149 ARG E N     1 
ATOM   1512 C CA    . ARG E  1 8  ? -41.778 23.661 -5.518  1.00 46.81  ? 149 ARG E CA    1 
ATOM   1513 C C     . ARG E  1 8  ? -40.894 23.477 -6.714  1.00 46.70  ? 149 ARG E C     1 
ATOM   1514 O O     . ARG E  1 8  ? -40.524 24.447 -7.341  1.00 49.12  ? 149 ARG E O     1 
ATOM   1515 C CB    . ARG E  1 8  ? -43.127 24.191 -5.979  1.00 45.57  ? 149 ARG E CB    1 
ATOM   1516 C CG    . ARG E  1 8  ? -44.062 24.442 -4.827  1.00 44.67  ? 149 ARG E CG    1 
ATOM   1517 C CD    . ARG E  1 8  ? -45.484 24.691 -5.294  1.00 45.46  ? 149 ARG E CD    1 
ATOM   1518 N NE    . ARG E  1 8  ? -46.298 25.181 -4.198  1.00 44.72  ? 149 ARG E NE    1 
ATOM   1519 C CZ    . ARG E  1 8  ? -47.579 25.509 -4.302  1.00 46.45  ? 149 ARG E CZ    1 
ATOM   1520 N NH1   . ARG E  1 8  ? -48.255 25.415 -5.467  1.00 44.64  ? 149 ARG E NH1   1 
ATOM   1521 N NH2   . ARG E  1 8  ? -48.193 25.949 -3.206  1.00 48.82  ? 149 ARG E NH2   1 
ATOM   1522 N N     . MET E  1 9  ? -40.566 22.225 -7.005  1.00 44.26  ? 150 MET E N     1 
ATOM   1523 C CA    . MET E  1 9  ? -39.604 21.868 -7.993  1.00 45.26  ? 150 MET E CA    1 
ATOM   1524 C C     . MET E  1 9  ? -40.351 21.195 -9.109  1.00 42.89  ? 150 MET E C     1 
ATOM   1525 O O     . MET E  1 9  ? -41.191 20.344 -8.856  1.00 39.89  ? 150 MET E O     1 
ATOM   1526 C CB    . MET E  1 9  ? -38.659 20.824 -7.409  1.00 46.45  ? 150 MET E CB    1 
ATOM   1527 C CG    . MET E  1 9  ? -37.737 21.323 -6.335  1.00 49.02  ? 150 MET E CG    1 
ATOM   1528 S SD    . MET E  1 9  ? -36.916 22.882 -6.769  1.00 56.86  ? 150 MET E SD    1 
ATOM   1529 C CE    . MET E  1 9  ? -35.545 22.322 -7.827  1.00 57.62  ? 150 MET E CE    1 
ATOM   1530 N N     . ASP E  1 10 ? -40.019 21.522 -10.345 1.00 44.53  ? 151 ASP E N     1 
ATOM   1531 C CA    . ASP E  1 10 ? -40.592 20.799 -11.504 1.00 44.26  ? 151 ASP E CA    1 
ATOM   1532 C C     . ASP E  1 10 ? -40.303 19.299 -11.318 1.00 43.01  ? 151 ASP E C     1 
ATOM   1533 O O     . ASP E  1 10 ? -39.278 18.941 -10.703 1.00 42.19  ? 151 ASP E O     1 
ATOM   1534 C CB    . ASP E  1 10 ? -39.977 21.281 -12.823 1.00 47.41  ? 151 ASP E CB    1 
ATOM   1535 C CG    . ASP E  1 10 ? -40.652 22.551 -13.409 1.00 49.78  ? 151 ASP E CG    1 
ATOM   1536 O OD1   . ASP E  1 10 ? -41.856 22.480 -13.724 1.00 50.89  ? 151 ASP E OD1   1 
ATOM   1537 O OD2   . ASP E  1 10 ? -39.959 23.570 -13.676 1.00 51.54  ? 151 ASP E OD2   1 
ATOM   1538 N N     . CYS E  1 11 ? -41.162 18.425 -11.839 1.00 42.05  ? 152 CYS E N     1 
ATOM   1539 C CA    . CYS E  1 11 ? -40.931 16.992 -11.661 1.00 43.30  ? 152 CYS E CA    1 
ATOM   1540 C C     . CYS E  1 11 ? -40.833 16.426 -13.030 1.00 45.67  ? 152 CYS E C     1 
ATOM   1541 O O     . CYS E  1 11 ? -41.862 16.285 -13.700 1.00 46.95  ? 152 CYS E O     1 
ATOM   1542 C CB    . CYS E  1 11 ? -42.026 16.258 -10.875 1.00 41.68  ? 152 CYS E CB    1 
ATOM   1543 S SG    . CYS E  1 11 ? -41.619 14.474 -10.719 1.00 43.05  ? 152 CYS E SG    1 
ATOM   1544 N N     . PRO E  1 12 ? -39.599 16.114 -13.473 1.00 48.60  ? 153 PRO E N     1 
ATOM   1545 C CA    . PRO E  1 12 ? -39.396 15.731 -14.869 1.00 50.55  ? 153 PRO E CA    1 
ATOM   1546 C C     . PRO E  1 12 ? -40.126 14.467 -15.287 1.00 51.22  ? 153 PRO E C     1 
ATOM   1547 O O     . PRO E  1 12 ? -40.520 14.352 -16.432 1.00 51.48  ? 153 PRO E O     1 
ATOM   1548 C CB    . PRO E  1 12 ? -37.881 15.503 -14.937 1.00 53.17  ? 153 PRO E CB    1 
ATOM   1549 C CG    . PRO E  1 12 ? -37.326 16.426 -13.924 1.00 52.56  ? 153 PRO E CG    1 
ATOM   1550 C CD    . PRO E  1 12 ? -38.307 16.325 -12.788 1.00 49.19  ? 153 PRO E CD    1 
ATOM   1551 N N     . ALA E  1 13 ? -40.309 13.520 -14.364 1.00 51.38  ? 154 ALA E N     1 
ATOM   1552 C CA    . ALA E  1 13 ? -40.962 12.247 -14.702 1.00 51.65  ? 154 ALA E CA    1 
ATOM   1553 C C     . ALA E  1 13 ? -42.468 12.339 -14.771 1.00 49.36  ? 154 ALA E C     1 
ATOM   1554 O O     . ALA E  1 13 ? -43.096 11.319 -14.912 1.00 50.80  ? 154 ALA E O     1 
ATOM   1555 C CB    . ALA E  1 13 ? -40.569 11.168 -13.702 1.00 51.78  ? 154 ALA E CB    1 
ATOM   1556 N N     . LEU E  1 14 ? -43.059 13.521 -14.608 1.00 49.29  ? 155 LEU E N     1 
ATOM   1557 C CA    . LEU E  1 14 ? -44.516 13.716 -14.727 1.00 47.88  ? 155 LEU E CA    1 
ATOM   1558 C C     . LEU E  1 14 ? -44.666 14.753 -15.809 1.00 50.75  ? 155 LEU E C     1 
ATOM   1559 O O     . LEU E  1 14 ? -43.689 15.472 -16.102 1.00 50.71  ? 155 LEU E O     1 
ATOM   1560 C CB    . LEU E  1 14 ? -45.106 14.281 -13.437 1.00 45.04  ? 155 LEU E CB    1 
ATOM   1561 C CG    . LEU E  1 14 ? -45.270 13.399 -12.197 1.00 44.43  ? 155 LEU E CG    1 
ATOM   1562 C CD1   . LEU E  1 14 ? -45.652 14.216 -10.956 1.00 42.88  ? 155 LEU E CD1   1 
ATOM   1563 C CD2   . LEU E  1 14 ? -46.315 12.322 -12.392 1.00 44.96  ? 155 LEU E CD2   1 
ATOM   1564 N N     . PRO E  1 15 ? -45.897 14.909 -16.349 1.00 53.32  ? 156 PRO E N     1 
ATOM   1565 C CA    . PRO E  1 15 ? -46.165 15.836 -17.465 1.00 55.51  ? 156 PRO E CA    1 
ATOM   1566 C C     . PRO E  1 15 ? -45.917 17.325 -17.160 1.00 56.45  ? 156 PRO E C     1 
ATOM   1567 O O     . PRO E  1 15 ? -45.552 17.681 -16.026 1.00 54.62  ? 156 PRO E O     1 
ATOM   1568 C CB    . PRO E  1 15 ? -47.653 15.584 -17.808 1.00 55.88  ? 156 PRO E CB    1 
ATOM   1569 C CG    . PRO E  1 15 ? -47.925 14.218 -17.256 1.00 54.52  ? 156 PRO E CG    1 
ATOM   1570 C CD    . PRO E  1 15 ? -47.143 14.235 -15.939 1.00 52.94  ? 156 PRO E CD    1 
ATOM   1571 N N     . PRO E  1 16 ? -46.046 18.186 -18.188 1.00 58.95  ? 157 PRO E N     1 
ATOM   1572 C CA    . PRO E  1 16 ? -45.547 19.567 -17.989 1.00 60.07  ? 157 PRO E CA    1 
ATOM   1573 C C     . PRO E  1 16 ? -46.344 20.412 -17.003 1.00 58.62  ? 157 PRO E C     1 
ATOM   1574 O O     . PRO E  1 16 ? -47.564 20.467 -17.100 1.00 59.92  ? 157 PRO E O     1 
ATOM   1575 C CB    . PRO E  1 16 ? -45.596 20.193 -19.416 1.00 63.54  ? 157 PRO E CB    1 
ATOM   1576 C CG    . PRO E  1 16 ? -45.604 19.037 -20.354 1.00 63.35  ? 157 PRO E CG    1 
ATOM   1577 C CD    . PRO E  1 16 ? -46.034 17.789 -19.616 1.00 60.43  ? 157 PRO E CD    1 
ATOM   1578 N N     . GLY E  1 17 ? -45.630 21.074 -16.090 1.00 57.30  ? 158 GLY E N     1 
ATOM   1579 C CA    . GLY E  1 17 ? -46.213 21.959 -15.104 1.00 55.33  ? 158 GLY E CA    1 
ATOM   1580 C C     . GLY E  1 17 ? -46.481 21.315 -13.748 1.00 51.68  ? 158 GLY E C     1 
ATOM   1581 O O     . GLY E  1 17 ? -46.866 22.008 -12.819 1.00 50.79  ? 158 GLY E O     1 
ATOM   1582 N N     . TRP E  1 18 ? -46.321 19.994 -13.651 1.00 48.86  ? 159 TRP E N     1 
ATOM   1583 C CA    . TRP E  1 18 ? -46.369 19.278 -12.389 1.00 44.14  ? 159 TRP E CA    1 
ATOM   1584 C C     . TRP E  1 18 ? -45.167 19.573 -11.477 1.00 43.33  ? 159 TRP E C     1 
ATOM   1585 O O     . TRP E  1 18 ? -44.015 19.472 -11.896 1.00 43.96  ? 159 TRP E O     1 
ATOM   1586 C CB    . TRP E  1 18 ? -46.462 17.756 -12.644 1.00 43.00  ? 159 TRP E CB    1 
ATOM   1587 C CG    . TRP E  1 18 ? -47.820 17.308 -13.080 1.00 43.15  ? 159 TRP E CG    1 
ATOM   1588 C CD1   . TRP E  1 18 ? -48.281 17.177 -14.371 1.00 45.85  ? 159 TRP E CD1   1 
ATOM   1589 C CD2   . TRP E  1 18 ? -48.902 16.914 -12.247 1.00 42.16  ? 159 TRP E CD2   1 
ATOM   1590 N NE1   . TRP E  1 18 ? -49.568 16.725 -14.381 1.00 44.16  ? 159 TRP E NE1   1 
ATOM   1591 C CE2   . TRP E  1 18 ? -49.978 16.557 -13.094 1.00 44.99  ? 159 TRP E CE2   1 
ATOM   1592 C CE3   . TRP E  1 18 ? -49.078 16.837 -10.877 1.00 40.98  ? 159 TRP E CE3   1 
ATOM   1593 C CZ2   . TRP E  1 18 ? -51.203 16.138 -12.595 1.00 45.17  ? 159 TRP E CZ2   1 
ATOM   1594 C CZ3   . TRP E  1 18 ? -50.286 16.424 -10.379 1.00 40.46  ? 159 TRP E CZ3   1 
ATOM   1595 C CH2   . TRP E  1 18 ? -51.328 16.081 -11.217 1.00 43.40  ? 159 TRP E CH2   1 
ATOM   1596 N N     . LYS E  1 19 ? -45.413 19.896 -10.216 1.00 41.30  ? 160 LYS E N     1 
ATOM   1597 C CA    . LYS E  1 19 ? -44.321 20.201 -9.296  1.00 40.96  ? 160 LYS E CA    1 
ATOM   1598 C C     . LYS E  1 19 ? -44.421 19.376 -8.014  1.00 40.12  ? 160 LYS E C     1 
ATOM   1599 O O     . LYS E  1 19 ? -45.486 18.915 -7.636  1.00 38.39  ? 160 LYS E O     1 
ATOM   1600 C CB    . LYS E  1 19 ? -44.279 21.714 -9.018  1.00 42.89  ? 160 LYS E CB    1 
ATOM   1601 C CG    . LYS E  1 19 ? -43.806 22.559 -10.187 1.00 44.84  ? 160 LYS E CG    1 
ATOM   1602 C CD    . LYS E  1 19 ? -44.043 24.059 -10.006 1.00 46.95  ? 160 LYS E CD    1 
ATOM   1603 C CE    . LYS E  1 19 ? -43.704 24.863 -11.296 1.00 48.13  ? 160 LYS E CE    1 
ATOM   1604 N N     . LYS E  1 20 ? -43.268 19.170 -7.388  1.00 42.58  ? 161 LYS E N     1 
ATOM   1605 C CA    . LYS E  1 20 ? -43.082 18.345 -6.204  1.00 42.42  ? 161 LYS E CA    1 
ATOM   1606 C C     . LYS E  1 20 ? -42.524 19.289 -5.164  1.00 42.58  ? 161 LYS E C     1 
ATOM   1607 O O     . LYS E  1 20 ? -41.688 20.108 -5.501  1.00 45.13  ? 161 LYS E O     1 
ATOM   1608 C CB    . LYS E  1 20 ? -42.059 17.264 -6.500  1.00 45.45  ? 161 LYS E CB    1 
ATOM   1609 C CG    . LYS E  1 20 ? -41.680 16.314 -5.378  1.00 45.98  ? 161 LYS E CG    1 
ATOM   1610 C CD    . LYS E  1 20 ? -40.459 15.469 -5.799  1.00 49.19  ? 161 LYS E CD    1 
ATOM   1611 C CE    . LYS E  1 20 ? -40.120 14.423 -4.730  1.00 49.31  ? 161 LYS E CE    1 
ATOM   1612 N N     . GLU E  1 21 ? -43.004 19.160 -3.921  1.00 41.22  ? 162 GLU E N     1 
ATOM   1613 C CA    . GLU E  1 21 ? -42.463 19.847 -2.746  1.00 41.76  ? 162 GLU E CA    1 
ATOM   1614 C C     . GLU E  1 21 ? -42.236 18.870 -1.605  1.00 39.84  ? 162 GLU E C     1 
ATOM   1615 O O     . GLU E  1 21 ? -43.044 17.955 -1.406  1.00 38.27  ? 162 GLU E O     1 
ATOM   1616 C CB    . GLU E  1 21 ? -43.505 20.851 -2.273  1.00 43.92  ? 162 GLU E CB    1 
ATOM   1617 C CG    . GLU E  1 21 ? -42.995 21.997 -1.442  1.00 44.52  ? 162 GLU E CG    1 
ATOM   1618 C CD    . GLU E  1 21 ? -44.149 22.804 -0.879  1.00 47.68  ? 162 GLU E CD    1 
ATOM   1619 O OE1   . GLU E  1 21 ? -45.237 22.259 -0.593  1.00 47.95  ? 162 GLU E OE1   1 
ATOM   1620 O OE2   . GLU E  1 21 ? -43.978 24.014 -0.685  1.00 57.48  ? 162 GLU E OE2   1 
ATOM   1621 N N     . GLU E  1 22 ? -41.180 19.096 -0.828  1.00 40.43  ? 163 GLU E N     1 
ATOM   1622 C CA    . GLU E  1 22 ? -40.864 18.269 0.301   1.00 42.12  ? 163 GLU E CA    1 
ATOM   1623 C C     . GLU E  1 22 ? -40.847 19.222 1.477   1.00 43.87  ? 163 GLU E C     1 
ATOM   1624 O O     . GLU E  1 22 ? -40.013 20.127 1.531   1.00 45.32  ? 163 GLU E O     1 
ATOM   1625 C CB    . GLU E  1 22 ? -39.527 17.495 0.162   1.00 45.34  ? 163 GLU E CB    1 
ATOM   1626 C CG    . GLU E  1 22 ? -39.587 16.090 0.776   1.00 46.78  ? 163 GLU E CG    1 
ATOM   1627 C CD    . GLU E  1 22 ? -38.227 15.451 1.108   1.00 50.89  ? 163 GLU E CD    1 
ATOM   1628 O OE1   . GLU E  1 22 ? -38.061 14.926 2.216   1.00 51.90  ? 163 GLU E OE1   1 
ATOM   1629 O OE2   . GLU E  1 22 ? -37.311 15.419 0.270   1.00 55.21  ? 163 GLU E OE2   1 
ATOM   1630 N N     . VAL E  1 23 ? -41.798 19.022 2.400   1.00 41.66  ? 164 VAL E N     1 
ATOM   1631 C CA    . VAL E  1 23 ? -41.885 19.813 3.600   1.00 41.35  ? 164 VAL E CA    1 
ATOM   1632 C C     . VAL E  1 23 ? -41.432 18.961 4.786   1.00 39.05  ? 164 VAL E C     1 
ATOM   1633 O O     . VAL E  1 23 ? -41.908 17.864 4.991   1.00 38.49  ? 164 VAL E O     1 
ATOM   1634 C CB    . VAL E  1 23 ? -43.327 20.391 3.815   1.00 41.37  ? 164 VAL E CB    1 
ATOM   1635 C CG1   . VAL E  1 23 ? -43.461 21.058 5.190   1.00 44.20  ? 164 VAL E CG1   1 
ATOM   1636 C CG2   . VAL E  1 23 ? -43.635 21.415 2.761   1.00 41.57  ? 164 VAL E CG2   1 
ATOM   1637 N N     . ILE E  1 24 ? -40.527 19.505 5.578   1.00 39.60  ? 165 ILE E N     1 
ATOM   1638 C CA    . ILE E  1 24 ? -40.053 18.851 6.795   1.00 39.25  ? 165 ILE E CA    1 
ATOM   1639 C C     . ILE E  1 24 ? -41.012 19.206 7.911   1.00 38.70  ? 165 ILE E C     1 
ATOM   1640 O O     . ILE E  1 24 ? -41.317 20.379 8.112   1.00 38.28  ? 165 ILE E O     1 
ATOM   1641 C CB    . ILE E  1 24 ? -38.662 19.350 7.154   1.00 41.40  ? 165 ILE E CB    1 
ATOM   1642 C CG1   . ILE E  1 24 ? -37.707 19.173 5.954   1.00 42.51  ? 165 ILE E CG1   1 
ATOM   1643 C CG2   . ILE E  1 24 ? -38.150 18.660 8.409   1.00 42.34  ? 165 ILE E CG2   1 
ATOM   1644 C CD1   . ILE E  1 24 ? -37.623 17.773 5.376   1.00 42.46  ? 165 ILE E CD1   1 
ATOM   1645 N N     . ARG E  1 25 ? -41.503 18.210 8.639   1.00 38.84  ? 166 ARG E N     1 
ATOM   1646 C CA    . ARG E  1 25 ? -42.344 18.483 9.847   1.00 40.63  ? 166 ARG E CA    1 
ATOM   1647 C C     . ARG E  1 25 ? -41.578 19.206 10.985  1.00 44.05  ? 166 ARG E C     1 
ATOM   1648 O O     . ARG E  1 25 ? -40.546 18.707 11.410  1.00 46.90  ? 166 ARG E O     1 
ATOM   1649 C CB    . ARG E  1 25 ? -42.908 17.170 10.394  1.00 39.06  ? 166 ARG E CB    1 
ATOM   1650 C CG    . ARG E  1 25 ? -43.811 16.493 9.407   1.00 36.77  ? 166 ARG E CG    1 
ATOM   1651 C CD    . ARG E  1 25 ? -44.850 15.701 10.117  1.00 37.72  ? 166 ARG E CD    1 
ATOM   1652 N NE    . ARG E  1 25 ? -45.654 14.986 9.153   1.00 36.47  ? 166 ARG E NE    1 
ATOM   1653 C CZ    . ARG E  1 25 ? -46.641 14.143 9.439   1.00 36.48  ? 166 ARG E CZ    1 
ATOM   1654 N NH1   . ARG E  1 25 ? -46.966 13.861 10.718  1.00 37.87  ? 166 ARG E NH1   1 
ATOM   1655 N NH2   . ARG E  1 25 ? -47.296 13.560 8.435   1.00 34.75  ? 166 ARG E NH2   1 
ATOM   1656 N N     . LYS E  1 26 ? -42.092 20.350 11.461  1.00 46.01  ? 167 LYS E N     1 
ATOM   1657 C CA    . LYS E  1 26 ? -41.371 21.262 12.370  1.00 48.51  ? 167 LYS E CA    1 
ATOM   1658 C C     . LYS E  1 26 ? -41.451 20.800 13.811  1.00 51.26  ? 167 LYS E C     1 
ATOM   1659 O O     . LYS E  1 26 ? -40.527 21.077 14.594  1.00 53.27  ? 167 LYS E O     1 
ATOM   1660 C CB    . LYS E  1 26 ? -41.910 22.736 12.275  1.00 49.70  ? 167 LYS E CB    1 
ATOM   1661 C CG    . LYS E  1 26 ? -41.717 23.477 10.923  1.00 50.45  ? 167 LYS E CG    1 
ATOM   1662 N N     . SER E  1 27 ? -42.534 20.113 14.189  1.00 52.78  ? 168 SER E N     1 
ATOM   1663 C CA    . SER E  1 27 ? -42.848 19.875 15.650  1.00 55.76  ? 168 SER E CA    1 
ATOM   1664 C C     . SER E  1 27 ? -43.701 18.633 15.932  1.00 56.24  ? 168 SER E C     1 
ATOM   1665 O O     . SER E  1 27 ? -44.080 17.896 15.040  1.00 55.99  ? 168 SER E O     1 
ATOM   1666 C CB    . SER E  1 27 ? -43.554 21.118 16.226  1.00 56.42  ? 168 SER E CB    1 
ATOM   1667 O OG    . SER E  1 27 ? -44.791 21.364 15.571  1.00 54.77  ? 168 SER E OG    1 
ATOM   1668 N N     . GLY E  1 28 ? -44.021 18.410 17.194  1.00 61.65  ? 169 GLY E N     1 
ATOM   1669 C CA    . GLY E  1 28 ? -44.789 17.236 17.595  1.00 63.42  ? 169 GLY E CA    1 
ATOM   1670 C C     . GLY E  1 28 ? -43.946 15.966 17.519  1.00 64.43  ? 169 GLY E C     1 
ATOM   1671 O O     . GLY E  1 28 ? -42.731 16.001 17.249  1.00 60.79  ? 169 GLY E O     1 
ATOM   1672 N N     . LEU E  1 29 ? -44.619 14.846 17.782  1.00 67.04  ? 170 LEU E N     1 
ATOM   1673 C CA    . LEU E  1 29 ? -43.985 13.529 17.872  1.00 67.65  ? 170 LEU E CA    1 
ATOM   1674 C C     . LEU E  1 29 ? -43.336 13.182 16.548  1.00 64.82  ? 170 LEU E C     1 
ATOM   1675 O O     . LEU E  1 29 ? -42.293 12.510 16.537  1.00 62.59  ? 170 LEU E O     1 
ATOM   1676 C CB    . LEU E  1 29 ? -45.007 12.453 18.302  1.00 69.98  ? 170 LEU E CB    1 
ATOM   1677 N N     . SER E  1 30 ? -43.916 13.711 15.448  1.00 60.47  ? 171 SER E N     1 
ATOM   1678 C CA    . SER E  1 30 ? -43.417 13.457 14.085  1.00 56.57  ? 171 SER E CA    1 
ATOM   1679 C C     . SER E  1 30 ? -42.304 14.392 13.525  1.00 56.18  ? 171 SER E C     1 
ATOM   1680 O O     . SER E  1 30 ? -41.893 14.239 12.352  1.00 56.30  ? 171 SER E O     1 
ATOM   1681 C CB    . SER E  1 30 ? -44.605 13.442 13.124  1.00 53.68  ? 171 SER E CB    1 
ATOM   1682 O OG    . SER E  1 30 ? -45.306 14.665 13.183  1.00 51.72  ? 171 SER E OG    1 
ATOM   1683 N N     . ALA E  1 31 ? -41.794 15.312 14.351  1.00 55.22  ? 172 ALA E N     1 
ATOM   1684 C CA    . ALA E  1 31 ? -40.851 16.342 13.898  1.00 54.41  ? 172 ALA E CA    1 
ATOM   1685 C C     . ALA E  1 31 ? -39.572 15.753 13.320  1.00 54.55  ? 172 ALA E C     1 
ATOM   1686 O O     . ALA E  1 31 ? -39.053 14.759 13.837  1.00 54.50  ? 172 ALA E O     1 
ATOM   1687 C CB    . ALA E  1 31 ? -40.503 17.305 15.030  1.00 57.39  ? 172 ALA E CB    1 
ATOM   1688 N N     . GLY E  1 32 ? -39.106 16.364 12.220  1.00 53.62  ? 173 GLY E N     1 
ATOM   1689 C CA    . GLY E  1 32 ? -37.922 15.915 11.504  1.00 53.18  ? 173 GLY E CA    1 
ATOM   1690 C C     . GLY E  1 32 ? -38.255 15.012 10.348  1.00 51.26  ? 173 GLY E C     1 
ATOM   1691 O O     . GLY E  1 32 ? -37.411 14.806 9.506   1.00 49.24  ? 173 GLY E O     1 
ATOM   1692 N N     . LYS E  1 33 ? -39.472 14.454 10.320  1.00 50.61  ? 174 LYS E N     1 
ATOM   1693 C CA    . LYS E  1 33 ? -39.916 13.583 9.220   1.00 50.18  ? 174 LYS E CA    1 
ATOM   1694 C C     . LYS E  1 33 ? -40.325 14.480 8.039   1.00 46.68  ? 174 LYS E C     1 
ATOM   1695 O O     . LYS E  1 33 ? -40.595 15.657 8.255   1.00 45.61  ? 174 LYS E O     1 
ATOM   1696 C CB    . LYS E  1 33 ? -41.127 12.753 9.689   1.00 50.46  ? 174 LYS E CB    1 
ATOM   1697 N N     . SER E  1 34 ? -40.444 13.951 6.827   1.00 43.79  ? 175 SER E N     1 
ATOM   1698 C CA    . SER E  1 34 ? -40.930 14.800 5.698   1.00 41.48  ? 175 SER E CA    1 
ATOM   1699 C C     . SER E  1 34 ? -42.143 14.303 4.995   1.00 38.81  ? 175 SER E C     1 
ATOM   1700 O O     . SER E  1 34 ? -42.394 13.126 4.975   1.00 38.77  ? 175 SER E O     1 
ATOM   1701 C CB    . SER E  1 34 ? -39.866 15.003 4.632   1.00 42.44  ? 175 SER E CB    1 
ATOM   1702 O OG    . SER E  1 34 ? -39.679 13.824 3.891   1.00 42.15  ? 175 SER E OG    1 
ATOM   1703 N N     . ASP E  1 35 ? -42.909 15.232 4.432   1.00 36.38  ? 176 ASP E N     1 
ATOM   1704 C CA    . ASP E  1 35 ? -44.021 14.902 3.631   1.00 33.24  ? 176 ASP E CA    1 
ATOM   1705 C C     . ASP E  1 35 ? -43.723 15.474 2.218   1.00 32.98  ? 176 ASP E C     1 
ATOM   1706 O O     . ASP E  1 35 ? -43.176 16.597 2.038   1.00 34.36  ? 176 ASP E O     1 
ATOM   1707 C CB    . ASP E  1 35 ? -45.336 15.469 4.172   1.00 32.67  ? 176 ASP E CB    1 
ATOM   1708 C CG    . ASP E  1 35 ? -45.662 15.044 5.623   1.00 33.78  ? 176 ASP E CG    1 
ATOM   1709 O OD1   . ASP E  1 35 ? -45.302 15.822 6.483   1.00 32.58  ? 176 ASP E OD1   1 
ATOM   1710 O OD2   . ASP E  1 35 ? -46.354 14.009 5.907   1.00 34.76  ? 176 ASP E OD2   1 
ATOM   1711 N N     . VAL E  1 36 ? -44.151 14.720 1.222   1.00 32.22  ? 177 VAL E N     1 
ATOM   1712 C CA    . VAL E  1 36 ? -43.980 15.073 -0.184  1.00 32.70  ? 177 VAL E CA    1 
ATOM   1713 C C     . VAL E  1 36 ? -45.334 15.391 -0.770  1.00 31.98  ? 177 VAL E C     1 
ATOM   1714 O O     . VAL E  1 36 ? -46.278 14.616 -0.643  1.00 34.54  ? 177 VAL E O     1 
ATOM   1715 C CB    . VAL E  1 36 ? -43.363 13.888 -0.933  1.00 32.92  ? 177 VAL E CB    1 
ATOM   1716 C CG1   . VAL E  1 36 ? -43.206 14.175 -2.425  1.00 33.83  ? 177 VAL E CG1   1 
ATOM   1717 C CG2   . VAL E  1 36 ? -42.006 13.570 -0.356  1.00 34.75  ? 177 VAL E CG2   1 
ATOM   1718 N N     . TYR E  1 37 ? -45.456 16.559 -1.366  1.00 32.22  ? 178 TYR E N     1 
ATOM   1719 C CA    . TYR E  1 37 ? -46.687 16.943 -2.033  1.00 32.42  ? 178 TYR E CA    1 
ATOM   1720 C C     . TYR E  1 37 ? -46.425 17.161 -3.495  1.00 33.35  ? 178 TYR E C     1 
ATOM   1721 O O     . TYR E  1 37 ? -45.314 17.576 -3.848  1.00 36.76  ? 178 TYR E O     1 
ATOM   1722 C CB    . TYR E  1 37 ? -47.253 18.215 -1.399  1.00 32.23  ? 178 TYR E CB    1 
ATOM   1723 C CG    . TYR E  1 37 ? -47.443 18.109 0.089   1.00 30.90  ? 178 TYR E CG    1 
ATOM   1724 C CD1   . TYR E  1 37 ? -48.219 17.105 0.628   1.00 31.93  ? 178 TYR E CD1   1 
ATOM   1725 C CD2   . TYR E  1 37 ? -46.862 19.034 0.955   1.00 31.16  ? 178 TYR E CD2   1 
ATOM   1726 C CE1   . TYR E  1 37 ? -48.435 16.988 2.023   1.00 32.09  ? 178 TYR E CE1   1 
ATOM   1727 C CE2   . TYR E  1 37 ? -47.028 18.948 2.317   1.00 31.36  ? 178 TYR E CE2   1 
ATOM   1728 C CZ    . TYR E  1 37 ? -47.815 17.908 2.885   1.00 32.61  ? 178 TYR E CZ    1 
ATOM   1729 O OH    . TYR E  1 37 ? -47.984 17.804 4.264   1.00 32.72  ? 178 TYR E OH    1 
ATOM   1730 N N     . TYR E  1 38 ? -47.402 16.861 -4.350  1.00 33.42  ? 179 TYR E N     1 
ATOM   1731 C CA    . TYR E  1 38 ? -47.339 17.259 -5.762  1.00 34.97  ? 179 TYR E CA    1 
ATOM   1732 C C     . TYR E  1 38 ? -48.423 18.270 -6.104  1.00 35.96  ? 179 TYR E C     1 
ATOM   1733 O O     . TYR E  1 38 ? -49.514 18.303 -5.465  1.00 35.55  ? 179 TYR E O     1 
ATOM   1734 C CB    . TYR E  1 38 ? -47.451 16.052 -6.706  1.00 35.36  ? 179 TYR E CB    1 
ATOM   1735 C CG    . TYR E  1 38 ? -46.272 15.144 -6.635  1.00 34.84  ? 179 TYR E CG    1 
ATOM   1736 C CD1   . TYR E  1 38 ? -46.196 14.177 -5.681  1.00 34.97  ? 179 TYR E CD1   1 
ATOM   1737 C CD2   . TYR E  1 38 ? -45.249 15.227 -7.552  1.00 36.93  ? 179 TYR E CD2   1 
ATOM   1738 C CE1   . TYR E  1 38 ? -45.096 13.334 -5.592  1.00 35.76  ? 179 TYR E CE1   1 
ATOM   1739 C CE2   . TYR E  1 38 ? -44.138 14.387 -7.477  1.00 37.34  ? 179 TYR E CE2   1 
ATOM   1740 C CZ    . TYR E  1 38 ? -44.057 13.455 -6.488  1.00 36.83  ? 179 TYR E CZ    1 
ATOM   1741 O OH    . TYR E  1 38 ? -42.941 12.623 -6.404  1.00 38.94  ? 179 TYR E OH    1 
ATOM   1742 N N     . PHE E  1 39 ? -48.098 19.120 -7.077  1.00 36.20  ? 180 PHE E N     1 
ATOM   1743 C CA    . PHE E  1 39 ? -49.015 20.166 -7.517  1.00 39.45  ? 180 PHE E CA    1 
ATOM   1744 C C     . PHE E  1 39 ? -49.290 20.055 -9.009  1.00 40.67  ? 180 PHE E C     1 
ATOM   1745 O O     . PHE E  1 39 ? -48.341 19.916 -9.770  1.00 40.78  ? 180 PHE E O     1 
ATOM   1746 C CB    . PHE E  1 39 ? -48.472 21.535 -7.157  1.00 40.18  ? 180 PHE E CB    1 
ATOM   1747 C CG    . PHE E  1 39 ? -48.395 21.747 -5.680  1.00 38.88  ? 180 PHE E CG    1 
ATOM   1748 C CD1   . PHE E  1 39 ? -47.269 21.405 -4.985  1.00 39.09  ? 180 PHE E CD1   1 
ATOM   1749 C CD2   . PHE E  1 39 ? -49.474 22.233 -4.989  1.00 39.35  ? 180 PHE E CD2   1 
ATOM   1750 C CE1   . PHE E  1 39 ? -47.199 21.566 -3.598  1.00 38.37  ? 180 PHE E CE1   1 
ATOM   1751 C CE2   . PHE E  1 39 ? -49.413 22.437 -3.625  1.00 39.86  ? 180 PHE E CE2   1 
ATOM   1752 C CZ    . PHE E  1 39 ? -48.274 22.109 -2.922  1.00 38.52  ? 180 PHE E CZ    1 
ATOM   1753 N N     . SER E  1 40 ? -50.570 20.080 -9.407  1.00 40.06  ? 181 SER E N     1 
ATOM   1754 C CA    . SER E  1 40 ? -50.945 20.031 -10.822 1.00 43.01  ? 181 SER E CA    1 
ATOM   1755 C C     . SER E  1 40 ? -50.527 21.342 -11.495 1.00 46.03  ? 181 SER E C     1 
ATOM   1756 O O     . SER E  1 40 ? -50.182 22.337 -10.803 1.00 48.29  ? 181 SER E O     1 
ATOM   1757 C CB    . SER E  1 40 ? -52.458 19.839 -10.993 1.00 43.39  ? 181 SER E CB    1 
ATOM   1758 O OG    . SER E  1 40 ? -53.184 21.053 -10.736 1.00 45.57  ? 181 SER E OG    1 
ATOM   1759 N N     . PRO E  1 41 ? -50.600 21.383 -12.822 1.00 47.09  ? 182 PRO E N     1 
ATOM   1760 C CA    . PRO E  1 41 ? -50.385 22.674 -13.448 1.00 50.07  ? 182 PRO E CA    1 
ATOM   1761 C C     . PRO E  1 41 ? -51.454 23.705 -13.046 1.00 52.72  ? 182 PRO E C     1 
ATOM   1762 O O     . PRO E  1 41 ? -51.093 24.862 -12.825 1.00 53.84  ? 182 PRO E O     1 
ATOM   1763 C CB    . PRO E  1 41 ? -50.405 22.349 -14.958 1.00 51.62  ? 182 PRO E CB    1 
ATOM   1764 C CG    . PRO E  1 41 ? -50.871 20.930 -15.075 1.00 49.35  ? 182 PRO E CG    1 
ATOM   1765 C CD    . PRO E  1 41 ? -50.563 20.274 -13.790 1.00 47.14  ? 182 PRO E CD    1 
ATOM   1766 N N     . SER E  1 42 ? -52.734 23.304 -12.944 1.00 55.23  ? 183 SER E N     1 
ATOM   1767 C CA    . SER E  1 42 ? -53.776 24.134 -12.225 1.00 58.37  ? 183 SER E CA    1 
ATOM   1768 C C     . SER E  1 42 ? -53.250 24.728 -10.876 1.00 57.83  ? 183 SER E C     1 
ATOM   1769 O O     . SER E  1 42 ? -53.431 25.899 -10.595 1.00 62.94  ? 183 SER E O     1 
ATOM   1770 C CB    . SER E  1 42 ? -55.051 23.310 -11.944 1.00 56.76  ? 183 SER E CB    1 
ATOM   1771 N N     . GLY E  1 43 ? -52.566 23.921 -10.066 1.00 55.32  ? 184 GLY E N     1 
ATOM   1772 C CA    . GLY E  1 43 ? -52.176 24.285 -8.669  1.00 52.10  ? 184 GLY E CA    1 
ATOM   1773 C C     . GLY E  1 43 ? -52.771 23.393 -7.563  1.00 48.56  ? 184 GLY E C     1 
ATOM   1774 O O     . GLY E  1 43 ? -52.492 23.620 -6.392  1.00 46.24  ? 184 GLY E O     1 
ATOM   1775 N N     . LYS E  1 44 ? -53.585 22.403 -7.940  1.00 48.06  ? 185 LYS E N     1 
ATOM   1776 C CA    . LYS E  1 44 ? -54.172 21.408 -7.042  1.00 48.25  ? 185 LYS E CA    1 
ATOM   1777 C C     . LYS E  1 44 ? -53.142 20.527 -6.329  1.00 45.77  ? 185 LYS E C     1 
ATOM   1778 O O     . LYS E  1 44 ? -52.195 19.996 -6.939  1.00 44.54  ? 185 LYS E O     1 
ATOM   1779 C CB    . LYS E  1 44 ? -55.173 20.488 -7.801  1.00 51.02  ? 185 LYS E CB    1 
ATOM   1780 C CG    . LYS E  1 44 ? -56.016 19.623 -6.835  1.00 52.31  ? 185 LYS E CG    1 
ATOM   1781 C CD    . LYS E  1 44 ? -57.118 18.759 -7.490  1.00 55.28  ? 185 LYS E CD    1 
ATOM   1782 C CE    . LYS E  1 44 ? -58.059 18.098 -6.467  1.00 54.14  ? 185 LYS E CE    1 
ATOM   1783 N N     . LYS E  1 45 ? -53.374 20.300 -5.039  1.00 43.02  ? 186 LYS E N     1 
ATOM   1784 C CA    . LYS E  1 45 ? -52.402 19.595 -4.206  1.00 40.03  ? 186 LYS E CA    1 
ATOM   1785 C C     . LYS E  1 45 ? -52.694 18.112 -4.123  1.00 38.16  ? 186 LYS E C     1 
ATOM   1786 O O     . LYS E  1 45 ? -53.816 17.777 -3.891  1.00 39.19  ? 186 LYS E O     1 
ATOM   1787 C CB    . LYS E  1 45 ? -52.467 20.149 -2.797  1.00 39.52  ? 186 LYS E CB    1 
ATOM   1788 C CG    . LYS E  1 45 ? -51.310 19.758 -1.912  1.00 37.47  ? 186 LYS E CG    1 
ATOM   1789 C CD    . LYS E  1 45 ? -51.339 20.669 -0.684  1.00 38.56  ? 186 LYS E CD    1 
ATOM   1790 C CE    . LYS E  1 45 ? -50.740 19.973 0.517   1.00 36.94  ? 186 LYS E CE    1 
ATOM   1791 N NZ    . LYS E  1 45 ? -50.472 20.961 1.572   1.00 38.53  ? 186 LYS E NZ    1 
ATOM   1792 N N     . PHE E  1 46 ? -51.684 17.250 -4.277  1.00 35.34  ? 187 PHE E N     1 
ATOM   1793 C CA    . PHE E  1 46 ? -51.853 15.808 -4.100  1.00 34.80  ? 187 PHE E CA    1 
ATOM   1794 C C     . PHE E  1 46 ? -50.884 15.330 -3.049  1.00 33.28  ? 187 PHE E C     1 
ATOM   1795 O O     . PHE E  1 46 ? -49.755 15.788 -2.972  1.00 32.52  ? 187 PHE E O     1 
ATOM   1796 C CB    . PHE E  1 46 ? -51.633 15.054 -5.396  1.00 36.60  ? 187 PHE E CB    1 
ATOM   1797 C CG    . PHE E  1 46 ? -52.523 15.509 -6.500  1.00 39.42  ? 187 PHE E CG    1 
ATOM   1798 C CD1   . PHE E  1 46 ? -52.265 16.676 -7.179  1.00 39.58  ? 187 PHE E CD1   1 
ATOM   1799 C CD2   . PHE E  1 46 ? -53.678 14.813 -6.797  1.00 42.18  ? 187 PHE E CD2   1 
ATOM   1800 C CE1   . PHE E  1 46 ? -53.100 17.132 -8.185  1.00 41.68  ? 187 PHE E CE1   1 
ATOM   1801 C CE2   . PHE E  1 46 ? -54.531 15.267 -7.777  1.00 43.29  ? 187 PHE E CE2   1 
ATOM   1802 C CZ    . PHE E  1 46 ? -54.233 16.421 -8.489  1.00 43.97  ? 187 PHE E CZ    1 
ATOM   1803 N N     . ARG E  1 47 ? -51.336 14.414 -2.213  1.00 34.14  ? 188 ARG E N     1 
ATOM   1804 C CA    . ARG E  1 47 ? -50.578 14.007 -1.013  1.00 33.33  ? 188 ARG E CA    1 
ATOM   1805 C C     . ARG E  1 47 ? -50.225 12.553 -0.994  1.00 33.90  ? 188 ARG E C     1 
ATOM   1806 O O     . ARG E  1 47 ? -49.587 12.093 -0.050  1.00 32.32  ? 188 ARG E O     1 
ATOM   1807 C CB    . ARG E  1 47 ? -51.417 14.232 0.212   1.00 34.06  ? 188 ARG E CB    1 
ATOM   1808 C CG    . ARG E  1 47 ? -51.971 15.612 0.339   1.00 35.31  ? 188 ARG E CG    1 
ATOM   1809 C CD    . ARG E  1 47 ? -52.165 15.944 1.809   1.00 35.55  ? 188 ARG E CD    1 
ATOM   1810 N NE    . ARG E  1 47 ? -53.009 17.113 1.999   1.00 35.23  ? 188 ARG E NE    1 
ATOM   1811 C CZ    . ARG E  1 47 ? -53.242 17.703 3.167   1.00 35.83  ? 188 ARG E CZ    1 
ATOM   1812 N NH1   . ARG E  1 47 ? -52.701 17.269 4.314   1.00 34.98  ? 188 ARG E NH1   1 
ATOM   1813 N NH2   . ARG E  1 47 ? -54.020 18.766 3.178   1.00 37.02  ? 188 ARG E NH2   1 
ATOM   1814 N N     . SER E  1 48 ? -50.647 11.822 -2.021  1.00 33.81  ? 189 SER E N     1 
ATOM   1815 C CA    . SER E  1 48 ? -50.281 10.420 -2.145  1.00 34.86  ? 189 SER E CA    1 
ATOM   1816 C C     . SER E  1 48 ? -50.363 9.965  -3.624  1.00 36.17  ? 189 SER E C     1 
ATOM   1817 O O     . SER E  1 48 ? -50.981 10.659 -4.474  1.00 33.72  ? 189 SER E O     1 
ATOM   1818 C CB    . SER E  1 48 ? -51.244 9.563  -1.354  1.00 34.15  ? 189 SER E CB    1 
ATOM   1819 O OG    . SER E  1 48 ? -52.520 9.486  -2.039  1.00 33.56  ? 189 SER E OG    1 
ATOM   1820 N N     . LYS E  1 49 ? -49.803 8.782  -3.867  1.00 36.51  ? 190 LYS E N     1 
ATOM   1821 C CA    . LYS E  1 49 ? -49.703 8.221  -5.197  1.00 39.33  ? 190 LYS E CA    1 
ATOM   1822 C C     . LYS E  1 49 ? -51.040 7.772  -5.738  1.00 41.03  ? 190 LYS E C     1 
ATOM   1823 O O     . LYS E  1 49 ? -51.321 8.011  -6.941  1.00 43.06  ? 190 LYS E O     1 
ATOM   1824 C CB    . LYS E  1 49 ? -48.695 7.070  -5.212  1.00 41.23  ? 190 LYS E CB    1 
ATOM   1825 C CG    . LYS E  1 49 ? -48.452 6.435  -6.596  1.00 43.74  ? 190 LYS E CG    1 
ATOM   1826 C CD    . LYS E  1 49 ? -47.363 5.354  -6.518  1.00 45.09  ? 190 LYS E CD    1 
ATOM   1827 C CE    . LYS E  1 49 ? -47.453 4.315  -7.600  1.00 48.96  ? 190 LYS E CE    1 
ATOM   1828 N NZ    . LYS E  1 49 ? -46.309 3.359  -7.412  1.00 51.12  ? 190 LYS E NZ    1 
ATOM   1829 N N     . PRO E  1 50 ? -51.870 7.116  -4.897  1.00 40.50  ? 191 PRO E N     1 
ATOM   1830 C CA    . PRO E  1 50 ? -53.185 6.781  -5.432  1.00 42.10  ? 191 PRO E CA    1 
ATOM   1831 C C     . PRO E  1 50 ? -54.081 7.990  -5.661  1.00 41.83  ? 191 PRO E C     1 
ATOM   1832 O O     . PRO E  1 50 ? -54.971 7.923  -6.527  1.00 42.82  ? 191 PRO E O     1 
ATOM   1833 C CB    . PRO E  1 50 ? -53.791 5.820  -4.403  1.00 43.38  ? 191 PRO E CB    1 
ATOM   1834 C CG    . PRO E  1 50 ? -52.641 5.348  -3.584  1.00 43.85  ? 191 PRO E CG    1 
ATOM   1835 C CD    . PRO E  1 50 ? -51.609 6.433  -3.619  1.00 41.26  ? 191 PRO E CD    1 
ATOM   1836 N N     . GLN E  1 51 ? -53.861 9.081  -4.938  1.00 39.75  ? 192 GLN E N     1 
ATOM   1837 C CA    . GLN E  1 51 ? -54.660 10.311 -5.185  1.00 40.89  ? 192 GLN E CA    1 
ATOM   1838 C C     . GLN E  1 51 ? -54.277 10.821 -6.565  1.00 38.40  ? 192 GLN E C     1 
ATOM   1839 O O     . GLN E  1 51 ? -55.124 11.165 -7.380  1.00 37.56  ? 192 GLN E O     1 
ATOM   1840 C CB    . GLN E  1 51 ? -54.416 11.374 -4.076  1.00 41.82  ? 192 GLN E CB    1 
ATOM   1841 C CG    . GLN E  1 51 ? -55.354 12.610 -3.996  1.00 44.10  ? 192 GLN E CG    1 
ATOM   1842 C CD    . GLN E  1 51 ? -54.874 13.657 -2.932  1.00 46.05  ? 192 GLN E CD    1 
ATOM   1843 O OE1   . GLN E  1 51 ? -53.847 13.461 -2.273  1.00 43.37  ? 192 GLN E OE1   1 
ATOM   1844 N NE2   . GLN E  1 51 ? -55.587 14.798 -2.819  1.00 48.47  ? 192 GLN E NE2   1 
ATOM   1845 N N     . LEU E  1 52 ? -52.986 10.776 -6.821  1.00 37.57  ? 193 LEU E N     1 
ATOM   1846 C CA    . LEU E  1 52 ? -52.414 11.112 -8.105  1.00 40.15  ? 193 LEU E CA    1 
ATOM   1847 C C     . LEU E  1 52 ? -52.861 10.234 -9.271  1.00 42.07  ? 193 LEU E C     1 
ATOM   1848 O O     . LEU E  1 52 ? -53.183 10.759 -10.331 1.00 45.70  ? 193 LEU E O     1 
ATOM   1849 C CB    . LEU E  1 52 ? -50.901 11.087 -7.989  1.00 40.29  ? 193 LEU E CB    1 
ATOM   1850 C CG    . LEU E  1 52 ? -50.056 11.892 -8.935  1.00 42.52  ? 193 LEU E CG    1 
ATOM   1851 C CD1   . LEU E  1 52 ? -50.342 13.377 -8.859  1.00 42.65  ? 193 LEU E CD1   1 
ATOM   1852 C CD2   . LEU E  1 52 ? -48.587 11.627 -8.569  1.00 44.71  ? 193 LEU E CD2   1 
ATOM   1853 N N     . ALA E  1 53 ? -52.847 8.914  -9.098  1.00 43.62  ? 194 ALA E N     1 
ATOM   1854 C CA    . ALA E  1 53 ? -53.286 7.981  -10.176 1.00 44.17  ? 194 ALA E CA    1 
ATOM   1855 C C     . ALA E  1 53 ? -54.784 8.094  -10.468 1.00 45.89  ? 194 ALA E C     1 
ATOM   1856 O O     . ALA E  1 53 ? -55.204 7.998  -11.654 1.00 48.48  ? 194 ALA E O     1 
ATOM   1857 C CB    . ALA E  1 53 ? -52.925 6.541  -9.880  1.00 43.69  ? 194 ALA E CB    1 
ATOM   1858 N N     . ARG E  1 54 ? -55.577 8.338  -9.437  1.00 46.19  ? 195 ARG E N     1 
ATOM   1859 C CA    . ARG E  1 54 ? -57.007 8.663  -9.629  1.00 50.26  ? 195 ARG E CA    1 
ATOM   1860 C C     . ARG E  1 54 ? -57.182 9.894  -10.551 1.00 49.46  ? 195 ARG E C     1 
ATOM   1861 O O     . ARG E  1 54 ? -57.948 9.841  -11.525 1.00 52.13  ? 195 ARG E O     1 
ATOM   1862 C CB    . ARG E  1 54 ? -57.730 8.908  -8.295  1.00 52.75  ? 195 ARG E CB    1 
ATOM   1863 C CG    . ARG E  1 54 ? -57.959 7.662  -7.440  1.00 57.14  ? 195 ARG E CG    1 
ATOM   1864 C CD    . ARG E  1 54 ? -59.022 7.879  -6.339  1.00 60.56  ? 195 ARG E CD    1 
ATOM   1865 N NE    . ARG E  1 54 ? -58.698 8.917  -5.332  1.00 59.84  ? 195 ARG E NE    1 
ATOM   1866 C CZ    . ARG E  1 54 ? -57.974 8.729  -4.214  1.00 60.27  ? 195 ARG E CZ    1 
ATOM   1867 N NH1   . ARG E  1 54 ? -57.440 7.542  -3.899  1.00 60.04  ? 195 ARG E NH1   1 
ATOM   1868 N NH2   . ARG E  1 54 ? -57.750 9.762  -3.402  1.00 60.52  ? 195 ARG E NH2   1 
ATOM   1869 N N     . TYR E  1 55 ? -56.448 10.980 -10.283 1.00 45.13  ? 196 TYR E N     1 
ATOM   1870 C CA    . TYR E  1 55 ? -56.586 12.216 -11.090 1.00 43.47  ? 196 TYR E CA    1 
ATOM   1871 C C     . TYR E  1 55 ? -56.053 12.044 -12.520 1.00 42.97  ? 196 TYR E C     1 
ATOM   1872 O O     . TYR E  1 55 ? -56.724 12.399 -13.456 1.00 46.37  ? 196 TYR E O     1 
ATOM   1873 C CB    . TYR E  1 55 ? -55.909 13.386 -10.395 1.00 40.88  ? 196 TYR E CB    1 
ATOM   1874 C CG    . TYR E  1 55 ? -56.047 14.744 -11.042 1.00 41.35  ? 196 TYR E CG    1 
ATOM   1875 C CD1   . TYR E  1 55 ? -57.146 15.556 -10.798 1.00 42.47  ? 196 TYR E CD1   1 
ATOM   1876 C CD2   . TYR E  1 55 ? -55.040 15.242 -11.883 1.00 41.56  ? 196 TYR E CD2   1 
ATOM   1877 C CE1   . TYR E  1 55 ? -57.253 16.811 -11.388 1.00 43.85  ? 196 TYR E CE1   1 
ATOM   1878 C CE2   . TYR E  1 55 ? -55.154 16.484 -12.490 1.00 43.09  ? 196 TYR E CE2   1 
ATOM   1879 C CZ    . TYR E  1 55 ? -56.234 17.274 -12.218 1.00 43.87  ? 196 TYR E CZ    1 
ATOM   1880 O OH    . TYR E  1 55 ? -56.303 18.509 -12.810 1.00 46.91  ? 196 TYR E OH    1 
ATOM   1881 N N     . LEU E  1 56 ? -54.852 11.516 -12.690 1.00 41.63  ? 197 LEU E N     1 
ATOM   1882 C CA    . LEU E  1 56 ? -54.245 11.382 -14.039 1.00 40.35  ? 197 LEU E CA    1 
ATOM   1883 C C     . LEU E  1 56 ? -54.858 10.284 -14.890 1.00 42.27  ? 197 LEU E C     1 
ATOM   1884 O O     . LEU E  1 56 ? -54.861 10.389 -16.143 1.00 43.31  ? 197 LEU E O     1 
ATOM   1885 C CB    . LEU E  1 56 ? -52.734 11.169 -13.949 1.00 38.86  ? 197 LEU E CB    1 
ATOM   1886 C CG    . LEU E  1 56 ? -51.995 12.432 -13.477 1.00 38.09  ? 197 LEU E CG    1 
ATOM   1887 C CD1   . LEU E  1 56 ? -50.565 12.154 -12.989 1.00 36.65  ? 197 LEU E CD1   1 
ATOM   1888 C CD2   . LEU E  1 56 ? -52.018 13.489 -14.583 1.00 39.28  ? 197 LEU E CD2   1 
ATOM   1889 N N     . GLY E  1 57 ? -55.358 9.241  -14.215 1.00 41.75  ? 198 GLY E N     1 
ATOM   1890 C CA    . GLY E  1 57 ? -55.913 8.048  -14.841 1.00 43.93  ? 198 GLY E CA    1 
ATOM   1891 C C     . GLY E  1 57 ? -54.934 7.436  -15.838 1.00 45.24  ? 198 GLY E C     1 
ATOM   1892 O O     . GLY E  1 57 ? -53.768 7.257  -15.539 1.00 44.48  ? 198 GLY E O     1 
ATOM   1893 N N     . ASN E  1 58 ? -55.383 7.202  -17.049 1.00 46.17  ? 199 ASN E N     1 
ATOM   1894 C CA    . ASN E  1 58 ? -54.523 6.555  -17.998 1.00 47.78  ? 199 ASN E CA    1 
ATOM   1895 C C     . ASN E  1 58 ? -53.677 7.527  -18.858 1.00 48.23  ? 199 ASN E C     1 
ATOM   1896 O O     . ASN E  1 58 ? -53.079 7.111  -19.838 1.00 48.84  ? 199 ASN E O     1 
ATOM   1897 C CB    . ASN E  1 58 ? -55.360 5.570  -18.833 1.00 50.20  ? 199 ASN E CB    1 
ATOM   1898 C CG    . ASN E  1 58 ? -56.305 6.256  -19.797 1.00 51.51  ? 199 ASN E CG    1 
ATOM   1899 O OD1   . ASN E  1 58 ? -56.340 7.499  -19.891 1.00 49.92  ? 199 ASN E OD1   1 
ATOM   1900 N ND2   . ASN E  1 58 ? -57.047 5.444  -20.564 1.00 53.69  ? 199 ASN E ND2   1 
ATOM   1901 N N     . THR E  1 59 ? -53.598 8.817  -18.488 1.00 48.04  ? 200 THR E N     1 
ATOM   1902 C CA    . THR E  1 59 ? -52.736 9.743  -19.199 1.00 47.80  ? 200 THR E CA    1 
ATOM   1903 C C     . THR E  1 59 ? -51.253 9.442  -18.908 1.00 49.56  ? 200 THR E C     1 
ATOM   1904 O O     . THR E  1 59 ? -50.356 9.868  -19.649 1.00 51.04  ? 200 THR E O     1 
ATOM   1905 C CB    . THR E  1 59 ? -53.065 11.202 -18.879 1.00 45.61  ? 200 THR E CB    1 
ATOM   1906 O OG1   . THR E  1 59 ? -52.947 11.423 -17.471 1.00 44.04  ? 200 THR E OG1   1 
ATOM   1907 C CG2   . THR E  1 59 ? -54.447 11.533 -19.296 1.00 46.48  ? 200 THR E CG2   1 
ATOM   1908 N N     . VAL E  1 60 ? -50.993 8.697  -17.845 1.00 51.43  ? 201 VAL E N     1 
ATOM   1909 C CA    . VAL E  1 60 ? -49.658 8.484  -17.367 1.00 54.20  ? 201 VAL E CA    1 
ATOM   1910 C C     . VAL E  1 60 ? -49.596 7.170  -16.571 1.00 56.84  ? 201 VAL E C     1 
ATOM   1911 O O     . VAL E  1 60 ? -50.362 6.985  -15.610 1.00 54.15  ? 201 VAL E O     1 
ATOM   1912 C CB    . VAL E  1 60 ? -49.254 9.645  -16.402 1.00 53.36  ? 201 VAL E CB    1 
ATOM   1913 C CG1   . VAL E  1 60 ? -47.816 9.473  -15.915 1.00 53.82  ? 201 VAL E CG1   1 
ATOM   1914 C CG2   . VAL E  1 60 ? -49.381 11.009 -17.060 1.00 53.00  ? 201 VAL E CG2   1 
ATOM   1915 N N     . ASP E  1 61 ? -48.652 6.295  -16.942 1.00 59.39  ? 202 ASP E N     1 
ATOM   1916 C CA    . ASP E  1 61 ? -48.359 5.064  -16.180 1.00 59.65  ? 202 ASP E CA    1 
ATOM   1917 C C     . ASP E  1 61 ? -47.537 5.384  -14.942 1.00 56.46  ? 202 ASP E C     1 
ATOM   1918 O O     . ASP E  1 61 ? -46.422 5.864  -15.033 1.00 58.19  ? 202 ASP E O     1 
ATOM   1919 C CB    . ASP E  1 61 ? -47.593 4.035  -17.044 1.00 63.83  ? 202 ASP E CB    1 
ATOM   1920 C CG    . ASP E  1 61 ? -47.679 2.602  -16.487 1.00 67.05  ? 202 ASP E CG    1 
ATOM   1921 O OD1   . ASP E  1 61 ? -47.847 2.434  -15.258 1.00 66.87  ? 202 ASP E OD1   1 
ATOM   1922 O OD2   . ASP E  1 61 ? -47.591 1.633  -17.297 1.00 72.99  ? 202 ASP E OD2   1 
ATOM   1923 N N     . LEU E  1 62 ? -48.084 5.071  -13.782 1.00 54.40  ? 203 LEU E N     1 
ATOM   1924 C CA    . LEU E  1 62 ? -47.432 5.364  -12.534 1.00 52.43  ? 203 LEU E CA    1 
ATOM   1925 C C     . LEU E  1 62 ? -46.968 4.126  -11.818 1.00 53.93  ? 203 LEU E C     1 
ATOM   1926 O O     . LEU E  1 62 ? -46.380 4.242  -10.766 1.00 53.98  ? 203 LEU E O     1 
ATOM   1927 C CB    . LEU E  1 62 ? -48.392 6.125  -11.627 1.00 50.17  ? 203 LEU E CB    1 
ATOM   1928 C CG    . LEU E  1 62 ? -48.734 7.527  -12.080 1.00 48.53  ? 203 LEU E CG    1 
ATOM   1929 C CD1   . LEU E  1 62 ? -49.829 8.043  -11.180 1.00 48.89  ? 203 LEU E CD1   1 
ATOM   1930 C CD2   . LEU E  1 62 ? -47.542 8.456  -12.036 1.00 48.18  ? 203 LEU E CD2   1 
ATOM   1931 N N     . SER E  1 63 ? -47.184 2.942  -12.368 1.00 56.72  ? 204 SER E N     1 
ATOM   1932 C CA    . SER E  1 63 ? -46.842 1.727  -11.608 1.00 60.33  ? 204 SER E CA    1 
ATOM   1933 C C     . SER E  1 63 ? -45.396 1.693  -11.037 1.00 59.39  ? 204 SER E C     1 
ATOM   1934 O O     . SER E  1 63 ? -45.198 1.183  -9.935  1.00 59.34  ? 204 SER E O     1 
ATOM   1935 C CB    . SER E  1 63 ? -47.148 0.440  -12.420 1.00 63.07  ? 204 SER E CB    1 
ATOM   1936 O OG    . SER E  1 63 ? -46.500 0.473  -13.668 1.00 64.63  ? 204 SER E OG    1 
ATOM   1937 N N     . SER E  1 64 ? -44.416 2.241  -11.760 1.00 58.69  ? 205 SER E N     1 
ATOM   1938 C CA    . SER E  1 64 ? -43.015 2.261  -11.284 1.00 60.49  ? 205 SER E CA    1 
ATOM   1939 C C     . SER E  1 64 ? -42.552 3.616  -10.706 1.00 57.01  ? 205 SER E C     1 
ATOM   1940 O O     . SER E  1 64 ? -41.373 3.759  -10.381 1.00 58.22  ? 205 SER E O     1 
ATOM   1941 C CB    . SER E  1 64 ? -42.071 1.830  -12.419 1.00 64.60  ? 205 SER E CB    1 
ATOM   1942 O OG    . SER E  1 64 ? -41.914 2.893  -13.347 1.00 65.14  ? 205 SER E OG    1 
ATOM   1943 N N     . PHE E  1 65 ? -43.481 4.579  -10.563 1.00 52.49  ? 206 PHE E N     1 
ATOM   1944 C CA    . PHE E  1 65 ? -43.224 5.930  -10.033 1.00 48.76  ? 206 PHE E CA    1 
ATOM   1945 C C     . PHE E  1 65 ? -43.133 5.886  -8.506  1.00 47.28  ? 206 PHE E C     1 
ATOM   1946 O O     . PHE E  1 65 ? -44.010 5.388  -7.840  1.00 44.45  ? 206 PHE E O     1 
ATOM   1947 C CB    . PHE E  1 65 ? -44.380 6.875  -10.438 1.00 46.40  ? 206 PHE E CB    1 
ATOM   1948 C CG    . PHE E  1 65 ? -44.165 8.312  -10.054 1.00 45.37  ? 206 PHE E CG    1 
ATOM   1949 C CD1   . PHE E  1 65 ? -43.281 9.121  -10.787 1.00 45.53  ? 206 PHE E CD1   1 
ATOM   1950 C CD2   . PHE E  1 65 ? -44.825 8.864  -8.964  1.00 43.25  ? 206 PHE E CD2   1 
ATOM   1951 C CE1   . PHE E  1 65 ? -43.067 10.438 -10.418 1.00 44.63  ? 206 PHE E CE1   1 
ATOM   1952 C CE2   . PHE E  1 65 ? -44.614 10.194 -8.580  1.00 42.64  ? 206 PHE E CE2   1 
ATOM   1953 C CZ    . PHE E  1 65 ? -43.736 10.982 -9.305  1.00 44.43  ? 206 PHE E CZ    1 
ATOM   1954 N N     . ASP E  1 66 ? -42.062 6.433  -7.959  1.00 48.04  ? 207 ASP E N     1 
ATOM   1955 C CA    . ASP E  1 66 ? -41.804 6.408  -6.517  1.00 46.31  ? 207 ASP E CA    1 
ATOM   1956 C C     . ASP E  1 66 ? -42.239 7.798  -6.083  1.00 43.12  ? 207 ASP E C     1 
ATOM   1957 O O     . ASP E  1 66 ? -41.541 8.789  -6.362  1.00 40.64  ? 207 ASP E O     1 
ATOM   1958 C CB    . ASP E  1 66 ? -40.311 6.142  -6.245  1.00 49.11  ? 207 ASP E CB    1 
ATOM   1959 C CG    . ASP E  1 66 ? -39.901 6.368  -4.779  1.00 49.22  ? 207 ASP E CG    1 
ATOM   1960 O OD1   . ASP E  1 66 ? -40.604 6.987  -3.969  1.00 50.09  ? 207 ASP E OD1   1 
ATOM   1961 O OD2   . ASP E  1 66 ? -38.830 5.952  -4.413  1.00 51.08  ? 207 ASP E OD2   1 
ATOM   1962 N N     . PHE E  1 67 ? -43.403 7.850  -5.422  1.00 40.99  ? 208 PHE E N     1 
ATOM   1963 C CA    . PHE E  1 67 ? -43.991 9.084  -4.951  1.00 38.21  ? 208 PHE E CA    1 
ATOM   1964 C C     . PHE E  1 67 ? -42.994 9.917  -4.190  1.00 38.20  ? 208 PHE E C     1 
ATOM   1965 O O     . PHE E  1 67 ? -42.928 11.120 -4.358  1.00 36.21  ? 208 PHE E O     1 
ATOM   1966 C CB    . PHE E  1 67 ? -45.186 8.784  -4.031  1.00 37.37  ? 208 PHE E CB    1 
ATOM   1967 C CG    . PHE E  1 67 ? -45.990 9.997  -3.696  1.00 35.45  ? 208 PHE E CG    1 
ATOM   1968 C CD1   . PHE E  1 67 ? -46.862 10.539 -4.619  1.00 34.81  ? 208 PHE E CD1   1 
ATOM   1969 C CD2   . PHE E  1 67 ? -45.858 10.608 -2.451  1.00 37.30  ? 208 PHE E CD2   1 
ATOM   1970 C CE1   . PHE E  1 67 ? -47.610 11.690 -4.332  1.00 35.47  ? 208 PHE E CE1   1 
ATOM   1971 C CE2   . PHE E  1 67 ? -46.611 11.759 -2.138  1.00 37.20  ? 208 PHE E CE2   1 
ATOM   1972 C CZ    . PHE E  1 67 ? -47.493 12.300 -3.082  1.00 35.79  ? 208 PHE E CZ    1 
ATOM   1973 N N     . ARG E  1 68 ? -42.211 9.260  -3.345  1.00 41.38  ? 209 ARG E N     1 
ATOM   1974 C CA    . ARG E  1 68 ? -41.391 9.979  -2.402  1.00 43.48  ? 209 ARG E CA    1 
ATOM   1975 C C     . ARG E  1 68 ? -40.243 10.717 -3.080  1.00 44.61  ? 209 ARG E C     1 
ATOM   1976 O O     . ARG E  1 68 ? -39.927 11.844 -2.687  1.00 46.15  ? 209 ARG E O     1 
ATOM   1977 C CB    . ARG E  1 68 ? -40.923 9.043  -1.261  1.00 47.71  ? 209 ARG E CB    1 
ATOM   1978 C CG    . ARG E  1 68 ? -40.180 9.771  -0.151  1.00 50.26  ? 209 ARG E CG    1 
ATOM   1979 C CD    . ARG E  1 68 ? -40.111 8.988  1.157   1.00 54.11  ? 209 ARG E CD    1 
ATOM   1980 N NE    . ARG E  1 68 ? -41.285 9.173  2.035   1.00 53.02  ? 209 ARG E NE    1 
ATOM   1981 C CZ    . ARG E  1 68 ? -41.540 10.246 2.792   1.00 52.35  ? 209 ARG E CZ    1 
ATOM   1982 N NH1   . ARG E  1 68 ? -40.720 11.289 2.799   1.00 52.18  ? 209 ARG E NH1   1 
ATOM   1983 N NH2   . ARG E  1 68 ? -42.642 10.279 3.564   1.00 50.85  ? 209 ARG E NH2   1 
ATOM   1984 N N     . THR E  1 69 ? -39.635 10.107 -4.098  1.00 44.89  ? 210 THR E N     1 
ATOM   1985 C CA    . THR E  1 69 ? -38.462 10.658 -4.754  1.00 46.33  ? 210 THR E CA    1 
ATOM   1986 C C     . THR E  1 69 ? -38.766 11.295 -6.076  1.00 46.95  ? 210 THR E C     1 
ATOM   1987 O O     . THR E  1 69 ? -37.860 11.776 -6.715  1.00 52.11  ? 210 THR E O     1 
ATOM   1988 C CB    . THR E  1 69 ? -37.457 9.538  -5.128  1.00 48.98  ? 210 THR E CB    1 
ATOM   1989 O OG1   . THR E  1 69 ? -38.122 8.610  -5.983  1.00 48.67  ? 210 THR E OG1   1 
ATOM   1990 C CG2   . THR E  1 69 ? -36.915 8.828  -3.921  1.00 49.93  ? 210 THR E CG2   1 
ATOM   1991 N N     . GLY E  1 70 ? -39.989 11.208 -6.568  1.00 45.19  ? 211 GLY E N     1 
ATOM   1992 C CA    . GLY E  1 70 ? -40.283 11.750 -7.883  1.00 46.95  ? 211 GLY E CA    1 
ATOM   1993 C C     . GLY E  1 70 ? -39.783 10.998 -9.111  1.00 48.96  ? 211 GLY E C     1 
ATOM   1994 O O     . GLY E  1 70 ? -40.047 11.449 -10.232 1.00 50.88  ? 211 GLY E O     1 
ATOM   1995 N N     . LYS E  1 71 ? -39.149 9.835  -8.916  1.00 51.80  ? 212 LYS E N     1 
ATOM   1996 C CA    . LYS E  1 71 ? -38.476 9.105  -10.000 1.00 53.99  ? 212 LYS E CA    1 
ATOM   1997 C C     . LYS E  1 71 ? -39.209 7.811  -10.414 1.00 54.82  ? 212 LYS E C     1 
ATOM   1998 O O     . LYS E  1 71 ? -39.879 7.200  -9.621  1.00 53.20  ? 212 LYS E O     1 
ATOM   1999 C CB    . LYS E  1 71 ? -37.036 8.829  -9.592  1.00 56.47  ? 212 LYS E CB    1 
ATOM   2000 C CG    . LYS E  1 71 ? -36.230 10.097 -9.374  1.00 57.18  ? 212 LYS E CG    1 
ATOM   2001 C CD    . LYS E  1 71 ? -34.726 9.861  -9.293  1.00 61.30  ? 212 LYS E CD    1 
ATOM   2002 N N     . MET E  1 72 ? -39.131 7.448  -11.694 1.00 59.11  ? 213 MET E N     1 
ATOM   2003 C CA    . MET E  1 72 ? -39.471 6.093  -12.166 1.00 62.80  ? 213 MET E CA    1 
ATOM   2004 C C     . MET E  1 72 ? -38.324 5.138  -11.810 1.00 67.31  ? 213 MET E C     1 
ATOM   2005 O O     . MET E  1 72 ? -37.177 5.576  -11.797 1.00 69.52  ? 213 MET E O     1 
ATOM   2006 C CB    . MET E  1 72 ? -39.681 6.108  -13.688 1.00 64.98  ? 213 MET E CB    1 
ATOM   2007 C CG    . MET E  1 72 ? -40.832 7.009  -14.133 1.00 62.18  ? 213 MET E CG    1 
ATOM   2008 S SD    . MET E  1 72 ? -42.435 6.401  -13.548 1.00 61.19  ? 213 MET E SD    1 
ATOM   2009 C CE    . MET E  1 72 ? -43.505 7.573  -14.368 1.00 60.41  ? 213 MET E CE    1 
ATOM   2010 N N     . MET E  1 73 ? -38.629 3.856  -11.541 1.00 70.98  ? 214 MET E N     1 
ATOM   2011 C CA    . MET E  1 73 ? -37.640 2.850  -11.069 1.00 76.68  ? 214 MET E CA    1 
ATOM   2012 C C     . MET E  1 73 ? -37.582 1.559  -11.900 1.00 82.47  ? 214 MET E C     1 
ATOM   2013 O O     . MET E  1 73 ? -38.599 0.887  -12.046 1.00 85.52  ? 214 MET E O     1 
ATOM   2014 C CB    . MET E  1 73 ? -37.973 2.448  -9.629  1.00 77.72  ? 214 MET E CB    1 
ATOM   2015 C CG    . MET E  1 73 ? -38.089 3.598  -8.623  1.00 75.64  ? 214 MET E CG    1 
ATOM   2016 S SD    . MET E  1 73 ? -36.553 4.561  -8.434  1.00 81.97  ? 214 MET E SD    1 
ATOM   2017 C CE    . MET E  1 73 ? -36.804 5.324  -6.807  1.00 76.89  ? 214 MET E CE    1 
ATOM   2018 N N     . PRO E  1 74 ? -36.380 1.177  -12.396 1.00 86.48  ? 215 PRO E N     1 
ATOM   2019 C CA    . PRO E  1 74 ? -36.013 -0.047 -13.116 1.00 87.46  ? 215 PRO E CA    1 
ATOM   2020 N N     . GLY F  1 6  ? -76.829 28.050 18.253  1.00 85.92  ? 147 GLY F N     1 
ATOM   2021 C CA    . GLY F  1 6  ? -76.729 26.732 18.971  1.00 84.64  ? 147 GLY F CA    1 
ATOM   2022 C C     . GLY F  1 6  ? -76.914 26.843 20.486  1.00 87.36  ? 147 GLY F C     1 
ATOM   2023 O O     . GLY F  1 6  ? -76.690 27.921 21.045  1.00 88.20  ? 147 GLY F O     1 
ATOM   2024 N N     . LYS F  1 7  ? -77.334 25.734 21.132  1.00 86.90  ? 148 LYS F N     1 
ATOM   2025 C CA    . LYS F  1 7  ? -77.454 25.603 22.620  1.00 85.79  ? 148 LYS F CA    1 
ATOM   2026 C C     . LYS F  1 7  ? -76.147 25.088 23.281  1.00 80.33  ? 148 LYS F C     1 
ATOM   2027 O O     . LYS F  1 7  ? -75.348 24.369 22.674  1.00 71.36  ? 148 LYS F O     1 
ATOM   2028 C CB    . LYS F  1 7  ? -78.652 24.707 23.018  1.00 88.09  ? 148 LYS F CB    1 
ATOM   2029 N N     . ARG F  1 8  ? -75.937 25.487 24.530  1.00 79.23  ? 149 ARG F N     1 
ATOM   2030 C CA    . ARG F  1 8  ? -74.649 25.267 25.206  1.00 77.23  ? 149 ARG F CA    1 
ATOM   2031 C C     . ARG F  1 8  ? -74.865 24.410 26.457  1.00 73.88  ? 149 ARG F C     1 
ATOM   2032 O O     . ARG F  1 8  ? -75.575 24.813 27.378  1.00 77.16  ? 149 ARG F O     1 
ATOM   2033 C CB    . ARG F  1 8  ? -73.980 26.608 25.550  1.00 78.81  ? 149 ARG F CB    1 
ATOM   2034 C CG    . ARG F  1 8  ? -73.765 27.538 24.347  1.00 78.38  ? 149 ARG F CG    1 
ATOM   2035 C CD    . ARG F  1 8  ? -73.588 28.995 24.773  1.00 79.36  ? 149 ARG F CD    1 
ATOM   2036 N NE    . ARG F  1 8  ? -73.054 29.795 23.668  1.00 77.58  ? 149 ARG F NE    1 
ATOM   2037 C CZ    . ARG F  1 8  ? -72.314 30.904 23.792  1.00 78.24  ? 149 ARG F CZ    1 
ATOM   2038 N NH1   . ARG F  1 8  ? -71.982 31.414 24.994  1.00 78.48  ? 149 ARG F NH1   1 
ATOM   2039 N NH2   . ARG F  1 8  ? -71.883 31.511 22.682  1.00 77.90  ? 149 ARG F NH2   1 
ATOM   2040 N N     . MET F  1 9  ? -74.245 23.231 26.464  1.00 68.46  ? 150 MET F N     1 
ATOM   2041 C CA    . MET F  1 9  ? -74.468 22.221 27.483  1.00 69.12  ? 150 MET F CA    1 
ATOM   2042 C C     . MET F  1 9  ? -73.474 22.434 28.652  1.00 68.51  ? 150 MET F C     1 
ATOM   2043 O O     . MET F  1 9  ? -72.264 22.684 28.433  1.00 65.73  ? 150 MET F O     1 
ATOM   2044 C CB    . MET F  1 9  ? -74.356 20.817 26.865  1.00 66.81  ? 150 MET F CB    1 
ATOM   2045 N N     . ASP F  1 10 ? -73.991 22.395 29.883  1.00 68.38  ? 151 ASP F N     1 
ATOM   2046 C CA    . ASP F  1 10 ? -73.159 22.504 31.083  1.00 68.68  ? 151 ASP F CA    1 
ATOM   2047 C C     . ASP F  1 10 ? -72.053 21.446 31.018  1.00 66.05  ? 151 ASP F C     1 
ATOM   2048 O O     . ASP F  1 10 ? -72.268 20.350 30.477  1.00 65.17  ? 151 ASP F O     1 
ATOM   2049 C CB    . ASP F  1 10 ? -74.013 22.377 32.379  1.00 72.04  ? 151 ASP F CB    1 
ATOM   2050 N N     . CYS F  1 11 ? -70.864 21.802 31.509  1.00 64.75  ? 152 CYS F N     1 
ATOM   2051 C CA    . CYS F  1 11 ? -69.709 20.892 31.479  1.00 63.64  ? 152 CYS F CA    1 
ATOM   2052 C C     . CYS F  1 11 ? -69.131 20.650 32.875  1.00 65.01  ? 152 CYS F C     1 
ATOM   2053 O O     . CYS F  1 11 ? -68.098 21.214 33.217  1.00 63.55  ? 152 CYS F O     1 
ATOM   2054 C CB    . CYS F  1 11 ? -68.614 21.388 30.525  1.00 60.78  ? 152 CYS F CB    1 
ATOM   2055 S SG    . CYS F  1 11 ? -67.396 20.068 30.171  1.00 60.30  ? 152 CYS F SG    1 
ATOM   2056 N N     . PRO F  1 12 ? -69.790 19.788 33.686  1.00 68.77  ? 153 PRO F N     1 
ATOM   2057 C CA    . PRO F  1 12 ? -69.398 19.539 35.100  1.00 70.34  ? 153 PRO F CA    1 
ATOM   2058 C C     . PRO F  1 12 ? -67.894 19.272 35.427  1.00 69.87  ? 153 PRO F C     1 
ATOM   2059 O O     . PRO F  1 12 ? -67.501 19.489 36.566  1.00 71.52  ? 153 PRO F O     1 
ATOM   2060 C CB    . PRO F  1 12 ? -70.251 18.312 35.479  1.00 73.61  ? 153 PRO F CB    1 
ATOM   2061 C CG    . PRO F  1 12 ? -70.786 17.773 34.185  1.00 72.15  ? 153 PRO F CG    1 
ATOM   2062 C CD    . PRO F  1 12 ? -70.976 18.977 33.337  1.00 69.45  ? 153 PRO F CD    1 
ATOM   2063 N N     . ALA F  1 13 ? -67.075 18.796 34.471  1.00 67.48  ? 154 ALA F N     1 
ATOM   2064 C CA    . ALA F  1 13 ? -65.617 18.610 34.708  1.00 67.03  ? 154 ALA F CA    1 
ATOM   2065 C C     . ALA F  1 13 ? -64.846 19.917 34.902  1.00 65.52  ? 154 ALA F C     1 
ATOM   2066 O O     . ALA F  1 13 ? -63.817 19.941 35.573  1.00 66.05  ? 154 ALA F O     1 
ATOM   2067 C CB    . ALA F  1 13 ? -64.983 17.820 33.568  1.00 65.54  ? 154 ALA F CB    1 
ATOM   2068 N N     . LEU F  1 14 ? -65.347 20.983 34.284  1.00 63.50  ? 155 LEU F N     1 
ATOM   2069 C CA    . LEU F  1 14 ? -64.761 22.314 34.370  1.00 64.10  ? 155 LEU F CA    1 
ATOM   2070 C C     . LEU F  1 14 ? -65.394 23.077 35.546  1.00 67.91  ? 155 LEU F C     1 
ATOM   2071 O O     . LEU F  1 14 ? -66.355 22.577 36.145  1.00 68.95  ? 155 LEU F O     1 
ATOM   2072 C CB    . LEU F  1 14 ? -65.004 23.047 33.048  1.00 61.43  ? 155 LEU F CB    1 
ATOM   2073 C CG    . LEU F  1 14 ? -64.561 22.248 31.798  1.00 59.00  ? 155 LEU F CG    1 
ATOM   2074 C CD1   . LEU F  1 14 ? -64.725 23.105 30.553  1.00 57.23  ? 155 LEU F CD1   1 
ATOM   2075 C CD2   . LEU F  1 14 ? -63.146 21.677 31.880  1.00 58.92  ? 155 LEU F CD2   1 
ATOM   2076 N N     . PRO F  1 15 ? -64.855 24.276 35.902  1.00 69.53  ? 156 PRO F N     1 
ATOM   2077 C CA    . PRO F  1 15 ? -65.547 25.077 36.938  1.00 72.43  ? 156 PRO F CA    1 
ATOM   2078 C C     . PRO F  1 15 ? -67.000 25.448 36.557  1.00 72.07  ? 156 PRO F C     1 
ATOM   2079 O O     . PRO F  1 15 ? -67.401 25.277 35.394  1.00 69.37  ? 156 PRO F O     1 
ATOM   2080 C CB    . PRO F  1 15 ? -64.660 26.335 37.091  1.00 73.09  ? 156 PRO F CB    1 
ATOM   2081 C CG    . PRO F  1 15 ? -63.316 25.934 36.580  1.00 71.29  ? 156 PRO F CG    1 
ATOM   2082 C CD    . PRO F  1 15 ? -63.541 24.847 35.551  1.00 68.97  ? 156 PRO F CD    1 
ATOM   2083 N N     . PRO F  1 16 ? -67.804 25.900 37.537  1.00 75.29  ? 157 PRO F N     1 
ATOM   2084 C CA    . PRO F  1 16 ? -69.145 26.367 37.183  1.00 75.91  ? 157 PRO F CA    1 
ATOM   2085 C C     . PRO F  1 16 ? -69.058 27.609 36.309  1.00 74.34  ? 157 PRO F C     1 
ATOM   2086 O O     . PRO F  1 16 ? -68.075 28.370 36.388  1.00 71.64  ? 157 PRO F O     1 
ATOM   2087 C CB    . PRO F  1 16 ? -69.818 26.701 38.530  1.00 79.60  ? 157 PRO F CB    1 
ATOM   2088 C CG    . PRO F  1 16 ? -68.857 26.291 39.581  1.00 81.37  ? 157 PRO F CG    1 
ATOM   2089 C CD    . PRO F  1 16 ? -67.506 26.099 38.966  1.00 78.69  ? 157 PRO F CD    1 
ATOM   2090 N N     . GLY F  1 17 ? -70.099 27.778 35.496  1.00 74.83  ? 158 GLY F N     1 
ATOM   2091 C CA    . GLY F  1 17 ? -70.128 28.760 34.419  1.00 74.66  ? 158 GLY F CA    1 
ATOM   2092 C C     . GLY F  1 17 ? -69.722 28.212 33.058  1.00 70.41  ? 158 GLY F C     1 
ATOM   2093 O O     . GLY F  1 17 ? -70.215 28.701 32.059  1.00 69.13  ? 158 GLY F O     1 
ATOM   2094 N N     . TRP F  1 18 ? -68.835 27.209 33.023  1.00 70.12  ? 159 TRP F N     1 
ATOM   2095 C CA    . TRP F  1 18 ? -68.181 26.718 31.762  1.00 67.68  ? 159 TRP F CA    1 
ATOM   2096 C C     . TRP F  1 18 ? -69.066 25.819 30.896  1.00 67.67  ? 159 TRP F C     1 
ATOM   2097 O O     . TRP F  1 18 ? -69.442 24.714 31.334  1.00 69.62  ? 159 TRP F O     1 
ATOM   2098 C CB    . TRP F  1 18 ? -66.881 25.931 32.052  1.00 65.90  ? 159 TRP F CB    1 
ATOM   2099 C CG    . TRP F  1 18 ? -65.733 26.785 32.321  1.00 67.16  ? 159 TRP F CG    1 
ATOM   2100 C CD1   . TRP F  1 18 ? -65.313 27.244 33.541  1.00 70.64  ? 159 TRP F CD1   1 
ATOM   2101 C CD2   . TRP F  1 18 ? -64.846 27.322 31.365  1.00 66.08  ? 159 TRP F CD2   1 
ATOM   2102 N NE1   . TRP F  1 18 ? -64.196 28.021 33.397  1.00 70.14  ? 159 TRP F NE1   1 
ATOM   2103 C CE2   . TRP F  1 18 ? -63.889 28.096 32.070  1.00 68.29  ? 159 TRP F CE2   1 
ATOM   2104 C CE3   . TRP F  1 18 ? -64.760 27.238 29.977  1.00 63.89  ? 159 TRP F CE3   1 
ATOM   2105 C CZ2   . TRP F  1 18 ? -62.848 28.765 31.435  1.00 68.62  ? 159 TRP F CZ2   1 
ATOM   2106 C CZ3   . TRP F  1 18 ? -63.712 27.921 29.327  1.00 64.95  ? 159 TRP F CZ3   1 
ATOM   2107 C CH2   . TRP F  1 18 ? -62.769 28.669 30.060  1.00 66.54  ? 159 TRP F CH2   1 
ATOM   2108 N N     . LYS F  1 19 ? -69.340 26.251 29.654  1.00 65.77  ? 160 LYS F N     1 
ATOM   2109 C CA    . LYS F  1 19 ? -70.231 25.495 28.776  1.00 64.62  ? 160 LYS F CA    1 
ATOM   2110 C C     . LYS F  1 19 ? -69.453 24.922 27.589  1.00 62.64  ? 160 LYS F C     1 
ATOM   2111 O O     . LYS F  1 19 ? -68.353 25.403 27.266  1.00 63.07  ? 160 LYS F O     1 
ATOM   2112 C CB    . LYS F  1 19 ? -71.490 26.325 28.374  1.00 66.04  ? 160 LYS F CB    1 
ATOM   2113 C CG    . LYS F  1 19 ? -72.239 27.009 29.563  1.00 69.35  ? 160 LYS F CG    1 
ATOM   2114 C CD    . LYS F  1 19 ? -73.722 26.642 29.699  1.00 70.99  ? 160 LYS F CD    1 
ATOM   2115 N N     . LYS F  1 20 ? -70.018 23.855 27.009  1.00 61.43  ? 161 LYS F N     1 
ATOM   2116 C CA    . LYS F  1 20 ? -69.551 23.212 25.782  1.00 58.40  ? 161 LYS F CA    1 
ATOM   2117 C C     . LYS F  1 20 ? -70.624 23.395 24.765  1.00 58.87  ? 161 LYS F C     1 
ATOM   2118 O O     . LYS F  1 20 ? -71.788 23.160 25.087  1.00 60.09  ? 161 LYS F O     1 
ATOM   2119 C CB    . LYS F  1 20 ? -69.368 21.701 25.985  1.00 57.53  ? 161 LYS F CB    1 
ATOM   2120 C CG    . LYS F  1 20 ? -69.460 20.848 24.726  1.00 55.55  ? 161 LYS F CG    1 
ATOM   2121 C CD    . LYS F  1 20 ? -68.945 19.424 24.920  1.00 55.71  ? 161 LYS F CD    1 
ATOM   2122 C CE    . LYS F  1 20 ? -69.558 18.467 23.908  1.00 54.67  ? 161 LYS F CE    1 
ATOM   2123 N N     . GLU F  1 21 ? -70.221 23.745 23.536  1.00 57.05  ? 162 GLU F N     1 
ATOM   2124 C CA    . GLU F  1 21 ? -71.116 23.836 22.359  1.00 57.81  ? 162 GLU F CA    1 
ATOM   2125 C C     . GLU F  1 21 ? -70.522 23.004 21.195  1.00 55.59  ? 162 GLU F C     1 
ATOM   2126 O O     . GLU F  1 21 ? -69.284 22.954 21.027  1.00 55.64  ? 162 GLU F O     1 
ATOM   2127 C CB    . GLU F  1 21 ? -71.276 25.330 21.952  1.00 59.62  ? 162 GLU F CB    1 
ATOM   2128 C CG    . GLU F  1 21 ? -72.238 25.618 20.809  1.00 59.87  ? 162 GLU F CG    1 
ATOM   2129 C CD    . GLU F  1 21 ? -72.167 27.051 20.308  1.00 61.73  ? 162 GLU F CD    1 
ATOM   2130 O OE1   . GLU F  1 21 ? -71.063 27.593 20.080  1.00 61.80  ? 162 GLU F OE1   1 
ATOM   2131 O OE2   . GLU F  1 21 ? -73.232 27.652 20.108  1.00 67.61  ? 162 GLU F OE2   1 
ATOM   2132 N N     . GLU F  1 22 ? -71.381 22.335 20.415  1.00 54.22  ? 163 GLU F N     1 
ATOM   2133 C CA    . GLU F  1 22 ? -70.946 21.569 19.245  1.00 50.91  ? 163 GLU F CA    1 
ATOM   2134 C C     . GLU F  1 22 ? -71.731 22.083 18.052  1.00 51.40  ? 163 GLU F C     1 
ATOM   2135 O O     . GLU F  1 22 ? -72.978 22.089 18.090  1.00 53.86  ? 163 GLU F O     1 
ATOM   2136 C CB    . GLU F  1 22 ? -71.156 20.080 19.430  1.00 50.42  ? 163 GLU F CB    1 
ATOM   2137 C CG    . GLU F  1 22 ? -70.406 19.258 18.402  1.00 49.40  ? 163 GLU F CG    1 
ATOM   2138 C CD    . GLU F  1 22 ? -70.150 17.816 18.836  1.00 51.86  ? 163 GLU F CD    1 
ATOM   2139 O OE1   . GLU F  1 22 ? -69.688 17.004 18.003  1.00 49.33  ? 163 GLU F OE1   1 
ATOM   2140 O OE2   . GLU F  1 22 ? -70.388 17.479 20.021  1.00 54.75  ? 163 GLU F OE2   1 
ATOM   2141 N N     . VAL F  1 23 ? -71.008 22.555 17.030  1.00 47.58  ? 164 VAL F N     1 
ATOM   2142 C CA    . VAL F  1 23 ? -71.623 23.206 15.901  1.00 46.82  ? 164 VAL F CA    1 
ATOM   2143 C C     . VAL F  1 23 ? -71.237 22.540 14.610  1.00 44.07  ? 164 VAL F C     1 
ATOM   2144 O O     . VAL F  1 23 ? -70.083 22.569 14.195  1.00 43.30  ? 164 VAL F O     1 
ATOM   2145 C CB    . VAL F  1 23 ? -71.294 24.689 15.808  1.00 47.44  ? 164 VAL F CB    1 
ATOM   2146 C CG1   . VAL F  1 23 ? -72.032 25.321 14.621  1.00 47.71  ? 164 VAL F CG1   1 
ATOM   2147 C CG2   . VAL F  1 23 ? -71.706 25.382 17.097  1.00 49.82  ? 164 VAL F CG2   1 
ATOM   2148 N N     . ILE F  1 24 ? -72.279 22.030 13.954  1.00 45.74  ? 165 ILE F N     1 
ATOM   2149 C CA    . ILE F  1 24 ? -72.208 21.241 12.744  1.00 44.93  ? 165 ILE F CA    1 
ATOM   2150 C C     . ILE F  1 24 ? -71.861 22.148 11.585  1.00 43.18  ? 165 ILE F C     1 
ATOM   2151 O O     . ILE F  1 24 ? -72.500 23.191 11.396  1.00 43.97  ? 165 ILE F O     1 
ATOM   2152 C CB    . ILE F  1 24 ? -73.559 20.550 12.451  1.00 48.61  ? 165 ILE F CB    1 
ATOM   2153 C CG1   . ILE F  1 24 ? -73.962 19.624 13.635  1.00 52.08  ? 165 ILE F CG1   1 
ATOM   2154 C CG2   . ILE F  1 24 ? -73.514 19.767 11.140  1.00 47.65  ? 165 ILE F CG2   1 
ATOM   2155 C CD1   . ILE F  1 24 ? -73.007 18.477 13.893  1.00 51.37  ? 165 ILE F CD1   1 
ATOM   2156 N N     . ARG F  1 25 ? -70.824 21.757 10.843  1.00 39.80  ? 166 ARG F N     1 
ATOM   2157 C CA    . ARG F  1 25 ? -70.473 22.397 9.588   1.00 37.51  ? 166 ARG F CA    1 
ATOM   2158 C C     . ARG F  1 25 ? -71.558 22.105 8.535   1.00 38.61  ? 166 ARG F C     1 
ATOM   2159 O O     . ARG F  1 25 ? -71.851 20.953 8.256   1.00 37.94  ? 166 ARG F O     1 
ATOM   2160 C CB    . ARG F  1 25 ? -69.121 21.878 9.140   1.00 34.65  ? 166 ARG F CB    1 
ATOM   2161 C CG    . ARG F  1 25 ? -67.999 22.354 10.060  1.00 34.03  ? 166 ARG F CG    1 
ATOM   2162 C CD    . ARG F  1 25 ? -66.628 21.828 9.642   1.00 33.64  ? 166 ARG F CD    1 
ATOM   2163 N NE    . ARG F  1 25 ? -65.596 22.489 10.429  1.00 32.57  ? 166 ARG F NE    1 
ATOM   2164 C CZ    . ARG F  1 25 ? -64.421 22.866 10.003  1.00 31.73  ? 166 ARG F CZ    1 
ATOM   2165 N NH1   . ARG F  1 25 ? -64.054 22.671 8.743   1.00 30.74  ? 166 ARG F NH1   1 
ATOM   2166 N NH2   . ARG F  1 25 ? -63.610 23.513 10.854  1.00 31.84  ? 166 ARG F NH2   1 
ATOM   2167 N N     . LYS F  1 26 ? -72.099 23.160 7.933   1.00 41.45  ? 167 LYS F N     1 
ATOM   2168 C CA    . LYS F  1 26 ? -73.331 23.118 7.123   1.00 43.87  ? 167 LYS F CA    1 
ATOM   2169 C C     . LYS F  1 26 ? -73.100 22.740 5.693   1.00 42.37  ? 167 LYS F C     1 
ATOM   2170 O O     . LYS F  1 26 ? -74.021 22.249 5.080   1.00 41.84  ? 167 LYS F O     1 
ATOM   2171 C CB    . LYS F  1 26 ? -74.010 24.473 7.065   1.00 48.99  ? 167 LYS F CB    1 
ATOM   2172 C CG    . LYS F  1 26 ? -74.631 24.936 8.393   1.00 53.39  ? 167 LYS F CG    1 
ATOM   2173 C CD    . LYS F  1 26 ? -75.367 26.257 8.196   1.00 57.09  ? 167 LYS F CD    1 
ATOM   2174 C CE    . LYS F  1 26 ? -75.217 27.212 9.383   1.00 59.58  ? 167 LYS F CE    1 
ATOM   2175 N NZ    . LYS F  1 26 ? -75.463 28.595 8.897   1.00 62.69  ? 167 LYS F NZ    1 
ATOM   2176 N N     . SER F  1 27 ? -71.880 22.937 5.191   1.00 40.82  ? 168 SER F N     1 
ATOM   2177 C CA    . SER F  1 27 ? -71.600 22.934 3.760   1.00 42.57  ? 168 SER F CA    1 
ATOM   2178 C C     . SER F  1 27 ? -70.111 22.720 3.496   1.00 40.57  ? 168 SER F C     1 
ATOM   2179 O O     . SER F  1 27 ? -69.317 22.722 4.418   1.00 42.95  ? 168 SER F O     1 
ATOM   2180 C CB    . SER F  1 27 ? -71.982 24.301 3.204   1.00 44.80  ? 168 SER F CB    1 
ATOM   2181 O OG    . SER F  1 27 ? -70.924 25.247 3.410   1.00 46.55  ? 168 SER F OG    1 
ATOM   2182 N N     . GLY F  1 28 ? -69.725 22.554 2.248   1.00 39.92  ? 169 GLY F N     1 
ATOM   2183 C CA    . GLY F  1 28 ? -68.327 22.503 1.869   1.00 38.16  ? 169 GLY F CA    1 
ATOM   2184 C C     . GLY F  1 28 ? -67.826 21.081 2.000   1.00 37.55  ? 169 GLY F C     1 
ATOM   2185 O O     . GLY F  1 28 ? -68.566 20.186 2.346   1.00 35.41  ? 169 GLY F O     1 
ATOM   2186 N N     . LEU F  1 29 ? -66.547 20.883 1.703   1.00 39.38  ? 170 LEU F N     1 
ATOM   2187 C CA    . LEU F  1 29 ? -65.906 19.575 1.848   1.00 40.09  ? 170 LEU F CA    1 
ATOM   2188 C C     . LEU F  1 29 ? -66.066 18.896 3.250   1.00 39.52  ? 170 LEU F C     1 
ATOM   2189 O O     . LEU F  1 29 ? -66.151 17.661 3.328   1.00 38.78  ? 170 LEU F O     1 
ATOM   2190 C CB    . LEU F  1 29 ? -64.408 19.698 1.532   1.00 42.67  ? 170 LEU F CB    1 
ATOM   2191 C CG    . LEU F  1 29 ? -63.973 20.237 0.148   1.00 47.38  ? 170 LEU F CG    1 
ATOM   2192 C CD1   . LEU F  1 29 ? -62.451 20.061 0.050   1.00 48.25  ? 170 LEU F CD1   1 
ATOM   2193 C CD2   . LEU F  1 29 ? -64.719 19.573 -1.026  1.00 45.93  ? 170 LEU F CD2   1 
ATOM   2194 N N     . SER F  1 30 ? -66.049 19.689 4.341   1.00 38.16  ? 171 SER F N     1 
ATOM   2195 C CA    . SER F  1 30 ? -66.203 19.130 5.713   1.00 36.33  ? 171 SER F CA    1 
ATOM   2196 C C     . SER F  1 30 ? -67.648 19.195 6.230   1.00 37.29  ? 171 SER F C     1 
ATOM   2197 O O     . SER F  1 30 ? -67.841 19.032 7.430   1.00 37.21  ? 171 SER F O     1 
ATOM   2198 C CB    . SER F  1 30 ? -65.265 19.819 6.708   1.00 35.40  ? 171 SER F CB    1 
ATOM   2199 O OG    . SER F  1 30 ? -65.442 21.241 6.710   1.00 35.66  ? 171 SER F OG    1 
ATOM   2200 N N     . ALA F  1 31 ? -68.632 19.408 5.335   1.00 36.11  ? 172 ALA F N     1 
ATOM   2201 C CA    . ALA F  1 31 ? -70.035 19.354 5.679   1.00 38.11  ? 172 ALA F CA    1 
ATOM   2202 C C     . ALA F  1 31 ? -70.324 18.173 6.588   1.00 36.88  ? 172 ALA F C     1 
ATOM   2203 O O     . ALA F  1 31 ? -69.926 17.079 6.317   1.00 35.98  ? 172 ALA F O     1 
ATOM   2204 C CB    . ALA F  1 31 ? -70.915 19.196 4.391   1.00 38.85  ? 172 ALA F CB    1 
ATOM   2205 N N     . GLY F  1 32 ? -71.082 18.353 7.641   1.00 38.67  ? 173 GLY F N     1 
ATOM   2206 C CA    . GLY F  1 32 ? -71.378 17.182 8.471   1.00 40.35  ? 173 GLY F CA    1 
ATOM   2207 C C     . GLY F  1 32 ? -70.377 16.949 9.606   1.00 40.14  ? 173 GLY F C     1 
ATOM   2208 O O     . GLY F  1 32 ? -70.780 16.407 10.614  1.00 41.78  ? 173 GLY F O     1 
ATOM   2209 N N     . LYS F  1 33 ? -69.106 17.371 9.491   1.00 39.04  ? 174 LYS F N     1 
ATOM   2210 C CA    . LYS F  1 33 ? -68.216 17.375 10.681  1.00 39.75  ? 174 LYS F CA    1 
ATOM   2211 C C     . LYS F  1 33 ? -68.642 18.512 11.634  1.00 38.32  ? 174 LYS F C     1 
ATOM   2212 O O     . LYS F  1 33 ? -69.484 19.347 11.294  1.00 40.36  ? 174 LYS F O     1 
ATOM   2213 C CB    . LYS F  1 33 ? -66.751 17.605 10.349  1.00 41.29  ? 174 LYS F CB    1 
ATOM   2214 C CG    . LYS F  1 33 ? -66.155 16.759 9.252   1.00 44.18  ? 174 LYS F CG    1 
ATOM   2215 C CD    . LYS F  1 33 ? -65.848 15.383 9.792   1.00 47.50  ? 174 LYS F CD    1 
ATOM   2216 C CE    . LYS F  1 33 ? -65.475 14.454 8.643   1.00 47.48  ? 174 LYS F CE    1 
ATOM   2217 N NZ    . LYS F  1 33 ? -65.310 13.103 9.257   1.00 50.79  ? 174 LYS F NZ    1 
ATOM   2218 N N     . SER F  1 34 ? -68.059 18.539 12.820  1.00 37.71  ? 175 SER F N     1 
ATOM   2219 C CA    . SER F  1 34 ? -68.394 19.524 13.859  1.00 37.31  ? 175 SER F CA    1 
ATOM   2220 C C     . SER F  1 34 ? -67.150 20.168 14.414  1.00 35.67  ? 175 SER F C     1 
ATOM   2221 O O     . SER F  1 34 ? -66.061 19.593 14.372  1.00 32.75  ? 175 SER F O     1 
ATOM   2222 C CB    . SER F  1 34 ? -69.162 18.826 14.974  1.00 38.87  ? 175 SER F CB    1 
ATOM   2223 O OG    . SER F  1 34 ? -68.291 17.988 15.695  1.00 39.36  ? 175 SER F OG    1 
ATOM   2224 N N     . ASP F  1 35 ? -67.326 21.413 14.843  1.00 35.98  ? 176 ASP F N     1 
ATOM   2225 C CA    . ASP F  1 35 ? -66.424 22.079 15.742  1.00 36.77  ? 176 ASP F CA    1 
ATOM   2226 C C     . ASP F  1 35 ? -66.994 22.098 17.189  1.00 38.66  ? 176 ASP F C     1 
ATOM   2227 O O     . ASP F  1 35 ? -68.229 22.198 17.425  1.00 38.22  ? 176 ASP F O     1 
ATOM   2228 C CB    . ASP F  1 35 ? -66.208 23.503 15.297  1.00 37.78  ? 176 ASP F CB    1 
ATOM   2229 C CG    . ASP F  1 35 ? -65.689 23.595 13.893  1.00 37.47  ? 176 ASP F CG    1 
ATOM   2230 O OD1   . ASP F  1 35 ? -64.449 23.440 13.675  1.00 37.71  ? 176 ASP F OD1   1 
ATOM   2231 O OD2   . ASP F  1 35 ? -66.551 23.763 13.023  1.00 37.48  ? 176 ASP F OD2   1 
ATOM   2232 N N     . VAL F  1 36 ? -66.074 22.048 18.138  1.00 39.19  ? 177 VAL F N     1 
ATOM   2233 C CA    . VAL F  1 36 ? -66.394 22.021 19.544  1.00 41.83  ? 177 VAL F CA    1 
ATOM   2234 C C     . VAL F  1 36 ? -65.740 23.236 20.168  1.00 43.15  ? 177 VAL F C     1 
ATOM   2235 O O     . VAL F  1 36 ? -64.515 23.476 20.003  1.00 43.81  ? 177 VAL F O     1 
ATOM   2236 C CB    . VAL F  1 36 ? -65.936 20.718 20.183  1.00 42.50  ? 177 VAL F CB    1 
ATOM   2237 C CG1   . VAL F  1 36 ? -66.207 20.705 21.704  1.00 44.69  ? 177 VAL F CG1   1 
ATOM   2238 C CG2   . VAL F  1 36 ? -66.675 19.575 19.532  1.00 41.93  ? 177 VAL F CG2   1 
ATOM   2239 N N     . TYR F  1 37 ? -66.575 24.030 20.827  1.00 44.59  ? 178 TYR F N     1 
ATOM   2240 C CA    . TYR F  1 37 ? -66.124 25.255 21.478  1.00 48.07  ? 178 TYR F CA    1 
ATOM   2241 C C     . TYR F  1 37 ? -66.414 25.096 22.973  1.00 50.11  ? 178 TYR F C     1 
ATOM   2242 O O     . TYR F  1 37 ? -67.320 24.324 23.356  1.00 50.70  ? 178 TYR F O     1 
ATOM   2243 C CB    . TYR F  1 37 ? -66.855 26.491 20.904  1.00 49.27  ? 178 TYR F CB    1 
ATOM   2244 C CG    . TYR F  1 37 ? -66.765 26.612 19.382  1.00 48.16  ? 178 TYR F CG    1 
ATOM   2245 C CD1   . TYR F  1 37 ? -65.560 26.810 18.786  1.00 49.06  ? 178 TYR F CD1   1 
ATOM   2246 C CD2   . TYR F  1 37 ? -67.886 26.504 18.556  1.00 49.09  ? 178 TYR F CD2   1 
ATOM   2247 C CE1   . TYR F  1 37 ? -65.439 26.937 17.401  1.00 49.52  ? 178 TYR F CE1   1 
ATOM   2248 C CE2   . TYR F  1 37 ? -67.793 26.616 17.151  1.00 48.09  ? 178 TYR F CE2   1 
ATOM   2249 C CZ    . TYR F  1 37 ? -66.558 26.845 16.583  1.00 48.73  ? 178 TYR F CZ    1 
ATOM   2250 O OH    . TYR F  1 37 ? -66.335 26.919 15.229  1.00 49.70  ? 178 TYR F OH    1 
ATOM   2251 N N     . TYR F  1 38 ? -65.634 25.820 23.793  1.00 50.69  ? 179 TYR F N     1 
ATOM   2252 C CA    . TYR F  1 38 ? -65.957 26.073 25.206  1.00 52.08  ? 179 TYR F CA    1 
ATOM   2253 C C     . TYR F  1 38 ? -66.017 27.590 25.489  1.00 54.84  ? 179 TYR F C     1 
ATOM   2254 O O     . TYR F  1 38 ? -65.213 28.377 24.937  1.00 54.37  ? 179 TYR F O     1 
ATOM   2255 C CB    . TYR F  1 38 ? -64.974 25.394 26.148  1.00 51.62  ? 179 TYR F CB    1 
ATOM   2256 C CG    . TYR F  1 38 ? -64.989 23.908 26.023  1.00 49.69  ? 179 TYR F CG    1 
ATOM   2257 C CD1   . TYR F  1 38 ? -64.174 23.280 25.129  1.00 47.84  ? 179 TYR F CD1   1 
ATOM   2258 C CD2   . TYR F  1 38 ? -65.826 23.132 26.799  1.00 50.63  ? 179 TYR F CD2   1 
ATOM   2259 C CE1   . TYR F  1 38 ? -64.198 21.910 24.985  1.00 48.45  ? 179 TYR F CE1   1 
ATOM   2260 C CE2   . TYR F  1 38 ? -65.846 21.755 26.685  1.00 50.00  ? 179 TYR F CE2   1 
ATOM   2261 C CZ    . TYR F  1 38 ? -65.038 21.153 25.785  1.00 49.10  ? 179 TYR F CZ    1 
ATOM   2262 O OH    . TYR F  1 38 ? -65.067 19.806 25.635  1.00 49.94  ? 179 TYR F OH    1 
ATOM   2263 N N     . PHE F  1 39 ? -67.006 27.983 26.296  1.00 55.93  ? 180 PHE F N     1 
ATOM   2264 C CA    . PHE F  1 39 ? -67.197 29.371 26.730  1.00 59.08  ? 180 PHE F CA    1 
ATOM   2265 C C     . PHE F  1 39 ? -66.971 29.434 28.237  1.00 60.23  ? 180 PHE F C     1 
ATOM   2266 O O     . PHE F  1 39 ? -67.485 28.583 28.970  1.00 57.26  ? 180 PHE F O     1 
ATOM   2267 C CB    . PHE F  1 39 ? -68.625 29.832 26.398  1.00 61.45  ? 180 PHE F CB    1 
ATOM   2268 C CG    . PHE F  1 39 ? -68.918 29.796 24.936  1.00 60.75  ? 180 PHE F CG    1 
ATOM   2269 C CD1   . PHE F  1 39 ? -68.546 30.866 24.117  1.00 62.21  ? 180 PHE F CD1   1 
ATOM   2270 C CD2   . PHE F  1 39 ? -69.479 28.656 24.357  1.00 59.01  ? 180 PHE F CD2   1 
ATOM   2271 C CE1   . PHE F  1 39 ? -68.766 30.809 22.743  1.00 61.46  ? 180 PHE F CE1   1 
ATOM   2272 C CE2   . PHE F  1 39 ? -69.706 28.596 22.993  1.00 58.84  ? 180 PHE F CE2   1 
ATOM   2273 C CZ    . PHE F  1 39 ? -69.348 29.676 22.179  1.00 59.84  ? 180 PHE F CZ    1 
ATOM   2274 N N     . SER F  1 40 ? -66.178 30.403 28.684  1.00 63.28  ? 181 SER F N     1 
ATOM   2275 C CA    . SER F  1 40 ? -65.954 30.613 30.137  1.00 67.72  ? 181 SER F CA    1 
ATOM   2276 C C     . SER F  1 40 ? -67.209 31.246 30.795  1.00 69.86  ? 181 SER F C     1 
ATOM   2277 O O     . SER F  1 40 ? -68.163 31.638 30.080  1.00 68.62  ? 181 SER F O     1 
ATOM   2278 C CB    . SER F  1 40 ? -64.632 31.394 30.406  1.00 69.56  ? 181 SER F CB    1 
ATOM   2279 O OG    . SER F  1 40 ? -64.774 32.805 30.470  1.00 74.76  ? 181 SER F OG    1 
ATOM   2280 N N     . PRO F  1 41 ? -67.232 31.340 32.145  1.00 73.50  ? 182 PRO F N     1 
ATOM   2281 C CA    . PRO F  1 41 ? -68.377 32.041 32.809  1.00 77.21  ? 182 PRO F CA    1 
ATOM   2282 C C     . PRO F  1 41 ? -68.500 33.483 32.325  1.00 79.15  ? 182 PRO F C     1 
ATOM   2283 O O     . PRO F  1 41 ? -69.614 33.952 32.122  1.00 81.55  ? 182 PRO F O     1 
ATOM   2284 C CB    . PRO F  1 41 ? -68.023 32.005 34.294  1.00 79.00  ? 182 PRO F CB    1 
ATOM   2285 C CG    . PRO F  1 41 ? -66.921 31.002 34.424  1.00 77.21  ? 182 PRO F CG    1 
ATOM   2286 C CD    . PRO F  1 41 ? -66.191 30.961 33.116  1.00 74.14  ? 182 PRO F CD    1 
ATOM   2287 N N     . SER F  1 42 ? -67.337 34.133 32.148  1.00 79.27  ? 183 SER F N     1 
ATOM   2288 C CA    . SER F  1 42 ? -67.163 35.399 31.399  1.00 80.98  ? 183 SER F CA    1 
ATOM   2289 C C     . SER F  1 42 ? -67.771 35.412 29.962  1.00 79.38  ? 183 SER F C     1 
ATOM   2290 O O     . SER F  1 42 ? -68.165 36.474 29.465  1.00 81.99  ? 183 SER F O     1 
ATOM   2291 C CB    . SER F  1 42 ? -65.659 35.757 31.322  1.00 80.41  ? 183 SER F CB    1 
ATOM   2292 N N     . GLY F  1 43 ? -67.830 34.252 29.299  1.00 75.02  ? 184 GLY F N     1 
ATOM   2293 C CA    . GLY F  1 43 ? -68.340 34.126 27.914  1.00 72.90  ? 184 GLY F CA    1 
ATOM   2294 C C     . GLY F  1 43 ? -67.251 34.127 26.839  1.00 69.95  ? 184 GLY F C     1 
ATOM   2295 O O     . GLY F  1 43 ? -67.575 34.176 25.647  1.00 68.43  ? 184 GLY F O     1 
ATOM   2296 N N     . LYS F  1 44 ? -65.974 34.090 27.265  1.00 69.44  ? 185 LYS F N     1 
ATOM   2297 C CA    . LYS F  1 44 ? -64.803 34.029 26.372  1.00 68.28  ? 185 LYS F CA    1 
ATOM   2298 C C     . LYS F  1 44 ? -64.719 32.625 25.712  1.00 65.00  ? 185 LYS F C     1 
ATOM   2299 O O     . LYS F  1 44 ? -64.705 31.587 26.403  1.00 64.39  ? 185 LYS F O     1 
ATOM   2300 C CB    . LYS F  1 44 ? -63.514 34.378 27.140  1.00 68.63  ? 185 LYS F CB    1 
ATOM   2301 N N     . LYS F  1 45 ? -64.690 32.608 24.383  1.00 63.95  ? 186 LYS F N     1 
ATOM   2302 C CA    . LYS F  1 45 ? -64.778 31.367 23.593  1.00 61.19  ? 186 LYS F CA    1 
ATOM   2303 C C     . LYS F  1 45 ? -63.402 30.690 23.495  1.00 58.11  ? 186 LYS F C     1 
ATOM   2304 O O     . LYS F  1 45 ? -62.404 31.349 23.338  1.00 58.59  ? 186 LYS F O     1 
ATOM   2305 C CB    . LYS F  1 45 ? -65.352 31.712 22.208  1.00 62.27  ? 186 LYS F CB    1 
ATOM   2306 C CG    . LYS F  1 45 ? -65.543 30.563 21.225  1.00 62.03  ? 186 LYS F CG    1 
ATOM   2307 C CD    . LYS F  1 45 ? -65.688 31.020 19.758  1.00 62.87  ? 186 LYS F CD    1 
ATOM   2308 C CE    . LYS F  1 45 ? -67.112 31.460 19.385  1.00 64.30  ? 186 LYS F CE    1 
ATOM   2309 N NZ    . LYS F  1 45 ? -67.591 30.841 18.104  1.00 62.96  ? 186 LYS F NZ    1 
ATOM   2310 N N     . PHE F  1 46 ? -63.364 29.364 23.579  1.00 55.98  ? 187 PHE F N     1 
ATOM   2311 C CA    . PHE F  1 46 ? -62.115 28.576 23.445  1.00 54.49  ? 187 PHE F CA    1 
ATOM   2312 C C     . PHE F  1 46 ? -62.281 27.451 22.433  1.00 50.54  ? 187 PHE F C     1 
ATOM   2313 O O     . PHE F  1 46 ? -63.281 26.717 22.460  1.00 49.14  ? 187 PHE F O     1 
ATOM   2314 C CB    . PHE F  1 46 ? -61.690 27.990 24.791  1.00 56.51  ? 187 PHE F CB    1 
ATOM   2315 C CG    . PHE F  1 46 ? -61.205 29.030 25.735  1.00 59.38  ? 187 PHE F CG    1 
ATOM   2316 C CD1   . PHE F  1 46 ? -62.096 29.746 26.495  1.00 59.96  ? 187 PHE F CD1   1 
ATOM   2317 C CD2   . PHE F  1 46 ? -59.866 29.358 25.769  1.00 61.00  ? 187 PHE F CD2   1 
ATOM   2318 C CE1   . PHE F  1 46 ? -61.654 30.758 27.316  1.00 64.59  ? 187 PHE F CE1   1 
ATOM   2319 C CE2   . PHE F  1 46 ? -59.408 30.357 26.583  1.00 64.92  ? 187 PHE F CE2   1 
ATOM   2320 C CZ    . PHE F  1 46 ? -60.305 31.057 27.380  1.00 65.81  ? 187 PHE F CZ    1 
ATOM   2321 N N     . ARG F  1 47 ? -61.289 27.317 21.556  1.00 48.97  ? 188 ARG F N     1 
ATOM   2322 C CA    . ARG F  1 47 ? -61.431 26.466 20.382  1.00 46.89  ? 188 ARG F CA    1 
ATOM   2323 C C     . ARG F  1 47 ? -60.399 25.354 20.272  1.00 47.97  ? 188 ARG F C     1 
ATOM   2324 O O     . ARG F  1 47 ? -60.373 24.632 19.269  1.00 47.64  ? 188 ARG F O     1 
ATOM   2325 C CB    . ARG F  1 47 ? -61.378 27.324 19.134  1.00 45.17  ? 188 ARG F CB    1 
ATOM   2326 C CG    . ARG F  1 47 ? -62.230 28.566 19.211  1.00 45.96  ? 188 ARG F CG    1 
ATOM   2327 C CD    . ARG F  1 47 ? -62.466 29.142 17.817  1.00 45.16  ? 188 ARG F CD    1 
ATOM   2328 N NE    . ARG F  1 47 ? -61.295 29.794 17.242  1.00 45.62  ? 188 ARG F NE    1 
ATOM   2329 C CZ    . ARG F  1 47 ? -60.969 29.828 15.932  1.00 44.55  ? 188 ARG F CZ    1 
ATOM   2330 N NH1   . ARG F  1 47 ? -61.690 29.164 14.978  1.00 42.06  ? 188 ARG F NH1   1 
ATOM   2331 N NH2   . ARG F  1 47 ? -59.879 30.516 15.574  1.00 44.95  ? 188 ARG F NH2   1 
ATOM   2332 N N     . SER F  1 48 ? -59.562 25.190 21.291  1.00 50.10  ? 189 SER F N     1 
ATOM   2333 C CA    . SER F  1 48 ? -58.653 24.053 21.322  1.00 51.51  ? 189 SER F CA    1 
ATOM   2334 C C     . SER F  1 48 ? -58.229 23.749 22.754  1.00 55.21  ? 189 SER F C     1 
ATOM   2335 O O     . SER F  1 48 ? -58.278 24.625 23.627  1.00 54.86  ? 189 SER F O     1 
ATOM   2336 C CB    . SER F  1 48 ? -57.424 24.353 20.477  1.00 50.63  ? 189 SER F CB    1 
ATOM   2337 O OG    . SER F  1 48 ? -56.677 25.424 21.017  1.00 50.59  ? 189 SER F OG    1 
ATOM   2338 N N     . LYS F  1 49 ? -57.825 22.500 22.976  1.00 59.18  ? 190 LYS F N     1 
ATOM   2339 C CA    . LYS F  1 49 ? -57.247 22.067 24.264  1.00 64.25  ? 190 LYS F CA    1 
ATOM   2340 C C     . LYS F  1 49 ? -56.053 22.919 24.824  1.00 66.04  ? 190 LYS F C     1 
ATOM   2341 O O     . LYS F  1 49 ? -56.101 23.297 25.993  1.00 66.79  ? 190 LYS F O     1 
ATOM   2342 C CB    . LYS F  1 49 ? -56.898 20.581 24.196  1.00 67.25  ? 190 LYS F CB    1 
ATOM   2343 C CG    . LYS F  1 49 ? -56.614 19.924 25.521  1.00 71.49  ? 190 LYS F CG    1 
ATOM   2344 C CD    . LYS F  1 49 ? -56.201 18.465 25.326  1.00 74.66  ? 190 LYS F CD    1 
ATOM   2345 C CE    . LYS F  1 49 ? -55.455 17.916 26.548  1.00 77.84  ? 190 LYS F CE    1 
ATOM   2346 N NZ    . LYS F  1 49 ? -56.115 16.680 27.038  1.00 78.86  ? 190 LYS F NZ    1 
ATOM   2347 N N     . PRO F  1 50 ? -55.023 23.261 24.009  1.00 66.73  ? 191 PRO F N     1 
ATOM   2348 C CA    . PRO F  1 50 ? -53.998 24.217 24.518  1.00 69.49  ? 191 PRO F CA    1 
ATOM   2349 C C     . PRO F  1 50 ? -54.556 25.574 24.985  1.00 67.97  ? 191 PRO F C     1 
ATOM   2350 O O     . PRO F  1 50 ? -54.345 25.928 26.126  1.00 69.64  ? 191 PRO F O     1 
ATOM   2351 C CB    . PRO F  1 50 ? -53.038 24.419 23.326  1.00 71.19  ? 191 PRO F CB    1 
ATOM   2352 C CG    . PRO F  1 50 ? -53.403 23.392 22.313  1.00 70.63  ? 191 PRO F CG    1 
ATOM   2353 C CD    . PRO F  1 50 ? -54.798 22.911 22.595  1.00 67.64  ? 191 PRO F CD    1 
ATOM   2354 N N     . GLN F  1 51 ? -55.289 26.285 24.121  1.00 66.50  ? 192 GLN F N     1 
ATOM   2355 C CA    . GLN F  1 51 ? -55.939 27.596 24.437  1.00 67.17  ? 192 GLN F CA    1 
ATOM   2356 C C     . GLN F  1 51 ? -56.697 27.499 25.767  1.00 66.86  ? 192 GLN F C     1 
ATOM   2357 O O     . GLN F  1 51 ? -56.615 28.384 26.639  1.00 67.74  ? 192 GLN F O     1 
ATOM   2358 C CB    . GLN F  1 51 ? -56.919 27.985 23.299  1.00 67.41  ? 192 GLN F CB    1 
ATOM   2359 C CG    . GLN F  1 51 ? -57.345 29.457 23.169  1.00 70.02  ? 192 GLN F CG    1 
ATOM   2360 C CD    . GLN F  1 51 ? -58.313 29.741 21.983  1.00 69.92  ? 192 GLN F CD    1 
ATOM   2361 O OE1   . GLN F  1 51 ? -58.992 28.844 21.442  1.00 67.20  ? 192 GLN F OE1   1 
ATOM   2362 N NE2   . GLN F  1 51 ? -58.378 31.012 21.587  1.00 72.38  ? 192 GLN F NE2   1 
ATOM   2363 N N     . LEU F  1 52 ? -57.424 26.394 25.916  1.00 64.10  ? 193 LEU F N     1 
ATOM   2364 C CA    . LEU F  1 52 ? -58.153 26.105 27.133  1.00 64.15  ? 193 LEU F CA    1 
ATOM   2365 C C     . LEU F  1 52 ? -57.211 25.769 28.307  1.00 67.82  ? 193 LEU F C     1 
ATOM   2366 O O     . LEU F  1 52 ? -57.496 26.143 29.448  1.00 66.93  ? 193 LEU F O     1 
ATOM   2367 C CB    . LEU F  1 52 ? -59.138 24.963 26.890  1.00 61.65  ? 193 LEU F CB    1 
ATOM   2368 C CG    . LEU F  1 52 ? -60.181 24.703 27.971  1.00 61.42  ? 193 LEU F CG    1 
ATOM   2369 C CD1   . LEU F  1 52 ? -61.061 25.927 28.208  1.00 61.27  ? 193 LEU F CD1   1 
ATOM   2370 C CD2   . LEU F  1 52 ? -60.991 23.476 27.593  1.00 59.86  ? 193 LEU F CD2   1 
ATOM   2371 N N     . ALA F  1 53 ? -56.107 25.066 28.025  1.00 70.11  ? 194 ALA F N     1 
ATOM   2372 C CA    . ALA F  1 53 ? -55.158 24.626 29.068  1.00 73.67  ? 194 ALA F CA    1 
ATOM   2373 C C     . ALA F  1 53 ? -54.202 25.715 29.553  1.00 77.37  ? 194 ALA F C     1 
ATOM   2374 O O     . ALA F  1 53 ? -53.832 25.704 30.719  1.00 81.24  ? 194 ALA F O     1 
ATOM   2375 C CB    . ALA F  1 53 ? -54.367 23.418 28.595  1.00 73.84  ? 194 ALA F CB    1 
ATOM   2376 N N     . ARG F  1 54 ? -53.775 26.625 28.671  1.00 78.44  ? 195 ARG F N     1 
ATOM   2377 C CA    . ARG F  1 54 ? -53.030 27.817 29.101  1.00 81.85  ? 195 ARG F CA    1 
ATOM   2378 C C     . ARG F  1 54 ? -53.941 28.709 29.978  1.00 82.74  ? 195 ARG F C     1 
ATOM   2379 O O     . ARG F  1 54 ? -53.567 29.029 31.116  1.00 85.31  ? 195 ARG F O     1 
ATOM   2380 C CB    . ARG F  1 54 ? -52.443 28.583 27.900  1.00 82.51  ? 195 ARG F CB    1 
ATOM   2381 N N     . TYR F  1 55 ? -55.146 29.043 29.489  1.00 80.88  ? 196 TYR F N     1 
ATOM   2382 C CA    . TYR F  1 55 ? -56.096 29.922 30.226  1.00 82.16  ? 196 TYR F CA    1 
ATOM   2383 C C     . TYR F  1 55 ? -56.351 29.457 31.651  1.00 83.27  ? 196 TYR F C     1 
ATOM   2384 O O     . TYR F  1 55 ? -56.252 30.253 32.571  1.00 87.21  ? 196 TYR F O     1 
ATOM   2385 C CB    . TYR F  1 55 ? -57.450 30.087 29.504  1.00 79.76  ? 196 TYR F CB    1 
ATOM   2386 C CG    . TYR F  1 55 ? -58.417 31.058 30.188  1.00 81.26  ? 196 TYR F CG    1 
ATOM   2387 C CD1   . TYR F  1 55 ? -58.200 32.442 30.150  1.00 83.99  ? 196 TYR F CD1   1 
ATOM   2388 C CD2   . TYR F  1 55 ? -59.550 30.596 30.866  1.00 81.20  ? 196 TYR F CD2   1 
ATOM   2389 C CE1   . TYR F  1 55 ? -59.073 33.336 30.772  1.00 86.85  ? 196 TYR F CE1   1 
ATOM   2390 C CE2   . TYR F  1 55 ? -60.429 31.485 31.496  1.00 83.87  ? 196 TYR F CE2   1 
ATOM   2391 C CZ    . TYR F  1 55 ? -60.191 32.857 31.453  1.00 86.44  ? 196 TYR F CZ    1 
ATOM   2392 O OH    . TYR F  1 55 ? -61.068 33.735 32.079  1.00 86.49  ? 196 TYR F OH    1 
ATOM   2393 N N     . LEU F  1 56 ? -56.655 28.178 31.828  1.00 82.66  ? 197 LEU F N     1 
ATOM   2394 C CA    . LEU F  1 56 ? -56.987 27.644 33.155  1.00 86.47  ? 197 LEU F CA    1 
ATOM   2395 C C     . LEU F  1 56 ? -55.762 27.306 34.058  1.00 91.78  ? 197 LEU F C     1 
ATOM   2396 O O     . LEU F  1 56 ? -55.911 27.230 35.299  1.00 91.22  ? 197 LEU F O     1 
ATOM   2397 C CB    . LEU F  1 56 ? -57.956 26.451 33.034  1.00 84.09  ? 197 LEU F CB    1 
ATOM   2398 C CG    . LEU F  1 56 ? -59.380 26.811 32.564  1.00 82.12  ? 197 LEU F CG    1 
ATOM   2399 C CD1   . LEU F  1 56 ? -60.167 25.568 32.156  1.00 79.19  ? 197 LEU F CD1   1 
ATOM   2400 C CD2   . LEU F  1 56 ? -60.148 27.628 33.607  1.00 83.80  ? 197 LEU F CD2   1 
ATOM   2401 N N     . GLY F  1 57 ? -54.586 27.098 33.443  1.00 94.38  ? 198 GLY F N     1 
ATOM   2402 C CA    . GLY F  1 57 ? -53.308 26.934 34.171  1.00 99.10  ? 198 GLY F CA    1 
ATOM   2403 C C     . GLY F  1 57 ? -53.312 25.839 35.229  1.00 101.41 ? 198 GLY F C     1 
ATOM   2404 O O     . GLY F  1 57 ? -54.040 24.845 35.091  1.00 100.00 ? 198 GLY F O     1 
ATOM   2405 N N     . ASN F  1 58 ? -52.522 26.032 36.293  1.00 104.36 ? 199 ASN F N     1 
ATOM   2406 C CA    . ASN F  1 58 ? -52.451 25.076 37.414  1.00 106.47 ? 199 ASN F CA    1 
ATOM   2407 C C     . ASN F  1 58 ? -53.816 24.702 38.051  1.00 105.50 ? 199 ASN F C     1 
ATOM   2408 O O     . ASN F  1 58 ? -53.989 23.565 38.497  1.00 104.87 ? 199 ASN F O     1 
ATOM   2409 C CB    . ASN F  1 58 ? -51.502 25.600 38.500  1.00 109.67 ? 199 ASN F CB    1 
ATOM   2410 N N     . THR F  1 59 ? -54.779 25.636 38.062  1.00 105.30 ? 200 THR F N     1 
ATOM   2411 C CA    . THR F  1 59 ? -56.076 25.471 38.786  1.00 105.19 ? 200 THR F CA    1 
ATOM   2412 C C     . THR F  1 59 ? -57.102 24.405 38.269  1.00 102.20 ? 200 THR F C     1 
ATOM   2413 O O     . THR F  1 59 ? -58.153 24.220 38.898  1.00 102.57 ? 200 THR F O     1 
ATOM   2414 C CB    . THR F  1 59 ? -56.813 26.831 38.912  1.00 104.14 ? 200 THR F CB    1 
ATOM   2415 N N     . VAL F  1 60 ? -56.816 23.740 37.141  1.00 98.17  ? 201 VAL F N     1 
ATOM   2416 C CA    . VAL F  1 60 ? -57.556 22.536 36.691  1.00 93.84  ? 201 VAL F CA    1 
ATOM   2417 C C     . VAL F  1 60 ? -56.637 21.735 35.745  1.00 91.53  ? 201 VAL F C     1 
ATOM   2418 O O     . VAL F  1 60 ? -56.148 22.279 34.766  1.00 89.29  ? 201 VAL F O     1 
ATOM   2419 C CB    . VAL F  1 60 ? -58.883 22.899 35.970  1.00 89.49  ? 201 VAL F CB    1 
ATOM   2420 N N     . ASP F  1 61 ? -56.383 20.464 36.056  1.00 91.96  ? 202 ASP F N     1 
ATOM   2421 C CA    . ASP F  1 61 ? -55.509 19.598 35.238  1.00 91.93  ? 202 ASP F CA    1 
ATOM   2422 C C     . ASP F  1 61 ? -56.296 18.968 34.086  1.00 89.36  ? 202 ASP F C     1 
ATOM   2423 O O     . ASP F  1 61 ? -57.217 18.181 34.319  1.00 88.45  ? 202 ASP F O     1 
ATOM   2424 C CB    . ASP F  1 61 ? -54.878 18.489 36.102  1.00 95.31  ? 202 ASP F CB    1 
ATOM   2425 C CG    . ASP F  1 61 ? -53.911 17.565 35.321  1.00 96.44  ? 202 ASP F CG    1 
ATOM   2426 O OD1   . ASP F  1 61 ? -53.652 17.740 34.109  1.00 94.55  ? 202 ASP F OD1   1 
ATOM   2427 O OD2   . ASP F  1 61 ? -53.397 16.622 35.945  1.00 100.15 ? 202 ASP F OD2   1 
ATOM   2428 N N     . LEU F  1 62 ? -55.889 19.281 32.852  1.00 87.36  ? 203 LEU F N     1 
ATOM   2429 C CA    . LEU F  1 62 ? -56.580 18.805 31.642  1.00 85.41  ? 203 LEU F CA    1 
ATOM   2430 C C     . LEU F  1 62 ? -55.762 17.754 30.854  1.00 88.00  ? 203 LEU F C     1 
ATOM   2431 O O     . LEU F  1 62 ? -56.021 17.534 29.669  1.00 89.55  ? 203 LEU F O     1 
ATOM   2432 C CB    . LEU F  1 62 ? -56.949 20.009 30.757  1.00 80.35  ? 203 LEU F CB    1 
ATOM   2433 C CG    . LEU F  1 62 ? -57.681 21.188 31.438  1.00 79.43  ? 203 LEU F CG    1 
ATOM   2434 C CD1   . LEU F  1 62 ? -57.804 22.370 30.504  1.00 77.89  ? 203 LEU F CD1   1 
ATOM   2435 C CD2   . LEU F  1 62 ? -59.068 20.820 31.942  1.00 78.43  ? 203 LEU F CD2   1 
ATOM   2436 N N     . SER F  1 63 ? -54.812 17.080 31.516  1.00 91.96  ? 204 SER F N     1 
ATOM   2437 C CA    . SER F  1 63 ? -53.962 16.044 30.881  1.00 93.37  ? 204 SER F CA    1 
ATOM   2438 C C     . SER F  1 63 ? -54.799 14.918 30.237  1.00 91.89  ? 204 SER F C     1 
ATOM   2439 O O     . SER F  1 63 ? -54.585 14.556 29.078  1.00 87.05  ? 204 SER F O     1 
ATOM   2440 C CB    . SER F  1 63 ? -52.968 15.457 31.905  1.00 97.66  ? 204 SER F CB    1 
ATOM   2441 N N     . SER F  1 64 ? -55.760 14.398 31.003  1.00 92.74  ? 205 SER F N     1 
ATOM   2442 C CA    . SER F  1 64 ? -56.692 13.352 30.535  1.00 91.75  ? 205 SER F CA    1 
ATOM   2443 C C     . SER F  1 64 ? -58.052 13.895 30.000  1.00 86.10  ? 205 SER F C     1 
ATOM   2444 O O     . SER F  1 64 ? -58.939 13.104 29.651  1.00 87.16  ? 205 SER F O     1 
ATOM   2445 C CB    . SER F  1 64 ? -56.926 12.325 31.671  1.00 95.22  ? 205 SER F CB    1 
ATOM   2446 N N     . PHE F  1 65 ? -58.206 15.220 29.919  1.00 80.31  ? 206 PHE F N     1 
ATOM   2447 C CA    . PHE F  1 65 ? -59.460 15.852 29.468  1.00 76.08  ? 206 PHE F CA    1 
ATOM   2448 C C     . PHE F  1 65 ? -59.643 15.802 27.936  1.00 72.65  ? 206 PHE F C     1 
ATOM   2449 O O     . PHE F  1 65 ? -58.892 16.460 27.220  1.00 71.90  ? 206 PHE F O     1 
ATOM   2450 C CB    . PHE F  1 65 ? -59.489 17.321 29.925  1.00 73.40  ? 206 PHE F CB    1 
ATOM   2451 C CG    . PHE F  1 65 ? -60.771 18.035 29.605  1.00 70.90  ? 206 PHE F CG    1 
ATOM   2452 C CD1   . PHE F  1 65 ? -61.970 17.612 30.155  1.00 71.34  ? 206 PHE F CD1   1 
ATOM   2453 C CD2   . PHE F  1 65 ? -60.785 19.131 28.742  1.00 69.52  ? 206 PHE F CD2   1 
ATOM   2454 C CE1   . PHE F  1 65 ? -63.155 18.258 29.863  1.00 69.47  ? 206 PHE F CE1   1 
ATOM   2455 C CE2   . PHE F  1 65 ? -61.969 19.792 28.457  1.00 67.13  ? 206 PHE F CE2   1 
ATOM   2456 C CZ    . PHE F  1 65 ? -63.153 19.357 29.024  1.00 67.90  ? 206 PHE F CZ    1 
ATOM   2457 N N     . ASP F  1 66 ? -60.642 15.050 27.450  1.00 70.03  ? 207 ASP F N     1 
ATOM   2458 C CA    . ASP F  1 66 ? -60.926 14.945 25.993  1.00 66.66  ? 207 ASP F CA    1 
ATOM   2459 C C     . ASP F  1 66 ? -61.750 16.159 25.501  1.00 60.25  ? 207 ASP F C     1 
ATOM   2460 O O     . ASP F  1 66 ? -62.964 16.271 25.803  1.00 56.93  ? 207 ASP F O     1 
ATOM   2461 C CB    . ASP F  1 66 ? -61.644 13.630 25.627  1.00 68.22  ? 207 ASP F CB    1 
ATOM   2462 C CG    . ASP F  1 66 ? -61.879 13.502 24.125  1.00 66.96  ? 207 ASP F CG    1 
ATOM   2463 O OD1   . ASP F  1 66 ? -60.935 13.136 23.397  1.00 67.65  ? 207 ASP F OD1   1 
ATOM   2464 O OD2   . ASP F  1 66 ? -62.995 13.813 23.668  1.00 64.62  ? 207 ASP F OD2   1 
ATOM   2465 N N     . PHE F  1 67 ? -61.081 17.043 24.748  1.00 55.94  ? 208 PHE F N     1 
ATOM   2466 C CA    . PHE F  1 67 ? -61.652 18.331 24.323  1.00 53.35  ? 208 PHE F CA    1 
ATOM   2467 C C     . PHE F  1 67 ? -62.955 18.178 23.538  1.00 51.39  ? 208 PHE F C     1 
ATOM   2468 O O     . PHE F  1 67 ? -63.845 19.018 23.653  1.00 49.14  ? 208 PHE F O     1 
ATOM   2469 C CB    . PHE F  1 67 ? -60.615 19.129 23.511  1.00 52.45  ? 208 PHE F CB    1 
ATOM   2470 C CG    . PHE F  1 67 ? -61.083 20.500 23.064  1.00 50.61  ? 208 PHE F CG    1 
ATOM   2471 C CD1   . PHE F  1 67 ? -61.743 20.666 21.845  1.00 48.28  ? 208 PHE F CD1   1 
ATOM   2472 C CD2   . PHE F  1 67 ? -60.827 21.633 23.837  1.00 50.89  ? 208 PHE F CD2   1 
ATOM   2473 C CE1   . PHE F  1 67 ? -62.165 21.928 21.428  1.00 47.08  ? 208 PHE F CE1   1 
ATOM   2474 C CE2   . PHE F  1 67 ? -61.240 22.898 23.417  1.00 50.09  ? 208 PHE F CE2   1 
ATOM   2475 C CZ    . PHE F  1 67 ? -61.909 23.046 22.210  1.00 47.69  ? 208 PHE F CZ    1 
ATOM   2476 N N     . ARG F  1 68 ? -63.066 17.091 22.782  1.00 52.66  ? 209 ARG F N     1 
ATOM   2477 C CA    . ARG F  1 68 ? -64.164 16.894 21.837  1.00 55.01  ? 209 ARG F CA    1 
ATOM   2478 C C     . ARG F  1 68 ? -65.463 16.372 22.500  1.00 55.94  ? 209 ARG F C     1 
ATOM   2479 O O     . ARG F  1 68 ? -66.555 16.749 22.097  1.00 56.57  ? 209 ARG F O     1 
ATOM   2480 C CB    . ARG F  1 68 ? -63.688 15.965 20.674  1.00 56.19  ? 209 ARG F CB    1 
ATOM   2481 C CG    . ARG F  1 68 ? -64.757 15.641 19.612  1.00 58.34  ? 209 ARG F CG    1 
ATOM   2482 C CD    . ARG F  1 68 ? -64.205 15.226 18.215  1.00 56.92  ? 209 ARG F CD    1 
ATOM   2483 N NE    . ARG F  1 68 ? -63.850 16.394 17.411  1.00 54.76  ? 209 ARG F NE    1 
ATOM   2484 C CZ    . ARG F  1 68 ? -64.702 17.148 16.706  1.00 53.52  ? 209 ARG F CZ    1 
ATOM   2485 N NH1   . ARG F  1 68 ? -66.007 16.885 16.637  1.00 52.54  ? 209 ARG F NH1   1 
ATOM   2486 N NH2   . ARG F  1 68 ? -64.230 18.188 16.045  1.00 53.09  ? 209 ARG F NH2   1 
ATOM   2487 N N     . THR F  1 69 ? -65.346 15.498 23.487  1.00 57.56  ? 210 THR F N     1 
ATOM   2488 C CA    . THR F  1 69 ? -66.506 14.988 24.215  1.00 59.91  ? 210 THR F CA    1 
ATOM   2489 C C     . THR F  1 69 ? -66.850 15.817 25.451  1.00 59.94  ? 210 THR F C     1 
ATOM   2490 O O     . THR F  1 69 ? -67.983 15.843 25.867  1.00 58.91  ? 210 THR F O     1 
ATOM   2491 C CB    . THR F  1 69 ? -66.233 13.570 24.710  1.00 63.44  ? 210 THR F CB    1 
ATOM   2492 O OG1   . THR F  1 69 ? -65.005 13.581 25.452  1.00 65.18  ? 210 THR F OG1   1 
ATOM   2493 C CG2   . THR F  1 69 ? -66.129 12.590 23.511  1.00 63.56  ? 210 THR F CG2   1 
ATOM   2494 N N     . GLY F  1 70 ? -65.859 16.472 26.042  1.00 60.77  ? 211 GLY F N     1 
ATOM   2495 C CA    . GLY F  1 70 ? -66.055 17.241 27.274  1.00 62.65  ? 211 GLY F CA    1 
ATOM   2496 C C     . GLY F  1 70 ? -66.011 16.444 28.578  1.00 66.58  ? 211 GLY F C     1 
ATOM   2497 O O     . GLY F  1 70 ? -66.334 16.989 29.654  1.00 65.07  ? 211 GLY F O     1 
ATOM   2498 N N     . LYS F  1 71 ? -65.587 15.177 28.477  1.00 69.03  ? 212 LYS F N     1 
ATOM   2499 C CA    . LYS F  1 71 ? -65.481 14.246 29.599  1.00 72.68  ? 212 LYS F CA    1 
ATOM   2500 C C     . LYS F  1 71 ? -63.997 13.896 29.848  1.00 74.49  ? 212 LYS F C     1 
ATOM   2501 O O     . LYS F  1 71 ? -63.200 13.871 28.910  1.00 73.56  ? 212 LYS F O     1 
ATOM   2502 C CB    . LYS F  1 71 ? -66.284 12.972 29.280  1.00 74.75  ? 212 LYS F CB    1 
ATOM   2503 C CG    . LYS F  1 71 ? -67.736 13.181 28.823  1.00 73.98  ? 212 LYS F CG    1 
ATOM   2504 C CD    . LYS F  1 71 ? -68.666 13.705 29.919  1.00 74.94  ? 212 LYS F CD    1 
ATOM   2505 C CE    . LYS F  1 71 ? -70.132 13.412 29.608  1.00 75.62  ? 212 LYS F CE    1 
ATOM   2506 N N     . MET F  1 72 ? -63.638 13.637 31.108  1.00 78.77  ? 213 MET F N     1 
ATOM   2507 C CA    . MET F  1 72 ? -62.288 13.164 31.489  1.00 82.51  ? 213 MET F CA    1 
ATOM   2508 C C     . MET F  1 72 ? -62.125 11.679 31.173  1.00 86.81  ? 213 MET F C     1 
ATOM   2509 O O     . MET F  1 72 ? -63.116 10.934 31.162  1.00 87.65  ? 213 MET F O     1 
ATOM   2510 C CB    . MET F  1 72 ? -62.035 13.359 32.987  1.00 84.55  ? 213 MET F CB    1 
ATOM   2511 C CG    . MET F  1 72 ? -62.004 14.805 33.451  1.00 82.98  ? 213 MET F CG    1 
ATOM   2512 S SD    . MET F  1 72 ? -60.420 15.610 33.137  1.00 82.36  ? 213 MET F SD    1 
ATOM   2513 C CE    . MET F  1 72 ? -60.757 17.307 33.602  1.00 80.44  ? 213 MET F CE    1 
ATOM   2514 N N     . MET F  1 73 ? -60.877 11.250 30.952  1.00 90.48  ? 214 MET F N     1 
ATOM   2515 C CA    . MET F  1 73 ? -60.557 9.841  30.591  1.00 95.10  ? 214 MET F CA    1 
ATOM   2516 C C     . MET F  1 73 ? -59.931 9.023  31.754  1.00 98.89  ? 214 MET F C     1 
ATOM   2517 O O     . MET F  1 73 ? -59.021 9.496  32.440  1.00 99.88  ? 214 MET F O     1 
ATOM   2518 C CB    . MET F  1 73 ? -59.652 9.807  29.336  1.00 94.78  ? 214 MET F CB    1 
ATOM   2519 C CG    . MET F  1 73 ? -60.237 10.462 28.077  1.00 91.82  ? 214 MET F CG    1 
ATOM   2520 S SD    . MET F  1 73 ? -61.968 10.060 27.649  1.00 93.35  ? 214 MET F SD    1 
ATOM   2521 C CE    . MET F  1 73 ? -61.747 9.365  26.004  1.00 91.40  ? 214 MET F CE    1 
ATOM   2522 N N     . PRO F  1 74 ? -60.431 7.795  31.980  1.00 100.42 ? 215 PRO F N     1 
ATOM   2523 O "O5'" . DC  G  2 1  ? -68.670 25.163 7.444   1.00 40.83  ? 1   DC  G "O5'" 1 
ATOM   2524 C "C5'" . DC  G  2 1  ? -68.766 25.627 6.093   1.00 40.35  ? 1   DC  G "C5'" 1 
ATOM   2525 C "C4'" . DC  G  2 1  ? -67.403 25.841 5.466   1.00 37.65  ? 1   DC  G "C4'" 1 
ATOM   2526 O "O4'" . DC  G  2 1  ? -66.550 26.738 6.233   1.00 34.96  ? 1   DC  G "O4'" 1 
ATOM   2527 C "C3'" . DC  G  2 1  ? -66.587 24.588 5.221   1.00 35.80  ? 1   DC  G "C3'" 1 
ATOM   2528 O "O3'" . DC  G  2 1  ? -66.018 24.741 3.919   1.00 35.95  ? 1   DC  G "O3'" 1 
ATOM   2529 C "C2'" . DC  G  2 1  ? -65.592 24.617 6.358   1.00 35.06  ? 1   DC  G "C2'" 1 
ATOM   2530 C "C1'" . DC  G  2 1  ? -65.348 26.106 6.575   1.00 34.83  ? 1   DC  G "C1'" 1 
ATOM   2531 N N1    . DC  G  2 1  ? -65.011 26.462 7.984   1.00 35.37  ? 1   DC  G N1    1 
ATOM   2532 C C2    . DC  G  2 1  ? -63.809 27.132 8.255   1.00 34.09  ? 1   DC  G C2    1 
ATOM   2533 O O2    . DC  G  2 1  ? -63.079 27.457 7.315   1.00 34.07  ? 1   DC  G O2    1 
ATOM   2534 N N3    . DC  G  2 1  ? -63.473 27.400 9.542   1.00 32.73  ? 1   DC  G N3    1 
ATOM   2535 C C4    . DC  G  2 1  ? -64.267 26.994 10.534  1.00 33.44  ? 1   DC  G C4    1 
ATOM   2536 N N4    . DC  G  2 1  ? -63.892 27.261 11.783  1.00 32.24  ? 1   DC  G N4    1 
ATOM   2537 C C5    . DC  G  2 1  ? -65.472 26.272 10.290  1.00 35.88  ? 1   DC  G C5    1 
ATOM   2538 C C6    . DC  G  2 1  ? -65.806 26.037 9.012   1.00 35.89  ? 1   DC  G C6    1 
ATOM   2539 P P     . DG  G  2 2  ? -64.959 23.658 3.310   1.00 34.14  ? 2   DG  G P     1 
ATOM   2540 O OP1   . DG  G  2 2  ? -65.273 23.526 1.873   1.00 37.29  ? 2   DG  G OP1   1 
ATOM   2541 O OP2   . DG  G  2 2  ? -64.922 22.404 4.145   1.00 34.40  ? 2   DG  G OP2   1 
ATOM   2542 O "O5'" . DG  G  2 2  ? -63.576 24.427 3.449   1.00 34.07  ? 2   DG  G "O5'" 1 
ATOM   2543 C "C5'" . DG  G  2 2  ? -63.487 25.800 3.051   1.00 35.85  ? 2   DG  G "C5'" 1 
ATOM   2544 C "C4'" . DG  G  2 2  ? -62.048 26.249 2.965   1.00 36.85  ? 2   DG  G "C4'" 1 
ATOM   2545 O "O4'" . DG  G  2 2  ? -61.504 26.531 4.287   1.00 34.55  ? 2   DG  G "O4'" 1 
ATOM   2546 C "C3'" . DG  G  2 2  ? -61.106 25.228 2.346   1.00 35.93  ? 2   DG  G "C3'" 1 
ATOM   2547 O "O3'" . DG  G  2 2  ? -60.105 25.983 1.671   1.00 40.15  ? 2   DG  G "O3'" 1 
ATOM   2548 C "C2'" . DG  G  2 2  ? -60.550 24.495 3.547   1.00 34.23  ? 2   DG  G "C2'" 1 
ATOM   2549 C "C1'" . DG  G  2 2  ? -60.525 25.553 4.645   1.00 33.32  ? 2   DG  G "C1'" 1 
ATOM   2550 N N9    . DG  G  2 2  ? -60.856 25.115 5.998   1.00 31.96  ? 2   DG  G N9    1 
ATOM   2551 C C8    . DG  G  2 2  ? -61.930 24.341 6.366   1.00 32.69  ? 2   DG  G C8    1 
ATOM   2552 N N7    . DG  G  2 2  ? -62.064 24.231 7.661   1.00 31.35  ? 2   DG  G N7    1 
ATOM   2553 C C5    . DG  G  2 2  ? -61.069 25.048 8.176   1.00 29.96  ? 2   DG  G C5    1 
ATOM   2554 C C6    . DG  G  2 2  ? -60.716 25.315 9.517   1.00 29.29  ? 2   DG  G C6    1 
ATOM   2555 O O6    . DG  G  2 2  ? -61.237 24.883 10.543  1.00 31.40  ? 2   DG  G O6    1 
ATOM   2556 N N1    . DG  G  2 2  ? -59.608 26.139 9.603   1.00 29.06  ? 2   DG  G N1    1 
ATOM   2557 C C2    . DG  G  2 2  ? -58.926 26.664 8.527   1.00 30.26  ? 2   DG  G C2    1 
ATOM   2558 N N2    . DG  G  2 2  ? -57.872 27.443 8.824   1.00 30.08  ? 2   DG  G N2    1 
ATOM   2559 N N3    . DG  G  2 2  ? -59.247 26.428 7.260   1.00 28.66  ? 2   DG  G N3    1 
ATOM   2560 C C4    . DG  G  2 2  ? -60.321 25.611 7.162   1.00 30.28  ? 2   DG  G C4    1 
ATOM   2561 P P     . DG  G  2 3  ? -59.028 25.230 0.743   1.00 39.74  ? 3   DG  G P     1 
ATOM   2562 O OP1   . DG  G  2 3  ? -58.479 26.263 -0.148  1.00 39.86  ? 3   DG  G OP1   1 
ATOM   2563 O OP2   . DG  G  2 3  ? -59.624 23.974 0.266   1.00 38.46  ? 3   DG  G OP2   1 
ATOM   2564 O "O5'" . DG  G  2 3  ? -57.896 24.834 1.772   1.00 37.06  ? 3   DG  G "O5'" 1 
ATOM   2565 C "C5'" . DG  G  2 3  ? -56.988 25.884 2.220   1.00 36.82  ? 3   DG  G "C5'" 1 
ATOM   2566 C "C4'" . DG  G  2 3  ? -56.015 25.284 3.200   1.00 34.39  ? 3   DG  G "C4'" 1 
ATOM   2567 O "O4'" . DG  G  2 3  ? -56.761 24.913 4.379   1.00 32.07  ? 3   DG  G "O4'" 1 
ATOM   2568 C "C3'" . DG  G  2 3  ? -55.379 23.985 2.694   1.00 34.63  ? 3   DG  G "C3'" 1 
ATOM   2569 O "O3'" . DG  G  2 3  ? -54.016 23.953 3.121   1.00 36.18  ? 3   DG  G "O3'" 1 
ATOM   2570 C "C2'" . DG  G  2 3  ? -56.163 22.899 3.411   1.00 31.95  ? 3   DG  G "C2'" 1 
ATOM   2571 C "C1'" . DG  G  2 3  ? -56.416 23.597 4.721   1.00 31.37  ? 3   DG  G "C1'" 1 
ATOM   2572 N N9    . DG  G  2 3  ? -57.457 23.065 5.583   1.00 31.06  ? 3   DG  G N9    1 
ATOM   2573 C C8    . DG  G  2 3  ? -58.514 22.247 5.251   1.00 30.04  ? 3   DG  G C8    1 
ATOM   2574 N N7    . DG  G  2 3  ? -59.217 21.878 6.287   1.00 29.37  ? 3   DG  G N7    1 
ATOM   2575 C C5    . DG  G  2 3  ? -58.585 22.485 7.365   1.00 29.11  ? 3   DG  G C5    1 
ATOM   2576 C C6    . DG  G  2 3  ? -58.898 22.465 8.743   1.00 29.10  ? 3   DG  G C6    1 
ATOM   2577 O O6    . DG  G  2 3  ? -59.816 21.887 9.307   1.00 29.62  ? 3   DG  G O6    1 
ATOM   2578 N N1    . DG  G  2 3  ? -57.961 23.159 9.492   1.00 28.95  ? 3   DG  G N1    1 
ATOM   2579 C C2    . DG  G  2 3  ? -56.865 23.800 8.983   1.00 29.74  ? 3   DG  G C2    1 
ATOM   2580 N N2    . DG  G  2 3  ? -56.082 24.428 9.872   1.00 31.06  ? 3   DG  G N2    1 
ATOM   2581 N N3    . DG  G  2 3  ? -56.588 23.873 7.695   1.00 30.39  ? 3   DG  G N3    1 
ATOM   2582 C C4    . DG  G  2 3  ? -57.482 23.195 6.949   1.00 29.89  ? 3   DG  G C4    1 
ATOM   2583 P P     . DA  G  2 4  ? -52.840 23.699 2.065   1.00 37.32  ? 4   DA  G P     1 
ATOM   2584 O OP1   . DA  G  2 4  ? -53.010 24.603 0.967   1.00 37.88  ? 4   DA  G OP1   1 
ATOM   2585 O OP2   . DA  G  2 4  ? -52.770 22.222 1.856   1.00 37.84  ? 4   DA  G OP2   1 
ATOM   2586 O "O5'" . DA  G  2 4  ? -51.558 24.145 2.906   1.00 39.84  ? 4   DA  G "O5'" 1 
ATOM   2587 C "C5'" . DA  G  2 4  ? -51.536 25.411 3.612   1.00 40.07  ? 4   DA  G "C5'" 1 
ATOM   2588 C "C4'" . DA  G  2 4  ? -50.905 25.272 4.976   1.00 39.71  ? 4   DA  G "C4'" 1 
ATOM   2589 O "O4'" . DA  G  2 4  ? -51.815 24.621 5.892   1.00 36.97  ? 4   DA  G "O4'" 1 
ATOM   2590 C "C3'" . DA  G  2 4  ? -49.629 24.429 4.990   1.00 41.57  ? 4   DA  G "C3'" 1 
ATOM   2591 O "O3'" . DA  G  2 4  ? -48.761 25.015 5.969   1.00 43.33  ? 4   DA  G "O3'" 1 
ATOM   2592 C "C2'" . DA  G  2 4  ? -50.144 23.035 5.324   1.00 39.41  ? 4   DA  G "C2'" 1 
ATOM   2593 C "C1'" . DA  G  2 4  ? -51.327 23.335 6.260   1.00 36.51  ? 4   DA  G "C1'" 1 
ATOM   2594 N N9    . DA  G  2 4  ? -52.455 22.403 6.215   1.00 35.09  ? 4   DA  G N9    1 
ATOM   2595 C C8    . DA  G  2 4  ? -52.964 21.710 5.145   1.00 33.72  ? 4   DA  G C8    1 
ATOM   2596 N N7    . DA  G  2 4  ? -53.999 20.960 5.444   1.00 33.88  ? 4   DA  G N7    1 
ATOM   2597 C C5    . DA  G  2 4  ? -54.205 21.199 6.795   1.00 32.75  ? 4   DA  G C5    1 
ATOM   2598 C C6    . DA  G  2 4  ? -55.174 20.734 7.704   1.00 32.65  ? 4   DA  G C6    1 
ATOM   2599 N N6    . DA  G  2 4  ? -56.141 19.878 7.383   1.00 30.27  ? 4   DA  G N6    1 
ATOM   2600 N N1    . DA  G  2 4  ? -55.043 21.098 8.998   1.00 34.42  ? 4   DA  G N1    1 
ATOM   2601 C C2    . DA  G  2 4  ? -54.076 21.965 9.324   1.00 34.62  ? 4   DA  G C2    1 
ATOM   2602 N N3    . DA  G  2 4  ? -53.139 22.509 8.550   1.00 35.33  ? 4   DA  G N3    1 
ATOM   2603 C C4    . DA  G  2 4  ? -53.243 22.060 7.290   1.00 34.84  ? 4   DA  G C4    1 
ATOM   2604 P P     . DG  G  2 5  ? -47.389 24.303 6.386   1.00 47.49  ? 5   DG  G P     1 
ATOM   2605 O OP1   . DG  G  2 5  ? -46.476 25.344 6.865   1.00 46.78  ? 5   DG  G OP1   1 
ATOM   2606 O OP2   . DG  G  2 5  ? -47.026 23.250 5.356   1.00 45.53  ? 5   DG  G OP2   1 
ATOM   2607 O "O5'" . DG  G  2 5  ? -47.825 23.387 7.615   1.00 45.34  ? 5   DG  G "O5'" 1 
ATOM   2608 C "C5'" . DG  G  2 5  ? -48.160 23.953 8.909   1.00 41.98  ? 5   DG  G "C5'" 1 
ATOM   2609 C "C4'" . DG  G  2 5  ? -48.420 22.817 9.870   1.00 39.32  ? 5   DG  G "C4'" 1 
ATOM   2610 O "O4'" . DG  G  2 5  ? -49.578 22.108 9.375   1.00 33.56  ? 5   DG  G "O4'" 1 
ATOM   2611 C "C3'" . DG  G  2 5  ? -47.283 21.780 9.959   1.00 39.03  ? 5   DG  G "C3'" 1 
ATOM   2612 O "O3'" . DG  G  2 5  ? -46.830 21.625 11.310  1.00 41.88  ? 5   DG  G "O3'" 1 
ATOM   2613 C "C2'" . DG  G  2 5  ? -47.881 20.523 9.345   1.00 35.59  ? 5   DG  G "C2'" 1 
ATOM   2614 C "C1'" . DG  G  2 5  ? -49.367 20.724 9.560   1.00 33.06  ? 5   DG  G "C1'" 1 
ATOM   2615 N N9    . DG  G  2 5  ? -50.264 20.008 8.662   1.00 30.65  ? 5   DG  G N9    1 
ATOM   2616 C C8    . DG  G  2 5  ? -50.175 19.918 7.292   1.00 28.71  ? 5   DG  G C8    1 
ATOM   2617 N N7    . DG  G  2 5  ? -51.148 19.229 6.761   1.00 26.98  ? 5   DG  G N7    1 
ATOM   2618 C C5    . DG  G  2 5  ? -51.946 18.866 7.837   1.00 27.21  ? 5   DG  G C5    1 
ATOM   2619 C C6    . DG  G  2 5  ? -53.147 18.100 7.882   1.00 28.05  ? 5   DG  G C6    1 
ATOM   2620 O O6    . DG  G  2 5  ? -53.790 17.606 6.940   1.00 28.28  ? 5   DG  G O6    1 
ATOM   2621 N N1    . DG  G  2 5  ? -53.633 17.983 9.182   1.00 27.62  ? 5   DG  G N1    1 
ATOM   2622 C C2    . DG  G  2 5  ? -53.028 18.500 10.298  1.00 29.12  ? 5   DG  G C2    1 
ATOM   2623 N N2    . DG  G  2 5  ? -53.647 18.265 11.465  1.00 29.97  ? 5   DG  G N2    1 
ATOM   2624 N N3    . DG  G  2 5  ? -51.902 19.206 10.274  1.00 29.56  ? 5   DG  G N3    1 
ATOM   2625 C C4    . DG  G  2 5  ? -51.415 19.339 9.020   1.00 29.94  ? 5   DG  G C4    1 
ATOM   2626 P P     . DT  G  2 6  ? -45.773 20.493 11.736  1.00 44.53  ? 6   DT  G P     1 
ATOM   2627 O OP1   . DT  G  2 6  ? -44.944 21.047 12.832  1.00 48.86  ? 6   DT  G OP1   1 
ATOM   2628 O OP2   . DT  G  2 6  ? -45.110 19.954 10.539  1.00 49.32  ? 6   DT  G OP2   1 
ATOM   2629 O "O5'" . DT  G  2 6  ? -46.707 19.333 12.298  1.00 43.24  ? 6   DT  G "O5'" 1 
ATOM   2630 C "C5'" . DT  G  2 6  ? -47.537 19.681 13.435  1.00 42.84  ? 6   DT  G "C5'" 1 
ATOM   2631 C "C4'" . DT  G  2 6  ? -48.366 18.517 13.912  1.00 40.51  ? 6   DT  G "C4'" 1 
ATOM   2632 O "O4'" . DT  G  2 6  ? -49.319 18.198 12.886  1.00 37.19  ? 6   DT  G "O4'" 1 
ATOM   2633 C "C3'" . DT  G  2 6  ? -47.636 17.215 14.246  1.00 41.92  ? 6   DT  G "C3'" 1 
ATOM   2634 O "O3'" . DT  G  2 6  ? -48.159 16.689 15.489  1.00 44.12  ? 6   DT  G "O3'" 1 
ATOM   2635 C "C2'" . DT  G  2 6  ? -47.957 16.338 13.058  1.00 38.95  ? 6   DT  G "C2'" 1 
ATOM   2636 C "C1'" . DT  G  2 6  ? -49.350 16.803 12.690  1.00 36.48  ? 6   DT  G "C1'" 1 
ATOM   2637 N N1    . DT  G  2 6  ? -49.703 16.538 11.269  1.00 34.98  ? 6   DT  G N1    1 
ATOM   2638 C C2    . DT  G  2 6  ? -50.888 15.893 10.987  1.00 34.00  ? 6   DT  G C2    1 
ATOM   2639 O O2    . DT  G  2 6  ? -51.653 15.510 11.849  1.00 37.25  ? 6   DT  G O2    1 
ATOM   2640 N N3    . DT  G  2 6  ? -51.078 15.597 9.658   1.00 32.38  ? 6   DT  G N3    1 
ATOM   2641 C C4    . DT  G  2 6  ? -50.256 15.942 8.605   1.00 32.04  ? 6   DT  G C4    1 
ATOM   2642 O O4    . DT  G  2 6  ? -50.588 15.674 7.463   1.00 31.99  ? 6   DT  G O4    1 
ATOM   2643 C C5    . DT  G  2 6  ? -49.064 16.665 8.964   1.00 33.92  ? 6   DT  G C5    1 
ATOM   2644 C C7    . DT  G  2 6  ? -48.137 17.115 7.880   1.00 35.00  ? 6   DT  G C7    1 
ATOM   2645 C C6    . DT  G  2 6  ? -48.835 16.902 10.263  1.00 34.21  ? 6   DT  G C6    1 
ATOM   2646 P P     . DG  G  2 7  ? -47.821 15.205 16.032  1.00 45.88  ? 7   DG  G P     1 
ATOM   2647 O OP1   . DG  G  2 7  ? -47.628 15.346 17.522  1.00 50.69  ? 7   DG  G OP1   1 
ATOM   2648 O OP2   . DG  G  2 7  ? -46.734 14.563 15.235  1.00 45.87  ? 7   DG  G OP2   1 
ATOM   2649 O "O5'" . DG  G  2 7  ? -49.181 14.408 15.743  1.00 45.32  ? 7   DG  G "O5'" 1 
ATOM   2650 C "C5'" . DG  G  2 7  ? -50.454 14.994 16.136  1.00 45.50  ? 7   DG  G "C5'" 1 
ATOM   2651 C "C4'" . DG  G  2 7  ? -51.604 14.016 16.045  1.00 44.90  ? 7   DG  G "C4'" 1 
ATOM   2652 O "O4'" . DG  G  2 7  ? -51.917 13.767 14.655  1.00 41.62  ? 7   DG  G "O4'" 1 
ATOM   2653 C "C3'" . DG  G  2 7  ? -51.404 12.634 16.674  1.00 46.27  ? 7   DG  G "C3'" 1 
ATOM   2654 O "O3'" . DG  G  2 7  ? -52.710 12.189 17.097  1.00 48.42  ? 7   DG  G "O3'" 1 
ATOM   2655 C "C2'" . DG  G  2 7  ? -50.845 11.825 15.514  1.00 43.98  ? 7   DG  G "C2'" 1 
ATOM   2656 C "C1'" . DG  G  2 7  ? -51.572 12.413 14.303  1.00 40.82  ? 7   DG  G "C1'" 1 
ATOM   2657 N N9    . DG  G  2 7  ? -50.874 12.466 13.012  1.00 37.85  ? 7   DG  G N9    1 
ATOM   2658 C C8    . DG  G  2 7  ? -49.716 13.156 12.745  1.00 37.57  ? 7   DG  G C8    1 
ATOM   2659 N N7    . DG  G  2 7  ? -49.391 13.142 11.481  1.00 36.16  ? 7   DG  G N7    1 
ATOM   2660 C C5    . DG  G  2 7  ? -50.417 12.439 10.869  1.00 34.04  ? 7   DG  G C5    1 
ATOM   2661 C C6    . DG  G  2 7  ? -50.609 12.096 9.506   1.00 31.47  ? 7   DG  G C6    1 
ATOM   2662 O O6    . DG  G  2 7  ? -49.913 12.394 8.540   1.00 31.48  ? 7   DG  G O6    1 
ATOM   2663 N N1    . DG  G  2 7  ? -51.785 11.379 9.317   1.00 31.45  ? 7   DG  G N1    1 
ATOM   2664 C C2    . DG  G  2 7  ? -52.664 11.029 10.318  1.00 32.34  ? 7   DG  G C2    1 
ATOM   2665 N N2    . DG  G  2 7  ? -53.742 10.327 9.947   1.00 31.15  ? 7   DG  G N2    1 
ATOM   2666 N N3    . DG  G  2 7  ? -52.456 11.279 11.601  1.00 34.35  ? 7   DG  G N3    1 
ATOM   2667 C C4    . DG  G  2 7  ? -51.346 12.021 11.798  1.00 34.37  ? 7   DG  G C4    1 
ATOM   2668 P P     . DT  G  2 8  ? -52.985 10.842 17.997  1.00 52.77  ? 8   DT  G P     1 
ATOM   2669 O OP1   . DT  G  2 8  ? -54.210 11.105 18.787  1.00 57.65  ? 8   DT  G OP1   1 
ATOM   2670 O OP2   . DT  G  2 8  ? -51.718 10.350 18.644  1.00 52.22  ? 8   DT  G OP2   1 
ATOM   2671 O "O5'" . DT  G  2 8  ? -53.307 9.700  16.933  1.00 52.81  ? 8   DT  G "O5'" 1 
ATOM   2672 C "C5'" . DT  G  2 8  ? -54.283 9.876  15.878  1.00 52.19  ? 8   DT  G "C5'" 1 
ATOM   2673 C "C4'" . DT  G  2 8  ? -54.339 8.664  14.965  1.00 51.62  ? 8   DT  G "C4'" 1 
ATOM   2674 O "O4'" . DT  G  2 8  ? -53.503 8.846  13.795  1.00 49.01  ? 8   DT  G "O4'" 1 
ATOM   2675 C "C3'" . DT  G  2 8  ? -53.918 7.323  15.577  1.00 54.42  ? 8   DT  G "C3'" 1 
ATOM   2676 O "O3'" . DT  G  2 8  ? -54.985 6.395  15.343  1.00 57.30  ? 8   DT  G "O3'" 1 
ATOM   2677 C "C2'" . DT  G  2 8  ? -52.615 6.967  14.862  1.00 51.65  ? 8   DT  G "C2'" 1 
ATOM   2678 C "C1'" . DT  G  2 8  ? -52.806 7.633  13.501  1.00 48.17  ? 8   DT  G "C1'" 1 
ATOM   2679 N N1    . DT  G  2 8  ? -51.613 8.000  12.683  1.00 43.67  ? 8   DT  G N1    1 
ATOM   2680 C C2    . DT  G  2 8  ? -51.683 7.812  11.315  1.00 40.08  ? 8   DT  G C2    1 
ATOM   2681 O O2    . DT  G  2 8  ? -52.591 7.210  10.769  1.00 40.75  ? 8   DT  G O2    1 
ATOM   2682 N N3    . DT  G  2 8  ? -50.599 8.281  10.614  1.00 37.04  ? 8   DT  G N3    1 
ATOM   2683 C C4    . DT  G  2 8  ? -49.497 8.935  11.122  1.00 38.25  ? 8   DT  G C4    1 
ATOM   2684 O O4    . DT  G  2 8  ? -48.607 9.312  10.364  1.00 39.24  ? 8   DT  G O4    1 
ATOM   2685 C C5    . DT  G  2 8  ? -49.488 9.112  12.561  1.00 39.52  ? 8   DT  G C5    1 
ATOM   2686 C C7    . DT  G  2 8  ? -48.321 9.797  13.198  1.00 38.22  ? 8   DT  G C7    1 
ATOM   2687 C C6    . DT  G  2 8  ? -50.546 8.667  13.258  1.00 42.22  ? 8   DT  G C6    1 
ATOM   2688 P P     . DG  G  2 9  ? -55.076 5.036  16.195  1.00 61.49  ? 9   DG  G P     1 
ATOM   2689 O OP1   . DG  G  2 9  ? -56.428 4.965  16.788  1.00 64.67  ? 9   DG  G OP1   1 
ATOM   2690 O OP2   . DG  G  2 9  ? -53.845 4.890  17.022  1.00 61.77  ? 9   DG  G OP2   1 
ATOM   2691 O "O5'" . DG  G  2 9  ? -54.948 3.889  15.105  1.00 61.56  ? 9   DG  G "O5'" 1 
ATOM   2692 C "C5'" . DG  G  2 9  ? -55.764 3.840  13.920  1.00 59.02  ? 9   DG  G "C5'" 1 
ATOM   2693 C "C4'" . DG  G  2 9  ? -55.114 2.894  12.938  1.00 57.70  ? 9   DG  G "C4'" 1 
ATOM   2694 O "O4'" . DG  G  2 9  ? -54.021 3.585  12.289  1.00 52.07  ? 9   DG  G "O4'" 1 
ATOM   2695 C "C3'" . DG  G  2 9  ? -54.493 1.646  13.583  1.00 58.78  ? 9   DG  G "C3'" 1 
ATOM   2696 O "O3'" . DG  G  2 9  ? -54.563 0.536  12.687  1.00 61.93  ? 9   DG  G "O3'" 1 
ATOM   2697 C "C2'" . DG  G  2 9  ? -53.034 2.031  13.720  1.00 55.24  ? 9   DG  G "C2'" 1 
ATOM   2698 C "C1'" . DG  G  2 9  ? -52.870 2.775  12.418  1.00 51.30  ? 9   DG  G "C1'" 1 
ATOM   2699 N N9    . DG  G  2 9  ? -51.701 3.625  12.268  1.00 46.75  ? 9   DG  G N9    1 
ATOM   2700 C C8    . DG  G  2 9  ? -50.867 4.142  13.232  1.00 46.58  ? 9   DG  G C8    1 
ATOM   2701 N N7    . DG  G  2 9  ? -49.887 4.845  12.732  1.00 43.87  ? 9   DG  G N7    1 
ATOM   2702 C C5    . DG  G  2 9  ? -50.049 4.726  11.360  1.00 39.37  ? 9   DG  G C5    1 
ATOM   2703 C C6    . DG  G  2 9  ? -49.269 5.231  10.303  1.00 37.00  ? 9   DG  G C6    1 
ATOM   2704 O O6    . DG  G  2 9  ? -48.245 5.913  10.367  1.00 37.31  ? 9   DG  G O6    1 
ATOM   2705 N N1    . DG  G  2 9  ? -49.770 4.844  9.065   1.00 35.42  ? 9   DG  G N1    1 
ATOM   2706 C C2    . DG  G  2 9  ? -50.888 4.070  8.872   1.00 36.47  ? 9   DG  G C2    1 
ATOM   2707 N N2    . DG  G  2 9  ? -51.230 3.808  7.598   1.00 35.53  ? 9   DG  G N2    1 
ATOM   2708 N N3    . DG  G  2 9  ? -51.623 3.590  9.856   1.00 37.79  ? 9   DG  G N3    1 
ATOM   2709 C C4    . DG  G  2 9  ? -51.162 3.973  11.061  1.00 40.58  ? 9   DG  G C4    1 
ATOM   2710 P P     . DG  G  2 10 ? -55.454 -0.773 13.025  1.00 66.71  ? 10  DG  G P     1 
ATOM   2711 O OP1   . DG  G  2 10 ? -56.805 -0.319 13.415  1.00 67.75  ? 10  DG  G OP1   1 
ATOM   2712 O OP2   . DG  G  2 10 ? -54.676 -1.656 13.932  1.00 67.44  ? 10  DG  G OP2   1 
ATOM   2713 O "O5'" . DG  G  2 10 ? -55.552 -1.461 11.584  1.00 65.19  ? 10  DG  G "O5'" 1 
ATOM   2714 C "C5'" . DG  G  2 10 ? -55.974 -0.680 10.424  1.00 60.97  ? 10  DG  G "C5'" 1 
ATOM   2715 C "C4'" . DG  G  2 10 ? -55.223 -1.068 9.168   1.00 57.42  ? 10  DG  G "C4'" 1 
ATOM   2716 O "O4'" . DG  G  2 10 ? -53.957 -0.366 9.092   1.00 53.78  ? 10  DG  G "O4'" 1 
ATOM   2717 C "C3'" . DG  G  2 10 ? -54.890 -2.556 9.013   1.00 59.40  ? 10  DG  G "C3'" 1 
ATOM   2718 O "O3'" . DG  G  2 10 ? -55.098 -2.940 7.637   1.00 57.01  ? 10  DG  G "O3'" 1 
ATOM   2719 C "C2'" . DG  G  2 10 ? -53.469 -2.645 9.558   1.00 57.71  ? 10  DG  G "C2'" 1 
ATOM   2720 C "C1'" . DG  G  2 10 ? -52.868 -1.285 9.179   1.00 54.27  ? 10  DG  G "C1'" 1 
ATOM   2721 N N9    . DG  G  2 10 ? -51.879 -0.720 10.101  1.00 52.80  ? 10  DG  G N9    1 
ATOM   2722 C C8    . DG  G  2 10 ? -51.873 -0.799 11.474  1.00 54.57  ? 10  DG  G C8    1 
ATOM   2723 N N7    . DG  G  2 10 ? -50.870 -0.163 12.019  1.00 53.74  ? 10  DG  G N7    1 
ATOM   2724 C C5    . DG  G  2 10 ? -50.182 0.382  10.942  1.00 49.81  ? 10  DG  G C5    1 
ATOM   2725 C C6    . DG  G  2 10 ? -49.012 1.189  10.909  1.00 46.73  ? 10  DG  G C6    1 
ATOM   2726 O O6    . DG  G  2 10 ? -48.331 1.600  11.854  1.00 44.94  ? 10  DG  G O6    1 
ATOM   2727 N N1    . DG  G  2 10 ? -48.662 1.527  9.608   1.00 43.57  ? 10  DG  G N1    1 
ATOM   2728 C C2    . DG  G  2 10 ? -49.330 1.124  8.483   1.00 43.89  ? 10  DG  G C2    1 
ATOM   2729 N N2    . DG  G  2 10 ? -48.829 1.548  7.318   1.00 43.23  ? 10  DG  G N2    1 
ATOM   2730 N N3    . DG  G  2 10 ? -50.426 0.383  8.497   1.00 45.76  ? 10  DG  G N3    1 
ATOM   2731 C C4    . DG  G  2 10 ? -50.787 0.043  9.751   1.00 48.77  ? 10  DG  G C4    1 
ATOM   2732 P P     . DG  G  2 11 ? -54.845 -4.437 7.166   1.00 60.40  ? 11  DG  G P     1 
ATOM   2733 O OP1   . DG  G  2 11 ? -55.922 -4.814 6.215   1.00 63.63  ? 11  DG  G OP1   1 
ATOM   2734 O OP2   . DG  G  2 11 ? -54.558 -5.287 8.361   1.00 61.56  ? 11  DG  G OP2   1 
ATOM   2735 O "O5'" . DG  G  2 11 ? -53.541 -4.335 6.257   1.00 55.97  ? 11  DG  G "O5'" 1 
ATOM   2736 C "C5'" . DG  G  2 11 ? -53.222 -3.131 5.500   1.00 49.85  ? 11  DG  G "C5'" 1 
ATOM   2737 C "C4'" . DG  G  2 11 ? -51.841 -3.244 4.892   1.00 47.08  ? 11  DG  G "C4'" 1 
ATOM   2738 O "O4'" . DG  G  2 11 ? -50.868 -2.706 5.815   1.00 43.83  ? 11  DG  G "O4'" 1 
ATOM   2739 C "C3'" . DG  G  2 11 ? -51.371 -4.668 4.573   1.00 48.01  ? 11  DG  G "C3'" 1 
ATOM   2740 O "O3'" . DG  G  2 11 ? -50.693 -4.661 3.319   1.00 47.67  ? 11  DG  G "O3'" 1 
ATOM   2741 C "C2'" . DG  G  2 11 ? -50.492 -5.029 5.762   1.00 47.10  ? 11  DG  G "C2'" 1 
ATOM   2742 C "C1'" . DG  G  2 11 ? -49.895 -3.681 6.132   1.00 44.51  ? 11  DG  G "C1'" 1 
ATOM   2743 N N9    . DG  G  2 11 ? -49.528 -3.472 7.526   1.00 45.39  ? 11  DG  G N9    1 
ATOM   2744 C C8    . DG  G  2 11 ? -50.148 -3.956 8.655   1.00 46.93  ? 11  DG  G C8    1 
ATOM   2745 N N7    . DG  G  2 11 ? -49.622 -3.500 9.760   1.00 46.62  ? 11  DG  G N7    1 
ATOM   2746 C C5    . DG  G  2 11 ? -48.618 -2.642 9.334   1.00 43.70  ? 11  DG  G C5    1 
ATOM   2747 C C6    . DG  G  2 11 ? -47.680 -1.883 10.076  1.00 43.49  ? 11  DG  G C6    1 
ATOM   2748 O O6    . DG  G  2 11 ? -47.559 -1.795 11.301  1.00 45.48  ? 11  DG  G O6    1 
ATOM   2749 N N1    . DG  G  2 11 ? -46.836 -1.157 9.243   1.00 41.48  ? 11  DG  G N1    1 
ATOM   2750 C C2    . DG  G  2 11 ? -46.853 -1.201 7.872   1.00 40.83  ? 11  DG  G C2    1 
ATOM   2751 N N2    . DG  G  2 11 ? -45.945 -0.442 7.241   1.00 40.92  ? 11  DG  G N2    1 
ATOM   2752 N N3    . DG  G  2 11 ? -47.733 -1.887 7.169   1.00 40.89  ? 11  DG  G N3    1 
ATOM   2753 C C4    . DG  G  2 11 ? -48.560 -2.601 7.958   1.00 43.02  ? 11  DG  G C4    1 
ATOM   2754 P P     . DC  G  2 12 ? -50.191 -6.025 2.677   1.00 52.35  ? 12  DC  G P     1 
ATOM   2755 O OP1   . DC  G  2 12 ? -50.158 -5.811 1.216   1.00 56.93  ? 12  DC  G OP1   1 
ATOM   2756 O OP2   . DC  G  2 12 ? -50.953 -7.158 3.263   1.00 55.44  ? 12  DC  G OP2   1 
ATOM   2757 O "O5'" . DC  G  2 12 ? -48.653 -6.102 3.078   1.00 52.27  ? 12  DC  G "O5'" 1 
ATOM   2758 C "C5'" . DC  G  2 12 ? -47.828 -5.009 2.643   1.00 50.08  ? 12  DC  G "C5'" 1 
ATOM   2759 C "C4'" . DC  G  2 12 ? -46.603 -4.895 3.509   1.00 49.72  ? 12  DC  G "C4'" 1 
ATOM   2760 O "O4'" . DC  G  2 12 ? -46.948 -4.584 4.868   1.00 48.54  ? 12  DC  G "O4'" 1 
ATOM   2761 C "C3'" . DC  G  2 12 ? -45.815 -6.174 3.634   1.00 51.53  ? 12  DC  G "C3'" 1 
ATOM   2762 O "O3'" . DC  G  2 12 ? -45.110 -6.355 2.400   1.00 55.83  ? 12  DC  G "O3'" 1 
ATOM   2763 C "C2'" . DC  G  2 12 ? -45.038 -5.948 4.928   1.00 49.94  ? 12  DC  G "C2'" 1 
ATOM   2764 C "C1'" . DC  G  2 12 ? -45.782 -4.798 5.628   1.00 47.53  ? 12  DC  G "C1'" 1 
ATOM   2765 N N1    . DC  G  2 12 ? -46.179 -5.013 7.048   1.00 46.81  ? 12  DC  G N1    1 
ATOM   2766 C C2    . DC  G  2 12 ? -45.462 -4.360 8.059   1.00 44.55  ? 12  DC  G C2    1 
ATOM   2767 O O2    . DC  G  2 12 ? -44.529 -3.619 7.744   1.00 42.70  ? 12  DC  G O2    1 
ATOM   2768 N N3    . DC  G  2 12 ? -45.814 -4.549 9.350   1.00 45.18  ? 12  DC  G N3    1 
ATOM   2769 C C4    . DC  G  2 12 ? -46.804 -5.392 9.655   1.00 47.02  ? 12  DC  G C4    1 
ATOM   2770 N N4    . DC  G  2 12 ? -47.103 -5.567 10.939  1.00 48.84  ? 12  DC  G N4    1 
ATOM   2771 C C5    . DC  G  2 12 ? -47.544 -6.077 8.650   1.00 48.49  ? 12  DC  G C5    1 
ATOM   2772 C C6    . DC  G  2 12 ? -47.193 -5.871 7.372   1.00 47.63  ? 12  DC  G C6    1 
ATOM   2773 O "O5'" . DG  H  3 1  ? -38.378 -2.580 16.680  1.00 69.36  ? 1   DG  H "O5'" 1 
ATOM   2774 C "C5'" . DG  H  3 1  ? -38.669 -1.170 16.650  1.00 64.65  ? 1   DG  H "C5'" 1 
ATOM   2775 C "C4'" . DG  H  3 1  ? -38.525 -0.650 15.239  1.00 62.65  ? 1   DG  H "C4'" 1 
ATOM   2776 O "O4'" . DG  H  3 1  ? -39.304 -1.472 14.327  1.00 59.09  ? 1   DG  H "O4'" 1 
ATOM   2777 C "C3'" . DG  H  3 1  ? -39.010 0.786  15.023  1.00 60.23  ? 1   DG  H "C3'" 1 
ATOM   2778 O "O3'" . DG  H  3 1  ? -38.124 1.408  14.081  1.00 63.23  ? 1   DG  H "O3'" 1 
ATOM   2779 C "C2'" . DG  H  3 1  ? -40.437 0.591  14.547  1.00 55.55  ? 1   DG  H "C2'" 1 
ATOM   2780 C "C1'" . DG  H  3 1  ? -40.380 -0.724 13.782  1.00 54.41  ? 1   DG  H "C1'" 1 
ATOM   2781 N N9    . DG  H  3 1  ? -41.599 -1.526 13.885  1.00 52.28  ? 1   DG  H N9    1 
ATOM   2782 C C8    . DG  H  3 1  ? -42.277 -1.886 15.026  1.00 53.13  ? 1   DG  H C8    1 
ATOM   2783 N N7    . DG  H  3 1  ? -43.366 -2.565 14.784  1.00 51.82  ? 1   DG  H N7    1 
ATOM   2784 C C5    . DG  H  3 1  ? -43.414 -2.653 13.400  1.00 49.51  ? 1   DG  H C5    1 
ATOM   2785 C C6    . DG  H  3 1  ? -44.356 -3.295 12.549  1.00 47.95  ? 1   DG  H C6    1 
ATOM   2786 O O6    . DG  H  3 1  ? -45.380 -3.926 12.860  1.00 47.55  ? 1   DG  H O6    1 
ATOM   2787 N N1    . DG  H  3 1  ? -43.999 -3.166 11.207  1.00 46.56  ? 1   DG  H N1    1 
ATOM   2788 C C2    . DG  H  3 1  ? -42.885 -2.502 10.743  1.00 46.37  ? 1   DG  H C2    1 
ATOM   2789 N N2    . DG  H  3 1  ? -42.703 -2.490 9.413   1.00 45.51  ? 1   DG  H N2    1 
ATOM   2790 N N3    . DG  H  3 1  ? -42.005 -1.904 11.525  1.00 47.25  ? 1   DG  H N3    1 
ATOM   2791 C C4    . DG  H  3 1  ? -42.327 -2.019 12.831  1.00 49.63  ? 1   DG  H C4    1 
ATOM   2792 P P     . DC  H  3 2  ? -38.390 2.901  13.481  1.00 63.76  ? 2   DC  H P     1 
ATOM   2793 O OP1   . DC  H  3 2  ? -37.040 3.540  13.327  1.00 66.66  ? 2   DC  H OP1   1 
ATOM   2794 O OP2   . DC  H  3 2  ? -39.499 3.584  14.233  1.00 61.66  ? 2   DC  H OP2   1 
ATOM   2795 O "O5'" . DC  H  3 2  ? -39.027 2.608  12.052  1.00 61.90  ? 2   DC  H "O5'" 1 
ATOM   2796 C "C5'" . DC  H  3 2  ? -38.223 2.013  11.012  1.00 63.99  ? 2   DC  H "C5'" 1 
ATOM   2797 C "C4'" . DC  H  3 2  ? -38.977 2.030  9.702   1.00 61.56  ? 2   DC  H "C4'" 1 
ATOM   2798 O "O4'" . DC  H  3 2  ? -40.184 1.239  9.808   1.00 59.88  ? 2   DC  H "O4'" 1 
ATOM   2799 C "C3'" . DC  H  3 2  ? -39.412 3.415  9.221   1.00 59.43  ? 2   DC  H "C3'" 1 
ATOM   2800 O "O3'" . DC  H  3 2  ? -39.110 3.473  7.826   1.00 61.70  ? 2   DC  H "O3'" 1 
ATOM   2801 C "C2'" . DC  H  3 2  ? -40.901 3.462  9.515   1.00 55.20  ? 2   DC  H "C2'" 1 
ATOM   2802 C "C1'" . DC  H  3 2  ? -41.309 2.002  9.402   1.00 54.20  ? 2   DC  H "C1'" 1 
ATOM   2803 N N1    . DC  H  3 2  ? -42.444 1.561  10.225  1.00 50.24  ? 2   DC  H N1    1 
ATOM   2804 C C2    . DC  H  3 2  ? -43.475 0.844  9.615   1.00 45.98  ? 2   DC  H C2    1 
ATOM   2805 O O2    . DC  H  3 2  ? -43.440 0.675  8.391   1.00 45.73  ? 2   DC  H O2    1 
ATOM   2806 N N3    . DC  H  3 2  ? -44.512 0.410  10.363  1.00 44.06  ? 2   DC  H N3    1 
ATOM   2807 C C4    . DC  H  3 2  ? -44.510 0.606  11.681  1.00 45.28  ? 2   DC  H C4    1 
ATOM   2808 N N4    . DC  H  3 2  ? -45.539 0.131  12.383  1.00 45.66  ? 2   DC  H N4    1 
ATOM   2809 C C5    . DC  H  3 2  ? -43.463 1.320  12.335  1.00 47.33  ? 2   DC  H C5    1 
ATOM   2810 C C6    . DC  H  3 2  ? -42.449 1.760  11.578  1.00 48.98  ? 2   DC  H C6    1 
ATOM   2811 P P     . DC  H  3 3  ? -39.114 4.850  7.056   1.00 63.07  ? 3   DC  H P     1 
ATOM   2812 O OP1   . DC  H  3 3  ? -37.933 4.842  6.165   1.00 65.25  ? 3   DC  H OP1   1 
ATOM   2813 O OP2   . DC  H  3 3  ? -39.352 5.944  8.032   1.00 61.33  ? 3   DC  H OP2   1 
ATOM   2814 O "O5'" . DC  H  3 3  ? -40.442 4.792  6.177   1.00 58.75  ? 3   DC  H "O5'" 1 
ATOM   2815 C "C5'" . DC  H  3 3  ? -40.882 3.581  5.529   1.00 57.34  ? 3   DC  H "C5'" 1 
ATOM   2816 C "C4'" . DC  H  3 3  ? -42.326 3.747  5.137   1.00 55.27  ? 3   DC  H "C4'" 1 
ATOM   2817 O "O4'" . DC  H  3 3  ? -43.193 3.333  6.227   1.00 51.50  ? 3   DC  H "O4'" 1 
ATOM   2818 C "C3'" . DC  H  3 3  ? -42.704 5.203  4.857   1.00 57.07  ? 3   DC  H "C3'" 1 
ATOM   2819 O "O3'" . DC  H  3 3  ? -43.682 5.172  3.836   1.00 60.67  ? 3   DC  H "O3'" 1 
ATOM   2820 C "C2'" . DC  H  3 3  ? -43.406 5.636  6.134   1.00 53.04  ? 3   DC  H "C2'" 1 
ATOM   2821 C "C1'" . DC  H  3 3  ? -44.147 4.350  6.450   1.00 48.96  ? 3   DC  H "C1'" 1 
ATOM   2822 N N1    . DC  H  3 3  ? -44.674 4.177  7.807   1.00 47.16  ? 3   DC  H N1    1 
ATOM   2823 C C2    . DC  H  3 3  ? -45.817 3.389  7.979   1.00 43.50  ? 3   DC  H C2    1 
ATOM   2824 O O2    . DC  H  3 3  ? -46.353 2.885  6.984   1.00 42.05  ? 3   DC  H O2    1 
ATOM   2825 N N3    . DC  H  3 3  ? -46.304 3.196  9.222   1.00 42.26  ? 3   DC  H N3    1 
ATOM   2826 C C4    . DC  H  3 3  ? -45.688 3.737  10.271  1.00 43.89  ? 3   DC  H C4    1 
ATOM   2827 N N4    . DC  H  3 3  ? -46.191 3.495  11.480  1.00 47.20  ? 3   DC  H N4    1 
ATOM   2828 C C5    . DC  H  3 3  ? -44.521 4.539  10.129  1.00 46.08  ? 3   DC  H C5    1 
ATOM   2829 C C6    . DC  H  3 3  ? -44.053 4.735  8.890   1.00 46.68  ? 3   DC  H C6    1 
ATOM   2830 P P     . DC  H  3 4  ? -43.621 6.158  2.620   1.00 61.92  ? 4   DC  H P     1 
ATOM   2831 O OP1   . DC  H  3 4  ? -42.425 5.788  1.827   1.00 60.65  ? 4   DC  H OP1   1 
ATOM   2832 O OP2   . DC  H  3 4  ? -43.811 7.525  3.157   1.00 58.76  ? 4   DC  H OP2   1 
ATOM   2833 O "O5'" . DC  H  3 4  ? -44.918 5.697  1.823   1.00 55.25  ? 4   DC  H "O5'" 1 
ATOM   2834 C "C5'" . DC  H  3 4  ? -45.144 4.290  1.549   1.00 51.32  ? 4   DC  H "C5'" 1 
ATOM   2835 C "C4'" . DC  H  3 4  ? -46.622 3.980  1.636   1.00 48.57  ? 4   DC  H "C4'" 1 
ATOM   2836 O "O4'" . DC  H  3 4  ? -47.080 4.085  3.007   1.00 43.16  ? 4   DC  H "O4'" 1 
ATOM   2837 C "C3'" . DC  H  3 4  ? -47.536 4.905  0.826   1.00 47.56  ? 4   DC  H "C3'" 1 
ATOM   2838 O "O3'" . DC  H  3 4  ? -48.534 4.073  0.234   1.00 47.42  ? 4   DC  H "O3'" 1 
ATOM   2839 C "C2'" . DC  H  3 4  ? -48.039 5.898  1.861   1.00 43.46  ? 4   DC  H "C2'" 1 
ATOM   2840 C "C1'" . DC  H  3 4  ? -48.109 5.044  3.131   1.00 42.15  ? 4   DC  H "C1'" 1 
ATOM   2841 N N1    . DC  H  3 4  ? -47.885 5.700  4.430   1.00 41.99  ? 4   DC  H N1    1 
ATOM   2842 C C2    . DC  H  3 4  ? -48.587 5.227  5.550   1.00 40.63  ? 4   DC  H C2    1 
ATOM   2843 O O2    . DC  H  3 4  ? -49.501 4.405  5.382   1.00 39.12  ? 4   DC  H O2    1 
ATOM   2844 N N3    . DC  H  3 4  ? -48.297 5.735  6.773   1.00 40.12  ? 4   DC  H N3    1 
ATOM   2845 C C4    . DC  H  3 4  ? -47.312 6.629  6.906   1.00 42.09  ? 4   DC  H C4    1 
ATOM   2846 N N4    . DC  H  3 4  ? -47.058 7.113  8.128   1.00 41.32  ? 4   DC  H N4    1 
ATOM   2847 C C5    . DC  H  3 4  ? -46.540 7.072  5.791   1.00 42.28  ? 4   DC  H C5    1 
ATOM   2848 C C6    . DC  H  3 4  ? -46.830 6.553  4.592   1.00 41.46  ? 4   DC  H C6    1 
ATOM   2849 P P     . DA  H  3 5  ? -49.405 4.614  -0.944  1.00 49.74  ? 5   DA  H P     1 
ATOM   2850 O OP1   . DA  H  3 5  ? -49.980 3.458  -1.662  1.00 51.95  ? 5   DA  H OP1   1 
ATOM   2851 O OP2   . DA  H  3 5  ? -48.657 5.675  -1.668  1.00 51.36  ? 5   DA  H OP2   1 
ATOM   2852 O "O5'" . DA  H  3 5  ? -50.573 5.379  -0.196  1.00 46.76  ? 5   DA  H "O5'" 1 
ATOM   2853 C "C5'" . DA  H  3 5  ? -51.722 4.653  0.248   1.00 45.44  ? 5   DA  H "C5'" 1 
ATOM   2854 C "C4'" . DA  H  3 5  ? -52.492 5.496  1.234   1.00 42.41  ? 5   DA  H "C4'" 1 
ATOM   2855 O "O4'" . DA  H  3 5  ? -51.641 5.867  2.341   1.00 37.61  ? 5   DA  H "O4'" 1 
ATOM   2856 C "C3'" . DA  H  3 5  ? -53.043 6.805  0.671   1.00 41.76  ? 5   DA  H "C3'" 1 
ATOM   2857 O "O3'" . DA  H  3 5  ? -54.433 6.572  0.432   1.00 44.53  ? 5   DA  H "O3'" 1 
ATOM   2858 C "C2'" . DA  H  3 5  ? -52.723 7.829  1.749   1.00 38.32  ? 5   DA  H "C2'" 1 
ATOM   2859 C "C1'" . DA  H  3 5  ? -52.211 7.003  2.916   1.00 36.29  ? 5   DA  H "C1'" 1 
ATOM   2860 N N9    . DA  H  3 5  ? -51.201 7.653  3.758   1.00 34.83  ? 5   DA  H N9    1 
ATOM   2861 C C8    . DA  H  3 5  ? -50.132 8.429  3.376   1.00 34.29  ? 5   DA  H C8    1 
ATOM   2862 N N7    . DA  H  3 5  ? -49.478 8.958  4.380   1.00 31.75  ? 5   DA  H N7    1 
ATOM   2863 C C5    . DA  H  3 5  ? -50.168 8.513  5.498   1.00 31.74  ? 5   DA  H C5    1 
ATOM   2864 C C6    . DA  H  3 5  ? -49.950 8.687  6.879   1.00 31.23  ? 5   DA  H C6    1 
ATOM   2865 N N6    . DA  H  3 5  ? -48.942 9.397  7.390   1.00 32.67  ? 5   DA  H N6    1 
ATOM   2866 N N1    . DA  H  3 5  ? -50.800 8.074  7.729   1.00 30.67  ? 5   DA  H N1    1 
ATOM   2867 C C2    . DA  H  3 5  ? -51.825 7.375  7.220   1.00 31.76  ? 5   DA  H C2    1 
ATOM   2868 N N3    . DA  H  3 5  ? -52.119 7.121  5.947   1.00 33.43  ? 5   DA  H N3    1 
ATOM   2869 C C4    . DA  H  3 5  ? -51.234 7.712  5.128   1.00 32.54  ? 5   DA  H C4    1 
HETATM 2870 N N1    . 5CM H  3 6  ? -54.118 10.137 5.038   1.00 35.67  ? 6   5CM H N1    1 
HETATM 2871 C C2    . 5CM H  3 6  ? -53.566 10.210 6.335   1.00 34.74  ? 6   5CM H C2    1 
HETATM 2872 N N3    . 5CM H  3 6  ? -52.396 10.865 6.585   1.00 32.55  ? 6   5CM H N3    1 
HETATM 2873 C C4    . 5CM H  3 6  ? -51.683 11.418 5.563   1.00 31.63  ? 6   5CM H C4    1 
HETATM 2874 C C5    . 5CM H  3 6  ? -52.224 11.297 4.203   1.00 32.98  ? 6   5CM H C5    1 
HETATM 2875 C C5A   . 5CM H  3 6  ? -51.532 11.837 2.988   1.00 33.93  ? 6   5CM H C5A   1 
HETATM 2876 C C6    . 5CM H  3 6  ? -53.424 10.636 4.019   1.00 34.86  ? 6   5CM H C6    1 
HETATM 2877 O O2    . 5CM H  3 6  ? -54.216 9.724  7.263   1.00 36.84  ? 6   5CM H O2    1 
HETATM 2878 N N4    . 5CM H  3 6  ? -50.520 12.036 5.786   1.00 31.06  ? 6   5CM H N4    1 
HETATM 2879 C "C1'" . 5CM H  3 6  ? -55.407 9.487  4.821   1.00 37.24  ? 6   5CM H "C1'" 1 
HETATM 2880 C "C2'" . 5CM H  3 6  ? -56.396 10.371 4.023   1.00 37.83  ? 6   5CM H "C2'" 1 
HETATM 2881 C "C3'" . 5CM H  3 6  ? -57.400 9.341  3.631   1.00 40.56  ? 6   5CM H "C3'" 1 
HETATM 2882 C "C4'" . 5CM H  3 6  ? -56.589 8.020  3.616   1.00 41.07  ? 6   5CM H "C4'" 1 
HETATM 2883 O "O4'" . 5CM H  3 6  ? -55.290 8.285  4.111   1.00 37.23  ? 6   5CM H "O4'" 1 
HETATM 2884 O "O3'" . 5CM H  3 6  ? -58.349 9.097  4.660   1.00 41.92  ? 6   5CM H "O3'" 1 
HETATM 2885 C "C5'" . 5CM H  3 6  ? -56.521 7.293  2.264   1.00 44.19  ? 6   5CM H "C5'" 1 
HETATM 2886 O "O5'" . 5CM H  3 6  ? -56.048 8.220  1.327   1.00 44.12  ? 6   5CM H "O5'" 1 
HETATM 2887 P P     . 5CM H  3 6  ? -55.412 7.724  -0.041  1.00 44.78  ? 6   5CM H P     1 
HETATM 2888 O OP1   . 5CM H  3 6  ? -56.494 7.101  -0.851  1.00 51.23  ? 6   5CM H OP1   1 
HETATM 2889 O OP2   . 5CM H  3 6  ? -54.603 8.857  -0.584  1.00 45.05  ? 6   5CM H OP2   1 
ATOM   2890 P P     . DA  H  3 7  ? -59.629 10.016 4.867   1.00 42.60  ? 7   DA  H P     1 
ATOM   2891 O OP1   . DA  H  3 7  ? -60.802 9.199  4.562   1.00 46.97  ? 7   DA  H OP1   1 
ATOM   2892 O OP2   . DA  H  3 7  ? -59.426 11.310 4.217   1.00 44.88  ? 7   DA  H OP2   1 
ATOM   2893 O "O5'" . DA  H  3 7  ? -59.582 10.277 6.436   1.00 43.54  ? 7   DA  H "O5'" 1 
ATOM   2894 C "C5'" . DA  H  3 7  ? -59.181 9.232  7.359   1.00 44.20  ? 7   DA  H "C5'" 1 
ATOM   2895 C "C4'" . DA  H  3 7  ? -59.149 9.733  8.787   1.00 43.68  ? 7   DA  H "C4'" 1 
ATOM   2896 O "O4'" . DA  H  3 7  ? -57.868 10.326 9.102   1.00 39.74  ? 7   DA  H "O4'" 1 
ATOM   2897 C "C3'" . DA  H  3 7  ? -60.187 10.794 9.140   1.00 44.41  ? 7   DA  H "C3'" 1 
ATOM   2898 O "O3'" . DA  H  3 7  ? -60.626 10.523 10.474  1.00 47.64  ? 7   DA  H "O3'" 1 
ATOM   2899 C "C2'" . DA  H  3 7  ? -59.425 12.101 8.969   1.00 39.83  ? 7   DA  H "C2'" 1 
ATOM   2900 C "C1'" . DA  H  3 7  ? -57.978 11.727 9.326   1.00 37.46  ? 7   DA  H "C1'" 1 
ATOM   2901 N N9    . DA  H  3 7  ? -56.938 12.363 8.511   1.00 34.72  ? 7   DA  H N9    1 
ATOM   2902 C C8    . DA  H  3 7  ? -56.902 12.365 7.136   1.00 34.89  ? 7   DA  H C8    1 
ATOM   2903 N N7    . DA  H  3 7  ? -55.818 12.902 6.636   1.00 33.51  ? 7   DA  H N7    1 
ATOM   2904 C C5    . DA  H  3 7  ? -55.087 13.276 7.751   1.00 31.99  ? 7   DA  H C5    1 
ATOM   2905 C C6    . DA  H  3 7  ? -53.862 13.936 7.893   1.00 32.09  ? 7   DA  H C6    1 
ATOM   2906 N N6    . DA  H  3 7  ? -53.130 14.357 6.865   1.00 31.60  ? 7   DA  H N6    1 
ATOM   2907 N N1    . DA  H  3 7  ? -53.417 14.178 9.150   1.00 33.02  ? 7   DA  H N1    1 
ATOM   2908 C C2    . DA  H  3 7  ? -54.196 13.829 10.181  1.00 31.03  ? 7   DA  H C2    1 
ATOM   2909 N N3    . DA  H  3 7  ? -55.385 13.234 10.172  1.00 31.90  ? 7   DA  H N3    1 
ATOM   2910 C C4    . DA  H  3 7  ? -55.776 12.972 8.914   1.00 32.47  ? 7   DA  H C4    1 
ATOM   2911 P P     . DC  H  3 8  ? -61.665 11.519 11.224  1.00 48.89  ? 8   DC  H P     1 
ATOM   2912 O OP1   . DC  H  3 8  ? -62.468 10.678 12.147  1.00 52.40  ? 8   DC  H OP1   1 
ATOM   2913 O OP2   . DC  H  3 8  ? -62.324 12.427 10.226  1.00 48.31  ? 8   DC  H OP2   1 
ATOM   2914 O "O5'" . DC  H  3 8  ? -60.715 12.550 11.989  1.00 47.15  ? 8   DC  H "O5'" 1 
ATOM   2915 C "C5'" . DC  H  3 8  ? -59.744 12.113 12.953  1.00 45.08  ? 8   DC  H "C5'" 1 
ATOM   2916 C "C4'" . DC  H  3 8  ? -58.946 13.294 13.462  1.00 43.60  ? 8   DC  H "C4'" 1 
ATOM   2917 O "O4'" . DC  H  3 8  ? -58.024 13.740 12.438  1.00 39.18  ? 8   DC  H "O4'" 1 
ATOM   2918 C "C3'" . DC  H  3 8  ? -59.774 14.519 13.870  1.00 42.41  ? 8   DC  H "C3'" 1 
ATOM   2919 O "O3'" . DC  H  3 8  ? -59.487 14.851 15.239  1.00 43.26  ? 8   DC  H "O3'" 1 
ATOM   2920 C "C2'" . DC  H  3 8  ? -59.359 15.592 12.879  1.00 39.08  ? 8   DC  H "C2'" 1 
ATOM   2921 C "C1'" . DC  H  3 8  ? -57.981 15.145 12.423  1.00 37.83  ? 8   DC  H "C1'" 1 
ATOM   2922 N N1    . DC  H  3 8  ? -57.596 15.557 11.054  1.00 36.13  ? 8   DC  H N1    1 
ATOM   2923 C C2    . DC  H  3 8  ? -56.368 16.205 10.862  1.00 34.23  ? 8   DC  H C2    1 
ATOM   2924 O O2    . DC  H  3 8  ? -55.638 16.406 11.844  1.00 38.15  ? 8   DC  H O2    1 
ATOM   2925 N N3    . DC  H  3 8  ? -56.001 16.578 9.610   1.00 32.70  ? 8   DC  H N3    1 
ATOM   2926 C C4    . DC  H  3 8  ? -56.814 16.336 8.579   1.00 32.63  ? 8   DC  H C4    1 
ATOM   2927 N N4    . DC  H  3 8  ? -56.417 16.719 7.377   1.00 32.01  ? 8   DC  H N4    1 
ATOM   2928 C C5    . DC  H  3 8  ? -58.090 15.715 8.750   1.00 35.75  ? 8   DC  H C5    1 
ATOM   2929 C C6    . DC  H  3 8  ? -58.434 15.334 9.991   1.00 35.57  ? 8   DC  H C6    1 
ATOM   2930 P P     . DT  H  3 9  ? -60.185 16.129 15.945  1.00 44.55  ? 9   DT  H P     1 
ATOM   2931 O OP1   . DT  H  3 9  ? -60.494 15.762 17.362  1.00 50.61  ? 9   DT  H OP1   1 
ATOM   2932 O OP2   . DT  H  3 9  ? -61.282 16.636 15.080  1.00 41.45  ? 9   DT  H OP2   1 
ATOM   2933 O "O5'" . DT  H  3 9  ? -58.986 17.193 15.999  1.00 41.55  ? 9   DT  H "O5'" 1 
ATOM   2934 C "C5'" . DT  H  3 9  ? -57.662 16.792 16.425  1.00 42.24  ? 9   DT  H "C5'" 1 
ATOM   2935 C "C4'" . DT  H  3 9  ? -56.653 17.923 16.321  1.00 41.27  ? 9   DT  H "C4'" 1 
ATOM   2936 O "O4'" . DT  H  3 9  ? -56.349 18.313 14.955  1.00 40.52  ? 9   DT  H "O4'" 1 
ATOM   2937 C "C3'" . DT  H  3 9  ? -57.018 19.219 17.044  1.00 41.83  ? 9   DT  H "C3'" 1 
ATOM   2938 O "O3'" . DT  H  3 9  ? -55.806 19.640 17.707  1.00 43.00  ? 9   DT  H "O3'" 1 
ATOM   2939 C "C2'" . DT  H  3 9  ? -57.532 20.099 15.916  1.00 39.43  ? 9   DT  H "C2'" 1 
ATOM   2940 C "C1'" . DT  H  3 9  ? -56.615 19.719 14.750  1.00 38.27  ? 9   DT  H "C1'" 1 
ATOM   2941 N N1    . DT  H  3 9  ? -57.103 19.856 13.349  1.00 34.79  ? 9   DT  H N1    1 
ATOM   2942 C C2    . DT  H  3 9  ? -56.239 20.298 12.360  1.00 33.75  ? 9   DT  H C2    1 
ATOM   2943 O O2    . DT  H  3 9  ? -55.147 20.789 12.586  1.00 37.56  ? 9   DT  H O2    1 
ATOM   2944 N N3    . DT  H  3 9  ? -56.718 20.167 11.086  1.00 31.53  ? 9   DT  H N3    1 
ATOM   2945 C C4    . DT  H  3 9  ? -57.924 19.623 10.699  1.00 31.12  ? 9   DT  H C4    1 
ATOM   2946 O O4    . DT  H  3 9  ? -58.222 19.604 9.519   1.00 31.20  ? 9   DT  H O4    1 
ATOM   2947 C C5    . DT  H  3 9  ? -58.785 19.184 11.782  1.00 32.76  ? 9   DT  H C5    1 
ATOM   2948 C C7    . DT  H  3 9  ? -60.156 18.665 11.462  1.00 33.61  ? 9   DT  H C7    1 
ATOM   2949 C C6    . DT  H  3 9  ? -58.320 19.287 13.031  1.00 32.47  ? 9   DT  H C6    1 
ATOM   2950 P P     . DC  H  3 10 ? -55.764 20.679 18.961  1.00 44.73  ? 10  DC  H P     1 
ATOM   2951 O OP1   . DC  H  3 10 ? -54.510 20.383 19.670  1.00 46.40  ? 10  DC  H OP1   1 
ATOM   2952 O OP2   . DC  H  3 10 ? -57.092 20.845 19.632  1.00 43.62  ? 10  DC  H OP2   1 
ATOM   2953 O "O5'" . DC  H  3 10 ? -55.621 22.093 18.260  1.00 42.07  ? 10  DC  H "O5'" 1 
ATOM   2954 C "C5'" . DC  H  3 10 ? -54.514 22.331 17.360  1.00 40.14  ? 10  DC  H "C5'" 1 
ATOM   2955 C "C4'" . DC  H  3 10 ? -54.808 23.591 16.579  1.00 39.74  ? 10  DC  H "C4'" 1 
ATOM   2956 O "O4'" . DC  H  3 10 ? -55.646 23.245 15.459  1.00 34.89  ? 10  DC  H "O4'" 1 
ATOM   2957 C "C3'" . DC  H  3 10 ? -55.581 24.669 17.363  1.00 42.03  ? 10  DC  H "C3'" 1 
ATOM   2958 O "O3'" . DC  H  3 10 ? -55.209 25.989 16.982  1.00 44.90  ? 10  DC  H "O3'" 1 
ATOM   2959 C "C2'" . DC  H  3 10 ? -56.990 24.555 16.810  1.00 40.31  ? 10  DC  H "C2'" 1 
ATOM   2960 C "C1'" . DC  H  3 10 ? -56.680 24.210 15.365  1.00 36.47  ? 10  DC  H "C1'" 1 
ATOM   2961 N N1    . DC  H  3 10 ? -57.759 23.650 14.522  1.00 34.46  ? 10  DC  H N1    1 
ATOM   2962 C C2    . DC  H  3 10 ? -57.599 23.665 13.124  1.00 33.22  ? 10  DC  H C2    1 
ATOM   2963 O O2    . DC  H  3 10 ? -56.582 24.183 12.639  1.00 31.59  ? 10  DC  H O2    1 
ATOM   2964 N N3    . DC  H  3 10 ? -58.578 23.157 12.343  1.00 31.80  ? 10  DC  H N3    1 
ATOM   2965 C C4    . DC  H  3 10 ? -59.675 22.640 12.903  1.00 34.16  ? 10  DC  H C4    1 
ATOM   2966 N N4    . DC  H  3 10 ? -60.605 22.130 12.102  1.00 34.01  ? 10  DC  H N4    1 
ATOM   2967 C C5    . DC  H  3 10 ? -59.849 22.588 14.319  1.00 36.58  ? 10  DC  H C5    1 
ATOM   2968 C C6    . DC  H  3 10 ? -58.873 23.091 15.080  1.00 34.99  ? 10  DC  H C6    1 
ATOM   2969 P P     . DC  H  3 11 ? -54.531 26.997 18.026  1.00 47.54  ? 11  DC  H P     1 
ATOM   2970 O OP1   . DC  H  3 11 ? -53.191 26.464 18.325  1.00 49.78  ? 11  DC  H OP1   1 
ATOM   2971 O OP2   . DC  H  3 11 ? -55.508 27.282 19.108  1.00 48.39  ? 11  DC  H OP2   1 
ATOM   2972 O "O5'" . DC  H  3 11 ? -54.453 28.330 17.160  1.00 47.49  ? 11  DC  H "O5'" 1 
ATOM   2973 C "C5'" . DC  H  3 11 ? -53.491 28.361 16.081  1.00 48.20  ? 11  DC  H "C5'" 1 
ATOM   2974 C "C4'" . DC  H  3 11 ? -54.102 28.905 14.813  1.00 46.03  ? 11  DC  H "C4'" 1 
ATOM   2975 O "O4'" . DC  H  3 11 ? -55.134 28.027 14.305  1.00 41.39  ? 11  DC  H "O4'" 1 
ATOM   2976 C "C3'" . DC  H  3 11 ? -54.759 30.275 14.958  1.00 47.75  ? 11  DC  H "C3'" 1 
ATOM   2977 O "O3'" . DC  H  3 11 ? -54.419 30.978 13.767  1.00 53.56  ? 11  DC  H "O3'" 1 
ATOM   2978 C "C2'" . DC  H  3 11 ? -56.239 29.959 14.911  1.00 43.77  ? 11  DC  H "C2'" 1 
ATOM   2979 C "C1'" . DC  H  3 11 ? -56.219 28.838 13.899  1.00 39.79  ? 11  DC  H "C1'" 1 
ATOM   2980 N N1    . DC  H  3 11 ? -57.422 27.984 13.764  1.00 36.75  ? 11  DC  H N1    1 
ATOM   2981 C C2    . DC  H  3 11 ? -57.797 27.568 12.479  1.00 35.07  ? 11  DC  H C2    1 
ATOM   2982 O O2    . DC  H  3 11 ? -57.097 27.895 11.516  1.00 33.46  ? 11  DC  H O2    1 
ATOM   2983 N N3    . DC  H  3 11 ? -58.902 26.798 12.326  1.00 33.52  ? 11  DC  H N3    1 
ATOM   2984 C C4    . DC  H  3 11 ? -59.643 26.480 13.390  1.00 33.92  ? 11  DC  H C4    1 
ATOM   2985 N N4    . DC  H  3 11 ? -60.727 25.729 13.191  1.00 34.25  ? 11  DC  H N4    1 
ATOM   2986 C C5    . DC  H  3 11 ? -59.289 26.897 14.709  1.00 35.28  ? 11  DC  H C5    1 
ATOM   2987 C C6    . DC  H  3 11 ? -58.206 27.676 14.843  1.00 36.52  ? 11  DC  H C6    1 
ATOM   2988 P P     . DG  H  3 12 ? -53.571 32.322 13.847  1.00 59.24  ? 12  DG  H P     1 
ATOM   2989 O OP1   . DG  H  3 12 ? -52.158 31.891 13.856  1.00 60.77  ? 12  DG  H OP1   1 
ATOM   2990 O OP2   . DG  H  3 12 ? -54.138 33.142 14.966  1.00 55.26  ? 12  DG  H OP2   1 
ATOM   2991 O "O5'" . DG  H  3 12 ? -53.940 33.063 12.470  1.00 58.63  ? 12  DG  H "O5'" 1 
ATOM   2992 C "C5'" . DG  H  3 12 ? -53.737 32.449 11.151  1.00 55.20  ? 12  DG  H "C5'" 1 
ATOM   2993 C "C4'" . DG  H  3 12 ? -54.927 32.637 10.230  1.00 52.73  ? 12  DG  H "C4'" 1 
ATOM   2994 O "O4'" . DG  H  3 12 ? -55.913 31.602 10.466  1.00 48.56  ? 12  DG  H "O4'" 1 
ATOM   2995 C "C3'" . DG  H  3 12 ? -55.682 33.966 10.362  1.00 52.05  ? 12  DG  H "C3'" 1 
ATOM   2996 O "O3'" . DG  H  3 12 ? -55.599 34.795 9.210   1.00 54.24  ? 12  DG  H "O3'" 1 
ATOM   2997 C "C2'" . DG  H  3 12 ? -57.146 33.579 10.415  1.00 49.25  ? 12  DG  H "C2'" 1 
ATOM   2998 C "C1'" . DG  H  3 12 ? -57.175 32.113 10.078  1.00 45.83  ? 12  DG  H "C1'" 1 
ATOM   2999 N N9    . DG  H  3 12 ? -58.188 31.408 10.845  1.00 41.84  ? 12  DG  H N9    1 
ATOM   3000 C C8    . DG  H  3 12 ? -58.340 31.440 12.210  1.00 40.20  ? 12  DG  H C8    1 
ATOM   3001 N N7    . DG  H  3 12 ? -59.352 30.736 12.628  1.00 38.23  ? 12  DG  H N7    1 
ATOM   3002 C C5    . DG  H  3 12 ? -59.896 30.197 11.473  1.00 37.85  ? 12  DG  H C5    1 
ATOM   3003 C C6    . DG  H  3 12 ? -60.996 29.321 11.304  1.00 37.08  ? 12  DG  H C6    1 
ATOM   3004 O O6    . DG  H  3 12 ? -61.725 28.821 12.179  1.00 36.30  ? 12  DG  H O6    1 
ATOM   3005 N N1    . DG  H  3 12 ? -61.226 29.043 9.958   1.00 35.64  ? 12  DG  H N1    1 
ATOM   3006 C C2    . DG  H  3 12 ? -60.473 29.522 8.913   1.00 37.26  ? 12  DG  H C2    1 
ATOM   3007 N N2    . DG  H  3 12 ? -60.853 29.135 7.679   1.00 35.37  ? 12  DG  H N2    1 
ATOM   3008 N N3    . DG  H  3 12 ? -59.424 30.323 9.064   1.00 37.08  ? 12  DG  H N3    1 
ATOM   3009 C C4    . DG  H  3 12 ? -59.198 30.616 10.361  1.00 38.22  ? 12  DG  H C4    1 
HETATM 3010 X UNK   . UNX I  4 .  ? -38.296 11.626 -35.273 1.00 22.40  ? 301 UNX A UNK   1 
HETATM 3011 X UNK   . UNX J  4 .  ? -24.141 12.875 -14.918 1.00 15.08  ? 302 UNX A UNK   1 
HETATM 3012 X UNK   . UNX K  4 .  ? -27.148 18.616 -32.763 1.00 28.07  ? 303 UNX A UNK   1 
HETATM 3013 X UNK   . UNX L  4 .  ? -33.673 16.779 -12.965 1.00 40.08  ? 304 UNX A UNK   1 
HETATM 3014 X UNK   . UNX M  4 .  ? -28.599 10.722 -36.382 1.00 27.45  ? 305 UNX A UNK   1 
HETATM 3015 X UNK   . UNX N  4 .  ? -52.878 8.040  -30.660 1.00 41.71  ? 301 UNX B UNK   1 
HETATM 3016 X UNK   . UNX O  4 .  ? -56.144 6.328  -31.880 1.00 39.61  ? 302 UNX B UNK   1 
HETATM 3017 X UNK   . UNX P  4 .  ? -45.186 -1.691 -65.249 1.00 50.23  ? 303 UNX B UNK   1 
HETATM 3018 X UNK   . UNX Q  4 .  ? -58.334 8.481  -36.091 1.00 25.48  ? 304 UNX B UNK   1 
HETATM 3019 X UNK   . UNX R  4 .  ? -52.132 1.757  -45.882 1.00 36.92  ? 305 UNX B UNK   1 
HETATM 3020 X UNK   . UNX S  4 .  ? -44.440 9.622  -44.462 1.00 21.19  ? 306 UNX B UNK   1 
HETATM 3021 X UNK   . UNX T  4 .  ? -45.827 11.560 -43.301 1.00 29.79  ? 307 UNX B UNK   1 
HETATM 3022 X UNK   . UNX U  4 .  ? -45.133 11.204 -40.343 1.00 24.67  ? 308 UNX B UNK   1 
HETATM 3023 X UNK   . UNX V  4 .  ? -45.773 3.434  -45.791 1.00 31.42  ? 309 UNX B UNK   1 
HETATM 3024 X UNK   . UNX W  4 .  ? -43.833 13.392 -39.243 1.00 19.27  ? 310 UNX B UNK   1 
HETATM 3025 X UNK   . UNX X  4 .  ? -41.572 -1.383 -50.235 1.00 48.78  ? 311 UNX B UNK   1 
HETATM 3026 X UNK   . UNX Y  4 .  ? -44.531 5.778  -46.188 1.00 31.10  ? 312 UNX B UNK   1 
HETATM 3027 X UNK   . UNX Z  4 .  ? -33.046 9.241  -42.940 1.00 27.38  ? 101 UNX C UNK   1 
HETATM 3028 X UNK   . UNX AA 4 .  ? -35.390 14.778 -44.512 1.00 18.80  ? 102 UNX C UNK   1 
HETATM 3029 X UNK   . UNX BA 4 .  ? -43.386 9.738  -38.630 1.00 31.10  ? 103 UNX C UNK   1 
HETATM 3030 X UNK   . UNX CA 4 .  ? -36.409 24.770 -41.237 1.00 42.71  ? 104 UNX C UNK   1 
HETATM 3031 X UNK   . UNX DA 4 .  ? -35.341 7.643  -43.970 1.00 16.90  ? 101 UNX D UNK   1 
HETATM 3032 X UNK   . UNX EA 4 .  ? -41.642 12.194 -38.791 1.00 26.01  ? 102 UNX D UNK   1 
HETATM 3033 X UNK   . UNX FA 4 .  ? -42.646 11.262 -46.066 1.00 26.50  ? 103 UNX D UNK   1 
HETATM 3034 X UNK   . UNX GA 4 .  ? -46.054 10.742 10.538  1.00 37.90  ? 301 UNX E UNK   1 
HETATM 3035 X UNK   . UNX HA 4 .  ? -39.741 22.511 5.110   1.00 30.59  ? 302 UNX E UNK   1 
HETATM 3036 X UNK   . UNX IA 4 .  ? -48.024 22.773 1.835   1.00 40.80  ? 303 UNX E UNK   1 
HETATM 3037 X UNK   . UNX JA 4 .  ? -45.447 11.993 2.107   1.00 30.99  ? 304 UNX E UNK   1 
HETATM 3038 X UNK   . UNX KA 4 .  ? -42.582 17.702 -15.802 1.00 16.11  ? 305 UNX E UNK   1 
HETATM 3039 X UNK   . UNX LA 4 .  ? -54.132 18.149 -15.768 1.00 43.22  ? 306 UNX E UNK   1 
HETATM 3040 X UNK   . UNX MA 4 .  ? -64.000 33.862 33.283  1.00 48.39  ? 301 UNX F UNK   1 
HETATM 3041 X UNK   . UNX NA 4 .  ? -71.205 26.043 8.670   1.00 34.47  ? 302 UNX F UNK   1 
HETATM 3042 X UNK   . UNX OA 4 .  ? -64.166 19.128 12.447  1.00 25.82  ? 303 UNX F UNK   1 
HETATM 3043 X UNK   . UNX PA 4 .  ? -51.574 21.461 11.925  1.00 27.83  ? 101 UNX G UNK   1 
HETATM 3044 X UNK   . UNX QA 4 .  ? -62.147 21.340 4.654   1.00 31.06  ? 102 UNX G UNK   1 
HETATM 3045 X UNK   . UNX RA 4 .  ? -61.859 20.730 7.782   1.00 33.27  ? 103 UNX G UNK   1 
HETATM 3046 X UNK   . UNX SA 4 .  ? -53.794 15.884 13.692  1.00 19.24  ? 104 UNX G UNK   1 
HETATM 3047 X UNK   . UNX TA 4 .  ? -51.928 18.767 14.182  1.00 37.92  ? 105 UNX G UNK   1 
HETATM 3048 X UNK   . UNX UA 4 .  ? -48.132 -2.624 13.623  1.00 29.68  ? 106 UNX G UNK   1 
HETATM 3049 X UNK   . UNX VA 4 .  ? -67.039 25.537 0.884   1.00 31.24  ? 107 UNX G UNK   1 
HETATM 3050 X UNK   . UNX WA 4 .  ? -54.712 14.028 4.246   1.00 25.33  ? 101 UNX H UNK   1 
HETATM 3051 X UNK   . UNX XA 4 .  ? -53.763 23.125 13.085  1.00 13.41  ? 102 UNX H UNK   1 
HETATM 3052 O O     . HOH YA 5 .  ? -29.551 17.338 -32.295 1.00 33.51  ? 401 HOH A O     1 
HETATM 3053 O O     . HOH YA 5 .  ? -30.013 16.946 -35.095 1.00 30.76  ? 402 HOH A O     1 
HETATM 3054 O O     . HOH YA 5 .  ? -29.249 7.202  -20.673 1.00 46.12  ? 403 HOH A O     1 
HETATM 3055 O O     . HOH YA 5 .  ? -35.660 11.945 -30.605 1.00 39.88  ? 404 HOH A O     1 
HETATM 3056 O O     . HOH ZA 5 .  ? -41.076 8.508  -48.985 1.00 31.34  ? 401 HOH B O     1 
HETATM 3057 O O     . HOH AB 5 .  ? -48.487 5.164  -32.129 1.00 35.25  ? 201 HOH C O     1 
HETATM 3058 O O     . HOH AB 5 .  ? -31.639 14.866 -35.707 1.00 30.19  ? 202 HOH C O     1 
HETATM 3059 O O     . HOH AB 5 .  ? -36.503 9.669  -31.631 1.00 41.11  ? 203 HOH C O     1 
HETATM 3060 O O     . HOH AB 5 .  ? -43.587 9.332  -35.626 1.00 37.66  ? 204 HOH C O     1 
HETATM 3061 O O     . HOH BB 5 .  ? -44.614 14.126 -43.841 1.00 34.78  ? 201 HOH D O     1 
HETATM 3062 O O     . HOH BB 5 .  ? -42.539 10.618 -48.636 1.00 31.28  ? 202 HOH D O     1 
HETATM 3063 O O     . HOH CB 5 .  ? -47.157 19.853 5.467   1.00 34.87  ? 401 HOH E O     1 
HETATM 3064 O O     . HOH CB 5 .  ? -47.948 13.392 1.468   1.00 31.04  ? 402 HOH E O     1 
HETATM 3065 O O     . HOH CB 5 .  ? -48.576 13.503 4.219   1.00 29.34  ? 403 HOH E O     1 
HETATM 3066 O O     . HOH DB 5 .  ? -62.991 24.126 17.917  1.00 39.13  ? 401 HOH F O     1 
HETATM 3067 O O     . HOH DB 5 .  ? -74.845 24.170 12.292  1.00 40.21  ? 402 HOH F O     1 
HETATM 3068 O O     . HOH DB 5 .  ? -62.908 21.074 13.663  1.00 32.90  ? 403 HOH F O     1 
HETATM 3069 O O     . HOH EB 5 .  ? -49.877 15.809 4.840   1.00 32.37  ? 201 HOH G O     1 
HETATM 3070 O O     . HOH EB 5 .  ? -54.954 21.004 0.633   1.00 36.51  ? 202 HOH G O     1 
HETATM 3071 O O     . HOH EB 5 .  ? -49.406 -7.206 11.850  1.00 35.61  ? 203 HOH G O     1 
HETATM 3072 O O     . HOH EB 5 .  ? -56.729 18.964 4.589   1.00 29.06  ? 204 HOH G O     1 
HETATM 3073 O O     . HOH FB 5 .  ? -58.531 31.336 6.784   1.00 42.11  ? 201 HOH H O     1 
HETATM 3074 O O     . HOH FB 5 .  ? -60.227 18.596 8.089   1.00 28.99  ? 202 HOH H O     1 
HETATM 3075 O O     . HOH FB 5 .  ? -59.249 22.043 18.197  1.00 34.85  ? 203 HOH H O     1 
HETATM 3076 O O     . HOH FB 5 .  ? -60.997 20.179 17.930  1.00 32.08  ? 204 HOH H O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    C CA    . GLY A 6  ? 0.8385 0.9029 0.8035 0.0538  -0.0137 -0.0791 147 GLY A CA    
2    C C     . GLY A 6  ? 0.8330 0.8969 0.7930 0.0604  -0.0216 -0.0692 147 GLY A C     
3    O O     . GLY A 6  ? 0.8500 0.8641 0.7844 0.0521  -0.0234 -0.0571 147 GLY A O     
4    N N     . LYS A 7  ? 0.7870 0.9086 0.7704 0.0741  -0.0258 -0.0754 148 LYS A N     
5    C CA    . LYS A 7  ? 0.7594 0.8882 0.7361 0.0885  -0.0378 -0.0704 148 LYS A CA    
6    C C     . LYS A 7  ? 0.6928 0.8184 0.6709 0.0594  -0.0342 -0.0589 148 LYS A C     
7    O O     . LYS A 7  ? 0.6617 0.8230 0.6659 0.0356  -0.0260 -0.0616 148 LYS A O     
8    C CB    . LYS A 7  ? 0.7184 0.9241 0.7277 0.1080  -0.0446 -0.0851 148 LYS A CB    
9    N N     . ARG A 8  ? 0.6943 0.7724 0.6391 0.0621  -0.0388 -0.0456 149 ARG A N     
10   C CA    . ARG A 8  ? 0.6339 0.7115 0.5765 0.0392  -0.0350 -0.0359 149 ARG A CA    
11   C C     . ARG A 8  ? 0.5990 0.7021 0.5377 0.0558  -0.0481 -0.0373 149 ARG A C     
12   O O     . ARG A 8  ? 0.6299 0.7094 0.5398 0.0843  -0.0594 -0.0338 149 ARG A O     
13   C CB    . ARG A 8  ? 0.6680 0.6848 0.5786 0.0255  -0.0273 -0.0208 149 ARG A CB    
14   C CG    . ARG A 8  ? 0.6589 0.6624 0.5800 0.0041  -0.0162 -0.0229 149 ARG A CG    
15   C CD    . ARG A 8  ? 0.6820 0.6523 0.5877 -0.0199 -0.0061 -0.0111 149 ARG A CD    
16   N NE    . ARG A 8  ? 0.6918 0.6478 0.6048 -0.0361 0.0002  -0.0163 149 ARG A NE    
17   C CZ    . ARG A 8  ? 0.7177 0.6518 0.6253 -0.0603 0.0092  -0.0111 149 ARG A CZ    
18   N NH1   . ARG A 8  ? 0.6934 0.6162 0.5867 -0.0724 0.0167  0.0015  149 ARG A NH1   
19   N NH2   . ARG A 8  ? 0.7212 0.6500 0.6387 -0.0730 0.0111  -0.0205 149 ARG A NH2   
20   N N     . MET A 9  ? 0.5343 0.6840 0.4996 0.0390  -0.0476 -0.0440 150 MET A N     
21   C CA    . MET A 9  ? 0.5291 0.7189 0.5008 0.0505  -0.0620 -0.0522 150 MET A CA    
22   C C     . MET A 9  ? 0.5028 0.6765 0.4564 0.0352  -0.0607 -0.0445 150 MET A C     
23   O O     . MET A 9  ? 0.4444 0.6183 0.4093 0.0085  -0.0490 -0.0438 150 MET A O     
24   C CB    . MET A 9  ? 0.5074 0.7662 0.5266 0.0374  -0.0612 -0.0702 150 MET A CB    
25   C CG    . MET A 9  ? 0.5170 0.8056 0.5585 0.0526  -0.0599 -0.0803 150 MET A CG    
26   S SD    . MET A 9  ? 0.6121 0.8931 0.6295 0.1045  -0.0792 -0.0825 150 MET A SD    
27   C CE    . MET A 9  ? 0.6064 0.9590 0.6436 0.1182  -0.1007 -0.0981 150 MET A CE    
28   N N     . ASP A 10 ? 0.5380 0.6991 0.4603 0.0558  -0.0736 -0.0400 151 ASP A N     
29   C CA    . ASP A 10 ? 0.5450 0.7014 0.4489 0.0466  -0.0753 -0.0370 151 ASP A CA    
30   C C     . ASP A 10 ? 0.5131 0.7186 0.4545 0.0233  -0.0759 -0.0540 151 ASP A C     
31   O O     . ASP A 10 ? 0.4902 0.7453 0.4687 0.0209  -0.0814 -0.0698 151 ASP A O     
32   C CB    . ASP A 10 ? 0.6006 0.7529 0.4688 0.0779  -0.0944 -0.0356 151 ASP A CB    
33   C CG    . ASP A 10 ? 0.6630 0.7460 0.4760 0.0982  -0.0912 -0.0140 151 ASP A CG    
34   O OD1   . ASP A 10 ? 0.6925 0.7304 0.4802 0.0805  -0.0740 0.0021  151 ASP A OD1   
35   O OD2   . ASP A 10 ? 0.6898 0.7635 0.4809 0.1331  -0.1063 -0.0135 151 ASP A OD2   
36   N N     . CYS A 11 ? 0.5384 0.7279 0.4675 0.0053  -0.0687 -0.0510 152 CYS A N     
37   C CA    . CYS A 11 ? 0.5341 0.7492 0.4862 -0.0187 -0.0674 -0.0651 152 CYS A CA    
38   C C     . CYS A 11 ? 0.5731 0.7878 0.4988 -0.0128 -0.0799 -0.0707 152 CYS A C     
39   O O     . CYS A 11 ? 0.6176 0.7978 0.5111 -0.0131 -0.0724 -0.0608 152 CYS A O     
40   C CB    . CYS A 11 ? 0.5135 0.7025 0.4677 -0.0405 -0.0484 -0.0585 152 CYS A CB    
41   S SG    . CYS A 11 ? 0.5143 0.7161 0.4813 -0.0667 -0.0480 -0.0749 152 CYS A SG    
42   N N     . PRO A 12 ? 0.5811 0.8389 0.5201 -0.0061 -0.0993 -0.0881 153 PRO A N     
43   C CA    . PRO A 12 ? 0.6003 0.8585 0.5088 0.0044  -0.1153 -0.0953 153 PRO A CA    
44   C C     . PRO A 12 ? 0.6237 0.8607 0.5180 -0.0169 -0.1091 -0.1012 153 PRO A C     
45   O O     . PRO A 12 ? 0.6739 0.8920 0.5279 -0.0053 -0.1156 -0.1007 153 PRO A O     
46   C CB    . PRO A 12 ? 0.6007 0.9233 0.5400 0.0096  -0.1381 -0.1188 153 PRO A CB    
47   C CG    . PRO A 12 ? 0.5770 0.9307 0.5561 0.0118  -0.1334 -0.1195 153 PRO A CG    
48   C CD    . PRO A 12 ? 0.5485 0.8634 0.5326 -0.0083 -0.1075 -0.1045 153 PRO A CD    
49   N N     . ALA A 13 ? 0.6191 0.8554 0.5400 -0.0452 -0.0967 -0.1070 154 ALA A N     
50   C CA    . ALA A 13 ? 0.6323 0.8403 0.5364 -0.0633 -0.0908 -0.1139 154 ALA A CA    
51   C C     . ALA A 13 ? 0.6160 0.7793 0.4856 -0.0532 -0.0751 -0.0959 154 ALA A C     
52   O O     . ALA A 13 ? 0.6331 0.7720 0.4787 -0.0571 -0.0722 -0.1012 154 ALA A O     
53   C CB    . ALA A 13 ? 0.6164 0.8264 0.5505 -0.0942 -0.0809 -0.1226 154 ALA A CB    
54   N N     . LEU A 14 ? 0.6060 0.7602 0.4726 -0.0404 -0.0651 -0.0765 155 LEU A N     
55   C CA    . LEU A 14 ? 0.5975 0.7211 0.4392 -0.0349 -0.0483 -0.0602 155 LEU A CA    
56   C C     . LEU A 14 ? 0.6424 0.7558 0.4490 -0.0144 -0.0510 -0.0480 155 LEU A C     
57   O O     . LEU A 14 ? 0.6579 0.7837 0.4626 -0.0008 -0.0657 -0.0488 155 LEU A O     
58   C CB    . LEU A 14 ? 0.5561 0.6748 0.4217 -0.0425 -0.0330 -0.0480 155 LEU A CB    
59   C CG    . LEU A 14 ? 0.5274 0.6451 0.4155 -0.0594 -0.0254 -0.0543 155 LEU A CG    
60   C CD1   . LEU A 14 ? 0.5089 0.6273 0.4183 -0.0626 -0.0149 -0.0439 155 LEU A CD1   
61   C CD2   . LEU A 14 ? 0.5367 0.6339 0.4043 -0.0599 -0.0171 -0.0562 155 LEU A CD2   
62   N N     . PRO A 15 ? 0.6805 0.7718 0.4580 -0.0105 -0.0353 -0.0357 156 PRO A N     
63   C CA    . PRO A 15 ? 0.7284 0.8011 0.4635 0.0055  -0.0316 -0.0199 156 PRO A CA    
64   C C     . PRO A 15 ? 0.7530 0.8120 0.4855 0.0131  -0.0324 -0.0045 156 PRO A C     
65   O O     . PRO A 15 ? 0.7216 0.7887 0.4896 0.0059  -0.0335 -0.0059 156 PRO A O     
66   C CB    . PRO A 15 ? 0.7345 0.7961 0.4573 -0.0013 -0.0069 -0.0093 156 PRO A CB    
67   C CG    . PRO A 15 ? 0.7127 0.7855 0.4537 -0.0090 -0.0070 -0.0260 156 PRO A CG    
68   C CD    . PRO A 15 ? 0.6746 0.7592 0.4574 -0.0206 -0.0178 -0.0350 156 PRO A CD    
69   N N     . PRO A 16 ? 0.8046 0.8373 0.4888 0.0297  -0.0316 0.0102  157 PRO A N     
70   C CA    . PRO A 16 ? 0.8313 0.8396 0.5026 0.0421  -0.0359 0.0235  157 PRO A CA    
71   C C     . PRO A 16 ? 0.7997 0.7891 0.4918 0.0233  -0.0168 0.0352  157 PRO A C     
72   O O     . PRO A 16 ? 0.7898 0.7761 0.4852 0.0045  0.0041  0.0416  157 PRO A O     
73   C CB    . PRO A 16 ? 0.9034 0.8735 0.5056 0.0612  -0.0334 0.0410  157 PRO A CB    
74   C CG    . PRO A 16 ? 0.9143 0.9004 0.4972 0.0620  -0.0324 0.0323  157 PRO A CG    
75   C CD    . PRO A 16 ? 0.8547 0.8797 0.4891 0.0445  -0.0349 0.0104  157 PRO A CD    
76   N N     . GLY A 17 ? 0.7877 0.7703 0.4953 0.0301  -0.0256 0.0349  158 GLY A N     
77   C CA    . GLY A 17 ? 0.7837 0.7411 0.5047 0.0155  -0.0117 0.0441  158 GLY A CA    
78   C C     . GLY A 17 ? 0.7220 0.7102 0.4983 -0.0059 -0.0055 0.0321  158 GLY A C     
79   O O     . GLY A 17 ? 0.7161 0.6860 0.5037 -0.0176 0.0034  0.0366  158 GLY A O     
80   N N     . TRP A 18 ? 0.6653 0.6938 0.4697 -0.0112 -0.0106 0.0170  159 TRP A N     
81   C CA    . TRP A 18 ? 0.6274 0.6811 0.4753 -0.0273 -0.0066 0.0062  159 TRP A CA    
82   C C     . TRP A 18 ? 0.6017 0.6719 0.4746 -0.0195 -0.0192 -0.0035 159 TRP A C     
83   O O     . TRP A 18 ? 0.6063 0.6969 0.4802 -0.0058 -0.0346 -0.0124 159 TRP A O     
84   C CB    . TRP A 18 ? 0.6027 0.6811 0.4612 -0.0342 -0.0074 -0.0057 159 TRP A CB    
85   C CG    . TRP A 18 ? 0.6126 0.6857 0.4586 -0.0418 0.0079  -0.0004 159 TRP A CG    
86   C CD1   . TRP A 18 ? 0.6582 0.7224 0.4699 -0.0348 0.0125  0.0052  159 TRP A CD1   
87   C CD2   . TRP A 18 ? 0.5916 0.6742 0.4585 -0.0542 0.0205  -0.0019 159 TRP A CD2   
88   N NE1   . TRP A 18 ? 0.6438 0.7154 0.4571 -0.0427 0.0289  0.0069  159 TRP A NE1   
89   C CE2   . TRP A 18 ? 0.6304 0.7148 0.4784 -0.0536 0.0328  0.0021  159 TRP A CE2   
90   C CE3   . TRP A 18 ? 0.5571 0.6491 0.4541 -0.0630 0.0223  -0.0067 159 TRP A CE3   
91   C CZ2   . TRP A 18 ? 0.6203 0.7219 0.4838 -0.0598 0.0452  -0.0002 159 TRP A CZ2   
92   C CZ3   . TRP A 18 ? 0.5474 0.6506 0.4554 -0.0689 0.0329  -0.0080 159 TRP A CZ3   
93   C CH2   . TRP A 18 ? 0.5787 0.6896 0.4725 -0.0667 0.0437  -0.0054 159 TRP A CH2   
94   N N     . LYS A 19 ? 0.5601 0.6282 0.4547 -0.0279 -0.0128 -0.0042 160 LYS A N     
95   C CA    . LYS A 19 ? 0.5467 0.6341 0.4639 -0.0192 -0.0217 -0.0140 160 LYS A CA    
96   C C     . LYS A 19 ? 0.4967 0.6080 0.4467 -0.0360 -0.0149 -0.0231 160 LYS A C     
97   O O     . LYS A 19 ? 0.4832 0.5870 0.4345 -0.0501 -0.0046 -0.0198 160 LYS A O     
98   C CB    . LYS A 19 ? 0.5891 0.6426 0.4891 -0.0052 -0.0230 -0.0069 160 LYS A CB    
99   C CG    . LYS A 19 ? 0.6244 0.6399 0.4791 0.0135  -0.0288 0.0055  160 LYS A CG    
100  C CD    . LYS A 19 ? 0.6745 0.6454 0.5039 0.0324  -0.0326 0.0114  160 LYS A CD    
101  C CE    . LYS A 19 ? 0.7138 0.6323 0.4851 0.0529  -0.0373 0.0274  160 LYS A CE    
102  N N     . LYS A 20 ? 0.4950 0.6383 0.4691 -0.0330 -0.0206 -0.0347 161 LYS A N     
103  C CA    . LYS A 20 ? 0.4698 0.6345 0.4694 -0.0485 -0.0130 -0.0426 161 LYS A CA    
104  C C     . LYS A 20 ? 0.4757 0.6478 0.4871 -0.0387 -0.0123 -0.0462 161 LYS A C     
105  O O     . LYS A 20 ? 0.4625 0.6421 0.4721 -0.0189 -0.0217 -0.0491 161 LYS A O     
106  C CB    . LYS A 20 ? 0.4879 0.6875 0.5038 -0.0568 -0.0181 -0.0544 161 LYS A CB    
107  C CG    . LYS A 20 ? 0.4834 0.7024 0.5205 -0.0747 -0.0086 -0.0616 161 LYS A CG    
108  C CD    . LYS A 20 ? 0.4988 0.7523 0.5528 -0.0883 -0.0134 -0.0748 161 LYS A CD    
109  C CE    . LYS A 20 ? 0.4987 0.7768 0.5749 -0.1078 -0.0012 -0.0817 161 LYS A CE    
110  N N     . GLU A 21 ? 0.4578 0.6259 0.4765 -0.0484 -0.0024 -0.0467 162 GLU A N     
111  C CA    . GLU A 21 ? 0.4792 0.6555 0.5070 -0.0391 -0.0001 -0.0526 162 GLU A CA    
112  C C     . GLU A 21 ? 0.4387 0.6371 0.4809 -0.0533 0.0103  -0.0578 162 GLU A C     
113  O O     . GLU A 21 ? 0.4172 0.6028 0.4528 -0.0683 0.0164  -0.0533 162 GLU A O     
114  C CB    . GLU A 21 ? 0.5120 0.6485 0.5227 -0.0362 0.0016  -0.0474 162 GLU A CB    
115  C CG    . GLU A 21 ? 0.5276 0.6585 0.5366 -0.0203 0.0003  -0.0545 162 GLU A CG    
116  C CD    . GLU A 21 ? 0.5701 0.6628 0.5644 -0.0259 0.0028  -0.0534 162 GLU A CD    
117  O OE1   . GLU A 21 ? 0.5461 0.6275 0.5380 -0.0434 0.0066  -0.0483 162 GLU A OE1   
118  O OE2   . GLU A 21 ? 0.7076 0.7844 0.6932 -0.0117 0.0002  -0.0604 162 GLU A OE2   
119  N N     . GLU A 22 ? 0.4330 0.6624 0.4907 -0.0466 0.0135  -0.0666 163 GLU A N     
120  C CA    . GLU A 22 ? 0.4532 0.7014 0.5191 -0.0607 0.0271  -0.0699 163 GLU A CA    
121  C C     . GLU A 22 ? 0.4628 0.7062 0.5229 -0.0460 0.0305  -0.0737 163 GLU A C     
122  O O     . GLU A 22 ? 0.4824 0.7405 0.5488 -0.0255 0.0251  -0.0810 163 GLU A O     
123  C CB    . GLU A 22 ? 0.4846 0.7838 0.5764 -0.0712 0.0316  -0.0790 163 GLU A CB    
124  C CG    . GLU A 22 ? 0.5281 0.8383 0.6210 -0.0903 0.0504  -0.0794 163 GLU A CG    
125  C CD    . GLU A 22 ? 0.5641 0.9183 0.6808 -0.1144 0.0596  -0.0870 163 GLU A CD    
126  O OE1   . GLU A 22 ? 0.5710 0.9249 0.6815 -0.1339 0.0778  -0.0845 163 GLU A OE1   
127  O OE2   . GLU A 22 ? 0.6119 1.0002 0.7512 -0.1158 0.0491  -0.0959 163 GLU A OE2   
128  N N     . VAL A 23 ? 0.4608 0.6814 0.5048 -0.0532 0.0378  -0.0700 164 VAL A N     
129  C CA    . VAL A 23 ? 0.4408 0.6517 0.4733 -0.0407 0.0400  -0.0751 164 VAL A CA    
130  C C     . VAL A 23 ? 0.4383 0.6692 0.4676 -0.0487 0.0559  -0.0766 164 VAL A C     
131  O O     . VAL A 23 ? 0.4440 0.6616 0.4599 -0.0637 0.0630  -0.0691 164 VAL A O     
132  C CB    . VAL A 23 ? 0.4552 0.6248 0.4692 -0.0414 0.0325  -0.0716 164 VAL A CB    
133  C CG1   . VAL A 23 ? 0.4704 0.6269 0.4705 -0.0297 0.0316  -0.0805 164 VAL A CG1   
134  C CG2   . VAL A 23 ? 0.4843 0.6322 0.4981 -0.0382 0.0217  -0.0678 164 VAL A CG2   
135  N N     . ILE A 24 ? 0.4478 0.7086 0.4848 -0.0364 0.0627  -0.0861 165 ILE A N     
136  C CA    . ILE A 24 ? 0.4541 0.7332 0.4827 -0.0435 0.0812  -0.0868 165 ILE A CA    
137  C C     . ILE A 24 ? 0.4607 0.7057 0.4572 -0.0334 0.0797  -0.0873 165 ILE A C     
138  O O     . ILE A 24 ? 0.4845 0.7163 0.4754 -0.0145 0.0693  -0.0962 165 ILE A O     
139  C CB    . ILE A 24 ? 0.4583 0.7908 0.5073 -0.0306 0.0910  -0.0992 165 ILE A CB    
140  C CG1   . ILE A 24 ? 0.4440 0.8237 0.5306 -0.0352 0.0881  -0.1042 165 ILE A CG1   
141  C CG2   . ILE A 24 ? 0.4754 0.8251 0.5112 -0.0415 0.1142  -0.0978 165 ILE A CG2   
142  C CD1   . ILE A 24 ? 0.4371 0.8164 0.5320 -0.0672 0.0917  -0.0955 165 ILE A CD1   
143  N N     . ARG A 25 ? 0.4724 0.7009 0.4439 -0.0446 0.0893  -0.0791 166 ARG A N     
144  C CA    . ARG A 25 ? 0.5041 0.7077 0.4426 -0.0325 0.0866  -0.0817 166 ARG A CA    
145  C C     . ARG A 25 ? 0.5505 0.7748 0.4797 -0.0165 0.0966  -0.0927 166 ARG A C     
146  O O     . ARG A 25 ? 0.5746 0.8290 0.5068 -0.0229 0.1163  -0.0910 166 ARG A O     
147  C CB    . ARG A 25 ? 0.5162 0.6962 0.4227 -0.0431 0.0945  -0.0691 166 ARG A CB    
148  C CG    . ARG A 25 ? 0.4848 0.6411 0.3936 -0.0527 0.0837  -0.0603 166 ARG A CG    
149  C CD    . ARG A 25 ? 0.5118 0.6369 0.3807 -0.0503 0.0843  -0.0514 166 ARG A CD    
150  N NE    . ARG A 25 ? 0.4963 0.6029 0.3681 -0.0560 0.0752  -0.0445 166 ARG A NE    
151  C CZ    . ARG A 25 ? 0.5071 0.5863 0.3482 -0.0480 0.0695  -0.0382 166 ARG A CZ    
152  N NH1   . ARG A 25 ? 0.5277 0.5910 0.3283 -0.0339 0.0709  -0.0365 166 ARG A NH1   
153  N NH2   . ARG A 25 ? 0.4930 0.5614 0.3414 -0.0506 0.0617  -0.0344 166 ARG A NH2   
154  N N     . LYS A 26 ? 0.6093 0.8162 0.5253 0.0026  0.0837  -0.1051 167 LYS A N     
155  C CA    . LYS A 26 ? 0.6319 0.8532 0.5368 0.0244  0.0893  -0.1199 167 LYS A CA    
156  C C     . LYS A 26 ? 0.6666 0.8825 0.5312 0.0297  0.1002  -0.1203 167 LYS A C     
157  O O     . LYS A 26 ? 0.6501 0.8906 0.5049 0.0430  0.1149  -0.1284 167 LYS A O     
158  C CB    . LYS A 26 ? 0.6542 0.8465 0.5562 0.0423  0.0687  -0.1351 167 LYS A CB    
159  C CG    . LYS A 26 ? 0.6485 0.8337 0.5784 0.0414  0.0568  -0.1336 167 LYS A CG    
160  N N     . SER A 27 ? 0.6892 0.8756 0.5278 0.0226  0.0931  -0.1123 168 SER A N     
161  C CA    . SER A 27 ? 0.7228 0.8969 0.5139 0.0345  0.0974  -0.1147 168 SER A CA    
162  C C     . SER A 27 ? 0.7297 0.8806 0.4901 0.0256  0.0990  -0.0980 168 SER A C     
163  O O     . SER A 27 ? 0.6861 0.8272 0.4619 0.0107  0.0948  -0.0862 168 SER A O     
164  C CB    . SER A 27 ? 0.7478 0.9030 0.5239 0.0536  0.0757  -0.1357 168 SER A CB    
165  O OG    . SER A 27 ? 0.7324 0.8659 0.5174 0.0457  0.0527  -0.1370 168 SER A OG    
166  N N     . GLY A 28 ? 0.8006 0.9398 0.5110 0.0391  0.1046  -0.0981 169 GLY A N     
167  C CA    . GLY A 28 ? 0.8396 0.9495 0.5050 0.0396  0.1058  -0.0825 169 GLY A CA    
168  C C     . GLY A 28 ? 0.8653 0.9681 0.5187 0.0195  0.1340  -0.0600 169 GLY A C     
169  O O     . GLY A 28 ? 0.8572 0.9885 0.5348 0.0050  0.1561  -0.0586 169 GLY A O     
170  N N     . LEU A 29 ? 0.9056 0.9700 0.5215 0.0188  0.1322  -0.0440 170 LEU A N     
171  C CA    . LEU A 29 ? 0.9513 0.9889 0.5350 0.0000  0.1596  -0.0214 170 LEU A CA    
172  C C     . LEU A 29 ? 0.8885 0.9378 0.5205 -0.0299 0.1686  -0.0156 170 LEU A C     
173  O O     . LEU A 29 ? 0.9061 0.9520 0.5294 -0.0544 0.1965  -0.0033 170 LEU A O     
174  C CB    . LEU A 29 ? 1.0192 1.0005 0.5416 0.0134  0.1512  -0.0063 170 LEU A CB    
175  C CG    . LEU A 29 ? 1.0879 1.0529 0.5479 0.0452  0.1431  -0.0095 170 LEU A CG    
176  C CD1   . LEU A 29 ? 1.1272 1.0509 0.5455 0.0679  0.1202  -0.0025 170 LEU A CD1   
177  C CD2   . LEU A 29 ? 1.1487 1.0999 0.5542 0.0405  0.1773  0.0034  170 LEU A CD2   
178  N N     . SER A 30 ? 0.8070 0.8706 0.4877 -0.0296 0.1456  -0.0252 171 SER A N     
179  C CA    . SER A 30 ? 0.7546 0.8298 0.4804 -0.0542 0.1487  -0.0222 171 SER A CA    
180  C C     . SER A 30 ? 0.7067 0.8374 0.4896 -0.0622 0.1532  -0.0357 171 SER A C     
181  O O     . SER A 30 ? 0.6717 0.8168 0.4936 -0.0780 0.1504  -0.0363 171 SER A O     
182  C CB    . SER A 30 ? 0.7239 0.7815 0.4636 -0.0476 0.1232  -0.0233 171 SER A CB    
183  O OG    . SER A 30 ? 0.6920 0.7646 0.4443 -0.0267 0.1006  -0.0380 171 SER A OG    
184  N N     . ALA A 31 ? 0.7065 0.8672 0.4902 -0.0485 0.1598  -0.0470 172 ALA A N     
185  C CA    . ALA A 31 ? 0.6564 0.8682 0.4894 -0.0448 0.1595  -0.0626 172 ALA A CA    
186  C C     . ALA A 31 ? 0.6415 0.8948 0.5113 -0.0699 0.1792  -0.0604 172 ALA A C     
187  O O     . ALA A 31 ? 0.6444 0.9016 0.4968 -0.0901 0.2051  -0.0507 172 ALA A O     
188  C CB    . ALA A 31 ? 0.6802 0.9110 0.4969 -0.0212 0.1646  -0.0760 172 ALA A CB    
189  N N     . GLY A 32 ? 0.6031 0.8864 0.5219 -0.0692 0.1660  -0.0700 173 GLY A N     
190  C CA    . GLY A 32 ? 0.5877 0.9196 0.5496 -0.0908 0.1774  -0.0726 173 GLY A CA    
191  C C     . GLY A 32 ? 0.5776 0.8877 0.5501 -0.1154 0.1704  -0.0636 173 GLY A C     
192  O O     . GLY A 32 ? 0.5580 0.9070 0.5711 -0.1286 0.1691  -0.0701 173 GLY A O     
193  N N     . LYS A 33 ? 0.6083 0.8575 0.5421 -0.1186 0.1646  -0.0506 174 LYS A N     
194  C CA    . LYS A 33 ? 0.6023 0.8198 0.5377 -0.1337 0.1539  -0.0435 174 LYS A CA    
195  C C     . LYS A 33 ? 0.5477 0.7731 0.5122 -0.1153 0.1276  -0.0519 174 LYS A C     
196  O O     . LYS A 33 ? 0.5270 0.7595 0.4945 -0.0919 0.1175  -0.0595 174 LYS A O     
197  C CB    . LYS A 33 ? 0.6380 0.7895 0.5183 -0.1329 0.1547  -0.0286 174 LYS A CB    
198  C CG    . LYS A 33 ? 0.7016 0.8320 0.5368 -0.1442 0.1810  -0.0175 174 LYS A CG    
199  N N     . SER A 34 ? 0.5109 0.7305 0.4915 -0.1268 0.1180  -0.0508 175 SER A N     
200  C CA    . SER A 34 ? 0.4745 0.6968 0.4759 -0.1122 0.0963  -0.0558 175 SER A CA    
201  C C     . SER A 34 ? 0.4553 0.6351 0.4389 -0.1118 0.0843  -0.0482 175 SER A C     
202  O O     . SER A 34 ? 0.4720 0.6220 0.4329 -0.1241 0.0902  -0.0406 175 SER A O     
203  C CB    . SER A 34 ? 0.4667 0.7335 0.5067 -0.1185 0.0928  -0.0648 175 SER A CB    
204  O OG    . SER A 34 ? 0.4718 0.7316 0.5139 -0.1427 0.0952  -0.0622 175 SER A OG    
205  N N     . ASP A 35 ? 0.4155 0.5898 0.4052 -0.0960 0.0690  -0.0505 176 ASP A N     
206  C CA    . ASP A 35 ? 0.4067 0.5560 0.3884 -0.0950 0.0590  -0.0457 176 ASP A CA    
207  C C     . ASP A 35 ? 0.3790 0.5437 0.3840 -0.0948 0.0494  -0.0490 176 ASP A C     
208  O O     . ASP A 35 ? 0.3688 0.5538 0.3906 -0.0853 0.0448  -0.0547 176 ASP A O     
209  C CB    . ASP A 35 ? 0.4175 0.5518 0.3869 -0.0812 0.0508  -0.0459 176 ASP A CB    
210  C CG    . ASP A 35 ? 0.4500 0.5721 0.3918 -0.0754 0.0571  -0.0445 176 ASP A CG    
211  O OD1   . ASP A 35 ? 0.4512 0.5859 0.3936 -0.0696 0.0607  -0.0501 176 ASP A OD1   
212  O OD2   . ASP A 35 ? 0.4641 0.5625 0.3794 -0.0730 0.0576  -0.0384 176 ASP A OD2   
213  N N     . VAL A 36 ? 0.3673 0.5184 0.3674 -0.1019 0.0459  -0.0456 177 VAL A N     
214  C CA    . VAL A 36 ? 0.3623 0.5226 0.3754 -0.0996 0.0359  -0.0474 177 VAL A CA    
215  C C     . VAL A 36 ? 0.3527 0.4934 0.3557 -0.0918 0.0298  -0.0425 177 VAL A C     
216  O O     . VAL A 36 ? 0.3665 0.4899 0.3545 -0.0924 0.0316  -0.0392 177 VAL A O     
217  C CB    . VAL A 36 ? 0.3655 0.5287 0.3796 -0.1144 0.0365  -0.0501 177 VAL A CB    
218  C CG1   . VAL A 36 ? 0.3760 0.5472 0.3963 -0.1089 0.0246  -0.0525 177 VAL A CG1   
219  C CG2   . VAL A 36 ? 0.3745 0.5674 0.4054 -0.1279 0.0449  -0.0568 177 VAL A CG2   
220  N N     . TYR A 37 ? 0.3584 0.5018 0.3678 -0.0836 0.0234  -0.0422 178 TYR A N     
221  C CA    . TYR A 37 ? 0.3704 0.4996 0.3722 -0.0816 0.0209  -0.0372 178 TYR A CA    
222  C C     . TYR A 37 ? 0.3834 0.5118 0.3818 -0.0791 0.0160  -0.0345 178 TYR A C     
223  O O     . TYR A 37 ? 0.4042 0.5438 0.4084 -0.0742 0.0109  -0.0376 178 TYR A O     
224  C CB    . TYR A 37 ? 0.3756 0.4973 0.3790 -0.0783 0.0200  -0.0379 178 TYR A CB    
225  C CG    . TYR A 37 ? 0.3660 0.4907 0.3694 -0.0774 0.0224  -0.0429 178 TYR A CG    
226  C CD1   . TYR A 37 ? 0.3738 0.4989 0.3695 -0.0787 0.0249  -0.0425 178 TYR A CD1   
227  C CD2   . TYR A 37 ? 0.3733 0.4976 0.3784 -0.0714 0.0214  -0.0487 178 TYR A CD2   
228  C CE1   . TYR A 37 ? 0.3878 0.5131 0.3760 -0.0747 0.0259  -0.0463 178 TYR A CE1   
229  C CE2   . TYR A 37 ? 0.3826 0.5090 0.3820 -0.0688 0.0236  -0.0540 178 TYR A CE2   
230  C CZ    . TYR A 37 ? 0.3940 0.5211 0.3839 -0.0709 0.0257  -0.0521 178 TYR A CZ    
231  O OH    . TYR A 37 ? 0.4157 0.5424 0.3920 -0.0653 0.0267  -0.0560 178 TYR A OH    
232  N N     . TYR A 38 ? 0.4029 0.5227 0.3910 -0.0804 0.0173  -0.0298 179 TYR A N     
233  C CA    . TYR A 38 ? 0.4292 0.5435 0.4058 -0.0761 0.0138  -0.0253 179 TYR A CA    
234  C C     . TYR A 38 ? 0.4559 0.5566 0.4251 -0.0782 0.0190  -0.0176 179 TYR A C     
235  O O     . TYR A 38 ? 0.4333 0.5384 0.4098 -0.0851 0.0250  -0.0183 179 TYR A O     
236  C CB    . TYR A 38 ? 0.4311 0.5463 0.3964 -0.0771 0.0135  -0.0270 179 TYR A CB    
237  C CG    . TYR A 38 ? 0.4345 0.5589 0.4047 -0.0807 0.0077  -0.0357 179 TYR A CG    
238  C CD1   . TYR A 38 ? 0.4348 0.5572 0.4091 -0.0893 0.0121  -0.0401 179 TYR A CD1   
239  C CD2   . TYR A 38 ? 0.4549 0.5903 0.4240 -0.0767 -0.0019 -0.0400 179 TYR A CD2   
240  C CE1   . TYR A 38 ? 0.4320 0.5617 0.4116 -0.0998 0.0100  -0.0482 179 TYR A CE1   
241  C CE2   . TYR A 38 ? 0.4531 0.6063 0.4340 -0.0856 -0.0070 -0.0513 179 TYR A CE2   
242  C CZ    . TYR A 38 ? 0.4359 0.5851 0.4231 -0.1000 0.0007  -0.0548 179 TYR A CZ    
243  O OH    . TYR A 38 ? 0.4705 0.6334 0.4682 -0.1159 -0.0001 -0.0652 179 TYR A OH    
244  N N     . PHE A 39 ? 0.4674 0.5518 0.4205 -0.0728 0.0167  -0.0107 180 PHE A N     
245  C CA    . PHE A 39 ? 0.5033 0.5664 0.4425 -0.0797 0.0247  -0.0012 180 PHE A CA    
246  C C     . PHE A 39 ? 0.5226 0.5777 0.4364 -0.0764 0.0282  0.0074  180 PHE A C     
247  O O     . PHE A 39 ? 0.5358 0.5884 0.4352 -0.0630 0.0188  0.0074  180 PHE A O     
248  C CB    . PHE A 39 ? 0.5377 0.5708 0.4669 -0.0752 0.0210  0.0017  180 PHE A CB    
249  C CG    . PHE A 39 ? 0.5209 0.5593 0.4697 -0.0775 0.0188  -0.0077 180 PHE A CG    
250  C CD1   . PHE A 39 ? 0.4925 0.5492 0.4541 -0.0658 0.0113  -0.0163 180 PHE A CD1   
251  C CD2   . PHE A 39 ? 0.5213 0.5521 0.4767 -0.0930 0.0249  -0.0096 180 PHE A CD2   
252  C CE1   . PHE A 39 ? 0.4759 0.5380 0.4505 -0.0663 0.0111  -0.0247 180 PHE A CE1   
253  C CE2   . PHE A 39 ? 0.5022 0.5371 0.4707 -0.0930 0.0214  -0.0199 180 PHE A CE2   
254  C CZ    . PHE A 39 ? 0.4802 0.5285 0.4555 -0.0781 0.0150  -0.0266 180 PHE A CZ    
255  N N     . SER A 40 ? 0.5131 0.5693 0.4219 -0.0884 0.0415  0.0134  181 SER A N     
256  C CA    . SER A 40 ? 0.5487 0.5975 0.4284 -0.0858 0.0490  0.0229  181 SER A CA    
257  C C     . SER A 40 ? 0.5998 0.6054 0.4450 -0.0834 0.0504  0.0369  181 SER A C     
258  O O     . SER A 40 ? 0.6090 0.5885 0.4546 -0.0859 0.0472  0.0386  181 SER A O     
259  C CB    . SER A 40 ? 0.5236 0.5957 0.4119 -0.0999 0.0662  0.0240  181 SER A CB    
260  O OG    . SER A 40 ? 0.5539 0.6143 0.4462 -0.1206 0.0782  0.0305  181 SER A OG    
261  N N     . PRO A 41 ? 0.6450 0.6373 0.4538 -0.0768 0.0555  0.0472  182 PRO A N     
262  C CA    . PRO A 41 ? 0.7107 0.6513 0.4770 -0.0730 0.0579  0.0632  182 PRO A CA    
263  C C     . PRO A 41 ? 0.7505 0.6678 0.5186 -0.1007 0.0762  0.0716  182 PRO A C     
264  O O     . PRO A 41 ? 0.7817 0.6481 0.5270 -0.1008 0.0741  0.0792  182 PRO A O     
265  C CB    . PRO A 41 ? 0.7454 0.6783 0.4682 -0.0612 0.0620  0.0730  182 PRO A CB    
266  C CG    . PRO A 41 ? 0.6950 0.6768 0.4403 -0.0604 0.0626  0.0601  182 PRO A CG    
267  C CD    . PRO A 41 ? 0.6403 0.6545 0.4368 -0.0665 0.0550  0.0437  182 PRO A CD    
268  N N     . SER A 42 ? 0.7635 0.7181 0.5586 -0.1230 0.0927  0.0679  183 SER A N     
269  C CA    . SER A 42 ? 0.8093 0.7577 0.6200 -0.1556 0.1088  0.0697  183 SER A CA    
270  C C     . SER A 42 ? 0.8002 0.7294 0.6302 -0.1578 0.0953  0.0601  183 SER A C     
271  O O     . SER A 42 ? 0.8672 0.7470 0.6781 -0.1736 0.1008  0.0667  183 SER A O     
272  C CB    . SER A 42 ? 0.7701 0.7838 0.6207 -0.1727 0.1227  0.0600  183 SER A CB    
273  N N     . GLY A 43 ? 0.7259 0.6869 0.5862 -0.1410 0.0785  0.0452  184 GLY A N     
274  C CA    . GLY A 43 ? 0.7037 0.6589 0.5857 -0.1415 0.0672  0.0333  184 GLY A CA    
275  C C     . GLY A 43 ? 0.6245 0.6341 0.5517 -0.1465 0.0638  0.0167  184 GLY A C     
276  O O     . GLY A 43 ? 0.6034 0.6117 0.5450 -0.1447 0.0548  0.0065  184 GLY A O     
277  N N     . LYS A 44 ? 0.5869 0.6410 0.5302 -0.1487 0.0707  0.0141  185 LYS A N     
278  C CA    . LYS A 44 ? 0.5307 0.6333 0.5072 -0.1469 0.0673  0.0004  185 LYS A CA    
279  C C     . LYS A 44 ? 0.4848 0.5903 0.4647 -0.1255 0.0529  -0.0062 185 LYS A C     
280  O O     . LYS A 44 ? 0.4492 0.5429 0.4133 -0.1115 0.0477  -0.0023 185 LYS A O     
281  C CB    . LYS A 44 ? 0.5374 0.6799 0.5198 -0.1473 0.0789  0.0009  185 LYS A CB    
282  C CG    . LYS A 44 ? 0.5325 0.7294 0.5484 -0.1498 0.0802  -0.0127 185 LYS A CG    
283  N N     . LYS A 45 ? 0.4532 0.5783 0.4533 -0.1246 0.0470  -0.0172 186 LYS A N     
284  C CA    . LYS A 45 ? 0.4400 0.5621 0.4407 -0.1102 0.0369  -0.0224 186 LYS A CA    
285  C C     . LYS A 45 ? 0.4080 0.5535 0.4119 -0.0999 0.0362  -0.0266 186 LYS A C     
286  O O     . LYS A 45 ? 0.3882 0.5591 0.4031 -0.1012 0.0388  -0.0315 186 LYS A O     
287  C CB    . LYS A 45 ? 0.4476 0.5667 0.4582 -0.1143 0.0317  -0.0309 186 LYS A CB    
288  C CG    . LYS A 45 ? 0.4247 0.5384 0.4327 -0.1016 0.0248  -0.0352 186 LYS A CG    
289  C CD    . LYS A 45 ? 0.4259 0.5358 0.4386 -0.1043 0.0203  -0.0448 186 LYS A CD    
290  C CE    . LYS A 45 ? 0.4042 0.5203 0.4139 -0.0917 0.0171  -0.0496 186 LYS A CE    
291  N NZ    . LYS A 45 ? 0.4262 0.5315 0.4336 -0.0908 0.0128  -0.0586 186 LYS A NZ    
292  N N     . PHE A 46 ? 0.3803 0.5161 0.3733 -0.0900 0.0325  -0.0257 187 PHE A N     
293  C CA    . PHE A 46 ? 0.3789 0.5199 0.3652 -0.0803 0.0315  -0.0294 187 PHE A CA    
294  C C     . PHE A 46 ? 0.3810 0.5103 0.3642 -0.0781 0.0274  -0.0322 187 PHE A C     
295  O O     . PHE A 46 ? 0.3855 0.5082 0.3714 -0.0818 0.0255  -0.0314 187 PHE A O     
296  C CB    . PHE A 46 ? 0.4030 0.5364 0.3733 -0.0758 0.0328  -0.0270 187 PHE A CB    
297  C CG    . PHE A 46 ? 0.4140 0.5598 0.3823 -0.0775 0.0403  -0.0231 187 PHE A CG    
298  C CD1   . PHE A 46 ? 0.4196 0.5563 0.3837 -0.0854 0.0432  -0.0154 187 PHE A CD1   
299  C CD2   . PHE A 46 ? 0.4136 0.5812 0.3830 -0.0700 0.0456  -0.0270 187 PHE A CD2   
300  C CE1   . PHE A 46 ? 0.4479 0.5934 0.4061 -0.0906 0.0541  -0.0097 187 PHE A CE1   
301  C CE2   . PHE A 46 ? 0.4243 0.6124 0.3959 -0.0742 0.0562  -0.0240 187 PHE A CE2   
302  C CZ    . PHE A 46 ? 0.4505 0.6261 0.4154 -0.0869 0.0619  -0.0144 187 PHE A CZ    
303  N N     . ARG A 47 ? 0.3766 0.5047 0.3519 -0.0704 0.0268  -0.0352 188 ARG A N     
304  C CA    . ARG A 47 ? 0.3894 0.5043 0.3560 -0.0698 0.0265  -0.0360 188 ARG A CA    
305  C C     . ARG A 47 ? 0.4209 0.5110 0.3633 -0.0664 0.0286  -0.0347 188 ARG A C     
306  O O     . ARG A 47 ? 0.4717 0.5463 0.4016 -0.0687 0.0316  -0.0334 188 ARG A O     
307  C CB    . ARG A 47 ? 0.3792 0.5041 0.3465 -0.0624 0.0236  -0.0399 188 ARG A CB    
308  C CG    . ARG A 47 ? 0.3646 0.5068 0.3524 -0.0693 0.0209  -0.0440 188 ARG A CG    
309  C CD    . ARG A 47 ? 0.3756 0.5272 0.3613 -0.0626 0.0155  -0.0512 188 ARG A CD    
310  N NE    . ARG A 47 ? 0.3546 0.5236 0.3602 -0.0720 0.0114  -0.0589 188 ARG A NE    
311  C CZ    . ARG A 47 ? 0.3622 0.5378 0.3689 -0.0711 0.0048  -0.0685 188 ARG A CZ    
312  N NH1   . ARG A 47 ? 0.3549 0.5232 0.3418 -0.0581 0.0020  -0.0703 188 ARG A NH1   
313  N NH2   . ARG A 47 ? 0.3673 0.5536 0.3915 -0.0850 0.0014  -0.0769 188 ARG A NH2   
314  N N     . SER A 48 ? 0.4094 0.4911 0.3406 -0.0613 0.0282  -0.0352 189 SER A N     
315  C CA    . SER A 48 ? 0.4491 0.4945 0.3510 -0.0604 0.0298  -0.0354 189 SER A CA    
316  C C     . SER A 48 ? 0.4797 0.5183 0.3734 -0.0589 0.0281  -0.0388 189 SER A C     
317  O O     . SER A 48 ? 0.4404 0.5036 0.3457 -0.0527 0.0275  -0.0394 189 SER A O     
318  C CB    . SER A 48 ? 0.4605 0.4858 0.3350 -0.0409 0.0289  -0.0349 189 SER A CB    
319  O OG    . SER A 48 ? 0.4636 0.5111 0.3419 -0.0220 0.0255  -0.0390 189 SER A OG    
320  N N     . LYS A 49 ? 0.5092 0.5114 0.3783 -0.0650 0.0285  -0.0413 190 LYS A N     
321  C CA    . LYS A 49 ? 0.5564 0.5441 0.4099 -0.0630 0.0254  -0.0474 190 LYS A CA    
322  C C     . LYS A 49 ? 0.5824 0.5703 0.4198 -0.0376 0.0250  -0.0497 190 LYS A C     
323  O O     . LYS A 49 ? 0.5838 0.5884 0.4237 -0.0328 0.0243  -0.0530 190 LYS A O     
324  C CB    . LYS A 49 ? 0.6133 0.5535 0.4391 -0.0778 0.0259  -0.0521 190 LYS A CB    
325  C CG    . LYS A 49 ? 0.6387 0.5612 0.4471 -0.0796 0.0203  -0.0623 190 LYS A CG    
326  C CD    . LYS A 49 ? 0.6818 0.5595 0.4688 -0.1038 0.0208  -0.0690 190 LYS A CD    
327  C CE    . LYS A 49 ? 0.7203 0.5859 0.4932 -0.1082 0.0122  -0.0827 190 LYS A CE    
328  N NZ    . LYS A 49 ? 0.7852 0.6029 0.5358 -0.1368 0.0125  -0.0922 190 LYS A NZ    
329  N N     . PRO A 50 ? 0.5893 0.5595 0.4068 -0.0188 0.0255  -0.0486 191 PRO A N     
330  C CA    . PRO A 50 ? 0.6022 0.5838 0.4084 0.0093  0.0247  -0.0538 191 PRO A CA    
331  C C     . PRO A 50 ? 0.5686 0.6147 0.4132 0.0125  0.0274  -0.0531 191 PRO A C     
332  O O     . PRO A 50 ? 0.5627 0.6323 0.4067 0.0281  0.0302  -0.0581 191 PRO A O     
333  C CB    . PRO A 50 ? 0.6283 0.5775 0.4022 0.0333  0.0221  -0.0535 191 PRO A CB    
334  C CG    . PRO A 50 ? 0.6630 0.5658 0.4188 0.0137  0.0239  -0.0471 191 PRO A CG    
335  C CD    . PRO A 50 ? 0.6124 0.5416 0.4044 -0.0190 0.0268  -0.0444 191 PRO A CD    
336  N N     . GLN A 51 ? 0.5303 0.6033 0.4058 -0.0033 0.0280  -0.0479 192 GLN A N     
337  C CA    . GLN A 51 ? 0.5128 0.6380 0.4222 -0.0081 0.0319  -0.0474 192 GLN A CA    
338  C C     . GLN A 51 ? 0.5261 0.6553 0.4382 -0.0200 0.0365  -0.0447 192 GLN A C     
339  O O     . GLN A 51 ? 0.4631 0.6224 0.3833 -0.0171 0.0434  -0.0450 192 GLN A O     
340  C CB    . GLN A 51 ? 0.5194 0.6587 0.4530 -0.0226 0.0302  -0.0442 192 GLN A CB    
341  C CG    . GLN A 51 ? 0.5233 0.7104 0.4884 -0.0276 0.0325  -0.0466 192 GLN A CG    
342  C CD    . GLN A 51 ? 0.5466 0.7349 0.5286 -0.0432 0.0293  -0.0453 192 GLN A CD    
343  O OE1   . GLN A 51 ? 0.5157 0.6761 0.4859 -0.0447 0.0259  -0.0430 192 GLN A OE1   
344  N NE2   . GLN A 51 ? 0.5222 0.7416 0.5303 -0.0566 0.0319  -0.0475 192 GLN A NE2   
345  N N     . LEU A 52 ? 0.5214 0.6223 0.4249 -0.0329 0.0328  -0.0425 193 LEU A N     
346  C CA    . LEU A 52 ? 0.5408 0.6419 0.4411 -0.0407 0.0332  -0.0406 193 LEU A CA    
347  C C     . LEU A 52 ? 0.5668 0.6612 0.4416 -0.0263 0.0351  -0.0462 193 LEU A C     
348  O O     . LEU A 52 ? 0.5458 0.6558 0.4179 -0.0259 0.0400  -0.0435 193 LEU A O     
349  C CB    . LEU A 52 ? 0.5519 0.6323 0.4508 -0.0542 0.0260  -0.0414 193 LEU A CB    
350  C CG    . LEU A 52 ? 0.5661 0.6529 0.4680 -0.0615 0.0218  -0.0394 193 LEU A CG    
351  C CD1   . LEU A 52 ? 0.5640 0.6691 0.4833 -0.0648 0.0260  -0.0303 193 LEU A CD1   
352  C CD2   . LEU A 52 ? 0.5728 0.6520 0.4814 -0.0736 0.0143  -0.0444 193 LEU A CD2   
353  N N     . ALA A 53 ? 0.6011 0.6666 0.4513 -0.0135 0.0317  -0.0538 194 ALA A N     
354  C CA    . ALA A 53 ? 0.6238 0.6758 0.4432 0.0044  0.0325  -0.0622 194 ALA A CA    
355  C C     . ALA A 53 ? 0.6217 0.7143 0.4468 0.0250  0.0421  -0.0637 194 ALA A C     
356  O O     . ALA A 53 ? 0.6447 0.7482 0.4541 0.0354  0.0478  -0.0674 194 ALA A O     
357  C CB    . ALA A 53 ? 0.6554 0.6534 0.4403 0.0126  0.0261  -0.0705 194 ALA A CB    
358  N N     . ARG A 54 ? 0.5944 0.7145 0.4420 0.0308  0.0441  -0.0622 195 ARG A N     
359  C CA    . ARG A 54 ? 0.5952 0.7703 0.4605 0.0465  0.0531  -0.0658 195 ARG A CA    
360  C C     . ARG A 54 ? 0.5610 0.7737 0.4468 0.0276  0.0654  -0.0587 195 ARG A C     
361  O O     . ARG A 54 ? 0.5888 0.8323 0.4706 0.0383  0.0766  -0.0619 195 ARG A O     
362  C CB    . ARG A 54 ? 0.6086 0.8128 0.4994 0.0520  0.0497  -0.0673 195 ARG A CB    
363  C CG    . ARG A 54 ? 0.6784 0.8481 0.5391 0.0813  0.0396  -0.0739 195 ARG A CG    
364  C CD    . ARG A 54 ? 0.6916 0.9024 0.5737 0.0969  0.0345  -0.0783 195 ARG A CD    
365  N NE    . ARG A 54 ? 0.6458 0.8722 0.5585 0.0712  0.0319  -0.0724 195 ARG A NE    
366  C CZ    . ARG A 54 ? 0.6690 0.8556 0.5680 0.0662  0.0241  -0.0674 195 ARG A CZ    
367  N NH1   . ARG A 54 ? 0.7005 0.8231 0.5546 0.0800  0.0193  -0.0653 195 ARG A NH1   
368  N NH2   . ARG A 54 ? 0.6474 0.8548 0.5748 0.0453  0.0225  -0.0645 195 ARG A NH2   
369  N N     . TYR A 55 ? 0.5031 0.7088 0.4050 0.0011  0.0644  -0.0487 196 TYR A N     
370  C CA    . TYR A 55 ? 0.4785 0.7043 0.3896 -0.0175 0.0764  -0.0390 196 TYR A CA    
371  C C     . TYR A 55 ? 0.4939 0.6966 0.3700 -0.0129 0.0786  -0.0365 196 TYR A C     
372  O O     . TYR A 55 ? 0.5216 0.7468 0.3901 -0.0130 0.0930  -0.0326 196 TYR A O     
373  C CB    . TYR A 55 ? 0.4447 0.6594 0.3746 -0.0410 0.0727  -0.0302 196 TYR A CB    
374  C CG    . TYR A 55 ? 0.4416 0.6607 0.3739 -0.0606 0.0839  -0.0186 196 TYR A CG    
375  C CD1   . TYR A 55 ? 0.4527 0.7077 0.4093 -0.0759 0.0971  -0.0168 196 TYR A CD1   
376  C CD2   . TYR A 55 ? 0.4609 0.6442 0.3687 -0.0648 0.0801  -0.0096 196 TYR A CD2   
377  C CE1   . TYR A 55 ? 0.4808 0.7271 0.4309 -0.0979 0.1104  -0.0039 196 TYR A CE1   
378  C CE2   . TYR A 55 ? 0.4887 0.6629 0.3870 -0.0795 0.0903  0.0033  196 TYR A CE2   
379  C CZ    . TYR A 55 ? 0.5041 0.7036 0.4210 -0.0977 0.1065  0.0074  196 TYR A CZ    
380  O OH    . TYR A 55 ? 0.5547 0.7324 0.4544 -0.1155 0.1186  0.0221  196 TYR A OH    
381  N N     . LEU A 56 ? 0.5006 0.6615 0.3546 -0.0103 0.0648  -0.0396 197 LEU A N     
382  C CA    . LEU A 56 ? 0.5393 0.6801 0.3599 -0.0069 0.0625  -0.0393 197 LEU A CA    
383  C C     . LEU A 56 ? 0.5658 0.7049 0.3555 0.0155  0.0660  -0.0505 197 LEU A C     
384  O O     . LEU A 56 ? 0.5994 0.7396 0.3623 0.0211  0.0715  -0.0490 197 LEU A O     
385  C CB    . LEU A 56 ? 0.5361 0.6429 0.3495 -0.0151 0.0449  -0.0421 197 LEU A CB    
386  C CG    . LEU A 56 ? 0.5095 0.6176 0.3406 -0.0311 0.0417  -0.0308 197 LEU A CG    
387  C CD1   . LEU A 56 ? 0.4946 0.5859 0.3334 -0.0386 0.0257  -0.0368 197 LEU A CD1   
388  C CD2   . LEU A 56 ? 0.5264 0.6322 0.3329 -0.0290 0.0450  -0.0220 197 LEU A CD2   
389  N N     . GLY A 57 ? 0.5596 0.6898 0.3467 0.0311  0.0617  -0.0618 198 GLY A N     
390  C CA    . GLY A 57 ? 0.5894 0.7108 0.3439 0.0578  0.0632  -0.0750 198 GLY A CA    
391  C C     . GLY A 57 ? 0.6293 0.7087 0.3439 0.0590  0.0524  -0.0830 198 GLY A C     
392  O O     . GLY A 57 ? 0.6160 0.6631 0.3300 0.0424  0.0381  -0.0844 198 GLY A O     
393  N N     . ASN A 58 ? 0.6428 0.7295 0.3260 0.0773  0.0597  -0.0893 199 ASN A N     
394  C CA    . ASN A 58 ? 0.6949 0.7409 0.3350 0.0828  0.0472  -0.1019 199 ASN A CA    
395  C C     . ASN A 58 ? 0.7013 0.7529 0.3337 0.0683  0.0435  -0.0934 199 ASN A C     
396  O O     . ASN A 58 ? 0.7199 0.7495 0.3146 0.0752  0.0335  -0.1043 199 ASN A O     
397  C CB    . ASN A 58 ? 0.7348 0.7738 0.3349 0.1155  0.0528  -0.1175 199 ASN A CB    
398  C CG    . ASN A 58 ? 0.7430 0.8331 0.3375 0.1282  0.0743  -0.1109 199 ASN A CG    
399  O OD1   . ASN A 58 ? 0.7122 0.8354 0.3277 0.1098  0.0855  -0.0932 199 ASN A OD1   
400  N ND2   . ASN A 58 ? 0.7842 0.8767 0.3454 0.1600  0.0815  -0.1255 199 ASN A ND2   
401  N N     . THR A 59 ? 0.6863 0.7621 0.3509 0.0496  0.0489  -0.0754 200 THR A N     
402  C CA    . THR A 59 ? 0.6991 0.7721 0.3517 0.0404  0.0426  -0.0665 200 THR A CA    
403  C C     . THR A 59 ? 0.6953 0.7456 0.3568 0.0268  0.0189  -0.0742 200 THR A C     
404  O O     . THR A 59 ? 0.6956 0.7431 0.3417 0.0257  0.0073  -0.0735 200 THR A O     
405  C CB    . THR A 59 ? 0.6705 0.7685 0.3459 0.0275  0.0581  -0.0445 200 THR A CB    
406  O OG1   . THR A 59 ? 0.6382 0.7420 0.3580 0.0124  0.0559  -0.0409 200 THR A OG1   
407  C CG2   . THR A 59 ? 0.6818 0.8110 0.3510 0.0355  0.0840  -0.0383 200 THR A CG2   
408  N N     . VAL A 60 ? 0.7223 0.7597 0.4078 0.0170  0.0124  -0.0816 201 VAL A N     
409  C CA    . VAL A 60 ? 0.7384 0.7637 0.4393 -0.0008 -0.0057 -0.0888 201 VAL A CA    
410  C C     . VAL A 60 ? 0.7746 0.7681 0.4727 -0.0057 -0.0099 -0.1028 201 VAL A C     
411  O O     . VAL A 60 ? 0.7862 0.7757 0.4935 -0.0004 0.0008  -0.0981 201 VAL A O     
412  C CB    . VAL A 60 ? 0.7010 0.7466 0.4439 -0.0158 -0.0037 -0.0742 201 VAL A CB    
413  C CG1   . VAL A 60 ? 0.6996 0.7460 0.4604 -0.0318 -0.0210 -0.0828 201 VAL A CG1   
414  C CG2   . VAL A 60 ? 0.6978 0.7622 0.4383 -0.0107 0.0044  -0.0569 201 VAL A CG2   
415  N N     . ASP A 61 ? 0.8087 0.7783 0.4925 -0.0165 -0.0259 -0.1202 202 ASP A N     
416  C CA    . ASP A 61 ? 0.8421 0.7681 0.5167 -0.0276 -0.0294 -0.1329 202 ASP A CA    
417  C C     . ASP A 61 ? 0.7870 0.7192 0.5006 -0.0533 -0.0292 -0.1265 202 ASP A C     
418  O O     . ASP A 61 ? 0.7934 0.7440 0.5281 -0.0735 -0.0395 -0.1320 202 ASP A O     
419  C CB    . ASP A 61 ? 0.9021 0.7971 0.5435 -0.0344 -0.0458 -0.1567 202 ASP A CB    
420  C CG    . ASP A 61 ? 0.9784 0.8105 0.5961 -0.0459 -0.0471 -0.1702 202 ASP A CG    
421  O OD1   . ASP A 61 ? 0.9687 0.7839 0.5999 -0.0534 -0.0375 -0.1600 202 ASP A OD1   
422  O OD2   . ASP A 61 ? 1.0694 0.8626 0.6489 -0.0476 -0.0584 -0.1916 202 ASP A OD2   
423  N N     . LEU A 62 ? 0.7780 0.6976 0.4993 -0.0505 -0.0177 -0.1166 203 LEU A N     
424  C CA    . LEU A 62 ? 0.7589 0.6840 0.5116 -0.0722 -0.0150 -0.1095 203 LEU A CA    
425  C C     . LEU A 62 ? 0.8028 0.6731 0.5349 -0.0896 -0.0148 -0.1179 203 LEU A C     
426  O O     . LEU A 62 ? 0.7851 0.6530 0.5349 -0.1057 -0.0085 -0.1103 203 LEU A O     
427  C CB    . LEU A 62 ? 0.7104 0.6586 0.4845 -0.0597 -0.0029 -0.0921 203 LEU A CB    
428  C CG    . LEU A 62 ? 0.6743 0.6704 0.4725 -0.0529 -0.0004 -0.0812 203 LEU A CG    
429  C CD1   . LEU A 62 ? 0.6612 0.6754 0.4784 -0.0447 0.0106  -0.0686 203 LEU A CD1   
430  C CD2   . LEU A 62 ? 0.6667 0.6884 0.4915 -0.0695 -0.0082 -0.0804 203 LEU A CD2   
431  N N     . SER A 63 ? 0.8503 0.6713 0.5402 -0.0869 -0.0205 -0.1332 204 SER A N     
432  C CA    . SER A 63 ? 0.9155 0.6665 0.5737 -0.1029 -0.0182 -0.1395 204 SER A CA    
433  C C     . SER A 63 ? 0.9042 0.6620 0.5901 -0.1458 -0.0178 -0.1417 204 SER A C     
434  O O     . SER A 63 ? 0.9200 0.6358 0.5937 -0.1611 -0.0078 -0.1351 204 SER A O     
435  C CB    . SER A 63 ? 0.9881 0.6784 0.5927 -0.0960 -0.0264 -0.1591 204 SER A CB    
436  O OG    . SER A 63 ? 1.0012 0.7126 0.6136 -0.1154 -0.0404 -0.1768 204 SER A OG    
437  N N     . SER A 64 ? 0.8710 0.6844 0.5925 -0.1628 -0.0279 -0.1505 205 SER A N     
438  C CA    . SER A 64 ? 0.8802 0.7161 0.6344 -0.2040 -0.0288 -0.1580 205 SER A CA    
439  C C     . SER A 64 ? 0.7814 0.6908 0.5902 -0.2051 -0.0252 -0.1460 205 SER A C     
440  O O     . SER A 64 ? 0.7661 0.7138 0.6100 -0.2338 -0.0265 -0.1537 205 SER A O     
441  C CB    . SER A 64 ? 0.9297 0.7776 0.6835 -0.2224 -0.0467 -0.1835 205 SER A CB    
442  O OG    . SER A 64 ? 0.9184 0.8277 0.6922 -0.1989 -0.0592 -0.1841 205 SER A OG    
443  N N     . PHE A 65 ? 0.7157 0.6439 0.5305 -0.1744 -0.0202 -0.1287 206 PHE A N     
444  C CA    . PHE A 65 ? 0.6346 0.6228 0.4923 -0.1681 -0.0181 -0.1173 206 PHE A CA    
445  C C     . PHE A 65 ? 0.6124 0.5958 0.4838 -0.1817 -0.0033 -0.1066 206 PHE A C     
446  O O     . PHE A 65 ? 0.6008 0.5429 0.4470 -0.1722 0.0064  -0.0963 206 PHE A O     
447  C CB    . PHE A 65 ? 0.6065 0.6061 0.4584 -0.1346 -0.0172 -0.1044 206 PHE A CB    
448  C CG    . PHE A 65 ? 0.5548 0.6015 0.4406 -0.1270 -0.0162 -0.0936 206 PHE A CG    
449  C CD1   . PHE A 65 ? 0.5348 0.6233 0.4410 -0.1268 -0.0281 -0.0995 206 PHE A CD1   
450  C CD2   . PHE A 65 ? 0.5217 0.5686 0.4153 -0.1174 -0.0051 -0.0790 206 PHE A CD2   
451  C CE1   . PHE A 65 ? 0.5194 0.6405 0.4494 -0.1161 -0.0275 -0.0895 206 PHE A CE1   
452  C CE2   . PHE A 65 ? 0.4939 0.5749 0.4137 -0.1109 -0.0045 -0.0705 206 PHE A CE2   
453  C CZ    . PHE A 65 ? 0.4977 0.6114 0.4337 -0.1097 -0.0149 -0.0750 206 PHE A CZ    
454  N N     . ASP A 66 ? 0.5905 0.6185 0.4995 -0.2017 -0.0022 -0.1103 207 ASP A N     
455  C CA    . ASP A 66 ? 0.5738 0.6035 0.4952 -0.2152 0.0135  -0.1009 207 ASP A CA    
456  C C     . ASP A 66 ? 0.5117 0.5759 0.4539 -0.1899 0.0151  -0.0880 207 ASP A C     
457  O O     . ASP A 66 ? 0.4542 0.5717 0.4297 -0.1849 0.0083  -0.0915 207 ASP A O     
458  C CB    . ASP A 66 ? 0.5737 0.6444 0.5290 -0.2498 0.0161  -0.1136 207 ASP A CB    
459  C CG    . ASP A 66 ? 0.5622 0.6390 0.5283 -0.2644 0.0357  -0.1037 207 ASP A CG    
460  O OD1   . ASP A 66 ? 0.6039 0.6840 0.5778 -0.2991 0.0460  -0.1107 207 ASP A OD1   
461  O OD2   . ASP A 66 ? 0.5432 0.6240 0.5101 -0.2436 0.0419  -0.0901 207 ASP A OD2   
462  N N     . PHE A 67 ? 0.5198 0.5521 0.4402 -0.1727 0.0224  -0.0750 208 PHE A N     
463  C CA    . PHE A 67 ? 0.4991 0.5573 0.4358 -0.1520 0.0236  -0.0646 208 PHE A CA    
464  C C     . PHE A 67 ? 0.4858 0.5880 0.4565 -0.1594 0.0273  -0.0654 208 PHE A C     
465  O O     . PHE A 67 ? 0.4646 0.5981 0.4547 -0.1446 0.0211  -0.0642 208 PHE A O     
466  C CB    . PHE A 67 ? 0.4876 0.5122 0.3996 -0.1375 0.0308  -0.0541 208 PHE A CB    
467  C CG    . PHE A 67 ? 0.4628 0.5118 0.3895 -0.1181 0.0293  -0.0472 208 PHE A CG    
468  C CD1   . PHE A 67 ? 0.4562 0.5114 0.3811 -0.1025 0.0239  -0.0459 208 PHE A CD1   
469  C CD2   . PHE A 67 ? 0.4742 0.5369 0.4129 -0.1171 0.0348  -0.0427 208 PHE A CD2   
470  C CE1   . PHE A 67 ? 0.4242 0.4990 0.3625 -0.0910 0.0243  -0.0404 208 PHE A CE1   
471  C CE2   . PHE A 67 ? 0.4683 0.5481 0.4183 -0.1025 0.0323  -0.0389 208 PHE A CE2   
472  C CZ    . PHE A 67 ? 0.4116 0.4967 0.3624 -0.0918 0.0273  -0.0378 208 PHE A CZ    
473  N N     . ARG A 68 ? 0.5260 0.6290 0.5008 -0.1819 0.0383  -0.0677 209 ARG A N     
474  C CA    . ARG A 68 ? 0.5373 0.6864 0.5431 -0.1851 0.0447  -0.0689 209 ARG A CA    
475  C C     . ARG A 68 ? 0.4954 0.7035 0.5384 -0.1827 0.0335  -0.0809 209 ARG A C     
476  O O     . ARG A 68 ? 0.4749 0.7164 0.5377 -0.1648 0.0308  -0.0805 209 ARG A O     
477  C CB    . ARG A 68 ? 0.6261 0.7684 0.6275 -0.2124 0.0629  -0.0685 209 ARG A CB    
478  C CG    . ARG A 68 ? 0.6850 0.7803 0.6504 -0.2055 0.0750  -0.0544 209 ARG A CG    
479  C CD    . ARG A 68 ? 0.7376 0.8509 0.7080 -0.2184 0.0936  -0.0513 209 ARG A CD    
480  N NE    . ARG A 68 ? 0.7727 0.8566 0.7143 -0.1958 0.0965  -0.0395 209 ARG A NE    
481  C CZ    . ARG A 68 ? 0.7417 0.8537 0.6951 -0.1778 0.0970  -0.0387 209 ARG A CZ    
482  N NH1   . ARG A 68 ? 0.7083 0.8772 0.6999 -0.1767 0.0973  -0.0476 209 ARG A NH1   
483  N NH2   . ARG A 68 ? 0.7609 0.8427 0.6847 -0.1582 0.0960  -0.0305 209 ARG A NH2   
484  N N     . THR A 69 ? 0.4796 0.6986 0.5290 -0.1989 0.0257  -0.0931 210 THR A N     
485  C CA    . THR A 69 ? 0.4901 0.7716 0.5746 -0.1962 0.0122  -0.1077 210 THR A CA    
486  C C     . THR A 69 ? 0.5158 0.7952 0.5901 -0.1698 -0.0068 -0.1077 210 THR A C     
487  O O     . THR A 69 ? 0.6032 0.9290 0.6986 -0.1563 -0.0204 -0.1167 210 THR A O     
488  C CB    . THR A 69 ? 0.5047 0.8056 0.6028 -0.2308 0.0107  -0.1252 210 THR A CB    
489  O OG1   . THR A 69 ? 0.5280 0.7648 0.5869 -0.2404 0.0090  -0.1235 210 THR A OG1   
490  C CG2   . THR A 69 ? 0.5006 0.8227 0.6179 -0.2632 0.0313  -0.1284 210 THR A CG2   
491  N N     . GLY A 70 ? 0.5156 0.7432 0.5552 -0.1618 -0.0079 -0.0987 211 GLY A N     
492  C CA    . GLY A 70 ? 0.5256 0.7479 0.5496 -0.1400 -0.0220 -0.0973 211 GLY A CA    
493  C C     . GLY A 70 ? 0.5513 0.7889 0.5737 -0.1475 -0.0372 -0.1136 211 GLY A C     
494  O O     . GLY A 70 ? 0.5907 0.8337 0.6004 -0.1266 -0.0508 -0.1137 211 GLY A O     
495  N N     . LYS A 71 ? 0.5687 0.8077 0.5985 -0.1782 -0.0346 -0.1272 212 LYS A N     
496  C CA    . LYS A 71 ? 0.5803 0.8351 0.6104 -0.1915 -0.0505 -0.1475 212 LYS A CA    
497  C C     . LYS A 71 ? 0.6376 0.8269 0.6275 -0.2057 -0.0467 -0.1498 212 LYS A C     
498  O O     . LYS A 71 ? 0.6411 0.7854 0.6149 -0.2172 -0.0302 -0.1404 212 LYS A O     
499  C CB    . LYS A 71 ? 0.5726 0.8905 0.6482 -0.2191 -0.0526 -0.1666 212 LYS A CB    
500  C CG    . LYS A 71 ? 0.5473 0.9394 0.6597 -0.1948 -0.0644 -0.1711 212 LYS A CG    
501  C CD    . LYS A 71 ? 0.5443 1.0167 0.7097 -0.2183 -0.0658 -0.1923 212 LYS A CD    
502  N N     . MET A 72 ? 0.6803 0.8608 0.6475 -0.1982 -0.0631 -0.1617 213 MET A N     
503  C CA    . MET A 72 ? 0.7681 0.8935 0.6986 -0.2142 -0.0647 -0.1732 213 MET A CA    
504  C C     . MET A 72 ? 0.8229 0.9587 0.7735 -0.2589 -0.0651 -0.1938 213 MET A C     
505  O O     . MET A 72 ? 0.8092 1.0150 0.8043 -0.2719 -0.0734 -0.2068 213 MET A O     
506  C CB    . MET A 72 ? 0.7906 0.9147 0.6934 -0.1936 -0.0841 -0.1841 213 MET A CB    
507  C CG    . MET A 72 ? 0.7725 0.8846 0.6504 -0.1541 -0.0812 -0.1646 213 MET A CG    
508  S SD    . MET A 72 ? 0.7892 0.8337 0.6321 -0.1447 -0.0602 -0.1478 213 MET A SD    
509  C CE    . MET A 72 ? 0.7777 0.8239 0.5925 -0.1060 -0.0606 -0.1352 213 MET A CE    
510  N N     . MET A 73 ? 0.8988 0.9650 0.8149 -0.2819 -0.0562 -0.1976 214 MET A N     
511  C CA    . MET A 73 ? 0.9750 1.0330 0.9028 -0.3319 -0.0491 -0.2124 214 MET A CA    
512  C C     . MET A 73 ? 1.0519 1.0595 0.9441 -0.3540 -0.0612 -0.2361 214 MET A C     
513  O O     . MET A 73 ? 1.1161 1.0355 0.9532 -0.3494 -0.0550 -0.2317 214 MET A O     
514  C CB    . MET A 73 ? 1.0199 1.0269 0.9324 -0.3441 -0.0225 -0.1918 214 MET A CB    
515  C CG    . MET A 73 ? 0.9750 1.0370 0.9267 -0.3318 -0.0101 -0.1739 214 MET A CG    
516  S SD    . MET A 73 ? 1.0470 1.2066 1.0681 -0.3691 -0.0064 -0.1894 214 MET A SD    
517  C CE    . MET A 73 ? 0.9690 1.1784 1.0206 -0.3381 0.0052  -0.1680 214 MET A CE    
518  C CA    . LYS B 7  ? 0.8926 1.3985 0.7906 -0.1648 -0.1769 -0.1430 148 LYS B CA    
519  C C     . LYS B 7  ? 0.9057 1.3419 0.7653 -0.1422 -0.1725 -0.1306 148 LYS B C     
520  O O     . LYS B 7  ? 0.9120 1.2830 0.7664 -0.1164 -0.1617 -0.1059 148 LYS B O     
521  N N     . ARG B 8  ? 0.9761 1.4348 0.8086 -0.1539 -0.1807 -0.1499 149 ARG B N     
522  C CA    . ARG B 8  ? 0.9883 1.3852 0.7810 -0.1390 -0.1757 -0.1438 149 ARG B CA    
523  C C     . ARG B 8  ? 0.9685 1.4222 0.7360 -0.0976 -0.1900 -0.1285 149 ARG B C     
524  O O     . ARG B 8  ? 1.0005 1.5361 0.7586 -0.1073 -0.2060 -0.1492 149 ARG B O     
525  C CB    . ARG B 8  ? 1.0489 1.4167 0.8213 -0.1859 -0.1695 -0.1804 149 ARG B CB    
526  C CG    . ARG B 8  ? 1.0856 1.3665 0.8200 -0.1791 -0.1565 -0.1769 149 ARG B CG    
527  C CD    . ARG B 8  ? 1.1389 1.3684 0.8514 -0.2246 -0.1413 -0.2107 149 ARG B CD    
528  N NE    . ARG B 8  ? 1.1440 1.3199 0.8760 -0.2468 -0.1217 -0.2133 149 ARG B NE    
529  C CZ    . ARG B 8  ? 1.1787 1.2808 0.8887 -0.2781 -0.0975 -0.2333 149 ARG B CZ    
530  N NH1   . ARG B 8  ? 1.2094 1.2758 0.8752 -0.2948 -0.0891 -0.2557 149 ARG B NH1   
531  N NH2   . ARG B 8  ? 1.1494 1.2075 0.8769 -0.2894 -0.0785 -0.2293 149 ARG B NH2   
532  N N     . MET B 9  ? 0.9204 1.3301 0.6732 -0.0535 -0.1816 -0.0941 150 MET B N     
533  C CA    . MET B 9  ? 0.9227 1.3728 0.6460 -0.0052 -0.1878 -0.0717 150 MET B CA    
534  C C     . MET B 9  ? 0.9353 1.3369 0.6154 0.0069  -0.1817 -0.0676 150 MET B C     
535  O O     . MET B 9  ? 0.9190 1.2349 0.5921 -0.0055 -0.1666 -0.0664 150 MET B O     
536  C CB    . MET B 9  ? 0.9020 1.3342 0.6295 0.0385  -0.1763 -0.0348 150 MET B CB    
537  N N     . ASP B 10 ? 0.9491 1.4138 0.5999 0.0335  -0.1933 -0.0649 151 ASP B N     
538  C CA    . ASP B 10 ? 0.9755 1.4010 0.5827 0.0516  -0.1868 -0.0573 151 ASP B CA    
539  C C     . ASP B 10 ? 0.9770 1.3151 0.5687 0.0852  -0.1621 -0.0204 151 ASP B C     
540  O O     . ASP B 10 ? 0.9936 1.3402 0.5786 0.1259  -0.1542 0.0087  151 ASP B O     
541  C CB    . ASP B 10 ? 1.0102 1.5337 0.5870 0.0822  -0.2041 -0.0576 151 ASP B CB    
542  N N     . CYS B 11 ? 0.9723 1.2275 0.5558 0.0672  -0.1472 -0.0228 152 CYS B N     
543  C CA    . CYS B 11 ? 0.9747 1.1513 0.5412 0.0892  -0.1218 0.0056  152 CYS B CA    
544  C C     . CYS B 11 ? 1.0146 1.1786 0.5330 0.1184  -0.1137 0.0196  152 CYS B C     
545  O O     . CYS B 11 ? 1.0046 1.1408 0.5089 0.1016  -0.1116 0.0069  152 CYS B O     
546  C CB    . CYS B 11 ? 0.9447 1.0537 0.5309 0.0549  -0.1095 -0.0044 152 CYS B CB    
547  S SG    . CYS B 11 ? 0.9746 1.0019 0.5449 0.0684  -0.0781 0.0217  152 CYS B SG    
548  N N     . PRO B 12 ? 1.0495 1.2287 0.5390 0.1657  -0.1056 0.0481  153 PRO B N     
549  C CA    . PRO B 12 ? 1.0992 1.2780 0.5374 0.2052  -0.0966 0.0673  153 PRO B CA    
550  C C     . PRO B 12 ? 1.1137 1.2045 0.5274 0.2040  -0.0688 0.0803  153 PRO B C     
551  O O     . PRO B 12 ? 1.1582 1.2512 0.5329 0.2236  -0.0658 0.0860  153 PRO B O     
552  N N     . ALA B 13 ? 1.0816 1.1031 0.5169 0.1818  -0.0481 0.0847  154 ALA B N     
553  C CA    . ALA B 13 ? 1.0926 1.0412 0.5096 0.1762  -0.0194 0.0957  154 ALA B CA    
554  C C     . ALA B 13 ? 1.0567 0.9977 0.4861 0.1413  -0.0268 0.0720  154 ALA B C     
555  O O     . ALA B 13 ? 1.0384 0.9353 0.4537 0.1367  -0.0058 0.0790  154 ALA B O     
556  C CB    . ALA B 13 ? 1.0922 0.9791 0.5229 0.1670  0.0087  0.1090  154 ALA B CB    
557  N N     . LEU B 14 ? 1.0402 1.0229 0.4938 0.1175  -0.0532 0.0447  155 LEU B N     
558  C CA    . LEU B 14 ? 1.0404 1.0187 0.4935 0.0925  -0.0603 0.0216  155 LEU B CA    
559  C C     . LEU B 14 ? 1.0700 1.0960 0.4892 0.1059  -0.0787 0.0098  155 LEU B C     
560  O O     . LEU B 14 ? 1.0527 1.1273 0.4591 0.1324  -0.0889 0.0187  155 LEU B O     
561  C CB    . LEU B 14 ? 1.0050 0.9873 0.4982 0.0569  -0.0711 -0.0017 155 LEU B CB    
562  C CG    . LEU B 14 ? 0.9841 0.9297 0.5110 0.0410  -0.0558 0.0046  155 LEU B CG    
563  C CD1   . LEU B 14 ? 0.9584 0.9079 0.5139 0.0122  -0.0650 -0.0176 155 LEU B CD1   
564  C CD2   . LEU B 14 ? 0.9897 0.8941 0.5064 0.0420  -0.0321 0.0167  155 LEU B CD2   
565  N N     . PRO B 15 ? 1.0989 1.1147 0.5002 0.0902  -0.0814 -0.0100 156 PRO B N     
566  C CA    . PRO B 15 ? 1.1490 1.2076 0.5140 0.0961  -0.0978 -0.0279 156 PRO B CA    
567  C C     . PRO B 15 ? 1.1589 1.2891 0.5372 0.0799  -0.1242 -0.0539 156 PRO B C     
568  O O     . PRO B 15 ? 1.1536 1.2900 0.5718 0.0597  -0.1287 -0.0600 156 PRO B O     
569  C CB    . PRO B 15 ? 1.1586 1.1730 0.5090 0.0739  -0.0895 -0.0468 156 PRO B CB    
570  C CG    . PRO B 15 ? 1.1310 1.0882 0.4967 0.0765  -0.0650 -0.0247 156 PRO B CG    
571  C CD    . PRO B 15 ? 1.0889 1.0505 0.4969 0.0711  -0.0650 -0.0140 156 PRO B CD    
572  N N     . PRO B 16 ? 1.1788 1.3682 0.5243 0.0867  -0.1410 -0.0708 157 PRO B N     
573  C CA    . PRO B 16 ? 1.1762 1.4519 0.5284 0.0666  -0.1668 -0.1023 157 PRO B CA    
574  C C     . PRO B 16 ? 1.1456 1.4037 0.5275 0.0117  -0.1692 -0.1375 157 PRO B C     
575  O O     . PRO B 16 ? 1.1351 1.3329 0.4997 -0.0159 -0.1578 -0.1586 157 PRO B O     
576  N N     . GLY B 17 ? 1.1233 1.4277 0.5459 0.0000  -0.1798 -0.1406 158 GLY B N     
577  C CA    . GLY B 17 ? 1.1116 1.4104 0.5634 -0.0518 -0.1813 -0.1733 158 GLY B CA    
578  C C     . GLY B 17 ? 1.0666 1.2884 0.5523 -0.0655 -0.1633 -0.1620 158 GLY B C     
579  O O     . GLY B 17 ? 1.0520 1.2650 0.5579 -0.1048 -0.1611 -0.1864 158 GLY B O     
580  N N     . TRP B 18 ? 1.0501 1.2181 0.5395 -0.0352 -0.1484 -0.1269 159 TRP B N     
581  C CA    . TRP B 18 ? 1.0056 1.1213 0.5304 -0.0412 -0.1341 -0.1121 159 TRP B CA    
582  C C     . TRP B 18 ? 0.9794 1.1462 0.5426 -0.0394 -0.1450 -0.1055 159 TRP B C     
583  O O     . TRP B 18 ? 0.9929 1.2217 0.5524 -0.0127 -0.1573 -0.0935 159 TRP B O     
584  C CB    . TRP B 18 ? 0.9858 1.0471 0.5050 -0.0133 -0.1156 -0.0799 159 TRP B CB    
585  C CG    . TRP B 18 ? 0.9982 1.0067 0.4904 -0.0179 -0.1013 -0.0851 159 TRP B CG    
586  C CD1   . TRP B 18 ? 1.0418 1.0486 0.4924 -0.0051 -0.1006 -0.0875 159 TRP B CD1   
587  C CD2   . TRP B 18 ? 0.9907 0.9440 0.4912 -0.0329 -0.0844 -0.0884 159 TRP B CD2   
588  N NE1   . TRP B 18 ? 1.0501 1.0015 0.4831 -0.0116 -0.0836 -0.0919 159 TRP B NE1   
589  C CE2   . TRP B 18 ? 1.0209 0.9406 0.4832 -0.0266 -0.0731 -0.0916 159 TRP B CE2   
590  C CE3   . TRP B 18 ? 0.9408 0.8731 0.4745 -0.0468 -0.0767 -0.0875 159 TRP B CE3   
591  C CZ2   . TRP B 18 ? 1.0251 0.8934 0.4813 -0.0306 -0.0533 -0.0920 159 TRP B CZ2   
592  C CZ3   . TRP B 18 ? 0.9373 0.8211 0.4644 -0.0503 -0.0579 -0.0879 159 TRP B CZ3   
593  C CH2   . TRP B 18 ? 0.9822 0.8355 0.4708 -0.0408 -0.0460 -0.0893 159 TRP B CH2   
594  N N     . LYS B 19 ? 0.9191 1.0617 0.5152 -0.0633 -0.1390 -0.1117 160 LYS B N     
595  C CA    . LYS B 19 ? 0.8881 1.0714 0.5217 -0.0608 -0.1463 -0.1035 160 LYS B CA    
596  C C     . LYS B 19 ? 0.8422 0.9675 0.5019 -0.0601 -0.1301 -0.0863 160 LYS B C     
597  O O     . LYS B 19 ? 0.8250 0.8939 0.4815 -0.0743 -0.1162 -0.0913 160 LYS B O     
598  C CB    . LYS B 19 ? 0.8916 1.1320 0.5422 -0.0968 -0.1593 -0.1355 160 LYS B CB    
599  C CG    . LYS B 19 ? 0.8958 1.2335 0.5329 -0.0939 -0.1809 -0.1509 160 LYS B CG    
600  N N     . LYS B 20 ? 0.8272 0.9698 0.5076 -0.0397 -0.1307 -0.0654 161 LYS B N     
601  C CA    . LYS B 20 ? 0.8108 0.9150 0.5185 -0.0406 -0.1181 -0.0522 161 LYS B CA    
602  C C     . LYS B 20 ? 0.7782 0.9174 0.5201 -0.0589 -0.1258 -0.0634 161 LYS B C     
603  O O     . LYS B 20 ? 0.7694 0.9736 0.5173 -0.0608 -0.1407 -0.0726 161 LYS B O     
604  C CB    . LYS B 20 ? 0.8270 0.9197 0.5273 -0.0072 -0.1091 -0.0235 161 LYS B CB    
605  C CG    . LYS B 20 ? 0.8037 0.8588 0.5254 -0.0076 -0.0946 -0.0112 161 LYS B CG    
606  C CD    . LYS B 20 ? 0.8399 0.8812 0.5449 0.0240  -0.0822 0.0138  161 LYS B CD    
607  C CE    . LYS B 20 ? 0.8239 0.8358 0.5485 0.0216  -0.0685 0.0219  161 LYS B CE    
608  N N     . GLU B 21 ? 0.7534 0.8561 0.5173 -0.0718 -0.1151 -0.0627 162 GLU B N     
609  C CA    . GLU B 21 ? 0.7419 0.8704 0.5388 -0.0859 -0.1184 -0.0688 162 GLU B CA    
610  C C     . GLU B 21 ? 0.7049 0.7972 0.5203 -0.0772 -0.1058 -0.0524 162 GLU B C     
611  O O     . GLU B 21 ? 0.6909 0.7365 0.4986 -0.0767 -0.0933 -0.0476 162 GLU B O     
612  C CB    . GLU B 21 ? 0.7597 0.8830 0.5603 -0.1228 -0.1161 -0.0958 162 GLU B CB    
613  C CG    . GLU B 21 ? 0.7455 0.8610 0.5764 -0.1382 -0.1082 -0.0980 162 GLU B CG    
614  C CD    . GLU B 21 ? 0.7705 0.8849 0.6028 -0.1763 -0.1023 -0.1248 162 GLU B CD    
615  O OE1   . GLU B 21 ? 0.8316 1.0049 0.6674 -0.1939 -0.1147 -0.1427 162 GLU B OE1   
616  O OE2   . GLU B 21 ? 0.7840 0.8421 0.6124 -0.1888 -0.0831 -0.1284 162 GLU B OE2   
617  N N     . GLU B 22 ? 0.6885 0.8096 0.5279 -0.0705 -0.1091 -0.0452 163 GLU B N     
618  C CA    . GLU B 22 ? 0.6638 0.7567 0.5195 -0.0650 -0.0981 -0.0337 163 GLU B CA    
619  C C     . GLU B 22 ? 0.6434 0.7568 0.5278 -0.0825 -0.0998 -0.0432 163 GLU B C     
620  O O     . GLU B 22 ? 0.6398 0.8062 0.5367 -0.0884 -0.1107 -0.0507 163 GLU B O     
621  C CB    . GLU B 22 ? 0.6879 0.7855 0.5371 -0.0364 -0.0953 -0.0141 163 GLU B CB    
622  C CG    . GLU B 22 ? 0.7051 0.7608 0.5599 -0.0335 -0.0798 -0.0051 163 GLU B CG    
623  C CD    . GLU B 22 ? 0.7603 0.7863 0.5905 -0.0101 -0.0661 0.0122  163 GLU B CD    
624  O OE1   . GLU B 22 ? 0.7941 0.7982 0.6292 -0.0062 -0.0541 0.0182  163 GLU B OE1   
625  O OE2   . GLU B 22 ? 0.8412 0.8599 0.6435 0.0038  -0.0640 0.0195  163 GLU B OE2   
626  N N     . VAL B 23 ? 0.6138 0.6918 0.5081 -0.0908 -0.0880 -0.0434 164 VAL B N     
627  C CA    . VAL B 23 ? 0.6020 0.6883 0.5203 -0.1055 -0.0843 -0.0498 164 VAL B CA    
628  C C     . VAL B 23 ? 0.5804 0.6512 0.5125 -0.0934 -0.0758 -0.0374 164 VAL B C     
629  O O     . VAL B 23 ? 0.6145 0.6530 0.5399 -0.0912 -0.0656 -0.0346 164 VAL B O     
630  C CB    . VAL B 23 ? 0.6128 0.6670 0.5225 -0.1274 -0.0732 -0.0639 164 VAL B CB    
631  C CG1   . VAL B 23 ? 0.6128 0.6746 0.5443 -0.1438 -0.0658 -0.0701 164 VAL B CG1   
632  C CG2   . VAL B 23 ? 0.6519 0.7103 0.5401 -0.1426 -0.0782 -0.0800 164 VAL B CG2   
633  N N     . ILE B 24 ? 0.5585 0.6592 0.5094 -0.0855 -0.0796 -0.0312 165 ILE B N     
634  C CA    . ILE B 24 ? 0.5421 0.6309 0.5038 -0.0742 -0.0715 -0.0213 165 ILE B CA    
635  C C     . ILE B 24 ? 0.5216 0.5935 0.4940 -0.0862 -0.0617 -0.0264 165 ILE B C     
636  O O     . ILE B 24 ? 0.5124 0.5906 0.4916 -0.1024 -0.0602 -0.0353 165 ILE B O     
637  C CB    . ILE B 24 ? 0.5442 0.6726 0.5226 -0.0617 -0.0764 -0.0138 165 ILE B CB    
638  C CG1   . ILE B 24 ? 0.5664 0.7119 0.5268 -0.0390 -0.0823 -0.0036 165 ILE B CG1   
639  C CG2   . ILE B 24 ? 0.5306 0.6439 0.5182 -0.0521 -0.0664 -0.0062 165 ILE B CG2   
640  C CD1   . ILE B 24 ? 0.5794 0.6769 0.5134 -0.0211 -0.0702 0.0079  165 ILE B CD1   
641  N N     . ARG B 25 ? 0.5197 0.5696 0.4888 -0.0788 -0.0528 -0.0217 166 ARG B N     
642  C CA    . ARG B 25 ? 0.4846 0.5254 0.4606 -0.0806 -0.0421 -0.0223 166 ARG B CA    
643  C C     . ARG B 25 ? 0.4865 0.5446 0.4833 -0.0772 -0.0403 -0.0182 166 ARG B C     
644  O O     . ARG B 25 ? 0.4542 0.5195 0.4544 -0.0667 -0.0422 -0.0130 166 ARG B O     
645  C CB    . ARG B 25 ? 0.4716 0.5023 0.4374 -0.0729 -0.0354 -0.0205 166 ARG B CB    
646  C CG    . ARG B 25 ? 0.4885 0.5059 0.4364 -0.0742 -0.0315 -0.0232 166 ARG B CG    
647  C CD    . ARG B 25 ? 0.4790 0.5043 0.4195 -0.0682 -0.0259 -0.0230 166 ARG B CD    
648  N NE    . ARG B 25 ? 0.4652 0.4835 0.3878 -0.0669 -0.0229 -0.0238 166 ARG B NE    
649  C CZ    . ARG B 25 ? 0.4303 0.4652 0.3457 -0.0584 -0.0152 -0.0228 166 ARG B CZ    
650  N NH1   . ARG B 25 ? 0.4148 0.4783 0.3392 -0.0524 -0.0110 -0.0227 166 ARG B NH1   
651  N NH2   . ARG B 25 ? 0.4316 0.4611 0.3296 -0.0539 -0.0112 -0.0219 166 ARG B NH2   
652  N N     . LYS B 26 ? 0.4955 0.5531 0.5016 -0.0855 -0.0324 -0.0204 167 LYS B N     
653  C CA    . LYS B 26 ? 0.4983 0.5794 0.5268 -0.0866 -0.0310 -0.0175 167 LYS B CA    
654  C C     . LYS B 26 ? 0.5071 0.5839 0.5401 -0.0727 -0.0219 -0.0102 167 LYS B C     
655  O O     . LYS B 26 ? 0.4967 0.5935 0.5455 -0.0671 -0.0224 -0.0056 167 LYS B O     
656  C CB    . LYS B 26 ? 0.5185 0.6014 0.5544 -0.1084 -0.0234 -0.0256 167 LYS B CB    
657  C CG    . LYS B 26 ? 0.5370 0.6395 0.5711 -0.1273 -0.0341 -0.0378 167 LYS B CG    
658  N N     . SER B 27 ? 0.5122 0.5701 0.5302 -0.0648 -0.0137 -0.0090 168 SER B N     
659  C CA    . SER B 27 ? 0.5142 0.5754 0.5333 -0.0513 -0.0039 -0.0035 168 SER B CA    
660  C C     . SER B 27 ? 0.4968 0.5603 0.4995 -0.0407 -0.0021 -0.0047 168 SER B C     
661  O O     . SER B 27 ? 0.5088 0.5668 0.4998 -0.0446 -0.0061 -0.0087 168 SER B O     
662  C CB    . SER B 27 ? 0.5540 0.6008 0.5736 -0.0525 0.0131  0.0008  168 SER B CB    
663  O OG    . SER B 27 ? 0.6072 0.6269 0.6035 -0.0478 0.0260  0.0023  168 SER B OG    
664  N N     . GLY B 28 ? 0.4766 0.5568 0.4794 -0.0278 0.0034  -0.0025 169 GLY B N     
665  C CA    . GLY B 28 ? 0.4516 0.5531 0.4410 -0.0164 0.0070  -0.0045 169 GLY B CA    
666  C C     . GLY B 28 ? 0.4425 0.5598 0.4308 -0.0267 -0.0012 -0.0164 169 GLY B C     
667  O O     . GLY B 28 ? 0.4482 0.5497 0.4416 -0.0364 -0.0062 -0.0195 169 GLY B O     
668  N N     . LEU B 29 ? 0.4418 0.5915 0.4206 -0.0242 0.0002  -0.0233 170 LEU B N     
669  C CA    . LEU B 29 ? 0.4606 0.6245 0.4352 -0.0419 -0.0026 -0.0394 170 LEU B CA    
670  C C     . LEU B 29 ? 0.4596 0.5875 0.4299 -0.0592 -0.0063 -0.0427 170 LEU B C     
671  O O     . LEU B 29 ? 0.4509 0.5624 0.4147 -0.0728 -0.0032 -0.0520 170 LEU B O     
672  C CB    . LEU B 29 ? 0.4761 0.6947 0.4439 -0.0410 -0.0006 -0.0484 170 LEU B CB    
673  C CG    . LEU B 29 ? 0.5143 0.7889 0.4804 -0.0207 0.0033  -0.0476 170 LEU B CG    
674  C CD1   . LEU B 29 ? 0.5146 0.8578 0.4758 -0.0262 0.0029  -0.0610 170 LEU B CD1   
675  C CD2   . LEU B 29 ? 0.5091 0.7869 0.4781 -0.0223 0.0046  -0.0543 170 LEU B CD2   
676  N N     . SER B 30 ? 0.4487 0.5603 0.4173 -0.0570 -0.0098 -0.0349 171 SER B N     
677  C CA    . SER B 30 ? 0.4408 0.5216 0.4025 -0.0685 -0.0134 -0.0357 171 SER B CA    
678  C C     . SER B 30 ? 0.4460 0.5014 0.4139 -0.0645 -0.0188 -0.0271 171 SER B C     
679  O O     . SER B 30 ? 0.4436 0.4827 0.4050 -0.0674 -0.0232 -0.0247 171 SER B O     
680  C CB    . SER B 30 ? 0.4334 0.5174 0.3867 -0.0692 -0.0144 -0.0347 171 SER B CB    
681  O OG    . SER B 30 ? 0.4422 0.5208 0.3963 -0.0570 -0.0144 -0.0259 171 SER B OG    
682  N N     . ALA B 31 ? 0.4426 0.5024 0.4227 -0.0572 -0.0182 -0.0227 172 ALA B N     
683  C CA    . ALA B 31 ? 0.4594 0.5124 0.4494 -0.0537 -0.0233 -0.0154 172 ALA B CA    
684  C C     . ALA B 31 ? 0.4557 0.4919 0.4337 -0.0524 -0.0248 -0.0137 172 ALA B C     
685  O O     . ALA B 31 ? 0.4860 0.5055 0.4494 -0.0542 -0.0167 -0.0180 172 ALA B O     
686  C CB    . ALA B 31 ? 0.4524 0.5164 0.4562 -0.0452 -0.0195 -0.0112 172 ALA B CB    
687  N N     . GLY B 32 ? 0.4507 0.4911 0.4308 -0.0492 -0.0326 -0.0081 173 GLY B N     
688  C CA    . GLY B 32 ? 0.4878 0.5122 0.4498 -0.0393 -0.0309 -0.0022 173 GLY B CA    
689  C C     . GLY B 32 ? 0.5067 0.5091 0.4467 -0.0448 -0.0289 -0.0045 173 GLY B C     
690  O O     . GLY B 32 ? 0.5248 0.5180 0.4490 -0.0330 -0.0285 0.0033  173 GLY B O     
691  N N     . LYS B 33 ? 0.5120 0.5109 0.4497 -0.0590 -0.0265 -0.0136 174 LYS B N     
692  C CA    . LYS B 33 ? 0.5385 0.5242 0.4586 -0.0651 -0.0254 -0.0155 174 LYS B CA    
693  C C     . LYS B 33 ? 0.5255 0.5266 0.4503 -0.0637 -0.0385 -0.0137 174 LYS B C     
694  O O     . LYS B 33 ? 0.5270 0.5469 0.4685 -0.0640 -0.0453 -0.0141 174 LYS B O     
695  C CB    . LYS B 33 ? 0.5436 0.5353 0.4619 -0.0790 -0.0189 -0.0254 174 LYS B CB    
696  C CG    . LYS B 33 ? 0.5725 0.5667 0.4905 -0.0889 -0.0074 -0.0350 174 LYS B CG    
697  C CD    . LYS B 33 ? 0.6323 0.5882 0.5260 -0.0970 0.0081  -0.0376 174 LYS B CD    
698  C CE    . LYS B 33 ? 0.6589 0.6031 0.5450 -0.1100 0.0236  -0.0499 174 LYS B CE    
699  N NZ    . LYS B 33 ? 0.7320 0.6253 0.5860 -0.1221 0.0453  -0.0529 174 LYS B NZ    
700  N N     . SER B 34 ? 0.5468 0.5383 0.4547 -0.0648 -0.0397 -0.0135 175 SER B N     
701  C CA    . SER B 34 ? 0.5403 0.5429 0.4454 -0.0660 -0.0504 -0.0153 175 SER B CA    
702  C C     . SER B 34 ? 0.5364 0.5283 0.4283 -0.0727 -0.0472 -0.0202 175 SER B C     
703  O O     . SER B 34 ? 0.5310 0.5120 0.4129 -0.0743 -0.0384 -0.0196 175 SER B O     
704  C CB    . SER B 34 ? 0.5730 0.5797 0.4635 -0.0529 -0.0556 -0.0078 175 SER B CB    
705  O OG    . SER B 34 ? 0.5922 0.5702 0.4585 -0.0481 -0.0449 -0.0026 175 SER B OG    
706  N N     . ASP B 35 ? 0.5310 0.5256 0.4216 -0.0781 -0.0515 -0.0261 176 ASP B N     
707  C CA    . ASP B 35 ? 0.5556 0.5372 0.4268 -0.0795 -0.0483 -0.0292 176 ASP B CA    
708  C C     . ASP B 35 ? 0.5761 0.5592 0.4303 -0.0788 -0.0576 -0.0310 176 ASP B C     
709  O O     . ASP B 35 ? 0.5670 0.5691 0.4270 -0.0824 -0.0675 -0.0355 176 ASP B O     
710  C CB    . ASP B 35 ? 0.5780 0.5498 0.4477 -0.0834 -0.0417 -0.0346 176 ASP B CB    
711  C CG    . ASP B 35 ? 0.5896 0.5670 0.4721 -0.0776 -0.0322 -0.0305 176 ASP B CG    
712  O OD1   . ASP B 35 ? 0.6055 0.5897 0.4820 -0.0698 -0.0245 -0.0274 176 ASP B OD1   
713  O OD2   . ASP B 35 ? 0.5886 0.5712 0.4873 -0.0801 -0.0324 -0.0306 176 ASP B OD2   
714  N N     . VAL B 36 ? 0.5994 0.5704 0.4328 -0.0742 -0.0540 -0.0284 177 VAL B N     
715  C CA    . VAL B 36 ? 0.6362 0.6099 0.4488 -0.0700 -0.0615 -0.0292 177 VAL B CA    
716  C C     . VAL B 36 ? 0.6746 0.6341 0.4691 -0.0765 -0.0590 -0.0390 177 VAL B C     
717  O O     . VAL B 36 ? 0.6872 0.6305 0.4758 -0.0745 -0.0474 -0.0372 177 VAL B O     
718  C CB    . VAL B 36 ? 0.6646 0.6269 0.4606 -0.0583 -0.0549 -0.0178 177 VAL B CB    
719  C CG1   . VAL B 36 ? 0.6943 0.6617 0.4639 -0.0488 -0.0619 -0.0168 177 VAL B CG1   
720  C CG2   . VAL B 36 ? 0.6714 0.6330 0.4762 -0.0505 -0.0508 -0.0082 177 VAL B CG2   
721  N N     . TYR B 37 ? 0.6937 0.6627 0.4779 -0.0844 -0.0683 -0.0506 178 TYR B N     
722  C CA    . TYR B 37 ? 0.7485 0.6948 0.5068 -0.0924 -0.0631 -0.0629 178 TYR B CA    
723  C C     . TYR B 37 ? 0.7772 0.7365 0.5103 -0.0883 -0.0729 -0.0669 178 TYR B C     
724  O O     . TYR B 37 ? 0.7890 0.7858 0.5270 -0.0832 -0.0865 -0.0652 178 TYR B O     
725  C CB    . TYR B 37 ? 0.7668 0.7043 0.5277 -0.1138 -0.0595 -0.0801 178 TYR B CB    
726  C CG    . TYR B 37 ? 0.7484 0.6752 0.5319 -0.1145 -0.0491 -0.0745 178 TYR B CG    
727  C CD1   . TYR B 37 ? 0.7324 0.6317 0.5091 -0.1014 -0.0329 -0.0649 178 TYR B CD1   
728  C CD2   . TYR B 37 ? 0.7431 0.6961 0.5543 -0.1247 -0.0558 -0.0772 178 TYR B CD2   
729  C CE1   . TYR B 37 ? 0.7382 0.6345 0.5324 -0.0978 -0.0236 -0.0588 178 TYR B CE1   
730  C CE2   . TYR B 37 ? 0.7212 0.6653 0.5512 -0.1232 -0.0458 -0.0710 178 TYR B CE2   
731  C CZ    . TYR B 37 ? 0.7256 0.6406 0.5459 -0.1095 -0.0299 -0.0621 178 TYR B CZ    
732  O OH    . TYR B 37 ? 0.7380 0.6509 0.5746 -0.1044 -0.0204 -0.0551 178 TYR B OH    
733  N N     . TYR B 38 ? 0.8002 0.7326 0.5037 -0.0863 -0.0650 -0.0710 179 TYR B N     
734  C CA    . TYR B 38 ? 0.8299 0.7752 0.5051 -0.0849 -0.0742 -0.0792 179 TYR B CA    
735  C C     . TYR B 38 ? 0.8847 0.8093 0.5332 -0.1054 -0.0701 -0.1039 179 TYR B C     
736  O O     . TYR B 38 ? 0.9051 0.7856 0.5446 -0.1137 -0.0527 -0.1099 179 TYR B O     
737  C CB    . TYR B 38 ? 0.8292 0.7646 0.4847 -0.0634 -0.0690 -0.0631 179 TYR B CB    
738  C CG    . TYR B 38 ? 0.7816 0.7322 0.4505 -0.0468 -0.0700 -0.0428 179 TYR B CG    
739  C CD1   . TYR B 38 ? 0.7795 0.7574 0.4354 -0.0310 -0.0797 -0.0357 179 TYR B CD1   
740  C CD2   . TYR B 38 ? 0.7542 0.6901 0.4433 -0.0456 -0.0579 -0.0311 179 TYR B CD2   
741  C CE1   . TYR B 38 ? 0.7716 0.7469 0.4299 -0.0124 -0.0727 -0.0149 179 TYR B CE1   
742  C CE2   . TYR B 38 ? 0.7404 0.6768 0.4352 -0.0351 -0.0526 -0.0155 179 TYR B CE2   
743  C CZ    . TYR B 38 ? 0.7695 0.7177 0.4467 -0.0177 -0.0577 -0.0063 179 TYR B CZ    
744  O OH    . TYR B 38 ? 0.7635 0.6957 0.4390 -0.0059 -0.0446 0.0103  179 TYR B OH    
745  N N     . PHE B 39 ? 0.9161 0.8738 0.5480 -0.1128 -0.0841 -0.1187 180 PHE B N     
746  C CA    . PHE B 39 ? 0.9900 0.9304 0.5901 -0.1365 -0.0799 -0.1467 180 PHE B CA    
747  C C     . PHE B 39 ? 1.0130 0.9683 0.5780 -0.1239 -0.0879 -0.1495 180 PHE B C     
748  O O     . PHE B 39 ? 1.0128 1.0248 0.5819 -0.1095 -0.1059 -0.1425 180 PHE B O     
749  C CB    . PHE B 39 ? 1.0167 0.9997 0.6333 -0.1682 -0.0904 -0.1711 180 PHE B CB    
750  C CG    . PHE B 39 ? 1.0069 0.9767 0.6569 -0.1802 -0.0815 -0.1679 180 PHE B CG    
751  C CD1   . PHE B 39 ? 1.0473 0.9518 0.6827 -0.2001 -0.0568 -0.1801 180 PHE B CD1   
752  C CD2   . PHE B 39 ? 0.9551 0.9727 0.6455 -0.1686 -0.0944 -0.1516 180 PHE B CD2   
753  C CE1   . PHE B 39 ? 1.0223 0.9140 0.6847 -0.2088 -0.0466 -0.1761 180 PHE B CE1   
754  C CE2   . PHE B 39 ? 0.9533 0.9602 0.6726 -0.1794 -0.0860 -0.1493 180 PHE B CE2   
755  C CZ    . PHE B 39 ? 0.9826 0.9282 0.6890 -0.1990 -0.0626 -0.1609 180 PHE B CZ    
756  N N     . SER B 40 ? 1.0548 0.9577 0.5812 -0.1249 -0.0722 -0.1576 181 SER B N     
757  C CA    . SER B 40 ? 1.0889 0.9993 0.5745 -0.1175 -0.0772 -0.1660 181 SER B CA    
758  C C     . SER B 40 ? 1.1380 1.0913 0.6081 -0.1496 -0.0911 -0.2026 181 SER B C     
759  O O     . SER B 40 ? 1.1169 1.0935 0.6104 -0.1793 -0.0951 -0.2206 181 SER B O     
760  C CB    . SER B 40 ? 1.1197 0.9573 0.5666 -0.1097 -0.0527 -0.1654 181 SER B CB    
761  O OG    . SER B 40 ? 1.1685 0.9527 0.5937 -0.1377 -0.0339 -0.1906 181 SER B OG    
762  N N     . PRO B 41 ? 1.2054 1.1777 0.6366 -0.1454 -0.0985 -0.2151 182 PRO B N     
763  C CA    . PRO B 41 ? 1.2540 1.2708 0.6660 -0.1827 -0.1097 -0.2569 182 PRO B CA    
764  C C     . PRO B 41 ? 1.3148 1.2690 0.7084 -0.2305 -0.0872 -0.2926 182 PRO B C     
765  O O     . PRO B 41 ? 1.3178 1.3163 0.7202 -0.2720 -0.0945 -0.3257 182 PRO B O     
766  C CB    . PRO B 41 ? 1.2902 1.3210 0.6561 -0.1643 -0.1160 -0.2607 182 PRO B CB    
767  C CG    . PRO B 41 ? 1.2486 1.2891 0.6275 -0.1135 -0.1203 -0.2158 182 PRO B CG    
768  C CD    . PRO B 41 ? 1.2008 1.1822 0.6120 -0.1060 -0.1026 -0.1905 182 PRO B CD    
769  N N     . SER B 42 ? 1.3649 1.2193 0.7327 -0.2233 -0.0573 -0.2846 183 SER B N     
770  C CA    . SER B 42 ? 1.4218 1.1949 0.7654 -0.2599 -0.0263 -0.3106 183 SER B CA    
771  C C     . SER B 42 ? 1.3963 1.1786 0.7852 -0.2820 -0.0235 -0.3108 183 SER B C     
772  O O     . SER B 42 ? 1.4260 1.1841 0.8028 -0.3283 -0.0080 -0.3444 183 SER B O     
773  C CB    . SER B 42 ? 1.4453 1.1159 0.7528 -0.2313 0.0067  -0.2907 183 SER B CB    
774  N N     . GLY B 43 ? 1.3329 1.1476 0.7713 -0.2507 -0.0359 -0.2744 184 GLY B N     
775  C CA    . GLY B 43 ? 1.2900 1.1069 0.7704 -0.2623 -0.0313 -0.2678 184 GLY B CA    
776  C C     . GLY B 43 ? 1.2981 1.0339 0.7753 -0.2390 -0.0029 -0.2426 184 GLY B C     
777  O O     . GLY B 43 ? 1.2708 0.9862 0.7682 -0.2514 0.0101  -0.2414 184 GLY B O     
778  N N     . LYS B 44 ? 1.3135 1.0099 0.7646 -0.2036 0.0074  -0.2221 185 LYS B N     
779  C CA    . LYS B 44 ? 1.2933 0.9445 0.7493 -0.1704 0.0280  -0.1915 185 LYS B CA    
780  C C     . LYS B 44 ? 1.1909 0.9041 0.7045 -0.1507 0.0068  -0.1642 185 LYS B C     
781  O O     . LYS B 44 ? 1.1690 0.9366 0.6999 -0.1383 -0.0163 -0.1543 185 LYS B O     
782  C CB    . LYS B 44 ? 1.3209 0.9336 0.7371 -0.1376 0.0425  -0.1775 185 LYS B CB    
783  N N     . LYS B 45 ? 1.1280 0.8271 0.6656 -0.1471 0.0182  -0.1525 186 LYS B N     
784  C CA    . LYS B 45 ? 1.0206 0.7715 0.6100 -0.1348 0.0017  -0.1318 186 LYS B CA    
785  C C     . LYS B 45 ? 0.9525 0.7051 0.5467 -0.0994 0.0071  -0.1043 186 LYS B C     
786  O O     . LYS B 45 ? 0.9721 0.6829 0.5408 -0.0818 0.0304  -0.0966 186 LYS B O     
787  C CB    . LYS B 45 ? 1.0207 0.7570 0.6302 -0.1488 0.0131  -0.1342 186 LYS B CB    
788  C CG    . LYS B 45 ? 0.9600 0.7488 0.6213 -0.1431 -0.0037 -0.1191 186 LYS B CG    
789  C CD    . LYS B 45 ? 0.9684 0.7347 0.6427 -0.1539 0.0124  -0.1205 186 LYS B CD    
790  C CE    . LYS B 45 ? 0.9118 0.7290 0.6347 -0.1502 -0.0036 -0.1083 186 LYS B CE    
791  N N     . PHE B 46 ? 0.8652 0.6674 0.4905 -0.0892 -0.0113 -0.0899 187 PHE B N     
792  C CA    . PHE B 46 ? 0.8277 0.6428 0.4626 -0.0645 -0.0061 -0.0681 187 PHE B CA    
793  C C     . PHE B 46 ? 0.7579 0.6072 0.4356 -0.0637 -0.0136 -0.0569 187 PHE B C     
794  O O     . PHE B 46 ? 0.7419 0.6162 0.4402 -0.0742 -0.0296 -0.0596 187 PHE B O     
795  C CB    . PHE B 46 ? 0.8284 0.6576 0.4484 -0.0553 -0.0133 -0.0632 187 PHE B CB    
796  C CG    . PHE B 46 ? 0.8912 0.6860 0.4659 -0.0529 -0.0040 -0.0736 187 PHE B CG    
797  C CD1   . PHE B 46 ? 0.9298 0.7263 0.4837 -0.0670 -0.0159 -0.0911 187 PHE B CD1   
798  C CD2   . PHE B 46 ? 0.9191 0.6826 0.4691 -0.0350 0.0181  -0.0667 187 PHE B CD2   
799  C CE1   . PHE B 46 ? 1.0040 0.7648 0.5111 -0.0670 -0.0056 -0.1041 187 PHE B CE1   
800  C CE2   . PHE B 46 ? 0.9950 0.7176 0.4970 -0.0305 0.0308  -0.0762 187 PHE B CE2   
801  C CZ    . PHE B 46 ? 1.0250 0.7420 0.5043 -0.0489 0.0191  -0.0965 187 PHE B CZ    
802  N N     . ARG B 47 ? 0.7101 0.5643 0.3981 -0.0497 -0.0011 -0.0449 188 ARG B N     
803  C CA    . ARG B 47 ? 0.6678 0.5523 0.3926 -0.0510 -0.0057 -0.0378 188 ARG B CA    
804  C C     . ARG B 47 ? 0.6412 0.5599 0.3815 -0.0448 -0.0054 -0.0274 188 ARG B C     
805  O O     . ARG B 47 ? 0.6162 0.5591 0.3836 -0.0494 -0.0081 -0.0247 188 ARG B O     
806  C CB    . ARG B 47 ? 0.6592 0.5326 0.3867 -0.0434 0.0081  -0.0352 188 ARG B CB    
807  C CG    . ARG B 47 ? 0.6963 0.5230 0.4012 -0.0527 0.0177  -0.0465 188 ARG B CG    
808  C CD    . ARG B 47 ? 0.6966 0.5118 0.4093 -0.0474 0.0313  -0.0420 188 ARG B CD    
809  N NE    . ARG B 47 ? 0.6996 0.5109 0.3953 -0.0161 0.0525  -0.0268 188 ARG B NE    
810  C CZ    . ARG B 47 ? 0.6746 0.5046 0.3835 0.0001  0.0609  -0.0156 188 ARG B CZ    
811  N NH1   . ARG B 47 ? 0.6427 0.4941 0.3847 -0.0136 0.0493  -0.0179 188 ARG B NH1   
812  N NH2   . ARG B 47 ? 0.6910 0.5252 0.3785 0.0347  0.0813  -0.0006 188 ARG B NH2   
813  N N     . SER B 48 ? 0.6539 0.5741 0.3762 -0.0380 -0.0006 -0.0237 189 SER B N     
814  C CA    . SER B 48 ? 0.6471 0.5990 0.3819 -0.0387 0.0038  -0.0170 189 SER B CA    
815  C C     . SER B 48 ? 0.6909 0.6352 0.4033 -0.0359 0.0070  -0.0140 189 SER B C     
816  O O     . SER B 48 ? 0.6934 0.6123 0.3775 -0.0280 0.0071  -0.0165 189 SER B O     
817  C CB    . SER B 48 ? 0.6325 0.6188 0.3744 -0.0261 0.0166  -0.0120 189 SER B CB    
818  O OG    . SER B 48 ? 0.6459 0.6277 0.3609 -0.0073 0.0283  -0.0070 189 SER B OG    
819  N N     . LYS B 49 ? 0.7199 0.6832 0.4419 -0.0441 0.0126  -0.0099 190 LYS B N     
820  C CA    . LYS B 49 ? 0.7639 0.7187 0.4645 -0.0419 0.0194  -0.0050 190 LYS B CA    
821  C C     . LYS B 49 ? 0.7764 0.7472 0.4617 -0.0280 0.0310  -0.0014 190 LYS B C     
822  O O     . LYS B 49 ? 0.8179 0.7676 0.4751 -0.0187 0.0327  0.0008  190 LYS B O     
823  C CB    . LYS B 49 ? 0.7906 0.7515 0.5014 -0.0578 0.0291  -0.0022 190 LYS B CB    
824  C CG    . LYS B 49 ? 0.8220 0.7713 0.5093 -0.0564 0.0417  0.0046  190 LYS B CG    
825  C CD    . LYS B 49 ? 0.8487 0.7801 0.5362 -0.0728 0.0560  0.0076  190 LYS B CD    
826  C CE    . LYS B 49 ? 0.8842 0.7902 0.5404 -0.0663 0.0699  0.0176  190 LYS B CE    
827  N NZ    . LYS B 49 ? 0.9296 0.8143 0.5828 -0.0866 0.0945  0.0196  190 LYS B NZ    
828  N N     . PRO B 50 ? 0.7710 0.7835 0.4721 -0.0225 0.0395  -0.0001 191 PRO B N     
829  C CA    . PRO B 50 ? 0.7804 0.8082 0.4613 0.0000  0.0518  0.0062  191 PRO B CA    
830  C C     . PRO B 50 ? 0.8002 0.7778 0.4454 0.0199  0.0520  0.0057  191 PRO B C     
831  O O     . PRO B 50 ? 0.8339 0.8015 0.4506 0.0356  0.0616  0.0100  191 PRO B O     
832  C CB    . PRO B 50 ? 0.7667 0.8567 0.4707 0.0076  0.0592  0.0087  191 PRO B CB    
833  C CG    . PRO B 50 ? 0.7503 0.8696 0.4883 -0.0221 0.0546  0.0009  191 PRO B CG    
834  C CD    . PRO B 50 ? 0.7524 0.8108 0.4869 -0.0347 0.0412  -0.0034 191 PRO B CD    
835  N N     . GLN B 51 ? 0.7944 0.7397 0.4389 0.0175  0.0448  -0.0007 192 GLN B N     
836  C CA    . GLN B 51 ? 0.8380 0.7267 0.4446 0.0277  0.0495  -0.0065 192 GLN B CA    
837  C C     . GLN B 51 ? 0.8442 0.7002 0.4262 0.0172  0.0401  -0.0155 192 GLN B C     
838  O O     . GLN B 51 ? 0.8796 0.6998 0.4218 0.0270  0.0486  -0.0198 192 GLN B O     
839  C CB    . GLN B 51 ? 0.8444 0.7107 0.4611 0.0186  0.0452  -0.0138 192 GLN B CB    
840  C CG    . GLN B 51 ? 0.9111 0.7153 0.4893 0.0234  0.0578  -0.0222 192 GLN B CG    
841  C CD    . GLN B 51 ? 0.9238 0.7096 0.5172 0.0081  0.0551  -0.0302 192 GLN B CD    
842  O OE1   . GLN B 51 ? 0.8678 0.6876 0.5008 -0.0063 0.0389  -0.0304 192 GLN B OE1   
843  N NE2   . GLN B 51 ? 0.9710 0.6978 0.5291 0.0112  0.0744  -0.0368 192 GLN B NE2   
844  N N     . LEU B 52 ? 0.8089 0.6778 0.4119 -0.0006 0.0237  -0.0183 193 LEU B N     
845  C CA    . LEU B 52 ? 0.8286 0.6840 0.4121 -0.0060 0.0131  -0.0235 193 LEU B CA    
846  C C     . LEU B 52 ? 0.8593 0.7179 0.4196 0.0073  0.0235  -0.0145 193 LEU B C     
847  O O     . LEU B 52 ? 0.8663 0.7016 0.3906 0.0134  0.0232  -0.0202 193 LEU B O     
848  C CB    . LEU B 52 ? 0.7954 0.6693 0.4056 -0.0185 -0.0008 -0.0216 193 LEU B CB    
849  C CG    . LEU B 52 ? 0.8221 0.6936 0.4146 -0.0183 -0.0131 -0.0237 193 LEU B CG    
850  C CD1   . LEU B 52 ? 0.8441 0.7043 0.4170 -0.0254 -0.0244 -0.0422 193 LEU B CD1   
851  C CD2   . LEU B 52 ? 0.8027 0.6898 0.4189 -0.0221 -0.0198 -0.0161 193 LEU B CD2   
852  N N     . ALA B 53 ? 0.8484 0.7392 0.4292 0.0091  0.0337  -0.0026 194 ALA B N     
853  C CA    . ALA B 53 ? 0.8873 0.7893 0.4527 0.0183  0.0466  0.0068  194 ALA B CA    
854  C C     . ALA B 53 ? 0.9368 0.8283 0.4720 0.0399  0.0591  0.0079  194 ALA B C     
855  O O     . ALA B 53 ? 0.9837 0.8617 0.4879 0.0508  0.0652  0.0106  194 ALA B O     
856  C CB    . ALA B 53 ? 0.8533 0.7993 0.4507 0.0076  0.0576  0.0146  194 ALA B CB    
857  N N     . ARG B 54 ? 0.9525 0.8463 0.4919 0.0497  0.0655  0.0073  195 ARG B N     
858  C CA    . ARG B 54 ? 1.0202 0.8938 0.5232 0.0767  0.0830  0.0108  195 ARG B CA    
859  C C     . ARG B 54 ? 1.0478 0.8561 0.5033 0.0772  0.0819  -0.0024 195 ARG B C     
860  O O     . ARG B 54 ? 1.0753 0.8646 0.4926 0.0947  0.0943  0.0000  195 ARG B O     
861  C CB    . ARG B 54 ? 1.0525 0.9338 0.5631 0.0920  0.0936  0.0151  195 ARG B CB    
862  C CG    . ARG B 54 ? 1.0673 1.0235 0.6028 0.1093  0.1051  0.0302  195 ARG B CG    
863  C CD    . ARG B 54 ? 1.1181 1.0729 0.6374 0.1428  0.1230  0.0395  195 ARG B CD    
864  N NE    . ARG B 54 ? 1.1491 1.0484 0.6626 0.1349  0.1199  0.0308  195 ARG B NE    
865  C CZ    . ARG B 54 ? 1.1109 1.0346 0.6618 0.1191  0.1083  0.0278  195 ARG B CZ    
866  N NH1   . ARG B 54 ? 1.0949 0.9635 0.6354 0.1129  0.1093  0.0203  195 ARG B NH1   
867  N NH2   . ARG B 54 ? 1.0634 1.0642 0.6601 0.1068  0.0979  0.0303  195 ARG B NH2   
868  N N     . TYR B 55 ? 1.0357 0.8159 0.4939 0.0560  0.0676  -0.0181 196 TYR B N     
869  C CA    . TYR B 55 ? 1.0774 0.8085 0.4953 0.0457  0.0633  -0.0376 196 TYR B CA    
870  C C     . TYR B 55 ? 1.0891 0.8282 0.4871 0.0457  0.0538  -0.0392 196 TYR B C     
871  O O     . TYR B 55 ? 1.1278 0.8318 0.4783 0.0523  0.0615  -0.0490 196 TYR B O     
872  C CB    . TYR B 55 ? 1.0689 0.7920 0.5047 0.0179  0.0474  -0.0548 196 TYR B CB    
873  C CG    . TYR B 55 ? 1.1252 0.8123 0.5226 -0.0007 0.0422  -0.0809 196 TYR B CG    
874  C CD1   . TYR B 55 ? 1.1872 0.8104 0.5366 -0.0007 0.0646  -0.0954 196 TYR B CD1   
875  C CD2   . TYR B 55 ? 1.1049 0.8239 0.5100 -0.0175 0.0177  -0.0918 196 TYR B CD2   
876  C CE1   . TYR B 55 ? 1.2585 0.8504 0.5700 -0.0253 0.0622  -0.1252 196 TYR B CE1   
877  C CE2   . TYR B 55 ? 1.1634 0.8667 0.5344 -0.0374 0.0114  -0.1195 196 TYR B CE2   
878  C CZ    . TYR B 55 ? 1.2416 0.8812 0.5663 -0.0455 0.0334  -0.1389 196 TYR B CZ    
879  O OH    . TYR B 55 ? 1.2907 0.9136 0.5783 -0.0730 0.0302  -0.1725 196 TYR B OH    
880  N N     . LEU B 56 ? 1.0326 0.8125 0.4620 0.0399  0.0406  -0.0290 197 LEU B N     
881  C CA    . LEU B 56 ? 1.0457 0.8345 0.4566 0.0444  0.0342  -0.0253 197 LEU B CA    
882  C C     . LEU B 56 ? 1.0746 0.8710 0.4699 0.0646  0.0525  -0.0086 197 LEU B C     
883  O O     . LEU B 56 ? 1.1169 0.9035 0.4774 0.0746  0.0535  -0.0083 197 LEU B O     
884  C CB    . LEU B 56 ? 0.9873 0.8038 0.4282 0.0340  0.0187  -0.0195 197 LEU B CB    
885  C CG    . LEU B 56 ? 0.9790 0.7990 0.4233 0.0190  -0.0023 -0.0367 197 LEU B CG    
886  C CD1   . LEU B 56 ? 0.9416 0.7883 0.4199 0.0149  -0.0120 -0.0260 197 LEU B CD1   
887  C CD2   . LEU B 56 ? 1.0313 0.8494 0.4341 0.0211  -0.0130 -0.0513 197 LEU B CD2   
888  N N     . GLY B 57 ? 1.0480 0.8694 0.4687 0.0706  0.0670  0.0044  198 GLY B N     
889  C CA    . GLY B 57 ? 1.0579 0.8980 0.4673 0.0886  0.0865  0.0189  198 GLY B CA    
890  C C     . GLY B 57 ? 1.0456 0.9062 0.4617 0.0836  0.0902  0.0308  198 GLY B C     
891  O O     . GLY B 57 ? 0.9985 0.8777 0.4475 0.0657  0.0872  0.0349  198 GLY B O     
892  N N     . ASN B 58 ? 1.0851 0.9364 0.4653 0.1005  0.1012  0.0369  199 ASN B N     
893  C CA    . ASN B 58 ? 1.0854 0.9403 0.4568 0.1000  0.1079  0.0485  199 ASN B CA    
894  C C     . ASN B 58 ? 1.1134 0.9405 0.4615 0.0995  0.0899  0.0425  199 ASN B C     
895  O O     . ASN B 58 ? 1.1295 0.9558 0.4739 0.0997  0.0953  0.0544  199 ASN B O     
896  C CB    . ASN B 58 ? 1.1175 0.9751 0.4562 0.1217  0.1273  0.0583  199 ASN B CB    
897  C CG    . ASN B 58 ? 1.1402 0.9590 0.4271 0.1420  0.1228  0.0471  199 ASN B CG    
898  N N     . THR B 59 ? 1.1165 0.9239 0.4470 0.0991  0.0714  0.0241  200 THR B N     
899  C CA    . THR B 59 ? 1.1390 0.9372 0.4393 0.1029  0.0539  0.0155  200 THR B CA    
900  C C     . THR B 59 ? 1.1150 0.9282 0.4370 0.0969  0.0431  0.0231  200 THR B C     
901  O O     . THR B 59 ? 1.1290 0.9459 0.4240 0.1107  0.0368  0.0277  200 THR B O     
902  C CB    . THR B 59 ? 1.1656 0.9475 0.4455 0.0943  0.0381  -0.0116 200 THR B CB    
903  O OG1   . THR B 59 ? 1.1466 0.9333 0.4653 0.0748  0.0292  -0.0199 200 THR B OG1   
904  C CG2   . THR B 59 ? 1.1934 0.9441 0.4372 0.1039  0.0531  -0.0202 200 THR B CG2   
905  N N     . VAL B 60 ? 1.0806 0.9030 0.4472 0.0803  0.0425  0.0252  201 VAL B N     
906  C CA    . VAL B 60 ? 1.0670 0.8964 0.4526 0.0763  0.0369  0.0335  201 VAL B CA    
907  C C     . VAL B 60 ? 1.0495 0.8790 0.4672 0.0637  0.0578  0.0472  201 VAL B C     
908  O O     . VAL B 60 ? 1.0209 0.8630 0.4664 0.0503  0.0631  0.0420  201 VAL B O     
909  C CB    . VAL B 60 ? 1.0364 0.8780 0.4425 0.0638  0.0135  0.0167  201 VAL B CB    
910  C CG1   . VAL B 60 ? 1.0147 0.8637 0.4438 0.0622  0.0113  0.0275  201 VAL B CG1   
911  C CG2   . VAL B 60 ? 1.0695 0.9208 0.4425 0.0698  -0.0058 -0.0005 201 VAL B CG2   
912  N N     . ASP B 61 ? 1.0744 0.8901 0.4841 0.0682  0.0729  0.0640  202 ASP B N     
913  C CA    . ASP B 61 ? 1.0630 0.8738 0.4985 0.0482  0.0978  0.0724  202 ASP B CA    
914  C C     . ASP B 61 ? 1.0265 0.8372 0.4934 0.0330  0.0905  0.0676  202 ASP B C     
915  O O     . ASP B 61 ? 1.0444 0.8364 0.4981 0.0445  0.0884  0.0757  202 ASP B O     
916  C CB    . ASP B 61 ? 1.1111 0.8917 0.5169 0.0556  0.1277  0.0921  202 ASP B CB    
917  C CG    . ASP B 61 ? 1.1050 0.8816 0.5352 0.0245  0.1589  0.0944  202 ASP B CG    
918  O OD1   . ASP B 61 ? 1.0636 0.8663 0.5350 -0.0007 0.1543  0.0812  202 ASP B OD1   
919  O OD2   . ASP B 61 ? 1.1361 0.8850 0.5420 0.0238  0.1900  0.1082  202 ASP B OD2   
920  N N     . LEU B 62 ? 0.9788 0.8137 0.4843 0.0114  0.0881  0.0562  203 LEU B N     
921  C CA    . LEU B 62 ? 0.9543 0.7921 0.4907 -0.0039 0.0816  0.0501  203 LEU B CA    
922  C C     . LEU B 62 ? 0.9625 0.7978 0.5181 -0.0305 0.1076  0.0512  203 LEU B C     
923  O O     . LEU B 62 ? 0.9168 0.7560 0.4982 -0.0465 0.1051  0.0441  203 LEU B O     
924  C CB    . LEU B 62 ? 0.8978 0.7631 0.4598 -0.0079 0.0602  0.0353  203 LEU B CB    
925  C CG    . LEU B 62 ? 0.9054 0.7665 0.4467 0.0086  0.0377  0.0280  203 LEU B CG    
926  C CD1   . LEU B 62 ? 0.8715 0.7451 0.4323 0.0021  0.0248  0.0138  203 LEU B CD1   
927  C CD2   . LEU B 62 ? 0.9195 0.7713 0.4472 0.0192  0.0251  0.0314  203 LEU B CD2   
928  N N     . SER B 63 ? 1.0059 0.8329 0.5461 -0.0375 0.1346  0.0587  204 SER B N     
929  C CA    . SER B 63 ? 1.0317 0.8533 0.5849 -0.0708 0.1651  0.0558  204 SER B CA    
930  C C     . SER B 63 ? 1.0358 0.8218 0.5920 -0.0790 0.1679  0.0545  204 SER B C     
931  O O     . SER B 63 ? 0.9861 0.7962 0.5749 -0.1033 0.1652  0.0403  204 SER B O     
932  C CB    . SER B 63 ? 1.0823 0.8721 0.6032 -0.0740 0.1996  0.0683  204 SER B CB    
933  N N     . SER B 64 ? 1.0817 0.8164 0.6016 -0.0527 0.1713  0.0704  205 SER B N     
934  C CA    . SER B 64 ? 1.1073 0.7959 0.6162 -0.0507 0.1821  0.0758  205 SER B CA    
935  C C     . SER B 64 ? 1.0605 0.7697 0.5884 -0.0347 0.1482  0.0716  205 SER B C     
936  O O     . SER B 64 ? 1.0808 0.7565 0.5984 -0.0269 0.1558  0.0781  205 SER B O     
937  C CB    . SER B 64 ? 1.1793 0.8054 0.6325 -0.0208 0.2074  0.1002  205 SER B CB    
938  N N     . PHE B 65 ? 1.0081 0.7680 0.5605 -0.0300 0.1151  0.0611  206 PHE B N     
939  C CA    . PHE B 65 ? 0.9641 0.7443 0.5303 -0.0154 0.0843  0.0569  206 PHE B CA    
940  C C     . PHE B 65 ? 0.9369 0.7282 0.5394 -0.0379 0.0815  0.0450  206 PHE B C     
941  O O     . PHE B 65 ? 0.8930 0.7133 0.5231 -0.0605 0.0816  0.0322  206 PHE B O     
942  C CB    . PHE B 65 ? 0.9351 0.7522 0.5068 -0.0072 0.0578  0.0478  206 PHE B CB    
943  C CG    . PHE B 65 ? 0.9101 0.7474 0.4904 0.0035  0.0297  0.0414  206 PHE B CG    
944  C CD1   . PHE B 65 ? 0.9327 0.7687 0.4894 0.0282  0.0221  0.0511  206 PHE B CD1   
945  C CD2   . PHE B 65 ? 0.8804 0.7425 0.4911 -0.0101 0.0133  0.0262  206 PHE B CD2   
946  C CE1   . PHE B 65 ? 0.9069 0.7752 0.4750 0.0338  -0.0033 0.0427  206 PHE B CE1   
947  C CE2   . PHE B 65 ? 0.8638 0.7442 0.4833 -0.0060 -0.0087 0.0183  206 PHE B CE2   
948  C CZ    . PHE B 65 ? 0.8820 0.7702 0.4825 0.0135  -0.0180 0.0252  206 PHE B CZ    
949  N N     . ASP B 66 ? 0.9433 0.7147 0.5430 -0.0288 0.0813  0.0503  207 ASP B N     
950  C CA    . ASP B 66 ? 0.9446 0.7259 0.5762 -0.0474 0.0776  0.0390  207 ASP B CA    
951  C C     . ASP B 66 ? 0.8805 0.7026 0.5368 -0.0383 0.0440  0.0317  207 ASP B C     
952  O O     . ASP B 66 ? 0.8586 0.6860 0.5042 -0.0153 0.0293  0.0387  207 ASP B O     
953  C CB    . ASP B 66 ? 1.0159 0.7489 0.6286 -0.0423 0.0992  0.0484  207 ASP B CB    
954  C CG    . ASP B 66 ? 1.0203 0.7633 0.6632 -0.0604 0.0951  0.0358  207 ASP B CG    
955  O OD1   . ASP B 66 ? 1.0354 0.7976 0.7018 -0.0922 0.1011  0.0196  207 ASP B OD1   
956  O OD2   . ASP B 66 ? 1.0334 0.7738 0.6769 -0.0412 0.0851  0.0421  207 ASP B OD2   
957  N N     . PHE B 67 ? 0.8269 0.6813 0.5135 -0.0554 0.0339  0.0179  208 PHE B N     
958  C CA    . PHE B 67 ? 0.8118 0.6943 0.5149 -0.0492 0.0085  0.0105  208 PHE B CA    
959  C C     . PHE B 67 ? 0.8067 0.6939 0.5236 -0.0436 -0.0034 0.0107  208 PHE B C     
960  O O     . PHE B 67 ? 0.7895 0.6945 0.5068 -0.0341 -0.0217 0.0082  208 PHE B O     
961  C CB    . PHE B 67 ? 0.7643 0.6733 0.4901 -0.0621 0.0066  -0.0002 208 PHE B CB    
962  C CG    . PHE B 67 ? 0.7244 0.6457 0.4566 -0.0566 -0.0107 -0.0073 208 PHE B CG    
963  C CD1   . PHE B 67 ? 0.7018 0.6317 0.4559 -0.0603 -0.0203 -0.0121 208 PHE B CD1   
964  C CD2   . PHE B 67 ? 0.7213 0.6400 0.4344 -0.0496 -0.0134 -0.0102 208 PHE B CD2   
965  C CE1   . PHE B 67 ? 0.6857 0.6190 0.4424 -0.0600 -0.0301 -0.0201 208 PHE B CE1   
966  C CE2   . PHE B 67 ? 0.7191 0.6362 0.4312 -0.0492 -0.0224 -0.0194 208 PHE B CE2   
967  C CZ    . PHE B 67 ? 0.6932 0.6165 0.4275 -0.0560 -0.0296 -0.0246 208 PHE B CZ    
968  N N     . ARG B 68 ? 0.8265 0.7014 0.5542 -0.0519 0.0082  0.0115  209 ARG B N     
969  C CA    . ARG B 68 ? 0.8199 0.6987 0.5600 -0.0446 0.0002  0.0134  209 ARG B CA    
970  C C     . ARG B 68 ? 0.8471 0.7207 0.5639 -0.0170 -0.0033 0.0275  209 ARG B C     
971  O O     . ARG B 68 ? 0.8415 0.7483 0.5706 -0.0080 -0.0227 0.0257  209 ARG B O     
972  C CB    . ARG B 68 ? 0.8153 0.6754 0.5646 -0.0589 0.0174  0.0103  209 ARG B CB    
973  C CG    . ARG B 68 ? 0.8256 0.6872 0.5856 -0.0487 0.0119  0.0136  209 ARG B CG    
974  C CD    . ARG B 68 ? 0.8016 0.6612 0.5805 -0.0675 0.0206  0.0033  209 ARG B CD    
975  N NE    . ARG B 68 ? 0.7374 0.6371 0.5458 -0.0819 0.0076  -0.0091 209 ARG B NE    
976  C CZ    . ARG B 68 ? 0.6998 0.6266 0.5303 -0.0768 -0.0094 -0.0113 209 ARG B CZ    
977  N NH1   . ARG B 68 ? 0.6723 0.6033 0.5061 -0.0623 -0.0198 -0.0049 209 ARG B NH1   
978  N NH2   . ARG B 68 ? 0.6668 0.6198 0.5144 -0.0851 -0.0138 -0.0194 209 ARG B NH2   
979  N N     . THR B 69 ? 0.8813 0.7178 0.5636 -0.0030 0.0171  0.0415  210 THR B N     
980  C CA    . THR B 69 ? 0.9153 0.7485 0.5689 0.0327  0.0184  0.0599  210 THR B CA    
981  C C     . THR B 69 ? 0.9277 0.7966 0.5667 0.0499  0.0001  0.0620  210 THR B C     
982  O O     . THR B 69 ? 0.9289 0.8295 0.5560 0.0784  -0.0106 0.0716  210 THR B O     
983  C CB    . THR B 69 ? 0.9765 0.7446 0.5879 0.0472  0.0546  0.0778  210 THR B CB    
984  O OG1   . THR B 69 ? 0.9731 0.7155 0.5677 0.0332  0.0701  0.0764  210 THR B OG1   
985  C CG2   . THR B 69 ? 0.9999 0.7262 0.6157 0.0317  0.0769  0.0746  210 THR B CG2   
986  N N     . GLY B 70 ? 0.9414 0.8094 0.5781 0.0345  -0.0018 0.0530  211 GLY B N     
987  C CA    . GLY B 70 ? 0.9613 0.8580 0.5788 0.0477  -0.0172 0.0516  211 GLY B CA    
988  C C     . GLY B 70 ? 0.9965 0.8720 0.5682 0.0781  -0.0016 0.0717  211 GLY B C     
989  O O     . GLY B 70 ? 1.0074 0.9195 0.5593 0.1016  -0.0161 0.0753  211 GLY B O     
990  N N     . LYS B 71 ? 1.0244 0.8426 0.5781 0.0749  0.0295  0.0829  212 LYS B N     
991  C CA    . LYS B 71 ? 1.0794 0.8569 0.5841 0.1053  0.0559  0.1067  212 LYS B CA    
992  C C     . LYS B 71 ? 1.0921 0.8196 0.5873 0.0807  0.0851  0.1057  212 LYS B C     
993  O O     . LYS B 71 ? 1.0736 0.7959 0.5998 0.0445  0.0898  0.0902  212 LYS B O     
994  C CB    . LYS B 71 ? 1.1212 0.8657 0.6067 0.1310  0.0763  0.1258  212 LYS B CB    
995  C CG    . LYS B 71 ? 1.0992 0.9026 0.5928 0.1610  0.0510  0.1305  212 LYS B CG    
996  N N     . MET B 72 ? 1.1335 0.8319 0.5859 0.1012  0.1052  0.1223  213 MET B N     
997  C CA    . MET B 72 ? 1.1518 0.8042 0.5896 0.0796  0.1377  0.1237  213 MET B CA    
998  C C     . MET B 72 ? 1.2351 0.8123 0.6451 0.0787  0.1813  0.1371  213 MET B C     
999  O O     . MET B 72 ? 1.2993 0.8501 0.6747 0.1174  0.1921  0.1580  213 MET B O     
1000 C CB    . MET B 72 ? 1.1636 0.8153 0.5621 0.1062  0.1419  0.1375  213 MET B CB    
1001 C CG    . MET B 72 ? 1.0934 0.8104 0.5053 0.1120  0.1024  0.1244  213 MET B CG    
1002 S SD    . MET B 72 ? 1.0165 0.7601 0.4725 0.0674  0.0908  0.0981  213 MET B SD    
1003 C CE    . MET B 72 ? 1.0078 0.7955 0.4475 0.0861  0.0605  0.0902  213 MET B CE    
1004 N N     . MET B 73 ? 1.2689 0.8141 0.6909 0.0354  0.2081  0.1244  214 MET B N     
1005 C CA    . MET B 73 ? 1.3666 0.8344 0.7637 0.0216  0.2527  0.1287  214 MET B CA    
1006 C C     . MET B 73 ? 1.4512 0.8684 0.8234 -0.0075 0.2970  0.1282  214 MET B C     
1007 O O     . MET B 73 ? 1.4310 0.8942 0.8313 -0.0352 0.2867  0.1137  214 MET B O     
1008 C CB    . MET B 73 ? 1.3160 0.8032 0.7575 -0.0143 0.2422  0.1049  214 MET B CB    
1009 N N     . PRO B 74 ? 1.5748 0.8962 0.8908 0.0001  0.3496  0.1451  215 PRO B N     
1010 C CA    . PRO B 74 ? 1.6512 0.9205 0.9400 -0.0308 0.3970  0.1445  215 PRO B CA    
1011 C C     . PRO B 74 ? 1.6386 0.9261 0.9672 -0.1041 0.4110  0.1100  215 PRO B C     
1012 O O     . PRO B 74 ? 1.6726 0.9502 0.9944 -0.1365 0.4403  0.1039  215 PRO B O     
1013 C CB    . PRO B 74 ? 1.7709 0.9213 0.9839 -0.0026 0.4544  0.1713  215 PRO B CB    
1014 C CG    . PRO B 74 ? 1.7615 0.9039 0.9726 0.0272  0.4404  0.1774  215 PRO B CG    
1015 C CD    . PRO B 74 ? 1.6452 0.9011 0.9118 0.0462  0.3711  0.1704  215 PRO B CD    
1016 O "O5'" . DC  C 1  ? 0.4326 0.5426 0.6917 -0.0503 0.0176  -0.1367 1   DC  C "O5'" 
1017 C "C5'" . DC  C 1  ? 0.4186 0.5279 0.6540 -0.0712 0.0466  -0.1435 1   DC  C "C5'" 
1018 C "C4'" . DC  C 1  ? 0.3993 0.4922 0.5690 -0.0790 0.0537  -0.1237 1   DC  C "C4'" 
1019 O "O4'" . DC  C 1  ? 0.3574 0.4361 0.4917 -0.0682 0.0359  -0.1006 1   DC  C "O4'" 
1020 C "C3'" . DC  C 1  ? 0.3737 0.4662 0.5352 -0.0749 0.0533  -0.1203 1   DC  C "C3'" 
1021 O "O3'" . DC  C 1  ? 0.3928 0.4760 0.5097 -0.0974 0.0722  -0.1169 1   DC  C "O3'" 
1022 C "C2'" . DC  C 1  ? 0.3595 0.4427 0.5016 -0.0545 0.0272  -0.0987 1   DC  C "C2'" 
1023 C "C1'" . DC  C 1  ? 0.3602 0.4329 0.4739 -0.0563 0.0239  -0.0861 1   DC  C "C1'" 
1024 N N1    . DC  C 1  ? 0.3258 0.3918 0.4340 -0.0425 0.0047  -0.0770 1   DC  C N1    
1025 C C2    . DC  C 1  ? 0.3392 0.3926 0.4165 -0.0402 0.0029  -0.0627 1   DC  C C2    
1026 O O2    . DC  C 1  ? 0.3489 0.3970 0.4091 -0.0466 0.0102  -0.0534 1   DC  C O2    
1027 N N3    . DC  C 1  ? 0.3200 0.3658 0.3885 -0.0337 -0.0073 -0.0603 1   DC  C N3    
1028 C C4    . DC  C 1  ? 0.3425 0.3888 0.4207 -0.0313 -0.0219 -0.0662 1   DC  C C4    
1029 N N4    . DC  C 1  ? 0.3440 0.3775 0.3993 -0.0326 -0.0307 -0.0641 1   DC  C N4    
1030 C C5    . DC  C 1  ? 0.3396 0.3979 0.4550 -0.0304 -0.0287 -0.0760 1   DC  C C5    
1031 C C6    . DC  C 1  ? 0.3361 0.4059 0.4707 -0.0349 -0.0119 -0.0837 1   DC  C C6    
1032 P P     . DG  C 2  ? 0.4087 0.4873 0.4984 -0.1004 0.0737  -0.1097 2   DG  C P     
1033 O OP1   . DG  C 2  ? 0.4668 0.5423 0.5349 -0.1334 0.1020  -0.1253 2   DG  C OP1   
1034 O OP2   . DG  C 2  ? 0.3762 0.4633 0.5037 -0.0790 0.0618  -0.1144 2   DG  C OP2   
1035 O "O5'" . DG  C 2  ? 0.4233 0.4856 0.4644 -0.0958 0.0554  -0.0786 2   DG  C "O5'" 
1036 C "C5'" . DG  C 2  ? 0.4605 0.5088 0.4744 -0.1080 0.0533  -0.0658 2   DG  C "C5'" 
1037 C "C4'" . DG  C 2  ? 0.4856 0.5193 0.4690 -0.1052 0.0351  -0.0391 2   DG  C "C4'" 
1038 O "O4'" . DG  C 2  ? 0.4518 0.4880 0.4558 -0.0794 0.0203  -0.0315 2   DG  C "O4'" 
1039 C "C3'" . DG  C 2  ? 0.4693 0.5027 0.4327 -0.1107 0.0329  -0.0333 2   DG  C "C3'" 
1040 O "O3'" . DG  C 2  ? 0.5205 0.5353 0.4535 -0.1227 0.0167  -0.0093 2   DG  C "O3'" 
1041 C "C2'" . DG  C 2  ? 0.4352 0.4788 0.4232 -0.0830 0.0227  -0.0317 2   DG  C "C2'" 
1042 C "C1'" . DG  C 2  ? 0.4110 0.4521 0.4157 -0.0673 0.0136  -0.0269 2   DG  C "C1'" 
1043 N N9    . DG  C 2  ? 0.3690 0.4178 0.3954 -0.0498 0.0110  -0.0362 2   DG  C N9    
1044 C C8    . DG  C 2  ? 0.3617 0.4192 0.4093 -0.0468 0.0139  -0.0513 2   DG  C C8    
1045 N N7    . DG  C 2  ? 0.3431 0.3991 0.4001 -0.0346 0.0026  -0.0520 2   DG  C N7    
1046 C C5    . DG  C 2  ? 0.3410 0.3885 0.3806 -0.0311 -0.0006 -0.0416 2   DG  C C5    
1047 C C6    . DG  C 2  ? 0.3414 0.3811 0.3735 -0.0257 -0.0068 -0.0413 2   DG  C C6    
1048 O O6    . DG  C 2  ? 0.3681 0.4031 0.3978 -0.0244 -0.0168 -0.0452 2   DG  C O6    
1049 N N1    . DG  C 2  ? 0.3515 0.3861 0.3793 -0.0253 -0.0015 -0.0365 2   DG  C N1    
1050 C C2    . DG  C 2  ? 0.3761 0.4114 0.4107 -0.0274 0.0005  -0.0278 2   DG  C C2    
1051 N N2    . DG  C 2  ? 0.3789 0.4094 0.4266 -0.0244 0.0022  -0.0256 2   DG  C N2    
1052 N N3    . DG  C 2  ? 0.3509 0.3889 0.3807 -0.0351 0.0002  -0.0226 2   DG  C N3    
1053 C C4    . DG  C 2  ? 0.3615 0.4062 0.3915 -0.0376 0.0035  -0.0322 2   DG  C C4    
1054 P P     . DG  C 3  ? 0.5289 0.5353 0.4289 -0.1387 0.0065  0.0044  3   DG  C P     
1055 O OP1   . DG  C 3  ? 0.5689 0.5493 0.4378 -0.1594 -0.0135 0.0290  3   DG  C OP1   
1056 O OP2   . DG  C 3  ? 0.4961 0.5114 0.3848 -0.1532 0.0288  -0.0168 3   DG  C OP2   
1057 O "O5'" . DG  C 3  ? 0.4860 0.5038 0.4173 -0.1093 -0.0079 0.0120  3   DG  C "O5'" 
1058 C "C5'" . DG  C 3  ? 0.4638 0.4750 0.4172 -0.0960 -0.0285 0.0295  3   DG  C "C5'" 
1059 C "C4'" . DG  C 3  ? 0.4283 0.4534 0.4111 -0.0743 -0.0308 0.0267  3   DG  C "C4'" 
1060 O "O4'" . DG  C 3  ? 0.3866 0.4227 0.3846 -0.0578 -0.0156 0.0090  3   DG  C "O4'" 
1061 C "C3'" . DG  C 3  ? 0.4393 0.4701 0.4053 -0.0822 -0.0311 0.0269  3   DG  C "C3'" 
1062 O "O3'" . DG  C 3  ? 0.4545 0.4907 0.4495 -0.0699 -0.0434 0.0345  3   DG  C "O3'" 
1063 C "C2'" . DG  C 3  ? 0.4129 0.4554 0.3806 -0.0739 -0.0111 0.0067  3   DG  C "C2'" 
1064 C "C1'" . DG  C 3  ? 0.3837 0.4288 0.3772 -0.0543 -0.0093 0.0014  3   DG  C "C1'" 
1065 N N9    . DG  C 3  ? 0.3554 0.4048 0.3547 -0.0463 0.0004  -0.0133 3   DG  C N9    
1066 C C8    . DG  C 3  ? 0.3504 0.4038 0.3502 -0.0513 0.0092  -0.0260 3   DG  C C8    
1067 N N7    . DG  C 3  ? 0.3354 0.3902 0.3519 -0.0404 0.0079  -0.0344 3   DG  C N7    
1068 C C5    . DG  C 3  ? 0.3267 0.3762 0.3404 -0.0314 0.0010  -0.0277 3   DG  C C5    
1069 C C6    . DG  C 3  ? 0.3243 0.3675 0.3385 -0.0243 -0.0048 -0.0309 3   DG  C C6    
1070 O O6    . DG  C 3  ? 0.3164 0.3567 0.3378 -0.0219 -0.0124 -0.0361 3   DG  C O6    
1071 N N1    . DG  C 3  ? 0.3267 0.3646 0.3343 -0.0231 -0.0027 -0.0282 3   DG  C N1    
1072 C C2    . DG  C 3  ? 0.3221 0.3629 0.3380 -0.0236 0.0010  -0.0228 3   DG  C C2    
1073 N N2    . DG  C 3  ? 0.3215 0.3584 0.3447 -0.0224 0.0068  -0.0271 3   DG  C N2    
1074 N N3    . DG  C 3  ? 0.3397 0.3852 0.3585 -0.0279 -0.0016 -0.0148 3   DG  C N3    
1075 C C4    . DG  C 3  ? 0.3423 0.3906 0.3522 -0.0337 -0.0003 -0.0177 3   DG  C C4    
1076 P P     . DA  C 4  ? 0.5069 0.5388 0.4958 -0.0837 -0.0654 0.0516  4   DA  C P     
1077 O OP1   . DA  C 4  ? 0.5153 0.5264 0.4852 -0.1025 -0.0866 0.0713  4   DA  C OP1   
1078 O OP2   . DA  C 4  ? 0.5226 0.5618 0.4849 -0.0928 -0.0542 0.0425  4   DA  C OP2   
1079 O "O5'" . DA  C 4  ? 0.4936 0.5358 0.5413 -0.0638 -0.0740 0.0525  4   DA  C "O5'" 
1080 C "C5'" . DA  C 4  ? 0.4759 0.5148 0.5672 -0.0505 -0.0776 0.0527  4   DA  C "C5'" 
1081 C "C4'" . DA  C 4  ? 0.4336 0.4869 0.5670 -0.0329 -0.0589 0.0333  4   DA  C "C4'" 
1082 O "O4'" . DA  C 4  ? 0.3849 0.4409 0.4870 -0.0293 -0.0337 0.0164  4   DA  C "O4'" 
1083 C "C3'" . DA  C 4  ? 0.4284 0.4951 0.5859 -0.0320 -0.0608 0.0305  4   DA  C "C3'" 
1084 O "O3'" . DA  C 4  ? 0.4289 0.5039 0.6497 -0.0203 -0.0510 0.0159  4   DA  C "O3'" 
1085 C "C2'" . DA  C 4  ? 0.4029 0.4739 0.5137 -0.0348 -0.0399 0.0189  4   DA  C "C2'" 
1086 C "C1'" . DA  C 4  ? 0.3699 0.4346 0.4628 -0.0290 -0.0227 0.0076  4   DA  C "C1'" 
1087 N N9    . DA  C 4  ? 0.3701 0.4314 0.4186 -0.0330 -0.0143 0.0036  4   DA  C N9    
1088 C C8    . DA  C 4  ? 0.3654 0.4254 0.3852 -0.0434 -0.0179 0.0084  4   DA  C C8    
1089 N N7    . DA  C 4  ? 0.3972 0.4553 0.3989 -0.0426 -0.0074 -0.0012 4   DA  C N7    
1090 C C5    . DA  C 4  ? 0.3702 0.4254 0.3798 -0.0325 -0.0017 -0.0082 4   DA  C C5    
1091 C C6    . DA  C 4  ? 0.3675 0.4162 0.3667 -0.0287 0.0020  -0.0160 4   DA  C C6    
1092 N N6    . DA  C 4  ? 0.3362 0.3836 0.3304 -0.0299 0.0013  -0.0201 4   DA  C N6    
1093 N N1    . DA  C 4  ? 0.4081 0.4498 0.4056 -0.0261 0.0053  -0.0206 4   DA  C N1    
1094 C C2    . DA  C 4  ? 0.3818 0.4262 0.3968 -0.0257 0.0110  -0.0226 4   DA  C C2    
1095 N N3    . DA  C 4  ? 0.3747 0.4277 0.4168 -0.0247 0.0075  -0.0172 4   DA  C N3    
1096 C C4    . DA  C 4  ? 0.3811 0.4380 0.4148 -0.0286 -0.0020 -0.0074 4   DA  C C4    
1097 P P     . DG  C 5  ? 0.4820 0.5743 0.7479 -0.0184 -0.0430 0.0031  5   DG  C P     
1098 O OP1   . DG  C 5  ? 0.4461 0.5448 0.7975 -0.0093 -0.0396 -0.0101 5   DG  C OP1   
1099 O OP2   . DG  C 5  ? 0.4625 0.5588 0.7087 -0.0280 -0.0639 0.0190  5   DG  C OP2   
1100 O "O5'" . DG  C 5  ? 0.4607 0.5538 0.6845 -0.0206 -0.0077 -0.0182 5   DG  C "O5'" 
1101 C "C5'" . DG  C 5  ? 0.4284 0.5145 0.6485 -0.0190 0.0161  -0.0364 5   DG  C "C5'" 
1102 C "C4'" . DG  C 5  ? 0.3969 0.4769 0.5648 -0.0278 0.0389  -0.0490 5   DG  C "C4'" 
1103 O "O4'" . DG  C 5  ? 0.3435 0.4146 0.4533 -0.0286 0.0277  -0.0347 5   DG  C "O4'" 
1104 C "C3'" . DG  C 5  ? 0.3889 0.4782 0.5684 -0.0346 0.0490  -0.0570 5   DG  C "C3'" 
1105 O "O3'" . DG  C 5  ? 0.4315 0.5154 0.6086 -0.0462 0.0809  -0.0820 5   DG  C "O3'" 
1106 C "C2'" . DG  C 5  ? 0.3691 0.4527 0.4931 -0.0374 0.0377  -0.0420 5   DG  C "C2'" 
1107 C "C1'" . DG  C 5  ? 0.3567 0.4256 0.4364 -0.0353 0.0337  -0.0361 5   DG  C "C1'" 
1108 N N9    . DG  C 5  ? 0.3583 0.4242 0.4063 -0.0345 0.0194  -0.0226 5   DG  C N9    
1109 C C8    . DG  C 5  ? 0.3411 0.4146 0.3951 -0.0357 0.0039  -0.0106 5   DG  C C8    
1110 N N7    . DG  C 5  ? 0.3317 0.3998 0.3542 -0.0391 0.0010  -0.0071 5   DG  C N7    
1111 C C5    . DG  C 5  ? 0.3272 0.3846 0.3310 -0.0359 0.0093  -0.0141 5   DG  C C5    
1112 C C6    . DG  C 5  ? 0.3564 0.4054 0.3410 -0.0356 0.0079  -0.0157 5   DG  C C6    
1113 O O6    . DG  C 5  ? 0.3626 0.4142 0.3446 -0.0389 0.0061  -0.0160 5   DG  C O6    
1114 N N1    . DG  C 5  ? 0.3595 0.3945 0.3306 -0.0339 0.0086  -0.0190 5   DG  C N1    
1115 C C2    . DG  C 5  ? 0.3681 0.3964 0.3331 -0.0371 0.0157  -0.0232 5   DG  C C2    
1116 N N2    . DG  C 5  ? 0.3718 0.3809 0.3103 -0.0419 0.0122  -0.0242 5   DG  C N2    
1117 N N3    . DG  C 5  ? 0.4022 0.4406 0.3888 -0.0382 0.0251  -0.0277 5   DG  C N3    
1118 C C4    . DG  C 5  ? 0.3649 0.4184 0.3755 -0.0352 0.0189  -0.0217 5   DG  C C4    
1119 P P     . DT  C 6  ? 0.4587 0.5446 0.6310 -0.0616 0.1038  -0.0979 6   DT  C P     
1120 O OP1   . DT  C 6  ? 0.4892 0.5792 0.7060 -0.0729 0.1375  -0.1298 6   DT  C OP1   
1121 O OP2   . DT  C 6  ? 0.5230 0.6250 0.7203 -0.0564 0.0862  -0.0857 6   DT  C OP2   
1122 O "O5'" . DT  C 6  ? 0.4760 0.5363 0.5564 -0.0723 0.1032  -0.0879 6   DT  C "O5'" 
1123 C "C5'" . DT  C 6  ? 0.4994 0.5361 0.5301 -0.0846 0.1146  -0.0950 6   DT  C "C5'" 
1124 C "C4'" . DT  C 6  ? 0.5142 0.5245 0.4700 -0.0937 0.1030  -0.0804 6   DT  C "C4'" 
1125 O "O4'" . DT  C 6  ? 0.4751 0.4914 0.4319 -0.0750 0.0745  -0.0591 6   DT  C "O4'" 
1126 C "C3'" . DT  C 6  ? 0.5314 0.5292 0.4567 -0.1110 0.1138  -0.0827 6   DT  C "C3'" 
1127 O "O3'" . DT  C 6  ? 0.5820 0.5415 0.4316 -0.1346 0.1157  -0.0808 6   DT  C "O3'" 
1128 C "C2'" . DT  C 6  ? 0.4783 0.4860 0.4129 -0.0946 0.0902  -0.0636 6   DT  C "C2'" 
1129 C "C1'" . DT  C 6  ? 0.4673 0.4737 0.3969 -0.0789 0.0672  -0.0497 6   DT  C "C1'" 
1130 N N1    . DT  C 6  ? 0.4343 0.4578 0.3883 -0.0629 0.0494  -0.0376 6   DT  C N1    
1131 C C2    . DT  C 6  ? 0.4193 0.4312 0.3521 -0.0579 0.0332  -0.0272 6   DT  C C2    
1132 O O2    . DT  C 6  ? 0.4757 0.4641 0.3765 -0.0633 0.0265  -0.0238 6   DT  C O2    
1133 N N3    . DT  C 6  ? 0.3979 0.4244 0.3497 -0.0499 0.0246  -0.0222 6   DT  C N3    
1134 C C4    . DT  C 6  ? 0.3721 0.4192 0.3507 -0.0486 0.0245  -0.0214 6   DT  C C4    
1135 O O4    . DT  C 6  ? 0.3556 0.4091 0.3358 -0.0486 0.0172  -0.0173 6   DT  C O4    
1136 C C5    . DT  C 6  ? 0.3948 0.4529 0.4008 -0.0505 0.0329  -0.0275 6   DT  C C5    
1137 C C7    . DT  C 6  ? 0.3757 0.4537 0.4198 -0.0493 0.0236  -0.0233 6   DT  C C7    
1138 C C6    . DT  C 6  ? 0.3865 0.4342 0.3839 -0.0568 0.0482  -0.0379 6   DT  C C6    
1139 P P     . DG  C 7  ? 0.6107 0.5396 0.4021 -0.1578 0.1175  -0.0746 7   DG  C P     
1140 O OP1   . DG  C 7  ? 0.7077 0.6022 0.4351 -0.1963 0.1405  -0.0889 7   DG  C OP1   
1141 O OP2   . DG  C 7  ? 0.5913 0.5428 0.4238 -0.1503 0.1245  -0.0772 7   DG  C OP2   
1142 O "O5'" . DG  C 7  ? 0.6318 0.5385 0.3903 -0.1468 0.0781  -0.0466 7   DG  C "O5'" 
1143 C "C5'" . DG  C 7  ? 0.6526 0.5466 0.3928 -0.1422 0.0565  -0.0372 7   DG  C "C5'" 
1144 C "C4'" . DG  C 7  ? 0.6601 0.5321 0.3840 -0.1344 0.0199  -0.0140 7   DG  C "C4'" 
1145 O "O4'" . DG  C 7  ? 0.6030 0.5057 0.3851 -0.1058 0.0115  -0.0105 7   DG  C "O4'" 
1146 C "C3'" . DG  C 7  ? 0.7039 0.5367 0.3785 -0.1552 0.0103  -0.0017 7   DG  C "C3'" 
1147 O "O3'" . DG  C 7  ? 0.7289 0.5324 0.3872 -0.1525 -0.0302 0.0191  7   DG  C "O3'" 
1148 C "C2'" . DG  C 7  ? 0.6620 0.5202 0.3823 -0.1383 0.0182  -0.0039 7   DG  C "C2'" 
1149 C "C1'" . DG  C 7  ? 0.5910 0.4847 0.3718 -0.1070 0.0076  -0.0040 7   DG  C "C1'" 
1150 N N9    . DG  C 7  ? 0.5419 0.4733 0.3715 -0.0920 0.0216  -0.0126 7   DG  C N9    
1151 C C8    . DG  C 7  ? 0.5136 0.4703 0.3654 -0.0939 0.0444  -0.0256 7   DG  C C8    
1152 N N7    . DG  C 7  ? 0.4870 0.4710 0.3778 -0.0816 0.0444  -0.0267 7   DG  C N7    
1153 C C5    . DG  C 7  ? 0.4697 0.4474 0.3616 -0.0726 0.0274  -0.0181 7   DG  C C5    
1154 C C6    . DG  C 7  ? 0.4265 0.4226 0.3451 -0.0639 0.0236  -0.0185 7   DG  C C6    
1155 O O6    . DG  C 7  ? 0.4247 0.4434 0.3631 -0.0639 0.0288  -0.0217 7   DG  C O6    
1156 N N1    . DG  C 7  ? 0.4077 0.3904 0.3293 -0.0587 0.0116  -0.0157 7   DG  C N1    
1157 C C2    . DG  C 7  ? 0.4484 0.4033 0.3560 -0.0585 -0.0034 -0.0088 7   DG  C C2    
1158 N N2    . DG  C 7  ? 0.4172 0.3645 0.3499 -0.0510 -0.0159 -0.0091 7   DG  C N2    
1159 N N3    . DG  C 7  ? 0.4843 0.4177 0.3564 -0.0688 -0.0066 -0.0029 7   DG  C N3    
1160 C C4    . DG  C 7  ? 0.4713 0.4184 0.3349 -0.0763 0.0128  -0.0100 7   DG  C C4    
1161 P P     . DT  C 8  ? 0.8140 0.5585 0.4136 -0.1762 -0.0620 0.0428  8   DT  C P     
1162 O OP1   . DT  C 8  ? 0.8692 0.5860 0.4518 -0.1790 -0.1038 0.0601  8   DT  C OP1   
1163 O OP2   . DT  C 8  ? 0.8795 0.5965 0.4122 -0.2132 -0.0358 0.0371  8   DT  C OP2   
1164 O "O5'" . DT  C 8  ? 0.8001 0.5549 0.4577 -0.1505 -0.0769 0.0502  8   DT  C "O5'" 
1165 C "C5'" . DT  C 8  ? 0.7503 0.5369 0.4823 -0.1175 -0.0898 0.0474  8   DT  C "C5'" 
1166 C "C4'" . DT  C 8  ? 0.7524 0.5424 0.5292 -0.1032 -0.0942 0.0484  8   DT  C "C4'" 
1167 O "O4'" . DT  C 8  ? 0.6826 0.5159 0.4919 -0.0920 -0.0603 0.0301  8   DT  C "O4'" 
1168 C "C3'" . DT  C 8  ? 0.8140 0.5575 0.5506 -0.1231 -0.1072 0.0637  8   DT  C "C3'" 
1169 O "O3'" . DT  C 8  ? 0.8654 0.5900 0.6498 -0.1087 -0.1429 0.0752  8   DT  C "O3'" 
1170 C "C2'" . DT  C 8  ? 0.7751 0.5435 0.5204 -0.1233 -0.0711 0.0488  8   DT  C "C2'" 
1171 C "C1'" . DT  C 8  ? 0.6887 0.5115 0.4982 -0.0971 -0.0542 0.0308  8   DT  C "C1'" 
1172 N N1    . DT  C 8  ? 0.6109 0.4709 0.4300 -0.0968 -0.0204 0.0148  8   DT  C N1    
1173 C C2    . DT  C 8  ? 0.5439 0.4348 0.4095 -0.0824 -0.0115 0.0040  8   DT  C C2    
1174 O O2    . DT  C 8  ? 0.5489 0.4382 0.4498 -0.0713 -0.0228 0.0025  8   DT  C O2    
1175 N N3    . DT  C 8  ? 0.4876 0.4093 0.3592 -0.0849 0.0111  -0.0064 8   DT  C N3    
1176 C C4    . DT  C 8  ? 0.5059 0.4354 0.3589 -0.0959 0.0274  -0.0107 8   DT  C C4    
1177 O O4    . DT  C 8  ? 0.5106 0.4693 0.3860 -0.0953 0.0415  -0.0197 8   DT  C O4    
1178 C C5    . DT  C 8  ? 0.5447 0.4432 0.3528 -0.1114 0.0255  -0.0051 8   DT  C C5    
1179 C C7    . DT  C 8  ? 0.5406 0.4450 0.3321 -0.1286 0.0510  -0.0171 8   DT  C C7    
1180 C C6    . DT  C 8  ? 0.5919 0.4561 0.3782 -0.1126 0.0006  0.0088  8   DT  C C6    
1181 P P     . DG  C 9  ? 0.9464 0.6040 0.6967 -0.1276 -0.1852 0.1033  9   DG  C P     
1182 O OP1   . DG  C 9  ? 0.9606 0.5961 0.7311 -0.1224 -0.2331 0.1197  9   DG  C OP1   
1183 O OP2   . DG  C 9  ? 0.9794 0.6053 0.6374 -0.1630 -0.1686 0.1101  9   DG  C OP2   
1184 O "O5'" . DG  C 9  ? 0.9208 0.5819 0.7360 -0.1110 -0.1834 0.0973  9   DG  C "O5'" 
1185 C "C5'" . DG  C 9  ? 0.8548 0.5585 0.7640 -0.0810 -0.1733 0.0760  9   DG  C "C5'" 
1186 C "C4'" . DG  C 9  ? 0.8474 0.5627 0.7833 -0.0777 -0.1471 0.0615  9   DG  C "C4'" 
1187 O "O4'" . DG  C 9  ? 0.7988 0.5548 0.7067 -0.0822 -0.1033 0.0443  9   DG  C "O4'" 
1188 C "C3'" . DG  C 9  ? 0.9130 0.5763 0.8126 -0.0962 -0.1621 0.0799  9   DG  C "C3'" 
1189 O "O3'" . DG  C 9  ? 0.9265 0.5960 0.8960 -0.0827 -0.1553 0.0654  9   DG  C "O3'" 
1190 C "C2'" . DG  C 9  ? 0.8936 0.5689 0.7225 -0.1168 -0.1247 0.0742  9   DG  C "C2'" 
1191 C "C1'" . DG  C 9  ? 0.7904 0.5297 0.6651 -0.0981 -0.0894 0.0463  9   DG  C "C1'" 
1192 N N9    . DG  C 9  ? 0.7407 0.5125 0.5795 -0.1076 -0.0546 0.0348  9   DG  C N9    
1193 C C8    . DG  C 9  ? 0.7489 0.5101 0.5250 -0.1284 -0.0447 0.0402  9   DG  C C8    
1194 N N7    . DG  C 9  ? 0.7192 0.5203 0.4982 -0.1293 -0.0131 0.0237  9   DG  C N7    
1195 C C5    . DG  C 9  ? 0.6319 0.4681 0.4659 -0.1106 -0.0056 0.0108  9   DG  C C5    
1196 C C6    . DG  C 9  ? 0.5897 0.4710 0.4474 -0.1060 0.0172  -0.0049 9   DG  C C6    
1197 O O6    . DG  C 9  ? 0.6193 0.5223 0.4684 -0.1128 0.0343  -0.0114 9   DG  C O6    
1198 N N1    . DG  C 9  ? 0.5378 0.4368 0.4363 -0.0946 0.0178  -0.0145 9   DG  C N1    
1199 C C2    . DG  C 9  ? 0.5616 0.4420 0.4891 -0.0861 0.0037  -0.0146 9   DG  C C2    
1200 N N2    . DG  C 9  ? 0.5388 0.4410 0.5043 -0.0811 0.0147  -0.0315 9   DG  C N2    
1201 N N3    . DG  C 9  ? 0.6114 0.4528 0.5341 -0.0852 -0.0205 0.0000  9   DG  C N3    
1202 C C4    . DG  C 9  ? 0.6458 0.4652 0.5148 -0.0987 -0.0264 0.0146  9   DG  C C4    
1203 P P     . DG  C 10 ? 0.9721 0.5907 0.9978 -0.0770 -0.1997 0.0808  10  DG  C P     
1204 O OP1   . DG  C 10 ? 0.9568 0.5762 1.0439 -0.0596 -0.2345 0.0845  10  DG  C OP1   
1205 O OP2   . DG  C 10 ? 1.0114 0.5694 0.9617 -0.1040 -0.2199 0.1097  10  DG  C OP2   
1206 O "O5'" . DG  C 10 ? 0.9291 0.5787 1.0372 -0.0616 -0.1683 0.0480  10  DG  C "O5'" 
1207 C "C5'" . DG  C 10 ? 0.8499 0.5541 1.0243 -0.0437 -0.1410 0.0154  10  DG  C "C5'" 
1208 C "C4'" . DG  C 10 ? 0.7889 0.5279 0.9651 -0.0486 -0.0929 -0.0132 10  DG  C "C4'" 
1209 O "O4'" . DG  C 10 ? 0.7654 0.5244 0.8567 -0.0629 -0.0703 -0.0076 10  DG  C "O4'" 
1210 C "C3'" . DG  C 10 ? 0.8149 0.5245 1.0135 -0.0547 -0.0907 -0.0169 10  DG  C "C3'" 
1211 O "O3'" . DG  C 10 ? 0.7678 0.5077 1.0353 -0.0497 -0.0573 -0.0553 10  DG  C "O3'" 
1212 C "C2'" . DG  C 10 ? 0.8186 0.5185 0.9231 -0.0757 -0.0786 -0.0013 10  DG  C "C2'" 
1213 C "C1'" . DG  C 10 ? 0.7591 0.5057 0.8177 -0.0779 -0.0549 -0.0074 10  DG  C "C1'" 
1214 N N9    . DG  C 10 ? 0.7510 0.4877 0.7266 -0.0945 -0.0547 0.0118  10  DG  C N9    
1215 C C8    . DG  C 10 ? 0.8115 0.5016 0.7367 -0.1070 -0.0832 0.0398  10  DG  C C8    
1216 N N7    . DG  C 10 ? 0.8288 0.5226 0.6853 -0.1254 -0.0670 0.0448  10  DG  C N7    
1217 C C5    . DG  C 10 ? 0.7564 0.5040 0.6283 -0.1205 -0.0316 0.0214  10  DG  C C5    
1218 C C6    . DG  C 10 ? 0.7153 0.4923 0.5521 -0.1321 -0.0043 0.0136  10  DG  C C6    
1219 O O6    . DG  C 10 ? 0.7312 0.4949 0.5164 -0.1502 0.0014  0.0207  10  DG  C O6    
1220 N N1    . DG  C 10 ? 0.6538 0.4789 0.5251 -0.1234 0.0171  -0.0063 10  DG  C N1    
1221 C C2    . DG  C 10 ? 0.6288 0.4702 0.5490 -0.1107 0.0186  -0.0198 10  DG  C C2    
1222 N N2    . DG  C 10 ? 0.5784 0.4607 0.5110 -0.1115 0.0381  -0.0360 10  DG  C N2    
1223 N N3    . DG  C 10 ? 0.6572 0.4746 0.6143 -0.1007 0.0017  -0.0189 10  DG  C N3    
1224 C C4    . DG  C 10 ? 0.7158 0.4878 0.6520 -0.1038 -0.0253 0.0031  10  DG  C C4    
1225 P P     . DG  C 11 ? 0.8365 0.5537 1.1411 -0.0559 -0.0460 -0.0695 11  DG  C P     
1226 O OP1   . DG  C 11 ? 0.8371 0.5732 1.2447 -0.0467 -0.0252 -0.1096 11  DG  C OP1   
1227 O OP2   . DG  C 11 ? 0.8883 0.5448 1.1721 -0.0598 -0.0865 -0.0344 11  DG  C OP2   
1228 O "O5'" . DG  C 11 ? 0.7890 0.5354 1.0214 -0.0754 -0.0066 -0.0801 11  DG  C "O5'" 
1229 C "C5'" . DG  C 11 ? 0.6911 0.4894 0.9031 -0.0806 0.0258  -0.1013 11  DG  C "C5'" 
1230 C "C4'" . DG  C 11 ? 0.6504 0.4644 0.8022 -0.1002 0.0497  -0.1045 11  DG  C "C4'" 
1231 O "O4'" . DG  C 11 ? 0.6132 0.4210 0.6967 -0.1045 0.0357  -0.0752 11  DG  C "O4'" 
1232 C "C3'" . DG  C 11 ? 0.6615 0.4511 0.8297 -0.1110 0.0593  -0.1148 11  DG  C "C3'" 
1233 O "O3'" . DG  C 11 ? 0.6342 0.4560 0.7824 -0.1292 0.0923  -0.1392 11  DG  C "O3'" 
1234 C "C2'" . DG  C 11 ? 0.6828 0.4380 0.7967 -0.1169 0.0381  -0.0819 11  DG  C "C2'" 
1235 C "C1'" . DG  C 11 ? 0.6534 0.4362 0.7080 -0.1186 0.0375  -0.0671 11  DG  C "C1'" 
1236 N N9    . DG  C 11 ? 0.6896 0.4419 0.6938 -0.1224 0.0151  -0.0364 11  DG  C N9    
1237 C C8    . DG  C 11 ? 0.7303 0.4321 0.7346 -0.1195 -0.0183 -0.0126 11  DG  C C8    
1238 N N7    . DG  C 11 ? 0.7625 0.4448 0.7007 -0.1324 -0.0288 0.0102  11  DG  C N7    
1239 C C5    . DG  C 11 ? 0.7115 0.4385 0.6186 -0.1399 0.0009  -0.0019 11  DG  C C5    
1240 C C6    . DG  C 11 ? 0.7111 0.4434 0.5586 -0.1557 0.0108  0.0061  11  DG  C C6    
1241 O O6    . DG  C 11 ? 0.7636 0.4595 0.5596 -0.1708 -0.0015 0.0250  11  DG  C O6    
1242 N N1    . DG  C 11 ? 0.6547 0.4387 0.5080 -0.1565 0.0380  -0.0121 11  DG  C N1    
1243 C C2    . DG  C 11 ? 0.6424 0.4633 0.5364 -0.1481 0.0508  -0.0316 11  DG  C C2    
1244 N N2    . DG  C 11 ? 0.6168 0.4803 0.5086 -0.1528 0.0678  -0.0424 11  DG  C N2    
1245 N N3    . DG  C 11 ? 0.6373 0.4516 0.5731 -0.1388 0.0469  -0.0413 11  DG  C N3    
1246 C C4    . DG  C 11 ? 0.6701 0.4390 0.6168 -0.1333 0.0236  -0.0274 11  DG  C C4    
1247 P P     . DC  C 12 ? 0.6968 0.5055 0.8653 -0.1452 0.1136  -0.1624 12  DC  C P     
1248 O OP1   . DC  C 12 ? 0.7670 0.6118 0.9303 -0.1636 0.1460  -0.1948 12  DC  C OP1   
1249 O OP2   . DC  C 12 ? 0.7283 0.4932 0.9663 -0.1330 0.0996  -0.1644 12  DC  C OP2   
1250 O "O5'" . DC  C 12 ? 0.7407 0.5487 0.8414 -0.1602 0.1123  -0.1433 12  DC  C "O5'" 
1251 C "C5'" . DC  C 12 ? 0.7081 0.5562 0.7573 -0.1695 0.1187  -0.1388 12  DC  C "C5'" 
1252 C "C4'" . DC  C 12 ? 0.7070 0.5494 0.7101 -0.1759 0.1100  -0.1158 12  DC  C "C4'" 
1253 O "O4'" . DC  C 12 ? 0.6925 0.5103 0.6824 -0.1630 0.0878  -0.0896 12  DC  C "O4'" 
1254 C "C3'" . DC  C 12 ? 0.7392 0.5542 0.7379 -0.1904 0.1165  -0.1178 12  DC  C "C3'" 
1255 O "O3'" . DC  C 12 ? 0.7699 0.6114 0.7606 -0.2103 0.1366  -0.1383 12  DC  C "O3'" 
1256 C "C2'" . DC  C 12 ? 0.7290 0.5266 0.6860 -0.1934 0.1045  -0.0914 12  DC  C "C2'" 
1257 C "C1'" . DC  C 12 ? 0.7032 0.5081 0.6525 -0.1769 0.0884  -0.0759 12  DC  C "C1'" 
1258 N N1    . DC  C 12 ? 0.7202 0.4789 0.6486 -0.1740 0.0664  -0.0505 12  DC  C N1    
1259 C C2    . DC  C 12 ? 0.7052 0.4636 0.5846 -0.1835 0.0657  -0.0355 12  DC  C C2    
1260 O O2    . DC  C 12 ? 0.6806 0.4802 0.5508 -0.1893 0.0827  -0.0449 12  DC  C O2    
1261 N N3    . DC  C 12 ? 0.7347 0.4459 0.5800 -0.1889 0.0457  -0.0122 12  DC  C N3    
1262 C C4    . DC  C 12 ? 0.7802 0.4445 0.6441 -0.1825 0.0197  0.0007  12  DC  C C4    
1263 N N4    . DC  C 12 ? 0.8302 0.4426 0.6507 -0.1930 -0.0063 0.0279  12  DC  C N4    
1264 C C5    . DC  C 12 ? 0.7782 0.4446 0.7088 -0.1678 0.0186  -0.0150 12  DC  C C5    
1265 C C6    . DC  C 12 ? 0.7364 0.4509 0.6941 -0.1655 0.0460  -0.0426 12  DC  C C6    
1266 O "O5'" . DG  D 1  ? 0.8919 0.6192 0.9220 -0.2639 0.2793  0.0449  1   DG  D "O5'" 
1267 C "C5'" . DG  D 1  ? 0.8402 0.5984 0.8853 -0.2498 0.2846  0.0341  1   DG  D "C5'" 
1268 C "C4'" . DG  D 1  ? 0.7693 0.5849 0.8935 -0.2241 0.2547  0.0246  1   DG  D "C4'" 
1269 O "O4'" . DG  D 1  ? 0.7313 0.5425 0.8413 -0.2097 0.2125  0.0339  1   DG  D "O4'" 
1270 C "C3'" . DG  D 1  ? 0.7358 0.5776 0.8665 -0.2053 0.2473  0.0186  1   DG  D "C3'" 
1271 O "O3'" . DG  D 1  ? 0.7267 0.6195 0.9453 -0.1925 0.2318  0.0082  1   DG  D "O3'" 
1272 C "C2'" . DG  D 1  ? 0.7113 0.5346 0.7811 -0.1891 0.2099  0.0318  1   DG  D "C2'" 
1273 C "C1'" . DG  D 1  ? 0.6909 0.5144 0.7811 -0.1875 0.1859  0.0354  1   DG  D "C1'" 
1274 N N9    . DG  D 1  ? 0.6911 0.4806 0.7275 -0.1812 0.1604  0.0481  1   DG  D N9    
1275 C C8    . DG  D 1  ? 0.7409 0.4809 0.7078 -0.1896 0.1610  0.0631  1   DG  D C8    
1276 N N7    . DG  D 1  ? 0.7401 0.4611 0.6894 -0.1785 0.1301  0.0717  1   DG  D N7    
1277 C C5    . DG  D 1  ? 0.6817 0.4416 0.6847 -0.1634 0.1142  0.0586  1   DG  D C5    
1278 C C6    . DG  D 1  ? 0.6524 0.4126 0.6677 -0.1493 0.0873  0.0551  1   DG  D C6    
1279 O O6    . DG  D 1  ? 0.6492 0.3785 0.6441 -0.1437 0.0696  0.0635  1   DG  D O6    
1280 N N1    . DG  D 1  ? 0.6108 0.4092 0.6701 -0.1440 0.0817  0.0392  1   DG  D N1    
1281 C C2    . DG  D 1  ? 0.5994 0.4317 0.6936 -0.1495 0.0922  0.0314  1   DG  D C2    
1282 N N2    . DG  D 1  ? 0.5840 0.4432 0.7092 -0.1466 0.0770  0.0196  1   DG  D N2    
1283 N N3    . DG  D 1  ? 0.6221 0.4590 0.7222 -0.1589 0.1157  0.0342  1   DG  D N3    
1284 C C4    . DG  D 1  ? 0.6574 0.4571 0.7080 -0.1662 0.1293  0.0461  1   DG  D C4    
1285 P P     . DC  D 2  ? 0.7471 0.6742 1.0006 -0.1741 0.2229  0.0009  2   DC  D P     
1286 O OP1   . DC  D 2  ? 0.7398 0.6967 1.0862 -0.1817 0.2508  -0.0143 2   DC  D OP1   
1287 O OP2   . DC  D 2  ? 0.7504 0.6523 0.9265 -0.1679 0.2247  0.0063  2   DC  D OP2   
1288 O "O5'" . DC  D 2  ? 0.6726 0.6235 0.9444 -0.1570 0.1733  0.0058  2   DC  D "O5'" 
1289 C "C5'" . DC  D 2  ? 0.6979 0.6645 1.0185 -0.1623 0.1540  0.0043  2   DC  D "C5'" 
1290 C "C4'" . DC  D 2  ? 0.6898 0.6626 0.9898 -0.1508 0.1114  0.0084  2   DC  D "C4'" 
1291 O "O4'" . DC  D 2  ? 0.6911 0.6326 0.9186 -0.1474 0.1061  0.0140  2   DC  D "O4'" 
1292 C "C3'" . DC  D 2  ? 0.6583 0.6508 0.9634 -0.1365 0.0928  0.0091  2   DC  D "C3'" 
1293 O "O3'" . DC  D 2  ? 0.6704 0.6812 1.0071 -0.1376 0.0562  0.0093  2   DC  D "O3'" 
1294 C "C2'" . DC  D 2  ? 0.6411 0.6106 0.8691 -0.1268 0.0921  0.0139  2   DC  D "C2'" 
1295 C "C1'" . DC  D 2  ? 0.6438 0.5884 0.8375 -0.1327 0.0881  0.0157  2   DC  D "C1'" 
1296 N N1    . DC  D 2  ? 0.6253 0.5384 0.7584 -0.1286 0.0945  0.0218  2   DC  D N1    
1297 C C2    . DC  D 2  ? 0.6062 0.5068 0.7119 -0.1222 0.0752  0.0213  2   DC  D C2    
1298 O O2    . DC  D 2  ? 0.5889 0.5030 0.7101 -0.1225 0.0580  0.0139  2   DC  D O2    
1299 N N3    . DC  D 2  ? 0.6133 0.4853 0.6781 -0.1175 0.0752  0.0279  2   DC  D N3    
1300 C C4    . DC  D 2  ? 0.6653 0.5156 0.7011 -0.1224 0.0908  0.0372  2   DC  D C4    
1301 N N4    . DC  D 2  ? 0.6781 0.4960 0.6728 -0.1193 0.0818  0.0468  2   DC  D N4    
1302 C C5    . DC  D 2  ? 0.6770 0.5356 0.7262 -0.1324 0.1161  0.0358  2   DC  D C5    
1303 C C6    . DC  D 2  ? 0.6420 0.5345 0.7476 -0.1337 0.1186  0.0270  2   DC  D C6    
1304 P P     . DC  D 3  ? 0.6512 0.6832 1.0151 -0.1292 0.0293  0.0127  3   DC  D P     
1305 O OP1   . DC  D 3  ? 0.6438 0.6937 1.0705 -0.1386 -0.0022 0.0139  3   DC  D OP1   
1306 O OP2   . DC  D 3  ? 0.6519 0.6896 1.0314 -0.1199 0.0549  0.0110  3   DC  D OP2   
1307 O "O5'" . DC  D 3  ? 0.6259 0.6417 0.9115 -0.1239 0.0100  0.0158  3   DC  D "O5'" 
1308 C "C5'" . DC  D 3  ? 0.6267 0.6271 0.8734 -0.1325 -0.0043 0.0125  3   DC  D "C5'" 
1309 C "C4'" . DC  D 3  ? 0.6300 0.6170 0.8128 -0.1267 -0.0100 0.0111  3   DC  D "C4'" 
1310 O "O4'" . DC  D 3  ? 0.5826 0.5540 0.7337 -0.1175 0.0145  0.0098  3   DC  D "O4'" 
1311 C "C3'" . DC  D 3  ? 0.6363 0.6333 0.8142 -0.1193 -0.0214 0.0170  3   DC  D "C3'" 
1312 O "O3'" . DC  D 3  ? 0.6914 0.6758 0.8156 -0.1242 -0.0349 0.0134  3   DC  D "O3'" 
1313 C "C2'" . DC  D 3  ? 0.5910 0.5848 0.7563 -0.1056 0.0059  0.0178  3   DC  D "C2'" 
1314 C "C1'" . DC  D 3  ? 0.5630 0.5363 0.6908 -0.1062 0.0173  0.0127  3   DC  D "C1'" 
1315 N N1    . DC  D 3  ? 0.5410 0.4995 0.6499 -0.0991 0.0393  0.0151  3   DC  D N1    
1316 C C2    . DC  D 3  ? 0.5196 0.4581 0.5947 -0.0956 0.0397  0.0129  3   DC  D C2    
1317 O O2    . DC  D 3  ? 0.5141 0.4507 0.5800 -0.0978 0.0288  0.0050  3   DC  D O2    
1318 N N3    . DC  D 3  ? 0.5173 0.4361 0.5716 -0.0917 0.0512  0.0190  3   DC  D N3    
1319 C C4    . DC  D 3  ? 0.5414 0.4570 0.5960 -0.0947 0.0677  0.0246  3   DC  D C4    
1320 N N4    . DC  D 3  ? 0.5934 0.4812 0.6125 -0.0958 0.0757  0.0319  3   DC  D N4    
1321 C C5    . DC  D 3  ? 0.5461 0.4841 0.6386 -0.0981 0.0759  0.0222  3   DC  D C5    
1322 C C6    . DC  D 3  ? 0.5379 0.4982 0.6626 -0.0986 0.0585  0.0187  3   DC  D C6    
1323 P P     . DC  D 4  ? 0.7376 0.7211 0.8478 -0.1366 -0.0684 0.0191  4   DC  D P     
1324 O OP1   . DC  D 4  ? 0.7239 0.7105 0.8678 -0.1511 -0.0929 0.0218  4   DC  D OP1   
1325 O OP2   . DC  D 4  ? 0.7113 0.7039 0.8308 -0.1255 -0.0705 0.0283  4   DC  D OP2   
1326 O "O5'" . DC  D 4  ? 0.6912 0.6535 0.7320 -0.1462 -0.0641 0.0072  4   DC  D "O5'" 
1327 C "C5'" . DC  D 4  ? 0.6585 0.6070 0.6826 -0.1531 -0.0517 -0.0073 4   DC  D "C5'" 
1328 C "C4'" . DC  D 4  ? 0.6377 0.5756 0.6283 -0.1465 -0.0284 -0.0203 4   DC  D "C4'" 
1329 O "O4'" . DC  D 4  ? 0.5640 0.5093 0.5771 -0.1253 -0.0100 -0.0157 4   DC  D "O4'" 
1330 C "C3'" . DC  D 4  ? 0.6422 0.5736 0.5890 -0.1537 -0.0301 -0.0237 4   DC  D "C3'" 
1331 O "O3'" . DC  D 4  ? 0.6482 0.5617 0.5645 -0.1643 -0.0130 -0.0457 4   DC  D "O3'" 
1332 C "C2'" . DC  D 4  ? 0.5812 0.5266 0.5449 -0.1326 -0.0196 -0.0149 4   DC  D "C2'" 
1333 C "C1'" . DC  D 4  ? 0.5753 0.5235 0.5707 -0.1167 -0.0037 -0.0154 4   DC  D "C1'" 
1334 N N1    . DC  D 4  ? 0.5596 0.5187 0.5789 -0.1010 0.0017  -0.0029 4   DC  D N1    
1335 C C2    . DC  D 4  ? 0.5739 0.5260 0.5952 -0.0887 0.0160  -0.0030 4   DC  D C2    
1336 O O2    . DC  D 4  ? 0.5457 0.4863 0.5598 -0.0875 0.0213  -0.0130 4   DC  D O2    
1337 N N3    . DC  D 4  ? 0.5505 0.5051 0.5816 -0.0803 0.0228  0.0069  4   DC  D N3    
1338 C C4    . DC  D 4  ? 0.5634 0.5312 0.6148 -0.0814 0.0207  0.0135  4   DC  D C4    
1339 N N4    . DC  D 4  ? 0.5704 0.5375 0.6292 -0.0759 0.0342  0.0185  4   DC  D N4    
1340 C C5    . DC  D 4  ? 0.5560 0.5348 0.6215 -0.0902 0.0033  0.0147  4   DC  D C5    
1341 C C6    . DC  D 4  ? 0.5534 0.5253 0.5973 -0.1011 -0.0079 0.0081  4   DC  D C6    
1342 P P     . DA  D 5  ? 0.6722 0.5687 0.5308 -0.1851 -0.0078 -0.0584 5   DA  D P     
1343 O OP1   . DA  D 5  ? 0.7034 0.5796 0.5405 -0.2007 0.0120  -0.0855 5   DA  D OP1   
1344 O OP2   . DA  D 5  ? 0.7132 0.6056 0.5427 -0.2002 -0.0374 -0.0405 5   DA  D OP2   
1345 O "O5'" . DA  D 5  ? 0.6454 0.5542 0.5176 -0.1658 0.0114  -0.0593 5   DA  D "O5'" 
1346 C "C5'" . DA  D 5  ? 0.6262 0.5362 0.5256 -0.1523 0.0364  -0.0760 5   DA  D "C5'" 
1347 C "C4'" . DA  D 5  ? 0.5791 0.5044 0.5001 -0.1321 0.0414  -0.0677 5   DA  D "C4'" 
1348 O "O4'" . DA  D 5  ? 0.5084 0.4462 0.4521 -0.1165 0.0260  -0.0450 5   DA  D "O4'" 
1349 C "C3'" . DA  D 5  ? 0.5871 0.5127 0.4753 -0.1423 0.0431  -0.0667 5   DA  D "C3'" 
1350 O "O3'" . DA  D 5  ? 0.6286 0.5515 0.5224 -0.1443 0.0694  -0.0894 5   DA  D "O3'" 
1351 C "C2'" . DA  D 5  ? 0.5393 0.4809 0.4468 -0.1240 0.0291  -0.0440 5   DA  D "C2'" 
1352 C "C1'" . DA  D 5  ? 0.4957 0.4434 0.4415 -0.1058 0.0270  -0.0373 5   DA  D "C1'" 
1353 N N9    . DA  D 5  ? 0.4879 0.4453 0.4486 -0.0961 0.0146  -0.0177 5   DA  D N9    
1354 C C8    . DA  D 5  ? 0.4702 0.4322 0.4302 -0.1026 -0.0016 -0.0051 5   DA  D C8    
1355 N N7    . DA  D 5  ? 0.4468 0.4184 0.4337 -0.0906 -0.0029 0.0062  5   DA  D N7    
1356 C C5    . DA  D 5  ? 0.4407 0.4100 0.4325 -0.0780 0.0115  0.0030  5   DA  D C5    
1357 C C6    . DA  D 5  ? 0.4275 0.3966 0.4312 -0.0672 0.0190  0.0098  5   DA  D C6    
1358 N N6    . DA  D 5  ? 0.4383 0.4141 0.4602 -0.0655 0.0203  0.0173  5   DA  D N6    
1359 N N1    . DA  D 5  ? 0.4282 0.3863 0.4252 -0.0603 0.0252  0.0077  5   DA  D N1    
1360 C C2    . DA  D 5  ? 0.4504 0.4036 0.4454 -0.0604 0.0250  -0.0023 5   DA  D C2    
1361 N N3    . DA  D 5  ? 0.4597 0.4151 0.4502 -0.0696 0.0257  -0.0139 5   DA  D N3    
1362 C C4    . DA  D 5  ? 0.4516 0.4130 0.4327 -0.0798 0.0186  -0.0099 5   DA  D C4    
1363 N N1    . 5CM D 6  ? 0.4385 0.4100 0.3985 -0.0738 0.0289  -0.0182 6   5CM D N1    
1364 C C2    . 5CM D 6  ? 0.4122 0.3841 0.3851 -0.0614 0.0242  -0.0068 6   5CM D C2    
1365 N N3    . 5CM D 6  ? 0.3926 0.3676 0.3673 -0.0617 0.0185  0.0043  6   5CM D N3    
1366 C C4    . 5CM D 6  ? 0.3823 0.3602 0.3519 -0.0713 0.0093  0.0089  6   5CM D C4    
1367 C C5    . 5CM D 6  ? 0.4246 0.3968 0.3679 -0.0863 0.0078  0.0012  6   5CM D C5    
1368 C C5A   . 5CM D 6  ? 0.4495 0.4146 0.3717 -0.1034 -0.0089 0.0087  6   5CM D C5A   
1369 C C6    . 5CM D 6  ? 0.4358 0.4049 0.3735 -0.0877 0.0220  -0.0141 6   5CM D C6    
1370 O O2    . 5CM D 6  ? 0.4162 0.3831 0.4000 -0.0523 0.0254  -0.0079 6   5CM D O2    
1371 N N4    . 5CM D 6  ? 0.3672 0.3500 0.3564 -0.0696 0.0021  0.0189  6   5CM D N4    
1372 C "C1'" . 5CM D 6  ? 0.4678 0.4384 0.4410 -0.0729 0.0411  -0.0349 6   5CM D "C1'" 
1373 C "C2'" . 5CM D 6  ? 0.4868 0.4595 0.4461 -0.0850 0.0527  -0.0462 6   5CM D "C2'" 
1374 C "C3'" . 5CM D 6  ? 0.5205 0.4914 0.5063 -0.0865 0.0698  -0.0688 6   5CM D "C3'" 
1375 C "C4'" . 5CM D 6  ? 0.5296 0.4922 0.5197 -0.0847 0.0645  -0.0679 6   5CM D "C4'" 
1376 O "O4'" . 5CM D 6  ? 0.4889 0.4520 0.4670 -0.0788 0.0468  -0.0461 6   5CM D "O4'" 
1377 O "O3'" . 5CM D 6  ? 0.5140 0.4917 0.5453 -0.0687 0.0665  -0.0704 6   5CM D "O3'" 
1378 C "C5'" . 5CM D 6  ? 0.5731 0.5236 0.5403 -0.1047 0.0763  -0.0840 6   5CM D "C5'" 
1379 O "O5'" . 5CM D 6  ? 0.6132 0.5573 0.5329 -0.1264 0.0803  -0.0857 6   5CM D "O5'" 
1380 P P     . 5CM D 6  ? 0.6228 0.5460 0.4922 -0.1547 0.0821  -0.0946 6   5CM D P     
1381 O OP1   . 5CM D 6  ? 0.7237 0.6360 0.5898 -0.1711 0.1158  -0.1274 6   5CM D OP1   
1382 O OP2   . 5CM D 6  ? 0.6535 0.5693 0.4758 -0.1688 0.0600  -0.0738 6   5CM D OP2   
1383 P P     . DA  D 7  ? 0.5135 0.5024 0.5668 -0.0653 0.0705  -0.0754 7   DA  D P     
1384 O OP1   . DA  D 7  ? 0.5486 0.5420 0.6511 -0.0668 0.0890  -0.1008 7   DA  D OP1   
1385 O OP2   . DA  D 7  ? 0.5350 0.5252 0.5482 -0.0763 0.0717  -0.0671 7   DA  D OP2   
1386 O "O5'" . DA  D 7  ? 0.5216 0.5100 0.5905 -0.0466 0.0463  -0.0570 7   DA  D "O5'" 
1387 C "C5'" . DA  D 7  ? 0.5177 0.4942 0.5927 -0.0368 0.0315  -0.0464 7   DA  D "C5'" 
1388 C "C4'" . DA  D 7  ? 0.5234 0.4922 0.5902 -0.0275 0.0110  -0.0287 7   DA  D "C4'" 
1389 O "O4'" . DA  D 7  ? 0.5093 0.4735 0.5334 -0.0307 0.0106  -0.0146 7   DA  D "O4'" 
1390 C "C3'" . DA  D 7  ? 0.5162 0.4936 0.5973 -0.0251 0.0057  -0.0310 7   DA  D "C3'" 
1391 O "O3'" . DA  D 7  ? 0.5588 0.5208 0.6435 -0.0175 -0.0193 -0.0183 7   DA  D "O3'" 
1392 C "C2'" . DA  D 7  ? 0.4908 0.4732 0.5318 -0.0320 0.0138  -0.0249 7   DA  D "C2'" 
1393 C "C1'" . DA  D 7  ? 0.4877 0.4587 0.4976 -0.0321 0.0112  -0.0117 7   DA  D "C1'" 
1394 N N9    . DA  D 7  ? 0.4566 0.4333 0.4452 -0.0396 0.0201  -0.0090 7   DA  D N9    
1395 C C8    . DA  D 7  ? 0.4462 0.4293 0.4308 -0.0500 0.0292  -0.0170 7   DA  D C8    
1396 N N7    . DA  D 7  ? 0.4336 0.4163 0.3994 -0.0563 0.0270  -0.0087 7   DA  D N7    
1397 C C5    . DA  D 7  ? 0.3994 0.3791 0.3661 -0.0479 0.0219  0.0019  7   DA  D C5    
1398 C C6    . DA  D 7  ? 0.3909 0.3707 0.3574 -0.0481 0.0195  0.0112  7   DA  D C6    
1399 N N6    . DA  D 7  ? 0.3734 0.3560 0.3398 -0.0560 0.0132  0.0158  7   DA  D N6    
1400 N N1    . DA  D 7  ? 0.4103 0.3844 0.3787 -0.0418 0.0232  0.0150  7   DA  D N1    
1401 C C2    . DA  D 7  ? 0.4194 0.3835 0.3776 -0.0378 0.0233  0.0135  7   DA  D C2    
1402 N N3    . DA  D 7  ? 0.4187 0.3812 0.3797 -0.0358 0.0173  0.0089  7   DA  D N3    
1403 C C4    . DA  D 7  ? 0.4239 0.3973 0.3956 -0.0398 0.0194  0.0015  7   DA  D C4    
1404 P P     . DC  D 8  ? 0.5797 0.5433 0.6746 -0.0154 -0.0357 -0.0160 8   DC  D P     
1405 O OP1   . DC  D 8  ? 0.6346 0.5824 0.7608 -0.0087 -0.0657 -0.0094 8   DC  D OP1   
1406 O OP2   . DC  D 8  ? 0.5282 0.5152 0.6464 -0.0198 -0.0173 -0.0317 8   DC  D OP2   
1407 O "O5'" . DC  D 8  ? 0.5886 0.5404 0.6219 -0.0203 -0.0353 -0.0027 8   DC  D "O5'" 
1408 C "C5'" . DC  D 8  ? 0.5642 0.4914 0.5547 -0.0228 -0.0414 0.0111  8   DC  D "C5'" 
1409 C "C4'" . DC  D 8  ? 0.5541 0.4768 0.5028 -0.0285 -0.0302 0.0147  8   DC  D "C4'" 
1410 O "O4'" . DC  D 8  ? 0.4998 0.4411 0.4526 -0.0294 -0.0090 0.0098  8   DC  D "O4'" 
1411 C "C3'" . DC  D 8  ? 0.5433 0.4671 0.4889 -0.0299 -0.0379 0.0120  8   DC  D "C3'" 
1412 O "O3'" . DC  D 8  ? 0.5618 0.4553 0.4603 -0.0372 -0.0480 0.0200  8   DC  D "O3'" 
1413 C "C2'" . DC  D 8  ? 0.5110 0.4534 0.4587 -0.0311 -0.0172 0.0060  8   DC  D "C2'" 
1414 C "C1'" . DC  D 8  ? 0.4924 0.4380 0.4345 -0.0316 -0.0024 0.0084  8   DC  D "C1'" 
1415 N N1    . DC  D 8  ? 0.4679 0.4324 0.4251 -0.0333 0.0084  0.0043  8   DC  D N1    
1416 C C2    . DC  D 8  ? 0.4564 0.4221 0.4069 -0.0354 0.0168  0.0084  8   DC  D C2    
1417 O O2    . DC  D 8  ? 0.4560 0.4103 0.3945 -0.0349 0.0215  0.0112  8   DC  D O2    
1418 N N3    . DC  D 8  ? 0.4215 0.3975 0.3795 -0.0399 0.0190  0.0087  8   DC  D N3    
1419 C C4    . DC  D 8  ? 0.4359 0.4189 0.3978 -0.0452 0.0199  0.0025  8   DC  D C4    
1420 N N4    . DC  D 8  ? 0.4457 0.4303 0.3994 -0.0552 0.0210  0.0042  8   DC  D N4    
1421 C C5    . DC  D 8  ? 0.4605 0.4461 0.4367 -0.0426 0.0195  -0.0065 8   DC  D C5    
1422 C C6    . DC  D 8  ? 0.4558 0.4331 0.4342 -0.0352 0.0103  -0.0038 8   DC  D C6    
1423 P P     . DT  D 9  ? 0.5938 0.4784 0.4748 -0.0426 -0.0579 0.0175  9   DT  D P     
1424 O OP1   . DT  D 9  ? 0.6499 0.4975 0.4917 -0.0517 -0.0857 0.0276  9   DT  D OP1   
1425 O OP2   . DT  D 9  ? 0.5388 0.4524 0.4690 -0.0369 -0.0592 0.0083  9   DT  D OP2   
1426 O "O5'" . DT  D 9  ? 0.5621 0.4439 0.4138 -0.0473 -0.0297 0.0129  9   DT  D "O5'" 
1427 C "C5'" . DT  D 9  ? 0.5758 0.4444 0.4016 -0.0519 -0.0110 0.0155  9   DT  D "C5'" 
1428 C "C4'" . DT  D 9  ? 0.5698 0.4407 0.3920 -0.0543 0.0150  0.0074  9   DT  D "C4'" 
1429 O "O4'" . DT  D 9  ? 0.5271 0.4293 0.3951 -0.0449 0.0226  0.0052  9   DT  D "O4'" 
1430 C "C3'" . DT  D 9  ? 0.5877 0.4425 0.3856 -0.0613 0.0158  0.0000  9   DT  D "C3'" 
1431 O "O3'" . DT  D 9  ? 0.6165 0.4543 0.3934 -0.0696 0.0448  -0.0079 9   DT  D "O3'" 
1432 C "C2'" . DT  D 9  ? 0.5334 0.4168 0.3752 -0.0520 0.0128  -0.0030 9   DT  D "C2'" 
1433 C "C1'" . DT  D 9  ? 0.5000 0.4072 0.3776 -0.0443 0.0246  -0.0002 9   DT  D "C1'" 
1434 N N1    . DT  D 9  ? 0.4560 0.3887 0.3679 -0.0388 0.0182  0.0018  9   DT  D N1    
1435 C C2    . DT  D 9  ? 0.4426 0.3868 0.3763 -0.0369 0.0264  0.0042  9   DT  D C2    
1436 O O2    . DT  D 9  ? 0.4518 0.3910 0.3935 -0.0364 0.0376  0.0032  9   DT  D O2    
1437 N N3    . DT  D 9  ? 0.4286 0.3878 0.3767 -0.0379 0.0204  0.0069  9   DT  D N3    
1438 C C4    . DT  D 9  ? 0.4208 0.3880 0.3721 -0.0396 0.0145  0.0035  9   DT  D C4    
1439 O O4    . DT  D 9  ? 0.4474 0.4239 0.4057 -0.0447 0.0164  0.0031  9   DT  D O4    
1440 C C5    . DT  D 9  ? 0.4325 0.3927 0.3789 -0.0375 0.0058  0.0000  9   DT  D C5    
1441 C C7    . DT  D 9  ? 0.4247 0.3957 0.3949 -0.0376 -0.0016 -0.0059 9   DT  D C7    
1442 C C6    . DT  D 9  ? 0.4395 0.3811 0.3619 -0.0378 0.0047  0.0016  9   DT  D C6    
1443 P P     . DC  D 10 ? 0.6838 0.4883 0.4145 -0.0847 0.0589  -0.0206 10  DC  D P     
1444 O OP1   . DC  D 10 ? 0.7422 0.5241 0.4454 -0.0974 0.0908  -0.0282 10  DC  D OP1   
1445 O OP2   . DC  D 10 ? 0.6933 0.4765 0.3842 -0.0931 0.0292  -0.0172 10  DC  D OP2   
1446 O "O5'" . DC  D 10 ? 0.6446 0.4725 0.4261 -0.0742 0.0693  -0.0294 10  DC  D "O5'" 
1447 C "C5'" . DC  D 10 ? 0.6029 0.4518 0.4368 -0.0651 0.0899  -0.0325 10  DC  D "C5'" 
1448 C "C4'" . DC  D 10 ? 0.5853 0.4490 0.4594 -0.0568 0.0858  -0.0347 10  DC  D "C4'" 
1449 O "O4'" . DC  D 10 ? 0.5357 0.4231 0.4292 -0.0487 0.0609  -0.0219 10  DC  D "O4'" 
1450 C "C3'" . DC  D 10 ? 0.6214 0.4625 0.4662 -0.0654 0.0863  -0.0458 10  DC  D "C3'" 
1451 O "O3'" . DC  D 10 ? 0.6572 0.5024 0.5453 -0.0601 0.0993  -0.0538 10  DC  D "O3'" 
1452 C "C2'" . DC  D 10 ? 0.5798 0.4339 0.4247 -0.0620 0.0560  -0.0359 10  DC  D "C2'" 
1453 C "C1'" . DC  D 10 ? 0.5237 0.4087 0.4151 -0.0503 0.0502  -0.0245 10  DC  D "C1'" 
1454 N N1    . DC  D 10 ? 0.4984 0.4015 0.3975 -0.0476 0.0294  -0.0158 10  DC  D N1    
1455 C C2    . DC  D 10 ? 0.4854 0.4093 0.4158 -0.0430 0.0266  -0.0082 10  DC  D C2    
1456 O O2    . DC  D 10 ? 0.4598 0.3854 0.4120 -0.0403 0.0338  -0.0054 10  DC  D O2    
1457 N N3    . DC  D 10 ? 0.4669 0.4053 0.4038 -0.0439 0.0158  -0.0051 10  DC  D N3    
1458 C C4    . DC  D 10 ? 0.4604 0.3977 0.3892 -0.0452 0.0048  -0.0083 10  DC  D C4    
1459 N N4    . DC  D 10 ? 0.4359 0.3897 0.3856 -0.0455 -0.0010 -0.0089 10  DC  D N4    
1460 C C5    . DC  D 10 ? 0.5102 0.4258 0.4088 -0.0485 -0.0011 -0.0113 10  DC  D C5    
1461 C C6    . DC  D 10 ? 0.5109 0.4080 0.3881 -0.0515 0.0131  -0.0154 10  DC  D C6    
1462 P P     . DC  D 11 ? 0.7419 0.5579 0.6192 -0.0700 0.1287  -0.0764 11  DC  D P     
1463 O OP1   . DC  D 11 ? 0.7427 0.5543 0.6343 -0.0729 0.1604  -0.0864 11  DC  D OP1   
1464 O OP2   . DC  D 11 ? 0.7747 0.5618 0.5847 -0.0855 0.1201  -0.0833 11  DC  D OP2   
1465 O "O5'" . DC  D 11 ? 0.6808 0.5087 0.6187 -0.0591 0.1246  -0.0762 11  DC  D "O5'" 
1466 C "C5'" . DC  D 11 ? 0.6358 0.4873 0.6416 -0.0453 0.1206  -0.0653 11  DC  D "C5'" 
1467 C "C4'" . DC  D 11 ? 0.6080 0.4712 0.6342 -0.0395 0.0935  -0.0495 11  DC  D "C4'" 
1468 O "O4'" . DC  D 11 ? 0.5668 0.4437 0.5590 -0.0415 0.0717  -0.0356 11  DC  D "O4'" 
1469 C "C3'" . DC  D 11 ? 0.6366 0.4816 0.6586 -0.0440 0.0941  -0.0590 11  DC  D "C3'" 
1470 O "O3'" . DC  D 11 ? 0.6895 0.5409 0.7631 -0.0365 0.0802  -0.0459 11  DC  D "O3'" 
1471 C "C2'" . DC  D 11 ? 0.6181 0.4671 0.5939 -0.0507 0.0737  -0.0519 11  DC  D "C2'" 
1472 C "C1'" . DC  D 11 ? 0.5634 0.4377 0.5484 -0.0451 0.0582  -0.0330 11  DC  D "C1'" 
1473 N N1    . DC  D 11 ? 0.5258 0.4115 0.4804 -0.0490 0.0428  -0.0269 11  DC  D N1    
1474 C C2    . DC  D 11 ? 0.5163 0.4209 0.4834 -0.0479 0.0302  -0.0133 11  DC  D C2    
1475 O O2    . DC  D 11 ? 0.5159 0.4233 0.5078 -0.0457 0.0276  -0.0033 11  DC  D O2    
1476 N N3    . DC  D 11 ? 0.4793 0.3957 0.4324 -0.0511 0.0209  -0.0120 11  DC  D N3    
1477 C C4    . DC  D 11 ? 0.4892 0.3990 0.4209 -0.0540 0.0158  -0.0198 11  DC  D C4    
1478 N N4    . DC  D 11 ? 0.4915 0.4145 0.4264 -0.0554 0.0038  -0.0187 11  DC  D N4    
1479 C C5    . DC  D 11 ? 0.5217 0.4078 0.4276 -0.0574 0.0226  -0.0298 11  DC  D C5    
1480 C C6    . DC  D 11 ? 0.5315 0.4063 0.4480 -0.0556 0.0398  -0.0351 11  DC  D C6    
1481 P P     . DG  D 12 ? 0.7078 0.5428 0.8416 -0.0313 0.0917  -0.0559 12  DG  D P     
1482 O OP1   . DG  D 12 ? 0.7062 0.5494 0.8969 -0.0226 0.1038  -0.0587 12  DG  D OP1   
1483 O OP2   . DG  D 12 ? 0.7063 0.5175 0.8117 -0.0401 0.1101  -0.0787 12  DG  D OP2   
1484 O "O5'" . DG  D 12 ? 0.6886 0.5267 0.8463 -0.0291 0.0599  -0.0304 12  DG  D "O5'" 
1485 C "C5'" . DG  D 12 ? 0.6182 0.4731 0.7817 -0.0271 0.0366  -0.0062 12  DG  D "C5'" 
1486 C "C4'" . DG  D 12 ? 0.6261 0.4786 0.7603 -0.0365 0.0130  0.0135  12  DG  D "C4'" 
1487 O "O4'" . DG  D 12 ? 0.6089 0.4771 0.6897 -0.0437 0.0135  0.0137  12  DG  D "O4'" 
1488 C "C3'" . DG  D 12 ? 0.6368 0.4694 0.7707 -0.0423 0.0119  0.0105  12  DG  D "C3'" 
1489 O "O3'" . DG  D 12 ? 0.6709 0.4879 0.8223 -0.0473 -0.0117 0.0330  12  DG  D "O3'" 
1490 C "C2'" . DG  D 12 ? 0.6264 0.4673 0.7065 -0.0534 0.0129  0.0077  12  DG  D "C2'" 
1491 C "C1'" . DG  D 12 ? 0.5851 0.4477 0.6404 -0.0543 0.0088  0.0153  12  DG  D "C1'" 
1492 N N9    . DG  D 12 ? 0.5435 0.4180 0.5658 -0.0572 0.0175  0.0018  12  DG  D N9    
1493 C C8    . DG  D 12 ? 0.5415 0.4096 0.5528 -0.0552 0.0294  -0.0165 12  DG  D C8    
1494 N N7    . DG  D 12 ? 0.5261 0.4028 0.5092 -0.0600 0.0262  -0.0219 12  DG  D N7    
1495 C C5    . DG  D 12 ? 0.4892 0.3824 0.4728 -0.0639 0.0175  -0.0100 12  DG  D C5    
1496 C C6    . DG  D 12 ? 0.4692 0.3787 0.4434 -0.0687 0.0128  -0.0121 12  DG  D C6    
1497 O O6    . DG  D 12 ? 0.4873 0.3996 0.4529 -0.0692 0.0081  -0.0213 12  DG  D O6    
1498 N N1    . DG  D 12 ? 0.4617 0.3815 0.4393 -0.0753 0.0126  -0.0026 12  DG  D N1    
1499 C C2    . DG  D 12 ? 0.4915 0.4018 0.4694 -0.0794 0.0106  0.0113  12  DG  D C2    
1500 N N2    . DG  D 12 ? 0.4799 0.3945 0.4453 -0.0921 0.0120  0.0182  12  DG  D N2    
1501 N N3    . DG  D 12 ? 0.4929 0.3874 0.4841 -0.0735 0.0069  0.0174  12  DG  D N3    
1502 C C4    . DG  D 12 ? 0.5062 0.3954 0.5051 -0.0647 0.0133  0.0044  12  DG  D C4    
1503 C CA    . GLY E 6  ? 0.7820 0.7476 0.6936 -0.0395 0.0244  -0.0705 147 GLY E CA    
1504 C C     . GLY E 6  ? 0.7709 0.7312 0.6714 -0.0567 0.0285  -0.0585 147 GLY E C     
1505 O O     . GLY E 6  ? 0.7902 0.7010 0.6671 -0.0502 0.0248  -0.0465 147 GLY E O     
1506 N N     . LYS E 7  ? 0.7323 0.7460 0.6481 -0.0784 0.0357  -0.0627 148 LYS E N     
1507 C CA    . LYS E 7  ? 0.7236 0.7426 0.6271 -0.1006 0.0433  -0.0546 148 LYS E CA    
1508 C C     . LYS E 7  ? 0.6649 0.7048 0.5845 -0.0741 0.0437  -0.0475 148 LYS E C     
1509 O O     . LYS E 7  ? 0.6326 0.7204 0.5845 -0.0539 0.0440  -0.0541 148 LYS E O     
1510 C CB    . LYS E 7  ? 0.7039 0.7837 0.6214 -0.1336 0.0530  -0.0655 148 LYS E CB    
1511 N N     . ARG E 8  ? 0.6736 0.6709 0.5656 -0.0747 0.0418  -0.0335 149 ARG E N     
1512 C CA    . ARG E 8  ? 0.6230 0.6332 0.5220 -0.0555 0.0412  -0.0268 149 ARG E CA    
1513 C C     . ARG E 8  ? 0.6163 0.6527 0.5052 -0.0809 0.0526  -0.0264 149 ARG E C     
1514 O O     . ARG E 8  ? 0.6682 0.6749 0.5230 -0.1109 0.0556  -0.0189 149 ARG E O     
1515 C CB    . ARG E 8  ? 0.6345 0.5882 0.5085 -0.0403 0.0297  -0.0120 149 ARG E CB    
1516 C CG    . ARG E 8  ? 0.6259 0.5602 0.5109 -0.0141 0.0207  -0.0154 149 ARG E CG    
1517 C CD    . ARG E 8  ? 0.6511 0.5514 0.5245 0.0093  0.0087  -0.0040 149 ARG E CD    
1518 N NE    . ARG E 8  ? 0.6450 0.5275 0.5265 0.0325  0.0023  -0.0105 149 ARG E NE    
1519 C CZ    . ARG E 8  ? 0.6745 0.5363 0.5539 0.0591  -0.0086 -0.0054 149 ARG E CZ    
1520 N NH1   . ARG E 8  ? 0.6580 0.5118 0.5261 0.0660  -0.0176 0.0086  149 ARG E NH1   
1521 N NH2   . ARG E 8  ? 0.7037 0.5579 0.5931 0.0799  -0.0109 -0.0164 149 ARG E NH2   
1522 N N     . MET E 9  ? 0.5592 0.6481 0.4744 -0.0692 0.0591  -0.0354 150 MET E N     
1523 C CA    . MET E 9  ? 0.5581 0.6888 0.4725 -0.0887 0.0731  -0.0423 150 MET E CA    
1524 C C     . MET E 9  ? 0.5365 0.6565 0.4363 -0.0782 0.0727  -0.0359 150 MET E C     
1525 O O     . MET E 9  ? 0.4955 0.6108 0.4092 -0.0498 0.0648  -0.0360 150 MET E O     
1526 C CB    . MET E 9  ? 0.5355 0.7355 0.4938 -0.0746 0.0793  -0.0618 150 MET E CB    
1527 C CG    . MET E 9  ? 0.5516 0.7813 0.5295 -0.0861 0.0793  -0.0712 150 MET E CG    
1528 S SD    . MET E 9  ? 0.6652 0.8844 0.6108 -0.1407 0.0885  -0.0679 150 MET E SD    
1529 C CE    . MET E 9  ? 0.6395 0.9473 0.6025 -0.1620 0.1096  -0.0844 150 MET E CE    
1530 N N     . ASP E 10 ? 0.5679 0.6868 0.4372 -0.1046 0.0816  -0.0314 151 ASP E N     
1531 C CA    . ASP E 10 ? 0.5708 0.6876 0.4232 -0.0984 0.0825  -0.0285 151 ASP E CA    
1532 C C     . ASP E 10 ? 0.5263 0.6917 0.4159 -0.0725 0.0886  -0.0488 151 ASP E C     
1533 O O     . ASP E 10 ? 0.4892 0.7022 0.4115 -0.0682 0.0968  -0.0654 151 ASP E O     
1534 C CB    . ASP E 10 ? 0.6217 0.7443 0.4354 -0.1354 0.0954  -0.0248 151 ASP E CB    
1535 C CG    . ASP E 10 ? 0.6935 0.7455 0.4522 -0.1564 0.0837  0.0017  151 ASP E CG    
1536 O OD1   . ASP E 10 ? 0.7256 0.7392 0.4686 -0.1374 0.0675  0.0154  151 ASP E OD1   
1537 O OD2   . ASP E 10 ? 0.7314 0.7679 0.4589 -0.1936 0.0903  0.0090  151 ASP E OD2   
1538 N N     . CYS E 11 ? 0.5206 0.6733 0.4037 -0.0555 0.0833  -0.0482 152 CYS E N     
1539 C CA    . CYS E 11 ? 0.5176 0.6998 0.4276 -0.0309 0.0873  -0.0671 152 CYS E CA    
1540 C C     . CYS E 11 ? 0.5518 0.7449 0.4384 -0.0398 0.0976  -0.0758 152 CYS E C     
1541 O O     . CYS E 11 ? 0.5874 0.7489 0.4473 -0.0414 0.0891  -0.0658 152 CYS E O     
1542 C CB    . CYS E 11 ? 0.5022 0.6571 0.4243 -0.0044 0.0722  -0.0625 152 CYS E CB    
1543 S SG    . CYS E 11 ? 0.5061 0.6804 0.4491 0.0229  0.0762  -0.0847 152 CYS E SG    
1544 N N     . PRO E 12 ? 0.5687 0.8124 0.4654 -0.0462 0.1161  -0.0961 153 PRO E N     
1545 C CA    . PRO E 12 ? 0.5976 0.8567 0.4664 -0.0601 0.1298  -0.1070 153 PRO E CA    
1546 C C     . PRO E 12 ? 0.6156 0.8539 0.4763 -0.0386 0.1250  -0.1168 153 PRO E C     
1547 O O     . PRO E 12 ? 0.6347 0.8624 0.4588 -0.0536 0.1283  -0.1167 153 PRO E O     
1548 C CB    . PRO E 12 ? 0.5980 0.9283 0.4939 -0.0621 0.1510  -0.1327 153 PRO E CB    
1549 C CG    . PRO E 12 ? 0.5772 0.9231 0.4965 -0.0717 0.1481  -0.1247 153 PRO E CG    
1550 C CD    . PRO E 12 ? 0.5471 0.8433 0.4783 -0.0471 0.1259  -0.1096 153 PRO E CD    
1551 N N     . ALA E 13 ? 0.6115 0.8400 0.5006 -0.0066 0.1163  -0.1248 154 ALA E N     
1552 C CA    . ALA E 13 ? 0.6282 0.8289 0.5053 0.0105  0.1116  -0.1355 154 ALA E CA    
1553 C C     . ALA E 13 ? 0.6226 0.7761 0.4764 0.0030  0.0938  -0.1147 154 ALA E C     
1554 O O     . ALA E 13 ? 0.6528 0.7809 0.4964 0.0123  0.0879  -0.1218 154 ALA E O     
1555 C CB    . ALA E 13 ? 0.6198 0.8193 0.5282 0.0453  0.1077  -0.1501 154 ALA E CB    
1556 N N     . LEU E 14 ? 0.6282 0.7697 0.4748 -0.0120 0.0841  -0.0904 155 LEU E N     
1557 C CA    . LEU E 14 ? 0.6270 0.7358 0.4561 -0.0164 0.0661  -0.0714 155 LEU E CA    
1558 C C     . LEU E 14 ? 0.6764 0.7817 0.4698 -0.0411 0.0654  -0.0569 155 LEU E C     
1559 O O     . LEU E 14 ? 0.6727 0.7948 0.4591 -0.0564 0.0780  -0.0575 155 LEU E O     
1560 C CB    . LEU E 14 ? 0.5871 0.6832 0.4408 -0.0051 0.0530  -0.0556 155 LEU E CB    
1561 C CG    . LEU E 14 ? 0.5716 0.6628 0.4535 0.0158  0.0486  -0.0618 155 LEU E CG    
1562 C CD1   . LEU E 14 ? 0.5465 0.6335 0.4492 0.0226  0.0398  -0.0479 155 LEU E CD1   
1563 C CD2   . LEU E 14 ? 0.5886 0.6603 0.4592 0.0176  0.0400  -0.0642 155 LEU E CD2   
1564 N N     . PRO E 15 ? 0.7239 0.8082 0.4937 -0.0467 0.0489  -0.0419 156 PRO E N     
1565 C CA    . PRO E 15 ? 0.7694 0.8429 0.4966 -0.0685 0.0431  -0.0248 156 PRO E CA    
1566 C C     . PRO E 15 ? 0.7893 0.8455 0.5100 -0.0760 0.0391  -0.0041 156 PRO E C     
1567 O O     . PRO E 15 ? 0.7555 0.8118 0.5078 -0.0648 0.0413  -0.0047 156 PRO E O     
1568 C CB    . PRO E 15 ? 0.7823 0.8431 0.4976 -0.0646 0.0212  -0.0137 156 PRO E CB    
1569 C CG    . PRO E 15 ? 0.7542 0.8224 0.4949 -0.0513 0.0234  -0.0327 156 PRO E CG    
1570 C CD    . PRO E 15 ? 0.7194 0.7922 0.4998 -0.0345 0.0331  -0.0392 156 PRO E CD    
1571 N N     . PRO E 16 ? 0.8430 0.8798 0.5168 -0.0973 0.0332  0.0137  157 PRO E N     
1572 C CA    . PRO E 16 ? 0.8713 0.8821 0.5287 -0.1108 0.0329  0.0310  157 PRO E CA    
1573 C C     . PRO E 16 ? 0.8587 0.8354 0.5330 -0.0893 0.0132  0.0475  157 PRO E C     
1574 O O     . PRO E 16 ? 0.8807 0.8434 0.5525 -0.0723 -0.0079 0.0594  157 PRO E O     
1575 C CB    . PRO E 16 ? 0.9443 0.9332 0.5367 -0.1400 0.0286  0.0489  157 PRO E CB    
1576 C CG    . PRO E 16 ? 0.9352 0.9565 0.5153 -0.1470 0.0376  0.0314  157 PRO E CG    
1577 C CD    . PRO E 16 ? 0.8740 0.9186 0.5033 -0.1185 0.0373  0.0106  157 PRO E CD    
1578 N N     . GLY E 17 ? 0.8392 0.8076 0.5301 -0.0910 0.0207  0.0460  158 GLY E N     
1579 C CA    . GLY E 17 ? 0.8216 0.7552 0.5251 -0.0721 0.0057  0.0572  158 GLY E CA    
1580 C C     . GLY E 17 ? 0.7488 0.7075 0.5071 -0.0447 0.0068  0.0420  158 GLY E C     
1581 O O     . GLY E 17 ? 0.7407 0.6770 0.5119 -0.0293 -0.0018 0.0464  158 GLY E O     
1582 N N     . TRP E 18 ? 0.6905 0.6903 0.4755 -0.0387 0.0165  0.0243  159 TRP E N     
1583 C CA    . TRP E 18 ? 0.6089 0.6301 0.4379 -0.0184 0.0193  0.0108  159 TRP E CA    
1584 C C     . TRP E 18 ? 0.5883 0.6212 0.4367 -0.0232 0.0319  0.0009  159 TRP E C     
1585 O O     . TRP E 18 ? 0.5906 0.6451 0.4345 -0.0407 0.0467  -0.0081 159 TRP E O     
1586 C CB    . TRP E 18 ? 0.5810 0.6299 0.4226 -0.0128 0.0247  -0.0040 159 TRP E CB    
1587 C CG    . TRP E 18 ? 0.5865 0.6314 0.4212 -0.0060 0.0100  0.0023  159 TRP E CG    
1588 C CD1   . TRP E 18 ? 0.6324 0.6744 0.4353 -0.0179 0.0040  0.0077  159 TRP E CD1   
1589 C CD2   . TRP E 18 ? 0.5640 0.6145 0.4231 0.0105  -0.0005 0.0031  159 TRP E CD2   
1590 N NE1   . TRP E 18 ? 0.6067 0.6549 0.4160 -0.0092 -0.0108 0.0112  159 TRP E NE1   
1591 C CE2   . TRP E 18 ? 0.6031 0.6586 0.4477 0.0072  -0.0129 0.0083  159 TRP E CE2   
1592 C CE3   . TRP E 18 ? 0.5370 0.5931 0.4268 0.0250  -0.0004 -0.0002 159 TRP E CE3   
1593 C CZ2   . TRP E 18 ? 0.5937 0.6648 0.4578 0.0167  -0.0241 0.0092  159 TRP E CZ2   
1594 C CZ3   . TRP E 18 ? 0.5212 0.5893 0.4267 0.0341  -0.0100 0.0011  159 TRP E CZ3   
1595 C CH2   . TRP E 18 ? 0.5586 0.6366 0.4536 0.0295  -0.0212 0.0053  159 TRP E CH2   
1596 N N     . LYS E 19 ? 0.5571 0.5835 0.4284 -0.0085 0.0267  0.0003  160 LYS E N     
1597 C CA    . LYS E 19 ? 0.5426 0.5825 0.4310 -0.0143 0.0358  -0.0090 160 LYS E CA    
1598 C C     . LYS E 19 ? 0.5131 0.5745 0.4367 0.0066  0.0348  -0.0194 160 LYS E C     
1599 O O     . LYS E 19 ? 0.4900 0.5462 0.4221 0.0233  0.0264  -0.0166 160 LYS E O     
1600 C CB    . LYS E 19 ? 0.5873 0.5873 0.4550 -0.0255 0.0309  0.0010  160 LYS E CB    
1601 C CG    . LYS E 19 ? 0.6342 0.6093 0.4601 -0.0547 0.0341  0.0119  160 LYS E CG    
1602 C CD    . LYS E 19 ? 0.6922 0.6055 0.4861 -0.0630 0.0242  0.0257  160 LYS E CD    
1603 C CE    . LYS E 19 ? 0.7374 0.6140 0.4772 -0.0951 0.0247  0.0419  160 LYS E CE    
1604 N N     . LYS E 20 ? 0.5286 0.6185 0.4708 0.0032  0.0431  -0.0313 161 LYS E N     
1605 C CA    . LYS E 20 ? 0.5101 0.6213 0.4802 0.0208  0.0414  -0.0403 161 LYS E CA    
1606 C C     . LYS E 20 ? 0.5095 0.6220 0.4861 0.0138  0.0407  -0.0425 161 LYS E C     
1607 O O     . LYS E 20 ? 0.5434 0.6603 0.5111 -0.0076 0.0469  -0.0442 161 LYS E O     
1608 C CB    . LYS E 20 ? 0.5312 0.6794 0.5162 0.0255  0.0495  -0.0540 161 LYS E CB    
1609 C CG    . LYS E 20 ? 0.5237 0.6906 0.5326 0.0460  0.0452  -0.0619 161 LYS E CG    
1610 C CD    . LYS E 20 ? 0.5460 0.7523 0.5704 0.0538  0.0528  -0.0780 161 LYS E CD    
1611 C CE    . LYS E 20 ? 0.5382 0.7540 0.5813 0.0799  0.0441  -0.0835 161 LYS E CE    
1612 N N     . GLU E 21 ? 0.4897 0.5983 0.4778 0.0281  0.0339  -0.0430 162 GLU E N     
1613 C CA    . GLU E 21 ? 0.4927 0.6066 0.4871 0.0231  0.0324  -0.0485 162 GLU E CA    
1614 C C     . GLU E 21 ? 0.4534 0.5931 0.4672 0.0389  0.0281  -0.0541 162 GLU E C     
1615 O O     . GLU E 21 ? 0.4351 0.5683 0.4505 0.0543  0.0241  -0.0500 162 GLU E O     
1616 C CB    . GLU E 21 ? 0.5382 0.6125 0.5180 0.0260  0.0270  -0.0432 162 GLU E CB    
1617 C CG    . GLU E 21 ? 0.5528 0.6139 0.5246 0.0132  0.0267  -0.0494 162 GLU E CG    
1618 C CD    . GLU E 21 ? 0.6101 0.6321 0.5695 0.0253  0.0214  -0.0482 162 GLU E CD    
1619 O OE1   . GLU E 21 ? 0.6088 0.6354 0.5773 0.0456  0.0183  -0.0461 162 GLU E OE1   
1620 O OE2   . GLU E 21 ? 0.7525 0.7391 0.6923 0.0143  0.0205  -0.0512 162 GLU E OE2   
1621 N N     . GLU E 22 ? 0.4480 0.6151 0.4729 0.0326  0.0274  -0.0625 163 GLU E N     
1622 C CA    . GLU E 22 ? 0.4573 0.6473 0.4956 0.0473  0.0201  -0.0658 163 GLU E CA    
1623 C C     . GLU E 22 ? 0.4834 0.6683 0.5152 0.0376  0.0165  -0.0693 163 GLU E C     
1624 O O     . GLU E 22 ? 0.4977 0.6947 0.5293 0.0180  0.0188  -0.0765 163 GLU E O     
1625 C CB    . GLU E 22 ? 0.4748 0.7127 0.5350 0.0539  0.0194  -0.0746 163 GLU E CB    
1626 C CG    . GLU E 22 ? 0.4902 0.7311 0.5562 0.0805  0.0093  -0.0721 163 GLU E CG    
1627 C CD    . GLU E 22 ? 0.5178 0.8083 0.6074 0.0949  0.0025  -0.0817 163 GLU E CD    
1628 O OE1   . GLU E 22 ? 0.5289 0.8240 0.6187 0.1091  -0.0108 -0.0786 163 GLU E OE1   
1629 O OE2   . GLU E 22 ? 0.5537 0.8824 0.6615 0.0939  0.0096  -0.0927 163 GLU E OE2   
1630 N N     . VAL E 23 ? 0.4640 0.6311 0.4874 0.0482  0.0119  -0.0655 164 VAL E N     
1631 C CA    . VAL E 23 ? 0.4650 0.6270 0.4788 0.0415  0.0093  -0.0715 164 VAL E CA    
1632 C C     . VAL E 23 ? 0.4255 0.6149 0.4433 0.0497  0.0001  -0.0718 164 VAL E C     
1633 O O     . VAL E 23 ? 0.4197 0.6068 0.4358 0.0640  -0.0039 -0.0635 164 VAL E O     
1634 C CB    . VAL E 23 ? 0.4820 0.6086 0.4812 0.0469  0.0126  -0.0700 164 VAL E CB    
1635 C CG1   . VAL E 23 ? 0.5228 0.6464 0.5099 0.0431  0.0113  -0.0799 164 VAL E CG1   
1636 C CG2   . VAL E 23 ? 0.4982 0.5926 0.4886 0.0405  0.0170  -0.0689 164 VAL E CG2   
1637 N N     . ILE E 24 ? 0.4247 0.6367 0.4431 0.0381  -0.0045 -0.0808 165 ILE E N     
1638 C CA    . ILE E 24 ? 0.4118 0.6503 0.4291 0.0447  -0.0166 -0.0804 165 ILE E CA    
1639 C C     . ILE E 24 ? 0.4201 0.6367 0.4134 0.0421  -0.0158 -0.0815 165 ILE E C     
1640 O O     . ILE E 24 ? 0.4247 0.6228 0.4067 0.0293  -0.0092 -0.0918 165 ILE E O     
1641 C CB    . ILE E 24 ? 0.4208 0.7021 0.4499 0.0306  -0.0231 -0.0913 165 ILE E CB    
1642 C CG1   . ILE E 24 ? 0.4154 0.7285 0.4710 0.0294  -0.0194 -0.0944 165 ILE E CG1   
1643 C CG2   . ILE E 24 ? 0.4237 0.7350 0.4500 0.0399  -0.0396 -0.0893 165 ILE E CG2   
1644 C CD1   . ILE E 24 ? 0.4063 0.7297 0.4770 0.0570  -0.0231 -0.0867 165 ILE E CD1   
1645 N N     . ARG E 25 ? 0.4261 0.6416 0.4079 0.0533  -0.0219 -0.0718 166 ARG E N     
1646 C CA    . ARG E 25 ? 0.4604 0.6663 0.4170 0.0478  -0.0197 -0.0746 166 ARG E CA    
1647 C C     . ARG E 25 ? 0.5013 0.7268 0.4455 0.0340  -0.0264 -0.0868 166 ARG E C     
1648 O O     . ARG E 25 ? 0.5264 0.7810 0.4742 0.0352  -0.0409 -0.0834 166 ARG E O     
1649 C CB    . ARG E 25 ? 0.4474 0.6485 0.3879 0.0562  -0.0255 -0.0591 166 ARG E CB    
1650 C CG    . ARG E 25 ? 0.4233 0.6035 0.3701 0.0640  -0.0185 -0.0494 166 ARG E CG    
1651 C CD    . ARG E 25 ? 0.4469 0.6168 0.3693 0.0603  -0.0169 -0.0393 166 ARG E CD    
1652 N NE    . ARG E 25 ? 0.4350 0.5876 0.3628 0.0636  -0.0119 -0.0307 166 ARG E NE    
1653 C CZ    . ARG E 25 ? 0.4452 0.5871 0.3538 0.0559  -0.0092 -0.0204 166 ARG E CZ    
1654 N NH1   . ARG E 25 ? 0.4712 0.6171 0.3504 0.0442  -0.0104 -0.0156 166 ARG E NH1   
1655 N NH2   . ARG E 25 ? 0.4256 0.5537 0.3409 0.0561  -0.0054 -0.0149 166 ARG E NH2   
1656 N N     . LYS E 26 ? 0.5365 0.7461 0.4655 0.0228  -0.0171 -0.1019 167 LYS E N     
1657 C CA    . LYS E 26 ? 0.5693 0.7899 0.4836 0.0048  -0.0215 -0.1183 167 LYS E CA    
1658 C C     . LYS E 26 ? 0.6072 0.8455 0.4949 0.0018  -0.0293 -0.1174 167 LYS E C     
1659 O O     . LYS E 26 ? 0.6278 0.8905 0.5057 -0.0115 -0.0408 -0.1251 167 LYS E O     
1660 C CB    . LYS E 26 ? 0.6010 0.7843 0.5029 -0.0045 -0.0084 -0.1377 167 LYS E CB    
1661 C CG    . LYS E 26 ? 0.6150 0.7707 0.5312 -0.0081 -0.0027 -0.1387 167 LYS E CG    
1662 N N     . SER E 27 ? 0.6342 0.8637 0.5073 0.0104  -0.0237 -0.1083 168 SER E N     
1663 C CA    . SER E 27 ? 0.6803 0.9213 0.5170 0.0016  -0.0264 -0.1097 168 SER E CA    
1664 C C     . SER E 27 ? 0.6926 0.9308 0.5134 0.0072  -0.0257 -0.0898 168 SER E C     
1665 O O     . SER E 27 ? 0.6879 0.9138 0.5254 0.0182  -0.0240 -0.0755 168 SER E O     
1666 C CB    . SER E 27 ? 0.6986 0.9274 0.5175 -0.0073 -0.0103 -0.1354 168 SER E CB    
1667 O OG    . SER E 27 ? 0.6800 0.8898 0.5112 0.0047  0.0071  -0.1394 168 SER E OG    
1668 N N     . GLY E 28 ? 0.7705 1.0181 0.5536 -0.0044 -0.0266 -0.0894 169 GLY E N     
1669 C CA    . GLY E 28 ? 0.8032 1.0455 0.5609 -0.0073 -0.0262 -0.0691 169 GLY E CA    
1670 C C     . GLY E 28 ? 0.8211 1.0547 0.5720 0.0010  -0.0503 -0.0421 169 GLY E C     
1671 O O     . GLY E 28 ? 0.7653 1.0092 0.5350 0.0114  -0.0675 -0.0414 169 GLY E O     
1672 N N     . LEU E 29 ? 0.8701 1.0849 0.5921 -0.0039 -0.0515 -0.0211 170 LEU E N     
1673 C CA    . LEU E 29 ? 0.8924 1.0839 0.5940 0.0051  -0.0758 0.0064  170 LEU E CA    
1674 C C     . LEU E 29 ? 0.8460 1.0265 0.5903 0.0296  -0.0834 0.0097  170 LEU E C     
1675 O O     . LEU E 29 ? 0.8190 0.9953 0.5637 0.0474  -0.1070 0.0218  170 LEU E O     
1676 C CB    . LEU E 29 ? 0.9469 1.1084 0.6033 -0.0111 -0.0721 0.0278  170 LEU E CB    
1677 N N     . SER E 30 ? 0.7788 0.9594 0.5593 0.0321  -0.0639 -0.0031 171 SER E N     
1678 C CA    . SER E 30 ? 0.7194 0.8916 0.5383 0.0517  -0.0667 -0.0026 171 SER E CA    
1679 C C     . SER E 30 ? 0.6912 0.8936 0.5495 0.0607  -0.0692 -0.0196 171 SER E C     
1680 O O     . SER E 30 ? 0.6828 0.8839 0.5721 0.0742  -0.0685 -0.0211 171 SER E O     
1681 C CB    . SER E 30 ? 0.6836 0.8398 0.5160 0.0477  -0.0472 -0.0046 171 SER E CB    
1682 O OG    . SER E 30 ? 0.6485 0.8240 0.4926 0.0379  -0.0287 -0.0234 171 SER E OG    
1683 N N     . ALA E 31 ? 0.6716 0.9014 0.5251 0.0500  -0.0719 -0.0327 172 ALA E N     
1684 C CA    . ALA E 31 ? 0.6416 0.8992 0.5264 0.0481  -0.0714 -0.0506 172 ALA E CA    
1685 C C     . ALA E 31 ? 0.6262 0.9076 0.5387 0.0658  -0.0881 -0.0458 172 ALA E C     
1686 O O     . ALA E 31 ? 0.6280 0.9139 0.5286 0.0804  -0.1084 -0.0317 172 ALA E O     
1687 C CB    . ALA E 31 ? 0.6780 0.9576 0.5446 0.0297  -0.0741 -0.0656 172 ALA E CB    
1688 N N     . GLY E 32 ? 0.5981 0.8935 0.5457 0.0654  -0.0792 -0.0577 173 GLY E N     
1689 C CA    . GLY E 32 ? 0.5704 0.8991 0.5511 0.0812  -0.0895 -0.0585 173 GLY E CA    
1690 C C     . GLY E 32 ? 0.5504 0.8537 0.5434 0.1006  -0.0840 -0.0500 173 GLY E C     
1691 O O     . GLY E 32 ? 0.5057 0.8361 0.5290 0.1126  -0.0855 -0.0557 173 GLY E O     
1692 N N     . LYS E 33 ? 0.5661 0.8218 0.5349 0.1019  -0.0773 -0.0380 174 LYS E N     
1693 C CA    . LYS E 33 ? 0.5689 0.7944 0.5433 0.1159  -0.0719 -0.0309 174 LYS E CA    
1694 C C     . LYS E 33 ? 0.5182 0.7427 0.5127 0.1042  -0.0519 -0.0418 174 LYS E C     
1695 O O     . LYS E 33 ? 0.5031 0.7330 0.4968 0.0863  -0.0426 -0.0508 174 LYS E O     
1696 C CB    . LYS E 33 ? 0.6000 0.7791 0.5380 0.1128  -0.0717 -0.0148 174 LYS E CB    
1697 N N     . SER E 34 ? 0.4822 0.6930 0.4883 0.1138  -0.0460 -0.0408 175 SER E N     
1698 C CA    . SER E 34 ? 0.4511 0.6562 0.4686 0.1015  -0.0290 -0.0478 175 SER E CA    
1699 C C     . SER E 34 ? 0.4329 0.6022 0.4393 0.1018  -0.0215 -0.0404 175 SER E C     
1700 O O     . SER E 34 ? 0.4436 0.5913 0.4381 0.1120  -0.0275 -0.0318 175 SER E O     
1701 C CB    . SER E 34 ? 0.4446 0.6793 0.4884 0.1040  -0.0251 -0.0580 175 SER E CB    
1702 O OG    . SER E 34 ? 0.4419 0.6690 0.4905 0.1236  -0.0276 -0.0559 175 SER E OG    
1703 N N     . ASP E 35 ? 0.4043 0.5655 0.4124 0.0898  -0.0099 -0.0436 176 ASP E N     
1704 C CA    . ASP E 35 ? 0.3740 0.5125 0.3765 0.0889  -0.0039 -0.0383 176 ASP E CA    
1705 C C     . ASP E 35 ? 0.3657 0.5067 0.3805 0.0858  0.0033  -0.0435 176 ASP E C     
1706 O O     . ASP E 35 ? 0.3776 0.5289 0.3989 0.0769  0.0072  -0.0501 176 ASP E O     
1707 C CB    . ASP E 35 ? 0.3724 0.5035 0.3654 0.0810  0.0013  -0.0369 176 ASP E CB    
1708 C CG    . ASP E 35 ? 0.3914 0.5248 0.3672 0.0781  -0.0027 -0.0328 176 ASP E CG    
1709 O OD1   . ASP E 35 ? 0.3728 0.5185 0.3465 0.0746  -0.0031 -0.0397 176 ASP E OD1   
1710 O OD2   . ASP E 35 ? 0.4132 0.5342 0.3730 0.0752  -0.0046 -0.0232 176 ASP E OD2   
1711 N N     . VAL E 36 ? 0.3617 0.4889 0.3736 0.0892  0.0052  -0.0401 177 VAL E N     
1712 C CA    . VAL E 36 ? 0.3662 0.4938 0.3824 0.0847  0.0118  -0.0434 177 VAL E CA    
1713 C C     . VAL E 36 ? 0.3658 0.4759 0.3733 0.0790  0.0141  -0.0374 177 VAL E C     
1714 O O     . VAL E 36 ? 0.4038 0.5040 0.4042 0.0801  0.0116  -0.0324 177 VAL E O     
1715 C CB    . VAL E 36 ? 0.3682 0.4965 0.3858 0.0949  0.0115  -0.0473 177 VAL E CB    
1716 C CG1   . VAL E 36 ? 0.3789 0.5106 0.3959 0.0876  0.0200  -0.0518 177 VAL E CG1   
1717 C CG2   . VAL E 36 ? 0.3780 0.5325 0.4097 0.1067  0.0070  -0.0545 177 VAL E CG2   
1718 N N     . TYR E 37 ? 0.3704 0.4770 0.3768 0.0719  0.0174  -0.0375 178 TYR E N     
1719 C CA    . TYR E 37 ? 0.3794 0.4732 0.3791 0.0710  0.0163  -0.0316 178 TYR E CA    
1720 C C     . TYR E 37 ? 0.3963 0.4833 0.3871 0.0639  0.0184  -0.0296 178 TYR E C     
1721 O O     . TYR E 37 ? 0.4384 0.5300 0.4279 0.0559  0.0233  -0.0335 178 TYR E O     
1722 C CB    . TYR E 37 ? 0.3797 0.4657 0.3791 0.0733  0.0150  -0.0320 178 TYR E CB    
1723 C CG    . TYR E 37 ? 0.3577 0.4540 0.3621 0.0776  0.0151  -0.0365 178 TYR E CG    
1724 C CD1   . TYR E 37 ? 0.3665 0.4742 0.3723 0.0797  0.0142  -0.0339 178 TYR E CD1   
1725 C CD2   . TYR E 37 ? 0.3627 0.4558 0.3652 0.0754  0.0162  -0.0435 178 TYR E CD2   
1726 C CE1   . TYR E 37 ? 0.3656 0.4838 0.3697 0.0799  0.0152  -0.0369 178 TYR E CE1   
1727 C CE2   . TYR E 37 ? 0.3618 0.4656 0.3641 0.0775  0.0164  -0.0485 178 TYR E CE2   
1728 C CZ    . TYR E 37 ? 0.3729 0.4907 0.3753 0.0800  0.0162  -0.0446 178 TYR E CZ    
1729 O OH    . TYR E 37 ? 0.3725 0.5019 0.3686 0.0785  0.0172  -0.0485 178 TYR E OH    
1730 N N     . TYR E 38 ? 0.4016 0.4829 0.3850 0.0638  0.0151  -0.0242 179 TYR E N     
1731 C CA    . TYR E 38 ? 0.4295 0.5017 0.3973 0.0554  0.0152  -0.0200 179 TYR E CA    
1732 C C     . TYR E 38 ? 0.4493 0.5076 0.4091 0.0592  0.0066  -0.0105 179 TYR E C     
1733 O O     . TYR E 38 ? 0.4378 0.5039 0.4091 0.0703  0.0009  -0.0095 179 TYR E O     
1734 C CB    . TYR E 38 ? 0.4356 0.5121 0.3955 0.0517  0.0164  -0.0226 179 TYR E CB    
1735 C CG    . TYR E 38 ? 0.4246 0.5099 0.3892 0.0533  0.0241  -0.0337 179 TYR E CG    
1736 C CD1   . TYR E 38 ? 0.4230 0.5086 0.3970 0.0631  0.0224  -0.0378 179 TYR E CD1   
1737 C CD2   . TYR E 38 ? 0.4503 0.5447 0.4081 0.0459  0.0326  -0.0404 179 TYR E CD2   
1738 C CE1   . TYR E 38 ? 0.4293 0.5210 0.4083 0.0716  0.0263  -0.0482 179 TYR E CE1   
1739 C CE2   . TYR E 38 ? 0.4465 0.5577 0.4142 0.0533  0.0396  -0.0540 179 TYR E CE2   
1740 C CZ    . TYR E 38 ? 0.4372 0.5454 0.4165 0.0691  0.0350  -0.0578 179 TYR E CZ    
1741 O OH    . TYR E 38 ? 0.4555 0.5787 0.4453 0.0831  0.0387  -0.0714 179 TYR E OH    
1742 N N     . PHE E 39 ? 0.4656 0.5048 0.4048 0.0504  0.0054  -0.0040 180 PHE E N     
1743 C CA    . PHE E 39 ? 0.5190 0.5354 0.4444 0.0575  -0.0063 0.0071  180 PHE E CA    
1744 C C     . PHE E 39 ? 0.5445 0.5551 0.4456 0.0486  -0.0122 0.0166  180 PHE E C     
1745 O O     . PHE E 39 ? 0.5529 0.5605 0.4362 0.0305  -0.0038 0.0159  180 PHE E O     
1746 C CB    . PHE E 39 ? 0.5442 0.5263 0.4559 0.0549  -0.0064 0.0095  180 PHE E CB    
1747 C CG    . PHE E 39 ? 0.5194 0.5066 0.4511 0.0645  -0.0028 -0.0008 180 PHE E CG    
1748 C CD1   . PHE E 39 ? 0.5136 0.5163 0.4550 0.0535  0.0074  -0.0104 180 PHE E CD1   
1749 C CD2   . PHE E 39 ? 0.5234 0.5065 0.4650 0.0858  -0.0102 -0.0024 180 PHE E CD2   
1750 C CE1   . PHE E 39 ? 0.4977 0.5067 0.4533 0.0604  0.0093  -0.0197 180 PHE E CE1   
1751 C CE2   . PHE E 39 ? 0.5233 0.5123 0.4788 0.0928  -0.0055 -0.0138 180 PHE E CE2   
1752 C CZ    . PHE E 39 ? 0.5013 0.5010 0.4613 0.0786  0.0037  -0.0216 180 PHE E CZ    
1753 N N     . SER E 40 ? 0.5348 0.5509 0.4362 0.0606  -0.0262 0.0239  181 SER E N     
1754 C CA    . SER E 40 ? 0.5825 0.5942 0.4573 0.0523  -0.0356 0.0343  181 SER E CA    
1755 C C     . SER E 40 ? 0.6480 0.6146 0.4860 0.0461  -0.0417 0.0488  181 SER E C     
1756 O O     . SER E 40 ? 0.6875 0.6237 0.5234 0.0514  -0.0410 0.0502  181 SER E O     
1757 C CB    . SER E 40 ? 0.5749 0.6112 0.4625 0.0679  -0.0524 0.0386  181 SER E CB    
1758 O OG    . SER E 40 ? 0.6075 0.6271 0.4966 0.0913  -0.0673 0.0474  181 SER E OG    
1759 N N     . PRO E 41 ? 0.6762 0.6330 0.4799 0.0331  -0.0487 0.0601  182 PRO E N     
1760 C CA    . PRO E 41 ? 0.7452 0.6507 0.5064 0.0268  -0.0581 0.0782  182 PRO E CA    
1761 C C     . PRO E 41 ? 0.7876 0.6646 0.5509 0.0580  -0.0800 0.0891  182 PRO E C     
1762 O O     . PRO E 41 ? 0.8276 0.6506 0.5671 0.0589  -0.0834 0.0972  182 PRO E O     
1763 C CB    . PRO E 41 ? 0.7772 0.6846 0.4993 0.0069  -0.0628 0.0883  182 PRO E CB    
1764 C CG    . PRO E 41 ? 0.7224 0.6818 0.4708 0.0083  -0.0592 0.0739  182 PRO E CG    
1765 C CD    . PRO E 41 ? 0.6712 0.6551 0.4648 0.0170  -0.0444 0.0553  182 PRO E CD    
1766 N N     . SER E 42 ? 0.7980 0.7113 0.5891 0.0829  -0.0943 0.0875  183 SER E N     
1767 C CA    . SER E 42 ? 0.8335 0.7395 0.6449 0.1209  -0.1110 0.0888  183 SER E CA    
1768 C C     . SER E 42 ? 0.8293 0.7116 0.6564 0.1291  -0.0982 0.0766  183 SER E C     
1769 O O     . SER E 42 ? 0.9153 0.7484 0.7274 0.1486  -0.1088 0.0816  183 SER E O     
1770 C CB    . SER E 42 ? 0.7749 0.7506 0.6311 0.1400  -0.1184 0.0794  183 SER E CB    
1771 N N     . GLY E 43 ? 0.7788 0.6914 0.6315 0.1140  -0.0768 0.0603  184 GLY E N     
1772 C CA    . GLY E 43 ? 0.7341 0.6391 0.6063 0.1212  -0.0653 0.0461  184 GLY E CA    
1773 C C     . GLY E 43 ? 0.6544 0.6176 0.5728 0.1331  -0.0573 0.0295  184 GLY E C     
1774 O O     . GLY E 43 ? 0.6210 0.5826 0.5531 0.1378  -0.0480 0.0175  184 GLY E O     
1775 N N     . LYS E 44 ? 0.6257 0.6376 0.5627 0.1341  -0.0612 0.0293  185 LYS E N     
1776 C CA    . LYS E 44 ? 0.5980 0.6643 0.5710 0.1361  -0.0533 0.0164  185 LYS E CA    
1777 C C     . LYS E 44 ? 0.5636 0.6344 0.5409 0.1158  -0.0353 0.0076  185 LYS E C     
1778 O O     . LYS E 44 ? 0.5575 0.6162 0.5186 0.0962  -0.0290 0.0099  185 LYS E O     
1779 C CB    . LYS E 44 ? 0.6144 0.7263 0.5976 0.1320  -0.0621 0.0194  185 LYS E CB    
1780 C CG    . LYS E 44 ? 0.6006 0.7687 0.6181 0.1321  -0.0557 0.0073  185 LYS E CG    
1781 C CD    . LYS E 44 ? 0.6175 0.8363 0.6465 0.1235  -0.0649 0.0083  185 LYS E CD    
1782 C CE    . LYS E 44 ? 0.5725 0.8502 0.6341 0.1206  -0.0581 -0.0032 185 LYS E CE    
1783 N N     . LYS E 45 ? 0.5139 0.6072 0.5133 0.1218  -0.0275 -0.0032 186 LYS E N     
1784 C CA    . LYS E 45 ? 0.4754 0.5690 0.4766 0.1075  -0.0142 -0.0101 186 LYS E CA    
1785 C C     . LYS E 45 ? 0.4394 0.5620 0.4484 0.0945  -0.0104 -0.0118 186 LYS E C     
1786 O O     . LYS E 45 ? 0.4370 0.5919 0.4601 0.0973  -0.0132 -0.0135 186 LYS E O     
1787 C CB    . LYS E 45 ? 0.4638 0.5611 0.4764 0.1181  -0.0088 -0.0201 186 LYS E CB    
1788 C CG    . LYS E 45 ? 0.4410 0.5321 0.4503 0.1059  0.0009  -0.0256 186 LYS E CG    
1789 C CD    . LYS E 45 ? 0.4557 0.5415 0.4678 0.1160  0.0044  -0.0360 186 LYS E CD    
1790 C CE    . LYS E 45 ? 0.4294 0.5302 0.4437 0.1061  0.0119  -0.0419 186 LYS E CE    
1791 N NZ    . LYS E 45 ? 0.4551 0.5442 0.4647 0.1111  0.0152  -0.0532 186 LYS E NZ    
1792 N N     . PHE E 46 ? 0.4110 0.5216 0.4099 0.0808  -0.0043 -0.0124 187 PHE E N     
1793 C CA    . PHE E 46 ? 0.4008 0.5223 0.3991 0.0693  -0.0016 -0.0143 187 PHE E CA    
1794 C C     . PHE E 46 ? 0.3848 0.4969 0.3824 0.0682  0.0050  -0.0184 187 PHE E C     
1795 O O     . PHE E 46 ? 0.3800 0.4798 0.3757 0.0712  0.0080  -0.0207 187 PHE E O     
1796 C CB    . PHE E 46 ? 0.4323 0.5433 0.4149 0.0587  -0.0035 -0.0128 187 PHE E CB    
1797 C CG    . PHE E 46 ? 0.4659 0.5870 0.4447 0.0584  -0.0128 -0.0073 187 PHE E CG    
1798 C CD1   . PHE E 46 ? 0.4755 0.5825 0.4458 0.0655  -0.0173 -0.0014 187 PHE E CD1   
1799 C CD2   . PHE E 46 ? 0.4919 0.6371 0.4736 0.0498  -0.0190 -0.0070 187 PHE E CD2   
1800 C CE1   . PHE E 46 ? 0.5023 0.6158 0.4652 0.0681  -0.0297 0.0063  187 PHE E CE1   
1801 C CE2   . PHE E 46 ? 0.5008 0.6629 0.4811 0.0516  -0.0309 -0.0016 187 PHE E CE2   
1802 C CZ    . PHE E 46 ? 0.5186 0.6633 0.4885 0.0629  -0.0373 0.0058  187 PHE E CZ    
1803 N N     . ARG E 47 ? 0.3933 0.5132 0.3905 0.0619  0.0062  -0.0186 188 ARG E N     
1804 C CA    . ARG E 47 ? 0.3871 0.4989 0.3804 0.0626  0.0091  -0.0199 188 ARG E CA    
1805 C C     . ARG E 47 ? 0.4071 0.4973 0.3836 0.0554  0.0073  -0.0176 188 ARG E C     
1806 O O     . ARG E 47 ? 0.3932 0.4724 0.3622 0.0581  0.0062  -0.0163 188 ARG E O     
1807 C CB    . ARG E 47 ? 0.3873 0.5206 0.3858 0.0606  0.0117  -0.0207 188 ARG E CB    
1808 C CG    . ARG E 47 ? 0.3917 0.5438 0.4057 0.0721  0.0131  -0.0259 188 ARG E CG    
1809 C CD    . ARG E 47 ? 0.3891 0.5568 0.4047 0.0735  0.0186  -0.0317 188 ARG E CD    
1810 N NE    . ARG E 47 ? 0.3730 0.5617 0.4036 0.0872  0.0207  -0.0403 188 ARG E NE    
1811 C CZ    . ARG E 47 ? 0.3750 0.5785 0.4076 0.0926  0.0270  -0.0504 188 ARG E CZ    
1812 N NH1   . ARG E 47 ? 0.3695 0.5714 0.3880 0.0822  0.0311  -0.0512 188 ARG E NH1   
1813 N NH2   . ARG E 47 ? 0.3804 0.5989 0.4272 0.1107  0.0280  -0.0605 188 ARG E NH2   
1814 N N     . SER E 48 ? 0.4125 0.4927 0.3794 0.0469  0.0053  -0.0172 189 SER E N     
1815 C CA    . SER E 48 ? 0.4443 0.4907 0.3894 0.0418  0.0029  -0.0173 189 SER E CA    
1816 C C     . SER E 48 ? 0.4684 0.5024 0.4034 0.0366  0.0022  -0.0224 189 SER E C     
1817 O O     . SER E 48 ? 0.4272 0.4834 0.3703 0.0322  0.0019  -0.0224 189 SER E O     
1818 C CB    . SER E 48 ? 0.4431 0.4824 0.3721 0.0235  0.0012  -0.0109 189 SER E CB    
1819 O OG    . SER E 48 ? 0.4282 0.4881 0.3587 0.0053  0.0010  -0.0111 189 SER E OG    
1820 N N     . LYS E 49 ? 0.4923 0.4885 0.4062 0.0378  0.0005  -0.0267 190 LYS E N     
1821 C CA    . LYS E 49 ? 0.5390 0.5176 0.4379 0.0341  0.0012  -0.0356 190 LYS E CA    
1822 C C     . LYS E 49 ? 0.5653 0.5439 0.4498 0.0090  -0.0022 -0.0338 190 LYS E C     
1823 O O     . LYS E 49 ? 0.5878 0.5786 0.4696 0.0025  -0.0023 -0.0386 190 LYS E O     
1824 C CB    . LYS E 49 ? 0.5841 0.5184 0.4639 0.0480  0.0002  -0.0442 190 LYS E CB    
1825 C CG    . LYS E 49 ? 0.6290 0.5424 0.4903 0.0472  0.0031  -0.0588 190 LYS E CG    
1826 C CD    . LYS E 49 ? 0.6655 0.5357 0.5116 0.0700  0.0019  -0.0707 190 LYS E CD    
1827 C CE    . LYS E 49 ? 0.7392 0.5675 0.5534 0.0653  0.0030  -0.0863 190 LYS E CE    
1828 N NZ    . LYS E 49 ? 0.7838 0.5709 0.5874 0.0969  0.0008  -0.0994 190 LYS E NZ    
1829 N N     . PRO E 50 ? 0.5659 0.5342 0.4386 -0.0087 -0.0054 -0.0270 191 PRO E N     
1830 C CA    . PRO E 50 ? 0.5843 0.5670 0.4482 -0.0370 -0.0085 -0.0266 191 PRO E CA    
1831 C C     . PRO E 50 ? 0.5492 0.5959 0.4443 -0.0378 -0.0095 -0.0231 191 PRO E C     
1832 O O     . PRO E 50 ? 0.5548 0.6239 0.4482 -0.0543 -0.0144 -0.0252 191 PRO E O     
1833 C CB    . PRO E 50 ? 0.6157 0.5748 0.4576 -0.0602 -0.0100 -0.0197 191 PRO E CB    
1834 C CG    . PRO E 50 ? 0.6428 0.5534 0.4698 -0.0407 -0.0106 -0.0170 191 PRO E CG    
1835 C CD    . PRO E 50 ? 0.5909 0.5280 0.4488 -0.0084 -0.0072 -0.0202 191 PRO E CD    
1836 N N     . GLN E 51 ? 0.5047 0.5792 0.4262 -0.0191 -0.0066 -0.0189 192 GLN E N     
1837 C CA    . GLN E 51 ? 0.4925 0.6191 0.4417 -0.0122 -0.0094 -0.0169 192 GLN E CA    
1838 C C     . GLN E 51 ? 0.4638 0.5859 0.4091 -0.0040 -0.0134 -0.0185 192 GLN E C     
1839 O O     . GLN E 51 ? 0.4423 0.5925 0.3920 -0.0089 -0.0211 -0.0170 192 GLN E O     
1840 C CB    . GLN E 51 ? 0.4909 0.6355 0.4625 0.0070  -0.0049 -0.0147 192 GLN E CB    
1841 C CG    . GLN E 51 ? 0.4942 0.6874 0.4938 0.0190  -0.0079 -0.0145 192 GLN E CG    
1842 C CD    . GLN E 51 ? 0.5137 0.7087 0.5272 0.0392  -0.0025 -0.0161 192 GLN E CD    
1843 O OE1   . GLN E 51 ? 0.4924 0.6592 0.4961 0.0414  0.0024  -0.0163 192 GLN E OE1   
1844 N NE2   . GLN E 51 ? 0.5266 0.7532 0.5616 0.0559  -0.0051 -0.0185 192 GLN E NE2   
1845 N N     . LEU E 52 ? 0.4679 0.5571 0.4025 0.0067  -0.0084 -0.0219 193 LEU E N     
1846 C CA    . LEU E 52 ? 0.5069 0.5881 0.4304 0.0100  -0.0086 -0.0248 193 LEU E CA    
1847 C C     . LEU E 52 ? 0.5423 0.6146 0.4415 -0.0081 -0.0126 -0.0305 193 LEU E C     
1848 O O     . LEU E 52 ? 0.5855 0.6726 0.4783 -0.0116 -0.0183 -0.0282 193 LEU E O     
1849 C CB    . LEU E 52 ? 0.5173 0.5756 0.4378 0.0229  0.0001  -0.0307 193 LEU E CB    
1850 C CG    . LEU E 52 ? 0.5461 0.6070 0.4623 0.0275  0.0043  -0.0324 193 LEU E CG    
1851 C CD1   . LEU E 52 ? 0.5385 0.6155 0.4663 0.0327  0.0003  -0.0216 193 LEU E CD1   
1852 C CD2   . LEU E 52 ? 0.5757 0.6269 0.4959 0.0389  0.0140  -0.0416 193 LEU E CD2   
1853 N N     . ALA E 53 ? 0.5781 0.6206 0.4583 -0.0201 -0.0109 -0.0378 194 ALA E N     
1854 C CA    . ALA E 53 ? 0.6003 0.6266 0.4513 -0.0410 -0.0146 -0.0465 194 ALA E CA    
1855 C C     . ALA E 53 ? 0.6070 0.6732 0.4631 -0.0625 -0.0255 -0.0411 194 ALA E C     
1856 O O     . ALA E 53 ? 0.6424 0.7178 0.4817 -0.0761 -0.0321 -0.0451 194 ALA E O     
1857 C CB    . ALA E 53 ? 0.6213 0.5936 0.4448 -0.0485 -0.0115 -0.0562 194 ALA E CB    
1858 N N     . ARG E 54 ? 0.5927 0.6898 0.4724 -0.0653 -0.0274 -0.0333 195 ARG E N     
1859 C CA    . ARG E 54 ? 0.6191 0.7745 0.5159 -0.0797 -0.0377 -0.0293 195 ARG E CA    
1860 C C     . ARG E 54 ? 0.5935 0.7822 0.5033 -0.0622 -0.0473 -0.0236 195 ARG E C     
1861 O O     . ARG E 54 ? 0.6207 0.8363 0.5235 -0.0756 -0.0592 -0.0240 195 ARG E O     
1862 C CB    . ARG E 54 ? 0.6284 0.8218 0.5538 -0.0802 -0.0350 -0.0244 195 ARG E CB    
1863 C CG    . ARG E 54 ? 0.6985 0.8675 0.6048 -0.1082 -0.0291 -0.0263 195 ARG E CG    
1864 C CD    . ARG E 54 ? 0.7136 0.9409 0.6464 -0.1194 -0.0263 -0.0229 195 ARG E CD    
1865 N NE    . ARG E 54 ? 0.6887 0.9352 0.6495 -0.0897 -0.0199 -0.0193 195 ARG E NE    
1866 C CZ    . ARG E 54 ? 0.7088 0.9209 0.6602 -0.0841 -0.0111 -0.0162 195 ARG E CZ    
1867 N NH1   . ARG E 54 ? 0.7384 0.8898 0.6529 -0.1016 -0.0087 -0.0141 195 ARG E NH1   
1868 N NH2   . ARG E 54 ? 0.6964 0.9305 0.6722 -0.0589 -0.0064 -0.0153 195 ARG E NH2   
1869 N N     . TYR E 55 ? 0.5366 0.7184 0.4597 -0.0344 -0.0437 -0.0177 196 TYR E N     
1870 C CA    . TYR E 55 ? 0.5081 0.7076 0.4356 -0.0178 -0.0543 -0.0091 196 TYR E CA    
1871 C C     . TYR E 55 ? 0.5217 0.6969 0.4140 -0.0274 -0.0570 -0.0105 196 TYR E C     
1872 O O     . TYR E 55 ? 0.5598 0.7577 0.4440 -0.0311 -0.0714 -0.0049 196 TYR E O     
1873 C CB    . TYR E 55 ? 0.4742 0.6618 0.4171 0.0084  -0.0492 -0.0032 196 TYR E CB    
1874 C CG    . TYR E 55 ? 0.4791 0.6705 0.4212 0.0266  -0.0610 0.0077  196 TYR E CG    
1875 C CD1   . TYR E 55 ? 0.4726 0.7017 0.4392 0.0444  -0.0744 0.0132  196 TYR E CD1   
1876 C CD2   . TYR E 55 ? 0.5032 0.6581 0.4174 0.0268  -0.0588 0.0126  196 TYR E CD2   
1877 C CE1   . TYR E 55 ? 0.4958 0.7149 0.4552 0.0649  -0.0883 0.0249  196 TYR E CE1   
1878 C CE2   . TYR E 55 ? 0.5293 0.6753 0.4326 0.0399  -0.0711 0.0259  196 TYR E CE2   
1879 C CZ    . TYR E 55 ? 0.5238 0.6952 0.4479 0.0607  -0.0869 0.0328  196 TYR E CZ    
1880 O OH    . TYR E 55 ? 0.5753 0.7245 0.4823 0.0769  -0.1016 0.0474  196 TYR E OH    
1881 N N     . LEU E 56 ? 0.5255 0.6592 0.3969 -0.0302 -0.0435 -0.0188 197 LEU E N     
1882 C CA    . LEU E 56 ? 0.5272 0.6420 0.3637 -0.0394 -0.0420 -0.0235 197 LEU E CA    
1883 C C     . LEU E 56 ? 0.5603 0.6750 0.3705 -0.0646 -0.0476 -0.0338 197 LEU E C     
1884 O O     . LEU E 56 ? 0.5829 0.6988 0.3639 -0.0751 -0.0530 -0.0347 197 LEU E O     
1885 C CB    . LEU E 56 ? 0.5225 0.6041 0.3499 -0.0320 -0.0241 -0.0332 197 LEU E CB    
1886 C CG    . LEU E 56 ? 0.5070 0.5896 0.3506 -0.0143 -0.0195 -0.0233 197 LEU E CG    
1887 C CD1   . LEU E 56 ? 0.4930 0.5581 0.3414 -0.0058 -0.0025 -0.0342 197 LEU E CD1   
1888 C CD2   . LEU E 56 ? 0.5281 0.6141 0.3501 -0.0179 -0.0268 -0.0115 197 LEU E CD2   
1889 N N     . GLY E 57 ? 0.5538 0.6636 0.3687 -0.0776 -0.0463 -0.0415 198 GLY E N     
1890 C CA    . GLY E 57 ? 0.5947 0.6937 0.3808 -0.1066 -0.0504 -0.0539 198 GLY E CA    
1891 C C     . GLY E 57 ? 0.6386 0.6950 0.3850 -0.1108 -0.0408 -0.0701 198 GLY E C     
1892 O O     . GLY E 57 ? 0.6406 0.6641 0.3851 -0.0940 -0.0265 -0.0778 198 GLY E O     
1893 N N     . ASN E 58 ? 0.6579 0.7221 0.3739 -0.1314 -0.0490 -0.0763 199 ASN E N     
1894 C CA    . ASN E 58 ? 0.7045 0.7309 0.3800 -0.1368 -0.0381 -0.0958 199 ASN E CA    
1895 C C     . ASN E 58 ? 0.7098 0.7478 0.3747 -0.1247 -0.0320 -0.0919 199 ASN E C     
1896 O O     . ASN E 58 ? 0.7355 0.7559 0.3641 -0.1326 -0.0230 -0.1088 199 ASN E O     
1897 C CB    . ASN E 58 ? 0.7501 0.7689 0.3881 -0.1711 -0.0474 -0.1098 199 ASN E CB    
1898 C CG    . ASN E 58 ? 0.7521 0.8225 0.3825 -0.1870 -0.0666 -0.0984 199 ASN E CG    
1899 O OD1   . ASN E 58 ? 0.7137 0.8191 0.3636 -0.1698 -0.0738 -0.0786 199 ASN E OD1   
1900 N ND2   . ASN E 58 ? 0.7907 0.8616 0.3878 -0.2202 -0.0764 -0.1112 199 ASN E ND2   
1901 N N     . THR E 59 ? 0.6896 0.7536 0.3818 -0.1073 -0.0357 -0.0709 200 THR E N     
1902 C CA    . THR E 59 ? 0.6905 0.7575 0.3678 -0.1009 -0.0289 -0.0652 200 THR E CA    
1903 C C     . THR E 59 ? 0.7193 0.7640 0.3997 -0.0873 -0.0049 -0.0815 200 THR E C     
1904 O O     . THR E 59 ? 0.7435 0.7915 0.4043 -0.0893 0.0069  -0.0857 200 THR E O     
1905 C CB    . THR E 59 ? 0.6485 0.7372 0.3473 -0.0875 -0.0409 -0.0385 200 THR E CB    
1906 O OG1   . THR E 59 ? 0.6146 0.7025 0.3560 -0.0678 -0.0366 -0.0340 200 THR E OG1   
1907 C CG2   . THR E 59 ? 0.6503 0.7683 0.3472 -0.0950 -0.0659 -0.0243 200 THR E CG2   
1908 N N     . VAL E 60 ? 0.7416 0.7672 0.4452 -0.0744 0.0016  -0.0908 201 VAL E N     
1909 C CA    . VAL E 60 ? 0.7766 0.7898 0.4930 -0.0551 0.0197  -0.1039 201 VAL E CA    
1910 C C     . VAL E 60 ? 0.8207 0.7977 0.5413 -0.0462 0.0219  -0.1187 201 VAL E C     
1911 O O     . VAL E 60 ? 0.7832 0.7536 0.5205 -0.0472 0.0117  -0.1075 201 VAL E O     
1912 C CB    . VAL E 60 ? 0.7474 0.7793 0.5006 -0.0388 0.0206  -0.0857 201 VAL E CB    
1913 C CG1   . VAL E 60 ? 0.7481 0.7789 0.5179 -0.0200 0.0378  -0.0997 201 VAL E CG1   
1914 C CG2   . VAL E 60 ? 0.7389 0.7917 0.4829 -0.0473 0.0154  -0.0673 201 VAL E CG2   
1915 N N     . ASP E 61 ? 0.8665 0.8195 0.5705 -0.0363 0.0354  -0.1439 202 ASP E N     
1916 C CA    . ASP E 61 ? 0.8855 0.7921 0.5886 -0.0209 0.0368  -0.1581 202 ASP E CA    
1917 C C     . ASP E 61 ? 0.8296 0.7442 0.5712 0.0067  0.0401  -0.1507 202 ASP E C     
1918 O O     . ASP E 61 ? 0.8365 0.7787 0.5954 0.0237  0.0520  -0.1577 202 ASP E O     
1919 C CB    . ASP E 61 ? 0.9592 0.8352 0.6306 -0.0128 0.0491  -0.1909 202 ASP E CB    
1920 C CG    . ASP E 61 ? 1.0297 0.8363 0.6816 -0.0036 0.0442  -0.2047 202 ASP E CG    
1921 O OD1   . ASP E 61 ? 1.0278 0.8148 0.6979 0.0053  0.0356  -0.1897 202 ASP E OD1   
1922 O OD2   . ASP E 61 ? 1.1316 0.8976 0.7441 -0.0071 0.0485  -0.2309 202 ASP E OD2   
1923 N N     . LEU E 62 ? 0.8071 0.6999 0.5597 0.0084  0.0297  -0.1375 203 LEU E N     
1924 C CA    . LEU E 62 ? 0.7692 0.6690 0.5539 0.0315  0.0299  -0.1286 203 LEU E CA    
1925 C C     . LEU E 62 ? 0.8094 0.6562 0.5834 0.0511  0.0271  -0.1386 203 LEU E C     
1926 O O     . LEU E 62 ? 0.8014 0.6515 0.5980 0.0717  0.0250  -0.1318 203 LEU E O     
1927 C CB    . LEU E 62 ? 0.7269 0.6474 0.5319 0.0196  0.0200  -0.1037 203 LEU E CB    
1928 C CG    . LEU E 62 ? 0.6852 0.6533 0.5053 0.0101  0.0198  -0.0907 203 LEU E CG    
1929 C CD1   . LEU E 62 ? 0.6788 0.6622 0.5165 0.0021  0.0094  -0.0716 203 LEU E CD1   
1930 C CD2   . LEU E 62 ? 0.6644 0.6607 0.5054 0.0258  0.0297  -0.0916 203 LEU E CD2   
1931 N N     . SER E 63 ? 0.8751 0.6685 0.6113 0.0459  0.0257  -0.1550 204 SER E N     
1932 C CA    . SER E 63 ? 0.9494 0.6755 0.6672 0.0650  0.0191  -0.1611 204 SER E CA    
1933 C C     . SER E 63 ? 0.9258 0.6609 0.6698 0.1096  0.0227  -0.1697 204 SER E C     
1934 O O     . SER E 63 ? 0.9377 0.6365 0.6805 0.1263  0.0122  -0.1605 204 SER E O     
1935 C CB    . SER E 63 ? 1.0245 0.6808 0.6909 0.0550  0.0179  -0.1824 204 SER E CB    
1936 O OG    . SER E 63 ? 1.0399 0.7156 0.7002 0.0643  0.0311  -0.2084 204 SER E OG    
1937 N N     . SER E 64 ? 0.8920 0.6795 0.6584 0.1262  0.0365  -0.1863 205 SER E N     
1938 C CA    . SER E 64 ? 0.8952 0.7096 0.6934 0.1672  0.0403  -0.1973 205 SER E CA    
1939 C C     . SER E 64 ? 0.8109 0.7003 0.6549 0.1665  0.0437  -0.1816 205 SER E C     
1940 O O     . SER E 64 ? 0.8033 0.7308 0.6778 0.1952  0.0475  -0.1915 205 SER E O     
1941 C CB    . SER E 64 ? 0.9441 0.7722 0.7379 0.1884  0.0555  -0.2322 205 SER E CB    
1942 O OG    . SER E 64 ? 0.9233 0.8208 0.7307 0.1673  0.0714  -0.2354 205 SER E OG    
1943 N N     . PHE E 65 ? 0.7455 0.6552 0.5937 0.1347  0.0414  -0.1588 206 PHE E N     
1944 C CA    . PHE E 65 ? 0.6677 0.6345 0.5504 0.1290  0.0436  -0.1433 206 PHE E CA    
1945 C C     . PHE E 65 ? 0.6466 0.6041 0.5454 0.1428  0.0312  -0.1282 206 PHE E C     
1946 O O     . PHE E 65 ? 0.6311 0.5461 0.5118 0.1345  0.0203  -0.1148 206 PHE E O     
1947 C CB    . PHE E 65 ? 0.6362 0.6154 0.5114 0.0952  0.0426  -0.1256 206 PHE E CB    
1948 C CG    . PHE E 65 ? 0.5989 0.6240 0.5009 0.0883  0.0450  -0.1117 206 PHE E CG    
1949 C CD1   . PHE E 65 ? 0.5834 0.6511 0.4950 0.0845  0.0577  -0.1195 206 PHE E CD1   
1950 C CD2   . PHE E 65 ? 0.5685 0.5925 0.4823 0.0834  0.0355  -0.0923 206 PHE E CD2   
1951 C CE1   . PHE E 65 ? 0.5560 0.6544 0.4853 0.0747  0.0590  -0.1067 206 PHE E CE1   
1952 C CE2   . PHE E 65 ? 0.5430 0.5999 0.4770 0.0781  0.0373  -0.0820 206 PHE E CE2   
1953 C CZ    . PHE E 65 ? 0.5529 0.6421 0.4929 0.0730  0.0481  -0.0885 206 PHE E CZ    
1954 N N     . ASP E 66 ? 0.6307 0.6325 0.5618 0.1602  0.0334  -0.1306 207 ASP E N     
1955 C CA    . ASP E 66 ? 0.6050 0.6042 0.5502 0.1748  0.0209  -0.1181 207 ASP E CA    
1956 C C     . ASP E 66 ? 0.5475 0.5819 0.5087 0.1511  0.0228  -0.1015 207 ASP E C     
1957 O O     . ASP E 66 ? 0.4919 0.5766 0.4756 0.1464  0.0318  -0.1061 207 ASP E O     
1958 C CB    . ASP E 66 ? 0.6201 0.6535 0.5922 0.2097  0.0206  -0.1342 207 ASP E CB    
1959 C CG    . ASP E 66 ? 0.6110 0.6580 0.6009 0.2224  0.0068  -0.1209 207 ASP E CG    
1960 O OD1   . ASP E 66 ? 0.6246 0.6671 0.6113 0.2024  0.0016  -0.1014 207 ASP E OD1   
1961 O OD2   . ASP E 66 ? 0.6215 0.6894 0.6300 0.2540  0.0006  -0.1315 207 ASP E OD2   
1962 N N     . PHE E 67 ? 0.5344 0.5411 0.4815 0.1351  0.0149  -0.0837 208 PHE E N     
1963 C CA    . PHE E 67 ? 0.4872 0.5184 0.4459 0.1169  0.0156  -0.0698 208 PHE E CA    
1964 C C     . PHE E 67 ? 0.4654 0.5357 0.4504 0.1253  0.0160  -0.0704 208 PHE E C     
1965 O O     . PHE E 67 ? 0.4270 0.5252 0.4235 0.1122  0.0219  -0.0682 208 PHE E O     
1966 C CB    . PHE E 67 ? 0.4910 0.4941 0.4348 0.1058  0.0069  -0.0546 208 PHE E CB    
1967 C CG    . PHE E 67 ? 0.4549 0.4824 0.4095 0.0900  0.0086  -0.0443 208 PHE E CG    
1968 C CD1   . PHE E 67 ? 0.4454 0.4802 0.3969 0.0752  0.0118  -0.0423 208 PHE E CD1   
1969 C CD2   . PHE E 67 ? 0.4695 0.5119 0.4357 0.0926  0.0057  -0.0379 208 PHE E CD2   
1970 C CE1   . PHE E 67 ? 0.4437 0.4983 0.4057 0.0675  0.0115  -0.0343 208 PHE E CE1   
1971 C CE2   . PHE E 67 ? 0.4592 0.5202 0.4340 0.0822  0.0079  -0.0321 208 PHE E CE2   
1972 C CZ    . PHE E 67 ? 0.4400 0.5060 0.4139 0.0720  0.0104  -0.0304 208 PHE E CZ    
1973 N N     . ARG E 68 ? 0.5040 0.5729 0.4951 0.1467  0.0078  -0.0730 209 ARG E N     
1974 C CA    . ARG E 68 ? 0.5104 0.6173 0.5242 0.1520  0.0045  -0.0720 209 ARG E CA    
1975 C C     . ARG E 68 ? 0.4982 0.6591 0.5376 0.1514  0.0151  -0.0864 209 ARG E C     
1976 O O     . ARG E 68 ? 0.5026 0.6950 0.5557 0.1373  0.0176  -0.0843 209 ARG E O     
1977 C CB    . ARG E 68 ? 0.5707 0.6617 0.5804 0.1756  -0.0110 -0.0683 209 ARG E CB    
1978 C CG    . ARG E 68 ? 0.5828 0.7145 0.6123 0.1781  -0.0175 -0.0660 209 ARG E CG    
1979 C CD    . ARG E 68 ? 0.6450 0.7519 0.6590 0.1940  -0.0359 -0.0547 209 ARG E CD    
1980 N NE    . ARG E 68 ? 0.6497 0.7264 0.6384 0.1731  -0.0384 -0.0379 209 ARG E NE    
1981 C CZ    . ARG E 68 ? 0.6312 0.7326 0.6253 0.1556  -0.0358 -0.0340 209 ARG E CZ    
1982 N NH1   . ARG E 68 ? 0.6042 0.7538 0.6244 0.1522  -0.0317 -0.0437 209 ARG E NH1   
1983 N NH2   . ARG E 68 ? 0.6278 0.7055 0.5987 0.1392  -0.0363 -0.0218 209 ARG E NH2   
1984 N N     . THR E 69 ? 0.4970 0.6685 0.5400 0.1634  0.0224  -0.1022 210 THR E N     
1985 C CA    . THR E 69 ? 0.4868 0.7188 0.5545 0.1616  0.0346  -0.1185 210 THR E CA    
1986 C C     . THR E 69 ? 0.4973 0.7340 0.5526 0.1359  0.0503  -0.1212 210 THR E C     
1987 O O     . THR E 69 ? 0.5415 0.8274 0.6109 0.1274  0.0629  -0.1339 210 THR E O     
1988 C CB    . THR E 69 ? 0.5090 0.7612 0.5907 0.1953  0.0352  -0.1398 210 THR E CB    
1989 O OG1   . THR E 69 ? 0.5312 0.7330 0.5850 0.2009  0.0381  -0.1446 210 THR E OG1   
1990 C CG2   . THR E 69 ? 0.5172 0.7686 0.6112 0.2275  0.0168  -0.1384 210 THR E CG2   
1991 N N     . GLY E 70 ? 0.4998 0.6898 0.5271 0.1233  0.0495  -0.1107 211 GLY E N     
1992 C CA    . GLY E 70 ? 0.5269 0.7195 0.5372 0.1005  0.0613  -0.1118 211 GLY E CA    
1993 C C     . GLY E 70 ? 0.5512 0.7554 0.5535 0.1066  0.0733  -0.1319 211 GLY E C     
1994 O O     . GLY E 70 ? 0.5817 0.7877 0.5638 0.0847  0.0827  -0.1317 211 GLY E O     
1995 N N     . LYS E 71 ? 0.5829 0.7891 0.5959 0.1373  0.0716  -0.1489 212 LYS E N     
1996 C CA    . LYS E 71 ? 0.6057 0.8302 0.6155 0.1495  0.0848  -0.1747 212 LYS E CA    
1997 C C     . LYS E 71 ? 0.6474 0.8090 0.6263 0.1630  0.0794  -0.1815 212 LYS E C     
1998 O O     . LYS E 71 ? 0.6475 0.7581 0.6157 0.1723  0.0640  -0.1697 212 LYS E O     
1999 C CB    . LYS E 71 ? 0.6048 0.8876 0.6529 0.1782  0.0882  -0.1947 212 LYS E CB    
2000 C CG    . LYS E 71 ? 0.5815 0.9335 0.6572 0.1568  0.0963  -0.1923 212 LYS E CG    
2001 C CD    . LYS E 71 ? 0.5932 1.0255 0.7104 0.1799  0.1039  -0.2178 212 LYS E CD    
2002 N N     . MET E 72 ? 0.7076 0.8713 0.6667 0.1580  0.0928  -0.2002 213 MET E N     
2003 C CA    . MET E 72 ? 0.7822 0.8912 0.7126 0.1751  0.0903  -0.2165 213 MET E CA    
2004 C C     . MET E 72 ? 0.8289 0.9477 0.7806 0.2214  0.0901  -0.2413 213 MET E C     
2005 O O     . MET E 72 ? 0.8208 1.0118 0.8086 0.2336  0.1003  -0.2547 213 MET E O     
2006 C CB    . MET E 72 ? 0.8179 0.9325 0.7183 0.1533  0.1060  -0.2314 213 MET E CB    
2007 C CG    . MET E 72 ? 0.7939 0.8979 0.6705 0.1119  0.1025  -0.2066 213 MET E CG    
2008 S SD    . MET E 72 ? 0.8150 0.8438 0.6660 0.1030  0.0806  -0.1857 213 MET E SD    
2009 C CE    . MET E 72 ? 0.8071 0.8498 0.6382 0.0618  0.0789  -0.1642 213 MET E CE    
2010 N N     . MET E 73 ? 0.9072 0.9542 0.8354 0.2464  0.0777  -0.2478 214 MET E N     
2011 C CA    . MET E 73 ? 0.9772 1.0158 0.9204 0.2985  0.0710  -0.2683 214 MET E CA    
2012 C C     . MET E 73 ? 1.0803 1.0628 0.9901 0.3228  0.0748  -0.2985 214 MET E C     
2013 O O     . MET E 73 ? 1.1624 1.0608 1.0260 0.3078  0.0664  -0.2918 214 MET E O     
2014 C CB    . MET E 73 ? 1.0093 0.9947 0.9491 0.3129  0.0460  -0.2436 214 MET E CB    
2015 C CG    . MET E 73 ? 0.9593 0.9879 0.9266 0.2923  0.0397  -0.2153 214 MET E CG    
2016 S SD    . MET E 73 ? 0.9797 1.1262 1.0086 0.3069  0.0496  -0.2281 214 MET E SD    
2017 C CE    . MET E 73 ? 0.9086 1.0603 0.9524 0.2954  0.0309  -0.1947 214 MET E CE    
2018 N N     . PRO E 74 ? 1.1076 1.1371 1.0409 0.3613  0.0871  -0.3338 215 PRO E N     
2019 C CA    . PRO E 74 ? 1.1420 1.1291 1.0520 0.3979  0.0921  -0.3709 215 PRO E CA    
2020 N N     . GLY F 6  ? 1.0358 1.2198 1.0089 0.2584  0.1351  -0.1068 147 GLY F N     
2021 C CA    . GLY F 6  ? 0.9981 1.2254 0.9922 0.2108  0.1490  -0.0986 147 GLY F CA    
2022 C C     . GLY F 6  ? 1.0371 1.2749 1.0070 0.2070  0.1658  -0.1093 147 GLY F C     
2023 O O     . GLY F 6  ? 1.0779 1.2653 1.0077 0.2335  0.1645  -0.1205 147 GLY F O     
2024 N N     . LYS F 7  ? 1.0055 1.3031 0.9929 0.1716  0.1814  -0.1062 148 LYS F N     
2025 C CA    . LYS F 7  ? 0.9962 1.3065 0.9569 0.1560  0.1988  -0.1127 148 LYS F CA    
2026 C C     . LYS F 7  ? 0.9631 1.1997 0.8893 0.1198  0.1922  -0.0934 148 LYS F C     
2027 O O     . LYS F 7  ? 0.8583 1.0607 0.7921 0.0970  0.1792  -0.0745 148 LYS F O     
2028 C CB    . LYS F 7  ? 0.9814 1.3959 0.9694 0.1319  0.2202  -0.1196 148 LYS F CB    
2029 N N     . ARG F 8  ? 0.9689 1.1852 0.8560 0.1187  0.2004  -0.1004 149 ARG F N     
2030 C CA    . ARG F 8  ? 0.9792 1.1263 0.8287 0.0938  0.1904  -0.0855 149 ARG F CA    
2031 C C     . ARG F 8  ? 0.9363 1.1075 0.7632 0.0602  0.2051  -0.0801 149 ARG F C     
2032 O O     . ARG F 8  ? 0.9719 1.1782 0.7814 0.0668  0.2229  -0.0968 149 ARG F O     
2033 C CB    . ARG F 8  ? 1.0337 1.1169 0.8436 0.1179  0.1823  -0.0970 149 ARG F CB    
2034 C CG    . ARG F 8  ? 1.0389 1.0836 0.8555 0.1474  0.1677  -0.1011 149 ARG F CG    
2035 C CD    . ARG F 8  ? 1.0881 1.0724 0.8548 0.1756  0.1653  -0.1192 149 ARG F CD    
2036 N NE    . ARG F 8  ? 1.0896 1.0124 0.8456 0.1900  0.1478  -0.1166 149 ARG F NE    
2037 C CZ    . ARG F 8  ? 1.1443 0.9825 0.8458 0.1941  0.1379  -0.1228 149 ARG F CZ    
2038 N NH1   . ARG F 8  ? 1.1752 0.9783 0.8281 0.1878  0.1428  -0.1341 149 ARG F NH1   
2039 N NH2   . ARG F 8  ? 1.1616 0.9463 0.8516 0.2001  0.1227  -0.1176 149 ARG F NH2   
2040 N N     . MET F 9  ? 0.8768 1.0253 0.6989 0.0259  0.1968  -0.0572 150 MET F N     
2041 C CA    . MET F 9  ? 0.8910 1.0507 0.6845 -0.0109 0.2079  -0.0466 150 MET F CA    
2042 C C     . MET F 9  ? 0.9186 1.0244 0.6600 -0.0177 0.2001  -0.0406 150 MET F C     
2043 O O     . MET F 9  ? 0.9037 0.9563 0.6373 -0.0096 0.1789  -0.0327 150 MET F O     
2044 C CB    . MET F 9  ? 0.8619 1.0108 0.6656 -0.0411 0.2008  -0.0251 150 MET F CB    
2045 N N     . ASP F 10 ? 0.9213 1.0492 0.6274 -0.0333 0.2176  -0.0464 151 ASP F N     
2046 C CA    . ASP F 10 ? 0.9581 1.0415 0.6097 -0.0439 0.2110  -0.0405 151 ASP F CA    
2047 C C     . ASP F 10 ? 0.9491 0.9775 0.5828 -0.0632 0.1875  -0.0119 151 ASP F C     
2048 O O     . ASP F 10 ? 0.9346 0.9616 0.5797 -0.0808 0.1855  0.0038  151 ASP F O     
2049 C CB    . ASP F 10 ? 1.0004 1.1225 0.6139 -0.0652 0.2360  -0.0487 151 ASP F CB    
2050 N N     . CYS F 11 ? 0.9568 0.9411 0.5622 -0.0574 0.1685  -0.0074 152 CYS F N     
2051 C CA    . CYS F 11 ? 0.9631 0.9025 0.5523 -0.0654 0.1427  0.0164  152 CYS F CA    
2052 C C     . CYS F 11 ? 1.0105 0.9227 0.5369 -0.0805 0.1348  0.0266  152 CYS F C     
2053 O O     . CYS F 11 ? 1.0024 0.8973 0.5146 -0.0710 0.1174  0.0239  152 CYS F O     
2054 C CB    . CYS F 11 ? 0.9212 0.8450 0.5433 -0.0434 0.1206  0.0142  152 CYS F CB    
2055 S SG    . CYS F 11 ? 0.9282 0.8166 0.5461 -0.0438 0.0906  0.0399  152 CYS F SG    
2056 N N     . PRO F 12 ? 1.0730 0.9822 0.5574 -0.1080 0.1471  0.0389  153 PRO F N     
2057 C CA    . PRO F 12 ? 1.1250 1.0077 0.5397 -0.1254 0.1417  0.0497  153 PRO F CA    
2058 C C     . PRO F 12 ? 1.1431 0.9817 0.5299 -0.1143 0.1065  0.0657  153 PRO F C     
2059 O O     . PRO F 12 ? 1.1844 1.0125 0.5205 -0.1221 0.1009  0.0673  153 PRO F O     
2060 C CB    . PRO F 12 ? 1.1829 1.0548 0.5588 -0.1608 0.1553  0.0681  153 PRO F CB    
2061 C CG    . PRO F 12 ? 1.1440 1.0271 0.5702 -0.1604 0.1599  0.0700  153 PRO F CG    
2062 C CD    . PRO F 12 ? 1.0712 1.0026 0.5647 -0.1304 0.1674  0.0436  153 PRO F CD    
2063 N N     . ALA F 13 ? 1.1083 0.9288 0.5266 -0.0955 0.0829  0.0759  154 ALA F N     
2064 C CA    . ALA F 13 ? 1.1154 0.9142 0.5170 -0.0788 0.0485  0.0863  154 ALA F CA    
2065 C C     . ALA F 13 ? 1.0822 0.9093 0.4977 -0.0690 0.0413  0.0660  154 ALA F C     
2066 O O     . ALA F 13 ? 1.1001 0.9232 0.4862 -0.0653 0.0180  0.0708  154 ALA F O     
2067 C CB    . ALA F 13 ? 1.0898 0.8739 0.5264 -0.0579 0.0279  0.0969  154 ALA F CB    
2068 N N     . LEU F 14 ? 1.0347 0.8873 0.4906 -0.0655 0.0599  0.0434  155 LEU F N     
2069 C CA    . LEU F 14 ? 1.0365 0.9017 0.4971 -0.0617 0.0566  0.0222  155 LEU F CA    
2070 C C     . LEU F 14 ? 1.1007 0.9645 0.5149 -0.0747 0.0760  0.0073  155 LEU F C     
2071 O O     . LEU F 14 ? 1.1217 0.9869 0.5110 -0.0860 0.0946  0.0125  155 LEU F O     
2072 C CB    . LEU F 14 ? 0.9804 0.8572 0.4963 -0.0490 0.0650  0.0071  155 LEU F CB    
2073 C CG    . LEU F 14 ? 0.9320 0.8143 0.4952 -0.0369 0.0508  0.0197  155 LEU F CG    
2074 C CD1   . LEU F 14 ? 0.8912 0.7831 0.5000 -0.0275 0.0579  0.0045  155 LEU F CD1   
2075 C CD2   . LEU F 14 ? 0.9312 0.8171 0.4902 -0.0312 0.0198  0.0314  155 LEU F CD2   
2076 N N     . PRO F 15 ? 1.1279 0.9888 0.5251 -0.0764 0.0724  -0.0125 156 PRO F N     
2077 C CA    . PRO F 15 ? 1.1813 1.0371 0.5333 -0.0845 0.0935  -0.0317 156 PRO F CA    
2078 C C     . PRO F 15 ? 1.1652 1.0343 0.5386 -0.0727 0.1254  -0.0476 156 PRO F C     
2079 O O     . PRO F 15 ? 1.1103 0.9900 0.5353 -0.0589 0.1292  -0.0454 156 PRO F O     
2080 C CB    . PRO F 15 ? 1.2016 1.0411 0.5341 -0.0883 0.0821  -0.0520 156 PRO F CB    
2081 C CG    . PRO F 15 ? 1.1678 1.0177 0.5230 -0.0910 0.0510  -0.0379 156 PRO F CG    
2082 C CD    . PRO F 15 ? 1.1169 0.9795 0.5240 -0.0765 0.0483  -0.0181 156 PRO F CD    
2083 N N     . PRO F 16 ? 1.2167 1.0929 0.5508 -0.0767 0.1479  -0.0643 157 PRO F N     
2084 C CA    . PRO F 16 ? 1.2083 1.1104 0.5654 -0.0587 0.1769  -0.0846 157 PRO F CA    
2085 C C     . PRO F 16 ? 1.1895 1.0676 0.5673 -0.0321 0.1748  -0.1064 157 PRO F C     
2086 O O     . PRO F 16 ? 1.1773 1.0145 0.5301 -0.0358 0.1580  -0.1133 157 PRO F O     
2087 C CB    . PRO F 16 ? 1.2681 1.1848 0.5714 -0.0669 0.1994  -0.1021 157 PRO F CB    
2088 C CG    . PRO F 16 ? 1.3160 1.2097 0.5657 -0.0934 0.1815  -0.0864 157 PRO F CG    
2089 C CD    . PRO F 16 ? 1.2853 1.1515 0.5531 -0.0945 0.1475  -0.0689 157 PRO F CD    
2090 N N     . GLY F 17 ? 1.1735 1.0774 0.5920 -0.0083 0.1911  -0.1166 158 GLY F N     
2091 C CA    . GLY F 17 ? 1.1727 1.0501 0.6140 0.0200  0.1868  -0.1311 158 GLY F CA    
2092 C C     . GLY F 17 ? 1.1001 0.9794 0.5956 0.0206  0.1708  -0.1112 158 GLY F C     
2093 O O     . GLY F 17 ? 1.0745 0.9527 0.5992 0.0454  0.1737  -0.1198 158 GLY F O     
2094 N N     . TRP F 18 ? 1.0925 0.9740 0.5977 -0.0031 0.1533  -0.0859 159 TRP F N     
2095 C CA    . TRP F 18 ? 1.0471 0.9264 0.5980 -0.0031 0.1351  -0.0690 159 TRP F CA    
2096 C C     . TRP F 18 ? 1.0183 0.9344 0.6185 0.0035  0.1442  -0.0587 159 TRP F C     
2097 O O     . TRP F 18 ? 1.0358 0.9746 0.6345 -0.0121 0.1501  -0.0444 159 TRP F O     
2098 C CB    . TRP F 18 ? 1.0295 0.9024 0.5717 -0.0237 0.1113  -0.0487 159 TRP F CB    
2099 C CG    . TRP F 18 ? 1.0635 0.9105 0.5776 -0.0328 0.0950  -0.0571 159 TRP F CG    
2100 C CD1   . TRP F 18 ? 1.1300 0.9629 0.5910 -0.0469 0.0922  -0.0654 159 TRP F CD1   
2101 C CD2   . TRP F 18 ? 1.0477 0.8825 0.5804 -0.0345 0.0798  -0.0598 159 TRP F CD2   
2102 N NE1   . TRP F 18 ? 1.1348 0.9489 0.5812 -0.0592 0.0752  -0.0733 159 TRP F NE1   
2103 C CE2   . TRP F 18 ? 1.0965 0.9122 0.5858 -0.0534 0.0680  -0.0700 159 TRP F CE2   
2104 C CE3   . TRP F 18 ? 1.0029 0.8431 0.5815 -0.0258 0.0754  -0.0552 159 TRP F CE3   
2105 C CZ2   . TRP F 18 ? 1.1038 0.9092 0.5943 -0.0679 0.0529  -0.0756 159 TRP F CZ2   
2106 C CZ3   . TRP F 18 ? 1.0204 0.8480 0.5994 -0.0377 0.0607  -0.0602 159 TRP F CZ3   
2107 C CH2   . TRP F 18 ? 1.0603 0.8723 0.5956 -0.0605 0.0501  -0.0703 159 TRP F CH2   
2108 N N     . LYS F 19 ? 0.9814 0.8983 0.6190 0.0225  0.1436  -0.0644 160 LYS F N     
2109 C CA    . LYS F 19 ? 0.9382 0.8944 0.6224 0.0281  0.1520  -0.0577 160 LYS F CA    
2110 C C     . LYS F 19 ? 0.9048 0.8513 0.6237 0.0245  0.1334  -0.0418 160 LYS F C     
2111 O O     . LYS F 19 ? 0.9222 0.8386 0.6352 0.0235  0.1167  -0.0410 160 LYS F O     
2112 C CB    . LYS F 19 ? 0.9421 0.9248 0.6422 0.0574  0.1692  -0.0792 160 LYS F CB    
2113 C CG    . LYS F 19 ? 0.9917 0.9879 0.6554 0.0680  0.1886  -0.1010 160 LYS F CG    
2114 C CD    . LYS F 19 ? 0.9789 1.0517 0.6667 0.0754  0.2128  -0.1116 160 LYS F CD    
2115 N N     . LYS F 20 ? 0.8693 0.8445 0.6202 0.0185  0.1375  -0.0305 161 LYS F N     
2116 C CA    . LYS F 20 ? 0.8198 0.7924 0.6064 0.0181  0.1241  -0.0186 161 LYS F CA    
2117 C C     . LYS F 20 ? 0.8027 0.8074 0.6267 0.0319  0.1346  -0.0268 161 LYS F C     
2118 O O     . LYS F 20 ? 0.8033 0.8474 0.6323 0.0296  0.1522  -0.0325 161 LYS F O     
2119 C CB    . LYS F 20 ? 0.8114 0.7808 0.5935 -0.0015 0.1190  0.0009  161 LYS F CB    
2120 C CG    . LYS F 20 ? 0.7723 0.7477 0.5907 -0.0021 0.1136  0.0091  161 LYS F CG    
2121 C CD    . LYS F 20 ? 0.7899 0.7372 0.5896 -0.0164 0.1022  0.0281  161 LYS F CD    
2122 C CE    . LYS F 20 ? 0.7670 0.7199 0.5904 -0.0246 0.1055  0.0331  161 LYS F CE    
2123 N N     . GLU F 21 ? 0.7746 0.7691 0.6239 0.0435  0.1235  -0.0271 162 GLU F N     
2124 C CA    . GLU F 21 ? 0.7620 0.7861 0.6483 0.0577  0.1282  -0.0323 162 GLU F CA    
2125 C C     . GLU F 21 ? 0.7258 0.7458 0.6402 0.0489  0.1154  -0.0199 162 GLU F C     
2126 O O     . GLU F 21 ? 0.7384 0.7296 0.6460 0.0436  0.1008  -0.0135 162 GLU F O     
2127 C CB    . GLU F 21 ? 0.7945 0.7992 0.6716 0.0856  0.1268  -0.0473 162 GLU F CB    
2128 C CG    . GLU F 21 ? 0.7777 0.8116 0.6855 0.1082  0.1288  -0.0538 162 GLU F CG    
2129 C CD    . GLU F 21 ? 0.8233 0.8138 0.7080 0.1365  0.1214  -0.0642 162 GLU F CD    
2130 O OE1   . GLU F 21 ? 0.8515 0.7859 0.7106 0.1275  0.1091  -0.0600 162 GLU F OE1   
2131 O OE2   . GLU F 21 ? 0.8894 0.9014 0.7780 0.1681  0.1272  -0.0772 162 GLU F OE2   
2132 N N     . GLU F 22 ? 0.6868 0.7414 0.6318 0.0463  0.1210  -0.0186 163 GLU F N     
2133 C CA    . GLU F 22 ? 0.6382 0.6888 0.6073 0.0398  0.1104  -0.0103 163 GLU F CA    
2134 C C     . GLU F 22 ? 0.6250 0.7045 0.6234 0.0554  0.1119  -0.0183 163 GLU F C     
2135 O O     . GLU F 22 ? 0.6361 0.7616 0.6486 0.0594  0.1239  -0.0259 163 GLU F O     
2136 C CB    . GLU F 22 ? 0.6317 0.6847 0.5992 0.0162  0.1131  0.0002  163 GLU F CB    
2137 C CG    . GLU F 22 ? 0.6211 0.6540 0.6017 0.0128  0.0997  0.0074  163 GLU F CG    
2138 C CD    . GLU F 22 ? 0.6705 0.6724 0.6274 -0.0057 0.0961  0.0196  163 GLU F CD    
2139 O OE1   . GLU F 22 ? 0.6426 0.6255 0.6060 -0.0062 0.0865  0.0231  163 GLU F OE1   
2140 O OE2   . GLU F 22 ? 0.7220 0.7117 0.6466 -0.0191 0.1022  0.0256  163 GLU F OE2   
2141 N N     . VAL F 23 ? 0.5815 0.6397 0.5867 0.0639  0.0996  -0.0175 164 VAL F N     
2142 C CA    . VAL F 23 ? 0.5608 0.6349 0.5832 0.0815  0.0974  -0.0234 164 VAL F CA    
2143 C C     . VAL F 23 ? 0.5174 0.5950 0.5620 0.0723  0.0888  -0.0177 164 VAL F C     
2144 O O     . VAL F 23 ? 0.5189 0.5687 0.5574 0.0662  0.0791  -0.0136 164 VAL F O     
2145 C CB    . VAL F 23 ? 0.5905 0.6261 0.5859 0.1015  0.0914  -0.0292 164 VAL F CB    
2146 C CG1   . VAL F 23 ? 0.5870 0.6330 0.5925 0.1240  0.0866  -0.0334 164 VAL F CG1   
2147 C CG2   . VAL F 23 ? 0.6322 0.6599 0.6006 0.1137  0.1004  -0.0383 164 VAL F CG2   
2148 N N     . ILE F 24 ? 0.5158 0.6359 0.5862 0.0716  0.0930  -0.0202 165 ILE F N     
2149 C CA    . ILE F 24 ? 0.4948 0.6260 0.5863 0.0607  0.0874  -0.0174 165 ILE F CA    
2150 C C     . ILE F 24 ? 0.4773 0.5950 0.5683 0.0757  0.0768  -0.0183 165 ILE F C     
2151 O O     . ILE F 24 ? 0.4874 0.6107 0.5725 0.0984  0.0753  -0.0230 165 ILE F O     
2152 C CB    . ILE F 24 ? 0.5148 0.7021 0.6300 0.0516  0.0954  -0.0219 165 ILE F CB    
2153 C CG1   . ILE F 24 ? 0.5588 0.7554 0.6645 0.0278  0.1078  -0.0199 165 ILE F CG1   
2154 C CG2   . ILE F 24 ? 0.4943 0.6894 0.6266 0.0387  0.0889  -0.0209 165 ILE F CG2   
2155 C CD1   . ILE F 24 ? 0.5728 0.7196 0.6592 0.0062  0.1037  -0.0098 165 ILE F CD1   
2156 N N     . ARG F 25 ? 0.4408 0.5384 0.5327 0.0645  0.0691  -0.0144 166 ARG F N     
2157 C CA    . ARG F 25 ? 0.4159 0.5043 0.5051 0.0696  0.0603  -0.0143 166 ARG F CA    
2158 C C     . ARG F 25 ? 0.4096 0.5366 0.5205 0.0738  0.0590  -0.0169 166 ARG F C     
2159 O O     . ARG F 25 ? 0.3864 0.5379 0.5169 0.0587  0.0621  -0.0183 166 ARG F O     
2160 C CB    . ARG F 25 ? 0.3844 0.4584 0.4734 0.0543  0.0553  -0.0127 166 ARG F CB    
2161 C CG    . ARG F 25 ? 0.3925 0.4400 0.4604 0.0502  0.0537  -0.0116 166 ARG F CG    
2162 C CD    . ARG F 25 ? 0.3844 0.4364 0.4574 0.0385  0.0484  -0.0133 166 ARG F CD    
2163 N NE    . ARG F 25 ? 0.3820 0.4204 0.4348 0.0321  0.0455  -0.0138 166 ARG F NE    
2164 C CZ    . ARG F 25 ? 0.3712 0.4167 0.4175 0.0192  0.0408  -0.0173 166 ARG F CZ    
2165 N NH1   . ARG F 25 ? 0.3484 0.4132 0.4060 0.0125  0.0393  -0.0206 166 ARG F NH1   
2166 N NH2   . ARG F 25 ? 0.3823 0.4196 0.4079 0.0093  0.0384  -0.0187 166 ARG F NH2   
2167 N N     . LYS F 26 ? 0.4490 0.5756 0.5501 0.0941  0.0528  -0.0176 167 LYS F N     
2168 C CA    . LYS F 26 ? 0.4575 0.6314 0.5777 0.1065  0.0495  -0.0214 167 LYS F CA    
2169 C C     . LYS F 26 ? 0.4342 0.6146 0.5609 0.0953  0.0415  -0.0195 167 LYS F C     
2170 O O     . LYS F 26 ? 0.4038 0.6329 0.5527 0.0944  0.0401  -0.0236 167 LYS F O     
2171 C CB    . LYS F 26 ? 0.5322 0.6974 0.6318 0.1424  0.0422  -0.0231 167 LYS F CB    
2172 C CG    . LYS F 26 ? 0.5861 0.7608 0.6815 0.1627  0.0507  -0.0301 167 LYS F CG    
2173 C CD    . LYS F 26 ? 0.6450 0.8081 0.7160 0.2075  0.0410  -0.0345 167 LYS F CD    
2174 C CE    . LYS F 26 ? 0.7042 0.8198 0.7396 0.2279  0.0452  -0.0394 167 LYS F CE    
2175 N NZ    . LYS F 26 ? 0.7773 0.8381 0.7662 0.2688  0.0303  -0.0399 167 LYS F NZ    
2176 N N     . SER F 27 ? 0.4348 0.5740 0.5423 0.0837  0.0373  -0.0150 168 SER F N     
2177 C CA    . SER F 27 ? 0.4584 0.5978 0.5609 0.0762  0.0293  -0.0133 168 SER F CA    
2178 C C     . SER F 27 ? 0.4454 0.5587 0.5372 0.0549  0.0308  -0.0127 168 SER F C     
2179 O O     . SER F 27 ? 0.4835 0.5780 0.5701 0.0495  0.0354  -0.0128 168 SER F O     
2180 C CB    . SER F 27 ? 0.5064 0.6197 0.5757 0.0985  0.0179  -0.0077 168 SER F CB    
2181 O OG    . SER F 27 ? 0.5630 0.6149 0.5907 0.0926  0.0160  -0.0021 168 SER F OG    
2182 N N     . GLY F 28 ? 0.4364 0.5556 0.5245 0.0434  0.0267  -0.0136 169 GLY F N     
2183 C CA    . GLY F 28 ? 0.4215 0.5294 0.4989 0.0244  0.0285  -0.0157 169 GLY F CA    
2184 C C     . GLY F 28 ? 0.3961 0.5282 0.5024 0.0164  0.0347  -0.0254 169 GLY F C     
2185 O O     . GLY F 28 ? 0.3581 0.5030 0.4840 0.0202  0.0372  -0.0283 169 GLY F O     
2186 N N     . LEU F 29 ? 0.4182 0.5558 0.5223 0.0049  0.0367  -0.0315 170 LEU F N     
2187 C CA    . LEU F 29 ? 0.4150 0.5687 0.5395 0.0058  0.0402  -0.0426 170 LEU F CA    
2188 C C     . LEU F 29 ? 0.4094 0.5489 0.5430 0.0163  0.0418  -0.0410 170 LEU F C     
2189 O O     . LEU F 29 ? 0.3985 0.5344 0.5404 0.0199  0.0426  -0.0471 170 LEU F O     
2190 C CB    . LEU F 29 ? 0.4420 0.6157 0.5636 -0.0026 0.0416  -0.0511 170 LEU F CB    
2191 C CG    . LEU F 29 ? 0.5002 0.6923 0.6077 -0.0201 0.0425  -0.0546 170 LEU F CG    
2192 C CD1   . LEU F 29 ? 0.4962 0.7272 0.6099 -0.0279 0.0465  -0.0681 170 LEU F CD1   
2193 C CD2   . LEU F 29 ? 0.4772 0.6780 0.5898 -0.0199 0.0418  -0.0595 170 LEU F CD2   
2194 N N     . SER F 30 ? 0.4005 0.5247 0.5244 0.0197  0.0419  -0.0331 171 SER F N     
2195 C CA    . SER F 30 ? 0.3814 0.4914 0.5074 0.0272  0.0435  -0.0302 171 SER F CA    
2196 C C     . SER F 30 ? 0.3949 0.5000 0.5219 0.0296  0.0472  -0.0241 171 SER F C     
2197 O O     . SER F 30 ? 0.3994 0.4929 0.5214 0.0323  0.0501  -0.0203 171 SER F O     
2198 C CB    . SER F 30 ? 0.3759 0.4788 0.4900 0.0278  0.0419  -0.0279 171 SER F CB    
2199 O OG    . SER F 30 ? 0.3900 0.4800 0.4849 0.0228  0.0418  -0.0228 171 SER F OG    
2200 N N     . ALA F 31 ? 0.3725 0.4938 0.5056 0.0286  0.0469  -0.0243 172 ALA F N     
2201 C CA    . ALA F 31 ? 0.3897 0.5276 0.5306 0.0310  0.0505  -0.0226 172 ALA F CA    
2202 C C     . ALA F 31 ? 0.3750 0.5077 0.5184 0.0209  0.0566  -0.0230 172 ALA F C     
2203 O O     . ALA F 31 ? 0.3688 0.4877 0.5103 0.0117  0.0559  -0.0266 172 ALA F O     
2204 C CB    . ALA F 31 ? 0.3850 0.5535 0.5375 0.0274  0.0472  -0.0264 172 ALA F CB    
2205 N N     . GLY F 32 ? 0.3956 0.5360 0.5374 0.0219  0.0628  -0.0201 173 GLY F N     
2206 C CA    . GLY F 32 ? 0.4233 0.5524 0.5574 0.0053  0.0691  -0.0187 173 GLY F CA    
2207 C C     . GLY F 32 ? 0.4409 0.5297 0.5545 0.0089  0.0679  -0.0131 173 GLY F C     
2208 O O     . GLY F 32 ? 0.4703 0.5478 0.5692 -0.0018 0.0738  -0.0089 173 GLY F O     
2209 N N     . LYS F 33 ? 0.4335 0.5062 0.5437 0.0216  0.0605  -0.0133 174 LYS F N     
2210 C CA    . LYS F 33 ? 0.4566 0.5046 0.5491 0.0276  0.0576  -0.0086 174 LYS F CA    
2211 C C     . LYS F 33 ? 0.4384 0.4933 0.5240 0.0315  0.0630  -0.0058 174 LYS F C     
2212 O O     . LYS F 33 ? 0.4546 0.5302 0.5485 0.0357  0.0673  -0.0084 174 LYS F O     
2213 C CB    . LYS F 33 ? 0.4760 0.5226 0.5699 0.0375  0.0485  -0.0123 174 LYS F CB    
2214 C CG    . LYS F 33 ? 0.5089 0.5578 0.6116 0.0406  0.0433  -0.0199 174 LYS F CG    
2215 C CD    . LYS F 33 ? 0.5684 0.5830 0.6534 0.0466  0.0384  -0.0189 174 LYS F CD    
2216 C CE    . LYS F 33 ? 0.5686 0.5780 0.6572 0.0524  0.0343  -0.0295 174 LYS F CE    
2217 N NZ    . LYS F 33 ? 0.6386 0.5947 0.6963 0.0607  0.0281  -0.0273 174 LYS F NZ    
2218 N N     . SER F 34 ? 0.4433 0.4794 0.5101 0.0333  0.0615  -0.0017 175 SER F N     
2219 C CA    . SER F 34 ? 0.4428 0.4789 0.4959 0.0366  0.0671  -0.0010 175 SER F CA    
2220 C C     . SER F 34 ? 0.4320 0.4535 0.4697 0.0405  0.0593  -0.0011 175 SER F C     
2221 O O     . SER F 34 ? 0.3964 0.4140 0.4338 0.0413  0.0499  -0.0003 175 SER F O     
2222 C CB    . SER F 34 ? 0.4688 0.5011 0.5069 0.0266  0.0758  0.0036  175 SER F CB    
2223 O OG    . SER F 34 ? 0.4923 0.4942 0.5088 0.0237  0.0683  0.0106  175 SER F OG    
2224 N N     . ASP F 35 ? 0.4423 0.4584 0.4661 0.0441  0.0626  -0.0043 176 ASP F N     
2225 C CA    . ASP F 35 ? 0.4656 0.4658 0.4654 0.0415  0.0580  -0.0053 176 ASP F CA    
2226 C C     . ASP F 35 ? 0.4998 0.4913 0.4777 0.0417  0.0655  -0.0038 176 ASP F C     
2227 O O     . ASP F 35 ? 0.4907 0.4915 0.4698 0.0464  0.0771  -0.0060 176 ASP F O     
2228 C CB    . ASP F 35 ? 0.4887 0.4733 0.4734 0.0412  0.0565  -0.0110 176 ASP F CB    
2229 C CG    . ASP F 35 ? 0.4773 0.4702 0.4761 0.0361  0.0507  -0.0120 176 ASP F CG    
2230 O OD1   . ASP F 35 ? 0.4752 0.4808 0.4767 0.0248  0.0433  -0.0137 176 ASP F OD1   
2231 O OD2   . ASP F 35 ? 0.4737 0.4683 0.4818 0.0440  0.0537  -0.0121 176 ASP F OD2   
2232 N N     . VAL F 36 ? 0.5166 0.4982 0.4743 0.0366  0.0587  -0.0018 177 VAL F N     
2233 C CA    . VAL F 36 ? 0.5622 0.5341 0.4930 0.0339  0.0641  0.0001  177 VAL F CA    
2234 C C     . VAL F 36 ? 0.5931 0.5497 0.4965 0.0305  0.0607  -0.0071 177 VAL F C     
2235 O O     . VAL F 36 ? 0.6014 0.5606 0.5022 0.0231  0.0484  -0.0086 177 VAL F O     
2236 C CB    . VAL F 36 ? 0.5755 0.5422 0.4971 0.0302  0.0566  0.0107  177 VAL F CB    
2237 C CG1   . VAL F 36 ? 0.6195 0.5736 0.5049 0.0238  0.0615  0.0144  177 VAL F CG1   
2238 C CG2   . VAL F 36 ? 0.5625 0.5304 0.5002 0.0284  0.0611  0.0165  177 VAL F CG2   
2239 N N     . TYR F 37 ? 0.6226 0.5669 0.5046 0.0351  0.0720  -0.0140 178 TYR F N     
2240 C CA    . TYR F 37 ? 0.6882 0.6049 0.5333 0.0312  0.0704  -0.0233 178 TYR F CA    
2241 C C     . TYR F 37 ? 0.7241 0.6388 0.5408 0.0284  0.0770  -0.0240 178 TYR F C     
2242 O O     . TYR F 37 ? 0.7228 0.6559 0.5474 0.0314  0.0876  -0.0195 178 TYR F O     
2243 C CB    . TYR F 37 ? 0.7160 0.6069 0.5490 0.0452  0.0770  -0.0341 178 TYR F CB    
2244 C CG    . TYR F 37 ? 0.6941 0.5853 0.5502 0.0480  0.0713  -0.0315 178 TYR F CG    
2245 C CD1   . TYR F 37 ? 0.7087 0.5931 0.5622 0.0297  0.0600  -0.0295 178 TYR F CD1   
2246 C CD2   . TYR F 37 ? 0.6927 0.5993 0.5730 0.0669  0.0774  -0.0318 178 TYR F CD2   
2247 C CE1   . TYR F 37 ? 0.7090 0.5942 0.5781 0.0285  0.0558  -0.0273 178 TYR F CE1   
2248 C CE2   . TYR F 37 ? 0.6748 0.5806 0.5715 0.0684  0.0711  -0.0288 178 TYR F CE2   
2249 C CZ    . TYR F 37 ? 0.6906 0.5818 0.5792 0.0484  0.0609  -0.0262 178 TYR F CZ    
2250 O OH    . TYR F 37 ? 0.6985 0.5909 0.5988 0.0445  0.0554  -0.0231 178 TYR F OH    
2251 N N     . TYR F 38 ? 0.7506 0.6443 0.5309 0.0179  0.0711  -0.0300 179 TYR F N     
2252 C CA    . TYR F 38 ? 0.7843 0.6678 0.5265 0.0156  0.0788  -0.0355 179 TYR F CA    
2253 C C     . TYR F 38 ? 0.8471 0.6888 0.5478 0.0178  0.0828  -0.0531 179 TYR F C     
2254 O O     . TYR F 38 ? 0.8545 0.6693 0.5418 0.0072  0.0728  -0.0576 179 TYR F O     
2255 C CB    . TYR F 38 ? 0.7808 0.6738 0.5066 0.0005  0.0661  -0.0265 179 TYR F CB    
2256 C CG    . TYR F 38 ? 0.7413 0.6556 0.4907 0.0025  0.0612  -0.0095 179 TYR F CG    
2257 C CD1   . TYR F 38 ? 0.7032 0.6319 0.4826 0.0050  0.0467  -0.0022 179 TYR F CD1   
2258 C CD2   . TYR F 38 ? 0.7574 0.6734 0.4927 0.0007  0.0718  -0.0018 179 TYR F CD2   
2259 C CE1   . TYR F 38 ? 0.7050 0.6388 0.4969 0.0104  0.0411  0.0118  179 TYR F CE1   
2260 C CE2   . TYR F 38 ? 0.7463 0.6640 0.4894 -0.0008 0.0664  0.0146  179 TYR F CE2   
2261 C CZ    . TYR F 38 ? 0.7249 0.6461 0.4943 0.0062  0.0504  0.0211  179 TYR F CZ    
2262 O OH    . TYR F 38 ? 0.7397 0.6492 0.5086 0.0080  0.0441  0.0357  179 TYR F OH    
2263 N N     . PHE F 39 ? 0.8711 0.7058 0.5481 0.0309  0.0981  -0.0641 180 PHE F N     
2264 C CA    . PHE F 39 ? 0.9439 0.7294 0.5713 0.0394  0.1031  -0.0836 180 PHE F CA    
2265 C C     . PHE F 39 ? 0.9741 0.7552 0.5592 0.0263  0.1065  -0.0898 180 PHE F C     
2266 O O     . PHE F 39 ? 0.9211 0.7399 0.5146 0.0256  0.1158  -0.0840 180 PHE F O     
2267 C CB    . PHE F 39 ? 0.9709 0.7587 0.6051 0.0748  0.1186  -0.0962 180 PHE F CB    
2268 C CG    . PHE F 39 ? 0.9478 0.7410 0.6193 0.0891  0.1140  -0.0902 180 PHE F CG    
2269 C CD1   . PHE F 39 ? 0.9951 0.7285 0.6397 0.0944  0.1042  -0.0952 180 PHE F CD1   
2270 C CD2   . PHE F 39 ? 0.8876 0.7400 0.6144 0.0915  0.1180  -0.0782 180 PHE F CD2   
2271 C CE1   . PHE F 39 ? 0.9743 0.7119 0.6490 0.1053  0.0985  -0.0878 180 PHE F CE1   
2272 C CE2   . PHE F 39 ? 0.8721 0.7316 0.6317 0.1023  0.1126  -0.0729 180 PHE F CE2   
2273 C CZ    . PHE F 39 ? 0.9115 0.7159 0.6463 0.1105  0.1027  -0.0773 180 PHE F CZ    
2274 N N     . SER F 40 ? 1.0450 0.7790 0.5803 0.0109  0.0986  -0.1009 181 SER F N     
2275 C CA    . SER F 40 ? 1.1205 0.8454 0.6072 -0.0024 0.1012  -0.1099 181 SER F CA    
2276 C C     . SER F 40 ? 1.1631 0.8718 0.6194 0.0247  0.1224  -0.1305 181 SER F C     
2277 O O     . SER F 40 ? 1.1443 0.8468 0.6159 0.0564  0.1321  -0.1390 181 SER F O     
2278 C CB    . SER F 40 ? 1.1715 0.8579 0.6135 -0.0342 0.0847  -0.1164 181 SER F CB    
2279 O OG    . SER F 40 ? 1.2819 0.8937 0.6648 -0.0319 0.0887  -0.1381 181 SER F OG    
2280 N N     . PRO F 41 ? 1.2238 0.9317 0.6371 0.0155  0.1293  -0.1401 182 PRO F N     
2281 C CA    . PRO F 41 ? 1.2860 0.9816 0.6659 0.0438  0.1506  -0.1651 182 PRO F CA    
2282 C C     . PRO F 41 ? 1.3506 0.9680 0.6886 0.0664  0.1494  -0.1872 182 PRO F C     
2283 O O     . PRO F 41 ? 1.3818 0.9968 0.7199 0.1075  0.1633  -0.2040 182 PRO F O     
2284 C CB    . PRO F 41 ? 1.3251 1.0211 0.6552 0.0211  0.1534  -0.1713 182 PRO F CB    
2285 C CG    . PRO F 41 ? 1.2868 1.0113 0.6353 -0.0133 0.1343  -0.1450 182 PRO F CG    
2286 C CD    . PRO F 41 ? 1.2380 0.9538 0.6249 -0.0180 0.1167  -0.1321 182 PRO F CD    
2287 N N     . SER F 42 ? 1.3852 0.9413 0.6851 0.0381  0.1316  -0.1870 183 SER F N     
2288 C CA    . SER F 42 ? 1.4525 0.9172 0.7071 0.0463  0.1241  -0.1998 183 SER F CA    
2289 C C     . SER F 42 ? 1.4185 0.8821 0.7152 0.0775  0.1229  -0.1919 183 SER F C     
2290 O O     . SER F 42 ? 1.4917 0.8784 0.7449 0.1044  0.1219  -0.2061 183 SER F O     
2291 C CB    . SER F 42 ? 1.4695 0.8949 0.6907 -0.0056 0.1044  -0.1941 183 SER F CB    
2292 N N     . GLY F 43 ? 1.3120 0.8529 0.6852 0.0744  0.1213  -0.1695 184 GLY F N     
2293 C CA    . GLY F 43 ? 1.2673 0.8180 0.6845 0.0985  0.1188  -0.1602 184 GLY F CA    
2294 C C     . GLY F 43 ? 1.2338 0.7629 0.6608 0.0674  0.1010  -0.1438 184 GLY F C     
2295 O O     . GLY F 43 ? 1.2083 0.7323 0.6594 0.0840  0.0973  -0.1369 184 GLY F O     
2296 N N     . LYS F 44 ? 1.2360 0.7591 0.6430 0.0223  0.0900  -0.1393 185 LYS F N     
2297 C CA    . LYS F 44 ? 1.2176 0.7405 0.6362 -0.0137 0.0745  -0.1265 185 LYS F CA    
2298 C C     . LYS F 44 ? 1.1189 0.7299 0.6209 -0.0121 0.0719  -0.1058 185 LYS F C     
2299 O O     . LYS F 44 ? 1.0803 0.7515 0.6147 -0.0132 0.0739  -0.0980 185 LYS F O     
2300 C CB    . LYS F 44 ? 1.2406 0.7503 0.6164 -0.0612 0.0640  -0.1316 185 LYS F CB    
2301 N N     . LYS F 45 ? 1.0974 0.7068 0.6254 -0.0092 0.0672  -0.0973 186 LYS F N     
2302 C CA    . LYS F 45 ? 1.0147 0.6947 0.6156 -0.0022 0.0660  -0.0809 186 LYS F CA    
2303 C C     . LYS F 45 ? 0.9520 0.6788 0.5772 -0.0357 0.0530  -0.0716 186 LYS F C     
2304 O O     . LYS F 45 ? 0.9745 0.6813 0.5703 -0.0669 0.0441  -0.0760 186 LYS F O     
2305 C CB    . LYS F 45 ? 1.0320 0.6895 0.6445 0.0163  0.0661  -0.0781 186 LYS F CB    
2306 C CG    . LYS F 45 ? 0.9853 0.7053 0.6660 0.0238  0.0653  -0.0640 186 LYS F CG    
2307 C CD    . LYS F 45 ? 1.0039 0.6984 0.6863 0.0294  0.0607  -0.0603 186 LYS F CD    
2308 C CE    . LYS F 45 ? 1.0303 0.7040 0.7087 0.0717  0.0672  -0.0655 186 LYS F CE    
2309 N NZ    . LYS F 45 ? 0.9845 0.6966 0.7110 0.0842  0.0654  -0.0559 186 LYS F NZ    
2310 N N     . PHE F 46 ? 0.8871 0.6769 0.5630 -0.0288 0.0515  -0.0597 187 PHE F N     
2311 C CA    . PHE F 46 ? 0.8413 0.6835 0.5454 -0.0480 0.0373  -0.0520 187 PHE F CA    
2312 C C     . PHE F 46 ? 0.7586 0.6419 0.5196 -0.0327 0.0362  -0.0404 187 PHE F C     
2313 O O     . PHE F 46 ? 0.7315 0.6216 0.5137 -0.0112 0.0448  -0.0339 187 PHE F O     
2314 C CB    . PHE F 46 ? 0.8617 0.7297 0.5554 -0.0525 0.0314  -0.0497 187 PHE F CB    
2315 C CG    . PHE F 46 ? 0.9268 0.7644 0.5648 -0.0753 0.0288  -0.0625 187 PHE F CG    
2316 C CD1   . PHE F 46 ? 0.9650 0.7528 0.5602 -0.0665 0.0415  -0.0724 187 PHE F CD1   
2317 C CD2   . PHE F 46 ? 0.9431 0.8041 0.5702 -0.1069 0.0143  -0.0676 187 PHE F CD2   
2318 C CE1   . PHE F 46 ? 1.0561 0.8055 0.5925 -0.0888 0.0392  -0.0866 187 PHE F CE1   
2319 C CE2   . PHE F 46 ? 1.0219 0.8519 0.5927 -0.1346 0.0116  -0.0809 187 PHE F CE2   
2320 C CZ    . PHE F 46 ? 1.0702 0.8377 0.5923 -0.1255 0.0239  -0.0903 187 PHE F CZ    
2321 N N     . ARG F 47 ? 0.7216 0.6349 0.5041 -0.0469 0.0263  -0.0396 188 ARG F N     
2322 C CA    . ARG F 47 ? 0.6698 0.6123 0.4992 -0.0337 0.0261  -0.0324 188 ARG F CA    
2323 C C     . ARG F 47 ? 0.6528 0.6540 0.5159 -0.0320 0.0133  -0.0286 188 ARG F C     
2324 O O     . ARG F 47 ? 0.6288 0.6538 0.5274 -0.0214 0.0123  -0.0254 188 ARG F O     
2325 C CB    . ARG F 47 ? 0.6567 0.5789 0.4808 -0.0457 0.0283  -0.0363 188 ARG F CB    
2326 C CG    . ARG F 47 ? 0.7047 0.5581 0.4835 -0.0432 0.0365  -0.0416 188 ARG F CG    
2327 C CD    . ARG F 47 ? 0.7047 0.5316 0.4795 -0.0451 0.0375  -0.0404 188 ARG F CD    
2328 N NE    . ARG F 47 ? 0.7193 0.5429 0.4711 -0.0827 0.0308  -0.0439 188 ARG F NE    
2329 C CZ    . ARG F 47 ? 0.6984 0.5329 0.4612 -0.0953 0.0292  -0.0410 188 ARG F CZ    
2330 N NH1   . ARG F 47 ? 0.6482 0.5003 0.4495 -0.0707 0.0321  -0.0342 188 ARG F NH1   
2331 N NH2   . ARG F 47 ? 0.7139 0.5470 0.4469 -0.1379 0.0250  -0.0457 188 ARG F NH2   
2332 N N     . SER F 48 ? 0.6760 0.7011 0.5262 -0.0386 0.0024  -0.0302 189 SER F N     
2333 C CA    . SER F 48 ? 0.6662 0.7460 0.5447 -0.0255 -0.0126 -0.0270 189 SER F CA    
2334 C C     . SER F 48 ? 0.7183 0.8067 0.5724 -0.0224 -0.0241 -0.0241 189 SER F C     
2335 O O     . SER F 48 ? 0.7335 0.8001 0.5505 -0.0409 -0.0215 -0.0290 189 SER F O     
2336 C CB    . SER F 48 ? 0.6293 0.7658 0.5285 -0.0425 -0.0207 -0.0377 189 SER F CB    
2337 O OG    . SER F 48 ? 0.6351 0.7824 0.5044 -0.0760 -0.0248 -0.0478 189 SER F OG    
2338 N N     . LYS F 49 ? 0.7552 0.8691 0.6242 0.0027  -0.0378 -0.0164 190 LYS F N     
2339 C CA    . LYS F 49 ? 0.8230 0.9507 0.6673 0.0105  -0.0544 -0.0119 190 LYS F CA    
2340 C C     . LYS F 49 ? 0.8325 1.0117 0.6648 -0.0132 -0.0673 -0.0249 190 LYS F C     
2341 O O     . LYS F 49 ? 0.8604 1.0226 0.6543 -0.0245 -0.0699 -0.0240 190 LYS F O     
2342 C CB    . LYS F 49 ? 0.8524 0.9925 0.7101 0.0469  -0.0707 -0.0021 190 LYS F CB    
2343 C CG    . LYS F 49 ? 0.9215 1.0520 0.7427 0.0623  -0.0881 0.0086  190 LYS F CG    
2344 C CD    . LYS F 49 ? 0.9601 1.0901 0.7863 0.1036  -0.1073 0.0176  190 LYS F CD    
2345 C CE    . LYS F 49 ? 1.0092 1.1487 0.7996 0.1243  -0.1338 0.0255  190 LYS F CE    
2346 N NZ    . LYS F 49 ? 1.0630 1.1231 0.8100 0.1468  -0.1390 0.0468  190 LYS F NZ    
2347 N N     . PRO F 50 ? 0.8098 1.0541 0.6713 -0.0260 -0.0738 -0.0382 191 PRO F N     
2348 C CA    . PRO F 50 ? 0.8340 1.1272 0.6790 -0.0612 -0.0828 -0.0524 191 PRO F CA    
2349 C C     . PRO F 50 ? 0.8518 1.0822 0.6485 -0.0997 -0.0680 -0.0577 191 PRO F C     
2350 O O     . PRO F 50 ? 0.8863 1.1126 0.6470 -0.1128 -0.0747 -0.0604 191 PRO F O     
2351 C CB    . PRO F 50 ? 0.8174 1.1862 0.7013 -0.0761 -0.0850 -0.0665 191 PRO F CB    
2352 C CG    . PRO F 50 ? 0.7976 1.1650 0.7208 -0.0392 -0.0817 -0.0598 191 PRO F CG    
2353 C CD    . PRO F 50 ? 0.7961 1.0724 0.7014 -0.0170 -0.0706 -0.0427 191 PRO F CD    
2354 N N     . GLN F 51 ? 0.8525 1.0299 0.6442 -0.1132 -0.0494 -0.0593 192 GLN F N     
2355 C CA    . GLN F 51 ? 0.9040 1.0048 0.6431 -0.1407 -0.0353 -0.0654 192 GLN F CA    
2356 C C     . GLN F 51 ? 0.9266 0.9827 0.6309 -0.1263 -0.0322 -0.0604 192 GLN F C     
2357 O O     . GLN F 51 ? 0.9642 0.9903 0.6191 -0.1503 -0.0314 -0.0697 192 GLN F O     
2358 C CB    . GLN F 51 ? 0.9247 0.9683 0.6681 -0.1347 -0.0182 -0.0624 192 GLN F CB    
2359 C CG    . GLN F 51 ? 1.0024 0.9673 0.6904 -0.1618 -0.0072 -0.0712 192 GLN F CG    
2360 C CD    . GLN F 51 ? 1.0166 0.9302 0.7099 -0.1472 0.0054  -0.0665 192 GLN F CD    
2361 O OE1   . GLN F 51 ? 0.9626 0.8912 0.6992 -0.1146 0.0097  -0.0567 192 GLN F OE1   
2362 N NE2   . GLN F 51 ? 1.0868 0.9343 0.7289 -0.1726 0.0101  -0.0737 192 GLN F NE2   
2363 N N     . LEU F 52 ? 0.8862 0.9371 0.6121 -0.0903 -0.0299 -0.0463 193 LEU F N     
2364 C CA    . LEU F 52 ? 0.9081 0.9260 0.6031 -0.0781 -0.0258 -0.0397 193 LEU F CA    
2365 C C     . LEU F 52 ? 0.9484 1.0054 0.6229 -0.0831 -0.0458 -0.0389 193 LEU F C     
2366 O O     . LEU F 52 ? 0.9613 0.9907 0.5911 -0.0921 -0.0430 -0.0412 193 LEU F O     
2367 C CB    . LEU F 52 ? 0.8734 0.8766 0.5922 -0.0469 -0.0180 -0.0243 193 LEU F CB    
2368 C CG    . LEU F 52 ? 0.8939 0.8598 0.5798 -0.0393 -0.0067 -0.0176 193 LEU F CG    
2369 C CD1   . LEU F 52 ? 0.9168 0.8389 0.5723 -0.0492 0.0129  -0.0310 193 LEU F CD1   
2370 C CD2   . LEU F 52 ? 0.8688 0.8275 0.5780 -0.0179 -0.0008 -0.0023 193 LEU F CD2   
2371 N N     . ALA F 53 ? 0.9443 1.0689 0.6505 -0.0744 -0.0663 -0.0369 194 ALA F N     
2372 C CA    . ALA F 53 ? 0.9784 1.1512 0.6695 -0.0708 -0.0902 -0.0353 194 ALA F CA    
2373 C C     . ALA F 53 ? 1.0209 1.2311 0.6877 -0.1110 -0.0989 -0.0531 194 ALA F C     
2374 O O     . ALA F 53 ? 1.0764 1.3002 0.7098 -0.1162 -0.1122 -0.0532 194 ALA F O     
2375 C CB    . ALA F 53 ? 0.9464 1.1801 0.6791 -0.0371 -0.1110 -0.0285 194 ALA F CB    
2376 N N     . ARG F 54 ? 1.0252 1.2517 0.7033 -0.1429 -0.0925 -0.0678 195 ARG F N     
2377 C CA    . ARG F 54 ? 1.0755 1.3176 0.7167 -0.1930 -0.0963 -0.0859 195 ARG F CA    
2378 C C     . ARG F 54 ? 1.1398 1.2876 0.7161 -0.2091 -0.0810 -0.0898 195 ARG F C     
2379 O O     . ARG F 54 ? 1.1839 1.3384 0.7191 -0.2276 -0.0904 -0.0965 195 ARG F O     
2380 C CB    . ARG F 54 ? 1.0700 1.3375 0.7272 -0.2295 -0.0908 -0.0991 195 ARG F CB    
2381 N N     . TYR F 55 ? 1.1463 1.2126 0.7138 -0.1974 -0.0585 -0.0866 196 TYR F N     
2382 C CA    . TYR F 55 ? 1.2120 1.1901 0.7194 -0.2044 -0.0421 -0.0941 196 TYR F CA    
2383 C C     . TYR F 55 ? 1.2357 1.2135 0.7146 -0.1917 -0.0462 -0.0894 196 TYR F C     
2384 O O     . TYR F 55 ? 1.3139 1.2627 0.7367 -0.2162 -0.0457 -0.1026 196 TYR F O     
2385 C CB    . TYR F 55 ? 1.2024 1.1122 0.7159 -0.1787 -0.0198 -0.0901 196 TYR F CB    
2386 C CG    . TYR F 55 ? 1.2696 1.0952 0.7224 -0.1787 -0.0030 -0.1022 196 TYR F CG    
2387 C CD1   . TYR F 55 ? 1.3445 1.1078 0.7388 -0.2107 0.0000  -0.1205 196 TYR F CD1   
2388 C CD2   . TYR F 55 ? 1.2767 1.0832 0.7252 -0.1475 0.0102  -0.0971 196 TYR F CD2   
2389 C CE1   . TYR F 55 ? 1.4286 1.1091 0.7620 -0.2037 0.0144  -0.1346 196 TYR F CE1   
2390 C CE2   . TYR F 55 ? 1.3504 1.0906 0.7453 -0.1425 0.0265  -0.1122 196 TYR F CE2   
2391 C CZ    . TYR F 55 ? 1.4240 1.0988 0.7613 -0.1665 0.0279  -0.1317 196 TYR F CZ    
2392 O OH    . TYR F 55 ? 1.4679 1.0710 0.7471 -0.1544 0.0432  -0.1494 196 TYR F OH    
2393 N N     . LEU F 56 ? 1.2088 1.2130 0.7189 -0.1567 -0.0507 -0.0709 197 LEU F N     
2394 C CA    . LEU F 56 ? 1.2708 1.2673 0.7471 -0.1456 -0.0537 -0.0628 197 LEU F CA    
2395 C C     . LEU F 56 ? 1.3225 1.3807 0.7840 -0.1560 -0.0820 -0.0617 197 LEU F C     
2396 O O     . LEU F 56 ? 1.3353 1.3801 0.7502 -0.1588 -0.0854 -0.0596 197 LEU F O     
2397 C CB    . LEU F 56 ? 1.2377 1.2198 0.7373 -0.1097 -0.0450 -0.0424 197 LEU F CB    
2398 C CG    . LEU F 56 ? 1.2301 1.1578 0.7322 -0.0997 -0.0158 -0.0455 197 LEU F CG    
2399 C CD1   . LEU F 56 ? 1.1818 1.1101 0.7166 -0.0726 -0.0094 -0.0263 197 LEU F CD1   
2400 C CD2   . LEU F 56 ? 1.2851 1.1680 0.7308 -0.1092 0.0012  -0.0588 197 LEU F CD2   
2401 N N     . GLY F 57 ? 1.3183 1.4493 0.8185 -0.1603 -0.1023 -0.0640 198 GLY F N     
2402 C CA    . GLY F 57 ? 1.3550 1.5632 0.8470 -0.1711 -0.1315 -0.0680 198 GLY F CA    
2403 C C     . GLY F 57 ? 1.3878 1.6050 0.8600 -0.1398 -0.1495 -0.0495 198 GLY F C     
2404 O O     . GLY F 57 ? 1.3782 1.5604 0.8606 -0.1045 -0.1445 -0.0299 198 GLY F O     
2405 N N     . ASN F 58 ? 1.4232 1.6820 0.8600 -0.1561 -0.1707 -0.0553 199 ASN F N     
2406 C CA    . ASN F 58 ? 1.4596 1.7222 0.8634 -0.1292 -0.1913 -0.0370 199 ASN F CA    
2407 C C     . ASN F 58 ? 1.4926 1.6628 0.8529 -0.1178 -0.1699 -0.0208 199 ASN F C     
2408 O O     . ASN F 58 ? 1.4948 1.6503 0.8394 -0.0867 -0.1824 0.0021  199 ASN F O     
2409 C CB    . ASN F 58 ? 1.4954 1.8122 0.8592 -0.1572 -0.2143 -0.0495 199 ASN F CB    
2410 N N     . THR F 59 ? 1.5179 1.6267 0.8563 -0.1421 -0.1382 -0.0333 200 THR F N     
2411 C CA    . THR F 59 ? 1.5546 1.5928 0.8490 -0.1380 -0.1147 -0.0248 200 THR F CA    
2412 C C     . THR F 59 ? 1.5217 1.5225 0.8387 -0.1080 -0.1001 -0.0031 200 THR F C     
2413 O O     . THR F 59 ? 1.5536 1.5093 0.8342 -0.1096 -0.0803 0.0031  200 THR F O     
2414 C CB    . THR F 59 ? 1.5674 1.5567 0.8326 -0.1658 -0.0852 -0.0493 200 THR F CB    
2415 N N     . VAL F 60 ? 1.4448 1.4670 0.8181 -0.0848 -0.1084 0.0057  201 VAL F N     
2416 C CA    . VAL F 60 ? 1.3958 1.3855 0.7842 -0.0578 -0.1023 0.0278  201 VAL F CA    
2417 C C     . VAL F 60 ? 1.3364 1.3668 0.7742 -0.0290 -0.1268 0.0353  201 VAL F C     
2418 O O     . VAL F 60 ? 1.2790 1.3480 0.7655 -0.0328 -0.1261 0.0203  201 VAL F O     
2419 C CB    . VAL F 60 ? 1.3466 1.2971 0.7565 -0.0629 -0.0665 0.0217  201 VAL F CB    
2420 N N     . ASP F 61 ? 1.3520 1.3710 0.7710 0.0000  -0.1487 0.0573  202 ASP F N     
2421 C CA    . ASP F 61 ? 1.3267 1.3806 0.7855 0.0366  -0.1739 0.0629  202 ASP F CA    
2422 C C     . ASP F 61 ? 1.2961 1.3102 0.7888 0.0505  -0.1563 0.0698  202 ASP F C     
2423 O O     . ASP F 61 ? 1.3184 1.2650 0.7773 0.0537  -0.1463 0.0881  202 ASP F O     
2424 C CB    . ASP F 61 ? 1.3877 1.4338 0.7998 0.0688  -0.2090 0.0834  202 ASP F CB    
2425 C CG    . ASP F 61 ? 1.3773 1.4611 0.8257 0.1172  -0.2384 0.0862  202 ASP F CG    
2426 O OD1   . ASP F 61 ? 1.3184 1.4433 0.8308 0.1238  -0.2318 0.0717  202 ASP F OD1   
2427 O OD2   . ASP F 61 ? 1.4428 1.5126 0.8498 0.1523  -0.2698 0.1029  202 ASP F OD2   
2428 N N     . LEU F 62 ? 1.2351 1.2936 0.7904 0.0556  -0.1535 0.0551  203 LEU F N     
2429 C CA    . LEU F 62 ? 1.2079 1.2372 0.7997 0.0661  -0.1368 0.0580  203 LEU F CA    
2430 C C     . LEU F 62 ? 1.2232 1.2761 0.8441 0.1079  -0.1605 0.0616  203 LEU F C     
2431 O O     . LEU F 62 ? 1.2300 1.2807 0.8917 0.1155  -0.1496 0.0572  203 LEU F O     
2432 C CB    . LEU F 62 ? 1.1235 1.1722 0.7572 0.0388  -0.1113 0.0385  203 LEU F CB    
2433 C CG    . LEU F 62 ? 1.1294 1.1546 0.7340 0.0044  -0.0890 0.0293  203 LEU F CG    
2434 C CD1   . LEU F 62 ? 1.0945 1.1327 0.7322 -0.0155 -0.0716 0.0101  203 LEU F CD1   
2435 C CD2   . LEU F 62 ? 1.1482 1.1117 0.7198 -0.0001 -0.0674 0.0413  203 LEU F CD2   
2436 N N     . SER F 63 ? 1.2748 1.3481 0.8709 0.1385  -0.1936 0.0689  204 SER F N     
2437 C CA    . SER F 63 ? 1.2780 1.3747 0.8949 0.1887  -0.2199 0.0698  204 SER F CA    
2438 C C     . SER F 63 ? 1.2930 1.3020 0.8961 0.2080  -0.2115 0.0849  204 SER F C     
2439 O O     . SER F 63 ? 1.2117 1.2380 0.8578 0.2291  -0.2109 0.0757  204 SER F O     
2440 C CB    . SER F 63 ? 1.3382 1.4572 0.9152 0.2240  -0.2592 0.0782  204 SER F CB    
2441 N N     . SER F 64 ? 1.3556 1.2726 0.8952 0.1955  -0.2038 0.1067  205 SER F N     
2442 C CA    . SER F 64 ? 1.3830 1.2072 0.8958 0.2001  -0.1934 0.1222  205 SER F CA    
2443 C C     . SER F 64 ? 1.3108 1.1143 0.8460 0.1555  -0.1528 0.1184  205 SER F C     
2444 O O     . SER F 64 ? 1.3550 1.0891 0.8676 0.1489  -0.1410 0.1299  205 SER F O     
2445 C CB    . SER F 64 ? 1.4890 1.2205 0.9083 0.2095  -0.2106 0.1500  205 SER F CB    
2446 N N     . PHE F 65 ? 1.2047 1.0666 0.7801 0.1262  -0.1333 0.1014  206 PHE F N     
2447 C CA    . PHE F 65 ? 1.1478 0.9986 0.7440 0.0917  -0.0979 0.0955  206 PHE F CA    
2448 C C     . PHE F 65 ? 1.0799 0.9464 0.7340 0.0982  -0.0873 0.0848  206 PHE F C     
2449 O O     . PHE F 65 ? 1.0341 0.9610 0.7366 0.1045  -0.0914 0.0683  206 PHE F O     
2450 C CB    . PHE F 65 ? 1.0949 0.9907 0.7033 0.0648  -0.0843 0.0800  206 PHE F CB    
2451 C CG    . PHE F 65 ? 1.0619 0.9470 0.6848 0.0380  -0.0508 0.0724  206 PHE F CG    
2452 C CD1   . PHE F 65 ? 1.0943 0.9353 0.6810 0.0212  -0.0326 0.0835  206 PHE F CD1   
2453 C CD2   . PHE F 65 ? 1.0168 0.9381 0.6863 0.0298  -0.0383 0.0537  206 PHE F CD2   
2454 C CE1   . PHE F 65 ? 1.0629 0.9090 0.6673 0.0022  -0.0030 0.0738  206 PHE F CE1   
2455 C CE2   . PHE F 65 ? 0.9865 0.8977 0.6661 0.0137  -0.0109 0.0462  206 PHE F CE2   
2456 C CZ    . PHE F 65 ? 1.0162 0.8965 0.6672 0.0026  0.0064  0.0549  206 PHE F CZ    
2457 N N     . ASP F 66 ? 1.0669 0.8816 0.7124 0.0917  -0.0733 0.0936  207 ASP F N     
2458 C CA    . ASP F 66 ? 1.0038 0.8297 0.6991 0.0955  -0.0628 0.0840  207 ASP F CA    
2459 C C     . ASP F 66 ? 0.8979 0.7585 0.6325 0.0686  -0.0355 0.0705  207 ASP F C     
2460 O O     . ASP F 66 ? 0.8679 0.7074 0.5875 0.0452  -0.0142 0.0743  207 ASP F O     
2461 C CB    . ASP F 66 ? 1.0568 0.8124 0.7228 0.0965  -0.0605 0.0972  207 ASP F CB    
2462 C CG    . ASP F 66 ? 1.0198 0.7894 0.7347 0.1004  -0.0515 0.0858  207 ASP F CG    
2463 O OD1   . ASP F 66 ? 1.0155 0.8018 0.7527 0.1314  -0.0684 0.0781  207 ASP F OD1   
2464 O OD2   . ASP F 66 ? 0.9834 0.7558 0.7159 0.0738  -0.0278 0.0827  207 ASP F OD2   
2465 N N     . PHE F 67 ? 0.8103 0.7245 0.5906 0.0727  -0.0372 0.0543  208 PHE F N     
2466 C CA    . PHE F 67 ? 0.7606 0.6989 0.5674 0.0525  -0.0169 0.0415  208 PHE F CA    
2467 C C     . PHE F 67 ? 0.7359 0.6570 0.5593 0.0437  0.0037  0.0419  208 PHE F C     
2468 O O     . PHE F 67 ? 0.7057 0.6304 0.5308 0.0299  0.0219  0.0360  208 PHE F O     
2469 C CB    . PHE F 67 ? 0.7202 0.7088 0.5636 0.0549  -0.0246 0.0265  208 PHE F CB    
2470 C CG    . PHE F 67 ? 0.6900 0.6865 0.5464 0.0353  -0.0077 0.0146  208 PHE F CG    
2471 C CD1   . PHE F 67 ? 0.6513 0.6462 0.5368 0.0344  0.0046  0.0108  208 PHE F CD1   
2472 C CD2   . PHE F 67 ? 0.7001 0.7001 0.5332 0.0189  -0.0064 0.0069  208 PHE F CD2   
2473 C CE1   . PHE F 67 ? 0.6364 0.6280 0.5244 0.0217  0.0167  0.0013  208 PHE F CE1   
2474 C CE2   . PHE F 67 ? 0.6934 0.6836 0.5262 0.0043  0.0068  -0.0040 208 PHE F CE2   
2475 C CZ    . PHE F 67 ? 0.6563 0.6403 0.5153 0.0079  0.0176  -0.0060 208 PHE F CZ    
2476 N N     . ARG F 68 ? 0.7551 0.6584 0.5873 0.0535  -0.0001 0.0475  209 ARG F N     
2477 C CA    . ARG F 68 ? 0.7795 0.6775 0.6331 0.0440  0.0163  0.0457  209 ARG F CA    
2478 C C     . ARG F 68 ? 0.8112 0.6800 0.6341 0.0235  0.0320  0.0552  209 ARG F C     
2479 O O     . ARG F 68 ? 0.8068 0.6942 0.6484 0.0103  0.0504  0.0495  209 ARG F O     
2480 C CB    . ARG F 68 ? 0.7900 0.6816 0.6632 0.0601  0.0057  0.0444  209 ARG F CB    
2481 C CG    . ARG F 68 ? 0.8120 0.6989 0.7054 0.0486  0.0202  0.0419  209 ARG F CG    
2482 C CD    . ARG F 68 ? 0.7804 0.6782 0.7041 0.0637  0.0127  0.0334  209 ARG F CD    
2483 N NE    . ARG F 68 ? 0.7233 0.6707 0.6863 0.0644  0.0160  0.0211  209 ARG F NE    
2484 C CZ    . ARG F 68 ? 0.6942 0.6600 0.6792 0.0521  0.0298  0.0160  209 ARG F CZ    
2485 N NH1   . ARG F 68 ? 0.6858 0.6420 0.6685 0.0389  0.0429  0.0193  209 ARG F NH1   
2486 N NH2   . ARG F 68 ? 0.6714 0.6677 0.6780 0.0524  0.0297  0.0072  209 ARG F NH2   
2487 N N     . THR F 69 ? 0.8621 0.6889 0.6359 0.0201  0.0242  0.0694  210 THR F N     
2488 C CA    . THR F 69 ? 0.9133 0.7139 0.6490 -0.0073 0.0400  0.0791  210 THR F CA    
2489 C C     . THR F 69 ? 0.9147 0.7335 0.6288 -0.0199 0.0512  0.0775  210 THR F C     
2490 O O     . THR F 69 ? 0.9028 0.7311 0.6045 -0.0437 0.0717  0.0771  210 THR F O     
2491 C CB    . THR F 69 ? 1.0014 0.7310 0.6779 -0.0088 0.0254  0.0977  210 THR F CB    
2492 O OG1   . THR F 69 ? 1.0357 0.7528 0.6881 0.0155  0.0021  0.1033  210 THR F OG1   
2493 C CG2   . THR F 69 ? 1.0104 0.7082 0.6962 0.0004  0.0175  0.0979  210 THR F CG2   
2494 N N     . GLY F 70 ? 0.9241 0.7524 0.6323 -0.0053 0.0379  0.0747  211 GLY F N     
2495 C CA    . GLY F 70 ? 0.9539 0.7927 0.6337 -0.0163 0.0463  0.0718  211 GLY F CA    
2496 C C     . GLY F 70 ? 1.0397 0.8371 0.6529 -0.0286 0.0402  0.0893  211 GLY F C     
2497 O O     . GLY F 70 ? 1.0276 0.8334 0.6112 -0.0423 0.0505  0.0868  211 GLY F O     
2498 N N     . LYS F 71 ? 1.0971 0.8446 0.6809 -0.0220 0.0224  0.1063  212 LYS F N     
2499 C CA    . LYS F 71 ? 1.1879 0.8771 0.6962 -0.0312 0.0117  0.1272  212 LYS F CA    
2500 C C     . LYS F 71 ? 1.2232 0.8934 0.7135 0.0039  -0.0236 0.1347  212 LYS F C     
2501 O O     . LYS F 71 ? 1.1906 0.8804 0.7239 0.0325  -0.0384 0.1267  212 LYS F O     
2502 C CB    . LYS F 71 ? 1.2452 0.8759 0.7187 -0.0522 0.0182  0.1417  212 LYS F CB    
2503 C CG    . LYS F 71 ? 1.2151 0.8802 0.7156 -0.0865 0.0511  0.1321  212 LYS F CG    
2504 C CD    . LYS F 71 ? 1.2258 0.9208 0.7008 -0.1186 0.0757  0.1294  212 LYS F CD    
2505 C CE    . LYS F 71 ? 1.2237 0.9442 0.7052 -0.1576 0.1049  0.1249  212 LYS F CE    
2506 N N     . MET F 72 ? 1.3086 0.9484 0.7357 0.0023  -0.0370 0.1488  213 MET F N     
2507 C CA    . MET F 72 ? 1.3707 0.9932 0.7708 0.0387  -0.0740 0.1580  213 MET F CA    
2508 C C     . MET F 72 ? 1.4681 1.0077 0.8224 0.0581  -0.0934 0.1766  213 MET F C     
2509 O O     . MET F 72 ? 1.5137 0.9903 0.8262 0.0298  -0.0785 0.1892  213 MET F O     
2510 C CB    . MET F 72 ? 1.4200 1.0333 0.7590 0.0298  -0.0833 0.1683  213 MET F CB    
2511 C CG    . MET F 72 ? 1.3666 1.0503 0.7360 0.0147  -0.0695 0.1488  213 MET F CG    
2512 S SD    . MET F 72 ? 1.3166 1.0748 0.7379 0.0467  -0.0965 0.1309  213 MET F SD    
2513 C CE    . MET F 72 ? 1.2680 1.0793 0.7087 0.0156  -0.0722 0.1078  213 MET F CE    
2514 N N     . MET F 73 ? 1.5137 1.0533 0.8706 0.1058  -0.1269 0.1769  214 MET F N     
2515 C CA    . MET F 73 ? 1.6166 1.0704 0.9261 0.1376  -0.1504 0.1913  214 MET F CA    
2516 C C     . MET F 73 ? 1.7194 1.1020 0.9360 0.1624  -0.1839 0.2148  214 MET F C     
2517 O O     . MET F 73 ? 1.7138 1.1478 0.9334 0.1851  -0.2048 0.2122  214 MET F O     
2518 C CB    . MET F 73 ? 1.5736 1.0760 0.9515 0.1823  -0.1645 0.1721  214 MET F CB    
2519 C CG    . MET F 73 ? 1.4907 1.0485 0.9493 0.1611  -0.1354 0.1518  214 MET F CG    
2520 S SD    . MET F 73 ? 1.5362 1.0339 0.9764 0.1081  -0.1001 0.1590  214 MET F SD    
2521 C CE    . MET F 73 ? 1.5032 0.9877 0.9818 0.1352  -0.1048 0.1464  214 MET F CE    
2522 N N     . PRO F 74 ? 1.8093 1.0695 0.9366 0.1554  -0.1899 0.2381  215 PRO F N     
2523 O "O5'" . DC  G 1  ? 0.4987 0.4861 0.5665 0.1102  -0.0323 -0.0854 1   DC  G "O5'" 
2524 C "C5'" . DC  G 1  ? 0.4985 0.4842 0.5504 0.1301  -0.0627 -0.1001 1   DC  G "C5'" 
2525 C "C4'" . DC  G 1  ? 0.4939 0.4505 0.4858 0.1294  -0.0704 -0.0778 1   DC  G "C4'" 
2526 O "O4'" . DC  G 1  ? 0.4852 0.4130 0.4300 0.1205  -0.0617 -0.0534 1   DC  G "O4'" 
2527 C "C3'" . DC  G 1  ? 0.4646 0.4267 0.4687 0.1157  -0.0635 -0.0688 1   DC  G "C3'" 
2528 O "O3'" . DC  G 1  ? 0.4835 0.4313 0.4509 0.1320  -0.0808 -0.0674 1   DC  G "O3'" 
2529 C "C2'" . DC  G 1  ? 0.4688 0.4140 0.4492 0.0955  -0.0439 -0.0422 1   DC  G "C2'" 
2530 C "C1'" . DC  G 1  ? 0.4896 0.4092 0.4243 0.1024  -0.0502 -0.0329 1   DC  G "C1'" 
2531 N N1    . DC  G 1  ? 0.5056 0.4120 0.4261 0.0916  -0.0373 -0.0202 1   DC  G N1    
2532 C C2    . DC  G 1  ? 0.5102 0.3901 0.3949 0.0854  -0.0412 -0.0030 1   DC  G C2    
2533 O O2    . DC  G 1  ? 0.5188 0.3873 0.3882 0.0865  -0.0488 0.0045  1   DC  G O2    
2534 N N3    . DC  G 1  ? 0.5026 0.3685 0.3723 0.0809  -0.0361 0.0034  1   DC  G N3    
2535 C C4    . DC  G 1  ? 0.5061 0.3794 0.3849 0.0837  -0.0215 -0.0016 1   DC  G C4    
2536 N N4    . DC  G 1  ? 0.5070 0.3599 0.3579 0.0863  -0.0180 0.0046  1   DC  G N4    
2537 C C5    . DC  G 1  ? 0.5141 0.4146 0.4342 0.0861  -0.0091 -0.0145 1   DC  G C5    
2538 C C6    . DC  G 1  ? 0.5001 0.4184 0.4449 0.0890  -0.0204 -0.0258 1   DC  G C6    
2539 P P     . DG  G 2  ? 0.4625 0.4098 0.4247 0.1258  -0.0784 -0.0569 2   DG  G P     
2540 O OP1   . DG  G 2  ? 0.5073 0.4533 0.4560 0.1550  -0.1013 -0.0751 2   DG  G OP1   
2541 O OP2   . DG  G 2  ? 0.4438 0.4100 0.4532 0.1033  -0.0627 -0.0562 2   DG  G OP2   
2542 O "O5'" . DG  G 2  ? 0.4887 0.4065 0.3992 0.1174  -0.0676 -0.0258 2   DG  G "O5'" 
2543 C "C5'" . DG  G 2  ? 0.5351 0.4252 0.4015 0.1312  -0.0721 -0.0179 2   DG  G "C5'" 
2544 C "C4'" . DG  G 2  ? 0.5659 0.4315 0.4026 0.1210  -0.0590 0.0096  2   DG  G "C4'" 
2545 O "O4'" . DG  G 2  ? 0.5330 0.3968 0.3827 0.0974  -0.0500 0.0205  2   DG  G "O4'" 
2546 C "C3'" . DG  G 2  ? 0.5512 0.4237 0.3901 0.1180  -0.0522 0.0181  2   DG  G "C3'" 
2547 O "O3'" . DG  G 2  ? 0.6257 0.4697 0.4301 0.1229  -0.0405 0.0396  2   DG  G "O3'" 
2548 C "C2'" . DG  G 2  ? 0.5133 0.4022 0.3850 0.0912  -0.0436 0.0235  2   DG  G "C2'" 
2549 C "C1'" . DG  G 2  ? 0.5077 0.3829 0.3754 0.0805  -0.0415 0.0295  2   DG  G "C1'" 
2550 N N9    . DG  G 2  ? 0.4798 0.3662 0.3681 0.0681  -0.0386 0.0243  2   DG  G N9    
2551 C C8    . DG  G 2  ? 0.4743 0.3797 0.3878 0.0694  -0.0363 0.0099  2   DG  G C8    
2552 N N7    . DG  G 2  ? 0.4568 0.3599 0.3744 0.0613  -0.0274 0.0120  2   DG  G N7    
2553 C C5    . DG  G 2  ? 0.4544 0.3367 0.3470 0.0568  -0.0312 0.0241  2   DG  G C5    
2554 C C6    . DG  G 2  ? 0.4557 0.3231 0.3339 0.0539  -0.0301 0.0280  2   DG  G C6    
2555 O O6    . DG  G 2  ? 0.4841 0.3497 0.3590 0.0566  -0.0201 0.0259  2   DG  G O6    
2556 N N1    . DG  G 2  ? 0.4621 0.3125 0.3293 0.0500  -0.0410 0.0346  2   DG  G N1    
2557 C C2    . DG  G 2  ? 0.4771 0.3237 0.3490 0.0466  -0.0442 0.0413  2   DG  G C2    
2558 N N2    . DG  G 2  ? 0.4790 0.3093 0.3546 0.0400  -0.0514 0.0461  2   DG  G N2    
2559 N N3    . DG  G 2  ? 0.4532 0.3087 0.3269 0.0519  -0.0398 0.0423  2   DG  G N3    
2560 C C4    . DG  G 2  ? 0.4647 0.3384 0.3471 0.0580  -0.0371 0.0314  2   DG  G C4    
2561 P P     . DG  G 3  ? 0.6240 0.4675 0.4183 0.1278  -0.0286 0.0524  3   DG  G P     
2562 O OP1   . DG  G 3  ? 0.6521 0.4584 0.4037 0.1429  -0.0130 0.0723  3   DG  G OP1   
2563 O OP2   . DG  G 3  ? 0.5967 0.4630 0.4016 0.1406  -0.0428 0.0322  3   DG  G OP2   
2564 O "O5'" . DG  G 3  ? 0.5729 0.4307 0.4042 0.0964  -0.0176 0.0639  3   DG  G "O5'" 
2565 C "C5'" . DG  G 3  ? 0.5742 0.4136 0.4112 0.0813  -0.0054 0.0810  3   DG  G "C5'" 
2566 C "C4'" . DG  G 3  ? 0.5244 0.3823 0.3998 0.0580  -0.0043 0.0829  3   DG  G "C4'" 
2567 O "O4'" . DG  G 3  ? 0.4873 0.3575 0.3735 0.0509  -0.0183 0.0684  3   DG  G "O4'" 
2568 C "C3'" . DG  G 3  ? 0.5176 0.3954 0.4025 0.0594  0.0006  0.0839  3   DG  G "C3'" 
2569 O "O3'" . DG  G 3  ? 0.5249 0.4086 0.4411 0.0429  0.0086  0.0929  3   DG  G "O3'" 
2570 C "C2'" . DG  G 3  ? 0.4735 0.3709 0.3694 0.0566  -0.0133 0.0673  3   DG  G "C2'" 
2571 C "C1'" . DG  G 3  ? 0.4659 0.3564 0.3694 0.0446  -0.0194 0.0645  3   DG  G "C1'" 
2572 N N9    . DG  G 3  ? 0.4580 0.3563 0.3656 0.0439  -0.0257 0.0519  3   DG  G N9    
2573 C C8    . DG  G 3  ? 0.4384 0.3497 0.3530 0.0515  -0.0277 0.0394  3   DG  G C8    
2574 N N7    . DG  G 3  ? 0.4250 0.3396 0.3511 0.0463  -0.0254 0.0328  3   DG  G N7    
2575 C C5    . DG  G 3  ? 0.4304 0.3308 0.3449 0.0391  -0.0251 0.0408  3   DG  G C5    
2576 C C6    . DG  G 3  ? 0.4358 0.3265 0.3431 0.0376  -0.0215 0.0397  3   DG  G C6    
2577 O O6    . DG  G 3  ? 0.4396 0.3325 0.3532 0.0393  -0.0110 0.0350  3   DG  G O6    
2578 N N1    . DG  G 3  ? 0.4441 0.3187 0.3369 0.0358  -0.0299 0.0444  3   DG  G N1    
2579 C C2    . DG  G 3  ? 0.4526 0.3248 0.3526 0.0309  -0.0377 0.0493  3   DG  G C2    
2580 N N2    . DG  G 3  ? 0.4748 0.3327 0.3723 0.0296  -0.0494 0.0477  3   DG  G N2    
2581 N N3    . DG  G 3  ? 0.4549 0.3353 0.3644 0.0298  -0.0334 0.0544  3   DG  G N3    
2582 C C4    . DG  G 3  ? 0.4446 0.3372 0.3539 0.0363  -0.0283 0.0500  3   DG  G C4    
2583 P P     . DA  G 4  ? 0.5360 0.4223 0.4594 0.0471  0.0301  0.1077  4   DA  G P     
2584 O OP1   . DA  G 4  ? 0.5629 0.4218 0.4543 0.0629  0.0481  0.1218  4   DA  G OP1   
2585 O OP2   . DA  G 4  ? 0.5351 0.4438 0.4585 0.0532  0.0240  0.0997  4   DA  G OP2   
2586 O "O5'" . DA  G 4  ? 0.5486 0.4408 0.5243 0.0247  0.0333  0.1112  4   DA  G "O5'" 
2587 C "C5'" . DA  G 4  ? 0.5516 0.4262 0.5444 0.0130  0.0287  0.1108  4   DA  G "C5'" 
2588 C "C4'" . DA  G 4  ? 0.5297 0.4172 0.5620 -0.0016 0.0080  0.0965  4   DA  G "C4'" 
2589 O "O4'" . DA  G 4  ? 0.5030 0.3944 0.5072 0.0036  -0.0128 0.0829  4   DA  G "O4'" 
2590 C "C3'" . DA  G 4  ? 0.5310 0.4434 0.6051 -0.0076 0.0105  0.0944  4   DA  G "C3'" 
2591 O "O3'" . DA  G 4  ? 0.5356 0.4497 0.6609 -0.0202 -0.0048 0.0825  4   DA  G "O3'" 
2592 C "C2'" . DA  G 4  ? 0.5089 0.4351 0.5532 0.0012  -0.0030 0.0854  4   DA  G "C2'" 
2593 C "C1'" . DA  G 4  ? 0.4879 0.3989 0.5003 0.0041  -0.0199 0.0764  4   DA  G "C1'" 
2594 N N9    . DA  G 4  ? 0.4807 0.3943 0.4581 0.0135  -0.0217 0.0730  4   DA  G N9    
2595 C C8    . DA  G 4  ? 0.4663 0.3873 0.4276 0.0228  -0.0125 0.0761  4   DA  G C8    
2596 N N7    . DA  G 4  ? 0.4726 0.3956 0.4189 0.0276  -0.0183 0.0676  4   DA  G N7    
2597 C C5    . DA  G 4  ? 0.4622 0.3758 0.4063 0.0224  -0.0269 0.0626  4   DA  G C5    
2598 C C6    . DA  G 4  ? 0.4674 0.3747 0.3983 0.0247  -0.0285 0.0562  4   DA  G C6    
2599 N N6    . DA  G 4  ? 0.4346 0.3487 0.3666 0.0282  -0.0227 0.0515  4   DA  G N6    
2600 N N1    . DA  G 4  ? 0.4985 0.3908 0.4182 0.0250  -0.0355 0.0538  4   DA  G N1    
2601 C C2    . DA  G 4  ? 0.5001 0.3865 0.4287 0.0222  -0.0465 0.0531  4   DA  G C2    
2602 N N3    . DA  G 4  ? 0.4976 0.3920 0.4528 0.0155  -0.0460 0.0571  4   DA  G N3    
2603 C C4    . DA  G 4  ? 0.4859 0.3931 0.4446 0.0160  -0.0327 0.0641  4   DA  G C4    
2604 P P     . DG  G 5  ? 0.5608 0.5018 0.7417 -0.0254 -0.0144 0.0705  5   DG  G P     
2605 O OP1   . DG  G 5  ? 0.5293 0.4688 0.7791 -0.0387 -0.0218 0.0605  5   DG  G OP1   
2606 O OP2   . DG  G 5  ? 0.5309 0.4917 0.7071 -0.0193 0.0067  0.0815  5   DG  G OP2   
2607 O "O5'" . DG  G 5  ? 0.5456 0.4869 0.6900 -0.0147 -0.0461 0.0532  5   DG  G "O5'" 
2608 C "C5'" . DG  G 5  ? 0.5134 0.4361 0.6452 -0.0109 -0.0737 0.0376  5   DG  G "C5'" 
2609 C "C4'" . DG  G 5  ? 0.4949 0.4144 0.5846 0.0040  -0.0926 0.0275  5   DG  G "C4'" 
2610 O "O4'" . DG  G 5  ? 0.4393 0.3557 0.4800 0.0082  -0.0749 0.0408  5   DG  G "O4'" 
2611 C "C3'" . DG  G 5  ? 0.4755 0.4151 0.5922 0.0084  -0.1017 0.0186  5   DG  G "C3'" 
2612 O "O3'" . DG  G 5  ? 0.5182 0.4457 0.6271 0.0234  -0.1355 -0.0029 5   DG  G "O3'" 
2613 C "C2'" . DG  G 5  ? 0.4434 0.3882 0.5205 0.0132  -0.0843 0.0316  5   DG  G "C2'" 
2614 C "C1'" . DG  G 5  ? 0.4357 0.3591 0.4611 0.0163  -0.0776 0.0388  5   DG  G "C1'" 
2615 N N9    . DG  G 5  ? 0.4115 0.3396 0.4133 0.0166  -0.0578 0.0505  5   DG  G N9    
2616 C C8    . DG  G 5  ? 0.3774 0.3209 0.3925 0.0132  -0.0401 0.0602  5   DG  G C8    
2617 N N7    . DG  G 5  ? 0.3642 0.3071 0.3536 0.0185  -0.0320 0.0634  5   DG  G N7    
2618 C C5    . DG  G 5  ? 0.3803 0.3081 0.3453 0.0216  -0.0393 0.0580  5   DG  G C5    
2619 C C6    . DG  G 5  ? 0.3991 0.3211 0.3453 0.0252  -0.0328 0.0570  5   DG  G C6    
2620 O O6    . DG  G 5  ? 0.3981 0.3290 0.3473 0.0273  -0.0259 0.0563  5   DG  G O6    
2621 N N1    . DG  G 5  ? 0.4076 0.3094 0.3324 0.0286  -0.0346 0.0549  5   DG  G N1    
2622 C C2    . DG  G 5  ? 0.4359 0.3224 0.3479 0.0334  -0.0472 0.0517  5   DG  G C2    
2623 N N2    . DG  G 5  ? 0.4664 0.3275 0.3446 0.0430  -0.0443 0.0516  5   DG  G N2    
2624 N N3    . DG  G 5  ? 0.4321 0.3256 0.3652 0.0311  -0.0610 0.0473  5   DG  G N3    
2625 C C4    . DG  G 5  ? 0.4192 0.3349 0.3833 0.0227  -0.0538 0.0518  5   DG  G C4    
2626 P P     . DT  G 6  ? 0.5441 0.4834 0.6643 0.0370  -0.1549 -0.0176 6   DT  G P     
2627 O OP1   . DT  G 6  ? 0.5921 0.5244 0.7397 0.0494  -0.1941 -0.0463 6   DT  G OP1   
2628 O OP2   . DT  G 6  ? 0.5793 0.5511 0.7433 0.0254  -0.1331 -0.0080 6   DT  G OP2   
2629 O "O5'" . DT  G 6  ? 0.5644 0.4776 0.6009 0.0545  -0.1518 -0.0093 6   DT  G "O5'" 
2630 C "C5'" . DT  G 6  ? 0.5907 0.4676 0.5691 0.0700  -0.1627 -0.0127 6   DT  G "C5'" 
2631 C "C4'" . DT  G 6  ? 0.5934 0.4438 0.5018 0.0849  -0.1501 -0.0013 6   DT  G "C4'" 
2632 O "O4'" . DT  G 6  ? 0.5467 0.4096 0.4565 0.0674  -0.1176 0.0181  6   DT  G "O4'" 
2633 C "C3'" . DT  G 6  ? 0.6196 0.4632 0.5097 0.1020  -0.1605 -0.0064 6   DT  G "C3'" 
2634 O "O3'" . DT  G 6  ? 0.6896 0.4854 0.5012 0.1296  -0.1638 -0.0051 6   DT  G "O3'" 
2635 C "C2'" . DT  G 6  ? 0.5698 0.4348 0.4752 0.0852  -0.1324 0.0102  6   DT  G "C2'" 
2636 C "C1'" . DT  G 6  ? 0.5445 0.4050 0.4363 0.0721  -0.1071 0.0251  6   DT  G "C1'" 
2637 N N1    . DT  G 6  ? 0.5062 0.3944 0.4282 0.0541  -0.0855 0.0359  6   DT  G N1    
2638 C C2    . DT  G 6  ? 0.5033 0.3832 0.4050 0.0512  -0.0649 0.0460  6   DT  G C2    
2639 O O2    . DT  G 6  ? 0.5663 0.4178 0.4311 0.0596  -0.0571 0.0498  6   DT  G O2    
2640 N N3    . DT  G 6  ? 0.4662 0.3703 0.3938 0.0412  -0.0531 0.0503  6   DT  G N3    
2641 C C4    . DT  G 6  ? 0.4414 0.3726 0.4031 0.0355  -0.0538 0.0501  6   DT  G C4    
2642 O O4    . DT  G 6  ? 0.4335 0.3783 0.4034 0.0332  -0.0427 0.0541  6   DT  G O4    
2643 C C5    . DT  G 6  ? 0.4540 0.3933 0.4415 0.0349  -0.0676 0.0434  6   DT  G C5    
2644 C C7    . DT  G 6  ? 0.4434 0.4103 0.4761 0.0275  -0.0600 0.0458  6   DT  G C7    
2645 C C6    . DT  G 6  ? 0.4696 0.3893 0.4409 0.0435  -0.0858 0.0343  6   DT  G C6    
2646 P P     . DG  G 7  ? 0.7384 0.5052 0.4995 0.1540  -0.1661 -0.0031 7   DG  G P     
2647 O OP1   . DG  G 7  ? 0.8383 0.5564 0.5311 0.1929  -0.1914 -0.0161 7   DG  G OP1   
2648 O OP2   . DG  G 7  ? 0.7098 0.5111 0.5217 0.1466  -0.1760 -0.0108 7   DG  G OP2   
2649 O "O5'" . DG  G 7  ? 0.7476 0.4972 0.4770 0.1436  -0.1231 0.0231  7   DG  G "O5'" 
2650 C "C5'" . DG  G 7  ? 0.7656 0.4959 0.4672 0.1413  -0.1009 0.0344  7   DG  G "C5'" 
2651 C "C4'" . DG  G 7  ? 0.7716 0.4822 0.4519 0.1358  -0.0616 0.0550  7   DG  G "C4'" 
2652 O "O4'" . DG  G 7  ? 0.6959 0.4483 0.4369 0.1066  -0.0483 0.0589  7   DG  G "O4'" 
2653 C "C3'" . DG  G 7  ? 0.8204 0.4878 0.4498 0.1571  -0.0525 0.0634  7   DG  G "C3'" 
2654 O "O3'" . DG  G 7  ? 0.8683 0.5023 0.4688 0.1574  -0.0110 0.0830  7   DG  G "O3'" 
2655 C "C2'" . DG  G 7  ? 0.7628 0.4650 0.4431 0.1392  -0.0563 0.0611  7   DG  G "C2'" 
2656 C "C1'" . DG  G 7  ? 0.6867 0.4347 0.4293 0.1076  -0.0430 0.0629  7   DG  G "C1'" 
2657 N N9    . DG  G 7  ? 0.6144 0.4099 0.4135 0.0911  -0.0555 0.0550  7   DG  G N9    
2658 C C8    . DG  G 7  ? 0.5922 0.4153 0.4199 0.0910  -0.0806 0.0424  7   DG  G C8    
2659 N N7    . DG  G 7  ? 0.5460 0.4071 0.4206 0.0758  -0.0782 0.0416  7   DG  G N7    
2660 C C5    . DG  G 7  ? 0.5198 0.3789 0.3944 0.0674  -0.0567 0.0507  7   DG  G C5    
2661 C C6    . DG  G 7  ? 0.4674 0.3541 0.3742 0.0569  -0.0488 0.0512  7   DG  G C6    
2662 O O6    . DG  G 7  ? 0.4480 0.3646 0.3834 0.0534  -0.0534 0.0482  7   DG  G O6    
2663 N N1    . DG  G 7  ? 0.4719 0.3462 0.3766 0.0527  -0.0326 0.0550  7   DG  G N1    
2664 C C2    . DG  G 7  ? 0.5027 0.3429 0.3829 0.0550  -0.0178 0.0614  7   DG  G C2    
2665 N N2    . DG  G 7  ? 0.4827 0.3183 0.3823 0.0475  -0.0010 0.0622  7   DG  G N2    
2666 N N3    . DG  G 7  ? 0.5517 0.3615 0.3918 0.0670  -0.0190 0.0656  7   DG  G N3    
2667 C C4    . DG  G 7  ? 0.5491 0.3706 0.3861 0.0738  -0.0420 0.0583  7   DG  G C4    
2668 P P     . DT  G 8  ? 0.9676 0.5358 0.5016 0.1811  0.0180  0.1015  8   DT  G P     
2669 O OP1   . DT  G 8  ? 1.0528 0.5857 0.5518 0.1885  0.0568  0.1178  8   DT  G OP1   
2670 O OP2   . DT  G 8  ? 0.9893 0.5261 0.4685 0.2143  -0.0131 0.0927  8   DT  G OP2   
2671 O "O5'" . DT  G 8  ? 0.9429 0.5307 0.5328 0.1544  0.0380  0.1085  8   DT  G "O5'" 
2672 C "C5'" . DT  G 8  ? 0.8960 0.5269 0.5599 0.1207  0.0558  0.1084  8   DT  G "C5'" 
2673 C "C4'" . DT  G 8  ? 0.8706 0.5123 0.5783 0.1048  0.0638  0.1090  8   DT  G "C4'" 
2674 O "O4'" . DT  G 8  ? 0.8061 0.4990 0.5571 0.0935  0.0315  0.0931  8   DT  G "O4'" 
2675 C "C3'" . DT  G 8  ? 0.9394 0.5274 0.6008 0.1235  0.0743  0.1202  8   DT  G "C3'" 
2676 O "O3'" . DT  G 8  ? 0.9693 0.5410 0.6665 0.1074  0.1123  0.1310  8   DT  G "O3'" 
2677 C "C2'" . DT  G 8  ? 0.8908 0.5065 0.5649 0.1263  0.0366  0.1055  8   DT  G "C2'" 
2678 C "C1'" . DT  G 8  ? 0.7998 0.4823 0.5481 0.0992  0.0243  0.0922  8   DT  G "C1'" 
2679 N N1    . DT  G 8  ? 0.7198 0.4470 0.4922 0.0983  -0.0098 0.0770  8   DT  G N1    
2680 C C2    . DT  G 8  ? 0.6429 0.4113 0.4685 0.0818  -0.0137 0.0694  8   DT  G C2    
2681 O O2    . DT  G 8  ? 0.6418 0.4103 0.4961 0.0702  0.0022  0.0704  8   DT  G O2    
2682 N N3    . DT  G 8  ? 0.5848 0.3918 0.4304 0.0827  -0.0373 0.0590  8   DT  G N3    
2683 C C4    . DT  G 8  ? 0.6020 0.4157 0.4355 0.0938  -0.0582 0.0526  8   DT  G C4    
2684 O O4    . DT  G 8  ? 0.5907 0.4424 0.4576 0.0908  -0.0722 0.0440  8   DT  G O4    
2685 C C5    . DT  G 8  ? 0.6493 0.4209 0.4311 0.1114  -0.0610 0.0557  8   DT  G C5    
2686 C C7    . DT  G 8  ? 0.6344 0.4106 0.4070 0.1277  -0.0910 0.0421  8   DT  G C7    
2687 C C6    . DT  G 8  ? 0.7093 0.4383 0.4565 0.1145  -0.0358 0.0691  8   DT  G C6    
2688 P P     . DG  G 9  ? 1.0635 0.5608 0.7121 0.1244  0.1451  0.1516  9   DG  G P     
2689 O OP1   . DG  G 9  ? 1.1110 0.5769 0.7692 0.1175  0.1980  0.1697  9   DG  G OP1   
2690 O OP2   . DG  G 9  ? 1.1093 0.5673 0.6704 0.1606  0.1206  0.1530  9   DG  G OP2   
2691 O "O5'" . DG  G 9  ? 1.0389 0.5533 0.7466 0.1065  0.1384  0.1432  9   DG  G "O5'" 
2692 C "C5'" . DG  G 9  ? 0.9592 0.5227 0.7606 0.0756  0.1403  0.1297  9   DG  G "C5'" 
2693 C "C4'" . DG  G 9  ? 0.9276 0.5068 0.7578 0.0720  0.1155  0.1166  9   DG  G "C4'" 
2694 O "O4'" . DG  G 9  ? 0.8428 0.4697 0.6657 0.0780  0.0727  0.1011  9   DG  G "O4'" 
2695 C "C3'" . DG  G 9  ? 0.9799 0.4965 0.7569 0.0915  0.1238  0.1298  9   DG  G "C3'" 
2696 O "O3'" . DG  G 9  ? 1.0011 0.5221 0.8297 0.0800  0.1190  0.1198  9   DG  G "O3'" 
2697 C "C2'" . DG  G 9  ? 0.9498 0.4781 0.6707 0.1150  0.0835  0.1222  9   DG  G "C2'" 
2698 C "C1'" . DG  G 9  ? 0.8535 0.4589 0.6368 0.0969  0.0543  0.1008  9   DG  G "C1'" 
2699 N N9    . DG  G 9  ? 0.7899 0.4314 0.5550 0.1080  0.0194  0.0898  9   DG  G N9    
2700 C C8    . DG  G 9  ? 0.8126 0.4364 0.5207 0.1306  0.0046  0.0914  9   DG  G C8    
2701 N N7    . DG  G 9  ? 0.7567 0.4273 0.4828 0.1321  -0.0265 0.0762  9   DG  G N7    
2702 C C5    . DG  G 9  ? 0.6645 0.3811 0.4503 0.1127  -0.0293 0.0678  9   DG  G C5    
2703 C C6    . DG  G 9  ? 0.6035 0.3751 0.4271 0.1078  -0.0503 0.0545  9   DG  G C6    
2704 O O6    . DG  G 9  ? 0.5986 0.3945 0.4243 0.1150  -0.0699 0.0467  9   DG  G O6    
2705 N N1    . DG  G 9  ? 0.5614 0.3580 0.4263 0.0952  -0.0459 0.0495  9   DG  G N1    
2706 C C2    . DG  G 9  ? 0.5763 0.3519 0.4572 0.0860  -0.0286 0.0519  9   DG  G C2    
2707 N N2    . DG  G 9  ? 0.5413 0.3455 0.4629 0.0794  -0.0342 0.0403  9   DG  G N2    
2708 N N3    . DG  G 9  ? 0.6158 0.3436 0.4763 0.0854  -0.0063 0.0640  9   DG  G N3    
2709 C C4    . DG  G 9  ? 0.6782 0.3773 0.4863 0.0996  -0.0054 0.0736  9   DG  G C4    
2710 P P     . DG  G 10 ? 1.0726 0.5339 0.9280 0.0711  0.1621  0.1337  10  DG  G P     
2711 O OP1   . DG  G 10 ? 1.0725 0.5308 0.9708 0.0532  0.2035  0.1425  10  DG  G OP1   
2712 O OP2   . DG  G 10 ? 1.1337 0.5231 0.9056 0.0983  0.1707  0.1526  10  DG  G OP2   
2713 O "O5'" . DG  G 10 ? 1.0123 0.5141 0.9502 0.0542  0.1361  0.1074  10  DG  G "O5'" 
2714 C "C5'" . DG  G 10 ? 0.9126 0.4868 0.9172 0.0384  0.1110  0.0822  10  DG  G "C5'" 
2715 C "C4'" . DG  G 10 ? 0.8493 0.4606 0.8715 0.0443  0.0682  0.0587  10  DG  G "C4'" 
2716 O "O4'" . DG  G 10 ? 0.8135 0.4516 0.7783 0.0617  0.0398  0.0587  10  DG  G "O4'" 
2717 C "C3'" . DG  G 10 ? 0.8865 0.4580 0.9122 0.0504  0.0655  0.0564  10  DG  G "C3'" 
2718 O "O3'" . DG  G 10 ? 0.8224 0.4321 0.9117 0.0457  0.0363  0.0268  10  DG  G "O3'" 
2719 C "C2'" . DG  G 10 ? 0.9005 0.4526 0.8394 0.0759  0.0504  0.0682  10  DG  G "C2'" 
2720 C "C1'" . DG  G 10 ? 0.8419 0.4545 0.7656 0.0802  0.0251  0.0603  10  DG  G "C1'" 
2721 N N9    . DG  G 10 ? 0.8510 0.4520 0.7032 0.0991  0.0193  0.0728  10  DG  G N9    
2722 C C8    . DG  G 10 ? 0.9128 0.4562 0.7042 0.1120  0.0415  0.0937  10  DG  G C8    
2723 N N7    . DG  G 10 ? 0.9182 0.4669 0.6566 0.1319  0.0216  0.0940  10  DG  G N7    
2724 C C5    . DG  G 10 ? 0.8341 0.4497 0.6085 0.1276  -0.0100 0.0746  10  DG  G C5    
2725 C C6    . DG  G 10 ? 0.7875 0.4401 0.5477 0.1399  -0.0387 0.0648  10  DG  G C6    
2726 O O6    . DG  G 10 ? 0.7858 0.4216 0.4999 0.1589  -0.0492 0.0667  10  DG  G O6    
2727 N N1    . DG  G 10 ? 0.7108 0.4242 0.5204 0.1304  -0.0555 0.0499  10  DG  G N1    
2728 C C2    . DG  G 10 ? 0.6930 0.4262 0.5481 0.1168  -0.0516 0.0426  10  DG  G C2    
2729 N N2    . DG  G 10 ? 0.6576 0.4431 0.5417 0.1166  -0.0676 0.0301  10  DG  G N2    
2730 N N3    . DG  G 10 ? 0.7211 0.4233 0.5942 0.1061  -0.0328 0.0462  10  DG  G N3    
2731 C C4    . DG  G 10 ? 0.7906 0.4359 0.6266 0.1098  -0.0103 0.0633  10  DG  G C4    
2732 P P     . DG  G 11 ? 0.8689 0.4480 0.9779 0.0517  0.0242  0.0152  11  DG  G P     
2733 O OP1   . DG  G 11 ? 0.8714 0.4703 1.0758 0.0370  0.0148  -0.0133 11  DG  G OP1   
2734 O OP2   . DG  G 11 ? 0.9246 0.4297 0.9847 0.0578  0.0542  0.0423  11  DG  G OP2   
2735 O "O5'" . DG  G 11 ? 0.8129 0.4312 0.8824 0.0747  -0.0190 0.0009  11  DG  G "O5'" 
2736 C "C5'" . DG  G 11 ? 0.7165 0.3973 0.7800 0.0798  -0.0408 -0.0093 11  DG  G "C5'" 
2737 C "C4'" . DG  G 11 ? 0.6876 0.3915 0.7096 0.1031  -0.0691 -0.0155 11  DG  G "C4'" 
2738 O "O4'" . DG  G 11 ? 0.6676 0.3664 0.6313 0.1113  -0.0633 0.0039  11  DG  G "O4'" 
2739 C "C3'" . DG  G 11 ? 0.7098 0.3845 0.7296 0.1169  -0.0836 -0.0254 11  DG  G "C3'" 
2740 O "O3'" . DG  G 11 ? 0.6922 0.4087 0.7103 0.1361  -0.1140 -0.0453 11  DG  G "O3'" 
2741 C "C2'" . DG  G 11 ? 0.7327 0.3654 0.6914 0.1272  -0.0726 -0.0034 11  DG  G "C2'" 
2742 C "C1'" . DG  G 11 ? 0.6988 0.3674 0.6250 0.1296  -0.0724 0.0066  11  DG  G "C1'" 
2743 N N9    . DG  G 11 ? 0.7400 0.3712 0.6132 0.1351  -0.0571 0.0277  11  DG  G N9    
2744 C C8    . DG  G 11 ? 0.7884 0.3554 0.6392 0.1315  -0.0283 0.0467  11  DG  G C8    
2745 N N7    . DG  G 11 ? 0.8121 0.3560 0.6031 0.1452  -0.0230 0.0616  11  DG  G N7    
2746 C C5    . DG  G 11 ? 0.7573 0.3583 0.5447 0.1540  -0.0512 0.0495  11  DG  G C5    
2747 C C6    . DG  G 11 ? 0.7664 0.3749 0.5112 0.1707  -0.0646 0.0515  11  DG  G C6    
2748 O O6    . DG  G 11 ? 0.8255 0.3883 0.5143 0.1860  -0.0574 0.0636  11  DG  G O6    
2749 N N1    . DG  G 11 ? 0.7089 0.3839 0.4830 0.1713  -0.0883 0.0359  11  DG  G N1    
2750 C C2    . DG  G 11 ? 0.6692 0.3911 0.4910 0.1625  -0.0960 0.0232  11  DG  G C2    
2751 N N2    . DG  G 11 ? 0.6453 0.4228 0.4865 0.1666  -0.1111 0.0133  11  DG  G N2    
2752 N N3    . DG  G 11 ? 0.6633 0.3765 0.5137 0.1521  -0.0883 0.0196  11  DG  G N3    
2753 C C4    . DG  G 11 ? 0.7143 0.3685 0.5516 0.1468  -0.0678 0.0315  11  DG  G C4    
2754 P P     . DC  G 12 ? 0.7578 0.4557 0.7756 0.1556  -0.1368 -0.0625 12  DC  G P     
2755 O OP1   . DC  G 12 ? 0.7960 0.5380 0.8288 0.1722  -0.1630 -0.0873 12  DC  G OP1   
2756 O OP2   . DC  G 12 ? 0.8071 0.4456 0.8537 0.1429  -0.1238 -0.0611 12  DC  G OP2   
2757 O "O5'" . DC  G 12 ? 0.7756 0.4762 0.7340 0.1760  -0.1428 -0.0509 12  DC  G "O5'" 
2758 C "C5'" . DC  G 12 ? 0.7356 0.4908 0.6764 0.1853  -0.1483 -0.0496 12  DC  G "C5'" 
2759 C "C4'" . DC  G 12 ? 0.7456 0.4979 0.6454 0.1961  -0.1475 -0.0366 12  DC  G "C4'" 
2760 O "O4'" . DC  G 12 ? 0.7489 0.4657 0.6295 0.1828  -0.1286 -0.0174 12  DC  G "O4'" 
2761 C "C3'" . DC  G 12 ? 0.7868 0.5085 0.6623 0.2174  -0.1622 -0.0424 12  DC  G "C3'" 
2762 O "O3'" . DC  G 12 ? 0.8253 0.5880 0.7079 0.2379  -0.1809 -0.0599 12  DC  G "O3'" 
2763 C "C2'" . DC  G 12 ? 0.7869 0.4890 0.6217 0.2239  -0.1580 -0.0277 12  DC  G "C2'" 
2764 C "C1'" . DC  G 12 ? 0.7543 0.4583 0.5932 0.2016  -0.1371 -0.0125 12  DC  G "C1'" 
2765 N N1    . DC  G 12 ? 0.7784 0.4202 0.5800 0.1989  -0.1198 0.0057  12  DC  G N1    
2766 C C2    . DC  G 12 ? 0.7640 0.4023 0.5263 0.2104  -0.1229 0.0133  12  DC  G C2    
2767 O O2    . DC  G 12 ? 0.7193 0.4103 0.4929 0.2174  -0.1396 0.0034  12  DC  G O2    
2768 N N3    . DC  G 12 ? 0.8090 0.3841 0.5233 0.2156  -0.1067 0.0305  12  DC  G N3    
2769 C C4    . DC  G 12 ? 0.8536 0.3697 0.5633 0.2069  -0.0819 0.0433  12  DC  G C4    
2770 N N4    . DC  G 12 ? 0.9178 0.3661 0.5717 0.2164  -0.0599 0.0638  12  DC  G N4    
2771 C C5    . DC  G 12 ? 0.8520 0.3740 0.6164 0.1901  -0.0777 0.0345  12  DC  G C5    
2772 C C6    . DC  G 12 ? 0.8064 0.3913 0.6119 0.1888  -0.1007 0.0140  12  DC  G C6    
2773 O "O5'" . DG  H 1  ? 1.0155 0.6830 0.9366 0.3576  -0.2475 0.0036  1   DG  H "O5'" 
2774 C "C5'" . DG  H 1  ? 0.9358 0.6404 0.8802 0.3367  -0.2473 -0.0045 1   DG  H "C5'" 
2775 C "C4'" . DG  H 1  ? 0.8551 0.6302 0.8950 0.3018  -0.2232 -0.0142 1   DG  H "C4'" 
2776 O "O4'" . DG  H 1  ? 0.8148 0.5821 0.8482 0.2826  -0.1822 0.0009  1   DG  H "O4'" 
2777 C "C3'" . DG  H 1  ? 0.8050 0.6148 0.8685 0.2756  -0.2124 -0.0174 1   DG  H "C3'" 
2778 O "O3'" . DG  H 1  ? 0.7877 0.6619 0.9528 0.2623  -0.2115 -0.0348 1   DG  H "O3'" 
2779 C "C2'" . DG  H 1  ? 0.7657 0.5572 0.7878 0.2508  -0.1682 0.0039  1   DG  H "C2'" 
2780 C "C1'" . DG  H 1  ? 0.7502 0.5338 0.7830 0.2514  -0.1508 0.0087  1   DG  H "C1'" 
2781 N N9    . DG  H 1  ? 0.7573 0.4936 0.7353 0.2442  -0.1228 0.0285  1   DG  H N9    
2782 C C8    . DG  H 1  ? 0.8137 0.4884 0.7162 0.2574  -0.1188 0.0470  1   DG  H C8    
2783 N N7    . DG  H 1  ? 0.8120 0.4579 0.6987 0.2428  -0.0851 0.0621  1   DG  H N7    
2784 C C5    . DG  H 1  ? 0.7469 0.4379 0.6961 0.2212  -0.0734 0.0493  1   DG  H C5    
2785 C C6    . DG  H 1  ? 0.7219 0.4085 0.6914 0.2017  -0.0466 0.0503  1   DG  H C6    
2786 O O6    . DG  H 1  ? 0.7370 0.3818 0.6877 0.1948  -0.0239 0.0640  1   DG  H O6    
2787 N N1    . DG  H 1  ? 0.6710 0.4061 0.6917 0.1925  -0.0472 0.0319  1   DG  H N1    
2788 C C2    . DG  H 1  ? 0.6421 0.4235 0.6960 0.1985  -0.0621 0.0189  1   DG  H C2    
2789 N N2    . DG  H 1  ? 0.6072 0.4236 0.6983 0.1927  -0.0524 0.0057  1   DG  H N2    
2790 N N3    . DG  H 1  ? 0.6505 0.4407 0.7039 0.2119  -0.0844 0.0177  1   DG  H N3    
2791 C C4    . DG  H 1  ? 0.7144 0.4585 0.7126 0.2235  -0.0930 0.0310  1   DG  H C4    
2792 P P     . DC  H 2  ? 0.7626 0.6817 0.9780 0.2330  -0.1929 -0.0383 2   DC  H P     
2793 O OP1   . DC  H 2  ? 0.7491 0.7161 1.0674 0.2373  -0.2143 -0.0613 2   DC  H OP1   
2794 O OP2   . DC  H 2  ? 0.7693 0.6582 0.9152 0.2263  -0.1916 -0.0283 2   DC  H OP2   
2795 O "O5'" . DC  H 2  ? 0.7305 0.6665 0.9548 0.2098  -0.1446 -0.0251 2   DC  H "O5'" 
2796 C "C5'" . DC  H 2  ? 0.7285 0.6930 1.0097 0.2129  -0.1300 -0.0307 2   DC  H "C5'" 
2797 C "C4'" . DC  H 2  ? 0.6968 0.6719 0.9702 0.1948  -0.0881 -0.0209 2   DC  H "C4'" 
2798 O "O4'" . DC  H 2  ? 0.7130 0.6472 0.9149 0.1913  -0.0803 -0.0099 2   DC  H "O4'" 
2799 C "C3'" . DC  H 2  ? 0.6561 0.6555 0.9462 0.1746  -0.0678 -0.0168 2   DC  H "C3'" 
2800 O "O3'" . DC  H 2  ? 0.6650 0.6905 0.9887 0.1722  -0.0340 -0.0155 2   DC  H "O3'" 
2801 C "C2'" . DC  H 2  ? 0.6373 0.6051 0.8547 0.1629  -0.0621 -0.0055 2   DC  H "C2'" 
2802 C "C1'" . DC  H 2  ? 0.6480 0.5845 0.8268 0.1714  -0.0599 -0.0024 2   DC  H "C1'" 
2803 N N1    . DC  H 2  ? 0.6324 0.5258 0.7506 0.1683  -0.0626 0.0075  2   DC  H N1    
2804 C C2    . DC  H 2  ? 0.5916 0.4673 0.6880 0.1602  -0.0441 0.0110  2   DC  H C2    
2805 O O2    . DC  H 2  ? 0.5752 0.4704 0.6919 0.1584  -0.0308 0.0035  2   DC  H O2    
2806 N N3    . DC  H 2  ? 0.5938 0.4301 0.6501 0.1559  -0.0399 0.0214  2   DC  H N3    
2807 C C4    . DC  H 2  ? 0.6301 0.4388 0.6514 0.1642  -0.0511 0.0310  2   DC  H C4    
2808 N N4    . DC  H 2  ? 0.6628 0.4281 0.6439 0.1620  -0.0374 0.0449  2   DC  H N4    
2809 C C5    . DC  H 2  ? 0.6491 0.4715 0.6775 0.1772  -0.0764 0.0252  2   DC  H C5    
2810 C C6    . DC  H 2  ? 0.6360 0.5031 0.7215 0.1771  -0.0829 0.0120  2   DC  H C6    
2811 P P     . DC  H 3  ? 0.6618 0.7148 1.0197 0.1585  -0.0050 -0.0098 3   DC  H P     
2812 O OP1   . DC  H 3  ? 0.6563 0.7392 1.0836 0.1675  0.0200  -0.0124 3   DC  H OP1   
2813 O OP2   . DC  H 3  ? 0.6376 0.6908 1.0018 0.1468  -0.0247 -0.0110 3   DC  H OP2   
2814 O "O5'" . DC  H 3  ? 0.6361 0.6705 0.9254 0.1524  0.0179  -0.0002 3   DC  H "O5'" 
2815 C "C5'" . DC  H 3  ? 0.6384 0.6538 0.8865 0.1626  0.0232  -0.0028 3   DC  H "C5'" 
2816 C "C4'" . DC  H 3  ? 0.6370 0.6340 0.8289 0.1541  0.0290  0.0003  3   DC  H "C4'" 
2817 O "O4'" . DC  H 3  ? 0.6079 0.5793 0.7696 0.1452  0.0072  0.0011  3   DC  H "O4'" 
2818 C "C3'" . DC  H 3  ? 0.6552 0.6650 0.8480 0.1433  0.0440  0.0085  3   DC  H "C3'" 
2819 O "O3'" . DC  H 3  ? 0.7198 0.7181 0.8672 0.1478  0.0563  0.0074  3   DC  H "O3'" 
2820 C "C2'" . DC  H 3  ? 0.6125 0.6111 0.7915 0.1284  0.0223  0.0108  3   DC  H "C2'" 
2821 C "C1'" . DC  H 3  ? 0.5822 0.5529 0.7252 0.1309  0.0098  0.0067  3   DC  H "C1'" 
2822 N N1    . DC  H 3  ? 0.5741 0.5216 0.6959 0.1246  -0.0076 0.0107  3   DC  H N1    
2823 C C2    . DC  H 3  ? 0.5471 0.4669 0.6386 0.1203  -0.0066 0.0116  3   DC  H C2    
2824 O O2    . DC  H 3  ? 0.5299 0.4489 0.6189 0.1213  0.0012  0.0042  3   DC  H O2    
2825 N N3    . DC  H 3  ? 0.5488 0.4407 0.6160 0.1177  -0.0133 0.0196  3   DC  H N3    
2826 C C4    . DC  H 3  ? 0.5727 0.4612 0.6336 0.1233  -0.0274 0.0236  3   DC  H C4    
2827 N N4    . DC  H 3  ? 0.6397 0.4922 0.6612 0.1272  -0.0312 0.0329  3   DC  H N4    
2828 C C5    . DC  H 3  ? 0.5781 0.4973 0.6754 0.1274  -0.0376 0.0172  3   DC  H C5    
2829 C C6    . DC  H 3  ? 0.5639 0.5129 0.6966 0.1259  -0.0239 0.0124  3   DC  H C6    
2830 P P     . DC  H 4  ? 0.7364 0.7425 0.8737 0.1566  0.0868  0.0152  4   DC  H P     
2831 O OP1   . DC  H 4  ? 0.7093 0.7249 0.8702 0.1750  0.1109  0.0164  4   DC  H OP1   
2832 O OP2   . DC  H 4  ? 0.6879 0.7027 0.8418 0.1404  0.0893  0.0252  4   DC  H OP2   
2833 O "O5'" . DC  H 4  ? 0.6796 0.6638 0.7557 0.1664  0.0797  0.0050  4   DC  H "O5'" 
2834 C "C5'" . DC  H 4  ? 0.6404 0.6093 0.7000 0.1773  0.0652  -0.0108 4   DC  H "C5'" 
2835 C "C4'" . DC  H 4  ? 0.6195 0.5720 0.6541 0.1705  0.0434  -0.0233 4   DC  H "C4'" 
2836 O "O4'" . DC  H 4  ? 0.5439 0.4958 0.6000 0.1464  0.0307  -0.0170 4   DC  H "O4'" 
2837 C "C3'" . DC  H 4  ? 0.6196 0.5690 0.6183 0.1779  0.0462  -0.0255 4   DC  H "C3'" 
2838 O "O3'" . DC  H 4  ? 0.6304 0.5629 0.6082 0.1888  0.0248  -0.0490 4   DC  H "O3'" 
2839 C "C2'" . DC  H 4  ? 0.5586 0.5172 0.5752 0.1534  0.0436  -0.0135 4   DC  H "C2'" 
2840 C "C1'" . DC  H 4  ? 0.5343 0.4880 0.5791 0.1358  0.0289  -0.0145 4   DC  H "C1'" 
2841 N N1    . DC  H 4  ? 0.5239 0.4837 0.5877 0.1181  0.0283  -0.0007 4   DC  H N1    
2842 C C2    . DC  H 4  ? 0.5109 0.4554 0.5773 0.1051  0.0176  0.0000  4   DC  H C2    
2843 O O2    . DC  H 4  ? 0.4969 0.4271 0.5621 0.1038  0.0122  -0.0101 4   DC  H O2    
2844 N N3    . DC  H 4  ? 0.5036 0.4465 0.5741 0.0964  0.0147  0.0108  4   DC  H N3    
2845 C C4    . DC  H 4  ? 0.5179 0.4778 0.6035 0.0976  0.0164  0.0164  4   DC  H C4    
2846 N N4    . DC  H 4  ? 0.5089 0.4643 0.5965 0.0927  0.0061  0.0215  4   DC  H N4    
2847 C C5    . DC  H 4  ? 0.5089 0.4878 0.6095 0.1061  0.0302  0.0165  4   DC  H C5    
2848 C C6    . DC  H 4  ? 0.5054 0.4814 0.5884 0.1177  0.0383  0.0098  4   DC  H C6    
2849 P P     . DA  H 5  ? 0.6792 0.6012 0.6091 0.2115  0.0178  -0.0620 5   DA  H P     
2850 O OP1   . DA  H 5  ? 0.7176 0.6218 0.6345 0.2303  -0.0079 -0.0929 5   DA  H OP1   
2851 O OP2   . DA  H 5  ? 0.7113 0.6341 0.6059 0.2296  0.0479  -0.0428 5   DA  H OP2   
2852 O "O5'" . DA  H 5  ? 0.6327 0.5623 0.5817 0.1884  0.0058  -0.0602 5   DA  H "O5'" 
2853 C "C5'" . DA  H 5  ? 0.6067 0.5321 0.5876 0.1750  -0.0189 -0.0799 5   DA  H "C5'" 
2854 C "C4'" . DA  H 5  ? 0.5565 0.4925 0.5623 0.1501  -0.0171 -0.0688 5   DA  H "C4'" 
2855 O "O4'" . DA  H 5  ? 0.4886 0.4323 0.5081 0.1315  0.0014  -0.0435 5   DA  H "O4'" 
2856 C "C3'" . DA  H 5  ? 0.5566 0.4971 0.5327 0.1603  -0.0173 -0.0668 5   DA  H "C3'" 
2857 O "O3'" . DA  H 5  ? 0.5862 0.5250 0.5807 0.1623  -0.0432 -0.0925 5   DA  H "O3'" 
2858 C "C2'" . DA  H 5  ? 0.5047 0.4568 0.4943 0.1379  0.0013  -0.0409 5   DA  H "C2'" 
2859 C "C1'" . DA  H 5  ? 0.4681 0.4198 0.4906 0.1184  0.0055  -0.0332 5   DA  H "C1'" 
2860 N N9    . DA  H 5  ? 0.4454 0.4045 0.4732 0.1078  0.0202  -0.0117 5   DA  H N9    
2861 C C8    . DA  H 5  ? 0.4383 0.4057 0.4588 0.1152  0.0354  0.0009  5   DA  H C8    
2862 N N7    . DA  H 5  ? 0.3968 0.3711 0.4384 0.1020  0.0396  0.0133  5   DA  H N7    
2863 C C5    . DA  H 5  ? 0.3974 0.3631 0.4453 0.0887  0.0281  0.0110  5   DA  H C5    
2864 C C6    . DA  H 5  ? 0.3902 0.3508 0.4456 0.0780  0.0239  0.0188  5   DA  H C6    
2865 N N6    . DA  H 5  ? 0.4013 0.3698 0.4700 0.0769  0.0229  0.0253  5   DA  H N6    
2866 N N1    . DA  H 5  ? 0.3906 0.3340 0.4405 0.0712  0.0207  0.0183  5   DA  H N1    
2867 C C2    . DA  H 5  ? 0.4046 0.3422 0.4597 0.0702  0.0210  0.0085  5   DA  H C2    
2868 N N3    . DA  H 5  ? 0.4227 0.3675 0.4798 0.0790  0.0169  -0.0048 5   DA  H N3    
2869 C C4    . DA  H 5  ? 0.4117 0.3684 0.4562 0.0902  0.0206  -0.0020 5   DA  H C4    
2870 N N1    . 5CM H 6  ? 0.4500 0.4175 0.4878 0.0805  0.0158  -0.0089 6   5CM H N1    
2871 C C2    . 5CM H 6  ? 0.4377 0.4009 0.4813 0.0675  0.0234  0.0049  6   5CM H C2    
2872 N N3    . 5CM H 6  ? 0.4104 0.3776 0.4485 0.0679  0.0281  0.0166  6   5CM H N3    
2873 C C4    . 5CM H 6  ? 0.3983 0.3732 0.4302 0.0783  0.0348  0.0198  6   5CM H C4    
2874 C C5    . 5CM H 6  ? 0.4228 0.3961 0.4342 0.0945  0.0338  0.0108  6   5CM H C5    
2875 C C5A   . 5CM H 6  ? 0.4431 0.4144 0.4316 0.1133  0.0481  0.0176  6   5CM H C5A   
2876 C C6    . 5CM H 6  ? 0.4469 0.4167 0.4605 0.0960  0.0197  -0.0057 6   5CM H C6    
2877 O O2    . 5CM H 6  ? 0.4637 0.4171 0.5190 0.0578  0.0257  0.0052  6   5CM H O2    
2878 N N4    . 5CM H 6  ? 0.3845 0.3653 0.4302 0.0768  0.0422  0.0299  6   5CM H N4    
2879 C "C1'" . 5CM H 6  ? 0.4627 0.4289 0.5232 0.0798  0.0043  -0.0278 6   5CM H "C1'" 
2880 C "C2'" . 5CM H 6  ? 0.4699 0.4434 0.5239 0.0909  -0.0069 -0.0399 6   5CM H "C2'" 
2881 C "C3'" . 5CM H 6  ? 0.4923 0.4658 0.5829 0.0935  -0.0248 -0.0660 6   5CM H "C3'" 
2882 C "C4'" . 5CM H 6  ? 0.5008 0.4639 0.5955 0.0930  -0.0232 -0.0672 6   5CM H "C4'" 
2883 O "O4'" . 5CM H 6  ? 0.4622 0.4227 0.5294 0.0893  -0.0060 -0.0431 6   5CM H "O4'" 
2884 O "O3'" . 5CM H 6  ? 0.4920 0.4679 0.6329 0.0734  -0.0169 -0.0672 6   5CM H "O3'" 
2885 C "C5'" . 5CM H 6  ? 0.5469 0.5043 0.6278 0.1171  -0.0449 -0.0915 6   5CM H "C5'" 
2886 O "O5'" . 5CM H 6  ? 0.5653 0.5215 0.5894 0.1401  -0.0451 -0.0864 6   5CM H "O5'" 
2887 P P     . 5CM H 6  ? 0.5945 0.5366 0.5701 0.1733  -0.0545 -0.0989 6   5CM H P     
2888 O OP1   . 5CM H 6  ? 0.6744 0.6107 0.6615 0.1920  -0.0908 -0.1371 6   5CM H OP1   
2889 O OP2   . 5CM H 6  ? 0.6187 0.5556 0.5372 0.1899  -0.0334 -0.0762 6   5CM H OP2   
2890 P P     . DA  H 7  ? 0.4874 0.4758 0.6554 0.0700  -0.0194 -0.0745 7   DA  H P     
2891 O OP1   . DA  H 7  ? 0.5183 0.5131 0.7530 0.0687  -0.0345 -0.1029 7   DA  H OP1   
2892 O OP2   . DA  H 7  ? 0.5306 0.5230 0.6516 0.0857  -0.0266 -0.0699 7   DA  H OP2   
2893 O "O5'" . DA  H 7  ? 0.4997 0.4813 0.6731 0.0496  0.0104  -0.0499 7   DA  H "O5'" 
2894 C "C5'" . DA  H 7  ? 0.5108 0.4748 0.6937 0.0378  0.0287  -0.0375 7   DA  H "C5'" 
2895 C "C4'" . DA  H 7  ? 0.5146 0.4655 0.6793 0.0288  0.0539  -0.0147 7   DA  H "C4'" 
2896 O "O4'" . DA  H 7  ? 0.4848 0.4298 0.5950 0.0339  0.0517  0.0009  7   DA  H "O4'" 
2897 C "C3'" . DA  H 7  ? 0.5157 0.4768 0.6948 0.0261  0.0614  -0.0162 7   DA  H "C3'" 
2898 O "O3'" . DA  H 7  ? 0.5611 0.5020 0.7468 0.0182  0.0924  -0.0009 7   DA  H "O3'" 
2899 C "C2'" . DA  H 7  ? 0.4727 0.4394 0.6011 0.0339  0.0512  -0.0084 7   DA  H "C2'" 
2900 C "C1'" . DA  H 7  ? 0.4602 0.4127 0.5504 0.0354  0.0515  0.0055  7   DA  H "C1'" 
2901 N N9    . DA  H 7  ? 0.4309 0.3925 0.4958 0.0435  0.0379  0.0067  7   DA  H N9    
2902 C C8    . DA  H 7  ? 0.4292 0.4020 0.4945 0.0538  0.0253  -0.0041 7   DA  H C8    
2903 N N7    . DA  H 7  ? 0.4191 0.3933 0.4605 0.0609  0.0246  0.0037  7   DA  H N7    
2904 C C5    . DA  H 7  ? 0.4041 0.3720 0.4393 0.0528  0.0312  0.0165  7   DA  H C5    
2905 C C6    . DA  H 7  ? 0.4072 0.3758 0.4362 0.0535  0.0323  0.0259  7   DA  H C6    
2906 N N6    . DA  H 7  ? 0.3993 0.3741 0.4272 0.0613  0.0363  0.0294  7   DA  H N6    
2907 N N1    . DA  H 7  ? 0.4228 0.3827 0.4490 0.0483  0.0301  0.0306  7   DA  H N1    
2908 C C2    . DA  H 7  ? 0.4055 0.3518 0.4214 0.0453  0.0328  0.0307  7   DA  H C2    
2909 N N3    . DA  H 7  ? 0.4151 0.3586 0.4383 0.0425  0.0410  0.0271  7   DA  H N3    
2910 C C4    . DA  H 7  ? 0.4120 0.3697 0.4520 0.0448  0.0372  0.0180  7   DA  H C4    
2911 P P     . DC  H 8  ? 0.5724 0.5162 0.7686 0.0164  0.1117  0.0026  8   DC  H P     
2912 O OP1   . DC  H 8  ? 0.6111 0.5350 0.8448 0.0090  0.1488  0.0117  8   DC  H OP1   
2913 O OP2   . DC  H 8  ? 0.5466 0.5203 0.7683 0.0206  0.0889  -0.0172 8   DC  H OP2   
2914 O "O5'" . DC  H 8  ? 0.5802 0.5098 0.7014 0.0242  0.1106  0.0190  8   DC  H "O5'" 
2915 C "C5'" . DC  H 8  ? 0.5812 0.4802 0.6512 0.0293  0.1188  0.0362  8   DC  H "C5'" 
2916 C "C4'" . DC  H 8  ? 0.5822 0.4756 0.5987 0.0381  0.1059  0.0410  8   DC  H "C4'" 
2917 O "O4'" . DC  H 8  ? 0.5189 0.4335 0.5361 0.0378  0.0787  0.0334  8   DC  H "O4'" 
2918 C "C3'" . DC  H 8  ? 0.5671 0.4641 0.5802 0.0404  0.1138  0.0388  8   DC  H "C3'" 
2919 O "O3'" . DC  H 8  ? 0.6078 0.4716 0.5641 0.0528  0.1240  0.0495  8   DC  H "O3'" 
2920 C "C2'" . DC  H 8  ? 0.5148 0.4368 0.5331 0.0397  0.0875  0.0289  8   DC  H "C2'" 
2921 C "C1'" . DC  H 8  ? 0.5031 0.4258 0.5083 0.0404  0.0698  0.0308  8   DC  H "C1'" 
2922 N N1    . DC  H 8  ? 0.4687 0.4139 0.4902 0.0398  0.0539  0.0241  8   DC  H N1    
2923 C C2    . DC  H 8  ? 0.4485 0.3947 0.4571 0.0422  0.0422  0.0274  8   DC  H C2    
2924 O O2    . DC  H 8  ? 0.5091 0.4412 0.4992 0.0443  0.0378  0.0308  8   DC  H O2    
2925 N N3    . DC  H 8  ? 0.4216 0.3814 0.4395 0.0448  0.0369  0.0261  8   DC  H N3    
2926 C C4    . DC  H 8  ? 0.4141 0.3839 0.4416 0.0492  0.0357  0.0189  8   DC  H C4    
2927 N N4    . DC  H 8  ? 0.4072 0.3815 0.4274 0.0584  0.0325  0.0197  8   DC  H N4    
2928 C C5    . DC  H 8  ? 0.4458 0.4189 0.4933 0.0468  0.0384  0.0095  8   DC  H C5    
2929 C C6    . DC  H 8  ? 0.4466 0.4083 0.4965 0.0400  0.0510  0.0138  8   DC  H C6    
2930 P P     . DT  H 9  ? 0.6330 0.4904 0.5691 0.0607  0.1332  0.0478  9   DT  H P     
2931 O OP1   . DT  H 9  ? 0.7406 0.5551 0.6270 0.0761  0.1633  0.0617  9   DT  H OP1   
2932 O OP2   . DT  H 9  ? 0.5637 0.4536 0.5574 0.0510  0.1361  0.0371  9   DT  H OP2   
2933 O "O5'" . DT  H 9  ? 0.6068 0.4633 0.5084 0.0673  0.0993  0.0410  9   DT  H "O5'" 
2934 C "C5'" . DT  H 9  ? 0.6330 0.4717 0.5000 0.0755  0.0799  0.0427  9   DT  H "C5'" 
2935 C "C4'" . DT  H 9  ? 0.6191 0.4650 0.4839 0.0777  0.0481  0.0315  9   DT  H "C4'" 
2936 O "O4'" . DT  H 9  ? 0.5817 0.4616 0.4962 0.0630  0.0381  0.0275  9   DT  H "O4'" 
2937 C "C3'" . DT  H 9  ? 0.6388 0.4712 0.4791 0.0875  0.0441  0.0238  9   DT  H "C3'" 
2938 O "O3'" . DT  H 9  ? 0.6676 0.4828 0.4834 0.0999  0.0127  0.0130  9   DT  H "O3'" 
2939 C "C2'" . DT  H 9  ? 0.5820 0.4456 0.4703 0.0731  0.0447  0.0200  9   DT  H "C2'" 
2940 C "C1'" . DT  H 9  ? 0.5472 0.4343 0.4724 0.0615  0.0323  0.0211  9   DT  H "C1'" 
2941 N N1    . DT  H 9  ? 0.4819 0.3957 0.4443 0.0518  0.0381  0.0226  9   DT  H N1    
2942 C C2    . DT  H 9  ? 0.4570 0.3834 0.4418 0.0475  0.0285  0.0234  9   DT  H C2    
2943 O O2    . DT  H 9  ? 0.5043 0.4261 0.4965 0.0473  0.0162  0.0214  9   DT  H O2    
2944 N N3    . DT  H 9  ? 0.4181 0.3606 0.4190 0.0462  0.0344  0.0255  9   DT  H N3    
2945 C C4    . DT  H 9  ? 0.4077 0.3591 0.4154 0.0473  0.0415  0.0218  9   DT  H C4    
2946 O O4    . DT  H 9  ? 0.4020 0.3644 0.4190 0.0515  0.0387  0.0196  9   DT  H O4    
2947 C C5    . DT  H 9  ? 0.4327 0.3760 0.4360 0.0467  0.0527  0.0199  9   DT  H C5    
2948 C C7    . DT  H 9  ? 0.4296 0.3852 0.4622 0.0458  0.0627  0.0132  9   DT  H C7    
2949 C C6    . DT  H 9  ? 0.4451 0.3678 0.4205 0.0497  0.0540  0.0230  9   DT  H C6    
2950 P P     . DC  H 10 ? 0.7173 0.4994 0.4826 0.1222  -0.0037 -0.0006 10  DC  H P     
2951 O OP1   . DC  H 10 ? 0.7547 0.5155 0.4928 0.1395  -0.0374 -0.0117 10  DC  H OP1   
2952 O OP2   . DC  H 10 ? 0.7237 0.4850 0.4486 0.1333  0.0274  0.0061  10  DC  H OP2   
2953 O "O5'" . DC  H 10 ? 0.6588 0.4642 0.4753 0.1087  -0.0189 -0.0124 10  DC  H "O5'" 
2954 C "C5'" . DC  H 10 ? 0.6061 0.4366 0.4822 0.0936  -0.0383 -0.0170 10  DC  H "C5'" 
2955 C "C4'" . DC  H 10 ? 0.5818 0.4279 0.5002 0.0811  -0.0351 -0.0189 10  DC  H "C4'" 
2956 O "O4'" . DC  H 10 ? 0.5066 0.3756 0.4434 0.0688  -0.0088 -0.0037 10  DC  H "O4'" 
2957 C "C3'" . DC  H 10 ? 0.6275 0.4525 0.5166 0.0929  -0.0368 -0.0290 10  DC  H "C3'" 
2958 O "O3'" . DC  H 10 ? 0.6487 0.4767 0.5804 0.0860  -0.0503 -0.0384 10  DC  H "O3'" 
2959 C "C2'" . DC  H 10 ? 0.6021 0.4400 0.4893 0.0874  -0.0050 -0.0157 10  DC  H "C2'" 
2960 C "C1'" . DC  H 10 ? 0.5276 0.3952 0.4627 0.0700  0.0009  -0.0049 10  DC  H "C1'" 
2961 N N1    . DC  H 10 ? 0.4926 0.3792 0.4374 0.0645  0.0229  0.0051  10  DC  H N1    
2962 C C2    . DC  H 10 ? 0.4597 0.3662 0.4360 0.0562  0.0250  0.0119  10  DC  H C2    
2963 O O2    . DC  H 10 ? 0.4322 0.3389 0.4291 0.0520  0.0168  0.0136  10  DC  H O2    
2964 N N3    . DC  H 10 ? 0.4336 0.3558 0.4187 0.0559  0.0363  0.0149  10  DC  H N3    
2965 C C4    . DC  H 10 ? 0.4647 0.3879 0.4450 0.0586  0.0487  0.0120  10  DC  H C4    
2966 N N4    . DC  H 10 ? 0.4486 0.3902 0.4534 0.0579  0.0547  0.0098  10  DC  H N4    
2967 C C5    . DC  H 10 ? 0.5121 0.4147 0.4631 0.0650  0.0564  0.0104  10  DC  H C5    
2968 C C6    . DC  H 10 ? 0.5070 0.3897 0.4327 0.0701  0.0414  0.0068  10  DC  H C6    
2969 P P     . DC  H 11 ? 0.6921 0.4935 0.6205 0.0996  -0.0854 -0.0645 11  DC  H P     
2970 O OP1   . DC  H 11 ? 0.7138 0.5153 0.6623 0.1023  -0.1138 -0.0762 11  DC  H OP1   
2971 O OP2   . DC  H 11 ? 0.7353 0.5080 0.5953 0.1215  -0.0820 -0.0721 11  DC  H OP2   
2972 O "O5'" . DC  H 11 ? 0.6676 0.4778 0.6588 0.0841  -0.0832 -0.0648 11  DC  H "O5'" 
2973 C "C5'" . DC  H 11 ? 0.6463 0.4772 0.7078 0.0653  -0.0793 -0.0560 11  DC  H "C5'" 
2974 C "C4'" . DC  H 11 ? 0.6081 0.4495 0.6911 0.0540  -0.0498 -0.0354 11  DC  H "C4'" 
2975 O "O4'" . DC  H 11 ? 0.5581 0.4132 0.6012 0.0558  -0.0270 -0.0190 11  DC  H "O4'" 
2976 C "C3'" . DC  H 11 ? 0.6358 0.4585 0.7197 0.0580  -0.0504 -0.0416 11  DC  H "C3'" 
2977 O "O3'" . DC  H 11 ? 0.6920 0.5167 0.8261 0.0463  -0.0326 -0.0258 11  DC  H "O3'" 
2978 C "C2'" . DC  H 11 ? 0.6019 0.4286 0.6325 0.0667  -0.0321 -0.0327 11  DC  H "C2'" 
2979 C "C1'" . DC  H 11 ? 0.5424 0.3933 0.5760 0.0590  -0.0140 -0.0137 11  DC  H "C1'" 
2980 N N1    . DC  H 11 ? 0.5111 0.3748 0.5103 0.0642  0.0013  -0.0069 11  DC  H N1    
2981 C C2    . DC  H 11 ? 0.4810 0.3620 0.4891 0.0611  0.0159  0.0072  11  DC  H C2    
2982 O O2    . DC  H 11 ? 0.4530 0.3340 0.4843 0.0567  0.0202  0.0173  11  DC  H O2    
2983 N N3    . DC  H 11 ? 0.4618 0.3567 0.4550 0.0653  0.0253  0.0081  11  DC  H N3    
2984 C C4    . DC  H 11 ? 0.4747 0.3659 0.4480 0.0705  0.0294  0.0005  11  DC  H C4    
2985 N N4    . DC  H 11 ? 0.4725 0.3791 0.4497 0.0722  0.0424  0.0011  11  DC  H N4    
2986 C C5    . DC  H 11 ? 0.5073 0.3761 0.4568 0.0767  0.0209  -0.0093 11  DC  H C5    
2987 C C6    . DC  H 11 ? 0.5233 0.3790 0.4851 0.0744  0.0028  -0.0152 11  DC  H C6    
2988 P P     . DG  H 12 ? 0.7478 0.5531 0.9497 0.0391  -0.0431 -0.0366 12  DG  H P     
2989 O OP1   . DG  H 12 ? 0.7431 0.5600 1.0057 0.0287  -0.0531 -0.0429 12  DG  H OP1   
2990 O OP2   . DG  H 12 ? 0.7133 0.4960 0.8901 0.0513  -0.0667 -0.0607 12  DG  H OP2   
2991 O "O5'" . DG  H 12 ? 0.7377 0.5352 0.9547 0.0350  -0.0085 -0.0088 12  DG  H "O5'" 
2992 C "C5'" . DG  H 12 ? 0.6902 0.4998 0.9073 0.0319  0.0219  0.0191  12  DG  H "C5'" 
2993 C "C4'" . DG  H 12 ? 0.6782 0.4811 0.8441 0.0446  0.0417  0.0381  12  DG  H "C4'" 
2994 O "O4'" . DG  H 12 ? 0.6367 0.4604 0.7478 0.0528  0.0335  0.0325  12  DG  H "O4'" 
2995 C "C3'" . DG  H 12 ? 0.6801 0.4568 0.8405 0.0523  0.0403  0.0355  12  DG  H "C3'" 
2996 O "O3'" . DG  H 12 ? 0.7130 0.4643 0.8833 0.0571  0.0677  0.0603  12  DG  H "O3'" 
2997 C "C2'" . DG  H 12 ? 0.6610 0.4489 0.7610 0.0670  0.0352  0.0320  12  DG  H "C2'" 
2998 C "C1'" . DG  H 12 ? 0.6160 0.4320 0.6931 0.0665  0.0382  0.0366  12  DG  H "C1'" 
2999 N N9    . DG  H 12 ? 0.5702 0.4039 0.6153 0.0717  0.0266  0.0220  12  DG  H N9    
3000 C C8    . DG  H 12 ? 0.5528 0.3841 0.5905 0.0715  0.0120  0.0028  12  DG  H C8    
3001 N N7    . DG  H 12 ? 0.5327 0.3778 0.5421 0.0782  0.0140  -0.0026 12  DG  H N7    
3002 C C5    . DG  H 12 ? 0.5232 0.3845 0.5302 0.0812  0.0243  0.0091  12  DG  H C5    
3003 C C6    . DG  H 12 ? 0.5095 0.3920 0.5073 0.0868  0.0288  0.0061  12  DG  H C6    
3004 O O6    . DG  H 12 ? 0.4987 0.3894 0.4908 0.0883  0.0327  -0.0031 12  DG  H O6    
3005 N N1    . DG  H 12 ? 0.4882 0.3794 0.4865 0.0932  0.0304  0.0147  12  DG  H N1    
3006 C C2    . DG  H 12 ? 0.5149 0.3911 0.5096 0.0965  0.0341  0.0294  12  DG  H C2    
3007 N N2    . DG  H 12 ? 0.4948 0.3751 0.4739 0.1105  0.0339  0.0350  12  DG  H N2    
3008 N N3    . DG  H 12 ? 0.5150 0.3709 0.5228 0.0890  0.0388  0.0371  12  DG  H N3    
3009 C C4    . DG  H 12 ? 0.5270 0.3790 0.5463 0.0802  0.0305  0.0241  12  DG  H C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  142 ?   ?   ?   A . n 
A 1 2  ALA 2  143 ?   ?   ?   A . n 
A 1 3  THR 3  144 ?   ?   ?   A . n 
A 1 4  GLU 4  145 ?   ?   ?   A . n 
A 1 5  SER 5  146 ?   ?   ?   A . n 
A 1 6  GLY 6  147 147 GLY GLY A . n 
A 1 7  LYS 7  148 148 LYS LYS A . n 
A 1 8  ARG 8  149 149 ARG ARG A . n 
A 1 9  MET 9  150 150 MET MET A . n 
A 1 10 ASP 10 151 151 ASP ASP A . n 
A 1 11 CYS 11 152 152 CYS CYS A . n 
A 1 12 PRO 12 153 153 PRO PRO A . n 
A 1 13 ALA 13 154 154 ALA ALA A . n 
A 1 14 LEU 14 155 155 LEU LEU A . n 
A 1 15 PRO 15 156 156 PRO PRO A . n 
A 1 16 PRO 16 157 157 PRO PRO A . n 
A 1 17 GLY 17 158 158 GLY GLY A . n 
A 1 18 TRP 18 159 159 TRP TRP A . n 
A 1 19 LYS 19 160 160 LYS LYS A . n 
A 1 20 LYS 20 161 161 LYS LYS A . n 
A 1 21 GLU 21 162 162 GLU GLU A . n 
A 1 22 GLU 22 163 163 GLU GLU A . n 
A 1 23 VAL 23 164 164 VAL VAL A . n 
A 1 24 ILE 24 165 165 ILE ILE A . n 
A 1 25 ARG 25 166 166 ARG ARG A . n 
A 1 26 LYS 26 167 167 LYS LYS A . n 
A 1 27 SER 27 168 168 SER SER A . n 
A 1 28 GLY 28 169 169 GLY GLY A . n 
A 1 29 LEU 29 170 170 LEU LEU A . n 
A 1 30 SER 30 171 171 SER SER A . n 
A 1 31 ALA 31 172 172 ALA ALA A . n 
A 1 32 GLY 32 173 173 GLY GLY A . n 
A 1 33 LYS 33 174 174 LYS LYS A . n 
A 1 34 SER 34 175 175 SER SER A . n 
A 1 35 ASP 35 176 176 ASP ASP A . n 
A 1 36 VAL 36 177 177 VAL VAL A . n 
A 1 37 TYR 37 178 178 TYR TYR A . n 
A 1 38 TYR 38 179 179 TYR TYR A . n 
A 1 39 PHE 39 180 180 PHE PHE A . n 
A 1 40 SER 40 181 181 SER SER A . n 
A 1 41 PRO 41 182 182 PRO PRO A . n 
A 1 42 SER 42 183 183 SER SER A . n 
A 1 43 GLY 43 184 184 GLY GLY A . n 
A 1 44 LYS 44 185 185 LYS LYS A . n 
A 1 45 LYS 45 186 186 LYS LYS A . n 
A 1 46 PHE 46 187 187 PHE PHE A . n 
A 1 47 ARG 47 188 188 ARG ARG A . n 
A 1 48 SER 48 189 189 SER SER A . n 
A 1 49 LYS 49 190 190 LYS LYS A . n 
A 1 50 PRO 50 191 191 PRO PRO A . n 
A 1 51 GLN 51 192 192 GLN GLN A . n 
A 1 52 LEU 52 193 193 LEU LEU A . n 
A 1 53 ALA 53 194 194 ALA ALA A . n 
A 1 54 ARG 54 195 195 ARG ARG A . n 
A 1 55 TYR 55 196 196 TYR TYR A . n 
A 1 56 LEU 56 197 197 LEU LEU A . n 
A 1 57 GLY 57 198 198 GLY GLY A . n 
A 1 58 ASN 58 199 199 ASN ASN A . n 
A 1 59 THR 59 200 200 THR THR A . n 
A 1 60 VAL 60 201 201 VAL VAL A . n 
A 1 61 ASP 61 202 202 ASP ASP A . n 
A 1 62 LEU 62 203 203 LEU LEU A . n 
A 1 63 SER 63 204 204 SER SER A . n 
A 1 64 SER 64 205 205 SER SER A . n 
A 1 65 PHE 65 206 206 PHE PHE A . n 
A 1 66 ASP 66 207 207 ASP ASP A . n 
A 1 67 PHE 67 208 208 PHE PHE A . n 
A 1 68 ARG 68 209 209 ARG ARG A . n 
A 1 69 THR 69 210 210 THR THR A . n 
A 1 70 GLY 70 211 211 GLY GLY A . n 
A 1 71 LYS 71 212 212 LYS LYS A . n 
A 1 72 MET 72 213 213 MET MET A . n 
A 1 73 MET 73 214 214 MET MET A . n 
A 1 74 PRO 74 215 ?   ?   ?   A . n 
A 1 75 SER 75 216 ?   ?   ?   A . n 
A 1 76 LYS 76 217 ?   ?   ?   A . n 
A 1 77 LEU 77 218 ?   ?   ?   A . n 
A 1 78 GLN 78 219 ?   ?   ?   A . n 
A 1 79 LYS 79 220 ?   ?   ?   A . n 
B 1 1  GLY 1  142 ?   ?   ?   B . n 
B 1 2  ALA 2  143 ?   ?   ?   B . n 
B 1 3  THR 3  144 ?   ?   ?   B . n 
B 1 4  GLU 4  145 ?   ?   ?   B . n 
B 1 5  SER 5  146 ?   ?   ?   B . n 
B 1 6  GLY 6  147 ?   ?   ?   B . n 
B 1 7  LYS 7  148 148 LYS LYS B . n 
B 1 8  ARG 8  149 149 ARG ARG B . n 
B 1 9  MET 9  150 150 MET MET B . n 
B 1 10 ASP 10 151 151 ASP ASP B . n 
B 1 11 CYS 11 152 152 CYS CYS B . n 
B 1 12 PRO 12 153 153 PRO PRO B . n 
B 1 13 ALA 13 154 154 ALA ALA B . n 
B 1 14 LEU 14 155 155 LEU LEU B . n 
B 1 15 PRO 15 156 156 PRO PRO B . n 
B 1 16 PRO 16 157 157 PRO PRO B . n 
B 1 17 GLY 17 158 158 GLY GLY B . n 
B 1 18 TRP 18 159 159 TRP TRP B . n 
B 1 19 LYS 19 160 160 LYS LYS B . n 
B 1 20 LYS 20 161 161 LYS LYS B . n 
B 1 21 GLU 21 162 162 GLU GLU B . n 
B 1 22 GLU 22 163 163 GLU GLU B . n 
B 1 23 VAL 23 164 164 VAL VAL B . n 
B 1 24 ILE 24 165 165 ILE ILE B . n 
B 1 25 ARG 25 166 166 ARG ARG B . n 
B 1 26 LYS 26 167 167 LYS LYS B . n 
B 1 27 SER 27 168 168 SER SER B . n 
B 1 28 GLY 28 169 169 GLY GLY B . n 
B 1 29 LEU 29 170 170 LEU LEU B . n 
B 1 30 SER 30 171 171 SER SER B . n 
B 1 31 ALA 31 172 172 ALA ALA B . n 
B 1 32 GLY 32 173 173 GLY GLY B . n 
B 1 33 LYS 33 174 174 LYS LYS B . n 
B 1 34 SER 34 175 175 SER SER B . n 
B 1 35 ASP 35 176 176 ASP ASP B . n 
B 1 36 VAL 36 177 177 VAL VAL B . n 
B 1 37 TYR 37 178 178 TYR TYR B . n 
B 1 38 TYR 38 179 179 TYR TYR B . n 
B 1 39 PHE 39 180 180 PHE PHE B . n 
B 1 40 SER 40 181 181 SER SER B . n 
B 1 41 PRO 41 182 182 PRO PRO B . n 
B 1 42 SER 42 183 183 SER SER B . n 
B 1 43 GLY 43 184 184 GLY GLY B . n 
B 1 44 LYS 44 185 185 LYS LYS B . n 
B 1 45 LYS 45 186 186 LYS LYS B . n 
B 1 46 PHE 46 187 187 PHE PHE B . n 
B 1 47 ARG 47 188 188 ARG ARG B . n 
B 1 48 SER 48 189 189 SER SER B . n 
B 1 49 LYS 49 190 190 LYS LYS B . n 
B 1 50 PRO 50 191 191 PRO PRO B . n 
B 1 51 GLN 51 192 192 GLN GLN B . n 
B 1 52 LEU 52 193 193 LEU LEU B . n 
B 1 53 ALA 53 194 194 ALA ALA B . n 
B 1 54 ARG 54 195 195 ARG ARG B . n 
B 1 55 TYR 55 196 196 TYR TYR B . n 
B 1 56 LEU 56 197 197 LEU LEU B . n 
B 1 57 GLY 57 198 198 GLY GLY B . n 
B 1 58 ASN 58 199 199 ASN ASN B . n 
B 1 59 THR 59 200 200 THR THR B . n 
B 1 60 VAL 60 201 201 VAL VAL B . n 
B 1 61 ASP 61 202 202 ASP ASP B . n 
B 1 62 LEU 62 203 203 LEU LEU B . n 
B 1 63 SER 63 204 204 SER SER B . n 
B 1 64 SER 64 205 205 SER SER B . n 
B 1 65 PHE 65 206 206 PHE PHE B . n 
B 1 66 ASP 66 207 207 ASP ASP B . n 
B 1 67 PHE 67 208 208 PHE PHE B . n 
B 1 68 ARG 68 209 209 ARG ARG B . n 
B 1 69 THR 69 210 210 THR THR B . n 
B 1 70 GLY 70 211 211 GLY GLY B . n 
B 1 71 LYS 71 212 212 LYS LYS B . n 
B 1 72 MET 72 213 213 MET MET B . n 
B 1 73 MET 73 214 214 MET MET B . n 
B 1 74 PRO 74 215 215 PRO PRO B . n 
B 1 75 SER 75 216 ?   ?   ?   B . n 
B 1 76 LYS 76 217 ?   ?   ?   B . n 
B 1 77 LEU 77 218 ?   ?   ?   B . n 
B 1 78 GLN 78 219 ?   ?   ?   B . n 
B 1 79 LYS 79 220 ?   ?   ?   B . n 
C 2 1  DC  1  1   1   DC  DC  C . n 
C 2 2  DG  2  2   2   DG  DG  C . n 
C 2 3  DG  3  3   3   DG  DG  C . n 
C 2 4  DA  4  4   4   DA  DA  C . n 
C 2 5  DG  5  5   5   DG  DG  C . n 
C 2 6  DT  6  6   6   DT  DT  C . n 
C 2 7  DG  7  7   7   DG  DG  C . n 
C 2 8  DT  8  8   8   DT  DT  C . n 
C 2 9  DG  9  9   9   DG  DG  C . n 
C 2 10 DG  10 10  10  DG  DG  C . n 
C 2 11 DG  11 11  11  DG  DG  C . n 
C 2 12 DC  12 12  12  DC  DC  C . n 
D 3 1  DG  1  1   1   DG  DG  D . n 
D 3 2  DC  2  2   2   DC  DC  D . n 
D 3 3  DC  3  3   3   DC  DC  D . n 
D 3 4  DC  4  4   4   DC  DC  D . n 
D 3 5  DA  5  5   5   DA  DA  D . n 
D 3 6  5CM 6  6   6   5CM 5CM D . n 
D 3 7  DA  7  7   7   DA  DA  D . n 
D 3 8  DC  8  8   8   DC  DC  D . n 
D 3 9  DT  9  9   9   DT  DT  D . n 
D 3 10 DC  10 10  10  DC  DC  D . n 
D 3 11 DC  11 11  11  DC  DC  D . n 
D 3 12 DG  12 12  12  DG  DG  D . n 
E 1 1  GLY 1  142 ?   ?   ?   E . n 
E 1 2  ALA 2  143 ?   ?   ?   E . n 
E 1 3  THR 3  144 ?   ?   ?   E . n 
E 1 4  GLU 4  145 ?   ?   ?   E . n 
E 1 5  SER 5  146 ?   ?   ?   E . n 
E 1 6  GLY 6  147 147 GLY GLY E . n 
E 1 7  LYS 7  148 148 LYS LYS E . n 
E 1 8  ARG 8  149 149 ARG ARG E . n 
E 1 9  MET 9  150 150 MET MET E . n 
E 1 10 ASP 10 151 151 ASP ASP E . n 
E 1 11 CYS 11 152 152 CYS CYS E . n 
E 1 12 PRO 12 153 153 PRO PRO E . n 
E 1 13 ALA 13 154 154 ALA ALA E . n 
E 1 14 LEU 14 155 155 LEU LEU E . n 
E 1 15 PRO 15 156 156 PRO PRO E . n 
E 1 16 PRO 16 157 157 PRO PRO E . n 
E 1 17 GLY 17 158 158 GLY GLY E . n 
E 1 18 TRP 18 159 159 TRP TRP E . n 
E 1 19 LYS 19 160 160 LYS LYS E . n 
E 1 20 LYS 20 161 161 LYS LYS E . n 
E 1 21 GLU 21 162 162 GLU GLU E . n 
E 1 22 GLU 22 163 163 GLU GLU E . n 
E 1 23 VAL 23 164 164 VAL VAL E . n 
E 1 24 ILE 24 165 165 ILE ILE E . n 
E 1 25 ARG 25 166 166 ARG ARG E . n 
E 1 26 LYS 26 167 167 LYS LYS E . n 
E 1 27 SER 27 168 168 SER SER E . n 
E 1 28 GLY 28 169 169 GLY GLY E . n 
E 1 29 LEU 29 170 170 LEU LEU E . n 
E 1 30 SER 30 171 171 SER SER E . n 
E 1 31 ALA 31 172 172 ALA ALA E . n 
E 1 32 GLY 32 173 173 GLY GLY E . n 
E 1 33 LYS 33 174 174 LYS LYS E . n 
E 1 34 SER 34 175 175 SER SER E . n 
E 1 35 ASP 35 176 176 ASP ASP E . n 
E 1 36 VAL 36 177 177 VAL VAL E . n 
E 1 37 TYR 37 178 178 TYR TYR E . n 
E 1 38 TYR 38 179 179 TYR TYR E . n 
E 1 39 PHE 39 180 180 PHE PHE E . n 
E 1 40 SER 40 181 181 SER SER E . n 
E 1 41 PRO 41 182 182 PRO PRO E . n 
E 1 42 SER 42 183 183 SER SER E . n 
E 1 43 GLY 43 184 184 GLY GLY E . n 
E 1 44 LYS 44 185 185 LYS LYS E . n 
E 1 45 LYS 45 186 186 LYS LYS E . n 
E 1 46 PHE 46 187 187 PHE PHE E . n 
E 1 47 ARG 47 188 188 ARG ARG E . n 
E 1 48 SER 48 189 189 SER SER E . n 
E 1 49 LYS 49 190 190 LYS LYS E . n 
E 1 50 PRO 50 191 191 PRO PRO E . n 
E 1 51 GLN 51 192 192 GLN GLN E . n 
E 1 52 LEU 52 193 193 LEU LEU E . n 
E 1 53 ALA 53 194 194 ALA ALA E . n 
E 1 54 ARG 54 195 195 ARG ARG E . n 
E 1 55 TYR 55 196 196 TYR TYR E . n 
E 1 56 LEU 56 197 197 LEU LEU E . n 
E 1 57 GLY 57 198 198 GLY GLY E . n 
E 1 58 ASN 58 199 199 ASN ASN E . n 
E 1 59 THR 59 200 200 THR THR E . n 
E 1 60 VAL 60 201 201 VAL VAL E . n 
E 1 61 ASP 61 202 202 ASP ASP E . n 
E 1 62 LEU 62 203 203 LEU LEU E . n 
E 1 63 SER 63 204 204 SER SER E . n 
E 1 64 SER 64 205 205 SER SER E . n 
E 1 65 PHE 65 206 206 PHE PHE E . n 
E 1 66 ASP 66 207 207 ASP ASP E . n 
E 1 67 PHE 67 208 208 PHE PHE E . n 
E 1 68 ARG 68 209 209 ARG ARG E . n 
E 1 69 THR 69 210 210 THR THR E . n 
E 1 70 GLY 70 211 211 GLY GLY E . n 
E 1 71 LYS 71 212 212 LYS LYS E . n 
E 1 72 MET 72 213 213 MET MET E . n 
E 1 73 MET 73 214 214 MET MET E . n 
E 1 74 PRO 74 215 215 PRO PRO E . n 
E 1 75 SER 75 216 ?   ?   ?   E . n 
E 1 76 LYS 76 217 ?   ?   ?   E . n 
E 1 77 LEU 77 218 ?   ?   ?   E . n 
E 1 78 GLN 78 219 ?   ?   ?   E . n 
E 1 79 LYS 79 220 ?   ?   ?   E . n 
F 1 1  GLY 1  142 ?   ?   ?   F . n 
F 1 2  ALA 2  143 ?   ?   ?   F . n 
F 1 3  THR 3  144 ?   ?   ?   F . n 
F 1 4  GLU 4  145 ?   ?   ?   F . n 
F 1 5  SER 5  146 ?   ?   ?   F . n 
F 1 6  GLY 6  147 147 GLY GLY F . n 
F 1 7  LYS 7  148 148 LYS LYS F . n 
F 1 8  ARG 8  149 149 ARG ARG F . n 
F 1 9  MET 9  150 150 MET MET F . n 
F 1 10 ASP 10 151 151 ASP ASP F . n 
F 1 11 CYS 11 152 152 CYS CYS F . n 
F 1 12 PRO 12 153 153 PRO PRO F . n 
F 1 13 ALA 13 154 154 ALA ALA F . n 
F 1 14 LEU 14 155 155 LEU LEU F . n 
F 1 15 PRO 15 156 156 PRO PRO F . n 
F 1 16 PRO 16 157 157 PRO PRO F . n 
F 1 17 GLY 17 158 158 GLY GLY F . n 
F 1 18 TRP 18 159 159 TRP TRP F . n 
F 1 19 LYS 19 160 160 LYS LYS F . n 
F 1 20 LYS 20 161 161 LYS LYS F . n 
F 1 21 GLU 21 162 162 GLU GLU F . n 
F 1 22 GLU 22 163 163 GLU GLU F . n 
F 1 23 VAL 23 164 164 VAL VAL F . n 
F 1 24 ILE 24 165 165 ILE ILE F . n 
F 1 25 ARG 25 166 166 ARG ARG F . n 
F 1 26 LYS 26 167 167 LYS LYS F . n 
F 1 27 SER 27 168 168 SER SER F . n 
F 1 28 GLY 28 169 169 GLY GLY F . n 
F 1 29 LEU 29 170 170 LEU LEU F . n 
F 1 30 SER 30 171 171 SER SER F . n 
F 1 31 ALA 31 172 172 ALA ALA F . n 
F 1 32 GLY 32 173 173 GLY GLY F . n 
F 1 33 LYS 33 174 174 LYS LYS F . n 
F 1 34 SER 34 175 175 SER SER F . n 
F 1 35 ASP 35 176 176 ASP ASP F . n 
F 1 36 VAL 36 177 177 VAL VAL F . n 
F 1 37 TYR 37 178 178 TYR TYR F . n 
F 1 38 TYR 38 179 179 TYR TYR F . n 
F 1 39 PHE 39 180 180 PHE PHE F . n 
F 1 40 SER 40 181 181 SER SER F . n 
F 1 41 PRO 41 182 182 PRO PRO F . n 
F 1 42 SER 42 183 183 SER SER F . n 
F 1 43 GLY 43 184 184 GLY GLY F . n 
F 1 44 LYS 44 185 185 LYS LYS F . n 
F 1 45 LYS 45 186 186 LYS LYS F . n 
F 1 46 PHE 46 187 187 PHE PHE F . n 
F 1 47 ARG 47 188 188 ARG ARG F . n 
F 1 48 SER 48 189 189 SER SER F . n 
F 1 49 LYS 49 190 190 LYS LYS F . n 
F 1 50 PRO 50 191 191 PRO PRO F . n 
F 1 51 GLN 51 192 192 GLN GLN F . n 
F 1 52 LEU 52 193 193 LEU LEU F . n 
F 1 53 ALA 53 194 194 ALA ALA F . n 
F 1 54 ARG 54 195 195 ARG ARG F . n 
F 1 55 TYR 55 196 196 TYR TYR F . n 
F 1 56 LEU 56 197 197 LEU LEU F . n 
F 1 57 GLY 57 198 198 GLY GLY F . n 
F 1 58 ASN 58 199 199 ASN ASN F . n 
F 1 59 THR 59 200 200 THR THR F . n 
F 1 60 VAL 60 201 201 VAL VAL F . n 
F 1 61 ASP 61 202 202 ASP ASP F . n 
F 1 62 LEU 62 203 203 LEU LEU F . n 
F 1 63 SER 63 204 204 SER SER F . n 
F 1 64 SER 64 205 205 SER SER F . n 
F 1 65 PHE 65 206 206 PHE PHE F . n 
F 1 66 ASP 66 207 207 ASP ASP F . n 
F 1 67 PHE 67 208 208 PHE PHE F . n 
F 1 68 ARG 68 209 209 ARG ARG F . n 
F 1 69 THR 69 210 210 THR THR F . n 
F 1 70 GLY 70 211 211 GLY GLY F . n 
F 1 71 LYS 71 212 212 LYS LYS F . n 
F 1 72 MET 72 213 213 MET MET F . n 
F 1 73 MET 73 214 214 MET MET F . n 
F 1 74 PRO 74 215 215 PRO PRO F . n 
F 1 75 SER 75 216 ?   ?   ?   F . n 
F 1 76 LYS 76 217 ?   ?   ?   F . n 
F 1 77 LEU 77 218 ?   ?   ?   F . n 
F 1 78 GLN 78 219 ?   ?   ?   F . n 
F 1 79 LYS 79 220 ?   ?   ?   F . n 
G 2 1  DC  1  1   1   DC  DC  G . n 
G 2 2  DG  2  2   2   DG  DG  G . n 
G 2 3  DG  3  3   3   DG  DG  G . n 
G 2 4  DA  4  4   4   DA  DA  G . n 
G 2 5  DG  5  5   5   DG  DG  G . n 
G 2 6  DT  6  6   6   DT  DT  G . n 
G 2 7  DG  7  7   7   DG  DG  G . n 
G 2 8  DT  8  8   8   DT  DT  G . n 
G 2 9  DG  9  9   9   DG  DG  G . n 
G 2 10 DG  10 10  10  DG  DG  G . n 
G 2 11 DG  11 11  11  DG  DG  G . n 
G 2 12 DC  12 12  12  DC  DC  G . n 
H 3 1  DG  1  1   1   DG  DG  H . n 
H 3 2  DC  2  2   2   DC  DC  H . n 
H 3 3  DC  3  3   3   DC  DC  H . n 
H 3 4  DC  4  4   4   DC  DC  H . n 
H 3 5  DA  5  5   5   DA  DA  H . n 
H 3 6  5CM 6  6   6   5CM 5CM H . n 
H 3 7  DA  7  7   7   DA  DA  H . n 
H 3 8  DC  8  8   8   DC  DC  H . n 
H 3 9  DT  9  9   9   DT  DT  H . n 
H 3 10 DC  10 10  10  DC  DC  H . n 
H 3 11 DC  11 11  11  DC  DC  H . n 
H 3 12 DG  12 12  12  DG  DG  H . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I  4 UNX 1 301 34 UNX UNX A . 
J  4 UNX 1 302 45 UNX UNX A . 
K  4 UNX 1 303 52 UNX UNX A . 
L  4 UNX 1 304 67 UNX UNX A . 
M  4 UNX 1 305 76 UNX UNX A . 
N  4 UNX 1 301 8  UNX UNX B . 
O  4 UNX 1 302 9  UNX UNX B . 
P  4 UNX 1 303 12 UNX UNX B . 
Q  4 UNX 1 304 28 UNX UNX B . 
R  4 UNX 1 305 49 UNX UNX B . 
S  4 UNX 1 306 63 UNX UNX B . 
T  4 UNX 1 307 64 UNX UNX B . 
U  4 UNX 1 308 68 UNX UNX B . 
V  4 UNX 1 309 71 UNX UNX B . 
W  4 UNX 1 310 73 UNX UNX B . 
X  4 UNX 1 311 77 UNX UNX B . 
Y  4 UNX 1 312 80 UNX UNX B . 
Z  4 UNX 1 101 13 UNX UNX C . 
AA 4 UNX 1 102 41 UNX UNX C . 
BA 4 UNX 1 103 54 UNX UNX C . 
CA 4 UNX 1 104 78 UNX UNX C . 
DA 4 UNX 1 101 32 UNX UNX D . 
EA 4 UNX 1 102 72 UNX UNX D . 
FA 4 UNX 1 103 82 UNX UNX D . 
GA 4 UNX 1 301 20 UNX UNX E . 
HA 4 UNX 1 302 23 UNX UNX E . 
IA 4 UNX 1 303 50 UNX UNX E . 
JA 4 UNX 1 304 55 UNX UNX E . 
KA 4 UNX 1 305 61 UNX UNX E . 
LA 4 UNX 1 306 69 UNX UNX E . 
MA 4 UNX 1 301 29 UNX UNX F . 
NA 4 UNX 1 302 66 UNX UNX F . 
OA 4 UNX 1 303 81 UNX UNX F . 
PA 4 UNX 1 101 14 UNX UNX G . 
QA 4 UNX 1 102 15 UNX UNX G . 
RA 4 UNX 1 103 36 UNX UNX G . 
SA 4 UNX 1 104 48 UNX UNX G . 
TA 4 UNX 1 105 62 UNX UNX G . 
UA 4 UNX 1 106 65 UNX UNX G . 
VA 4 UNX 1 107 79 UNX UNX G . 
WA 4 UNX 1 101 38 UNX UNX H . 
XA 4 UNX 1 102 60 UNX UNX H . 
YA 5 HOH 1 401 13 HOH HOH A . 
YA 5 HOH 2 402 19 HOH HOH A . 
YA 5 HOH 3 403 22 HOH HOH A . 
YA 5 HOH 4 404 11 HOH HOH A . 
ZA 5 HOH 1 401 16 HOH HOH B . 
AB 5 HOH 1 201 6  HOH HOH C . 
AB 5 HOH 2 202 21 HOH HOH C . 
AB 5 HOH 3 203 9  HOH HOH C . 
AB 5 HOH 4 204 4  HOH HOH C . 
BB 5 HOH 1 201 24 HOH HOH D . 
BB 5 HOH 2 202 41 HOH HOH D . 
CB 5 HOH 1 401 15 HOH HOH E . 
CB 5 HOH 2 402 7  HOH HOH E . 
CB 5 HOH 3 403 12 HOH HOH E . 
DB 5 HOH 1 401 28 HOH HOH F . 
DB 5 HOH 2 402 40 HOH HOH F . 
DB 5 HOH 3 403 2  HOH HOH F . 
EB 5 HOH 1 201 17 HOH HOH G . 
EB 5 HOH 2 202 8  HOH HOH G . 
EB 5 HOH 3 203 32 HOH HOH G . 
EB 5 HOH 4 204 39 HOH HOH G . 
FB 5 HOH 1 201 38 HOH HOH H . 
FB 5 HOH 2 202 14 HOH HOH H . 
FB 5 HOH 3 203 20 HOH HOH H . 
FB 5 HOH 4 204 27 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,YA,ZA,AB,BB 
2 1 E,F,G,H,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,CB,DB,EB,FB 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-02-14 
2 'Structure model' 1 1 2018-04-18 
3 'Structure model' 1 2 2018-05-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
8  2 'Structure model' '_citation.title'                   
9  2 'Structure model' '_citation.year'                    
10 2 'Structure model' '_citation_author.name'             
11 3 'Structure model' '_citation.journal_volume'          
12 3 'Structure model' '_citation.page_first'              
13 3 'Structure model' '_citation.page_last'               
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -27.7505 16.3216 -25.6641 0.0696 0.1923 0.0478 -0.0896 0.0145  -0.0391 2.7073 3.3979 7.0130 
-1.1763 -0.0485 1.4822 -0.0229 0.1297  -0.1068 -0.1635 -0.0016 -0.2299 0.1818  -0.1974 0.2914  
'X-RAY DIFFRACTION' 2 ? refined -45.1539 8.4864  -55.0331 0.3816 0.3122 0.0897 -0.0498 -0.0511 -0.0278 3.3243 1.4553 8.0106 
-1.1754 -3.8205 0.2675 0.1474  -0.1880 0.0406  0.5741  -0.0071 0.1494  -0.6020 0.0964  -0.3861 
'X-RAY DIFFRACTION' 3 ? refined -34.9360 17.9478 -39.8557 0.0838 0.0787 0.0274 -0.0459 0.0025  -0.0174 4.2443 7.3728 1.6847 4.3699 
0.4410  1.6833 -0.0711 0.0221  0.0490  0.0178  0.2648  0.2951  -0.4589 -0.3029 0.1228  
'X-RAY DIFFRACTION' 4 ? refined -33.6604 17.6424 -40.7069 0.0906 0.0579 0.0673 -0.0430 0.0309  0.0186  3.5572 8.0237 1.5917 3.1904 
0.3536  0.9449 0.0356  -0.0817 0.0461  -0.0355 0.0434  -0.3429 -0.2222 -0.1087 0.0695  
'X-RAY DIFFRACTION' 5 ? refined -46.2849 14.3515 -5.5360  0.0857 0.1716 0.0611 0.0631  0.0218  -0.0365 3.3864 2.9333 7.2430 1.2771 
0.7575  1.1323 -0.0967 0.2198  -0.1232 0.2099  -0.0518 -0.1259 -0.2635 0.1128  0.2159  
'X-RAY DIFFRACTION' 6 ? refined -64.8666 23.0714 23.8661  0.3458 0.2809 0.1620 0.0137  0.0545  -0.0020 2.4783 2.3374 9.4358 0.8814 
0.7204  1.5078 0.1484  -0.1010 -0.0474 -0.5573 -0.0573 0.0502  0.7506  -0.1983 0.0976  
'X-RAY DIFFRACTION' 7 ? refined -53.2773 12.6426 8.9417   0.1742 0.0598 0.0953 0.0403  -0.0202 0.0555  3.2346 7.0006 2.5787 
-4.0727 -0.0725 1.8479 -0.1268 0.0719  0.0549  -0.0039 -0.2107 0.1346  0.6031  0.2346  0.1347  
'X-RAY DIFFRACTION' 8 ? refined -52.0080 13.0161 9.7083   0.0884 0.0414 0.1179 0.0517  0.0227  0.0327  4.0561 8.4543 2.0953 
-4.0361 -0.3827 1.4342 0.0096  -0.0322 0.0226  0.0448  -0.0740 -0.2483 0.2860  0.1434  0.1003  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 147 A 214 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 148 B 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 1   C 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 1   D 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 147 E 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 F 147 F 215 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 G 1   G 12  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8 8 H 1   H 12  ? ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0158 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.32   2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .        5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C B CYS 152 ? ? N B PRO 153 ? ? CA B PRO 153 ? ? 129.47 119.30 10.17 1.50 Y 
2 1 C E MET 214 ? ? N E PRO 215 ? ? CA E PRO 215 ? ? 129.55 119.30 10.25 1.50 Y 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLY 147 ? N   ? A GLY 6  N   
2   1 Y 1 A LYS 148 ? CG  ? A LYS 7  CG  
3   1 Y 1 A LYS 148 ? CD  ? A LYS 7  CD  
4   1 Y 1 A LYS 148 ? CE  ? A LYS 7  CE  
5   1 Y 1 A LYS 148 ? NZ  ? A LYS 7  NZ  
6   1 Y 1 A LYS 160 ? NZ  ? A LYS 19 NZ  
7   1 Y 1 A LYS 161 ? NZ  ? A LYS 20 NZ  
8   1 Y 1 A LYS 167 ? CD  ? A LYS 26 CD  
9   1 Y 1 A LYS 167 ? CE  ? A LYS 26 CE  
10  1 Y 1 A LYS 167 ? NZ  ? A LYS 26 NZ  
11  1 Y 1 A LYS 174 ? CD  ? A LYS 33 CD  
12  1 Y 1 A LYS 174 ? CE  ? A LYS 33 CE  
13  1 Y 1 A LYS 174 ? NZ  ? A LYS 33 NZ  
14  1 Y 1 A SER 183 ? OG  ? A SER 42 OG  
15  1 Y 1 A LYS 185 ? CD  ? A LYS 44 CD  
16  1 Y 1 A LYS 185 ? CE  ? A LYS 44 CE  
17  1 Y 1 A LYS 185 ? NZ  ? A LYS 44 NZ  
18  1 Y 1 A LYS 212 ? CE  ? A LYS 71 CE  
19  1 Y 1 A LYS 212 ? NZ  ? A LYS 71 NZ  
20  1 Y 1 B LYS 148 ? N   ? B LYS 7  N   
21  1 Y 1 B LYS 148 ? CB  ? B LYS 7  CB  
22  1 Y 1 B LYS 148 ? CG  ? B LYS 7  CG  
23  1 Y 1 B LYS 148 ? CD  ? B LYS 7  CD  
24  1 Y 1 B LYS 148 ? CE  ? B LYS 7  CE  
25  1 Y 1 B LYS 148 ? NZ  ? B LYS 7  NZ  
26  1 Y 1 B MET 150 ? CG  ? B MET 9  CG  
27  1 Y 1 B MET 150 ? SD  ? B MET 9  SD  
28  1 Y 1 B MET 150 ? CE  ? B MET 9  CE  
29  1 Y 1 B ASP 151 ? CG  ? B ASP 10 CG  
30  1 Y 1 B ASP 151 ? OD1 ? B ASP 10 OD1 
31  1 Y 1 B ASP 151 ? OD2 ? B ASP 10 OD2 
32  1 Y 1 B PRO 153 ? CB  ? B PRO 12 CB  
33  1 Y 1 B PRO 153 ? CG  ? B PRO 12 CG  
34  1 Y 1 B PRO 153 ? CD  ? B PRO 12 CD  
35  1 Y 1 B PRO 157 ? CB  ? B PRO 16 CB  
36  1 Y 1 B PRO 157 ? CG  ? B PRO 16 CG  
37  1 Y 1 B PRO 157 ? CD  ? B PRO 16 CD  
38  1 Y 1 B LYS 160 ? CD  ? B LYS 19 CD  
39  1 Y 1 B LYS 160 ? CE  ? B LYS 19 CE  
40  1 Y 1 B LYS 160 ? NZ  ? B LYS 19 NZ  
41  1 Y 1 B LYS 161 ? NZ  ? B LYS 20 NZ  
42  1 Y 1 B LYS 167 ? CD  ? B LYS 26 CD  
43  1 Y 1 B LYS 167 ? CE  ? B LYS 26 CE  
44  1 Y 1 B LYS 167 ? NZ  ? B LYS 26 NZ  
45  1 Y 1 B SER 183 ? OG  ? B SER 42 OG  
46  1 Y 1 B LYS 185 ? CG  ? B LYS 44 CG  
47  1 Y 1 B LYS 185 ? CD  ? B LYS 44 CD  
48  1 Y 1 B LYS 185 ? CE  ? B LYS 44 CE  
49  1 Y 1 B LYS 185 ? NZ  ? B LYS 44 NZ  
50  1 Y 1 B LYS 186 ? NZ  ? B LYS 45 NZ  
51  1 Y 1 B ASN 199 ? OD1 ? B ASN 58 OD1 
52  1 Y 1 B ASN 199 ? ND2 ? B ASN 58 ND2 
53  1 Y 1 B SER 204 ? OG  ? B SER 63 OG  
54  1 Y 1 B SER 205 ? OG  ? B SER 64 OG  
55  1 Y 1 B LYS 212 ? CD  ? B LYS 71 CD  
56  1 Y 1 B LYS 212 ? CE  ? B LYS 71 CE  
57  1 Y 1 B LYS 212 ? NZ  ? B LYS 71 NZ  
58  1 Y 1 B MET 214 ? CG  ? B MET 73 CG  
59  1 Y 1 B MET 214 ? SD  ? B MET 73 SD  
60  1 Y 1 B MET 214 ? CE  ? B MET 73 CE  
61  1 Y 1 E GLY 147 ? N   ? E GLY 6  N   
62  1 Y 1 E LYS 148 ? CG  ? E LYS 7  CG  
63  1 Y 1 E LYS 148 ? CD  ? E LYS 7  CD  
64  1 Y 1 E LYS 148 ? CE  ? E LYS 7  CE  
65  1 Y 1 E LYS 148 ? NZ  ? E LYS 7  NZ  
66  1 Y 1 E LYS 160 ? NZ  ? E LYS 19 NZ  
67  1 Y 1 E LYS 161 ? NZ  ? E LYS 20 NZ  
68  1 Y 1 E LYS 167 ? CD  ? E LYS 26 CD  
69  1 Y 1 E LYS 167 ? CE  ? E LYS 26 CE  
70  1 Y 1 E LYS 167 ? NZ  ? E LYS 26 NZ  
71  1 Y 1 E LEU 170 ? CG  ? E LEU 29 CG  
72  1 Y 1 E LEU 170 ? CD1 ? E LEU 29 CD1 
73  1 Y 1 E LEU 170 ? CD2 ? E LEU 29 CD2 
74  1 Y 1 E LYS 174 ? CG  ? E LYS 33 CG  
75  1 Y 1 E LYS 174 ? CD  ? E LYS 33 CD  
76  1 Y 1 E LYS 174 ? CE  ? E LYS 33 CE  
77  1 Y 1 E LYS 174 ? NZ  ? E LYS 33 NZ  
78  1 Y 1 E SER 183 ? OG  ? E SER 42 OG  
79  1 Y 1 E LYS 185 ? NZ  ? E LYS 44 NZ  
80  1 Y 1 E LYS 212 ? CE  ? E LYS 71 CE  
81  1 Y 1 E LYS 212 ? NZ  ? E LYS 71 NZ  
82  1 Y 1 E PRO 215 ? C   ? E PRO 74 C   
83  1 Y 1 E PRO 215 ? O   ? E PRO 74 O   
84  1 Y 1 E PRO 215 ? CB  ? E PRO 74 CB  
85  1 Y 1 E PRO 215 ? CG  ? E PRO 74 CG  
86  1 Y 1 E PRO 215 ? CD  ? E PRO 74 CD  
87  1 Y 1 F LYS 148 ? CG  ? F LYS 7  CG  
88  1 Y 1 F LYS 148 ? CD  ? F LYS 7  CD  
89  1 Y 1 F LYS 148 ? CE  ? F LYS 7  CE  
90  1 Y 1 F LYS 148 ? NZ  ? F LYS 7  NZ  
91  1 Y 1 F MET 150 ? CG  ? F MET 9  CG  
92  1 Y 1 F MET 150 ? SD  ? F MET 9  SD  
93  1 Y 1 F MET 150 ? CE  ? F MET 9  CE  
94  1 Y 1 F ASP 151 ? CG  ? F ASP 10 CG  
95  1 Y 1 F ASP 151 ? OD1 ? F ASP 10 OD1 
96  1 Y 1 F ASP 151 ? OD2 ? F ASP 10 OD2 
97  1 Y 1 F LYS 160 ? CE  ? F LYS 19 CE  
98  1 Y 1 F LYS 160 ? NZ  ? F LYS 19 NZ  
99  1 Y 1 F LYS 161 ? NZ  ? F LYS 20 NZ  
100 1 Y 1 F SER 183 ? OG  ? F SER 42 OG  
101 1 Y 1 F LYS 185 ? CG  ? F LYS 44 CG  
102 1 Y 1 F LYS 185 ? CD  ? F LYS 44 CD  
103 1 Y 1 F LYS 185 ? CE  ? F LYS 44 CE  
104 1 Y 1 F LYS 185 ? NZ  ? F LYS 44 NZ  
105 1 Y 1 F ARG 195 ? CG  ? F ARG 54 CG  
106 1 Y 1 F ARG 195 ? CD  ? F ARG 54 CD  
107 1 Y 1 F ARG 195 ? NE  ? F ARG 54 NE  
108 1 Y 1 F ARG 195 ? CZ  ? F ARG 54 CZ  
109 1 Y 1 F ARG 195 ? NH1 ? F ARG 54 NH1 
110 1 Y 1 F ARG 195 ? NH2 ? F ARG 54 NH2 
111 1 Y 1 F ASN 199 ? CG  ? F ASN 58 CG  
112 1 Y 1 F ASN 199 ? OD1 ? F ASN 58 OD1 
113 1 Y 1 F ASN 199 ? ND2 ? F ASN 58 ND2 
114 1 Y 1 F THR 200 ? OG1 ? F THR 59 OG1 
115 1 Y 1 F THR 200 ? CG2 ? F THR 59 CG2 
116 1 Y 1 F VAL 201 ? CG1 ? F VAL 60 CG1 
117 1 Y 1 F VAL 201 ? CG2 ? F VAL 60 CG2 
118 1 Y 1 F SER 204 ? OG  ? F SER 63 OG  
119 1 Y 1 F SER 205 ? OG  ? F SER 64 OG  
120 1 Y 1 F LYS 212 ? NZ  ? F LYS 71 NZ  
121 1 Y 1 F PRO 215 ? CA  ? F PRO 74 CA  
122 1 Y 1 F PRO 215 ? C   ? F PRO 74 C   
123 1 Y 1 F PRO 215 ? O   ? F PRO 74 O   
124 1 Y 1 F PRO 215 ? CB  ? F PRO 74 CB  
125 1 Y 1 F PRO 215 ? CG  ? F PRO 74 CG  
126 1 Y 1 F PRO 215 ? CD  ? F PRO 74 CD  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 142 ? A GLY 1  
2  1 Y 1 A ALA 143 ? A ALA 2  
3  1 Y 1 A THR 144 ? A THR 3  
4  1 Y 1 A GLU 145 ? A GLU 4  
5  1 Y 1 A SER 146 ? A SER 5  
6  1 Y 1 A PRO 215 ? A PRO 74 
7  1 Y 1 A SER 216 ? A SER 75 
8  1 Y 1 A LYS 217 ? A LYS 76 
9  1 Y 1 A LEU 218 ? A LEU 77 
10 1 Y 1 A GLN 219 ? A GLN 78 
11 1 Y 1 A LYS 220 ? A LYS 79 
12 1 Y 1 B GLY 142 ? B GLY 1  
13 1 Y 1 B ALA 143 ? B ALA 2  
14 1 Y 1 B THR 144 ? B THR 3  
15 1 Y 1 B GLU 145 ? B GLU 4  
16 1 Y 1 B SER 146 ? B SER 5  
17 1 Y 1 B GLY 147 ? B GLY 6  
18 1 Y 1 B SER 216 ? B SER 75 
19 1 Y 1 B LYS 217 ? B LYS 76 
20 1 Y 1 B LEU 218 ? B LEU 77 
21 1 Y 1 B GLN 219 ? B GLN 78 
22 1 Y 1 B LYS 220 ? B LYS 79 
23 1 Y 1 E GLY 142 ? E GLY 1  
24 1 Y 1 E ALA 143 ? E ALA 2  
25 1 Y 1 E THR 144 ? E THR 3  
26 1 Y 1 E GLU 145 ? E GLU 4  
27 1 Y 1 E SER 146 ? E SER 5  
28 1 Y 1 E SER 216 ? E SER 75 
29 1 Y 1 E LYS 217 ? E LYS 76 
30 1 Y 1 E LEU 218 ? E LEU 77 
31 1 Y 1 E GLN 219 ? E GLN 78 
32 1 Y 1 E LYS 220 ? E LYS 79 
33 1 Y 1 F GLY 142 ? F GLY 1  
34 1 Y 1 F ALA 143 ? F ALA 2  
35 1 Y 1 F THR 144 ? F THR 3  
36 1 Y 1 F GLU 145 ? F GLU 4  
37 1 Y 1 F SER 146 ? F SER 5  
38 1 Y 1 F SER 216 ? F SER 75 
39 1 Y 1 F LYS 217 ? F LYS 76 
40 1 Y 1 F LEU 218 ? F LEU 77 
41 1 Y 1 F GLN 219 ? F GLN 78 
42 1 Y 1 F LYS 220 ? F LYS 79 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6C1U 'double helix'        
6C1U 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 1  1_555 D DG  12 1_555 0.328  -0.166 0.188  -3.772  2.085   -1.814 1  C_DC1:DG12_D C 1  ? D 12 ? 19 1 
1 C DG 2  1_555 D DC  11 1_555 -0.289 -0.079 -0.016 -3.666  -2.630  -2.105 2  C_DG2:DC11_D C 2  ? D 11 ? 19 1 
1 C DG 3  1_555 D DC  10 1_555 -0.384 0.069  0.316  9.111   -2.215  -0.596 3  C_DG3:DC10_D C 3  ? D 10 ? 19 1 
1 C DA 4  1_555 D DT  9  1_555 -0.017 -0.120 0.086  6.638   -19.588 -3.957 4  C_DA4:DT9_D  C 4  ? D 9  ? 20 1 
1 C DG 5  1_555 D DC  8  1_555 -0.194 -0.206 0.142  0.583   -14.089 2.680  5  C_DG5:DC8_D  C 5  ? D 8  ? 19 1 
1 C DT 6  1_555 D DA  7  1_555 0.037  -0.099 -0.096 -1.049  -4.325  -1.438 6  C_DT6:DA7_D  C 6  ? D 7  ? 20 1 
1 C DG 7  1_555 D 5CM 6  1_555 -0.240 -0.075 -0.472 -18.259 -6.297  -1.066 7  C_DG7:5CM6_D C 7  ? D 6  ? 19 1 
1 C DT 8  1_555 D DA  5  1_555 0.173  -0.176 0.412  -5.286  -7.807  -0.017 8  C_DT8:DA5_D  C 8  ? D 5  ? 20 1 
1 C DG 9  1_555 D DC  4  1_555 -0.268 -0.247 0.071  4.907   -8.714  -1.843 9  C_DG9:DC4_D  C 9  ? D 4  ? 19 1 
1 C DG 10 1_555 D DC  3  1_555 -0.033 -0.116 0.108  -1.700  -7.555  -2.391 10 C_DG10:DC3_D C 10 ? D 3  ? 19 1 
1 C DG 11 1_555 D DC  2  1_555 -0.023 -0.002 0.285  8.623   -10.069 -0.683 11 C_DG11:DC2_D C 11 ? D 2  ? 19 1 
1 C DC 12 1_555 D DG  1  1_555 0.143  -0.067 -0.206 7.897   -5.270  -1.640 12 C_DC12:DG1_D C 12 ? D 1  ? 19 1 
1 G DC 1  1_555 H DG  12 1_555 0.205  -0.250 0.219  -7.626  0.434   -3.258 13 G_DC1:DG12_H G 1  ? H 12 ? 19 1 
1 G DG 2  1_555 H DC  11 1_555 -0.284 -0.183 -0.072 -3.616  -6.972  -2.093 14 G_DG2:DC11_H G 2  ? H 11 ? 19 1 
1 G DG 3  1_555 H DC  10 1_555 -0.322 -0.158 0.267  4.401   -7.601  -1.180 15 G_DG3:DC10_H G 3  ? H 10 ? 19 1 
1 G DA 4  1_555 H DT  9  1_555 0.105  -0.115 0.114  4.365   -19.607 0.047  16 G_DA4:DT9_H  G 4  ? H 9  ? 20 1 
1 G DG 5  1_555 H DC  8  1_555 -0.020 -0.214 0.048  -2.050  -15.625 -0.556 17 G_DG5:DC8_H  G 5  ? H 8  ? 19 1 
1 G DT 6  1_555 H DA  7  1_555 0.025  -0.177 -0.056 -3.002  -3.276  1.047  18 G_DT6:DA7_H  G 6  ? H 7  ? 20 1 
1 G DG 7  1_555 H 5CM 6  1_555 -0.294 -0.168 -0.286 -13.513 -5.373  -0.363 19 G_DG7:5CM6_H G 7  ? H 6  ? 19 1 
1 G DT 8  1_555 H DA  5  1_555 -0.057 -0.060 0.306  -4.942  -7.739  -0.328 20 G_DT8:DA5_H  G 8  ? H 5  ? 20 1 
1 G DG 9  1_555 H DC  4  1_555 -0.076 -0.180 0.116  3.359   -9.057  -2.688 21 G_DG9:DC4_H  G 9  ? H 4  ? 19 1 
1 G DG 10 1_555 H DC  3  1_555 -0.059 -0.109 0.140  1.582   -8.186  -1.062 22 G_DG10:DC3_H G 10 ? H 3  ? 19 1 
1 G DG 11 1_555 H DC  2  1_555 0.126  0.016  0.075  7.574   -10.880 -0.768 23 G_DG11:DC2_H G 11 ? H 2  ? 19 1 
1 G DC 12 1_555 H DG  1  1_555 0.419  -0.091 -0.033 5.383   -6.914  2.891  24 G_DC12:DG1_H G 12 ? H 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 1  1_555 D DG  12 1_555 C DG 2  1_555 D DC  11 1_555 -0.206 0.103  3.307 1.740  -1.519 39.141 0.336  0.517  3.289 -2.265 
-2.594 39.207 1  CC_DC1DG2:DC11DG12_DD C 1  ? D 12 ? C 2  ? D 11 ? 
1 C DG 2  1_555 D DC  11 1_555 C DG 3  1_555 D DC  10 1_555 0.399  0.864  3.028 -0.645 4.165  26.904 0.850  -1.000 3.113 8.881  
1.376  27.226 2  CC_DG2DG3:DC10DC11_DD C 2  ? D 11 ? C 3  ? D 10 ? 
1 C DG 3  1_555 D DC  10 1_555 C DA 4  1_555 D DT  9  1_555 -1.140 1.668  3.440 1.666  -0.123 40.541 2.420  1.838  3.388 -0.178 
-2.402 40.574 3  CC_DG3DA4:DT9DC10_DD  C 3  ? D 10 ? C 4  ? D 9  ? 
1 C DA 4  1_555 D DT  9  1_555 C DG 5  1_555 D DC  8  1_555 0.931  0.102  3.400 -1.069 4.702  36.140 -0.513 -1.642 3.358 7.538  
1.713  36.450 4  CC_DA4DG5:DC8DT9_DD   C 4  ? D 9  ? C 5  ? D 8  ? 
1 C DG 5  1_555 D DC  8  1_555 C DT 6  1_555 D DA  7  1_555 -0.201 -0.319 3.265 1.539  -1.239 34.902 -0.345 0.567  3.263 -2.064 
-2.564 34.957 5  CC_DG5DT6:DA7DC8_DD   C 5  ? D 8  ? C 6  ? D 7  ? 
1 C DT 6  1_555 D DA  7  1_555 C DG 7  1_555 D 5CM 6  1_555 0.107  -0.240 3.712 0.021  3.529  43.849 -0.697 -0.140 3.683 4.717  
-0.028 43.983 6  CC_DT6DG7:5CM6DA7_DD  C 6  ? D 7  ? C 7  ? D 6  ? 
1 C DG 7  1_555 D 5CM 6  1_555 C DT 8  1_555 D DA  5  1_555 -0.597 -0.396 3.035 -6.862 -0.454 30.015 -0.662 -0.150 3.098 -0.862 
13.034 30.775 7  CC_DG7DT8:DA55CM6_DD  C 7  ? D 6  ? C 8  ? D 5  ? 
1 C DT 8  1_555 D DA  5  1_555 C DG 9  1_555 D DC  4  1_555 -0.558 0.655  3.032 2.705  6.024  25.709 -0.069 1.888  3.031 13.262 
-5.954 26.530 8  CC_DT8DG9:DC4DA5_DD   C 8  ? D 5  ? C 9  ? D 4  ? 
1 C DG 9  1_555 D DC  4  1_555 C DG 10 1_555 D DC  3  1_555 0.083  1.681  3.445 -0.187 -6.580 48.592 2.534  -0.115 3.205 -7.954 
0.226  49.009 9  CC_DG9DG10:DC3DC4_DD  C 9  ? D 4  ? C 10 ? D 3  ? 
1 C DG 10 1_555 D DC  3  1_555 C DG 11 1_555 D DC  2  1_555 -0.002 0.350  3.070 -0.968 4.947  32.136 -0.193 -0.157 3.087 8.868  
1.735  32.519 10 CC_DG10DG11:DC2DC3_DD C 10 ? D 3  ? C 11 ? D 2  ? 
1 C DG 11 1_555 D DC  2  1_555 C DC 12 1_555 D DG  1  1_555 0.824  -0.409 3.304 2.751  -3.146 34.728 -0.195 -0.946 3.380 -5.247 
-4.588 34.970 11 CC_DG11DC12:DG1DC2_DD C 11 ? D 2  ? C 12 ? D 1  ? 
1 G DC 1  1_555 H DG  12 1_555 G DG 2  1_555 H DC  11 1_555 -0.192 0.079  3.214 2.098  -0.792 38.300 0.218  0.550  3.197 -1.205 
-3.194 38.363 12 GG_DC1DG2:DC11DG12_HH G 1  ? H 12 ? G 2  ? H 11 ? 
1 G DG 2  1_555 H DC  11 1_555 G DG 3  1_555 H DC  10 1_555 0.447  0.801  3.140 -1.829 4.896  28.928 0.553  -1.264 3.196 9.701  
3.624  29.386 13 GG_DG2DG3:DC10DC11_HH G 2  ? H 11 ? G 3  ? H 10 ? 
1 G DG 3  1_555 H DC  10 1_555 G DA 4  1_555 H DT  9  1_555 -1.044 1.715  3.348 0.471  -1.028 39.492 2.660  1.600  3.292 -1.520 
-0.696 39.508 14 GG_DG3DA4:DT9DC10_HH  G 3  ? H 10 ? G 4  ? H 9  ? 
1 G DA 4  1_555 H DT  9  1_555 G DG 5  1_555 H DC  8  1_555 0.531  0.035  3.433 -1.281 5.779  37.171 -0.734 -0.998 3.381 8.996  
1.994  37.623 15 GG_DA4DG5:DC8DT9_HH   G 4  ? H 9  ? G 5  ? H 8  ? 
1 G DG 5  1_555 H DC  8  1_555 G DT 6  1_555 H DA  7  1_555 0.077  -0.289 3.357 0.990  -4.664 34.282 0.256  0.028  3.366 -7.864 
-1.670 34.602 16 GG_DG5DT6:DA7DC8_HH   G 5  ? H 8  ? G 6  ? H 7  ? 
1 G DT 6  1_555 H DA  7  1_555 G DG 7  1_555 H 5CM 6  1_555 0.185  -0.267 3.472 0.430  4.250  43.306 -0.794 -0.206 3.434 5.742  
-0.581 43.506 17 GG_DT6DG7:5CM6DA7_HH  G 6  ? H 7  ? G 7  ? H 6  ? 
1 G DG 7  1_555 H 5CM 6  1_555 G DT 8  1_555 H DA  5  1_555 -0.618 -0.456 3.129 -4.256 0.453  29.034 -0.994 0.332  3.178 0.898  
8.430  29.341 18 GG_DG7DT8:DA55CM6_HH  G 7  ? H 6  ? G 8  ? H 5  ? 
1 G DT 8  1_555 H DA  5  1_555 G DG 9  1_555 H DC  4  1_555 -0.581 0.573  3.123 0.964  5.708  27.667 -0.112 1.407  3.154 11.772 
-1.988 28.255 19 GG_DT8DG9:DC4DA5_HH   G 8  ? H 5  ? G 9  ? H 4  ? 
1 G DG 9  1_555 H DC  4  1_555 G DG 10 1_555 H DC  3  1_555 0.101  1.622  3.419 -0.001 -4.496 46.632 2.422  -0.127 3.258 -5.664 
0.001  46.836 20 GG_DG9DG10:DC3DC4_HH  G 9  ? H 4  ? G 10 ? H 3  ? 
1 G DG 10 1_555 H DC  3  1_555 G DG 11 1_555 H DC  2  1_555 -0.241 0.369  3.193 0.256  3.111  33.016 0.133  0.465  3.212 5.458  
-0.450 33.159 21 GG_DG10DG11:DC2DC3_HH G 10 ? H 3  ? G 11 ? H 2  ? 
1 G DG 11 1_555 H DC  2  1_555 G DC 12 1_555 H DG  1  1_555 1.083  -0.307 3.329 0.152  -1.724 34.786 -0.245 -1.786 3.345 -2.881 
-0.255 34.828 22 GG_DG11DC12:DG1DC2_HH G 11 ? H 2  ? G 12 ? H 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'UNKNOWN ATOM OR ION' UNX 
5 water                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   homology 
_pdbx_struct_assembly_auth_evidence.details                'see PDB entry 2KY8' 
#