data_6C3P
# 
_entry.id   6C3P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6C3P         
WWPDB D_1000231905 
EMDB  EMD-7339     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Cryo-EM structure of human KATP bound to ATP and ADP in propeller form' EMD-7339 'associated EM volume' 
EMDB .                                                                        EMD-7338 'other EM volume'      
PDB  .                                                                        6C3O     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6C3P 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lee, K.P.K.'   1 ? 
'Chen, J.'      2 ? 
'MacKinnon, R.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Molecular structure of human KATP in complex with ATP and ADP.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.32481 
_citation.pdbx_database_id_PubMed   29286281 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, K.P.K.'   1 
primary 'Chen, J.'      2 
primary 'MacKinnon, R.' 3 
# 
_cell.angle_alpha                  90 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6C3P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6C3P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-sensitive inward rectifier potassium channel 11' 45144.367  4 ? ? ? ? 
2 polymer     man 'ATP-binding cassette sub-family C member 8'          177180.219 4 ? ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                           507.181    8 ? ? ? ? 
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                            427.201    4 ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                       24.305     8 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'IKATP,Inward rectifier K(+) channel Kir6.2,Potassium channel,inwardly rectifying subfamily J member 11' 
2 'Sulfonylurea receptor 1'                                                                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SASASAMLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLI
FTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNI
VGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLH
QVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQR
FVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLSSNSL
EVLFQG
;
;SASASAMLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLI
FTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNI
VGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLH
QVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQR
FVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLSSNSL
EVLFQG
;
A,D,B,C ? 
2 'polypeptide(L)' no no 
;MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFM
LLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTSVVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLVLSSTFRILADLLGFAGPLCI
FGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYTSISIFMNTAIPIAAVLITFV
GHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQA
VPLRVVNRKRPAREDCRGLTGPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLNATVEENIIFESPFNKQRYKM
VIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDK
RTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS
SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDSA
LTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSI
LNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL
SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAVTSISNSLHRELSAGLV
GLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPV
LKHVNALIAPGQKIGICGRTGSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD
PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQ
KVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFDKPEKLLSRKDSVFASFVRADK
;
;MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFM
LLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTSVVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLVLSSTFRILADLLGFAGPLCI
FGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYTSISIFMNTAIPIAAVLITFV
GHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQA
VPLRVVNRKRPAREDCRGLTGPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLNATVEENIIFESPFNKQRYKM
VIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDK
RTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS
SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDSA
LTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSI
LNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL
SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAVTSISNSLHRELSAGLV
GLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPV
LKHVNALIAPGQKIGICGRTGSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD
PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQ
KVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFDKPEKLLSRKDSVFASFVRADK
;
E,H,G,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    SER n 
1 2    ALA n 
1 3    SER n 
1 4    ALA n 
1 5    SER n 
1 6    ALA n 
1 7    MET n 
1 8    LEU n 
1 9    SER n 
1 10   ARG n 
1 11   LYS n 
1 12   GLY n 
1 13   ILE n 
1 14   ILE n 
1 15   PRO n 
1 16   GLU n 
1 17   GLU n 
1 18   TYR n 
1 19   VAL n 
1 20   LEU n 
1 21   THR n 
1 22   ARG n 
1 23   LEU n 
1 24   ALA n 
1 25   GLU n 
1 26   ASP n 
1 27   PRO n 
1 28   ALA n 
1 29   GLU n 
1 30   PRO n 
1 31   ARG n 
1 32   TYR n 
1 33   ARG n 
1 34   ALA n 
1 35   ARG n 
1 36   GLN n 
1 37   ARG n 
1 38   ARG n 
1 39   ALA n 
1 40   ARG n 
1 41   PHE n 
1 42   VAL n 
1 43   SER n 
1 44   LYS n 
1 45   LYS n 
1 46   GLY n 
1 47   ASN n 
1 48   CYS n 
1 49   ASN n 
1 50   VAL n 
1 51   ALA n 
1 52   HIS n 
1 53   LYS n 
1 54   ASN n 
1 55   ILE n 
1 56   ARG n 
1 57   GLU n 
1 58   GLN n 
1 59   GLY n 
1 60   ARG n 
1 61   PHE n 
1 62   LEU n 
1 63   GLN n 
1 64   ASP n 
1 65   VAL n 
1 66   PHE n 
1 67   THR n 
1 68   THR n 
1 69   LEU n 
1 70   VAL n 
1 71   ASP n 
1 72   LEU n 
1 73   LYS n 
1 74   TRP n 
1 75   PRO n 
1 76   HIS n 
1 77   THR n 
1 78   LEU n 
1 79   LEU n 
1 80   ILE n 
1 81   PHE n 
1 82   THR n 
1 83   MET n 
1 84   SER n 
1 85   PHE n 
1 86   LEU n 
1 87   CYS n 
1 88   SER n 
1 89   TRP n 
1 90   LEU n 
1 91   LEU n 
1 92   PHE n 
1 93   ALA n 
1 94   MET n 
1 95   ALA n 
1 96   TRP n 
1 97   TRP n 
1 98   LEU n 
1 99   ILE n 
1 100  ALA n 
1 101  PHE n 
1 102  ALA n 
1 103  HIS n 
1 104  GLY n 
1 105  ASP n 
1 106  LEU n 
1 107  ALA n 
1 108  PRO n 
1 109  SER n 
1 110  GLU n 
1 111  GLY n 
1 112  THR n 
1 113  ALA n 
1 114  GLU n 
1 115  PRO n 
1 116  CYS n 
1 117  VAL n 
1 118  THR n 
1 119  SER n 
1 120  ILE n 
1 121  HIS n 
1 122  SER n 
1 123  PHE n 
1 124  SER n 
1 125  SER n 
1 126  ALA n 
1 127  PHE n 
1 128  LEU n 
1 129  PHE n 
1 130  SER n 
1 131  ILE n 
1 132  GLU n 
1 133  VAL n 
1 134  GLN n 
1 135  VAL n 
1 136  THR n 
1 137  ILE n 
1 138  GLY n 
1 139  PHE n 
1 140  GLY n 
1 141  GLY n 
1 142  ARG n 
1 143  MET n 
1 144  VAL n 
1 145  THR n 
1 146  GLU n 
1 147  GLU n 
1 148  CYS n 
1 149  PRO n 
1 150  LEU n 
1 151  ALA n 
1 152  ILE n 
1 153  LEU n 
1 154  ILE n 
1 155  LEU n 
1 156  ILE n 
1 157  VAL n 
1 158  GLN n 
1 159  ASN n 
1 160  ILE n 
1 161  VAL n 
1 162  GLY n 
1 163  LEU n 
1 164  MET n 
1 165  ILE n 
1 166  ASN n 
1 167  ALA n 
1 168  ILE n 
1 169  MET n 
1 170  LEU n 
1 171  GLY n 
1 172  CYS n 
1 173  ILE n 
1 174  PHE n 
1 175  MET n 
1 176  LYS n 
1 177  THR n 
1 178  ALA n 
1 179  GLN n 
1 180  ALA n 
1 181  HIS n 
1 182  ARG n 
1 183  ARG n 
1 184  ALA n 
1 185  GLU n 
1 186  THR n 
1 187  LEU n 
1 188  ILE n 
1 189  PHE n 
1 190  SER n 
1 191  LYS n 
1 192  HIS n 
1 193  ALA n 
1 194  VAL n 
1 195  ILE n 
1 196  ALA n 
1 197  LEU n 
1 198  ARG n 
1 199  HIS n 
1 200  GLY n 
1 201  ARG n 
1 202  LEU n 
1 203  CYS n 
1 204  PHE n 
1 205  MET n 
1 206  LEU n 
1 207  ARG n 
1 208  VAL n 
1 209  GLY n 
1 210  ASP n 
1 211  LEU n 
1 212  ARG n 
1 213  LYS n 
1 214  SER n 
1 215  MET n 
1 216  ILE n 
1 217  ILE n 
1 218  SER n 
1 219  ALA n 
1 220  THR n 
1 221  ILE n 
1 222  HIS n 
1 223  MET n 
1 224  GLN n 
1 225  VAL n 
1 226  VAL n 
1 227  ARG n 
1 228  LYS n 
1 229  THR n 
1 230  THR n 
1 231  SER n 
1 232  PRO n 
1 233  GLU n 
1 234  GLY n 
1 235  GLU n 
1 236  VAL n 
1 237  VAL n 
1 238  PRO n 
1 239  LEU n 
1 240  HIS n 
1 241  GLN n 
1 242  VAL n 
1 243  ASP n 
1 244  ILE n 
1 245  PRO n 
1 246  MET n 
1 247  GLU n 
1 248  ASN n 
1 249  GLY n 
1 250  VAL n 
1 251  GLY n 
1 252  GLY n 
1 253  ASN n 
1 254  SER n 
1 255  ILE n 
1 256  PHE n 
1 257  LEU n 
1 258  VAL n 
1 259  ALA n 
1 260  PRO n 
1 261  LEU n 
1 262  ILE n 
1 263  ILE n 
1 264  TYR n 
1 265  HIS n 
1 266  VAL n 
1 267  ILE n 
1 268  ASP n 
1 269  ALA n 
1 270  ASN n 
1 271  SER n 
1 272  PRO n 
1 273  LEU n 
1 274  TYR n 
1 275  ASP n 
1 276  LEU n 
1 277  ALA n 
1 278  PRO n 
1 279  SER n 
1 280  ASP n 
1 281  LEU n 
1 282  HIS n 
1 283  HIS n 
1 284  HIS n 
1 285  GLN n 
1 286  ASP n 
1 287  LEU n 
1 288  GLU n 
1 289  ILE n 
1 290  ILE n 
1 291  VAL n 
1 292  ILE n 
1 293  LEU n 
1 294  GLU n 
1 295  GLY n 
1 296  VAL n 
1 297  VAL n 
1 298  GLU n 
1 299  THR n 
1 300  THR n 
1 301  GLY n 
1 302  ILE n 
1 303  THR n 
1 304  THR n 
1 305  GLN n 
1 306  ALA n 
1 307  ARG n 
1 308  THR n 
1 309  SER n 
1 310  TYR n 
1 311  LEU n 
1 312  ALA n 
1 313  ASP n 
1 314  GLU n 
1 315  ILE n 
1 316  LEU n 
1 317  TRP n 
1 318  GLY n 
1 319  GLN n 
1 320  ARG n 
1 321  PHE n 
1 322  VAL n 
1 323  PRO n 
1 324  ILE n 
1 325  VAL n 
1 326  ALA n 
1 327  GLU n 
1 328  GLU n 
1 329  ASP n 
1 330  GLY n 
1 331  ARG n 
1 332  TYR n 
1 333  SER n 
1 334  VAL n 
1 335  ASP n 
1 336  TYR n 
1 337  SER n 
1 338  LYS n 
1 339  PHE n 
1 340  GLY n 
1 341  ASN n 
1 342  THR n 
1 343  ILE n 
1 344  LYS n 
1 345  VAL n 
1 346  PRO n 
1 347  THR n 
1 348  PRO n 
1 349  LEU n 
1 350  CYS n 
1 351  THR n 
1 352  ALA n 
1 353  ARG n 
1 354  GLN n 
1 355  LEU n 
1 356  ASP n 
1 357  GLU n 
1 358  ASP n 
1 359  HIS n 
1 360  SER n 
1 361  LEU n 
1 362  LEU n 
1 363  GLU n 
1 364  ALA n 
1 365  LEU n 
1 366  THR n 
1 367  LEU n 
1 368  ALA n 
1 369  SER n 
1 370  ALA n 
1 371  ARG n 
1 372  GLY n 
1 373  PRO n 
1 374  LEU n 
1 375  ARG n 
1 376  LYS n 
1 377  ARG n 
1 378  SER n 
1 379  VAL n 
1 380  PRO n 
1 381  MET n 
1 382  ALA n 
1 383  LYS n 
1 384  ALA n 
1 385  LYS n 
1 386  PRO n 
1 387  LYS n 
1 388  PHE n 
1 389  SER n 
1 390  ILE n 
1 391  SER n 
1 392  PRO n 
1 393  ASP n 
1 394  SER n 
1 395  LEU n 
1 396  SER n 
1 397  SER n 
1 398  ASN n 
1 399  SER n 
1 400  LEU n 
1 401  GLU n 
1 402  VAL n 
1 403  LEU n 
1 404  PHE n 
1 405  GLN n 
1 406  GLY n 
2 1    MET n 
2 2    PRO n 
2 3    LEU n 
2 4    ALA n 
2 5    PHE n 
2 6    CYS n 
2 7    GLY n 
2 8    SER n 
2 9    GLU n 
2 10   ASN n 
2 11   HIS n 
2 12   SER n 
2 13   ALA n 
2 14   ALA n 
2 15   TYR n 
2 16   ARG n 
2 17   VAL n 
2 18   ASP n 
2 19   GLN n 
2 20   GLY n 
2 21   VAL n 
2 22   LEU n 
2 23   ASN n 
2 24   ASN n 
2 25   GLY n 
2 26   CYS n 
2 27   PHE n 
2 28   VAL n 
2 29   ASP n 
2 30   ALA n 
2 31   LEU n 
2 32   ASN n 
2 33   VAL n 
2 34   VAL n 
2 35   PRO n 
2 36   HIS n 
2 37   VAL n 
2 38   PHE n 
2 39   LEU n 
2 40   LEU n 
2 41   PHE n 
2 42   ILE n 
2 43   THR n 
2 44   PHE n 
2 45   PRO n 
2 46   ILE n 
2 47   LEU n 
2 48   PHE n 
2 49   ILE n 
2 50   GLY n 
2 51   TRP n 
2 52   GLY n 
2 53   SER n 
2 54   GLN n 
2 55   SER n 
2 56   SER n 
2 57   LYS n 
2 58   VAL n 
2 59   HIS n 
2 60   ILE n 
2 61   HIS n 
2 62   HIS n 
2 63   SER n 
2 64   THR n 
2 65   TRP n 
2 66   LEU n 
2 67   HIS n 
2 68   PHE n 
2 69   PRO n 
2 70   GLY n 
2 71   HIS n 
2 72   ASN n 
2 73   LEU n 
2 74   ARG n 
2 75   TRP n 
2 76   ILE n 
2 77   LEU n 
2 78   THR n 
2 79   PHE n 
2 80   MET n 
2 81   LEU n 
2 82   LEU n 
2 83   PHE n 
2 84   VAL n 
2 85   LEU n 
2 86   VAL n 
2 87   CYS n 
2 88   GLU n 
2 89   ILE n 
2 90   ALA n 
2 91   GLU n 
2 92   GLY n 
2 93   ILE n 
2 94   LEU n 
2 95   SER n 
2 96   ASP n 
2 97   GLY n 
2 98   VAL n 
2 99   THR n 
2 100  GLU n 
2 101  SER n 
2 102  HIS n 
2 103  HIS n 
2 104  LEU n 
2 105  HIS n 
2 106  LEU n 
2 107  TYR n 
2 108  MET n 
2 109  PRO n 
2 110  ALA n 
2 111  GLY n 
2 112  MET n 
2 113  ALA n 
2 114  PHE n 
2 115  MET n 
2 116  ALA n 
2 117  ALA n 
2 118  VAL n 
2 119  THR n 
2 120  SER n 
2 121  VAL n 
2 122  VAL n 
2 123  TYR n 
2 124  TYR n 
2 125  HIS n 
2 126  ASN n 
2 127  ILE n 
2 128  GLU n 
2 129  THR n 
2 130  SER n 
2 131  ASN n 
2 132  PHE n 
2 133  PRO n 
2 134  LYS n 
2 135  LEU n 
2 136  LEU n 
2 137  ILE n 
2 138  ALA n 
2 139  LEU n 
2 140  LEU n 
2 141  VAL n 
2 142  TYR n 
2 143  TRP n 
2 144  THR n 
2 145  LEU n 
2 146  ALA n 
2 147  PHE n 
2 148  ILE n 
2 149  THR n 
2 150  LYS n 
2 151  THR n 
2 152  ILE n 
2 153  LYS n 
2 154  PHE n 
2 155  VAL n 
2 156  LYS n 
2 157  PHE n 
2 158  LEU n 
2 159  ASP n 
2 160  HIS n 
2 161  ALA n 
2 162  ILE n 
2 163  GLY n 
2 164  PHE n 
2 165  SER n 
2 166  GLN n 
2 167  LEU n 
2 168  ARG n 
2 169  PHE n 
2 170  CYS n 
2 171  LEU n 
2 172  THR n 
2 173  GLY n 
2 174  LEU n 
2 175  LEU n 
2 176  VAL n 
2 177  ILE n 
2 178  LEU n 
2 179  TYR n 
2 180  GLY n 
2 181  MET n 
2 182  LEU n 
2 183  LEU n 
2 184  LEU n 
2 185  VAL n 
2 186  GLU n 
2 187  VAL n 
2 188  ASN n 
2 189  VAL n 
2 190  ILE n 
2 191  ARG n 
2 192  VAL n 
2 193  ARG n 
2 194  ARG n 
2 195  TYR n 
2 196  ILE n 
2 197  PHE n 
2 198  PHE n 
2 199  LYS n 
2 200  THR n 
2 201  PRO n 
2 202  ARG n 
2 203  GLU n 
2 204  VAL n 
2 205  LYS n 
2 206  PRO n 
2 207  PRO n 
2 208  GLU n 
2 209  ASP n 
2 210  LEU n 
2 211  GLN n 
2 212  ASP n 
2 213  LEU n 
2 214  GLY n 
2 215  VAL n 
2 216  ARG n 
2 217  PHE n 
2 218  LEU n 
2 219  GLN n 
2 220  PRO n 
2 221  PHE n 
2 222  VAL n 
2 223  ASN n 
2 224  LEU n 
2 225  LEU n 
2 226  SER n 
2 227  LYS n 
2 228  GLY n 
2 229  THR n 
2 230  TYR n 
2 231  TRP n 
2 232  TRP n 
2 233  MET n 
2 234  ASN n 
2 235  ALA n 
2 236  PHE n 
2 237  ILE n 
2 238  LYS n 
2 239  THR n 
2 240  ALA n 
2 241  HIS n 
2 242  LYS n 
2 243  LYS n 
2 244  PRO n 
2 245  ILE n 
2 246  ASP n 
2 247  LEU n 
2 248  ARG n 
2 249  ALA n 
2 250  ILE n 
2 251  GLY n 
2 252  LYS n 
2 253  LEU n 
2 254  PRO n 
2 255  ILE n 
2 256  ALA n 
2 257  MET n 
2 258  ARG n 
2 259  ALA n 
2 260  LEU n 
2 261  THR n 
2 262  ASN n 
2 263  TYR n 
2 264  GLN n 
2 265  ARG n 
2 266  LEU n 
2 267  CYS n 
2 268  GLU n 
2 269  ALA n 
2 270  PHE n 
2 271  ASP n 
2 272  ALA n 
2 273  GLN n 
2 274  VAL n 
2 275  ARG n 
2 276  LYS n 
2 277  ASP n 
2 278  ILE n 
2 279  GLN n 
2 280  GLY n 
2 281  THR n 
2 282  GLN n 
2 283  GLY n 
2 284  ALA n 
2 285  ARG n 
2 286  ALA n 
2 287  ILE n 
2 288  TRP n 
2 289  GLN n 
2 290  ALA n 
2 291  LEU n 
2 292  SER n 
2 293  HIS n 
2 294  ALA n 
2 295  PHE n 
2 296  GLY n 
2 297  ARG n 
2 298  ARG n 
2 299  LEU n 
2 300  VAL n 
2 301  LEU n 
2 302  SER n 
2 303  SER n 
2 304  THR n 
2 305  PHE n 
2 306  ARG n 
2 307  ILE n 
2 308  LEU n 
2 309  ALA n 
2 310  ASP n 
2 311  LEU n 
2 312  LEU n 
2 313  GLY n 
2 314  PHE n 
2 315  ALA n 
2 316  GLY n 
2 317  PRO n 
2 318  LEU n 
2 319  CYS n 
2 320  ILE n 
2 321  PHE n 
2 322  GLY n 
2 323  ILE n 
2 324  VAL n 
2 325  ASP n 
2 326  HIS n 
2 327  LEU n 
2 328  GLY n 
2 329  LYS n 
2 330  GLU n 
2 331  ASN n 
2 332  ASP n 
2 333  VAL n 
2 334  PHE n 
2 335  GLN n 
2 336  PRO n 
2 337  LYS n 
2 338  THR n 
2 339  GLN n 
2 340  PHE n 
2 341  LEU n 
2 342  GLY n 
2 343  VAL n 
2 344  TYR n 
2 345  PHE n 
2 346  VAL n 
2 347  SER n 
2 348  SER n 
2 349  GLN n 
2 350  GLU n 
2 351  PHE n 
2 352  LEU n 
2 353  ALA n 
2 354  ASN n 
2 355  ALA n 
2 356  TYR n 
2 357  VAL n 
2 358  LEU n 
2 359  ALA n 
2 360  VAL n 
2 361  LEU n 
2 362  LEU n 
2 363  PHE n 
2 364  LEU n 
2 365  ALA n 
2 366  LEU n 
2 367  LEU n 
2 368  LEU n 
2 369  GLN n 
2 370  ARG n 
2 371  THR n 
2 372  PHE n 
2 373  LEU n 
2 374  GLN n 
2 375  ALA n 
2 376  SER n 
2 377  TYR n 
2 378  TYR n 
2 379  VAL n 
2 380  ALA n 
2 381  ILE n 
2 382  GLU n 
2 383  THR n 
2 384  GLY n 
2 385  ILE n 
2 386  ASN n 
2 387  LEU n 
2 388  ARG n 
2 389  GLY n 
2 390  ALA n 
2 391  ILE n 
2 392  GLN n 
2 393  THR n 
2 394  LYS n 
2 395  ILE n 
2 396  TYR n 
2 397  ASN n 
2 398  LYS n 
2 399  ILE n 
2 400  MET n 
2 401  HIS n 
2 402  LEU n 
2 403  SER n 
2 404  THR n 
2 405  SER n 
2 406  ASN n 
2 407  LEU n 
2 408  SER n 
2 409  MET n 
2 410  GLY n 
2 411  GLU n 
2 412  MET n 
2 413  THR n 
2 414  ALA n 
2 415  GLY n 
2 416  GLN n 
2 417  ILE n 
2 418  CYS n 
2 419  ASN n 
2 420  LEU n 
2 421  VAL n 
2 422  ALA n 
2 423  ILE n 
2 424  ASP n 
2 425  THR n 
2 426  ASN n 
2 427  GLN n 
2 428  LEU n 
2 429  MET n 
2 430  TRP n 
2 431  PHE n 
2 432  PHE n 
2 433  PHE n 
2 434  LEU n 
2 435  CYS n 
2 436  PRO n 
2 437  ASN n 
2 438  LEU n 
2 439  TRP n 
2 440  ALA n 
2 441  MET n 
2 442  PRO n 
2 443  VAL n 
2 444  GLN n 
2 445  ILE n 
2 446  ILE n 
2 447  VAL n 
2 448  GLY n 
2 449  VAL n 
2 450  ILE n 
2 451  LEU n 
2 452  LEU n 
2 453  TYR n 
2 454  TYR n 
2 455  ILE n 
2 456  LEU n 
2 457  GLY n 
2 458  VAL n 
2 459  SER n 
2 460  ALA n 
2 461  LEU n 
2 462  ILE n 
2 463  GLY n 
2 464  ALA n 
2 465  ALA n 
2 466  VAL n 
2 467  ILE n 
2 468  ILE n 
2 469  LEU n 
2 470  LEU n 
2 471  ALA n 
2 472  PRO n 
2 473  VAL n 
2 474  GLN n 
2 475  TYR n 
2 476  PHE n 
2 477  VAL n 
2 478  ALA n 
2 479  THR n 
2 480  LYS n 
2 481  LEU n 
2 482  SER n 
2 483  GLN n 
2 484  ALA n 
2 485  GLN n 
2 486  ARG n 
2 487  SER n 
2 488  THR n 
2 489  LEU n 
2 490  GLU n 
2 491  TYR n 
2 492  SER n 
2 493  ASN n 
2 494  GLU n 
2 495  ARG n 
2 496  LEU n 
2 497  LYS n 
2 498  GLN n 
2 499  THR n 
2 500  ASN n 
2 501  GLU n 
2 502  MET n 
2 503  LEU n 
2 504  ARG n 
2 505  GLY n 
2 506  ILE n 
2 507  LYS n 
2 508  LEU n 
2 509  LEU n 
2 510  LYS n 
2 511  LEU n 
2 512  TYR n 
2 513  ALA n 
2 514  TRP n 
2 515  GLU n 
2 516  ASN n 
2 517  ILE n 
2 518  PHE n 
2 519  ARG n 
2 520  THR n 
2 521  ARG n 
2 522  VAL n 
2 523  GLU n 
2 524  THR n 
2 525  THR n 
2 526  ARG n 
2 527  ARG n 
2 528  LYS n 
2 529  GLU n 
2 530  MET n 
2 531  THR n 
2 532  SER n 
2 533  LEU n 
2 534  ARG n 
2 535  ALA n 
2 536  PHE n 
2 537  ALA n 
2 538  ILE n 
2 539  TYR n 
2 540  THR n 
2 541  SER n 
2 542  ILE n 
2 543  SER n 
2 544  ILE n 
2 545  PHE n 
2 546  MET n 
2 547  ASN n 
2 548  THR n 
2 549  ALA n 
2 550  ILE n 
2 551  PRO n 
2 552  ILE n 
2 553  ALA n 
2 554  ALA n 
2 555  VAL n 
2 556  LEU n 
2 557  ILE n 
2 558  THR n 
2 559  PHE n 
2 560  VAL n 
2 561  GLY n 
2 562  HIS n 
2 563  VAL n 
2 564  SER n 
2 565  PHE n 
2 566  PHE n 
2 567  LYS n 
2 568  GLU n 
2 569  ALA n 
2 570  ASP n 
2 571  PHE n 
2 572  SER n 
2 573  PRO n 
2 574  SER n 
2 575  VAL n 
2 576  ALA n 
2 577  PHE n 
2 578  ALA n 
2 579  SER n 
2 580  LEU n 
2 581  SER n 
2 582  LEU n 
2 583  PHE n 
2 584  HIS n 
2 585  ILE n 
2 586  LEU n 
2 587  VAL n 
2 588  THR n 
2 589  PRO n 
2 590  LEU n 
2 591  PHE n 
2 592  LEU n 
2 593  LEU n 
2 594  SER n 
2 595  SER n 
2 596  VAL n 
2 597  VAL n 
2 598  ARG n 
2 599  SER n 
2 600  THR n 
2 601  VAL n 
2 602  LYS n 
2 603  ALA n 
2 604  LEU n 
2 605  VAL n 
2 606  SER n 
2 607  VAL n 
2 608  GLN n 
2 609  LYS n 
2 610  LEU n 
2 611  SER n 
2 612  GLU n 
2 613  PHE n 
2 614  LEU n 
2 615  SER n 
2 616  SER n 
2 617  ALA n 
2 618  GLU n 
2 619  ILE n 
2 620  ARG n 
2 621  GLU n 
2 622  GLU n 
2 623  GLN n 
2 624  CYS n 
2 625  ALA n 
2 626  PRO n 
2 627  HIS n 
2 628  GLU n 
2 629  PRO n 
2 630  THR n 
2 631  PRO n 
2 632  GLN n 
2 633  GLY n 
2 634  PRO n 
2 635  ALA n 
2 636  SER n 
2 637  LYS n 
2 638  TYR n 
2 639  GLN n 
2 640  ALA n 
2 641  VAL n 
2 642  PRO n 
2 643  LEU n 
2 644  ARG n 
2 645  VAL n 
2 646  VAL n 
2 647  ASN n 
2 648  ARG n 
2 649  LYS n 
2 650  ARG n 
2 651  PRO n 
2 652  ALA n 
2 653  ARG n 
2 654  GLU n 
2 655  ASP n 
2 656  CYS n 
2 657  ARG n 
2 658  GLY n 
2 659  LEU n 
2 660  THR n 
2 661  GLY n 
2 662  PRO n 
2 663  LEU n 
2 664  GLN n 
2 665  SER n 
2 666  LEU n 
2 667  VAL n 
2 668  PRO n 
2 669  SER n 
2 670  ALA n 
2 671  ASP n 
2 672  GLY n 
2 673  ASP n 
2 674  ALA n 
2 675  ASP n 
2 676  ASN n 
2 677  CYS n 
2 678  CYS n 
2 679  VAL n 
2 680  GLN n 
2 681  ILE n 
2 682  MET n 
2 683  GLY n 
2 684  GLY n 
2 685  TYR n 
2 686  PHE n 
2 687  THR n 
2 688  TRP n 
2 689  THR n 
2 690  PRO n 
2 691  ASP n 
2 692  GLY n 
2 693  ILE n 
2 694  PRO n 
2 695  THR n 
2 696  LEU n 
2 697  SER n 
2 698  ASN n 
2 699  ILE n 
2 700  THR n 
2 701  ILE n 
2 702  ARG n 
2 703  ILE n 
2 704  PRO n 
2 705  ARG n 
2 706  GLY n 
2 707  GLN n 
2 708  LEU n 
2 709  THR n 
2 710  MET n 
2 711  ILE n 
2 712  VAL n 
2 713  GLY n 
2 714  GLN n 
2 715  VAL n 
2 716  GLY n 
2 717  CYS n 
2 718  GLY n 
2 719  LYS n 
2 720  SER n 
2 721  SER n 
2 722  LEU n 
2 723  LEU n 
2 724  LEU n 
2 725  ALA n 
2 726  ALA n 
2 727  LEU n 
2 728  GLY n 
2 729  GLU n 
2 730  MET n 
2 731  GLN n 
2 732  LYS n 
2 733  VAL n 
2 734  SER n 
2 735  GLY n 
2 736  ALA n 
2 737  VAL n 
2 738  PHE n 
2 739  TRP n 
2 740  SER n 
2 741  SER n 
2 742  LEU n 
2 743  PRO n 
2 744  ASP n 
2 745  SER n 
2 746  GLU n 
2 747  ILE n 
2 748  GLY n 
2 749  GLU n 
2 750  ASP n 
2 751  PRO n 
2 752  SER n 
2 753  PRO n 
2 754  GLU n 
2 755  ARG n 
2 756  GLU n 
2 757  THR n 
2 758  ALA n 
2 759  THR n 
2 760  ASP n 
2 761  LEU n 
2 762  ASP n 
2 763  ILE n 
2 764  ARG n 
2 765  LYS n 
2 766  ARG n 
2 767  GLY n 
2 768  PRO n 
2 769  VAL n 
2 770  ALA n 
2 771  TYR n 
2 772  ALA n 
2 773  SER n 
2 774  GLN n 
2 775  LYS n 
2 776  PRO n 
2 777  TRP n 
2 778  LEU n 
2 779  LEU n 
2 780  ASN n 
2 781  ALA n 
2 782  THR n 
2 783  VAL n 
2 784  GLU n 
2 785  GLU n 
2 786  ASN n 
2 787  ILE n 
2 788  ILE n 
2 789  PHE n 
2 790  GLU n 
2 791  SER n 
2 792  PRO n 
2 793  PHE n 
2 794  ASN n 
2 795  LYS n 
2 796  GLN n 
2 797  ARG n 
2 798  TYR n 
2 799  LYS n 
2 800  MET n 
2 801  VAL n 
2 802  ILE n 
2 803  GLU n 
2 804  ALA n 
2 805  CYS n 
2 806  SER n 
2 807  LEU n 
2 808  GLN n 
2 809  PRO n 
2 810  ASP n 
2 811  ILE n 
2 812  ASP n 
2 813  ILE n 
2 814  LEU n 
2 815  PRO n 
2 816  HIS n 
2 817  GLY n 
2 818  ASP n 
2 819  GLN n 
2 820  THR n 
2 821  GLN n 
2 822  ILE n 
2 823  GLY n 
2 824  GLU n 
2 825  ARG n 
2 826  GLY n 
2 827  ILE n 
2 828  ASN n 
2 829  LEU n 
2 830  SER n 
2 831  GLY n 
2 832  GLY n 
2 833  GLN n 
2 834  ARG n 
2 835  GLN n 
2 836  ARG n 
2 837  ILE n 
2 838  SER n 
2 839  VAL n 
2 840  ALA n 
2 841  ARG n 
2 842  ALA n 
2 843  LEU n 
2 844  TYR n 
2 845  GLN n 
2 846  HIS n 
2 847  ALA n 
2 848  ASN n 
2 849  VAL n 
2 850  VAL n 
2 851  PHE n 
2 852  LEU n 
2 853  ASP n 
2 854  ASP n 
2 855  PRO n 
2 856  PHE n 
2 857  SER n 
2 858  ALA n 
2 859  LEU n 
2 860  ASP n 
2 861  ILE n 
2 862  HIS n 
2 863  LEU n 
2 864  SER n 
2 865  ASP n 
2 866  HIS n 
2 867  LEU n 
2 868  MET n 
2 869  GLN n 
2 870  ALA n 
2 871  GLY n 
2 872  ILE n 
2 873  LEU n 
2 874  GLU n 
2 875  LEU n 
2 876  LEU n 
2 877  ARG n 
2 878  ASP n 
2 879  ASP n 
2 880  LYS n 
2 881  ARG n 
2 882  THR n 
2 883  VAL n 
2 884  VAL n 
2 885  LEU n 
2 886  VAL n 
2 887  THR n 
2 888  HIS n 
2 889  LYS n 
2 890  LEU n 
2 891  GLN n 
2 892  TYR n 
2 893  LEU n 
2 894  PRO n 
2 895  HIS n 
2 896  ALA n 
2 897  ASP n 
2 898  TRP n 
2 899  ILE n 
2 900  ILE n 
2 901  ALA n 
2 902  MET n 
2 903  LYS n 
2 904  ASP n 
2 905  GLY n 
2 906  THR n 
2 907  ILE n 
2 908  GLN n 
2 909  ARG n 
2 910  GLU n 
2 911  GLY n 
2 912  THR n 
2 913  LEU n 
2 914  LYS n 
2 915  ASP n 
2 916  PHE n 
2 917  GLN n 
2 918  ARG n 
2 919  SER n 
2 920  GLU n 
2 921  CYS n 
2 922  GLN n 
2 923  LEU n 
2 924  PHE n 
2 925  GLU n 
2 926  HIS n 
2 927  TRP n 
2 928  LYS n 
2 929  THR n 
2 930  LEU n 
2 931  MET n 
2 932  ASN n 
2 933  ARG n 
2 934  GLN n 
2 935  ASP n 
2 936  GLN n 
2 937  GLU n 
2 938  LEU n 
2 939  GLU n 
2 940  LYS n 
2 941  GLU n 
2 942  THR n 
2 943  VAL n 
2 944  THR n 
2 945  GLU n 
2 946  ARG n 
2 947  LYS n 
2 948  ALA n 
2 949  THR n 
2 950  GLU n 
2 951  PRO n 
2 952  PRO n 
2 953  GLN n 
2 954  GLY n 
2 955  LEU n 
2 956  SER n 
2 957  ARG n 
2 958  ALA n 
2 959  MET n 
2 960  SER n 
2 961  SER n 
2 962  ARG n 
2 963  ASP n 
2 964  GLY n 
2 965  LEU n 
2 966  LEU n 
2 967  GLN n 
2 968  ASP n 
2 969  GLU n 
2 970  GLU n 
2 971  GLU n 
2 972  GLU n 
2 973  GLU n 
2 974  GLU n 
2 975  GLU n 
2 976  ALA n 
2 977  ALA n 
2 978  GLU n 
2 979  SER n 
2 980  GLU n 
2 981  GLU n 
2 982  ASP n 
2 983  ASP n 
2 984  ASN n 
2 985  LEU n 
2 986  SER n 
2 987  SER n 
2 988  MET n 
2 989  LEU n 
2 990  HIS n 
2 991  GLN n 
2 992  ARG n 
2 993  ALA n 
2 994  GLU n 
2 995  ILE n 
2 996  PRO n 
2 997  TRP n 
2 998  ARG n 
2 999  ALA n 
2 1000 CYS n 
2 1001 ALA n 
2 1002 LYS n 
2 1003 TYR n 
2 1004 LEU n 
2 1005 SER n 
2 1006 SER n 
2 1007 ALA n 
2 1008 GLY n 
2 1009 ILE n 
2 1010 LEU n 
2 1011 LEU n 
2 1012 LEU n 
2 1013 SER n 
2 1014 LEU n 
2 1015 LEU n 
2 1016 VAL n 
2 1017 PHE n 
2 1018 SER n 
2 1019 GLN n 
2 1020 LEU n 
2 1021 LEU n 
2 1022 LYS n 
2 1023 HIS n 
2 1024 MET n 
2 1025 VAL n 
2 1026 LEU n 
2 1027 VAL n 
2 1028 ALA n 
2 1029 ILE n 
2 1030 ASP n 
2 1031 TYR n 
2 1032 TRP n 
2 1033 LEU n 
2 1034 ALA n 
2 1035 LYS n 
2 1036 TRP n 
2 1037 THR n 
2 1038 ASP n 
2 1039 SER n 
2 1040 ALA n 
2 1041 LEU n 
2 1042 THR n 
2 1043 LEU n 
2 1044 THR n 
2 1045 PRO n 
2 1046 ALA n 
2 1047 ALA n 
2 1048 ARG n 
2 1049 ASN n 
2 1050 CYS n 
2 1051 SER n 
2 1052 LEU n 
2 1053 SER n 
2 1054 GLN n 
2 1055 GLU n 
2 1056 CYS n 
2 1057 THR n 
2 1058 LEU n 
2 1059 ASP n 
2 1060 GLN n 
2 1061 THR n 
2 1062 VAL n 
2 1063 TYR n 
2 1064 ALA n 
2 1065 MET n 
2 1066 VAL n 
2 1067 PHE n 
2 1068 THR n 
2 1069 VAL n 
2 1070 LEU n 
2 1071 CYS n 
2 1072 SER n 
2 1073 LEU n 
2 1074 GLY n 
2 1075 ILE n 
2 1076 VAL n 
2 1077 LEU n 
2 1078 CYS n 
2 1079 LEU n 
2 1080 VAL n 
2 1081 THR n 
2 1082 SER n 
2 1083 VAL n 
2 1084 THR n 
2 1085 VAL n 
2 1086 GLU n 
2 1087 TRP n 
2 1088 THR n 
2 1089 GLY n 
2 1090 LEU n 
2 1091 LYS n 
2 1092 VAL n 
2 1093 ALA n 
2 1094 LYS n 
2 1095 ARG n 
2 1096 LEU n 
2 1097 HIS n 
2 1098 ARG n 
2 1099 SER n 
2 1100 LEU n 
2 1101 LEU n 
2 1102 ASN n 
2 1103 ARG n 
2 1104 ILE n 
2 1105 ILE n 
2 1106 LEU n 
2 1107 ALA n 
2 1108 PRO n 
2 1109 MET n 
2 1110 ARG n 
2 1111 PHE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 THR n 
2 1115 THR n 
2 1116 PRO n 
2 1117 LEU n 
2 1118 GLY n 
2 1119 SER n 
2 1120 ILE n 
2 1121 LEU n 
2 1122 ASN n 
2 1123 ARG n 
2 1124 PHE n 
2 1125 SER n 
2 1126 SER n 
2 1127 ASP n 
2 1128 CYS n 
2 1129 ASN n 
2 1130 THR n 
2 1131 ILE n 
2 1132 ASP n 
2 1133 GLN n 
2 1134 HIS n 
2 1135 ILE n 
2 1136 PRO n 
2 1137 SER n 
2 1138 THR n 
2 1139 LEU n 
2 1140 GLU n 
2 1141 CYS n 
2 1142 LEU n 
2 1143 SER n 
2 1144 ARG n 
2 1145 SER n 
2 1146 THR n 
2 1147 LEU n 
2 1148 LEU n 
2 1149 CYS n 
2 1150 VAL n 
2 1151 SER n 
2 1152 ALA n 
2 1153 LEU n 
2 1154 ALA n 
2 1155 VAL n 
2 1156 ILE n 
2 1157 SER n 
2 1158 TYR n 
2 1159 VAL n 
2 1160 THR n 
2 1161 PRO n 
2 1162 VAL n 
2 1163 PHE n 
2 1164 LEU n 
2 1165 VAL n 
2 1166 ALA n 
2 1167 LEU n 
2 1168 LEU n 
2 1169 PRO n 
2 1170 LEU n 
2 1171 ALA n 
2 1172 ILE n 
2 1173 VAL n 
2 1174 CYS n 
2 1175 TYR n 
2 1176 PHE n 
2 1177 ILE n 
2 1178 GLN n 
2 1179 LYS n 
2 1180 TYR n 
2 1181 PHE n 
2 1182 ARG n 
2 1183 VAL n 
2 1184 ALA n 
2 1185 SER n 
2 1186 ARG n 
2 1187 ASP n 
2 1188 LEU n 
2 1189 GLN n 
2 1190 GLN n 
2 1191 LEU n 
2 1192 ASP n 
2 1193 ASP n 
2 1194 THR n 
2 1195 THR n 
2 1196 GLN n 
2 1197 LEU n 
2 1198 PRO n 
2 1199 LEU n 
2 1200 LEU n 
2 1201 SER n 
2 1202 HIS n 
2 1203 PHE n 
2 1204 ALA n 
2 1205 GLU n 
2 1206 THR n 
2 1207 VAL n 
2 1208 GLU n 
2 1209 GLY n 
2 1210 LEU n 
2 1211 THR n 
2 1212 THR n 
2 1213 ILE n 
2 1214 ARG n 
2 1215 ALA n 
2 1216 PHE n 
2 1217 ARG n 
2 1218 TYR n 
2 1219 GLU n 
2 1220 ALA n 
2 1221 ARG n 
2 1222 PHE n 
2 1223 GLN n 
2 1224 GLN n 
2 1225 LYS n 
2 1226 LEU n 
2 1227 LEU n 
2 1228 GLU n 
2 1229 TYR n 
2 1230 THR n 
2 1231 ASP n 
2 1232 SER n 
2 1233 ASN n 
2 1234 ASN n 
2 1235 ILE n 
2 1236 ALA n 
2 1237 SER n 
2 1238 LEU n 
2 1239 PHE n 
2 1240 LEU n 
2 1241 THR n 
2 1242 ALA n 
2 1243 ALA n 
2 1244 ASN n 
2 1245 ARG n 
2 1246 TRP n 
2 1247 LEU n 
2 1248 GLU n 
2 1249 VAL n 
2 1250 ARG n 
2 1251 MET n 
2 1252 GLU n 
2 1253 TYR n 
2 1254 ILE n 
2 1255 GLY n 
2 1256 ALA n 
2 1257 CYS n 
2 1258 VAL n 
2 1259 VAL n 
2 1260 LEU n 
2 1261 ILE n 
2 1262 ALA n 
2 1263 ALA n 
2 1264 VAL n 
2 1265 THR n 
2 1266 SER n 
2 1267 ILE n 
2 1268 SER n 
2 1269 ASN n 
2 1270 SER n 
2 1271 LEU n 
2 1272 HIS n 
2 1273 ARG n 
2 1274 GLU n 
2 1275 LEU n 
2 1276 SER n 
2 1277 ALA n 
2 1278 GLY n 
2 1279 LEU n 
2 1280 VAL n 
2 1281 GLY n 
2 1282 LEU n 
2 1283 GLY n 
2 1284 LEU n 
2 1285 THR n 
2 1286 TYR n 
2 1287 ALA n 
2 1288 LEU n 
2 1289 MET n 
2 1290 VAL n 
2 1291 SER n 
2 1292 ASN n 
2 1293 TYR n 
2 1294 LEU n 
2 1295 ASN n 
2 1296 TRP n 
2 1297 MET n 
2 1298 VAL n 
2 1299 ARG n 
2 1300 ASN n 
2 1301 LEU n 
2 1302 ALA n 
2 1303 ASP n 
2 1304 MET n 
2 1305 GLU n 
2 1306 LEU n 
2 1307 GLN n 
2 1308 LEU n 
2 1309 GLY n 
2 1310 ALA n 
2 1311 VAL n 
2 1312 LYS n 
2 1313 ARG n 
2 1314 ILE n 
2 1315 HIS n 
2 1316 GLY n 
2 1317 LEU n 
2 1318 LEU n 
2 1319 LYS n 
2 1320 THR n 
2 1321 GLU n 
2 1322 ALA n 
2 1323 GLU n 
2 1324 SER n 
2 1325 TYR n 
2 1326 GLU n 
2 1327 GLY n 
2 1328 LEU n 
2 1329 LEU n 
2 1330 ALA n 
2 1331 PRO n 
2 1332 SER n 
2 1333 LEU n 
2 1334 ILE n 
2 1335 PRO n 
2 1336 LYS n 
2 1337 ASN n 
2 1338 TRP n 
2 1339 PRO n 
2 1340 ASP n 
2 1341 GLN n 
2 1342 GLY n 
2 1343 LYS n 
2 1344 ILE n 
2 1345 GLN n 
2 1346 ILE n 
2 1347 GLN n 
2 1348 ASN n 
2 1349 LEU n 
2 1350 SER n 
2 1351 VAL n 
2 1352 ARG n 
2 1353 TYR n 
2 1354 ASP n 
2 1355 SER n 
2 1356 SER n 
2 1357 LEU n 
2 1358 LYS n 
2 1359 PRO n 
2 1360 VAL n 
2 1361 LEU n 
2 1362 LYS n 
2 1363 HIS n 
2 1364 VAL n 
2 1365 ASN n 
2 1366 ALA n 
2 1367 LEU n 
2 1368 ILE n 
2 1369 ALA n 
2 1370 PRO n 
2 1371 GLY n 
2 1372 GLN n 
2 1373 LYS n 
2 1374 ILE n 
2 1375 GLY n 
2 1376 ILE n 
2 1377 CYS n 
2 1378 GLY n 
2 1379 ARG n 
2 1380 THR n 
2 1381 GLY n 
2 1382 SER n 
2 1383 GLY n 
2 1384 LYS n 
2 1385 SER n 
2 1386 SER n 
2 1387 PHE n 
2 1388 SER n 
2 1389 LEU n 
2 1390 ALA n 
2 1391 PHE n 
2 1392 PHE n 
2 1393 ARG n 
2 1394 MET n 
2 1395 VAL n 
2 1396 ASP n 
2 1397 THR n 
2 1398 PHE n 
2 1399 GLU n 
2 1400 GLY n 
2 1401 HIS n 
2 1402 ILE n 
2 1403 ILE n 
2 1404 ILE n 
2 1405 ASP n 
2 1406 GLY n 
2 1407 ILE n 
2 1408 ASP n 
2 1409 ILE n 
2 1410 ALA n 
2 1411 LYS n 
2 1412 LEU n 
2 1413 PRO n 
2 1414 LEU n 
2 1415 HIS n 
2 1416 THR n 
2 1417 LEU n 
2 1418 ARG n 
2 1419 SER n 
2 1420 ARG n 
2 1421 LEU n 
2 1422 SER n 
2 1423 ILE n 
2 1424 ILE n 
2 1425 LEU n 
2 1426 GLN n 
2 1427 ASP n 
2 1428 PRO n 
2 1429 VAL n 
2 1430 LEU n 
2 1431 PHE n 
2 1432 SER n 
2 1433 GLY n 
2 1434 THR n 
2 1435 ILE n 
2 1436 ARG n 
2 1437 PHE n 
2 1438 ASN n 
2 1439 LEU n 
2 1440 ASP n 
2 1441 PRO n 
2 1442 GLU n 
2 1443 ARG n 
2 1444 LYS n 
2 1445 CYS n 
2 1446 SER n 
2 1447 ASP n 
2 1448 SER n 
2 1449 THR n 
2 1450 LEU n 
2 1451 TRP n 
2 1452 GLU n 
2 1453 ALA n 
2 1454 LEU n 
2 1455 GLU n 
2 1456 ILE n 
2 1457 ALA n 
2 1458 GLN n 
2 1459 LEU n 
2 1460 LYS n 
2 1461 LEU n 
2 1462 VAL n 
2 1463 VAL n 
2 1464 LYS n 
2 1465 ALA n 
2 1466 LEU n 
2 1467 PRO n 
2 1468 GLY n 
2 1469 GLY n 
2 1470 LEU n 
2 1471 ASP n 
2 1472 ALA n 
2 1473 ILE n 
2 1474 ILE n 
2 1475 THR n 
2 1476 GLU n 
2 1477 GLY n 
2 1478 GLY n 
2 1479 GLU n 
2 1480 ASN n 
2 1481 PHE n 
2 1482 SER n 
2 1483 GLN n 
2 1484 GLY n 
2 1485 GLN n 
2 1486 ARG n 
2 1487 GLN n 
2 1488 LEU n 
2 1489 PHE n 
2 1490 CYS n 
2 1491 LEU n 
2 1492 ALA n 
2 1493 ARG n 
2 1494 ALA n 
2 1495 PHE n 
2 1496 VAL n 
2 1497 ARG n 
2 1498 LYS n 
2 1499 THR n 
2 1500 SER n 
2 1501 ILE n 
2 1502 PHE n 
2 1503 ILE n 
2 1504 MET n 
2 1505 ASP n 
2 1506 GLU n 
2 1507 ALA n 
2 1508 THR n 
2 1509 ALA n 
2 1510 SER n 
2 1511 ILE n 
2 1512 ASP n 
2 1513 MET n 
2 1514 ALA n 
2 1515 THR n 
2 1516 GLU n 
2 1517 ASN n 
2 1518 ILE n 
2 1519 LEU n 
2 1520 GLN n 
2 1521 LYS n 
2 1522 VAL n 
2 1523 VAL n 
2 1524 MET n 
2 1525 THR n 
2 1526 ALA n 
2 1527 PHE n 
2 1528 ALA n 
2 1529 ASP n 
2 1530 ARG n 
2 1531 THR n 
2 1532 VAL n 
2 1533 VAL n 
2 1534 THR n 
2 1535 ILE n 
2 1536 ALA n 
2 1537 HIS n 
2 1538 ARG n 
2 1539 VAL n 
2 1540 HIS n 
2 1541 THR n 
2 1542 ILE n 
2 1543 LEU n 
2 1544 SER n 
2 1545 ALA n 
2 1546 ASP n 
2 1547 LEU n 
2 1548 VAL n 
2 1549 ILE n 
2 1550 VAL n 
2 1551 LEU n 
2 1552 LYS n 
2 1553 ARG n 
2 1554 GLY n 
2 1555 ALA n 
2 1556 ILE n 
2 1557 LEU n 
2 1558 GLU n 
2 1559 PHE n 
2 1560 ASP n 
2 1561 LYS n 
2 1562 PRO n 
2 1563 GLU n 
2 1564 LYS n 
2 1565 LEU n 
2 1566 LEU n 
2 1567 SER n 
2 1568 ARG n 
2 1569 LYS n 
2 1570 ASP n 
2 1571 SER n 
2 1572 VAL n 
2 1573 PHE n 
2 1574 ALA n 
2 1575 SER n 
2 1576 PHE n 
2 1577 VAL n 
2 1578 ARG n 
2 1579 ALA n 
2 1580 ASP n 
2 1581 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 406  Human ? KCNJ11                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1581 Human ? 'ABCC8, HRINS, SUR, SUR1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KCJ11_HUMAN Q14654 ? 1 
;MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
;
1 
2 UNP ABCC8_HUMAN Q09428 ? 2 
;MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFM
LLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTSVVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLVLSSTFRILADLLGFAGPLCI
FGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYTSISIFMNTAIPIAAVLITFV
GHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQA
VPLRVVNRKRPAREDCRGLTGPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLNATVEENIIFESPFNKQRYKM
VIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDK
RTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS
SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDSA
LTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSI
LNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL
SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAVTSISNSLHRELSAGLV
GLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPV
LKHVNALIAPGQKIGICGRTGSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD
PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQ
KVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFDKPEKLLSRKDSVFASFVRADK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6C3P A 7 ? 396  ? Q14654 1 ? 390  ? 1 390  
2 1 6C3P D 7 ? 396  ? Q14654 1 ? 390  ? 1 390  
3 1 6C3P B 7 ? 396  ? Q14654 1 ? 390  ? 1 390  
4 1 6C3P C 7 ? 396  ? Q14654 1 ? 390  ? 1 390  
5 2 6C3P E 1 ? 1581 ? Q09428 1 ? 1581 ? 1 1581 
6 2 6C3P H 1 ? 1581 ? Q09428 1 ? 1581 ? 1 1581 
7 2 6C3P G 1 ? 1581 ? Q09428 1 ? 1581 ? 1 1581 
8 2 6C3P F 1 ? 1581 ? Q09428 1 ? 1581 ? 1 1581 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6C3P SER A 1   ? UNP Q14654 ? ? 'expression tag' -5  1  
1 6C3P ALA A 2   ? UNP Q14654 ? ? 'expression tag' -4  2  
1 6C3P SER A 3   ? UNP Q14654 ? ? 'expression tag' -3  3  
1 6C3P ALA A 4   ? UNP Q14654 ? ? 'expression tag' -2  4  
1 6C3P SER A 5   ? UNP Q14654 ? ? 'expression tag' -1  5  
1 6C3P ALA A 6   ? UNP Q14654 ? ? 'expression tag' 0   6  
1 6C3P SER A 397 ? UNP Q14654 ? ? 'expression tag' 391 7  
1 6C3P ASN A 398 ? UNP Q14654 ? ? 'expression tag' 392 8  
1 6C3P SER A 399 ? UNP Q14654 ? ? 'expression tag' 393 9  
1 6C3P LEU A 400 ? UNP Q14654 ? ? 'expression tag' 394 10 
1 6C3P GLU A 401 ? UNP Q14654 ? ? 'expression tag' 395 11 
1 6C3P VAL A 402 ? UNP Q14654 ? ? 'expression tag' 396 12 
1 6C3P LEU A 403 ? UNP Q14654 ? ? 'expression tag' 397 13 
1 6C3P PHE A 404 ? UNP Q14654 ? ? 'expression tag' 398 14 
1 6C3P GLN A 405 ? UNP Q14654 ? ? 'expression tag' 399 15 
1 6C3P GLY A 406 ? UNP Q14654 ? ? 'expression tag' 400 16 
2 6C3P SER D 1   ? UNP Q14654 ? ? 'expression tag' -5  17 
2 6C3P ALA D 2   ? UNP Q14654 ? ? 'expression tag' -4  18 
2 6C3P SER D 3   ? UNP Q14654 ? ? 'expression tag' -3  19 
2 6C3P ALA D 4   ? UNP Q14654 ? ? 'expression tag' -2  20 
2 6C3P SER D 5   ? UNP Q14654 ? ? 'expression tag' -1  21 
2 6C3P ALA D 6   ? UNP Q14654 ? ? 'expression tag' 0   22 
2 6C3P SER D 397 ? UNP Q14654 ? ? 'expression tag' 391 23 
2 6C3P ASN D 398 ? UNP Q14654 ? ? 'expression tag' 392 24 
2 6C3P SER D 399 ? UNP Q14654 ? ? 'expression tag' 393 25 
2 6C3P LEU D 400 ? UNP Q14654 ? ? 'expression tag' 394 26 
2 6C3P GLU D 401 ? UNP Q14654 ? ? 'expression tag' 395 27 
2 6C3P VAL D 402 ? UNP Q14654 ? ? 'expression tag' 396 28 
2 6C3P LEU D 403 ? UNP Q14654 ? ? 'expression tag' 397 29 
2 6C3P PHE D 404 ? UNP Q14654 ? ? 'expression tag' 398 30 
2 6C3P GLN D 405 ? UNP Q14654 ? ? 'expression tag' 399 31 
2 6C3P GLY D 406 ? UNP Q14654 ? ? 'expression tag' 400 32 
3 6C3P SER B 1   ? UNP Q14654 ? ? 'expression tag' -5  33 
3 6C3P ALA B 2   ? UNP Q14654 ? ? 'expression tag' -4  34 
3 6C3P SER B 3   ? UNP Q14654 ? ? 'expression tag' -3  35 
3 6C3P ALA B 4   ? UNP Q14654 ? ? 'expression tag' -2  36 
3 6C3P SER B 5   ? UNP Q14654 ? ? 'expression tag' -1  37 
3 6C3P ALA B 6   ? UNP Q14654 ? ? 'expression tag' 0   38 
3 6C3P SER B 397 ? UNP Q14654 ? ? 'expression tag' 391 39 
3 6C3P ASN B 398 ? UNP Q14654 ? ? 'expression tag' 392 40 
3 6C3P SER B 399 ? UNP Q14654 ? ? 'expression tag' 393 41 
3 6C3P LEU B 400 ? UNP Q14654 ? ? 'expression tag' 394 42 
3 6C3P GLU B 401 ? UNP Q14654 ? ? 'expression tag' 395 43 
3 6C3P VAL B 402 ? UNP Q14654 ? ? 'expression tag' 396 44 
3 6C3P LEU B 403 ? UNP Q14654 ? ? 'expression tag' 397 45 
3 6C3P PHE B 404 ? UNP Q14654 ? ? 'expression tag' 398 46 
3 6C3P GLN B 405 ? UNP Q14654 ? ? 'expression tag' 399 47 
3 6C3P GLY B 406 ? UNP Q14654 ? ? 'expression tag' 400 48 
4 6C3P SER C 1   ? UNP Q14654 ? ? 'expression tag' -5  49 
4 6C3P ALA C 2   ? UNP Q14654 ? ? 'expression tag' -4  50 
4 6C3P SER C 3   ? UNP Q14654 ? ? 'expression tag' -3  51 
4 6C3P ALA C 4   ? UNP Q14654 ? ? 'expression tag' -2  52 
4 6C3P SER C 5   ? UNP Q14654 ? ? 'expression tag' -1  53 
4 6C3P ALA C 6   ? UNP Q14654 ? ? 'expression tag' 0   54 
4 6C3P SER C 397 ? UNP Q14654 ? ? 'expression tag' 391 55 
4 6C3P ASN C 398 ? UNP Q14654 ? ? 'expression tag' 392 56 
4 6C3P SER C 399 ? UNP Q14654 ? ? 'expression tag' 393 57 
4 6C3P LEU C 400 ? UNP Q14654 ? ? 'expression tag' 394 58 
4 6C3P GLU C 401 ? UNP Q14654 ? ? 'expression tag' 395 59 
4 6C3P VAL C 402 ? UNP Q14654 ? ? 'expression tag' 396 60 
4 6C3P LEU C 403 ? UNP Q14654 ? ? 'expression tag' 397 61 
4 6C3P PHE C 404 ? UNP Q14654 ? ? 'expression tag' 398 62 
4 6C3P GLN C 405 ? UNP Q14654 ? ? 'expression tag' 399 63 
4 6C3P GLY C 406 ? UNP Q14654 ? ? 'expression tag' 400 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"  ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6C3P 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6C3P 
_struct.title                        'Cryo-EM structure of human KATP bound to ATP and ADP in propeller form' 
_struct.pdbx_descriptor              
'ATP-sensitive inward rectifier potassium channel 11, ATP-binding cassette sub-family C member 8' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6C3P 
_struct_keywords.text            'ATP-dependent potassium channel Kir6.2 SUR1 ATP ADP, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLN A 63   ? ASP A 71   ? GLN A 57   ASP A 65   1 ? 9  
HELX_P HELX_P2   AA2 LYS A 73   ? HIS A 103  ? LYS A 67   HIS A 97   1 ? 31 
HELX_P HELX_P3   AA3 SER A 122  ? VAL A 135  ? SER A 116  VAL A 129  1 ? 14 
HELX_P HELX_P4   AA4 CYS A 148  ? ALA A 178  ? CYS A 142  ALA A 172  1 ? 31 
HELX_P HELX_P5   AA5 ARG A 182  ? GLU A 185  ? ARG A 176  GLU A 179  5 ? 4  
HELX_P HELX_P6   AA6 SER A 271  ? LEU A 276  ? SER A 265  LEU A 270  5 ? 6  
HELX_P HELX_P7   AA7 THR A 351  ? ALA A 364  ? THR A 345  ALA A 358  1 ? 14 
HELX_P HELX_P8   AA8 GLN B 63   ? ASP B 71   ? GLN D 57   ASP D 65   1 ? 9  
HELX_P HELX_P9   AA9 LYS B 73   ? HIS B 103  ? LYS D 67   HIS D 97   1 ? 31 
HELX_P HELX_P10  AB1 SER B 122  ? VAL B 135  ? SER D 116  VAL D 129  1 ? 14 
HELX_P HELX_P11  AB2 CYS B 148  ? ALA B 178  ? CYS D 142  ALA D 172  1 ? 31 
HELX_P HELX_P12  AB3 ARG B 182  ? GLU B 185  ? ARG D 176  GLU D 179  5 ? 4  
HELX_P HELX_P13  AB4 SER B 271  ? LEU B 276  ? SER D 265  LEU D 270  5 ? 6  
HELX_P HELX_P14  AB5 THR B 351  ? ALA B 364  ? THR D 345  ALA D 358  1 ? 14 
HELX_P HELX_P15  AB6 GLN C 63   ? ASP C 71   ? GLN B 57   ASP B 65   1 ? 9  
HELX_P HELX_P16  AB7 LYS C 73   ? HIS C 103  ? LYS B 67   HIS B 97   1 ? 31 
HELX_P HELX_P17  AB8 SER C 122  ? VAL C 135  ? SER B 116  VAL B 129  1 ? 14 
HELX_P HELX_P18  AB9 CYS C 148  ? ALA C 178  ? CYS B 142  ALA B 172  1 ? 31 
HELX_P HELX_P19  AC1 ARG C 182  ? GLU C 185  ? ARG B 176  GLU B 179  5 ? 4  
HELX_P HELX_P20  AC2 SER C 271  ? LEU C 276  ? SER B 265  LEU B 270  5 ? 6  
HELX_P HELX_P21  AC3 THR C 351  ? ALA C 364  ? THR B 345  ALA B 358  1 ? 14 
HELX_P HELX_P22  AC4 GLN D 63   ? ASP D 71   ? GLN C 57   ASP C 65   1 ? 9  
HELX_P HELX_P23  AC5 LYS D 73   ? HIS D 103  ? LYS C 67   HIS C 97   1 ? 31 
HELX_P HELX_P24  AC6 SER D 122  ? VAL D 135  ? SER C 116  VAL C 129  1 ? 14 
HELX_P HELX_P25  AC7 CYS D 148  ? ALA D 178  ? CYS C 142  ALA C 172  1 ? 31 
HELX_P HELX_P26  AC8 ARG D 182  ? GLU D 185  ? ARG C 176  GLU C 179  5 ? 4  
HELX_P HELX_P27  AC9 SER D 271  ? LEU D 276  ? SER C 265  LEU C 270  5 ? 6  
HELX_P HELX_P28  AD1 THR D 351  ? ALA D 364  ? THR C 345  ALA C 358  1 ? 14 
HELX_P HELX_P29  AD2 GLU E 9    ? ALA E 14   ? GLU E 9    ALA E 14   1 ? 6  
HELX_P HELX_P30  AD3 GLY E 20   ? ASN E 23   ? GLY E 20   ASN E 23   5 ? 4  
HELX_P HELX_P31  AD4 ASN E 24   ? ASN E 32   ? ASN E 24   ASN E 32   1 ? 9  
HELX_P HELX_P32  AD5 VAL E 33   ? THR E 43   ? VAL E 33   THR E 43   1 ? 11 
HELX_P HELX_P33  AD6 PHE E 44   ? GLY E 52   ? PHE E 44   GLY E 52   1 ? 9  
HELX_P HELX_P34  AD7 GLY E 70   ? ASP E 96   ? GLY E 70   ASP E 96   1 ? 27 
HELX_P HELX_P35  AD8 TYR E 107  ? THR E 129  ? TYR E 107  THR E 129  1 ? 23 
HELX_P HELX_P36  AD9 PHE E 132  ? ILE E 137  ? PHE E 132  ILE E 137  1 ? 6  
HELX_P HELX_P37  AE1 ILE E 137  ? ASP E 159  ? ILE E 137  ASP E 159  1 ? 23 
HELX_P HELX_P38  AE2 SER E 165  ? ARG E 193  ? SER E 165  ARG E 193  1 ? 29 
HELX_P HELX_P39  AE3 ASN E 223  ? TYR E 230  ? ASN E 223  TYR E 230  1 ? 8  
HELX_P HELX_P40  AE4 TYR E 230  ? LYS E 243  ? TYR E 230  LYS E 243  1 ? 14 
HELX_P HELX_P41  AE5 ALA E 259  ? ASP E 277  ? ALA E 259  ASP E 277  1 ? 19 
HELX_P HELX_P42  AE6 ILE E 287  ? PHE E 314  ? ILE E 287  PHE E 314  1 ? 28 
HELX_P HELX_P43  AE7 ALA E 315  ? GLY E 328  ? ALA E 315  GLY E 328  1 ? 14 
HELX_P HELX_P44  AE8 ASN E 354  ? HIS E 401  ? ASN E 354  HIS E 401  1 ? 48 
HELX_P HELX_P45  AE9 SER E 403  ? GLY E 410  ? SER E 403  GLY E 410  1 ? 8  
HELX_P HELX_P46  AF1 THR E 413  ? PHE E 432  ? THR E 413  PHE E 432  1 ? 20 
HELX_P HELX_P47  AF2 LEU E 434  ? ILE E 455  ? LEU E 434  ILE E 455  1 ? 22 
HELX_P HELX_P48  AF3 GLY E 463  ? GLY E 505  ? GLY E 463  GLY E 505  1 ? 43 
HELX_P HELX_P49  AF4 GLY E 505  ? ALA E 513  ? GLY E 505  ALA E 513  1 ? 9  
HELX_P HELX_P50  AF5 TRP E 514  ? HIS E 562  ? TRP E 514  HIS E 562  1 ? 49 
HELX_P HELX_P51  AF6 SER E 574  ? SER E 615  ? SER E 574  SER E 615  1 ? 42 
HELX_P HELX_P52  AF7 GLY E 718  ? LEU E 727  ? GLY E 718  LEU E 727  1 ? 10 
HELX_P HELX_P53  AF8 THR E 782  ? PHE E 789  ? THR E 782  PHE E 789  1 ? 8  
HELX_P HELX_P54  AF9 ASN E 794  ? SER E 806  ? ASN E 794  SER E 806  1 ? 13 
HELX_P HELX_P55  AG1 LEU E 807  ? ILE E 813  ? LEU E 807  ILE E 813  1 ? 7  
HELX_P HELX_P56  AG2 HIS E 816  ? THR E 820  ? HIS E 816  THR E 820  5 ? 5  
HELX_P HELX_P57  AG3 SER E 830  ? TYR E 844  ? SER E 830  TYR E 844  1 ? 15 
HELX_P HELX_P58  AG4 ASP E 860  ? LEU E 876  ? ASP E 860  LEU E 876  1 ? 17 
HELX_P HELX_P59  AG5 LEU E 913  ? ARG E 918  ? LEU E 913  ARG E 918  1 ? 6  
HELX_P HELX_P60  AG6 GLU E 920  ? LEU E 930  ? GLU E 920  LEU E 930  1 ? 11 
HELX_P HELX_P61  AG7 ILE E 995  ? ALA E 1007 ? ILE E 995  ALA E 1007 1 ? 13 
HELX_P HELX_P62  AG8 GLY E 1008 ? ALA E 1034 ? GLY E 1008 ALA E 1034 1 ? 27 
HELX_P HELX_P63  AG9 LYS E 1035 ? ASP E 1038 ? LYS E 1035 ASP E 1038 5 ? 4  
HELX_P HELX_P64  AH1 VAL E 1062 ? LEU E 1106 ? VAL E 1062 LEU E 1106 1 ? 45 
HELX_P HELX_P65  AH2 PRO E 1108 ? THR E 1115 ? PRO E 1108 THR E 1115 1 ? 8  
HELX_P HELX_P66  AH3 PRO E 1116 ? SER E 1126 ? PRO E 1116 SER E 1126 1 ? 11 
HELX_P HELX_P67  AH4 SER E 1126 ? THR E 1160 ? SER E 1126 THR E 1160 1 ? 35 
HELX_P HELX_P68  AH5 VAL E 1162 ? GLY E 1209 ? VAL E 1162 GLY E 1209 1 ? 48 
HELX_P HELX_P69  AH6 GLY E 1209 ? ARG E 1217 ? GLY E 1209 ARG E 1217 1 ? 9  
HELX_P HELX_P70  AH7 TYR E 1218 ? ARG E 1273 ? TYR E 1218 ARG E 1273 1 ? 56 
HELX_P HELX_P71  AH8 ALA E 1277 ? LYS E 1319 ? ALA E 1277 LYS E 1319 1 ? 43 
HELX_P HELX_P72  AH9 GLY E 1383 ? LEU E 1389 ? GLY E 1383 LEU E 1389 1 ? 7  
HELX_P HELX_P73  AI1 PRO E 1413 ? ARG E 1420 ? PRO E 1413 ARG E 1420 1 ? 8  
HELX_P HELX_P74  AI2 THR E 1434 ? ASP E 1440 ? THR E 1434 ASP E 1440 1 ? 7  
HELX_P HELX_P75  AI3 SER E 1446 ? ALA E 1457 ? SER E 1446 ALA E 1457 1 ? 12 
HELX_P HELX_P76  AI4 LEU E 1459 ? LEU E 1466 ? LEU E 1459 LEU E 1466 1 ? 8  
HELX_P HELX_P77  AI5 SER E 1482 ? VAL E 1496 ? SER E 1482 VAL E 1496 1 ? 15 
HELX_P HELX_P78  AI6 GLU E 1506 ? ILE E 1511 ? GLU E 1506 ILE E 1511 5 ? 6  
HELX_P HELX_P79  AI7 ASP E 1512 ? PHE E 1527 ? ASP E 1512 PHE E 1527 1 ? 16 
HELX_P HELX_P80  AI8 ARG E 1538 ? LEU E 1543 ? ARG E 1538 LEU E 1543 1 ? 6  
HELX_P HELX_P81  AI9 LYS E 1561 ? LYS E 1569 ? LYS E 1561 LYS E 1569 1 ? 9  
HELX_P HELX_P82  AJ1 SER E 1571 ? LYS E 1581 ? SER E 1571 LYS E 1581 1 ? 11 
HELX_P HELX_P83  AJ2 GLU F 9    ? ALA F 14   ? GLU H 9    ALA H 14   1 ? 6  
HELX_P HELX_P84  AJ3 GLY F 20   ? ASN F 23   ? GLY H 20   ASN H 23   5 ? 4  
HELX_P HELX_P85  AJ4 ASN F 24   ? ASN F 32   ? ASN H 24   ASN H 32   1 ? 9  
HELX_P HELX_P86  AJ5 VAL F 33   ? THR F 43   ? VAL H 33   THR H 43   1 ? 11 
HELX_P HELX_P87  AJ6 PHE F 44   ? GLY F 52   ? PHE H 44   GLY H 52   1 ? 9  
HELX_P HELX_P88  AJ7 GLY F 70   ? ASP F 96   ? GLY H 70   ASP H 96   1 ? 27 
HELX_P HELX_P89  AJ8 TYR F 107  ? THR F 129  ? TYR H 107  THR H 129  1 ? 23 
HELX_P HELX_P90  AJ9 PHE F 132  ? ILE F 137  ? PHE H 132  ILE H 137  1 ? 6  
HELX_P HELX_P91  AK1 ILE F 137  ? ASP F 159  ? ILE H 137  ASP H 159  1 ? 23 
HELX_P HELX_P92  AK2 SER F 165  ? ARG F 193  ? SER H 165  ARG H 193  1 ? 29 
HELX_P HELX_P93  AK3 ASN F 223  ? TYR F 230  ? ASN H 223  TYR H 230  1 ? 8  
HELX_P HELX_P94  AK4 TYR F 230  ? LYS F 243  ? TYR H 230  LYS H 243  1 ? 14 
HELX_P HELX_P95  AK5 ALA F 259  ? ASP F 277  ? ALA H 259  ASP H 277  1 ? 19 
HELX_P HELX_P96  AK6 ILE F 287  ? PHE F 314  ? ILE H 287  PHE H 314  1 ? 28 
HELX_P HELX_P97  AK7 ALA F 315  ? GLY F 328  ? ALA H 315  GLY H 328  1 ? 14 
HELX_P HELX_P98  AK8 ASN F 354  ? HIS F 401  ? ASN H 354  HIS H 401  1 ? 48 
HELX_P HELX_P99  AK9 SER F 403  ? GLY F 410  ? SER H 403  GLY H 410  1 ? 8  
HELX_P HELX_P100 AL1 THR F 413  ? PHE F 432  ? THR H 413  PHE H 432  1 ? 20 
HELX_P HELX_P101 AL2 LEU F 434  ? ILE F 455  ? LEU H 434  ILE H 455  1 ? 22 
HELX_P HELX_P102 AL3 GLY F 463  ? GLY F 505  ? GLY H 463  GLY H 505  1 ? 43 
HELX_P HELX_P103 AL4 GLY F 505  ? ALA F 513  ? GLY H 505  ALA H 513  1 ? 9  
HELX_P HELX_P104 AL5 TRP F 514  ? HIS F 562  ? TRP H 514  HIS H 562  1 ? 49 
HELX_P HELX_P105 AL6 SER F 574  ? SER F 615  ? SER H 574  SER H 615  1 ? 42 
HELX_P HELX_P106 AL7 GLY F 718  ? LEU F 727  ? GLY H 718  LEU H 727  1 ? 10 
HELX_P HELX_P107 AL8 THR F 782  ? PHE F 789  ? THR H 782  PHE H 789  1 ? 8  
HELX_P HELX_P108 AL9 ASN F 794  ? SER F 806  ? ASN H 794  SER H 806  1 ? 13 
HELX_P HELX_P109 AM1 LEU F 807  ? ILE F 813  ? LEU H 807  ILE H 813  1 ? 7  
HELX_P HELX_P110 AM2 HIS F 816  ? THR F 820  ? HIS H 816  THR H 820  5 ? 5  
HELX_P HELX_P111 AM3 SER F 830  ? TYR F 844  ? SER H 830  TYR H 844  1 ? 15 
HELX_P HELX_P112 AM4 ASP F 860  ? LEU F 876  ? ASP H 860  LEU H 876  1 ? 17 
HELX_P HELX_P113 AM5 LEU F 913  ? ARG F 918  ? LEU H 913  ARG H 918  1 ? 6  
HELX_P HELX_P114 AM6 GLU F 920  ? LEU F 930  ? GLU H 920  LEU H 930  1 ? 11 
HELX_P HELX_P115 AM7 ILE F 995  ? ALA F 1007 ? ILE H 995  ALA H 1007 1 ? 13 
HELX_P HELX_P116 AM8 GLY F 1008 ? ALA F 1034 ? GLY H 1008 ALA H 1034 1 ? 27 
HELX_P HELX_P117 AM9 LYS F 1035 ? ASP F 1038 ? LYS H 1035 ASP H 1038 5 ? 4  
HELX_P HELX_P118 AN1 VAL F 1062 ? LEU F 1106 ? VAL H 1062 LEU H 1106 1 ? 45 
HELX_P HELX_P119 AN2 PRO F 1108 ? THR F 1115 ? PRO H 1108 THR H 1115 1 ? 8  
HELX_P HELX_P120 AN3 PRO F 1116 ? SER F 1126 ? PRO H 1116 SER H 1126 1 ? 11 
HELX_P HELX_P121 AN4 SER F 1126 ? THR F 1160 ? SER H 1126 THR H 1160 1 ? 35 
HELX_P HELX_P122 AN5 VAL F 1162 ? GLY F 1209 ? VAL H 1162 GLY H 1209 1 ? 48 
HELX_P HELX_P123 AN6 GLY F 1209 ? ARG F 1217 ? GLY H 1209 ARG H 1217 1 ? 9  
HELX_P HELX_P124 AN7 TYR F 1218 ? ARG F 1273 ? TYR H 1218 ARG H 1273 1 ? 56 
HELX_P HELX_P125 AN8 ALA F 1277 ? LYS F 1319 ? ALA H 1277 LYS H 1319 1 ? 43 
HELX_P HELX_P126 AN9 GLY F 1383 ? LEU F 1389 ? GLY H 1383 LEU H 1389 1 ? 7  
HELX_P HELX_P127 AO1 PRO F 1413 ? ARG F 1420 ? PRO H 1413 ARG H 1420 1 ? 8  
HELX_P HELX_P128 AO2 THR F 1434 ? ASP F 1440 ? THR H 1434 ASP H 1440 1 ? 7  
HELX_P HELX_P129 AO3 SER F 1446 ? ALA F 1457 ? SER H 1446 ALA H 1457 1 ? 12 
HELX_P HELX_P130 AO4 LEU F 1459 ? LEU F 1466 ? LEU H 1459 LEU H 1466 1 ? 8  
HELX_P HELX_P131 AO5 SER F 1482 ? VAL F 1496 ? SER H 1482 VAL H 1496 1 ? 15 
HELX_P HELX_P132 AO6 GLU F 1506 ? ILE F 1511 ? GLU H 1506 ILE H 1511 5 ? 6  
HELX_P HELX_P133 AO7 ASP F 1512 ? PHE F 1527 ? ASP H 1512 PHE H 1527 1 ? 16 
HELX_P HELX_P134 AO8 ARG F 1538 ? LEU F 1543 ? ARG H 1538 LEU H 1543 1 ? 6  
HELX_P HELX_P135 AO9 LYS F 1561 ? LYS F 1569 ? LYS H 1561 LYS H 1569 1 ? 9  
HELX_P HELX_P136 AP1 SER F 1571 ? LYS F 1581 ? SER H 1571 LYS H 1581 1 ? 11 
HELX_P HELX_P137 AP2 GLU G 9    ? ALA G 14   ? GLU G 9    ALA G 14   1 ? 6  
HELX_P HELX_P138 AP3 GLY G 20   ? ASN G 23   ? GLY G 20   ASN G 23   5 ? 4  
HELX_P HELX_P139 AP4 ASN G 24   ? ASN G 32   ? ASN G 24   ASN G 32   1 ? 9  
HELX_P HELX_P140 AP5 VAL G 33   ? THR G 43   ? VAL G 33   THR G 43   1 ? 11 
HELX_P HELX_P141 AP6 PHE G 44   ? GLY G 52   ? PHE G 44   GLY G 52   1 ? 9  
HELX_P HELX_P142 AP7 GLY G 70   ? ASP G 96   ? GLY G 70   ASP G 96   1 ? 27 
HELX_P HELX_P143 AP8 TYR G 107  ? THR G 129  ? TYR G 107  THR G 129  1 ? 23 
HELX_P HELX_P144 AP9 PHE G 132  ? ILE G 137  ? PHE G 132  ILE G 137  1 ? 6  
HELX_P HELX_P145 AQ1 ILE G 137  ? ASP G 159  ? ILE G 137  ASP G 159  1 ? 23 
HELX_P HELX_P146 AQ2 SER G 165  ? ARG G 193  ? SER G 165  ARG G 193  1 ? 29 
HELX_P HELX_P147 AQ3 ASN G 223  ? TYR G 230  ? ASN G 223  TYR G 230  1 ? 8  
HELX_P HELX_P148 AQ4 TYR G 230  ? LYS G 243  ? TYR G 230  LYS G 243  1 ? 14 
HELX_P HELX_P149 AQ5 ALA G 259  ? ASP G 277  ? ALA G 259  ASP G 277  1 ? 19 
HELX_P HELX_P150 AQ6 ILE G 287  ? PHE G 314  ? ILE G 287  PHE G 314  1 ? 28 
HELX_P HELX_P151 AQ7 ALA G 315  ? GLY G 328  ? ALA G 315  GLY G 328  1 ? 14 
HELX_P HELX_P152 AQ8 ASN G 354  ? HIS G 401  ? ASN G 354  HIS G 401  1 ? 48 
HELX_P HELX_P153 AQ9 SER G 403  ? GLY G 410  ? SER G 403  GLY G 410  1 ? 8  
HELX_P HELX_P154 AR1 THR G 413  ? PHE G 432  ? THR G 413  PHE G 432  1 ? 20 
HELX_P HELX_P155 AR2 LEU G 434  ? ILE G 455  ? LEU G 434  ILE G 455  1 ? 22 
HELX_P HELX_P156 AR3 GLY G 463  ? GLY G 505  ? GLY G 463  GLY G 505  1 ? 43 
HELX_P HELX_P157 AR4 GLY G 505  ? ALA G 513  ? GLY G 505  ALA G 513  1 ? 9  
HELX_P HELX_P158 AR5 TRP G 514  ? HIS G 562  ? TRP G 514  HIS G 562  1 ? 49 
HELX_P HELX_P159 AR6 SER G 574  ? SER G 615  ? SER G 574  SER G 615  1 ? 42 
HELX_P HELX_P160 AR7 GLY G 718  ? LEU G 727  ? GLY G 718  LEU G 727  1 ? 10 
HELX_P HELX_P161 AR8 THR G 782  ? PHE G 789  ? THR G 782  PHE G 789  1 ? 8  
HELX_P HELX_P162 AR9 ASN G 794  ? SER G 806  ? ASN G 794  SER G 806  1 ? 13 
HELX_P HELX_P163 AS1 LEU G 807  ? ILE G 813  ? LEU G 807  ILE G 813  1 ? 7  
HELX_P HELX_P164 AS2 HIS G 816  ? THR G 820  ? HIS G 816  THR G 820  5 ? 5  
HELX_P HELX_P165 AS3 SER G 830  ? TYR G 844  ? SER G 830  TYR G 844  1 ? 15 
HELX_P HELX_P166 AS4 ASP G 860  ? LEU G 876  ? ASP G 860  LEU G 876  1 ? 17 
HELX_P HELX_P167 AS5 LEU G 913  ? ARG G 918  ? LEU G 913  ARG G 918  1 ? 6  
HELX_P HELX_P168 AS6 GLU G 920  ? LEU G 930  ? GLU G 920  LEU G 930  1 ? 11 
HELX_P HELX_P169 AS7 ILE G 995  ? ALA G 1007 ? ILE G 995  ALA G 1007 1 ? 13 
HELX_P HELX_P170 AS8 GLY G 1008 ? ALA G 1034 ? GLY G 1008 ALA G 1034 1 ? 27 
HELX_P HELX_P171 AS9 LYS G 1035 ? ASP G 1038 ? LYS G 1035 ASP G 1038 5 ? 4  
HELX_P HELX_P172 AT1 VAL G 1062 ? LEU G 1106 ? VAL G 1062 LEU G 1106 1 ? 45 
HELX_P HELX_P173 AT2 PRO G 1108 ? THR G 1115 ? PRO G 1108 THR G 1115 1 ? 8  
HELX_P HELX_P174 AT3 PRO G 1116 ? SER G 1126 ? PRO G 1116 SER G 1126 1 ? 11 
HELX_P HELX_P175 AT4 SER G 1126 ? THR G 1160 ? SER G 1126 THR G 1160 1 ? 35 
HELX_P HELX_P176 AT5 VAL G 1162 ? GLY G 1209 ? VAL G 1162 GLY G 1209 1 ? 48 
HELX_P HELX_P177 AT6 GLY G 1209 ? ARG G 1217 ? GLY G 1209 ARG G 1217 1 ? 9  
HELX_P HELX_P178 AT7 TYR G 1218 ? ARG G 1273 ? TYR G 1218 ARG G 1273 1 ? 56 
HELX_P HELX_P179 AT8 ALA G 1277 ? LYS G 1319 ? ALA G 1277 LYS G 1319 1 ? 43 
HELX_P HELX_P180 AT9 GLY G 1383 ? LEU G 1389 ? GLY G 1383 LEU G 1389 1 ? 7  
HELX_P HELX_P181 AU1 PRO G 1413 ? ARG G 1420 ? PRO G 1413 ARG G 1420 1 ? 8  
HELX_P HELX_P182 AU2 THR G 1434 ? ASP G 1440 ? THR G 1434 ASP G 1440 1 ? 7  
HELX_P HELX_P183 AU3 SER G 1446 ? ALA G 1457 ? SER G 1446 ALA G 1457 1 ? 12 
HELX_P HELX_P184 AU4 LEU G 1459 ? LEU G 1466 ? LEU G 1459 LEU G 1466 1 ? 8  
HELX_P HELX_P185 AU5 SER G 1482 ? VAL G 1496 ? SER G 1482 VAL G 1496 1 ? 15 
HELX_P HELX_P186 AU6 GLU G 1506 ? ILE G 1511 ? GLU G 1506 ILE G 1511 5 ? 6  
HELX_P HELX_P187 AU7 ASP G 1512 ? PHE G 1527 ? ASP G 1512 PHE G 1527 1 ? 16 
HELX_P HELX_P188 AU8 ARG G 1538 ? LEU G 1543 ? ARG G 1538 LEU G 1543 1 ? 6  
HELX_P HELX_P189 AU9 LYS G 1561 ? LYS G 1569 ? LYS G 1561 LYS G 1569 1 ? 9  
HELX_P HELX_P190 AV1 SER G 1571 ? LYS G 1581 ? SER G 1571 LYS G 1581 1 ? 11 
HELX_P HELX_P191 AV2 GLU H 9    ? ALA H 14   ? GLU F 9    ALA F 14   1 ? 6  
HELX_P HELX_P192 AV3 GLY H 20   ? ASN H 23   ? GLY F 20   ASN F 23   5 ? 4  
HELX_P HELX_P193 AV4 ASN H 24   ? ASN H 32   ? ASN F 24   ASN F 32   1 ? 9  
HELX_P HELX_P194 AV5 VAL H 33   ? THR H 43   ? VAL F 33   THR F 43   1 ? 11 
HELX_P HELX_P195 AV6 PHE H 44   ? GLY H 52   ? PHE F 44   GLY F 52   1 ? 9  
HELX_P HELX_P196 AV7 GLY H 70   ? ASP H 96   ? GLY F 70   ASP F 96   1 ? 27 
HELX_P HELX_P197 AV8 TYR H 107  ? THR H 129  ? TYR F 107  THR F 129  1 ? 23 
HELX_P HELX_P198 AV9 PHE H 132  ? ILE H 137  ? PHE F 132  ILE F 137  1 ? 6  
HELX_P HELX_P199 AW1 ILE H 137  ? ASP H 159  ? ILE F 137  ASP F 159  1 ? 23 
HELX_P HELX_P200 AW2 SER H 165  ? ARG H 193  ? SER F 165  ARG F 193  1 ? 29 
HELX_P HELX_P201 AW3 ASN H 223  ? TYR H 230  ? ASN F 223  TYR F 230  1 ? 8  
HELX_P HELX_P202 AW4 TYR H 230  ? LYS H 243  ? TYR F 230  LYS F 243  1 ? 14 
HELX_P HELX_P203 AW5 ALA H 259  ? ASP H 277  ? ALA F 259  ASP F 277  1 ? 19 
HELX_P HELX_P204 AW6 ILE H 287  ? PHE H 314  ? ILE F 287  PHE F 314  1 ? 28 
HELX_P HELX_P205 AW7 ALA H 315  ? GLY H 328  ? ALA F 315  GLY F 328  1 ? 14 
HELX_P HELX_P206 AW8 ASN H 354  ? HIS H 401  ? ASN F 354  HIS F 401  1 ? 48 
HELX_P HELX_P207 AW9 SER H 403  ? GLY H 410  ? SER F 403  GLY F 410  1 ? 8  
HELX_P HELX_P208 AX1 THR H 413  ? PHE H 432  ? THR F 413  PHE F 432  1 ? 20 
HELX_P HELX_P209 AX2 LEU H 434  ? ILE H 455  ? LEU F 434  ILE F 455  1 ? 22 
HELX_P HELX_P210 AX3 GLY H 463  ? GLY H 505  ? GLY F 463  GLY F 505  1 ? 43 
HELX_P HELX_P211 AX4 GLY H 505  ? ALA H 513  ? GLY F 505  ALA F 513  1 ? 9  
HELX_P HELX_P212 AX5 TRP H 514  ? HIS H 562  ? TRP F 514  HIS F 562  1 ? 49 
HELX_P HELX_P213 AX6 SER H 574  ? SER H 615  ? SER F 574  SER F 615  1 ? 42 
HELX_P HELX_P214 AX7 GLY H 718  ? LEU H 727  ? GLY F 718  LEU F 727  1 ? 10 
HELX_P HELX_P215 AX8 THR H 782  ? PHE H 789  ? THR F 782  PHE F 789  1 ? 8  
HELX_P HELX_P216 AX9 ASN H 794  ? SER H 806  ? ASN F 794  SER F 806  1 ? 13 
HELX_P HELX_P217 AY1 LEU H 807  ? ILE H 813  ? LEU F 807  ILE F 813  1 ? 7  
HELX_P HELX_P218 AY2 HIS H 816  ? THR H 820  ? HIS F 816  THR F 820  5 ? 5  
HELX_P HELX_P219 AY3 SER H 830  ? TYR H 844  ? SER F 830  TYR F 844  1 ? 15 
HELX_P HELX_P220 AY4 ASP H 860  ? LEU H 876  ? ASP F 860  LEU F 876  1 ? 17 
HELX_P HELX_P221 AY5 LEU H 913  ? ARG H 918  ? LEU F 913  ARG F 918  1 ? 6  
HELX_P HELX_P222 AY6 GLU H 920  ? LEU H 930  ? GLU F 920  LEU F 930  1 ? 11 
HELX_P HELX_P223 AY7 ILE H 995  ? ALA H 1007 ? ILE F 995  ALA F 1007 1 ? 13 
HELX_P HELX_P224 AY8 GLY H 1008 ? ALA H 1034 ? GLY F 1008 ALA F 1034 1 ? 27 
HELX_P HELX_P225 AY9 LYS H 1035 ? ASP H 1038 ? LYS F 1035 ASP F 1038 5 ? 4  
HELX_P HELX_P226 AZ1 VAL H 1062 ? LEU H 1106 ? VAL F 1062 LEU F 1106 1 ? 45 
HELX_P HELX_P227 AZ2 PRO H 1108 ? THR H 1115 ? PRO F 1108 THR F 1115 1 ? 8  
HELX_P HELX_P228 AZ3 PRO H 1116 ? SER H 1126 ? PRO F 1116 SER F 1126 1 ? 11 
HELX_P HELX_P229 AZ4 SER H 1126 ? THR H 1160 ? SER F 1126 THR F 1160 1 ? 35 
HELX_P HELX_P230 AZ5 VAL H 1162 ? GLY H 1209 ? VAL F 1162 GLY F 1209 1 ? 48 
HELX_P HELX_P231 AZ6 GLY H 1209 ? ARG H 1217 ? GLY F 1209 ARG F 1217 1 ? 9  
HELX_P HELX_P232 AZ7 TYR H 1218 ? ARG H 1273 ? TYR F 1218 ARG F 1273 1 ? 56 
HELX_P HELX_P233 AZ8 ALA H 1277 ? LYS H 1319 ? ALA F 1277 LYS F 1319 1 ? 43 
HELX_P HELX_P234 AZ9 GLY H 1383 ? LEU H 1389 ? GLY F 1383 LEU F 1389 1 ? 7  
HELX_P HELX_P235 BA1 PRO H 1413 ? ARG H 1420 ? PRO F 1413 ARG F 1420 1 ? 8  
HELX_P HELX_P236 BA2 THR H 1434 ? ASP H 1440 ? THR F 1434 ASP F 1440 1 ? 7  
HELX_P HELX_P237 BA3 SER H 1446 ? ALA H 1457 ? SER F 1446 ALA F 1457 1 ? 12 
HELX_P HELX_P238 BA4 LEU H 1459 ? LEU H 1466 ? LEU F 1459 LEU F 1466 1 ? 8  
HELX_P HELX_P239 BA5 SER H 1482 ? VAL H 1496 ? SER F 1482 VAL F 1496 1 ? 15 
HELX_P HELX_P240 BA6 GLU H 1506 ? ILE H 1511 ? GLU F 1506 ILE F 1511 5 ? 6  
HELX_P HELX_P241 BA7 ASP H 1512 ? PHE H 1527 ? ASP F 1512 PHE F 1527 1 ? 16 
HELX_P HELX_P242 BA8 ARG H 1538 ? LEU H 1543 ? ARG F 1538 LEU F 1543 1 ? 6  
HELX_P HELX_P243 BA9 LYS H 1561 ? LYS H 1569 ? LYS F 1561 LYS F 1569 1 ? 9  
HELX_P HELX_P244 BB1 SER H 1571 ? LYS H 1581 ? SER F 1571 LYS F 1581 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 116 SG  ? ? ? 1_555 A  CYS 148 SG  ? ? A CYS 110  A CYS 142  1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2  disulf ? ? B CYS 116 SG  ? ? ? 1_555 B  CYS 148 SG  ? ? D CYS 110  D CYS 142  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf3  disulf ? ? C CYS 116 SG  ? ? ? 1_555 C  CYS 148 SG  ? ? B CYS 110  B CYS 142  1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf4  disulf ? ? D CYS 116 SG  ? ? ? 1_555 D  CYS 148 SG  ? ? C CYS 110  C CYS 142  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf5  disulf ? ? E CYS 6   SG  ? ? ? 1_555 E  CYS 26  SG  ? ? E CYS 6    E CYS 26   1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? F CYS 6   SG  ? ? ? 1_555 F  CYS 26  SG  ? ? H CYS 6    H CYS 26   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf7  disulf ? ? G CYS 6   SG  ? ? ? 1_555 G  CYS 26  SG  ? ? G CYS 6    G CYS 26   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf8  disulf ? ? H CYS 6   SG  ? ? ? 1_555 H  CYS 26  SG  ? ? F CYS 6    F CYS 26   1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc1  metalc ? ? E SER 720 OG  ? ? ? 1_555 N  MG  .   MG  ? ? E SER 720  E MG  2002 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc2  metalc ? ? E GLN 774 OE1 ? ? ? 1_555 N  MG  .   MG  ? ? E GLN 774  E MG  2002 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc3  metalc ? ? F SER 720 OG  ? ? ? 1_555 R  MG  .   MG  ? ? H SER 720  H MG  2002 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc4  metalc ? ? F GLN 774 OE1 ? ? ? 1_555 R  MG  .   MG  ? ? H GLN 774  H MG  2002 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc5  metalc ? ? G SER 720 OG  ? ? ? 1_555 V  MG  .   MG  ? ? G SER 720  G MG  2002 1_555 ? ? ? ? ? ? ? 2.012 ? 
metalc6  metalc ? ? G GLN 774 OE1 ? ? ? 1_555 V  MG  .   MG  ? ? G GLN 774  G MG  2002 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc7  metalc ? ? H SER 720 OG  ? ? ? 1_555 Z  MG  .   MG  ? ? F SER 720  F MG  2002 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc8  metalc ? ? H GLN 774 OE1 ? ? ? 1_555 Z  MG  .   MG  ? ? F GLN 774  F MG  2002 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc9  metalc ? ? M ADP .   O3B ? ? ? 1_555 O  MG  .   MG  ? ? E ADP 2001 E MG  2003 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc10 metalc ? ? N MG  .   MG  ? ? ? 1_555 P  ATP .   O2B ? ? E MG  2002 E ATP 2004 1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc11 metalc ? ? N MG  .   MG  ? ? ? 1_555 P  ATP .   O3B ? ? E MG  2002 E ATP 2004 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc12 metalc ? ? N MG  .   MG  ? ? ? 1_555 P  ATP .   O3A ? ? E MG  2002 E ATP 2004 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc13 metalc ? ? Q ADP .   O3B ? ? ? 1_555 S  MG  .   MG  ? ? H ADP 2001 H MG  2003 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc14 metalc ? ? R MG  .   MG  ? ? ? 1_555 T  ATP .   O2B ? ? H MG  2002 H ATP 2004 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc15 metalc ? ? R MG  .   MG  ? ? ? 1_555 T  ATP .   O3B ? ? H MG  2002 H ATP 2004 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc16 metalc ? ? R MG  .   MG  ? ? ? 1_555 T  ATP .   O3A ? ? H MG  2002 H ATP 2004 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc17 metalc ? ? U ADP .   O3B ? ? ? 1_555 W  MG  .   MG  ? ? G ADP 2001 G MG  2003 1_555 ? ? ? ? ? ? ? 2.143 ? 
metalc18 metalc ? ? V MG  .   MG  ? ? ? 1_555 X  ATP .   O3B ? ? G MG  2002 G ATP 2004 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc19 metalc ? ? V MG  .   MG  ? ? ? 1_555 X  ATP .   O2B ? ? G MG  2002 G ATP 2004 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc20 metalc ? ? V MG  .   MG  ? ? ? 1_555 X  ATP .   O3A ? ? G MG  2002 G ATP 2004 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc21 metalc ? ? Y ADP .   O3B ? ? ? 1_555 AA MG  .   MG  ? ? F ADP 2001 F MG  2003 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc22 metalc ? ? Z MG  .   MG  ? ? ? 1_555 BA ATP .   O3B ? ? F MG  2002 F ATP 2004 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc23 metalc ? ? Z MG  .   MG  ? ? ? 1_555 BA ATP .   O2B ? ? F MG  2002 F ATP 2004 1_555 ? ? ? ? ? ? ? 1.961 ? 
metalc24 metalc ? ? Z MG  .   MG  ? ? ? 1_555 BA ATP .   O3A ? ? F MG  2002 F ATP 2004 1_555 ? ? ? ? ? ? ? 2.483 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 3 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 5 ? 
AC5 ? 3 ? 
AC6 ? 5 ? 
AC7 ? 3 ? 
AC8 ? 5 ? 
AC9 ? 3 ? 
AD1 ? 5 ? 
AD2 ? 3 ? 
AD3 ? 5 ? 
AD4 ? 3 ? 
AD5 ? 5 ? 
AD6 ? 3 ? 
AD7 ? 5 ? 
AD8 ? 3 ? 
AD9 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? parallel      
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? parallel      
AC4 3 4 ? parallel      
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? parallel      
AC6 3 4 ? parallel      
AC6 4 5 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? parallel      
AC8 3 4 ? parallel      
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? parallel      
AD1 3 4 ? parallel      
AD1 4 5 ? parallel      
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD3 1 2 ? parallel      
AD3 2 3 ? parallel      
AD3 3 4 ? parallel      
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? parallel      
AD5 2 3 ? parallel      
AD5 3 4 ? parallel      
AD5 4 5 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? parallel      
AD9 2 3 ? parallel      
AD9 3 4 ? parallel      
AD9 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 50   ? ALA A 51   ? VAL A 44   ALA A 45   
AA1 2 ARG B 331  ? VAL B 334  ? ARG D 325  VAL D 328  
AA1 3 VAL B 325  ? GLU B 328  ? VAL D 319  GLU D 322  
AA2 1 LEU A 187  ? PHE A 189  ? LEU A 181  PHE A 183  
AA2 2 ARG A 201  ? ASP A 210  ? ARG A 195  ASP A 204  
AA2 3 ILE A 262  ? VAL A 266  ? ILE A 256  VAL A 260  
AA3 1 LEU A 187  ? PHE A 189  ? LEU A 181  PHE A 183  
AA3 2 ARG A 201  ? ASP A 210  ? ARG A 195  ASP A 204  
AA3 3 ALA A 193  ? ARG A 198  ? ALA A 187  ARG A 192  
AA3 4 ILE A 315  ? LEU A 316  ? ILE A 309  LEU A 310  
AA4 1 VAL A 236  ? ASP A 243  ? VAL A 230  ASP A 237  
AA4 2 ILE A 216  ? THR A 230  ? ILE A 210  THR A 224  
AA4 3 GLU A 288  ? VAL A 297  ? GLU A 282  VAL A 291  
AA4 4 THR A 303  ? LEU A 311  ? THR A 297  LEU A 305  
AA5 1 GLN A 319  ? PHE A 321  ? GLN A 313  PHE A 315  
AA5 2 THR A 342  ? LYS A 344  ? THR A 336  LYS A 338  
AA6 1 VAL A 325  ? GLU A 328  ? VAL A 319  GLU A 322  
AA6 2 ARG A 331  ? VAL A 334  ? ARG A 325  VAL A 328  
AA6 3 VAL C 50   ? ALA C 51   ? VAL B 44   ALA B 45   
AA7 1 VAL B 50   ? ALA B 51   ? VAL D 44   ALA D 45   
AA7 2 ARG D 331  ? VAL D 334  ? ARG C 325  VAL C 328  
AA7 3 VAL D 325  ? GLU D 328  ? VAL C 319  GLU C 322  
AA8 1 LEU B 187  ? PHE B 189  ? LEU D 181  PHE D 183  
AA8 2 ARG B 201  ? ASP B 210  ? ARG D 195  ASP D 204  
AA8 3 ILE B 262  ? VAL B 266  ? ILE D 256  VAL D 260  
AA9 1 LEU B 187  ? PHE B 189  ? LEU D 181  PHE D 183  
AA9 2 ARG B 201  ? ASP B 210  ? ARG D 195  ASP D 204  
AA9 3 ALA B 193  ? ARG B 198  ? ALA D 187  ARG D 192  
AA9 4 ILE B 315  ? LEU B 316  ? ILE D 309  LEU D 310  
AB1 1 VAL B 236  ? ASP B 243  ? VAL D 230  ASP D 237  
AB1 2 ILE B 216  ? THR B 230  ? ILE D 210  THR D 224  
AB1 3 GLU B 288  ? VAL B 297  ? GLU D 282  VAL D 291  
AB1 4 THR B 303  ? LEU B 311  ? THR D 297  LEU D 305  
AB2 1 GLN B 319  ? PHE B 321  ? GLN D 313  PHE D 315  
AB2 2 THR B 342  ? LYS B 344  ? THR D 336  LYS D 338  
AB3 1 LEU C 187  ? PHE C 189  ? LEU B 181  PHE B 183  
AB3 2 ARG C 201  ? ASP C 210  ? ARG B 195  ASP B 204  
AB3 3 ILE C 262  ? VAL C 266  ? ILE B 256  VAL B 260  
AB4 1 LEU C 187  ? PHE C 189  ? LEU B 181  PHE B 183  
AB4 2 ARG C 201  ? ASP C 210  ? ARG B 195  ASP B 204  
AB4 3 ALA C 193  ? ARG C 198  ? ALA B 187  ARG B 192  
AB4 4 ILE C 315  ? LEU C 316  ? ILE B 309  LEU B 310  
AB5 1 VAL C 236  ? ASP C 243  ? VAL B 230  ASP B 237  
AB5 2 ILE C 216  ? THR C 230  ? ILE B 210  THR B 224  
AB5 3 GLU C 288  ? VAL C 297  ? GLU B 282  VAL B 291  
AB5 4 THR C 303  ? LEU C 311  ? THR B 297  LEU B 305  
AB6 1 GLN C 319  ? PHE C 321  ? GLN B 313  PHE B 315  
AB6 2 THR C 342  ? LYS C 344  ? THR B 336  LYS B 338  
AB7 1 VAL C 325  ? GLU C 328  ? VAL B 319  GLU B 322  
AB7 2 ARG C 331  ? VAL C 334  ? ARG B 325  VAL B 328  
AB7 3 VAL D 50   ? ALA D 51   ? VAL C 44   ALA C 45   
AB8 1 LEU D 187  ? PHE D 189  ? LEU C 181  PHE C 183  
AB8 2 ARG D 201  ? ASP D 210  ? ARG C 195  ASP C 204  
AB8 3 ILE D 262  ? VAL D 266  ? ILE C 256  VAL C 260  
AB9 1 LEU D 187  ? PHE D 189  ? LEU C 181  PHE C 183  
AB9 2 ARG D 201  ? ASP D 210  ? ARG C 195  ASP C 204  
AB9 3 ALA D 193  ? ARG D 198  ? ALA C 187  ARG C 192  
AB9 4 ILE D 315  ? LEU D 316  ? ILE C 309  LEU C 310  
AC1 1 VAL D 236  ? ASP D 243  ? VAL C 230  ASP C 237  
AC1 2 ILE D 216  ? THR D 230  ? ILE C 210  THR C 224  
AC1 3 GLU D 288  ? VAL D 297  ? GLU C 282  VAL C 291  
AC1 4 THR D 303  ? LEU D 311  ? THR C 297  LEU C 305  
AC2 1 GLN D 319  ? PHE D 321  ? GLN C 313  PHE C 315  
AC2 2 THR D 342  ? LYS D 344  ? THR C 336  LYS C 338  
AC3 1 LEU E 696  ? ARG E 702  ? LEU E 696  ARG E 702  
AC3 2 GLN E 680  ? THR E 687  ? GLN E 680  THR E 687  
AC3 3 GLN E 731  ? PHE E 738  ? GLN E 731  PHE E 738  
AC4 1 VAL E 850  ? PHE E 851  ? VAL E 850  PHE E 851  
AC4 2 VAL E 883  ? VAL E 886  ? VAL E 883  VAL E 886  
AC4 3 LEU E 708  ? GLY E 713  ? LEU E 708  GLY E 713  
AC4 4 TRP E 898  ? MET E 902  ? TRP E 898  MET E 902  
AC4 5 ILE E 907  ? GLU E 910  ? ILE E 907  GLU E 910  
AC5 1 ALA E 1366 ? ILE E 1368 ? ALA E 1366 ILE E 1368 
AC5 2 ILE E 1344 ? SER E 1350 ? ILE E 1344 SER E 1350 
AC5 3 GLU E 1399 ? ILE E 1404 ? GLU E 1399 ILE E 1404 
AC6 1 ILE E 1423 ? ILE E 1424 ? ILE E 1423 ILE E 1424 
AC6 2 ILE E 1501 ? MET E 1504 ? ILE E 1501 MET E 1504 
AC6 3 THR E 1531 ? ILE E 1535 ? THR E 1531 ILE E 1535 
AC6 4 LYS E 1373 ? GLY E 1378 ? LYS E 1373 GLY E 1378 
AC6 5 VAL E 1548 ? LEU E 1551 ? VAL E 1548 LEU E 1551 
AC7 1 LEU F 696  ? ARG F 702  ? LEU H 696  ARG H 702  
AC7 2 GLN F 680  ? THR F 687  ? GLN H 680  THR H 687  
AC7 3 GLN F 731  ? PHE F 738  ? GLN H 731  PHE H 738  
AC8 1 VAL F 850  ? PHE F 851  ? VAL H 850  PHE H 851  
AC8 2 VAL F 883  ? VAL F 886  ? VAL H 883  VAL H 886  
AC8 3 LEU F 708  ? GLY F 713  ? LEU H 708  GLY H 713  
AC8 4 TRP F 898  ? MET F 902  ? TRP H 898  MET H 902  
AC8 5 ILE F 907  ? GLU F 910  ? ILE H 907  GLU H 910  
AC9 1 ALA F 1366 ? ILE F 1368 ? ALA H 1366 ILE H 1368 
AC9 2 ILE F 1344 ? SER F 1350 ? ILE H 1344 SER H 1350 
AC9 3 GLU F 1399 ? ILE F 1404 ? GLU H 1399 ILE H 1404 
AD1 1 ILE F 1423 ? ILE F 1424 ? ILE H 1423 ILE H 1424 
AD1 2 ILE F 1501 ? MET F 1504 ? ILE H 1501 MET H 1504 
AD1 3 THR F 1531 ? ILE F 1535 ? THR H 1531 ILE H 1535 
AD1 4 LYS F 1373 ? GLY F 1378 ? LYS H 1373 GLY H 1378 
AD1 5 VAL F 1548 ? LEU F 1551 ? VAL H 1548 LEU H 1551 
AD2 1 LEU G 696  ? ARG G 702  ? LEU G 696  ARG G 702  
AD2 2 GLN G 680  ? THR G 687  ? GLN G 680  THR G 687  
AD2 3 GLN G 731  ? PHE G 738  ? GLN G 731  PHE G 738  
AD3 1 VAL G 850  ? PHE G 851  ? VAL G 850  PHE G 851  
AD3 2 VAL G 883  ? VAL G 886  ? VAL G 883  VAL G 886  
AD3 3 LEU G 708  ? GLY G 713  ? LEU G 708  GLY G 713  
AD3 4 TRP G 898  ? MET G 902  ? TRP G 898  MET G 902  
AD3 5 ILE G 907  ? GLU G 910  ? ILE G 907  GLU G 910  
AD4 1 ALA G 1366 ? ILE G 1368 ? ALA G 1366 ILE G 1368 
AD4 2 ILE G 1344 ? SER G 1350 ? ILE G 1344 SER G 1350 
AD4 3 GLU G 1399 ? ILE G 1404 ? GLU G 1399 ILE G 1404 
AD5 1 ILE G 1423 ? ILE G 1424 ? ILE G 1423 ILE G 1424 
AD5 2 ILE G 1501 ? MET G 1504 ? ILE G 1501 MET G 1504 
AD5 3 THR G 1531 ? ILE G 1535 ? THR G 1531 ILE G 1535 
AD5 4 LYS G 1373 ? GLY G 1378 ? LYS G 1373 GLY G 1378 
AD5 5 VAL G 1548 ? LEU G 1551 ? VAL G 1548 LEU G 1551 
AD6 1 LEU H 696  ? ARG H 702  ? LEU F 696  ARG F 702  
AD6 2 GLN H 680  ? THR H 687  ? GLN F 680  THR F 687  
AD6 3 GLN H 731  ? PHE H 738  ? GLN F 731  PHE F 738  
AD7 1 VAL H 850  ? PHE H 851  ? VAL F 850  PHE F 851  
AD7 2 VAL H 883  ? VAL H 886  ? VAL F 883  VAL F 886  
AD7 3 LEU H 708  ? GLY H 713  ? LEU F 708  GLY F 713  
AD7 4 TRP H 898  ? MET H 902  ? TRP F 898  MET F 902  
AD7 5 ILE H 907  ? GLU H 910  ? ILE F 907  GLU F 910  
AD8 1 ALA H 1366 ? ILE H 1368 ? ALA F 1366 ILE F 1368 
AD8 2 ILE H 1344 ? SER H 1350 ? ILE F 1344 SER F 1350 
AD8 3 GLU H 1399 ? ILE H 1404 ? GLU F 1399 ILE F 1404 
AD9 1 ILE H 1423 ? ILE H 1424 ? ILE F 1423 ILE F 1424 
AD9 2 ILE H 1501 ? MET H 1504 ? ILE F 1501 MET F 1504 
AD9 3 THR H 1531 ? ILE H 1535 ? THR F 1531 ILE F 1535 
AD9 4 LYS H 1373 ? GLY H 1378 ? LYS F 1373 GLY F 1378 
AD9 5 VAL H 1548 ? LEU H 1551 ? VAL F 1548 LEU F 1551 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 51   ? N ALA A 45   O VAL B 334  ? O VAL D 328  
AA1 2 3 O SER B 333  ? O SER D 327  N ALA B 326  ? N ALA D 320  
AA2 1 2 N ILE A 188  ? N ILE A 182  O GLY A 209  ? O GLY A 203  
AA2 2 3 N LEU A 206  ? N LEU A 200  O ILE A 263  ? O ILE A 257  
AA3 1 2 N ILE A 188  ? N ILE A 182  O GLY A 209  ? O GLY A 203  
AA3 2 3 O ARG A 201  ? O ARG A 195  N ARG A 198  ? N ARG A 192  
AA3 3 4 N ALA A 193  ? N ALA A 187  O LEU A 316  ? O LEU A 310  
AA4 1 2 O VAL A 242  ? O VAL A 236  N VAL A 225  ? N VAL A 219  
AA4 2 3 N GLN A 224  ? N GLN A 218  O ILE A 290  ? O ILE A 284  
AA4 3 4 N VAL A 291  ? N VAL A 285  O THR A 308  ? O THR A 302  
AA5 1 2 N ARG A 320  ? N ARG A 314  O ILE A 343  ? O ILE A 337  
AA6 1 2 N ALA A 326  ? N ALA A 320  O SER A 333  ? O SER A 327  
AA6 2 3 N VAL A 334  ? N VAL A 328  O ALA C 51   ? O ALA B 45   
AA7 1 2 N ALA B 51   ? N ALA D 45   O VAL D 334  ? O VAL C 328  
AA7 2 3 O SER D 333  ? O SER C 327  N ALA D 326  ? N ALA C 320  
AA8 1 2 N ILE B 188  ? N ILE D 182  O GLY B 209  ? O GLY D 203  
AA8 2 3 N LEU B 206  ? N LEU D 200  O ILE B 263  ? O ILE D 257  
AA9 1 2 N ILE B 188  ? N ILE D 182  O GLY B 209  ? O GLY D 203  
AA9 2 3 O ARG B 201  ? O ARG D 195  N ARG B 198  ? N ARG D 192  
AA9 3 4 N ALA B 193  ? N ALA D 187  O LEU B 316  ? O LEU D 310  
AB1 1 2 O VAL B 242  ? O VAL D 236  N VAL B 225  ? N VAL D 219  
AB1 2 3 N GLN B 224  ? N GLN D 218  O ILE B 290  ? O ILE D 284  
AB1 3 4 N VAL B 291  ? N VAL D 285  O THR B 308  ? O THR D 302  
AB2 1 2 N ARG B 320  ? N ARG D 314  O ILE B 343  ? O ILE D 337  
AB3 1 2 N ILE C 188  ? N ILE B 182  O GLY C 209  ? O GLY B 203  
AB3 2 3 N LEU C 206  ? N LEU B 200  O ILE C 263  ? O ILE B 257  
AB4 1 2 N ILE C 188  ? N ILE B 182  O GLY C 209  ? O GLY B 203  
AB4 2 3 O ARG C 201  ? O ARG B 195  N ARG C 198  ? N ARG B 192  
AB4 3 4 N ALA C 193  ? N ALA B 187  O LEU C 316  ? O LEU B 310  
AB5 1 2 O VAL C 242  ? O VAL B 236  N VAL C 225  ? N VAL B 219  
AB5 2 3 N GLN C 224  ? N GLN B 218  O ILE C 290  ? O ILE B 284  
AB5 3 4 N VAL C 291  ? N VAL B 285  O THR C 308  ? O THR B 302  
AB6 1 2 N ARG C 320  ? N ARG B 314  O ILE C 343  ? O ILE B 337  
AB7 1 2 N ALA C 326  ? N ALA B 320  O SER C 333  ? O SER B 327  
AB7 2 3 N VAL C 334  ? N VAL B 328  O ALA D 51   ? O ALA C 45   
AB8 1 2 N ILE D 188  ? N ILE C 182  O GLY D 209  ? O GLY C 203  
AB8 2 3 N LEU D 206  ? N LEU C 200  O ILE D 263  ? O ILE C 257  
AB9 1 2 N ILE D 188  ? N ILE C 182  O GLY D 209  ? O GLY C 203  
AB9 2 3 O ARG D 201  ? O ARG C 195  N ARG D 198  ? N ARG C 192  
AB9 3 4 N ALA D 193  ? N ALA C 187  O LEU D 316  ? O LEU C 310  
AC1 1 2 O VAL D 242  ? O VAL C 236  N VAL D 225  ? N VAL C 219  
AC1 2 3 N GLN D 224  ? N GLN C 218  O ILE D 290  ? O ILE C 284  
AC1 3 4 N VAL D 291  ? N VAL C 285  O THR D 308  ? O THR C 302  
AC2 1 2 N ARG D 320  ? N ARG C 314  O ILE D 343  ? O ILE C 337  
AC3 1 2 O ILE E 699  ? O ILE E 699  N GLY E 684  ? N GLY E 684  
AC3 2 3 N TYR E 685  ? N TYR E 685  O SER E 734  ? O SER E 734  
AC4 1 2 N VAL E 850  ? N VAL E 850  O VAL E 884  ? O VAL E 884  
AC4 2 3 O LEU E 885  ? O LEU E 885  N THR E 709  ? N THR E 709  
AC4 3 4 N MET E 710  ? N MET E 710  O ILE E 900  ? O ILE E 900  
AC4 4 5 N ALA E 901  ? N ALA E 901  O GLN E 908  ? O GLN E 908  
AC5 1 2 O ILE E 1368 ? O ILE E 1368 N ILE E 1344 ? N ILE E 1344 
AC5 2 3 N SER E 1350 ? N SER E 1350 O GLU E 1399 ? O GLU E 1399 
AC6 1 2 N ILE E 1424 ? N ILE E 1424 O ILE E 1503 ? O ILE E 1503 
AC6 2 3 N PHE E 1502 ? N PHE E 1502 O VAL E 1533 ? O VAL E 1533 
AC6 3 4 O THR E 1534 ? O THR E 1534 N ILE E 1376 ? N ILE E 1376 
AC6 4 5 N CYS E 1377 ? N CYS E 1377 O ILE E 1549 ? O ILE E 1549 
AC7 1 2 O ILE F 699  ? O ILE H 699  N GLY F 684  ? N GLY H 684  
AC7 2 3 N TYR F 685  ? N TYR H 685  O SER F 734  ? O SER H 734  
AC8 1 2 N VAL F 850  ? N VAL H 850  O VAL F 884  ? O VAL H 884  
AC8 2 3 O LEU F 885  ? O LEU H 885  N THR F 709  ? N THR H 709  
AC8 3 4 N MET F 710  ? N MET H 710  O ILE F 900  ? O ILE H 900  
AC8 4 5 N ALA F 901  ? N ALA H 901  O GLN F 908  ? O GLN H 908  
AC9 1 2 O ILE F 1368 ? O ILE H 1368 N ILE F 1344 ? N ILE H 1344 
AC9 2 3 N SER F 1350 ? N SER H 1350 O GLU F 1399 ? O GLU H 1399 
AD1 1 2 N ILE F 1424 ? N ILE H 1424 O ILE F 1503 ? O ILE H 1503 
AD1 2 3 N PHE F 1502 ? N PHE H 1502 O VAL F 1533 ? O VAL H 1533 
AD1 3 4 O THR F 1534 ? O THR H 1534 N ILE F 1376 ? N ILE H 1376 
AD1 4 5 N CYS F 1377 ? N CYS H 1377 O ILE F 1549 ? O ILE H 1549 
AD2 1 2 O ILE G 699  ? O ILE G 699  N GLY G 684  ? N GLY G 684  
AD2 2 3 N TYR G 685  ? N TYR G 685  O SER G 734  ? O SER G 734  
AD3 1 2 N VAL G 850  ? N VAL G 850  O VAL G 884  ? O VAL G 884  
AD3 2 3 O LEU G 885  ? O LEU G 885  N THR G 709  ? N THR G 709  
AD3 3 4 N MET G 710  ? N MET G 710  O ILE G 900  ? O ILE G 900  
AD3 4 5 N ALA G 901  ? N ALA G 901  O GLN G 908  ? O GLN G 908  
AD4 1 2 O ILE G 1368 ? O ILE G 1368 N ILE G 1344 ? N ILE G 1344 
AD4 2 3 N SER G 1350 ? N SER G 1350 O GLU G 1399 ? O GLU G 1399 
AD5 1 2 N ILE G 1424 ? N ILE G 1424 O ILE G 1503 ? O ILE G 1503 
AD5 2 3 N PHE G 1502 ? N PHE G 1502 O VAL G 1533 ? O VAL G 1533 
AD5 3 4 O THR G 1534 ? O THR G 1534 N ILE G 1376 ? N ILE G 1376 
AD5 4 5 N CYS G 1377 ? N CYS G 1377 O ILE G 1549 ? O ILE G 1549 
AD6 1 2 O ILE H 699  ? O ILE F 699  N GLY H 684  ? N GLY F 684  
AD6 2 3 N TYR H 685  ? N TYR F 685  O SER H 734  ? O SER F 734  
AD7 1 2 N VAL H 850  ? N VAL F 850  O VAL H 884  ? O VAL F 884  
AD7 2 3 O LEU H 885  ? O LEU F 885  N THR H 709  ? N THR F 709  
AD7 3 4 N MET H 710  ? N MET F 710  O ILE H 900  ? O ILE F 900  
AD7 4 5 N ALA H 901  ? N ALA F 901  O GLN H 908  ? O GLN F 908  
AD8 1 2 O ILE H 1368 ? O ILE F 1368 N ILE H 1344 ? N ILE F 1344 
AD8 2 3 N SER H 1350 ? N SER F 1350 O GLU H 1399 ? O GLU F 1399 
AD9 1 2 N ILE H 1424 ? N ILE F 1424 O ILE H 1503 ? O ILE F 1503 
AD9 2 3 N PHE H 1502 ? N PHE F 1502 O VAL H 1533 ? O VAL F 1533 
AD9 3 4 O THR H 1534 ? O THR F 1534 N ILE H 1376 ? N ILE F 1376 
AD9 4 5 N CYS H 1377 ? N CYS F 1377 O ILE H 1549 ? O ILE F 1549 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 501  ? 14 'binding site for residue ATP A 501'  
AC2 Software A ATP 502  ? 15 'binding site for residue ATP A 502'  
AC3 Software D ATP 501  ? 16 'binding site for residue ATP D 501'  
AC4 Software C ATP 501  ? 14 'binding site for residue ATP C 501'  
AC5 Software E ADP 2001 ? 10 'binding site for residue ADP E 2001' 
AC6 Software E MG  2002 ? 3  'binding site for residue MG E 2002'  
AC7 Software E MG  2003 ? 2  'binding site for residue MG E 2003'  
AC8 Software E ATP 2004 ? 17 'binding site for residue ATP E 2004' 
AC9 Software H ADP 2001 ? 10 'binding site for residue ADP H 2001' 
AD1 Software H MG  2002 ? 3  'binding site for residue MG H 2002'  
AD2 Software H MG  2003 ? 2  'binding site for residue MG H 2003'  
AD3 Software H ATP 2004 ? 17 'binding site for residue ATP H 2004' 
AD4 Software G ADP 2001 ? 10 'binding site for residue ADP G 2001' 
AD5 Software G MG  2002 ? 3  'binding site for residue MG G 2002'  
AD6 Software G MG  2003 ? 2  'binding site for residue MG G 2003'  
AD7 Software G ATP 2004 ? 17 'binding site for residue ATP G 2004' 
AD8 Software F ADP 2001 ? 10 'binding site for residue ADP F 2001' 
AD9 Software F MG  2002 ? 3  'binding site for residue MG F 2002'  
AE1 Software F MG  2003 ? 2  'binding site for residue MG F 2003'  
AE2 Software F ATP 2004 ? 17 'binding site for residue ATP F 2004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 LYS A  45   ? LYS A 39   . ? 1_555 ? 
2   AC1 14 ILE A  188  ? ILE A 182  . ? 1_555 ? 
3   AC1 14 PHE A  189  ? PHE A 183  . ? 1_555 ? 
4   AC1 14 SER A  190  ? SER A 184  . ? 1_555 ? 
5   AC1 14 LYS A  191  ? LYS A 185  . ? 1_555 ? 
6   AC1 14 LEU A  211  ? LEU A 205  . ? 1_555 ? 
7   AC1 14 TYR A  336  ? TYR A 330  . ? 1_555 ? 
8   AC1 14 SER A  337  ? SER A 331  . ? 1_555 ? 
9   AC1 14 LYS A  338  ? LYS A 332  . ? 1_555 ? 
10  AC1 14 PHE A  339  ? PHE A 333  . ? 1_555 ? 
11  AC1 14 GLY A  340  ? GLY A 334  . ? 1_555 ? 
12  AC1 14 ASN A  341  ? ASN A 335  . ? 1_555 ? 
13  AC1 14 ILE C  55   ? ILE B 49   . ? 1_555 ? 
14  AC1 14 ARG C  56   ? ARG B 50   . ? 1_555 ? 
15  AC2 15 ASN A  54   ? ASN A 48   . ? 1_555 ? 
16  AC2 15 ILE A  55   ? ILE A 49   . ? 1_555 ? 
17  AC2 15 ARG A  56   ? ARG A 50   . ? 1_555 ? 
18  AC2 15 GLU A  57   ? GLU A 51   . ? 1_555 ? 
19  AC2 15 LYS B  45   ? LYS D 39   . ? 1_555 ? 
20  AC2 15 ILE B  188  ? ILE D 182  . ? 1_555 ? 
21  AC2 15 PHE B  189  ? PHE D 183  . ? 1_555 ? 
22  AC2 15 SER B  190  ? SER D 184  . ? 1_555 ? 
23  AC2 15 LYS B  191  ? LYS D 185  . ? 1_555 ? 
24  AC2 15 LEU B  211  ? LEU D 205  . ? 1_555 ? 
25  AC2 15 TYR B  336  ? TYR D 330  . ? 1_555 ? 
26  AC2 15 SER B  337  ? SER D 331  . ? 1_555 ? 
27  AC2 15 PHE B  339  ? PHE D 333  . ? 1_555 ? 
28  AC2 15 GLY B  340  ? GLY D 334  . ? 1_555 ? 
29  AC2 15 ASN B  341  ? ASN D 335  . ? 1_555 ? 
30  AC3 16 LYS D  45   ? LYS C 39   . ? 1_555 ? 
31  AC3 16 ILE D  188  ? ILE C 182  . ? 1_555 ? 
32  AC3 16 PHE D  189  ? PHE C 183  . ? 1_555 ? 
33  AC3 16 SER D  190  ? SER C 184  . ? 1_555 ? 
34  AC3 16 LYS D  191  ? LYS C 185  . ? 1_555 ? 
35  AC3 16 LEU D  211  ? LEU C 205  . ? 1_555 ? 
36  AC3 16 TYR D  336  ? TYR C 330  . ? 1_555 ? 
37  AC3 16 SER D  337  ? SER C 331  . ? 1_555 ? 
38  AC3 16 LYS D  338  ? LYS C 332  . ? 1_555 ? 
39  AC3 16 PHE D  339  ? PHE C 333  . ? 1_555 ? 
40  AC3 16 GLY D  340  ? GLY C 334  . ? 1_555 ? 
41  AC3 16 ASN D  341  ? ASN C 335  . ? 1_555 ? 
42  AC3 16 ASN B  54   ? ASN D 48   . ? 1_555 ? 
43  AC3 16 ILE B  55   ? ILE D 49   . ? 1_555 ? 
44  AC3 16 ARG B  56   ? ARG D 50   . ? 1_555 ? 
45  AC3 16 GLU B  57   ? GLU D 51   . ? 1_555 ? 
46  AC4 14 LYS C  45   ? LYS B 39   . ? 1_555 ? 
47  AC4 14 ILE C  188  ? ILE B 182  . ? 1_555 ? 
48  AC4 14 PHE C  189  ? PHE B 183  . ? 1_555 ? 
49  AC4 14 SER C  190  ? SER B 184  . ? 1_555 ? 
50  AC4 14 LYS C  191  ? LYS B 185  . ? 1_555 ? 
51  AC4 14 LEU C  211  ? LEU B 205  . ? 1_555 ? 
52  AC4 14 TYR C  336  ? TYR B 330  . ? 1_555 ? 
53  AC4 14 SER C  337  ? SER B 331  . ? 1_555 ? 
54  AC4 14 PHE C  339  ? PHE B 333  . ? 1_555 ? 
55  AC4 14 GLY C  340  ? GLY B 334  . ? 1_555 ? 
56  AC4 14 ASN C  341  ? ASN B 335  . ? 1_555 ? 
57  AC4 14 ASN D  54   ? ASN C 48   . ? 1_555 ? 
58  AC4 14 ILE D  55   ? ILE C 49   . ? 1_555 ? 
59  AC4 14 ARG D  56   ? ARG C 50   . ? 1_555 ? 
60  AC5 10 TYR E  1353 ? TYR E 1353 . ? 1_555 ? 
61  AC5 10 VAL E  1360 ? VAL E 1360 . ? 1_555 ? 
62  AC5 10 THR E  1380 ? THR E 1380 . ? 1_555 ? 
63  AC5 10 GLY E  1381 ? GLY E 1381 . ? 1_555 ? 
64  AC5 10 SER E  1382 ? SER E 1382 . ? 1_555 ? 
65  AC5 10 GLY E  1383 ? GLY E 1383 . ? 1_555 ? 
66  AC5 10 LYS E  1384 ? LYS E 1384 . ? 1_555 ? 
67  AC5 10 SER E  1385 ? SER E 1385 . ? 1_555 ? 
68  AC5 10 SER E  1386 ? SER E 1386 . ? 1_555 ? 
69  AC5 10 MG  O  .    ? MG  E 2003 . ? 1_555 ? 
70  AC6 3  SER E  720  ? SER E 720  . ? 1_555 ? 
71  AC6 3  GLN E  774  ? GLN E 774  . ? 1_555 ? 
72  AC6 3  ATP P  .    ? ATP E 2004 . ? 1_555 ? 
73  AC7 2  SER E  1385 ? SER E 1385 . ? 1_555 ? 
74  AC7 2  ADP M  .    ? ADP E 2001 . ? 1_555 ? 
75  AC8 17 SER E  408  ? SER E 408  . ? 1_555 ? 
76  AC8 17 MET E  409  ? MET E 409  . ? 1_555 ? 
77  AC8 17 TRP E  688  ? TRP E 688  . ? 1_555 ? 
78  AC8 17 VAL E  715  ? VAL E 715  . ? 1_555 ? 
79  AC8 17 GLY E  716  ? GLY E 716  . ? 1_555 ? 
80  AC8 17 CYS E  717  ? CYS E 717  . ? 1_555 ? 
81  AC8 17 GLY E  718  ? GLY E 718  . ? 1_555 ? 
82  AC8 17 LYS E  719  ? LYS E 719  . ? 1_555 ? 
83  AC8 17 SER E  720  ? SER E 720  . ? 1_555 ? 
84  AC8 17 SER E  721  ? SER E 721  . ? 1_555 ? 
85  AC8 17 GLN E  774  ? GLN E 774  . ? 1_555 ? 
86  AC8 17 GLU E  1479 ? GLU E 1479 . ? 1_555 ? 
87  AC8 17 ASN E  1480 ? ASN E 1480 . ? 1_555 ? 
88  AC8 17 PHE E  1481 ? PHE E 1481 . ? 1_555 ? 
89  AC8 17 SER E  1482 ? SER E 1482 . ? 1_555 ? 
90  AC8 17 GLY E  1484 ? GLY E 1484 . ? 1_555 ? 
91  AC8 17 MG  N  .    ? MG  E 2002 . ? 1_555 ? 
92  AC9 10 TYR F  1353 ? TYR H 1353 . ? 1_555 ? 
93  AC9 10 VAL F  1360 ? VAL H 1360 . ? 1_555 ? 
94  AC9 10 THR F  1380 ? THR H 1380 . ? 1_555 ? 
95  AC9 10 GLY F  1381 ? GLY H 1381 . ? 1_555 ? 
96  AC9 10 SER F  1382 ? SER H 1382 . ? 1_555 ? 
97  AC9 10 GLY F  1383 ? GLY H 1383 . ? 1_555 ? 
98  AC9 10 LYS F  1384 ? LYS H 1384 . ? 1_555 ? 
99  AC9 10 SER F  1385 ? SER H 1385 . ? 1_555 ? 
100 AC9 10 SER F  1386 ? SER H 1386 . ? 1_555 ? 
101 AC9 10 MG  S  .    ? MG  H 2003 . ? 1_555 ? 
102 AD1 3  SER F  720  ? SER H 720  . ? 1_555 ? 
103 AD1 3  GLN F  774  ? GLN H 774  . ? 1_555 ? 
104 AD1 3  ATP T  .    ? ATP H 2004 . ? 1_555 ? 
105 AD2 2  SER F  1385 ? SER H 1385 . ? 1_555 ? 
106 AD2 2  ADP Q  .    ? ADP H 2001 . ? 1_555 ? 
107 AD3 17 SER F  408  ? SER H 408  . ? 1_555 ? 
108 AD3 17 MET F  409  ? MET H 409  . ? 1_555 ? 
109 AD3 17 TRP F  688  ? TRP H 688  . ? 1_555 ? 
110 AD3 17 VAL F  715  ? VAL H 715  . ? 1_555 ? 
111 AD3 17 GLY F  716  ? GLY H 716  . ? 1_555 ? 
112 AD3 17 CYS F  717  ? CYS H 717  . ? 1_555 ? 
113 AD3 17 GLY F  718  ? GLY H 718  . ? 1_555 ? 
114 AD3 17 LYS F  719  ? LYS H 719  . ? 1_555 ? 
115 AD3 17 SER F  720  ? SER H 720  . ? 1_555 ? 
116 AD3 17 SER F  721  ? SER H 721  . ? 1_555 ? 
117 AD3 17 GLN F  774  ? GLN H 774  . ? 1_555 ? 
118 AD3 17 GLU F  1479 ? GLU H 1479 . ? 1_555 ? 
119 AD3 17 ASN F  1480 ? ASN H 1480 . ? 1_555 ? 
120 AD3 17 PHE F  1481 ? PHE H 1481 . ? 1_555 ? 
121 AD3 17 SER F  1482 ? SER H 1482 . ? 1_555 ? 
122 AD3 17 GLY F  1484 ? GLY H 1484 . ? 1_555 ? 
123 AD3 17 MG  R  .    ? MG  H 2002 . ? 1_555 ? 
124 AD4 10 TYR G  1353 ? TYR G 1353 . ? 1_555 ? 
125 AD4 10 VAL G  1360 ? VAL G 1360 . ? 1_555 ? 
126 AD4 10 THR G  1380 ? THR G 1380 . ? 1_555 ? 
127 AD4 10 GLY G  1381 ? GLY G 1381 . ? 1_555 ? 
128 AD4 10 SER G  1382 ? SER G 1382 . ? 1_555 ? 
129 AD4 10 GLY G  1383 ? GLY G 1383 . ? 1_555 ? 
130 AD4 10 LYS G  1384 ? LYS G 1384 . ? 1_555 ? 
131 AD4 10 SER G  1385 ? SER G 1385 . ? 1_555 ? 
132 AD4 10 SER G  1386 ? SER G 1386 . ? 1_555 ? 
133 AD4 10 MG  W  .    ? MG  G 2003 . ? 1_555 ? 
134 AD5 3  SER G  720  ? SER G 720  . ? 1_555 ? 
135 AD5 3  GLN G  774  ? GLN G 774  . ? 1_555 ? 
136 AD5 3  ATP X  .    ? ATP G 2004 . ? 1_555 ? 
137 AD6 2  SER G  1385 ? SER G 1385 . ? 1_555 ? 
138 AD6 2  ADP U  .    ? ADP G 2001 . ? 1_555 ? 
139 AD7 17 SER G  408  ? SER G 408  . ? 1_555 ? 
140 AD7 17 MET G  409  ? MET G 409  . ? 1_555 ? 
141 AD7 17 TRP G  688  ? TRP G 688  . ? 1_555 ? 
142 AD7 17 VAL G  715  ? VAL G 715  . ? 1_555 ? 
143 AD7 17 GLY G  716  ? GLY G 716  . ? 1_555 ? 
144 AD7 17 CYS G  717  ? CYS G 717  . ? 1_555 ? 
145 AD7 17 GLY G  718  ? GLY G 718  . ? 1_555 ? 
146 AD7 17 LYS G  719  ? LYS G 719  . ? 1_555 ? 
147 AD7 17 SER G  720  ? SER G 720  . ? 1_555 ? 
148 AD7 17 SER G  721  ? SER G 721  . ? 1_555 ? 
149 AD7 17 GLN G  774  ? GLN G 774  . ? 1_555 ? 
150 AD7 17 GLU G  1479 ? GLU G 1479 . ? 1_555 ? 
151 AD7 17 ASN G  1480 ? ASN G 1480 . ? 1_555 ? 
152 AD7 17 PHE G  1481 ? PHE G 1481 . ? 1_555 ? 
153 AD7 17 SER G  1482 ? SER G 1482 . ? 1_555 ? 
154 AD7 17 GLY G  1484 ? GLY G 1484 . ? 1_555 ? 
155 AD7 17 MG  V  .    ? MG  G 2002 . ? 1_555 ? 
156 AD8 10 TYR H  1353 ? TYR F 1353 . ? 1_555 ? 
157 AD8 10 VAL H  1360 ? VAL F 1360 . ? 1_555 ? 
158 AD8 10 THR H  1380 ? THR F 1380 . ? 1_555 ? 
159 AD8 10 GLY H  1381 ? GLY F 1381 . ? 1_555 ? 
160 AD8 10 SER H  1382 ? SER F 1382 . ? 1_555 ? 
161 AD8 10 GLY H  1383 ? GLY F 1383 . ? 1_555 ? 
162 AD8 10 LYS H  1384 ? LYS F 1384 . ? 1_555 ? 
163 AD8 10 SER H  1385 ? SER F 1385 . ? 1_555 ? 
164 AD8 10 SER H  1386 ? SER F 1386 . ? 1_555 ? 
165 AD8 10 MG  AA .    ? MG  F 2003 . ? 1_555 ? 
166 AD9 3  SER H  720  ? SER F 720  . ? 1_555 ? 
167 AD9 3  GLN H  774  ? GLN F 774  . ? 1_555 ? 
168 AD9 3  ATP BA .    ? ATP F 2004 . ? 1_555 ? 
169 AE1 2  SER H  1385 ? SER F 1385 . ? 1_555 ? 
170 AE1 2  ADP Y  .    ? ADP F 2001 . ? 1_555 ? 
171 AE2 17 SER H  408  ? SER F 408  . ? 1_555 ? 
172 AE2 17 MET H  409  ? MET F 409  . ? 1_555 ? 
173 AE2 17 TRP H  688  ? TRP F 688  . ? 1_555 ? 
174 AE2 17 VAL H  715  ? VAL F 715  . ? 1_555 ? 
175 AE2 17 GLY H  716  ? GLY F 716  . ? 1_555 ? 
176 AE2 17 CYS H  717  ? CYS F 717  . ? 1_555 ? 
177 AE2 17 GLY H  718  ? GLY F 718  . ? 1_555 ? 
178 AE2 17 LYS H  719  ? LYS F 719  . ? 1_555 ? 
179 AE2 17 SER H  720  ? SER F 720  . ? 1_555 ? 
180 AE2 17 SER H  721  ? SER F 721  . ? 1_555 ? 
181 AE2 17 GLN H  774  ? GLN F 774  . ? 1_555 ? 
182 AE2 17 GLU H  1479 ? GLU F 1479 . ? 1_555 ? 
183 AE2 17 ASN H  1480 ? ASN F 1480 . ? 1_555 ? 
184 AE2 17 PHE H  1481 ? PHE F 1481 . ? 1_555 ? 
185 AE2 17 SER H  1482 ? SER F 1482 . ? 1_555 ? 
186 AE2 17 GLY H  1484 ? GLY F 1484 . ? 1_555 ? 
187 AE2 17 MG  Z  .    ? MG  F 2002 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6C3P 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A  1 38   ? 221.969 218.946 173.690 1.00 143.52 ? 32   ARG A N     1 
ATOM   2     C  CA    . ARG A  1 38   ? 221.668 217.599 173.218 1.00 143.52 ? 32   ARG A CA    1 
ATOM   3     C  C     . ARG A  1 38   ? 221.588 216.602 174.373 1.00 143.52 ? 32   ARG A C     1 
ATOM   4     O  O     . ARG A  1 38   ? 222.561 215.913 174.676 1.00 143.52 ? 32   ARG A O     1 
ATOM   5     C  CB    . ARG A  1 38   ? 222.716 217.141 172.210 1.00 143.52 ? 32   ARG A CB    1 
ATOM   6     C  CG    . ARG A  1 38   ? 222.430 215.788 171.603 1.00 143.52 ? 32   ARG A CG    1 
ATOM   7     C  CD    . ARG A  1 38   ? 223.484 215.438 170.587 1.00 143.52 ? 32   ARG A CD    1 
ATOM   8     N  NE    . ARG A  1 38   ? 223.338 214.077 170.084 1.00 143.52 ? 32   ARG A NE    1 
ATOM   9     C  CZ    . ARG A  1 38   ? 222.584 213.744 169.043 1.00 143.52 ? 32   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A  1 38   ? 221.909 214.677 168.394 1.00 143.52 ? 32   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A  1 38   ? 222.516 212.480 168.649 1.00 143.52 ? 32   ARG A NH2   1 
ATOM   12    N  N     . ALA A  1 39   ? 220.426 216.540 175.023 1.00 140.69 ? 33   ALA A N     1 
ATOM   13    C  CA    . ALA A  1 39   ? 220.206 215.599 176.115 1.00 140.69 ? 33   ALA A CA    1 
ATOM   14    C  C     . ALA A  1 39   ? 219.629 214.293 175.590 1.00 140.69 ? 33   ALA A C     1 
ATOM   15    O  O     . ALA A  1 39   ? 219.160 214.238 174.450 1.00 140.69 ? 33   ALA A O     1 
ATOM   16    C  CB    . ALA A  1 39   ? 219.275 216.213 177.162 1.00 140.69 ? 33   ALA A CB    1 
ATOM   17    N  N     . ARG A  1 40   ? 219.667 213.235 176.395 1.00 121.78 ? 34   ARG A N     1 
ATOM   18    C  CA    . ARG A  1 40   ? 218.939 212.010 176.098 1.00 121.78 ? 34   ARG A CA    1 
ATOM   19    C  C     . ARG A  1 40   ? 217.496 212.173 176.541 1.00 121.78 ? 34   ARG A C     1 
ATOM   20    O  O     . ARG A  1 40   ? 217.231 212.618 177.660 1.00 121.78 ? 34   ARG A O     1 
ATOM   21    C  CB    . ARG A  1 40   ? 219.525 210.793 176.800 1.00 121.78 ? 34   ARG A CB    1 
ATOM   22    C  CG    . ARG A  1 40   ? 220.893 210.391 176.336 1.00 121.78 ? 34   ARG A CG    1 
ATOM   23    C  CD    . ARG A  1 40   ? 221.292 209.108 177.024 1.00 121.78 ? 34   ARG A CD    1 
ATOM   24    N  NE    . ARG A  1 40   ? 220.390 208.036 176.617 1.00 121.78 ? 34   ARG A NE    1 
ATOM   25    C  CZ    . ARG A  1 40   ? 220.588 207.258 175.559 1.00 121.78 ? 34   ARG A CZ    1 
ATOM   26    N  NH1   . ARG A  1 40   ? 221.670 207.410 174.812 1.00 121.78 ? 34   ARG A NH1   1 
ATOM   27    N  NH2   . ARG A  1 40   ? 219.710 206.318 175.254 1.00 121.78 ? 34   ARG A NH2   1 
ATOM   28    N  N     . PHE A  1 41   ? 216.569 211.810 175.657 1.00 123.52 ? 35   PHE A N     1 
ATOM   29    C  CA    . PHE A  1 41   ? 215.160 211.832 176.025 1.00 123.52 ? 35   PHE A CA    1 
ATOM   30    C  C     . PHE A  1 41   ? 214.905 210.979 177.258 1.00 123.52 ? 35   PHE A C     1 
ATOM   31    O  O     . PHE A  1 41   ? 214.454 211.483 178.292 1.00 123.52 ? 35   PHE A O     1 
ATOM   32    C  CB    . PHE A  1 41   ? 214.319 211.347 174.850 1.00 123.52 ? 35   PHE A CB    1 
ATOM   33    C  CG    . PHE A  1 41   ? 212.852 211.393 175.099 1.00 123.52 ? 35   PHE A CG    1 
ATOM   34    C  CD1   . PHE A  1 41   ? 212.161 212.580 175.010 1.00 123.52 ? 35   PHE A CD1   1 
ATOM   35    C  CD2   . PHE A  1 41   ? 212.162 210.246 175.423 1.00 123.52 ? 35   PHE A CD2   1 
ATOM   36    C  CE1   . PHE A  1 41   ? 210.805 212.621 175.237 1.00 123.52 ? 35   PHE A CE1   1 
ATOM   37    C  CE2   . PHE A  1 41   ? 210.806 210.281 175.657 1.00 123.52 ? 35   PHE A CE2   1 
ATOM   38    C  CZ    . PHE A  1 41   ? 210.126 211.468 175.563 1.00 123.52 ? 35   PHE A CZ    1 
ATOM   39    N  N     . VAL A  1 42   ? 215.214 209.690 177.175 1.00 120.25 ? 36   VAL A N     1 
ATOM   40    C  CA    . VAL A  1 42   ? 215.146 208.787 178.314 1.00 120.25 ? 36   VAL A CA    1 
ATOM   41    C  C     . VAL A  1 42   ? 216.540 208.241 178.565 1.00 120.25 ? 36   VAL A C     1 
ATOM   42    O  O     . VAL A  1 42   ? 217.240 207.861 177.621 1.00 120.25 ? 36   VAL A O     1 
ATOM   43    C  CB    . VAL A  1 42   ? 214.143 207.641 178.085 1.00 120.25 ? 36   VAL A CB    1 
ATOM   44    C  CG1   . VAL A  1 42   ? 214.251 206.621 179.192 1.00 120.25 ? 36   VAL A CG1   1 
ATOM   45    C  CG2   . VAL A  1 42   ? 212.742 208.188 178.042 1.00 120.25 ? 36   VAL A CG2   1 
ATOM   46    N  N     . SER A  1 43   ? 216.948 208.221 179.828 1.00 119.41 ? 37   SER A N     1 
ATOM   47    C  CA    . SER A  1 43   ? 218.250 207.697 180.189 1.00 119.41 ? 37   SER A CA    1 
ATOM   48    C  C     . SER A  1 43   ? 218.348 206.224 179.813 1.00 119.41 ? 37   SER A C     1 
ATOM   49    O  O     . SER A  1 43   ? 217.345 205.524 179.654 1.00 119.41 ? 37   SER A O     1 
ATOM   50    C  CB    . SER A  1 43   ? 218.498 207.882 181.681 1.00 119.41 ? 37   SER A CB    1 
ATOM   51    O  OG    . SER A  1 43   ? 219.726 207.290 182.063 1.00 119.41 ? 37   SER A OG    1 
ATOM   52    N  N     . LYS A  1 44   ? 219.585 205.733 179.703 1.00 121.70 ? 38   LYS A N     1 
ATOM   53    C  CA    . LYS A  1 44   ? 219.807 204.313 179.457 1.00 121.70 ? 38   LYS A CA    1 
ATOM   54    C  C     . LYS A  1 44   ? 219.246 203.434 180.567 1.00 121.70 ? 38   LYS A C     1 
ATOM   55    O  O     . LYS A  1 44   ? 219.388 202.211 180.498 1.00 121.70 ? 38   LYS A O     1 
ATOM   56    C  CB    . LYS A  1 44   ? 221.301 204.020 179.284 1.00 121.70 ? 38   LYS A CB    1 
ATOM   57    C  CG    . LYS A  1 44   ? 221.927 204.621 178.027 1.00 121.70 ? 38   LYS A CG    1 
ATOM   58    C  CD    . LYS A  1 44   ? 221.301 204.045 176.759 1.00 121.70 ? 38   LYS A CD    1 
ATOM   59    C  CE    . LYS A  1 44   ? 221.667 202.581 176.526 1.00 121.70 ? 38   LYS A CE    1 
ATOM   60    N  NZ    . LYS A  1 44   ? 223.092 202.406 176.149 1.00 121.70 ? 38   LYS A NZ    1 
ATOM   61    N  N     . LYS A  1 45   ? 218.631 204.025 181.588 1.00 119.41 ? 39   LYS A N     1 
ATOM   62    C  CA    . LYS A  1 45   ? 218.028 203.276 182.679 1.00 119.41 ? 39   LYS A CA    1 
ATOM   63    C  C     . LYS A  1 45   ? 216.586 203.685 182.949 1.00 119.41 ? 39   LYS A C     1 
ATOM   64    O  O     . LYS A  1 45   ? 216.082 203.446 184.050 1.00 119.41 ? 39   LYS A O     1 
ATOM   65    C  CB    . LYS A  1 45   ? 218.870 203.429 183.943 1.00 119.41 ? 39   LYS A CB    1 
ATOM   66    C  CG    . LYS A  1 45   ? 220.279 202.899 183.773 1.00 119.41 ? 39   LYS A CG    1 
ATOM   67    C  CD    . LYS A  1 45   ? 220.248 201.400 183.526 1.00 119.41 ? 39   LYS A CD    1 
ATOM   68    C  CE    . LYS A  1 45   ? 221.639 200.793 183.462 1.00 119.41 ? 39   LYS A CE    1 
ATOM   69    N  NZ    . LYS A  1 45   ? 222.358 201.172 182.220 1.00 119.41 ? 39   LYS A NZ    1 
ATOM   70    N  N     . GLY A  1 46   ? 215.914 204.299 181.982 1.00 120.12 ? 40   GLY A N     1 
ATOM   71    C  CA    . GLY A  1 46   ? 214.499 204.569 182.105 1.00 120.12 ? 40   GLY A CA    1 
ATOM   72    C  C     . GLY A  1 46   ? 214.137 205.914 182.687 1.00 120.12 ? 40   GLY A C     1 
ATOM   73    O  O     . GLY A  1 46   ? 212.948 206.169 182.903 1.00 120.12 ? 40   GLY A O     1 
ATOM   74    N  N     . ASN A  1 47   ? 215.108 206.778 182.950 1.00 121.10 ? 41   ASN A N     1 
ATOM   75    C  CA    . ASN A  1 47   ? 214.798 208.079 183.520 1.00 121.10 ? 41   ASN A CA    1 
ATOM   76    C  C     . ASN A  1 47   ? 214.332 209.041 182.440 1.00 121.10 ? 41   ASN A C     1 
ATOM   77    O  O     . ASN A  1 47   ? 215.063 209.345 181.495 1.00 121.10 ? 41   ASN A O     1 
ATOM   78    C  CB    . ASN A  1 47   ? 216.021 208.652 184.229 1.00 121.10 ? 41   ASN A CB    1 
ATOM   79    C  CG    . ASN A  1 47   ? 216.487 207.780 185.364 1.00 121.10 ? 41   ASN A CG    1 
ATOM   80    O  OD1   . ASN A  1 47   ? 217.586 207.232 185.327 1.00 121.10 ? 41   ASN A OD1   1 
ATOM   81    N  ND2   . ASN A  1 47   ? 215.648 207.636 186.380 1.00 121.10 ? 41   ASN A ND2   1 
ATOM   82    N  N     . CYS A  1 48   ? 213.111 209.539 182.597 1.00 127.46 ? 42   CYS A N     1 
ATOM   83    C  CA    . CYS A  1 48   ? 212.537 210.499 181.667 1.00 127.46 ? 42   CYS A CA    1 
ATOM   84    C  C     . CYS A  1 48   ? 213.192 211.846 181.917 1.00 127.46 ? 42   CYS A C     1 
ATOM   85    O  O     . CYS A  1 48   ? 212.758 212.603 182.792 1.00 127.46 ? 42   CYS A O     1 
ATOM   86    C  CB    . CYS A  1 48   ? 211.025 210.582 181.843 1.00 127.46 ? 42   CYS A CB    1 
ATOM   87    S  SG    . CYS A  1 48   ? 210.186 209.027 181.483 1.00 127.46 ? 42   CYS A SG    1 
ATOM   88    N  N     . ASN A  1 49   ? 214.227 212.145 181.140 1.00 133.58 ? 43   ASN A N     1 
ATOM   89    C  CA    . ASN A  1 49   ? 215.115 213.274 181.410 1.00 133.58 ? 43   ASN A CA    1 
ATOM   90    C  C     . ASN A  1 49   ? 214.541 214.582 180.884 1.00 133.58 ? 43   ASN A C     1 
ATOM   91    O  O     . ASN A  1 49   ? 215.131 215.251 180.043 1.00 133.58 ? 43   ASN A O     1 
ATOM   92    C  CB    . ASN A  1 49   ? 216.484 212.995 180.807 1.00 133.58 ? 43   ASN A CB    1 
ATOM   93    C  CG    . ASN A  1 49   ? 217.142 211.776 181.414 1.00 133.58 ? 43   ASN A CG    1 
ATOM   94    O  OD1   . ASN A  1 49   ? 217.053 211.539 182.615 1.00 133.58 ? 43   ASN A OD1   1 
ATOM   95    N  ND2   . ASN A  1 49   ? 217.811 210.990 180.576 1.00 133.58 ? 43   ASN A ND2   1 
ATOM   96    N  N     . VAL A  1 50   ? 213.365 214.945 181.383 1.00 134.17 ? 44   VAL A N     1 
ATOM   97    C  CA    . VAL A  1 50   ? 212.636 216.125 180.931 1.00 134.17 ? 44   VAL A CA    1 
ATOM   98    C  C     . VAL A  1 50   ? 212.049 216.790 182.170 1.00 134.17 ? 44   VAL A C     1 
ATOM   99    O  O     . VAL A  1 50   ? 211.399 216.129 182.987 1.00 134.17 ? 44   VAL A O     1 
ATOM   100   C  CB    . VAL A  1 50   ? 211.532 215.779 179.931 1.00 134.17 ? 44   VAL A CB    1 
ATOM   101   C  CG1   . VAL A  1 50   ? 210.767 217.027 179.584 1.00 134.17 ? 44   VAL A CG1   1 
ATOM   102   C  CG2   . VAL A  1 50   ? 212.106 215.132 178.683 1.00 134.17 ? 44   VAL A CG2   1 
ATOM   103   N  N     . ALA A  1 51   ? 212.283 218.091 182.323 1.00 124.38 ? 45   ALA A N     1 
ATOM   104   C  CA    . ALA A  1 51   ? 211.662 218.837 183.406 1.00 124.38 ? 45   ALA A CA    1 
ATOM   105   C  C     . ALA A  1 51   ? 210.422 219.572 182.918 1.00 124.38 ? 45   ALA A C     1 
ATOM   106   O  O     . ALA A  1 51   ? 210.289 219.889 181.733 1.00 124.38 ? 45   ALA A O     1 
ATOM   107   C  CB    . ALA A  1 51   ? 212.647 219.826 184.022 1.00 124.38 ? 45   ALA A CB    1 
ATOM   108   N  N     . HIS A  1 52   ? 209.517 219.843 183.853 1.00 125.82 ? 46   HIS A N     1 
ATOM   109   C  CA    . HIS A  1 52   ? 208.230 220.438 183.537 1.00 125.82 ? 46   HIS A CA    1 
ATOM   110   C  C     . HIS A  1 52   ? 208.304 221.957 183.495 1.00 125.82 ? 46   HIS A C     1 
ATOM   111   O  O     . HIS A  1 52   ? 207.881 222.550 182.508 1.00 125.82 ? 46   HIS A O     1 
ATOM   112   C  CB    . HIS A  1 52   ? 207.173 219.978 184.540 1.00 125.82 ? 46   HIS A CB    1 
ATOM   113   C  CG    . HIS A  1 52   ? 206.896 218.508 184.497 1.00 125.82 ? 46   HIS A CG    1 
ATOM   114   N  ND1   . HIS A  1 52   ? 207.629 217.589 185.217 1.00 125.82 ? 46   HIS A ND1   1 
ATOM   115   C  CD2   . HIS A  1 52   ? 205.942 217.805 183.844 1.00 125.82 ? 46   HIS A CD2   1 
ATOM   116   C  CE1   . HIS A  1 52   ? 207.146 216.380 184.993 1.00 125.82 ? 46   HIS A CE1   1 
ATOM   117   N  NE2   . HIS A  1 52   ? 206.122 216.483 184.165 1.00 125.82 ? 46   HIS A NE2   1 
ATOM   118   N  N     . LYS A  1 53   ? 208.825 222.596 184.538 1.00 125.92 ? 47   LYS A N     1 
ATOM   119   C  CA    . LYS A  1 53   ? 209.071 224.034 184.449 1.00 125.92 ? 47   LYS A CA    1 
ATOM   120   C  C     . LYS A  1 53   ? 207.812 224.854 184.178 1.00 125.92 ? 47   LYS A C     1 
ATOM   121   O  O     . LYS A  1 53   ? 207.496 225.143 183.018 1.00 125.92 ? 47   LYS A O     1 
ATOM   122   C  CB    . LYS A  1 53   ? 210.146 224.346 183.411 1.00 125.92 ? 47   LYS A CB    1 
ATOM   123   C  CG    . LYS A  1 53   ? 211.519 223.865 183.845 1.00 125.92 ? 47   LYS A CG    1 
ATOM   124   C  CD    . LYS A  1 53   ? 212.574 224.327 182.875 1.00 125.92 ? 47   LYS A CD    1 
ATOM   125   C  CE    . LYS A  1 53   ? 212.468 223.551 181.599 1.00 125.92 ? 47   LYS A CE    1 
ATOM   126   N  NZ    . LYS A  1 53   ? 212.885 222.135 181.769 1.00 125.92 ? 47   LYS A NZ    1 
ATOM   127   N  N     . ASN A  1 54   ? 207.059 225.156 185.244 1.00 126.12 ? 48   ASN A N     1 
ATOM   128   C  CA    . ASN A  1 54   ? 205.912 226.076 185.226 1.00 126.12 ? 48   ASN A CA    1 
ATOM   129   C  C     . ASN A  1 54   ? 204.603 225.422 184.786 1.00 126.12 ? 48   ASN A C     1 
ATOM   130   O  O     . ASN A  1 54   ? 203.920 225.920 183.889 1.00 126.12 ? 48   ASN A O     1 
ATOM   131   C  CB    . ASN A  1 54   ? 206.199 227.285 184.332 1.00 126.12 ? 48   ASN A CB    1 
ATOM   132   C  CG    . ASN A  1 54   ? 207.469 227.998 184.718 1.00 126.12 ? 48   ASN A CG    1 
ATOM   133   O  OD1   . ASN A  1 54   ? 207.763 228.179 185.897 1.00 126.12 ? 48   ASN A OD1   1 
ATOM   134   N  ND2   . ASN A  1 54   ? 208.254 228.380 183.716 1.00 126.12 ? 48   ASN A ND2   1 
ATOM   135   N  N     . ILE A  1 55   ? 204.240 224.313 185.425 1.00 123.48 ? 49   ILE A N     1 
ATOM   136   C  CA    . ILE A  1 55   ? 202.851 223.859 185.439 1.00 123.48 ? 49   ILE A CA    1 
ATOM   137   C  C     . ILE A  1 55   ? 201.993 225.033 185.900 1.00 123.48 ? 49   ILE A C     1 
ATOM   138   O  O     . ILE A  1 55   ? 202.357 225.744 186.838 1.00 123.48 ? 49   ILE A O     1 
ATOM   139   C  CB    . ILE A  1 55   ? 202.650 222.653 186.363 1.00 123.48 ? 49   ILE A CB    1 
ATOM   140   C  CG1   . ILE A  1 55   ? 203.483 221.447 185.924 1.00 123.48 ? 49   ILE A CG1   1 
ATOM   141   C  CG2   . ILE A  1 55   ? 201.178 222.294 186.455 1.00 123.48 ? 49   ILE A CG2   1 
ATOM   142   C  CD1   . ILE A  1 55   ? 204.783 221.317 186.672 1.00 123.48 ? 49   ILE A CD1   1 
ATOM   143   N  N     . ARG A  1 56   ? 200.847 225.234 185.251 1.00 126.66 ? 50   ARG A N     1 
ATOM   144   C  CA    . ARG A  1 56   ? 199.935 226.307 185.630 1.00 126.66 ? 50   ARG A CA    1 
ATOM   145   C  C     . ARG A  1 56   ? 199.376 226.120 187.035 1.00 126.66 ? 50   ARG A C     1 
ATOM   146   O  O     . ARG A  1 56   ? 199.634 226.920 187.939 1.00 126.66 ? 50   ARG A O     1 
ATOM   147   C  CB    . ARG A  1 56   ? 198.790 226.364 184.623 1.00 126.66 ? 50   ARG A CB    1 
ATOM   148   C  CG    . ARG A  1 56   ? 197.849 227.525 184.718 1.00 126.66 ? 50   ARG A CG    1 
ATOM   149   C  CD    . ARG A  1 56   ? 196.879 227.398 183.563 1.00 126.66 ? 50   ARG A CD    1 
ATOM   150   N  NE    . ARG A  1 56   ? 195.926 228.492 183.477 1.00 126.66 ? 50   ARG A NE    1 
ATOM   151   C  CZ    . ARG A  1 56   ? 194.991 228.573 182.540 1.00 126.66 ? 50   ARG A CZ    1 
ATOM   152   N  NH1   . ARG A  1 56   ? 194.889 227.620 181.629 1.00 126.66 ? 50   ARG A NH1   1 
ATOM   153   N  NH2   . ARG A  1 56   ? 194.156 229.600 182.513 1.00 126.66 ? 50   ARG A NH2   1 
ATOM   154   N  N     . GLU A  1 57   ? 198.616 225.046 187.226 1.00 133.69 ? 51   GLU A N     1 
ATOM   155   C  CA    . GLU A  1 57   ? 197.708 224.939 188.358 1.00 133.69 ? 51   GLU A CA    1 
ATOM   156   C  C     . GLU A  1 57   ? 198.418 224.356 189.578 1.00 133.69 ? 51   GLU A C     1 
ATOM   157   O  O     . GLU A  1 57   ? 199.633 224.149 189.592 1.00 133.69 ? 51   GLU A O     1 
ATOM   158   C  CB    . GLU A  1 57   ? 196.494 224.105 187.966 1.00 133.69 ? 51   GLU A CB    1 
ATOM   159   C  CG    . GLU A  1 57   ? 195.688 224.712 186.840 1.00 133.69 ? 51   GLU A CG    1 
ATOM   160   C  CD    . GLU A  1 57   ? 195.079 226.042 187.220 1.00 133.69 ? 51   GLU A CD    1 
ATOM   161   O  OE1   . GLU A  1 57   ? 194.753 226.227 188.409 1.00 133.69 ? 51   GLU A OE1   1 
ATOM   162   O  OE2   . GLU A  1 57   ? 194.927 226.903 186.327 1.00 133.69 ? 51   GLU A OE2   1 
ATOM   163   N  N     . GLN A  1 58   ? 197.642 224.103 190.626 1.00 134.94 ? 52   GLN A N     1 
ATOM   164   C  CA    . GLN A  1 58   ? 198.119 223.480 191.849 1.00 134.94 ? 52   GLN A CA    1 
ATOM   165   C  C     . GLN A  1 58   ? 197.926 221.966 191.741 1.00 134.94 ? 52   GLN A C     1 
ATOM   166   O  O     . GLN A  1 58   ? 197.625 221.445 190.664 1.00 134.94 ? 52   GLN A O     1 
ATOM   167   C  CB    . GLN A  1 58   ? 197.391 224.085 193.050 1.00 134.94 ? 52   GLN A CB    1 
ATOM   168   N  N     . GLY A  1 59   ? 198.087 221.250 192.842 1.00 155.36 ? 53   GLY A N     1 
ATOM   169   C  CA    . GLY A  1 59   ? 197.984 219.797 192.831 1.00 155.36 ? 53   GLY A CA    1 
ATOM   170   C  C     . GLY A  1 59   ? 196.592 219.325 193.171 1.00 155.36 ? 53   GLY A C     1 
ATOM   171   O  O     . GLY A  1 59   ? 195.614 220.058 193.008 1.00 155.36 ? 53   GLY A O     1 
ATOM   172   N  N     . ARG A  1 60   ? 196.502 218.079 193.640 1.00 164.72 ? 54   ARG A N     1 
ATOM   173   C  CA    . ARG A  1 60   ? 195.230 217.486 194.046 1.00 164.72 ? 54   ARG A CA    1 
ATOM   174   C  C     . ARG A  1 60   ? 194.912 217.950 195.462 1.00 164.72 ? 54   ARG A C     1 
ATOM   175   O  O     . ARG A  1 60   ? 195.790 217.958 196.330 1.00 164.72 ? 54   ARG A O     1 
ATOM   176   C  CB    . ARG A  1 60   ? 195.283 215.964 193.957 1.00 164.72 ? 54   ARG A CB    1 
ATOM   177   N  N     . PHE A  1 61   ? 193.658 218.342 195.687 1.00 165.14 ? 55   PHE A N     1 
ATOM   178   C  CA    . PHE A  1 61   ? 193.228 218.967 196.934 1.00 165.14 ? 55   PHE A CA    1 
ATOM   179   C  C     . PHE A  1 61   ? 193.701 218.208 198.171 1.00 165.14 ? 55   PHE A C     1 
ATOM   180   O  O     . PHE A  1 61   ? 194.511 218.731 198.942 1.00 165.14 ? 55   PHE A O     1 
ATOM   181   C  CB    . PHE A  1 61   ? 191.699 219.129 196.920 1.00 165.14 ? 55   PHE A CB    1 
ATOM   182   C  CG    . PHE A  1 61   ? 190.940 217.835 196.746 1.00 165.14 ? 55   PHE A CG    1 
ATOM   183   C  CD1   . PHE A  1 61   ? 190.771 217.281 195.488 1.00 165.14 ? 55   PHE A CD1   1 
ATOM   184   C  CD2   . PHE A  1 61   ? 190.353 217.206 197.831 1.00 165.14 ? 55   PHE A CD2   1 
ATOM   185   C  CE1   . PHE A  1 61   ? 190.076 216.104 195.321 1.00 165.14 ? 55   PHE A CE1   1 
ATOM   186   C  CE2   . PHE A  1 61   ? 189.657 216.027 197.667 1.00 165.14 ? 55   PHE A CE2   1 
ATOM   187   C  CZ    . PHE A  1 61   ? 189.514 215.479 196.410 1.00 165.14 ? 55   PHE A CZ    1 
ATOM   188   N  N     . LEU A  1 62   ? 193.238 216.972 198.361 1.00 158.17 ? 56   LEU A N     1 
ATOM   189   C  CA    . LEU A  1 62   ? 193.675 216.124 199.464 1.00 158.17 ? 56   LEU A CA    1 
ATOM   190   C  C     . LEU A  1 62   ? 193.802 214.662 199.065 1.00 158.17 ? 56   LEU A C     1 
ATOM   191   O  O     . LEU A  1 62   ? 193.718 213.786 199.929 1.00 158.17 ? 56   LEU A O     1 
ATOM   192   C  CB    . LEU A  1 62   ? 192.728 216.244 200.659 1.00 158.17 ? 56   LEU A CB    1 
ATOM   193   C  CG    . LEU A  1 62   ? 192.889 217.421 201.627 1.00 158.17 ? 56   LEU A CG    1 
ATOM   194   C  CD1   . LEU A  1 62   ? 192.273 218.705 201.092 1.00 158.17 ? 56   LEU A CD1   1 
ATOM   195   C  CD2   . LEU A  1 62   ? 192.322 217.075 202.998 1.00 158.17 ? 56   LEU A CD2   1 
ATOM   196   N  N     . GLN A  1 63   ? 193.983 214.370 197.780 1.00 156.88 ? 57   GLN A N     1 
ATOM   197   C  CA    . GLN A  1 63   ? 194.208 213.004 197.323 1.00 156.88 ? 57   GLN A CA    1 
ATOM   198   C  C     . GLN A  1 63   ? 195.649 212.778 196.896 1.00 156.88 ? 57   GLN A C     1 
ATOM   199   O  O     . GLN A  1 63   ? 196.167 211.665 197.017 1.00 156.88 ? 57   GLN A O     1 
ATOM   200   C  CB    . GLN A  1 63   ? 193.261 212.664 196.166 1.00 156.88 ? 57   GLN A CB    1 
ATOM   201   N  N     . ASP A  1 64   ? 196.309 213.828 196.407 1.00 159.53 ? 58   ASP A N     1 
ATOM   202   C  CA    . ASP A  1 64   ? 197.722 213.767 196.063 1.00 159.53 ? 58   ASP A CA    1 
ATOM   203   C  C     . ASP A  1 64   ? 198.543 213.276 197.245 1.00 159.53 ? 58   ASP A C     1 
ATOM   204   O  O     . ASP A  1 64   ? 199.667 212.801 197.071 1.00 159.53 ? 58   ASP A O     1 
ATOM   205   C  CB    . ASP A  1 64   ? 198.228 215.138 195.600 1.00 159.53 ? 58   ASP A CB    1 
ATOM   206   C  CG    . ASP A  1 64   ? 198.069 216.220 196.659 1.00 159.53 ? 58   ASP A CG    1 
ATOM   207   O  OD1   . ASP A  1 64   ? 197.507 215.948 197.740 1.00 159.53 ? 58   ASP A OD1   1 
ATOM   208   O  OD2   . ASP A  1 64   ? 198.507 217.360 196.405 1.00 159.53 ? 58   ASP A OD2   1 
ATOM   209   N  N     . VAL A  1 65   ? 197.994 213.392 198.452 1.00 142.23 ? 59   VAL A N     1 
ATOM   210   C  CA    . VAL A  1 65   ? 198.701 212.911 199.632 1.00 142.23 ? 59   VAL A CA    1 
ATOM   211   C  C     . VAL A  1 65   ? 199.005 211.424 199.498 1.00 142.23 ? 59   VAL A C     1 
ATOM   212   O  O     . VAL A  1 65   ? 200.146 210.990 199.674 1.00 142.23 ? 59   VAL A O     1 
ATOM   213   C  CB    . VAL A  1 65   ? 197.897 213.228 200.904 1.00 142.23 ? 59   VAL A CB    1 
ATOM   214   C  CG1   . VAL A  1 65   ? 197.819 214.727 201.100 1.00 142.23 ? 59   VAL A CG1   1 
ATOM   215   C  CG2   . VAL A  1 65   ? 196.501 212.664 200.811 1.00 142.23 ? 59   VAL A CG2   1 
ATOM   216   N  N     . PHE A  1 66   ? 198.008 210.633 199.104 1.00 134.33 ? 60   PHE A N     1 
ATOM   217   C  CA    . PHE A  1 66   ? 198.203 209.189 199.029 1.00 134.33 ? 60   PHE A CA    1 
ATOM   218   C  C     . PHE A  1 66   ? 199.152 208.812 197.902 1.00 134.33 ? 60   PHE A C     1 
ATOM   219   O  O     . PHE A  1 66   ? 200.090 208.034 198.107 1.00 134.33 ? 60   PHE A O     1 
ATOM   220   C  CB    . PHE A  1 66   ? 196.853 208.499 198.865 1.00 134.33 ? 60   PHE A CB    1 
ATOM   221   C  CG    . PHE A  1 66   ? 195.986 208.599 200.082 1.00 134.33 ? 60   PHE A CG    1 
ATOM   222   C  CD1   . PHE A  1 66   ? 196.548 208.851 201.318 1.00 134.33 ? 60   PHE A CD1   1 
ATOM   223   C  CD2   . PHE A  1 66   ? 194.611 208.489 199.989 1.00 134.33 ? 60   PHE A CD2   1 
ATOM   224   C  CE1   . PHE A  1 66   ? 195.763 208.957 202.442 1.00 134.33 ? 60   PHE A CE1   1 
ATOM   225   C  CE2   . PHE A  1 66   ? 193.818 208.600 201.112 1.00 134.33 ? 60   PHE A CE2   1 
ATOM   226   C  CZ    . PHE A  1 66   ? 194.396 208.834 202.338 1.00 134.33 ? 60   PHE A CZ    1 
ATOM   227   N  N     . THR A  1 67   ? 198.929 209.355 196.707 1.00 148.39 ? 61   THR A N     1 
ATOM   228   C  CA    . THR A  1 67   ? 199.799 209.046 195.576 1.00 148.39 ? 61   THR A CA    1 
ATOM   229   C  C     . THR A  1 67   ? 201.238 209.462 195.853 1.00 148.39 ? 61   THR A C     1 
ATOM   230   O  O     . THR A  1 67   ? 202.168 208.664 195.694 1.00 148.39 ? 61   THR A O     1 
ATOM   231   C  CB    . THR A  1 67   ? 199.268 209.729 194.315 1.00 148.39 ? 61   THR A CB    1 
ATOM   232   O  OG1   . THR A  1 67   ? 199.133 211.135 194.550 1.00 148.39 ? 61   THR A OG1   1 
ATOM   233   C  CG2   . THR A  1 67   ? 197.919 209.146 193.923 1.00 148.39 ? 61   THR A CG2   1 
ATOM   234   N  N     . THR A  1 68   ? 201.442 210.714 196.268 1.00 144.48 ? 62   THR A N     1 
ATOM   235   C  CA    . THR A  1 68   ? 202.781 211.185 196.606 1.00 144.48 ? 62   THR A CA    1 
ATOM   236   C  C     . THR A  1 68   ? 203.350 210.420 197.788 1.00 144.48 ? 62   THR A C     1 
ATOM   237   O  O     . THR A  1 68   ? 204.568 210.397 197.996 1.00 144.48 ? 62   THR A O     1 
ATOM   238   C  CB    . THR A  1 68   ? 202.745 212.684 196.909 1.00 144.48 ? 62   THR A CB    1 
ATOM   239   O  OG1   . THR A  1 68   ? 201.802 212.936 197.955 1.00 144.48 ? 62   THR A OG1   1 
ATOM   240   C  CG2   . THR A  1 68   ? 202.361 213.476 195.668 1.00 144.48 ? 62   THR A CG2   1 
ATOM   241   N  N     . LEU A  1 69   ? 202.484 209.778 198.567 1.00 130.29 ? 63   LEU A N     1 
ATOM   242   C  CA    . LEU A  1 69   ? 202.947 209.015 199.711 1.00 130.29 ? 63   LEU A CA    1 
ATOM   243   C  C     . LEU A  1 69   ? 203.485 207.660 199.272 1.00 130.29 ? 63   LEU A C     1 
ATOM   244   O  O     . LEU A  1 69   ? 204.513 207.194 199.772 1.00 130.29 ? 63   LEU A O     1 
ATOM   245   C  CB    . LEU A  1 69   ? 201.791 208.873 200.699 1.00 130.29 ? 63   LEU A CB    1 
ATOM   246   C  CG    . LEU A  1 69   ? 202.053 208.466 202.143 1.00 130.29 ? 63   LEU A CG    1 
ATOM   247   C  CD1   . LEU A  1 69   ? 202.310 206.981 202.258 1.00 130.29 ? 63   LEU A CD1   1 
ATOM   248   C  CD2   . LEU A  1 69   ? 203.222 209.265 202.687 1.00 130.29 ? 63   LEU A CD2   1 
ATOM   249   N  N     . VAL A  1 70   ? 202.807 207.023 198.315 1.00 136.25 ? 64   VAL A N     1 
ATOM   250   C  CA    . VAL A  1 70   ? 203.178 205.666 197.921 1.00 136.25 ? 64   VAL A CA    1 
ATOM   251   C  C     . VAL A  1 70   ? 204.608 205.630 197.402 1.00 136.25 ? 64   VAL A C     1 
ATOM   252   O  O     . VAL A  1 70   ? 205.502 205.047 198.029 1.00 136.25 ? 64   VAL A O     1 
ATOM   253   C  CB    . VAL A  1 70   ? 202.196 205.123 196.871 1.00 136.25 ? 64   VAL A CB    1 
ATOM   254   C  CG1   . VAL A  1 70   ? 202.622 203.733 196.423 1.00 136.25 ? 64   VAL A CG1   1 
ATOM   255   C  CG2   . VAL A  1 70   ? 200.797 205.108 197.420 1.00 136.25 ? 64   VAL A CG2   1 
ATOM   256   N  N     . ASP A  1 71   ? 204.855 206.273 196.264 1.00 151.87 ? 65   ASP A N     1 
ATOM   257   C  CA    . ASP A  1 71   ? 206.171 206.266 195.645 1.00 151.87 ? 65   ASP A CA    1 
ATOM   258   C  C     . ASP A  1 71   ? 207.014 207.330 196.317 1.00 151.87 ? 65   ASP A C     1 
ATOM   259   O  O     . ASP A  1 71   ? 206.842 208.524 196.051 1.00 151.87 ? 65   ASP A O     1 
ATOM   260   C  CB    . ASP A  1 71   ? 206.101 206.528 194.142 1.00 151.87 ? 65   ASP A CB    1 
ATOM   261   C  CG    . ASP A  1 71   ? 207.441 206.319 193.455 1.00 151.87 ? 65   ASP A CG    1 
ATOM   262   O  OD1   . ASP A  1 71   ? 207.833 205.153 193.244 1.00 151.87 ? 65   ASP A OD1   1 
ATOM   263   O  OD2   . ASP A  1 71   ? 208.107 207.325 193.136 1.00 151.87 ? 65   ASP A OD2   1 
ATOM   264   N  N     . LEU A  1 72   ? 207.923 206.892 197.178 1.00 121.65 ? 66   LEU A N     1 
ATOM   265   C  CA    . LEU A  1 72   ? 208.685 207.809 198.001 1.00 121.65 ? 66   LEU A CA    1 
ATOM   266   C  C     . LEU A  1 72   ? 209.719 206.979 198.741 1.00 121.65 ? 66   LEU A C     1 
ATOM   267   O  O     . LEU A  1 72   ? 209.511 205.790 198.994 1.00 121.65 ? 66   LEU A O     1 
ATOM   268   C  CB    . LEU A  1 72   ? 207.770 208.565 198.968 1.00 121.65 ? 66   LEU A CB    1 
ATOM   269   C  CG    . LEU A  1 72   ? 208.317 209.765 199.725 1.00 121.65 ? 66   LEU A CG    1 
ATOM   270   C  CD1   . LEU A  1 72   ? 207.202 210.753 199.981 1.00 121.65 ? 66   LEU A CD1   1 
ATOM   271   C  CD2   . LEU A  1 72   ? 208.882 209.306 201.024 1.00 121.65 ? 66   LEU A CD2   1 
ATOM   272   N  N     . LYS A  1 73   ? 210.836 207.612 199.075 1.00 115.03 ? 67   LYS A N     1 
ATOM   273   C  CA    . LYS A  1 73   ? 211.933 206.876 199.683 1.00 115.03 ? 67   LYS A CA    1 
ATOM   274   C  C     . LYS A  1 73   ? 211.491 206.276 201.018 1.00 115.03 ? 67   LYS A C     1 
ATOM   275   O  O     . LYS A  1 73   ? 210.773 206.904 201.802 1.00 115.03 ? 67   LYS A O     1 
ATOM   276   C  CB    . LYS A  1 73   ? 213.140 207.796 199.862 1.00 115.03 ? 67   LYS A CB    1 
ATOM   277   C  CG    . LYS A  1 73   ? 214.412 207.078 200.267 1.00 115.03 ? 67   LYS A CG    1 
ATOM   278   C  CD    . LYS A  1 73   ? 215.586 208.032 200.417 1.00 115.03 ? 67   LYS A CD    1 
ATOM   279   C  CE    . LYS A  1 73   ? 216.833 207.292 200.885 1.00 115.03 ? 67   LYS A CE    1 
ATOM   280   N  NZ    . LYS A  1 73   ? 217.988 208.203 201.126 1.00 115.03 ? 67   LYS A NZ    1 
ATOM   281   N  N     . TRP A  1 74   ? 211.911 205.027 201.257 1.00 107.44 ? 68   TRP A N     1 
ATOM   282   C  CA    . TRP A  1 74   ? 211.459 204.286 202.434 1.00 107.44 ? 68   TRP A CA    1 
ATOM   283   C  C     . TRP A  1 74   ? 211.684 205.030 203.741 1.00 107.44 ? 68   TRP A C     1 
ATOM   284   O  O     . TRP A  1 74   ? 210.721 205.194 204.505 1.00 107.44 ? 68   TRP A O     1 
ATOM   285   C  CB    . TRP A  1 74   ? 212.118 202.905 202.456 1.00 107.44 ? 68   TRP A CB    1 
ATOM   286   C  CG    . TRP A  1 74   ? 211.543 201.993 201.447 1.00 107.44 ? 68   TRP A CG    1 
ATOM   287   C  CD1   . TRP A  1 74   ? 212.027 201.734 200.202 1.00 107.44 ? 68   TRP A CD1   1 
ATOM   288   C  CD2   . TRP A  1 74   ? 210.347 201.223 201.586 1.00 107.44 ? 68   TRP A CD2   1 
ATOM   289   N  NE1   . TRP A  1 74   ? 211.208 200.844 199.554 1.00 107.44 ? 68   TRP A NE1   1 
ATOM   290   C  CE2   . TRP A  1 74   ? 210.169 200.513 200.384 1.00 107.44 ? 68   TRP A CE2   1 
ATOM   291   C  CE3   . TRP A  1 74   ? 209.411 201.064 202.611 1.00 107.44 ? 68   TRP A CE3   1 
ATOM   292   C  CZ2   . TRP A  1 74   ? 209.091 199.656 200.178 1.00 107.44 ? 68   TRP A CZ2   1 
ATOM   293   C  CZ3   . TRP A  1 74   ? 208.343 200.212 202.404 1.00 107.44 ? 68   TRP A CZ3   1 
ATOM   294   C  CH2   . TRP A  1 74   ? 208.193 199.519 201.199 1.00 107.44 ? 68   TRP A CH2   1 
ATOM   295   N  N     . PRO A  1 75   ? 212.898 205.474 204.077 1.00 107.21 ? 69   PRO A N     1 
ATOM   296   C  CA    . PRO A  1 75   ? 213.079 206.140 205.373 1.00 107.21 ? 69   PRO A CA    1 
ATOM   297   C  C     . PRO A  1 75   ? 212.207 207.363 205.544 1.00 107.21 ? 69   PRO A C     1 
ATOM   298   O  O     . PRO A  1 75   ? 211.708 207.593 206.651 1.00 107.21 ? 69   PRO A O     1 
ATOM   299   C  CB    . PRO A  1 75   ? 214.571 206.498 205.381 1.00 107.21 ? 69   PRO A CB    1 
ATOM   300   C  CG    . PRO A  1 75   ? 214.964 206.517 203.950 1.00 107.21 ? 69   PRO A CG    1 
ATOM   301   C  CD    . PRO A  1 75   ? 214.151 205.458 203.304 1.00 107.21 ? 69   PRO A CD    1 
ATOM   302   N  N     . HIS A  1 76   ? 211.981 208.141 204.486 1.00 110.03 ? 70   HIS A N     1 
ATOM   303   C  CA    . HIS A  1 76   ? 211.110 209.300 204.621 1.00 110.03 ? 70   HIS A CA    1 
ATOM   304   C  C     . HIS A  1 76   ? 209.684 208.881 204.962 1.00 110.03 ? 70   HIS A C     1 
ATOM   305   O  O     . HIS A  1 76   ? 209.057 209.463 205.855 1.00 110.03 ? 70   HIS A O     1 
ATOM   306   C  CB    . HIS A  1 76   ? 211.127 210.132 203.342 1.00 110.03 ? 70   HIS A CB    1 
ATOM   307   C  CG    . HIS A  1 76   ? 212.463 210.723 203.014 1.00 110.03 ? 70   HIS A CG    1 
ATOM   308   N  ND1   . HIS A  1 76   ? 213.382 210.083 202.212 1.00 110.03 ? 70   HIS A ND1   1 
ATOM   309   C  CD2   . HIS A  1 76   ? 213.030 211.899 203.371 1.00 110.03 ? 70   HIS A CD2   1 
ATOM   310   C  CE1   . HIS A  1 76   ? 214.460 210.838 202.092 1.00 110.03 ? 70   HIS A CE1   1 
ATOM   311   N  NE2   . HIS A  1 76   ? 214.273 211.944 202.786 1.00 110.03 ? 70   HIS A NE2   1 
ATOM   312   N  N     . THR A  1 77   ? 209.157 207.866 204.273 1.00 110.87 ? 71   THR A N     1 
ATOM   313   C  CA    . THR A  1 77   ? 207.809 207.384 204.566 1.00 110.87 ? 71   THR A CA    1 
ATOM   314   C  C     . THR A  1 77   ? 207.713 206.841 205.986 1.00 110.87 ? 71   THR A C     1 
ATOM   315   O  O     . THR A  1 77   ? 206.770 207.159 206.726 1.00 110.87 ? 71   THR A O     1 
ATOM   316   C  CB    . THR A  1 77   ? 207.419 206.303 203.561 1.00 110.87 ? 71   THR A CB    1 
ATOM   317   O  OG1   . THR A  1 77   ? 207.446 206.847 202.237 1.00 110.87 ? 71   THR A OG1   1 
ATOM   318   C  CG2   . THR A  1 77   ? 206.029 205.765 203.857 1.00 110.87 ? 71   THR A CG2   1 
ATOM   319   N  N     . LEU A  1 78   ? 208.658 205.977 206.356 1.00 107.82 ? 72   LEU A N     1 
ATOM   320   C  CA    . LEU A  1 78   ? 208.779 205.514 207.732 1.00 107.82 ? 72   LEU A CA    1 
ATOM   321   C  C     . LEU A  1 78   ? 208.688 206.670 208.712 1.00 107.82 ? 72   LEU A C     1 
ATOM   322   O  O     . LEU A  1 78   ? 207.870 206.643 209.636 1.00 107.82 ? 72   LEU A O     1 
ATOM   323   C  CB    . LEU A  1 78   ? 210.106 204.776 207.900 1.00 107.82 ? 72   LEU A CB    1 
ATOM   324   C  CG    . LEU A  1 78   ? 210.523 204.204 209.254 1.00 107.82 ? 72   LEU A CG    1 
ATOM   325   C  CD1   . LEU A  1 78   ? 211.174 205.250 210.164 1.00 107.82 ? 72   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A  1 78   ? 209.329 203.574 209.940 1.00 107.82 ? 72   LEU A CD2   1 
ATOM   327   N  N     . LEU A  1 79   ? 209.549 207.669 208.543 1.00 103.36 ? 73   LEU A N     1 
ATOM   328   C  CA    . LEU A  1 79   ? 209.583 208.791 209.466 1.00 103.36 ? 73   LEU A CA    1 
ATOM   329   C  C     . LEU A  1 79   ? 208.238 209.489 209.517 1.00 103.36 ? 73   LEU A C     1 
ATOM   330   O  O     . LEU A  1 79   ? 207.780 209.888 210.591 1.00 103.36 ? 73   LEU A O     1 
ATOM   331   C  CB    . LEU A  1 79   ? 210.681 209.764 209.047 1.00 103.36 ? 73   LEU A CB    1 
ATOM   332   C  CG    . LEU A  1 79   ? 211.004 210.935 209.968 1.00 103.36 ? 73   LEU A CG    1 
ATOM   333   C  CD1   . LEU A  1 79   ? 212.467 211.304 209.819 1.00 103.36 ? 73   LEU A CD1   1 
ATOM   334   C  CD2   . LEU A  1 79   ? 210.127 212.138 209.653 1.00 103.36 ? 73   LEU A CD2   1 
ATOM   335   N  N     . ILE A  1 80   ? 207.593 209.656 208.364 1.00 104.46 ? 74   ILE A N     1 
ATOM   336   C  CA    . ILE A  1 80   ? 206.303 210.329 208.344 1.00 104.46 ? 74   ILE A CA    1 
ATOM   337   C  C     . ILE A  1 80   ? 205.292 209.566 209.186 1.00 104.46 ? 74   ILE A C     1 
ATOM   338   O  O     . ILE A  1 80   ? 204.552 210.157 209.979 1.00 104.46 ? 74   ILE A O     1 
ATOM   339   C  CB    . ILE A  1 80   ? 205.820 210.506 206.898 1.00 104.46 ? 74   ILE A CB    1 
ATOM   340   C  CG1   . ILE A  1 80   ? 206.752 211.466 206.154 1.00 104.46 ? 74   ILE A CG1   1 
ATOM   341   C  CG2   . ILE A  1 80   ? 204.392 211.009 206.877 1.00 104.46 ? 74   ILE A CG2   1 
ATOM   342   C  CD1   . ILE A  1 80   ? 206.567 211.480 204.652 1.00 104.46 ? 74   ILE A CD1   1 
ATOM   343   N  N     . PHE A  1 81   ? 205.263 208.243 209.053 1.00 105.01 ? 75   PHE A N     1 
ATOM   344   C  CA    . PHE A  1 81   ? 204.279 207.478 209.811 1.00 105.01 ? 75   PHE A CA    1 
ATOM   345   C  C     . PHE A  1 81   ? 204.593 207.505 211.299 1.00 105.01 ? 75   PHE A C     1 
ATOM   346   O  O     . PHE A  1 81   ? 203.699 207.695 212.134 1.00 105.01 ? 75   PHE A O     1 
ATOM   347   C  CB    . PHE A  1 81   ? 204.216 206.042 209.314 1.00 105.01 ? 75   PHE A CB    1 
ATOM   348   C  CG    . PHE A  1 81   ? 203.612 205.902 207.959 1.00 105.01 ? 75   PHE A CG    1 
ATOM   349   C  CD1   . PHE A  1 81   ? 203.074 206.990 207.303 1.00 105.01 ? 75   PHE A CD1   1 
ATOM   350   C  CD2   . PHE A  1 81   ? 203.531 204.664 207.359 1.00 105.01 ? 75   PHE A CD2   1 
ATOM   351   C  CE1   . PHE A  1 81   ? 202.503 206.849 206.055 1.00 105.01 ? 75   PHE A CE1   1 
ATOM   352   C  CE2   . PHE A  1 81   ? 202.960 204.522 206.114 1.00 105.01 ? 75   PHE A CE2   1 
ATOM   353   C  CZ    . PHE A  1 81   ? 202.447 205.610 205.463 1.00 105.01 ? 75   PHE A CZ    1 
ATOM   354   N  N     . THR A  1 82   ? 205.861 207.292 211.648 1.00 98.27  ? 76   THR A N     1 
ATOM   355   C  CA    . THR A  1 82   ? 206.277 207.382 213.040 1.00 98.27  ? 76   THR A CA    1 
ATOM   356   C  C     . THR A  1 82   ? 205.868 208.710 213.646 1.00 98.27  ? 76   THR A C     1 
ATOM   357   O  O     . THR A  1 82   ? 205.337 208.761 214.759 1.00 98.27  ? 76   THR A O     1 
ATOM   358   C  CB    . THR A  1 82   ? 207.788 207.222 213.143 1.00 98.27  ? 76   THR A CB    1 
ATOM   359   O  OG1   . THR A  1 82   ? 208.417 208.286 212.419 1.00 98.27  ? 76   THR A OG1   1 
ATOM   360   C  CG2   . THR A  1 82   ? 208.221 205.908 212.551 1.00 98.27  ? 76   THR A CG2   1 
ATOM   361   N  N     . MET A  1 83   ? 206.111 209.800 212.932 1.00 96.29  ? 77   MET A N     1 
ATOM   362   C  CA    . MET A  1 83   ? 205.847 211.102 213.513 1.00 96.29  ? 77   MET A CA    1 
ATOM   363   C  C     . MET A  1 83   ? 204.350 211.369 213.561 1.00 96.29  ? 77   MET A C     1 
ATOM   364   O  O     . MET A  1 83   ? 203.876 212.067 214.462 1.00 96.29  ? 77   MET A O     1 
ATOM   365   C  CB    . MET A  1 83   ? 206.609 212.178 212.735 1.00 96.29  ? 77   MET A CB    1 
ATOM   366   C  CG    . MET A  1 83   ? 206.787 213.471 213.508 1.00 96.29  ? 77   MET A CG    1 
ATOM   367   S  SD    . MET A  1 83   ? 207.917 214.642 212.738 1.00 96.29  ? 77   MET A SD    1 
ATOM   368   C  CE    . MET A  1 83   ? 207.890 215.958 213.954 1.00 96.29  ? 77   MET A CE    1 
ATOM   369   N  N     . SER A  1 84   ? 203.585 210.771 212.644 1.00 87.38  ? 78   SER A N     1 
ATOM   370   C  CA    . SER A  1 84   ? 202.132 210.810 212.764 1.00 87.38  ? 78   SER A CA    1 
ATOM   371   C  C     . SER A  1 84   ? 201.673 210.136 214.049 1.00 87.38  ? 78   SER A C     1 
ATOM   372   O  O     . SER A  1 84   ? 200.814 210.665 214.764 1.00 87.38  ? 78   SER A O     1 
ATOM   373   C  CB    . SER A  1 84   ? 201.488 210.134 211.557 1.00 87.38  ? 78   SER A CB    1 
ATOM   374   O  OG    . SER A  1 84   ? 201.779 208.748 211.545 1.00 87.38  ? 78   SER A OG    1 
ATOM   375   N  N     . PHE A  1 85   ? 202.225 208.965 214.352 1.00 74.70  ? 79   PHE A N     1 
ATOM   376   C  CA    . PHE A  1 85   ? 201.870 208.300 215.601 1.00 74.70  ? 79   PHE A CA    1 
ATOM   377   C  C     . PHE A  1 85   ? 202.287 209.126 216.808 1.00 74.70  ? 79   PHE A C     1 
ATOM   378   O  O     . PHE A  1 85   ? 201.537 209.227 217.784 1.00 74.70  ? 79   PHE A O     1 
ATOM   379   C  CB    . PHE A  1 85   ? 202.495 206.911 215.651 1.00 74.70  ? 79   PHE A CB    1 
ATOM   380   C  CG    . PHE A  1 85   ? 201.760 205.895 214.838 1.00 74.70  ? 79   PHE A CG    1 
ATOM   381   C  CD1   . PHE A  1 85   ? 200.424 206.068 214.548 1.00 74.70  ? 79   PHE A CD1   1 
ATOM   382   C  CD2   . PHE A  1 85   ? 202.408 204.786 214.335 1.00 74.70  ? 79   PHE A CD2   1 
ATOM   383   C  CE1   . PHE A  1 85   ? 199.741 205.138 213.799 1.00 74.70  ? 79   PHE A CE1   1 
ATOM   384   C  CE2   . PHE A  1 85   ? 201.730 203.860 213.578 1.00 74.70  ? 79   PHE A CE2   1 
ATOM   385   C  CZ    . PHE A  1 85   ? 200.395 204.035 213.310 1.00 74.70  ? 79   PHE A CZ    1 
ATOM   386   N  N     . LEU A  1 86   ? 203.472 209.730 216.761 1.00 75.06  ? 80   LEU A N     1 
ATOM   387   C  CA    . LEU A  1 86   ? 203.905 210.570 217.872 1.00 75.06  ? 80   LEU A CA    1 
ATOM   388   C  C     . LEU A  1 86   ? 202.956 211.734 218.090 1.00 75.06  ? 80   LEU A C     1 
ATOM   389   O  O     . LEU A  1 86   ? 202.580 212.028 219.227 1.00 75.06  ? 80   LEU A O     1 
ATOM   390   C  CB    . LEU A  1 86   ? 205.317 211.091 217.642 1.00 75.06  ? 80   LEU A CB    1 
ATOM   391   C  CG    . LEU A  1 86   ? 206.411 210.260 218.295 1.00 75.06  ? 80   LEU A CG    1 
ATOM   392   C  CD1   . LEU A  1 86   ? 206.224 210.354 219.789 1.00 75.06  ? 80   LEU A CD1   1 
ATOM   393   C  CD2   . LEU A  1 86   ? 206.338 208.824 217.840 1.00 75.06  ? 80   LEU A CD2   1 
ATOM   394   N  N     . CYS A  1 87   ? 202.580 212.429 217.020 1.00 81.62  ? 81   CYS A N     1 
ATOM   395   C  CA    . CYS A  1 87   ? 201.725 213.590 217.206 1.00 81.62  ? 81   CYS A CA    1 
ATOM   396   C  C     . CYS A  1 87   ? 200.340 213.168 217.668 1.00 81.62  ? 81   CYS A C     1 
ATOM   397   O  O     . CYS A  1 87   ? 199.745 213.819 218.532 1.00 81.62  ? 81   CYS A O     1 
ATOM   398   C  CB    . CYS A  1 87   ? 201.659 214.418 215.920 1.00 81.62  ? 81   CYS A CB    1 
ATOM   399   S  SG    . CYS A  1 87   ? 200.833 213.657 214.526 1.00 81.62  ? 81   CYS A SG    1 
ATOM   400   N  N     . SER A  1 88   ? 199.826 212.058 217.136 1.00 71.76  ? 82   SER A N     1 
ATOM   401   C  CA    . SER A  1 88   ? 198.537 211.564 217.597 1.00 71.76  ? 82   SER A CA    1 
ATOM   402   C  C     . SER A  1 88   ? 198.578 211.186 219.069 1.00 71.76  ? 82   SER A C     1 
ATOM   403   O  O     . SER A  1 88   ? 197.611 211.423 219.798 1.00 71.76  ? 82   SER A O     1 
ATOM   404   C  CB    . SER A  1 88   ? 198.107 210.369 216.756 1.00 71.76  ? 82   SER A CB    1 
ATOM   405   O  OG    . SER A  1 88   ? 196.889 209.843 217.239 1.00 71.76  ? 82   SER A OG    1 
ATOM   406   N  N     . TRP A  1 89   ? 199.684 210.608 219.527 1.00 59.39  ? 83   TRP A N     1 
ATOM   407   C  CA    . TRP A  1 89   ? 199.784 210.248 220.934 1.00 59.39  ? 83   TRP A CA    1 
ATOM   408   C  C     . TRP A  1 89   ? 199.887 211.488 221.803 1.00 59.39  ? 83   TRP A C     1 
ATOM   409   O  O     . TRP A  1 89   ? 199.132 211.630 222.766 1.00 59.39  ? 83   TRP A O     1 
ATOM   410   C  CB    . TRP A  1 89   ? 200.981 209.329 221.153 1.00 59.39  ? 83   TRP A CB    1 
ATOM   411   C  CG    . TRP A  1 89   ? 200.803 208.032 220.468 1.00 59.39  ? 83   TRP A CG    1 
ATOM   412   C  CD1   . TRP A  1 89   ? 199.655 207.557 219.923 1.00 59.39  ? 83   TRP A CD1   1 
ATOM   413   C  CD2   . TRP A  1 89   ? 201.808 207.053 220.197 1.00 59.39  ? 83   TRP A CD2   1 
ATOM   414   N  NE1   . TRP A  1 89   ? 199.870 206.333 219.350 1.00 59.39  ? 83   TRP A NE1   1 
ATOM   415   C  CE2   . TRP A  1 89   ? 201.189 206.004 219.505 1.00 59.39  ? 83   TRP A CE2   1 
ATOM   416   C  CE3   . TRP A  1 89   ? 203.169 206.957 220.483 1.00 59.39  ? 83   TRP A CE3   1 
ATOM   417   C  CZ2   . TRP A  1 89   ? 201.880 204.877 219.094 1.00 59.39  ? 83   TRP A CZ2   1 
ATOM   418   C  CZ3   . TRP A  1 89   ? 203.850 205.835 220.076 1.00 59.39  ? 83   TRP A CZ3   1 
ATOM   419   C  CH2   . TRP A  1 89   ? 203.206 204.810 219.391 1.00 59.39  ? 83   TRP A CH2   1 
ATOM   420   N  N     . LEU A  1 90   ? 200.790 212.401 221.462 1.00 64.19  ? 84   LEU A N     1 
ATOM   421   C  CA    . LEU A  1 90   ? 200.990 213.597 222.265 1.00 64.19  ? 84   LEU A CA    1 
ATOM   422   C  C     . LEU A  1 90   ? 199.756 214.482 222.321 1.00 64.19  ? 84   LEU A C     1 
ATOM   423   O  O     . LEU A  1 90   ? 199.494 215.093 223.360 1.00 64.19  ? 84   LEU A O     1 
ATOM   424   C  CB    . LEU A  1 90   ? 202.171 214.398 221.726 1.00 64.19  ? 84   LEU A CB    1 
ATOM   425   C  CG    . LEU A  1 90   ? 203.560 213.860 222.029 1.00 64.19  ? 84   LEU A CG    1 
ATOM   426   C  CD1   . LEU A  1 90   ? 204.595 214.572 221.197 1.00 64.19  ? 84   LEU A CD1   1 
ATOM   427   C  CD2   . LEU A  1 90   ? 203.821 214.105 223.490 1.00 64.19  ? 84   LEU A CD2   1 
ATOM   428   N  N     . LEU A  1 91   ? 198.999 214.589 221.232 1.00 60.52  ? 85   LEU A N     1 
ATOM   429   C  CA    . LEU A  1 91   ? 197.835 215.463 221.248 1.00 60.52  ? 85   LEU A CA    1 
ATOM   430   C  C     . LEU A  1 91   ? 196.836 214.994 222.295 1.00 60.52  ? 85   LEU A C     1 
ATOM   431   O  O     . LEU A  1 91   ? 196.447 215.746 223.197 1.00 60.52  ? 85   LEU A O     1 
ATOM   432   C  CB    . LEU A  1 91   ? 197.215 215.508 219.854 1.00 60.52  ? 85   LEU A CB    1 
ATOM   433   C  CG    . LEU A  1 91   ? 196.136 216.537 219.527 1.00 60.52  ? 85   LEU A CG    1 
ATOM   434   C  CD1   . LEU A  1 91   ? 196.227 216.905 218.064 1.00 60.52  ? 85   LEU A CD1   1 
ATOM   435   C  CD2   . LEU A  1 91   ? 194.761 215.984 219.831 1.00 60.52  ? 85   LEU A CD2   1 
ATOM   436   N  N     . PHE A  1 92   ? 196.436 213.730 222.218 1.00 54.89  ? 86   PHE A N     1 
ATOM   437   C  CA    . PHE A  1 92   ? 195.537 213.212 223.235 1.00 54.89  ? 86   PHE A CA    1 
ATOM   438   C  C     . PHE A  1 92   ? 196.199 213.128 224.596 1.00 54.89  ? 86   PHE A C     1 
ATOM   439   O  O     . PHE A  1 92   ? 195.497 213.128 225.608 1.00 54.89  ? 86   PHE A O     1 
ATOM   440   C  CB    . PHE A  1 92   ? 195.011 211.847 222.822 1.00 54.89  ? 86   PHE A CB    1 
ATOM   441   C  CG    . PHE A  1 92   ? 194.114 211.890 221.634 1.00 54.89  ? 86   PHE A CG    1 
ATOM   442   C  CD1   . PHE A  1 92   ? 192.800 212.280 221.764 1.00 54.89  ? 86   PHE A CD1   1 
ATOM   443   C  CD2   . PHE A  1 92   ? 194.581 211.541 220.387 1.00 54.89  ? 86   PHE A CD2   1 
ATOM   444   C  CE1   . PHE A  1 92   ? 191.973 212.323 220.675 1.00 54.89  ? 86   PHE A CE1   1 
ATOM   445   C  CE2   . PHE A  1 92   ? 193.755 211.582 219.295 1.00 54.89  ? 86   PHE A CE2   1 
ATOM   446   C  CZ    . PHE A  1 92   ? 192.449 211.974 219.438 1.00 54.89  ? 86   PHE A CZ    1 
ATOM   447   N  N     . ALA A  1 93   ? 197.526 213.056 224.658 1.00 56.55  ? 87   ALA A N     1 
ATOM   448   C  CA    . ALA A  1 93   ? 198.192 213.110 225.952 1.00 56.55  ? 87   ALA A CA    1 
ATOM   449   C  C     . ALA A  1 93   ? 197.939 214.448 226.619 1.00 56.55  ? 87   ALA A C     1 
ATOM   450   O  O     . ALA A  1 93   ? 197.563 214.515 227.796 1.00 56.55  ? 87   ALA A O     1 
ATOM   451   C  CB    . ALA A  1 93   ? 199.689 212.866 225.781 1.00 56.55  ? 87   ALA A CB    1 
ATOM   452   N  N     . MET A  1 94   ? 198.156 215.527 225.873 1.00 61.91  ? 88   MET A N     1 
ATOM   453   C  CA    . MET A  1 94   ? 197.798 216.846 226.362 1.00 61.91  ? 88   MET A CA    1 
ATOM   454   C  C     . MET A  1 94   ? 196.331 216.900 226.740 1.00 61.91  ? 88   MET A C     1 
ATOM   455   O  O     . MET A  1 94   ? 195.976 217.492 227.762 1.00 61.91  ? 88   MET A O     1 
ATOM   456   C  CB    . MET A  1 94   ? 198.121 217.895 225.303 1.00 61.91  ? 88   MET A CB    1 
ATOM   457   C  CG    . MET A  1 94   ? 197.890 219.323 225.750 1.00 61.91  ? 88   MET A CG    1 
ATOM   458   S  SD    . MET A  1 94   ? 198.928 219.773 227.153 1.00 61.91  ? 88   MET A SD    1 
ATOM   459   C  CE    . MET A  1 94   ? 200.543 219.824 226.390 1.00 61.91  ? 88   MET A CE    1 
ATOM   460   N  N     . ALA A  1 95   ? 195.471 216.263 225.948 1.00 55.63  ? 89   ALA A N     1 
ATOM   461   C  CA    . ALA A  1 95   ? 194.043 216.262 226.252 1.00 55.63  ? 89   ALA A CA    1 
ATOM   462   C  C     . ALA A  1 95   ? 193.767 215.629 227.611 1.00 55.63  ? 89   ALA A C     1 
ATOM   463   O  O     . ALA A  1 95   ? 193.117 216.232 228.471 1.00 55.63  ? 89   ALA A O     1 
ATOM   464   C  CB    . ALA A  1 95   ? 193.272 215.534 225.153 1.00 55.63  ? 89   ALA A CB    1 
ATOM   465   N  N     . TRP A  1 96   ? 194.244 214.403 227.815 1.00 53.11  ? 90   TRP A N     1 
ATOM   466   C  CA    . TRP A  1 96   ? 193.986 213.717 229.076 1.00 53.11  ? 90   TRP A CA    1 
ATOM   467   C  C     . TRP A  1 96   ? 194.580 214.480 230.246 1.00 53.11  ? 90   TRP A C     1 
ATOM   468   O  O     . TRP A  1 96   ? 193.947 214.601 231.302 1.00 53.11  ? 90   TRP A O     1 
ATOM   469   C  CB    . TRP A  1 96   ? 194.550 212.300 229.053 1.00 53.11  ? 90   TRP A CB    1 
ATOM   470   C  CG    . TRP A  1 96   ? 193.859 211.374 228.131 1.00 53.11  ? 90   TRP A CG    1 
ATOM   471   C  CD1   . TRP A  1 96   ? 194.355 210.841 226.986 1.00 53.11  ? 90   TRP A CD1   1 
ATOM   472   C  CD2   . TRP A  1 96   ? 192.519 210.900 228.249 1.00 53.11  ? 90   TRP A CD2   1 
ATOM   473   N  NE1   . TRP A  1 96   ? 193.415 210.037 226.394 1.00 53.11  ? 90   TRP A NE1   1 
ATOM   474   C  CE2   . TRP A  1 96   ? 192.275 210.063 227.150 1.00 53.11  ? 90   TRP A CE2   1 
ATOM   475   C  CE3   . TRP A  1 96   ? 191.504 211.097 229.183 1.00 53.11  ? 90   TRP A CE3   1 
ATOM   476   C  CZ2   . TRP A  1 96   ? 191.065 209.422 226.960 1.00 53.11  ? 90   TRP A CZ2   1 
ATOM   477   C  CZ3   . TRP A  1 96   ? 190.302 210.467 228.993 1.00 53.11  ? 90   TRP A CZ3   1 
ATOM   478   C  CH2   . TRP A  1 96   ? 190.090 209.638 227.889 1.00 53.11  ? 90   TRP A CH2   1 
ATOM   479   N  N     . TRP A  1 97   ? 195.809 214.969 230.093 1.00 55.69  ? 91   TRP A N     1 
ATOM   480   C  CA    . TRP A  1 97   ? 196.431 215.726 231.166 1.00 55.69  ? 91   TRP A CA    1 
ATOM   481   C  C     . TRP A  1 97   ? 195.603 216.943 231.522 1.00 55.69  ? 91   TRP A C     1 
ATOM   482   O  O     . TRP A  1 97   ? 195.343 217.213 232.701 1.00 55.69  ? 91   TRP A O     1 
ATOM   483   C  CB    . TRP A  1 97   ? 197.834 216.140 230.751 1.00 55.69  ? 91   TRP A CB    1 
ATOM   484   C  CG    . TRP A  1 97   ? 198.508 216.972 231.751 1.00 55.69  ? 91   TRP A CG    1 
ATOM   485   C  CD1   . TRP A  1 97   ? 198.895 216.602 232.998 1.00 55.69  ? 91   TRP A CD1   1 
ATOM   486   C  CD2   . TRP A  1 97   ? 198.882 218.337 231.601 1.00 55.69  ? 91   TRP A CD2   1 
ATOM   487   N  NE1   . TRP A  1 97   ? 199.495 217.655 233.637 1.00 55.69  ? 91   TRP A NE1   1 
ATOM   488   C  CE2   . TRP A  1 97   ? 199.497 218.734 232.796 1.00 55.69  ? 91   TRP A CE2   1 
ATOM   489   C  CE3   . TRP A  1 97   ? 198.755 219.262 230.567 1.00 55.69  ? 91   TRP A CE3   1 
ATOM   490   C  CZ2   . TRP A  1 97   ? 199.985 220.015 232.984 1.00 55.69  ? 91   TRP A CZ2   1 
ATOM   491   C  CZ3   . TRP A  1 97   ? 199.238 220.528 230.756 1.00 55.69  ? 91   TRP A CZ3   1 
ATOM   492   C  CH2   . TRP A  1 97   ? 199.844 220.897 231.954 1.00 55.69  ? 91   TRP A CH2   1 
ATOM   493   N  N     . LEU A  1 98   ? 195.168 217.684 230.509 1.00 57.47  ? 92   LEU A N     1 
ATOM   494   C  CA    . LEU A  1 98   ? 194.346 218.858 230.740 1.00 57.47  ? 92   LEU A CA    1 
ATOM   495   C  C     . LEU A  1 98   ? 193.048 218.490 231.433 1.00 57.47  ? 92   LEU A C     1 
ATOM   496   O  O     . LEU A  1 98   ? 192.571 219.225 232.299 1.00 57.47  ? 92   LEU A O     1 
ATOM   497   C  CB    . LEU A  1 98   ? 194.067 219.545 229.412 1.00 57.47  ? 92   LEU A CB    1 
ATOM   498   C  CG    . LEU A  1 98   ? 193.294 220.847 229.495 1.00 57.47  ? 92   LEU A CG    1 
ATOM   499   C  CD1   . LEU A  1 98   ? 194.127 221.872 230.232 1.00 57.47  ? 92   LEU A CD1   1 
ATOM   500   C  CD2   . LEU A  1 98   ? 192.937 221.326 228.105 1.00 57.47  ? 92   LEU A CD2   1 
ATOM   501   N  N     . ILE A  1 99   ? 192.454 217.359 231.061 1.00 58.35  ? 93   ILE A N     1 
ATOM   502   C  CA    . ILE A  1 99   ? 191.207 216.956 231.696 1.00 58.35  ? 93   ILE A CA    1 
ATOM   503   C  C     . ILE A  1 99   ? 191.428 216.642 233.163 1.00 58.35  ? 93   ILE A C     1 
ATOM   504   O  O     . ILE A  1 99   ? 190.659 217.075 234.024 1.00 58.35  ? 93   ILE A O     1 
ATOM   505   C  CB    . ILE A  1 99   ? 190.589 215.760 230.962 1.00 58.35  ? 93   ILE A CB    1 
ATOM   506   C  CG1   . ILE A  1 99   ? 190.226 216.158 229.538 1.00 58.35  ? 93   ILE A CG1   1 
ATOM   507   C  CG2   . ILE A  1 99   ? 189.377 215.255 231.718 1.00 58.35  ? 93   ILE A CG2   1 
ATOM   508   C  CD1   . ILE A  1 99   ? 189.277 217.320 229.474 1.00 58.35  ? 93   ILE A CD1   1 
ATOM   509   N  N     . ALA A  1 100  ? 192.467 215.871 233.469 1.00 59.84  ? 94   ALA A N     1 
ATOM   510   C  CA    . ALA A  1 100  ? 192.767 215.584 234.864 1.00 59.84  ? 94   ALA A CA    1 
ATOM   511   C  C     . ALA A  1 100  ? 193.015 216.858 235.637 1.00 59.84  ? 94   ALA A C     1 
ATOM   512   O  O     . ALA A  1 100  ? 192.644 216.962 236.811 1.00 59.84  ? 94   ALA A O     1 
ATOM   513   C  CB    . ALA A  1 100  ? 193.981 214.676 234.970 1.00 59.84  ? 94   ALA A CB    1 
ATOM   514   N  N     . PHE A  1 101  ? 193.630 217.842 234.996 1.00 64.20  ? 95   PHE A N     1 
ATOM   515   C  CA    . PHE A  1 101  ? 193.926 219.066 235.711 1.00 64.20  ? 95   PHE A CA    1 
ATOM   516   C  C     . PHE A  1 101  ? 192.695 219.937 235.890 1.00 64.20  ? 95   PHE A C     1 
ATOM   517   O  O     . PHE A  1 101  ? 192.589 220.640 236.897 1.00 64.20  ? 95   PHE A O     1 
ATOM   518   C  CB    . PHE A  1 101  ? 195.019 219.828 234.985 1.00 64.20  ? 95   PHE A CB    1 
ATOM   519   C  CG    . PHE A  1 101  ? 195.505 221.010 235.731 1.00 64.20  ? 95   PHE A CG    1 
ATOM   520   C  CD1   . PHE A  1 101  ? 196.194 220.850 236.906 1.00 64.20  ? 95   PHE A CD1   1 
ATOM   521   C  CD2   . PHE A  1 101  ? 195.305 222.279 235.246 1.00 64.20  ? 95   PHE A CD2   1 
ATOM   522   C  CE1   . PHE A  1 101  ? 196.650 221.929 237.595 1.00 64.20  ? 95   PHE A CE1   1 
ATOM   523   C  CE2   . PHE A  1 101  ? 195.766 223.362 235.937 1.00 64.20  ? 95   PHE A CE2   1 
ATOM   524   C  CZ    . PHE A  1 101  ? 196.439 223.188 237.111 1.00 64.20  ? 95   PHE A CZ    1 
ATOM   525   N  N     . ALA A  1 102  ? 191.760 219.894 234.945 1.00 64.90  ? 96   ALA A N     1 
ATOM   526   C  CA    . ALA A  1 102  ? 190.527 220.656 235.077 1.00 64.90  ? 96   ALA A CA    1 
ATOM   527   C  C     . ALA A  1 102  ? 189.599 220.018 236.093 1.00 64.90  ? 96   ALA A C     1 
ATOM   528   O  O     . ALA A  1 102  ? 188.860 220.716 236.793 1.00 64.90  ? 96   ALA A O     1 
ATOM   529   C  CB    . ALA A  1 102  ? 189.831 220.766 233.723 1.00 64.90  ? 96   ALA A CB    1 
ATOM   530   N  N     . HIS A  1 103  ? 189.631 218.692 236.188 1.00 63.08  ? 97   HIS A N     1 
ATOM   531   C  CA    . HIS A  1 103  ? 188.859 217.990 237.199 1.00 63.08  ? 97   HIS A CA    1 
ATOM   532   C  C     . HIS A  1 103  ? 189.373 218.264 238.604 1.00 63.08  ? 97   HIS A C     1 
ATOM   533   O  O     . HIS A  1 103  ? 188.755 217.819 239.576 1.00 63.08  ? 97   HIS A O     1 
ATOM   534   C  CB    . HIS A  1 103  ? 188.886 216.496 236.909 1.00 63.08  ? 97   HIS A CB    1 
ATOM   535   C  CG    . HIS A  1 103  ? 188.066 215.682 237.854 1.00 63.08  ? 97   HIS A CG    1 
ATOM   536   N  ND1   . HIS A  1 103  ? 188.580 215.162 239.020 1.00 63.08  ? 97   HIS A ND1   1 
ATOM   537   C  CD2   . HIS A  1 103  ? 186.764 215.317 237.819 1.00 63.08  ? 97   HIS A CD2   1 
ATOM   538   C  CE1   . HIS A  1 103  ? 187.632 214.496 239.656 1.00 63.08  ? 97   HIS A CE1   1 
ATOM   539   N  NE2   . HIS A  1 103  ? 186.521 214.576 238.949 1.00 63.08  ? 97   HIS A NE2   1 
ATOM   540   N  N     . GLY A  1 104  ? 190.469 219.000 238.732 1.00 65.59  ? 98   GLY A N     1 
ATOM   541   C  CA    . GLY A  1 104  ? 191.059 219.218 240.030 1.00 65.59  ? 98   GLY A CA    1 
ATOM   542   C  C     . GLY A  1 104  ? 191.516 217.896 240.585 1.00 65.59  ? 98   GLY A C     1 
ATOM   543   O  O     . GLY A  1 104  ? 191.159 217.520 241.704 1.00 65.59  ? 98   GLY A O     1 
ATOM   544   N  N     . ASP A  1 105  ? 192.293 217.169 239.793 1.00 67.03  ? 99   ASP A N     1 
ATOM   545   C  CA    . ASP A  1 105  ? 192.689 215.823 240.156 1.00 67.03  ? 99   ASP A CA    1 
ATOM   546   C  C     . ASP A  1 105  ? 194.184 215.659 240.371 1.00 67.03  ? 99   ASP A C     1 
ATOM   547   O  O     . ASP A  1 105  ? 194.610 214.584 240.801 1.00 67.03  ? 99   ASP A O     1 
ATOM   548   C  CB    . ASP A  1 105  ? 192.213 214.829 239.087 1.00 67.03  ? 99   ASP A CB    1 
ATOM   549   C  CG    . ASP A  1 105  ? 192.331 213.403 239.539 1.00 67.03  ? 99   ASP A CG    1 
ATOM   550   O  OD1   . ASP A  1 105  ? 191.555 213.007 240.432 1.00 67.03  ? 99   ASP A OD1   1 
ATOM   551   O  OD2   . ASP A  1 105  ? 193.197 212.678 239.011 1.00 67.03  ? 99   ASP A OD2   1 
ATOM   552   N  N     . LEU A  1 106  ? 194.988 216.680 240.100 1.00 70.39  ? 100  LEU A N     1 
ATOM   553   C  CA    . LEU A  1 106  ? 196.421 216.570 240.324 1.00 70.39  ? 100  LEU A CA    1 
ATOM   554   C  C     . LEU A  1 106  ? 196.802 217.011 241.730 1.00 70.39  ? 100  LEU A C     1 
ATOM   555   O  O     . LEU A  1 106  ? 197.700 216.433 242.349 1.00 70.39  ? 100  LEU A O     1 
ATOM   556   C  CB    . LEU A  1 106  ? 197.182 217.388 239.287 1.00 70.39  ? 100  LEU A CB    1 
ATOM   557   C  CG    . LEU A  1 106  ? 197.089 216.782 237.896 1.00 70.39  ? 100  LEU A CG    1 
ATOM   558   C  CD1   . LEU A  1 106  ? 197.714 217.686 236.857 1.00 70.39  ? 100  LEU A CD1   1 
ATOM   559   C  CD2   . LEU A  1 106  ? 197.779 215.442 237.920 1.00 70.39  ? 100  LEU A CD2   1 
ATOM   560   N  N     . ALA A  1 107  ? 196.133 218.031 242.237 1.00 87.76  ? 101  ALA A N     1 
ATOM   561   C  CA    . ALA A  1 107  ? 196.489 218.587 243.534 1.00 87.76  ? 101  ALA A CA    1 
ATOM   562   C  C     . ALA A  1 107  ? 196.006 217.751 244.717 1.00 87.76  ? 101  ALA A C     1 
ATOM   563   O  O     . ALA A  1 107  ? 196.823 217.369 245.565 1.00 87.76  ? 101  ALA A O     1 
ATOM   564   C  CB    . ALA A  1 107  ? 195.938 220.007 243.668 1.00 87.76  ? 101  ALA A CB    1 
ATOM   565   N  N     . PRO A  1 108  ? 194.698 217.448 244.826 1.00 92.37  ? 102  PRO A N     1 
ATOM   566   C  CA    . PRO A  1 108  ? 194.160 217.051 246.134 1.00 92.37  ? 102  PRO A CA    1 
ATOM   567   C  C     . PRO A  1 108  ? 194.719 215.748 246.676 1.00 92.37  ? 102  PRO A C     1 
ATOM   568   O  O     . PRO A  1 108  ? 195.306 215.732 247.763 1.00 92.37  ? 102  PRO A O     1 
ATOM   569   C  CB    . PRO A  1 108  ? 192.656 216.937 245.867 1.00 92.37  ? 102  PRO A CB    1 
ATOM   570   C  CG    . PRO A  1 108  ? 192.556 216.608 244.435 1.00 92.37  ? 102  PRO A CG    1 
ATOM   571   C  CD    . PRO A  1 108  ? 193.681 217.332 243.764 1.00 92.37  ? 102  PRO A CD    1 
ATOM   572   N  N     . SER A  1 109  ? 194.553 214.656 245.927 1.00 98.87  ? 103  SER A N     1 
ATOM   573   C  CA    . SER A  1 109  ? 194.846 213.310 246.421 1.00 98.87  ? 103  SER A CA    1 
ATOM   574   C  C     . SER A  1 109  ? 194.186 213.076 247.778 1.00 98.87  ? 103  SER A C     1 
ATOM   575   O  O     . SER A  1 109  ? 194.685 212.322 248.617 1.00 98.87  ? 103  SER A O     1 
ATOM   576   C  CB    . SER A  1 109  ? 196.353 213.064 246.490 1.00 98.87  ? 103  SER A CB    1 
ATOM   577   O  OG    . SER A  1 109  ? 196.964 213.902 247.454 1.00 98.87  ? 103  SER A OG    1 
ATOM   578   N  N     . GLU A  1 110  ? 193.040 213.730 247.989 1.00 98.37  ? 104  GLU A N     1 
ATOM   579   C  CA    . GLU A  1 110  ? 192.378 213.688 249.288 1.00 98.37  ? 104  GLU A CA    1 
ATOM   580   C  C     . GLU A  1 110  ? 191.825 212.307 249.597 1.00 98.37  ? 104  GLU A C     1 
ATOM   581   O  O     . GLU A  1 110  ? 191.550 211.998 250.762 1.00 98.37  ? 104  GLU A O     1 
ATOM   582   C  CB    . GLU A  1 110  ? 191.260 214.728 249.337 1.00 98.37  ? 104  GLU A CB    1 
ATOM   583   N  N     . GLY A  1 111  ? 191.649 211.471 248.579 1.00 100.82 ? 105  GLY A N     1 
ATOM   584   C  CA    . GLY A  1 111  ? 191.135 210.132 248.780 1.00 100.82 ? 105  GLY A CA    1 
ATOM   585   C  C     . GLY A  1 111  ? 189.663 210.011 248.454 1.00 100.82 ? 105  GLY A C     1 
ATOM   586   O  O     . GLY A  1 111  ? 189.198 208.955 248.017 1.00 100.82 ? 105  GLY A O     1 
ATOM   587   N  N     . THR A  1 112  ? 188.915 211.095 248.661 1.00 98.81  ? 106  THR A N     1 
ATOM   588   C  CA    . THR A  1 112  ? 187.478 211.059 248.425 1.00 98.81  ? 106  THR A CA    1 
ATOM   589   C  C     . THR A  1 112  ? 187.146 211.166 246.939 1.00 98.81  ? 106  THR A C     1 
ATOM   590   O  O     . THR A  1 112  ? 186.590 210.227 246.357 1.00 98.81  ? 106  THR A O     1 
ATOM   591   C  CB    . THR A  1 112  ? 186.791 212.181 249.199 1.00 98.81  ? 106  THR A CB    1 
ATOM   592   N  N     . ALA A  1 113  ? 187.489 212.287 246.312 1.00 90.90  ? 107  ALA A N     1 
ATOM   593   C  CA    . ALA A  1 113  ? 187.110 212.528 244.927 1.00 90.90  ? 107  ALA A CA    1 
ATOM   594   C  C     . ALA A  1 113  ? 187.853 211.578 244.001 1.00 90.90  ? 107  ALA A C     1 
ATOM   595   O  O     . ALA A  1 113  ? 189.083 211.479 244.048 1.00 90.90  ? 107  ALA A O     1 
ATOM   596   C  CB    . ALA A  1 113  ? 187.395 213.977 244.539 1.00 90.90  ? 107  ALA A CB    1 
ATOM   597   N  N     . GLU A  1 114  ? 187.109 210.893 243.159 1.00 81.25  ? 108  GLU A N     1 
ATOM   598   C  CA    . GLU A  1 114  ? 187.661 209.908 242.244 1.00 81.25  ? 108  GLU A CA    1 
ATOM   599   C  C     . GLU A  1 114  ? 188.045 210.582 240.939 1.00 81.25  ? 108  GLU A C     1 
ATOM   600   O  O     . GLU A  1 114  ? 187.327 211.476 240.477 1.00 81.25  ? 108  GLU A O     1 
ATOM   601   C  CB    . GLU A  1 114  ? 186.655 208.807 241.975 1.00 81.25  ? 108  GLU A CB    1 
ATOM   602   C  CG    . GLU A  1 114  ? 186.271 208.037 243.213 1.00 81.25  ? 108  GLU A CG    1 
ATOM   603   C  CD    . GLU A  1 114  ? 185.252 208.779 244.044 1.00 81.25  ? 108  GLU A CD    1 
ATOM   604   O  OE1   . GLU A  1 114  ? 184.824 209.868 243.614 1.00 81.25  ? 108  GLU A OE1   1 
ATOM   605   O  OE2   . GLU A  1 114  ? 184.882 208.283 245.123 1.00 81.25  ? 108  GLU A OE2   1 
ATOM   606   N  N     . PRO A  1 115  ? 189.143 210.190 240.324 1.00 73.78  ? 109  PRO A N     1 
ATOM   607   C  CA    . PRO A  1 115  ? 189.618 210.904 239.136 1.00 73.78  ? 109  PRO A CA    1 
ATOM   608   C  C     . PRO A  1 115  ? 188.760 210.659 237.913 1.00 73.78  ? 109  PRO A C     1 
ATOM   609   O  O     . PRO A  1 115  ? 187.961 209.720 237.882 1.00 73.78  ? 109  PRO A O     1 
ATOM   610   C  CB    . PRO A  1 115  ? 191.024 210.333 238.939 1.00 73.78  ? 109  PRO A CB    1 
ATOM   611   C  CG    . PRO A  1 115  ? 190.949 208.974 239.513 1.00 73.78  ? 109  PRO A CG    1 
ATOM   612   C  CD    . PRO A  1 115  ? 190.016 209.063 240.681 1.00 73.78  ? 109  PRO A CD    1 
ATOM   613   N  N     . CYS A  1 116  ? 188.912 211.510 236.898 1.00 82.22  ? 110  CYS A N     1 
ATOM   614   C  CA    . CYS A  1 116  ? 188.418 211.150 235.576 1.00 82.22  ? 110  CYS A CA    1 
ATOM   615   C  C     . CYS A  1 116  ? 189.059 209.853 235.114 1.00 82.22  ? 110  CYS A C     1 
ATOM   616   O  O     . CYS A  1 116  ? 188.376 208.952 234.615 1.00 82.22  ? 110  CYS A O     1 
ATOM   617   C  CB    . CYS A  1 116  ? 188.715 212.260 234.570 1.00 82.22  ? 110  CYS A CB    1 
ATOM   618   S  SG    . CYS A  1 116  ? 187.942 213.864 234.875 1.00 82.22  ? 110  CYS A SG    1 
ATOM   619   N  N     . VAL A  1 117  ? 190.369 209.743 235.289 1.00 71.34  ? 111  VAL A N     1 
ATOM   620   C  CA    . VAL A  1 117  ? 191.133 208.561 234.929 1.00 71.34  ? 111  VAL A CA    1 
ATOM   621   C  C     . VAL A  1 117  ? 192.048 208.220 236.094 1.00 71.34  ? 111  VAL A C     1 
ATOM   622   O  O     . VAL A  1 117  ? 192.685 209.103 236.675 1.00 71.34  ? 111  VAL A O     1 
ATOM   623   C  CB    . VAL A  1 117  ? 191.930 208.778 233.627 1.00 71.34  ? 111  VAL A CB    1 
ATOM   624   C  CG1   . VAL A  1 117  ? 192.851 209.967 233.767 1.00 71.34  ? 111  VAL A CG1   1 
ATOM   625   C  CG2   . VAL A  1 117  ? 192.719 207.539 233.273 1.00 71.34  ? 111  VAL A CG2   1 
ATOM   626   N  N     . THR A  1 118  ? 192.098 206.943 236.443 1.00 68.84  ? 112  THR A N     1 
ATOM   627   C  CA    . THR A  1 118  ? 192.792 206.518 237.646 1.00 68.84  ? 112  THR A CA    1 
ATOM   628   C  C     . THR A  1 118  ? 194.284 206.789 237.557 1.00 68.84  ? 112  THR A C     1 
ATOM   629   O  O     . THR A  1 118  ? 194.916 206.544 236.528 1.00 68.84  ? 112  THR A O     1 
ATOM   630   C  CB    . THR A  1 118  ? 192.569 205.029 237.892 1.00 68.84  ? 112  THR A CB    1 
ATOM   631   O  OG1   . THR A  1 118  ? 193.051 204.286 236.769 1.00 68.84  ? 112  THR A OG1   1 
ATOM   632   C  CG2   . THR A  1 118  ? 191.100 204.742 238.086 1.00 68.84  ? 112  THR A CG2   1 
ATOM   633   N  N     . SER A  1 119  ? 194.834 207.313 238.651 1.00 65.00  ? 113  SER A N     1 
ATOM   634   C  CA    . SER A  1 119  ? 196.267 207.303 238.929 1.00 65.00  ? 113  SER A CA    1 
ATOM   635   C  C     . SER A  1 119  ? 197.073 207.928 237.790 1.00 65.00  ? 113  SER A C     1 
ATOM   636   O  O     . SER A  1 119  ? 197.876 207.276 237.129 1.00 65.00  ? 113  SER A O     1 
ATOM   637   C  CB    . SER A  1 119  ? 196.747 205.874 239.199 1.00 65.00  ? 113  SER A CB    1 
ATOM   638   O  OG    . SER A  1 119  ? 196.668 205.092 238.023 1.00 65.00  ? 113  SER A OG    1 
ATOM   639   N  N     . ILE A  1 120  ? 196.838 209.216 237.575 1.00 61.08  ? 114  ILE A N     1 
ATOM   640   C  CA    . ILE A  1 120  ? 197.757 210.005 236.770 1.00 61.08  ? 114  ILE A CA    1 
ATOM   641   C  C     . ILE A  1 120  ? 198.123 211.252 237.557 1.00 61.08  ? 114  ILE A C     1 
ATOM   642   O  O     . ILE A  1 120  ? 197.269 211.912 238.154 1.00 61.08  ? 114  ILE A O     1 
ATOM   643   C  CB    . ILE A  1 120  ? 197.210 210.378 235.376 1.00 61.08  ? 114  ILE A CB    1 
ATOM   644   C  CG1   . ILE A  1 120  ? 196.086 211.387 235.456 1.00 61.08  ? 114  ILE A CG1   1 
ATOM   645   C  CG2   . ILE A  1 120  ? 196.709 209.155 234.652 1.00 61.08  ? 114  ILE A CG2   1 
ATOM   646   C  CD1   . ILE A  1 120  ? 195.803 211.948 234.114 1.00 61.08  ? 114  ILE A CD1   1 
ATOM   647   N  N     . HIS A  1 121  ? 199.414 211.555 237.570 1.00 60.80  ? 115  HIS A N     1 
ATOM   648   C  CA    . HIS A  1 121  ? 199.917 212.622 238.420 1.00 60.80  ? 115  HIS A CA    1 
ATOM   649   C  C     . HIS A  1 121  ? 200.876 213.527 237.672 1.00 60.80  ? 115  HIS A C     1 
ATOM   650   O  O     . HIS A  1 121  ? 201.239 214.587 238.193 1.00 60.80  ? 115  HIS A O     1 
ATOM   651   C  CB    . HIS A  1 121  ? 200.603 212.018 239.639 1.00 60.80  ? 115  HIS A CB    1 
ATOM   652   C  CG    . HIS A  1 121  ? 199.731 211.068 240.391 1.00 60.80  ? 115  HIS A CG    1 
ATOM   653   N  ND1   . HIS A  1 121  ? 199.714 209.716 240.125 1.00 60.80  ? 115  HIS A ND1   1 
ATOM   654   C  CD2   . HIS A  1 121  ? 198.808 211.275 241.356 1.00 60.80  ? 115  HIS A CD2   1 
ATOM   655   C  CE1   . HIS A  1 121  ? 198.839 209.127 240.919 1.00 60.80  ? 115  HIS A CE1   1 
ATOM   656   N  NE2   . HIS A  1 121  ? 198.273 210.052 241.675 1.00 60.80  ? 115  HIS A NE2   1 
ATOM   657   N  N     . SER A  1 122  ? 201.281 213.151 236.468 1.00 57.05  ? 116  SER A N     1 
ATOM   658   C  CA    . SER A  1 122  ? 202.219 213.942 235.694 1.00 57.05  ? 116  SER A CA    1 
ATOM   659   C  C     . SER A  1 122  ? 201.801 213.853 234.241 1.00 57.05  ? 116  SER A C     1 
ATOM   660   O  O     . SER A  1 122  ? 201.108 212.921 233.833 1.00 57.05  ? 116  SER A O     1 
ATOM   661   C  CB    . SER A  1 122  ? 203.651 213.444 235.876 1.00 57.05  ? 116  SER A CB    1 
ATOM   662   O  OG    . SER A  1 122  ? 203.797 212.149 235.326 1.00 57.05  ? 116  SER A OG    1 
ATOM   663   N  N     . PHE A  1 123  ? 202.225 214.844 233.458 1.00 60.18  ? 117  PHE A N     1 
ATOM   664   C  CA    . PHE A  1 123  ? 201.997 214.749 232.025 1.00 60.18  ? 117  PHE A CA    1 
ATOM   665   C  C     . PHE A  1 123  ? 202.576 213.464 231.468 1.00 60.18  ? 117  PHE A C     1 
ATOM   666   O  O     . PHE A  1 123  ? 202.040 212.907 230.506 1.00 60.18  ? 117  PHE A O     1 
ATOM   667   C  CB    . PHE A  1 123  ? 202.590 215.948 231.300 1.00 60.18  ? 117  PHE A CB    1 
ATOM   668   C  CG    . PHE A  1 123  ? 202.440 215.867 229.819 1.00 60.18  ? 117  PHE A CG    1 
ATOM   669   C  CD1   . PHE A  1 123  ? 201.213 216.076 229.226 1.00 60.18  ? 117  PHE A CD1   1 
ATOM   670   C  CD2   . PHE A  1 123  ? 203.517 215.556 229.018 1.00 60.18  ? 117  PHE A CD2   1 
ATOM   671   C  CE1   . PHE A  1 123  ? 201.071 215.988 227.866 1.00 60.18  ? 117  PHE A CE1   1 
ATOM   672   C  CE2   . PHE A  1 123  ? 203.377 215.470 227.658 1.00 60.18  ? 117  PHE A CE2   1 
ATOM   673   C  CZ    . PHE A  1 123  ? 202.155 215.683 227.083 1.00 60.18  ? 117  PHE A CZ    1 
ATOM   674   N  N     . SER A  1 124  ? 203.664 212.976 232.059 1.00 59.62  ? 118  SER A N     1 
ATOM   675   C  CA    . SER A  1 124  ? 204.176 211.666 231.687 1.00 59.62  ? 118  SER A CA    1 
ATOM   676   C  C     . SER A  1 124  ? 203.113 210.598 231.867 1.00 59.62  ? 118  SER A C     1 
ATOM   677   O  O     . SER A  1 124  ? 202.981 209.691 231.035 1.00 59.62  ? 118  SER A O     1 
ATOM   678   C  CB    . SER A  1 124  ? 205.411 211.338 232.519 1.00 59.62  ? 118  SER A CB    1 
ATOM   679   O  OG    . SER A  1 124  ? 205.888 210.045 232.214 1.00 59.62  ? 118  SER A OG    1 
ATOM   680   N  N     . SER A  1 125  ? 202.339 210.687 232.946 1.00 57.42  ? 119  SER A N     1 
ATOM   681   C  CA    . SER A  1 125  ? 201.276 209.719 233.165 1.00 57.42  ? 119  SER A CA    1 
ATOM   682   C  C     . SER A  1 125  ? 200.244 209.785 232.056 1.00 57.42  ? 119  SER A C     1 
ATOM   683   O  O     . SER A  1 125  ? 199.862 208.754 231.496 1.00 57.42  ? 119  SER A O     1 
ATOM   684   C  CB    . SER A  1 125  ? 200.611 209.962 234.514 1.00 57.42  ? 119  SER A CB    1 
ATOM   685   O  OG    . SER A  1 125  ? 201.534 209.787 235.568 1.00 57.42  ? 119  SER A OG    1 
ATOM   686   N  N     . ALA A  1 126  ? 199.778 210.987 231.728 1.00 56.74  ? 120  ALA A N     1 
ATOM   687   C  CA    . ALA A  1 126  ? 198.783 211.116 230.672 1.00 56.74  ? 120  ALA A CA    1 
ATOM   688   C  C     . ALA A  1 126  ? 199.328 210.639 229.341 1.00 56.74  ? 120  ALA A C     1 
ATOM   689   O  O     . ALA A  1 126  ? 198.580 210.102 228.521 1.00 56.74  ? 120  ALA A O     1 
ATOM   690   C  CB    . ALA A  1 126  ? 198.311 212.560 230.565 1.00 56.74  ? 120  ALA A CB    1 
ATOM   691   N  N     . PHE A  1 127  ? 200.627 210.796 229.118 1.00 54.94  ? 121  PHE A N     1 
ATOM   692   C  CA    . PHE A  1 127  ? 201.198 210.341 227.858 1.00 54.94  ? 121  PHE A CA    1 
ATOM   693   C  C     . PHE A  1 127  ? 201.251 208.823 227.797 1.00 54.94  ? 121  PHE A C     1 
ATOM   694   O  O     . PHE A  1 127  ? 200.882 208.218 226.780 1.00 54.94  ? 121  PHE A O     1 
ATOM   695   C  CB    . PHE A  1 127  ? 202.580 210.944 227.670 1.00 54.94  ? 121  PHE A CB    1 
ATOM   696   C  CG    . PHE A  1 127  ? 203.217 210.557 226.394 1.00 54.94  ? 121  PHE A CG    1 
ATOM   697   C  CD1   . PHE A  1 127  ? 202.681 210.978 225.197 1.00 54.94  ? 121  PHE A CD1   1 
ATOM   698   C  CD2   . PHE A  1 127  ? 204.366 209.801 226.379 1.00 54.94  ? 121  PHE A CD2   1 
ATOM   699   C  CE1   . PHE A  1 127  ? 203.261 210.631 224.007 1.00 54.94  ? 121  PHE A CE1   1 
ATOM   700   C  CE2   . PHE A  1 127  ? 204.958 209.461 225.192 1.00 54.94  ? 121  PHE A CE2   1 
ATOM   701   C  CZ    . PHE A  1 127  ? 204.403 209.874 224.002 1.00 54.94  ? 121  PHE A CZ    1 
ATOM   702   N  N     . LEU A  1 128  ? 201.725 208.189 228.868 1.00 52.68  ? 122  LEU A N     1 
ATOM   703   C  CA    . LEU A  1 128  ? 201.644 206.738 228.941 1.00 52.68  ? 122  LEU A CA    1 
ATOM   704   C  C     . LEU A  1 128  ? 200.223 206.259 228.736 1.00 52.68  ? 122  LEU A C     1 
ATOM   705   O  O     . LEU A  1 128  ? 199.995 205.264 228.042 1.00 52.68  ? 122  LEU A O     1 
ATOM   706   C  CB    . LEU A  1 128  ? 202.153 206.239 230.284 1.00 52.68  ? 122  LEU A CB    1 
ATOM   707   C  CG    . LEU A  1 128  ? 203.639 206.357 230.570 1.00 52.68  ? 122  LEU A CG    1 
ATOM   708   C  CD1   . LEU A  1 128  ? 203.906 205.899 231.982 1.00 52.68  ? 122  LEU A CD1   1 
ATOM   709   C  CD2   . LEU A  1 128  ? 204.402 205.517 229.588 1.00 52.68  ? 122  LEU A CD2   1 
ATOM   710   N  N     . PHE A  1 129  ? 199.259 206.950 229.331 1.00 52.25  ? 123  PHE A N     1 
ATOM   711   C  CA    . PHE A  1 129  ? 197.871 206.551 229.178 1.00 52.25  ? 123  PHE A CA    1 
ATOM   712   C  C     . PHE A  1 129  ? 197.426 206.655 227.730 1.00 52.25  ? 123  PHE A C     1 
ATOM   713   O  O     . PHE A  1 129  ? 196.730 205.770 227.223 1.00 52.25  ? 123  PHE A O     1 
ATOM   714   C  CB    . PHE A  1 129  ? 196.983 207.407 230.063 1.00 52.25  ? 123  PHE A CB    1 
ATOM   715   C  CG    . PHE A  1 129  ? 195.546 207.079 229.934 1.00 52.25  ? 123  PHE A CG    1 
ATOM   716   C  CD1   . PHE A  1 129  ? 195.037 205.943 230.516 1.00 52.25  ? 123  PHE A CD1   1 
ATOM   717   C  CD2   . PHE A  1 129  ? 194.703 207.893 229.212 1.00 52.25  ? 123  PHE A CD2   1 
ATOM   718   C  CE1   . PHE A  1 129  ? 193.711 205.629 230.391 1.00 52.25  ? 123  PHE A CE1   1 
ATOM   719   C  CE2   . PHE A  1 129  ? 193.377 207.583 229.084 1.00 52.25  ? 123  PHE A CE2   1 
ATOM   720   C  CZ    . PHE A  1 129  ? 192.881 206.450 229.674 1.00 52.25  ? 123  PHE A CZ    1 
ATOM   721   N  N     . SER A  1 130  ? 197.803 207.735 227.052 1.00 56.58  ? 124  SER A N     1 
ATOM   722   C  CA    . SER A  1 130  ? 197.413 207.884 225.659 1.00 56.58  ? 124  SER A CA    1 
ATOM   723   C  C     . SER A  1 130  ? 198.009 206.778 224.812 1.00 56.58  ? 124  SER A C     1 
ATOM   724   O  O     . SER A  1 130  ? 197.345 206.243 223.918 1.00 56.58  ? 124  SER A O     1 
ATOM   725   C  CB    . SER A  1 130  ? 197.841 209.248 225.137 1.00 56.58  ? 124  SER A CB    1 
ATOM   726   O  OG    . SER A  1 130  ? 197.150 210.265 225.833 1.00 56.58  ? 124  SER A OG    1 
ATOM   727   N  N     . ILE A  1 131  ? 199.262 206.417 225.084 1.00 53.97  ? 125  ILE A N     1 
ATOM   728   C  CA    . ILE A  1 131  ? 199.877 205.331 224.331 1.00 53.97  ? 125  ILE A CA    1 
ATOM   729   C  C     . ILE A  1 131  ? 199.150 204.025 224.601 1.00 53.97  ? 125  ILE A C     1 
ATOM   730   O  O     . ILE A  1 131  ? 198.848 203.264 223.678 1.00 53.97  ? 125  ILE A O     1 
ATOM   731   C  CB    . ILE A  1 131  ? 201.372 205.217 224.658 1.00 53.97  ? 125  ILE A CB    1 
ATOM   732   C  CG1   . ILE A  1 131  ? 202.120 206.448 224.163 1.00 53.97  ? 125  ILE A CG1   1 
ATOM   733   C  CG2   . ILE A  1 131  ? 201.954 203.983 224.028 1.00 53.97  ? 125  ILE A CG2   1 
ATOM   734   C  CD1   . ILE A  1 131  ? 203.567 206.446 224.555 1.00 53.97  ? 125  ILE A CD1   1 
ATOM   735   N  N     . GLU A  1 132  ? 198.847 203.750 225.867 1.00 58.59  ? 126  GLU A N     1 
ATOM   736   C  CA    . GLU A  1 132  ? 198.117 202.533 226.195 1.00 58.59  ? 126  GLU A CA    1 
ATOM   737   C  C     . GLU A  1 132  ? 196.785 202.476 225.479 1.00 58.59  ? 126  GLU A C     1 
ATOM   738   O  O     . GLU A  1 132  ? 196.399 201.420 224.971 1.00 58.59  ? 126  GLU A O     1 
ATOM   739   C  CB    . GLU A  1 132  ? 197.890 202.438 227.696 1.00 58.59  ? 126  GLU A CB    1 
ATOM   740   C  CG    . GLU A  1 132  ? 199.148 202.271 228.499 1.00 58.59  ? 126  GLU A CG    1 
ATOM   741   C  CD    . GLU A  1 132  ? 198.859 202.232 229.972 1.00 58.59  ? 126  GLU A CD    1 
ATOM   742   O  OE1   . GLU A  1 132  ? 197.680 202.407 230.340 1.00 58.59  ? 126  GLU A OE1   1 
ATOM   743   O  OE2   . GLU A  1 132  ? 199.802 202.053 230.766 1.00 58.59  ? 126  GLU A OE2   1 
ATOM   744   N  N     . VAL A  1 133  ? 196.077 203.596 225.419 1.00 47.20  ? 127  VAL A N     1 
ATOM   745   C  CA    . VAL A  1 133  ? 194.765 203.629 224.797 1.00 47.20  ? 127  VAL A CA    1 
ATOM   746   C  C     . VAL A  1 133  ? 194.889 203.399 223.302 1.00 47.20  ? 127  VAL A C     1 
ATOM   747   O  O     . VAL A  1 133  ? 194.343 202.433 222.766 1.00 47.20  ? 127  VAL A O     1 
ATOM   748   C  CB    . VAL A  1 133  ? 194.057 204.961 225.075 1.00 47.20  ? 127  VAL A CB    1 
ATOM   749   C  CG1   . VAL A  1 133  ? 192.797 205.048 224.251 1.00 47.20  ? 127  VAL A CG1   1 
ATOM   750   C  CG2   . VAL A  1 133  ? 193.732 205.070 226.541 1.00 47.20  ? 127  VAL A CG2   1 
ATOM   751   N  N     . GLN A  1 134  ? 195.613 204.282 222.622 1.00 55.82  ? 128  GLN A N     1 
ATOM   752   C  CA    . GLN A  1 134  ? 195.576 204.275 221.166 1.00 55.82  ? 128  GLN A CA    1 
ATOM   753   C  C     . GLN A  1 134  ? 196.256 203.041 220.590 1.00 55.82  ? 128  GLN A C     1 
ATOM   754   O  O     . GLN A  1 134  ? 195.855 202.545 219.533 1.00 55.82  ? 128  GLN A O     1 
ATOM   755   C  CB    . GLN A  1 134  ? 196.203 205.555 220.629 1.00 55.82  ? 128  GLN A CB    1 
ATOM   756   C  CG    . GLN A  1 134  ? 196.181 205.643 219.135 1.00 55.82  ? 128  GLN A CG    1 
ATOM   757   C  CD    . GLN A  1 134  ? 196.558 207.007 218.642 1.00 55.82  ? 128  GLN A CD    1 
ATOM   758   O  OE1   . GLN A  1 134  ? 196.781 207.923 219.427 1.00 55.82  ? 128  GLN A OE1   1 
ATOM   759   N  NE2   . GLN A  1 134  ? 196.640 207.155 217.328 1.00 55.82  ? 128  GLN A NE2   1 
ATOM   760   N  N     . VAL A  1 135  ? 197.275 202.515 221.270 1.00 49.43  ? 129  VAL A N     1 
ATOM   761   C  CA    . VAL A  1 135  ? 197.893 201.273 220.813 1.00 49.43  ? 129  VAL A CA    1 
ATOM   762   C  C     . VAL A  1 135  ? 197.099 200.058 221.261 1.00 49.43  ? 129  VAL A C     1 
ATOM   763   O  O     . VAL A  1 135  ? 197.432 198.929 220.879 1.00 49.43  ? 129  VAL A O     1 
ATOM   764   C  CB    . VAL A  1 135  ? 199.356 201.266 221.293 1.00 49.43  ? 129  VAL A CB    1 
ATOM   765   C  CG1   . VAL A  1 135  ? 200.095 200.037 220.827 1.00 49.43  ? 129  VAL A CG1   1 
ATOM   766   C  CG2   . VAL A  1 135  ? 200.052 202.496 220.793 1.00 49.43  ? 129  VAL A CG2   1 
ATOM   767   N  N     . THR A  1 136  ? 196.031 200.265 222.031 1.00 54.05  ? 130  THR A N     1 
ATOM   768   C  CA    . THR A  1 136  ? 195.137 199.197 222.479 1.00 54.05  ? 130  THR A CA    1 
ATOM   769   C  C     . THR A  1 136  ? 195.839 198.250 223.446 1.00 54.05  ? 130  THR A C     1 
ATOM   770   O  O     . THR A  1 136  ? 195.578 197.046 223.461 1.00 54.05  ? 130  THR A O     1 
ATOM   771   C  CB    . THR A  1 136  ? 194.549 198.413 221.306 1.00 54.05  ? 130  THR A CB    1 
ATOM   772   O  OG1   . THR A  1 136  ? 195.595 197.695 220.644 1.00 54.05  ? 130  THR A OG1   1 
ATOM   773   C  CG2   . THR A  1 136  ? 193.896 199.353 220.318 1.00 54.05  ? 130  THR A CG2   1 
ATOM   774   N  N     . ILE A  1 137  ? 196.733 198.794 224.264 1.00 51.01  ? 131  ILE A N     1 
ATOM   775   C  CA    . ILE A  1 137  ? 197.434 197.981 225.245 1.00 51.01  ? 131  ILE A CA    1 
ATOM   776   C  C     . ILE A  1 137  ? 196.629 197.946 226.532 1.00 51.01  ? 131  ILE A C     1 
ATOM   777   O  O     . ILE A  1 137  ? 196.148 196.887 226.948 1.00 51.01  ? 131  ILE A O     1 
ATOM   778   C  CB    . ILE A  1 137  ? 198.845 198.520 225.502 1.00 51.01  ? 131  ILE A CB    1 
ATOM   779   C  CG1   . ILE A  1 137  ? 199.685 198.411 224.233 1.00 51.01  ? 131  ILE A CG1   1 
ATOM   780   C  CG2   . ILE A  1 137  ? 199.500 197.761 226.619 1.00 51.01  ? 131  ILE A CG2   1 
ATOM   781   C  CD1   . ILE A  1 137  ? 201.006 199.112 224.340 1.00 51.01  ? 131  ILE A CD1   1 
ATOM   782   N  N     . GLY A  1 138  ? 196.463 199.104 227.162 1.00 59.83  ? 132  GLY A N     1 
ATOM   783   C  CA    . GLY A  1 138  ? 195.624 199.203 228.339 1.00 59.83  ? 132  GLY A CA    1 
ATOM   784   C  C     . GLY A  1 138  ? 196.065 198.340 229.498 1.00 59.83  ? 132  GLY A C     1 
ATOM   785   O  O     . GLY A  1 138  ? 195.401 197.349 229.813 1.00 59.83  ? 132  GLY A O     1 
ATOM   786   N  N     . PHE A  1 139  ? 197.189 198.682 230.125 1.00 60.29  ? 133  PHE A N     1 
ATOM   787   C  CA    . PHE A  1 139  ? 197.681 197.892 231.245 1.00 60.29  ? 133  PHE A CA    1 
ATOM   788   C  C     . PHE A  1 139  ? 196.652 197.805 232.361 1.00 60.29  ? 133  PHE A C     1 
ATOM   789   O  O     . PHE A  1 139  ? 196.299 196.705 232.794 1.00 60.29  ? 133  PHE A O     1 
ATOM   790   C  CB    . PHE A  1 139  ? 198.989 198.466 231.779 1.00 60.29  ? 133  PHE A CB    1 
ATOM   791   C  CG    . PHE A  1 139  ? 200.146 198.250 230.866 1.00 60.29  ? 133  PHE A CG    1 
ATOM   792   C  CD1   . PHE A  1 139  ? 200.734 197.008 230.772 1.00 60.29  ? 133  PHE A CD1   1 
ATOM   793   C  CD2   . PHE A  1 139  ? 200.653 199.283 230.111 1.00 60.29  ? 133  PHE A CD2   1 
ATOM   794   C  CE1   . PHE A  1 139  ? 201.794 196.801 229.936 1.00 60.29  ? 133  PHE A CE1   1 
ATOM   795   C  CE2   . PHE A  1 139  ? 201.718 199.083 229.275 1.00 60.29  ? 133  PHE A CE2   1 
ATOM   796   C  CZ    . PHE A  1 139  ? 202.288 197.842 229.185 1.00 60.29  ? 133  PHE A CZ    1 
ATOM   797   N  N     . GLY A  1 140  ? 196.163 198.942 232.834 1.00 63.15  ? 134  GLY A N     1 
ATOM   798   C  CA    . GLY A  1 140  ? 195.102 198.908 233.815 1.00 63.15  ? 134  GLY A CA    1 
ATOM   799   C  C     . GLY A  1 140  ? 195.368 199.752 235.038 1.00 63.15  ? 134  GLY A C     1 
ATOM   800   O  O     . GLY A  1 140  ? 194.434 200.163 235.730 1.00 63.15  ? 134  GLY A O     1 
ATOM   801   N  N     . GLY A  1 141  ? 196.645 200.004 235.324 1.00 65.24  ? 135  GLY A N     1 
ATOM   802   C  CA    . GLY A  1 141  ? 196.987 200.859 236.444 1.00 65.24  ? 135  GLY A CA    1 
ATOM   803   C  C     . GLY A  1 141  ? 196.458 202.266 236.305 1.00 65.24  ? 135  GLY A C     1 
ATOM   804   O  O     . GLY A  1 141  ? 196.254 202.947 237.314 1.00 65.24  ? 135  GLY A O     1 
ATOM   805   N  N     . ARG A  1 142  ? 196.229 202.715 235.080 1.00 61.34  ? 136  ARG A N     1 
ATOM   806   C  CA    . ARG A  1 142  ? 195.657 204.022 234.812 1.00 61.34  ? 136  ARG A CA    1 
ATOM   807   C  C     . ARG A  1 142  ? 194.480 203.841 233.864 1.00 61.34  ? 136  ARG A C     1 
ATOM   808   O  O     . ARG A  1 142  ? 194.662 203.459 232.704 1.00 61.34  ? 136  ARG A O     1 
ATOM   809   C  CB    . ARG A  1 142  ? 196.733 204.965 234.266 1.00 61.34  ? 136  ARG A CB    1 
ATOM   810   C  CG    . ARG A  1 142  ? 197.456 204.470 233.039 1.00 61.34  ? 136  ARG A CG    1 
ATOM   811   C  CD    . ARG A  1 142  ? 198.663 205.333 232.757 1.00 61.34  ? 136  ARG A CD    1 
ATOM   812   N  NE    . ARG A  1 142  ? 199.623 205.221 233.850 1.00 61.34  ? 136  ARG A NE    1 
ATOM   813   C  CZ    . ARG A  1 142  ? 200.541 204.267 233.938 1.00 61.34  ? 136  ARG A CZ    1 
ATOM   814   N  NH1   . ARG A  1 142  ? 200.622 203.341 232.995 1.00 61.34  ? 136  ARG A NH1   1 
ATOM   815   N  NH2   . ARG A  1 142  ? 201.373 204.229 234.964 1.00 61.34  ? 136  ARG A NH2   1 
ATOM   816   N  N     . MET A  1 143  ? 193.275 204.091 234.371 1.00 62.63  ? 137  MET A N     1 
ATOM   817   C  CA    . MET A  1 143  ? 192.062 203.577 233.757 1.00 62.63  ? 137  MET A CA    1 
ATOM   818   C  C     . MET A  1 143  ? 190.963 204.626 233.809 1.00 62.63  ? 137  MET A C     1 
ATOM   819   O  O     . MET A  1 143  ? 190.838 205.367 234.787 1.00 62.63  ? 137  MET A O     1 
ATOM   820   C  CB    . MET A  1 143  ? 191.612 202.299 234.467 1.00 62.63  ? 137  MET A CB    1 
ATOM   821   C  CG    . MET A  1 143  ? 190.334 201.692 233.959 1.00 62.63  ? 137  MET A CG    1 
ATOM   822   S  SD    . MET A  1 143  ? 190.010 200.169 234.854 1.00 62.63  ? 137  MET A SD    1 
ATOM   823   C  CE    . MET A  1 143  ? 189.683 200.811 236.492 1.00 62.63  ? 137  MET A CE    1 
ATOM   824   N  N     . VAL A  1 144  ? 190.160 204.671 232.748 1.00 66.46  ? 138  VAL A N     1 
ATOM   825   C  CA    . VAL A  1 144  ? 189.069 205.635 232.674 1.00 66.46  ? 138  VAL A CA    1 
ATOM   826   C  C     . VAL A  1 144  ? 187.998 205.269 233.688 1.00 66.46  ? 138  VAL A C     1 
ATOM   827   O  O     . VAL A  1 144  ? 187.737 204.089 233.946 1.00 66.46  ? 138  VAL A O     1 
ATOM   828   C  CB    . VAL A  1 144  ? 188.491 205.681 231.252 1.00 66.46  ? 138  VAL A CB    1 
ATOM   829   C  CG1   . VAL A  1 144  ? 187.374 206.696 231.166 1.00 66.46  ? 138  VAL A CG1   1 
ATOM   830   C  CG2   . VAL A  1 144  ? 189.568 206.002 230.261 1.00 66.46  ? 138  VAL A CG2   1 
ATOM   831   N  N     . THR A  1 145  ? 187.374 206.285 234.273 1.00 68.26  ? 139  THR A N     1 
ATOM   832   C  CA    . THR A  1 145  ? 186.344 206.101 235.281 1.00 68.26  ? 139  THR A CA    1 
ATOM   833   C  C     . THR A  1 145  ? 185.089 206.837 234.841 1.00 68.26  ? 139  THR A C     1 
ATOM   834   O  O     . THR A  1 145  ? 185.158 207.747 234.013 1.00 68.26  ? 139  THR A O     1 
ATOM   835   C  CB    . THR A  1 145  ? 186.826 206.622 236.634 1.00 68.26  ? 139  THR A CB    1 
ATOM   836   O  OG1   . THR A  1 145  ? 188.114 206.068 236.914 1.00 68.26  ? 139  THR A OG1   1 
ATOM   837   C  CG2   . THR A  1 145  ? 185.883 206.196 237.746 1.00 68.26  ? 139  THR A CG2   1 
ATOM   838   N  N     . GLU A  1 146  ? 183.944 206.440 235.391 1.00 66.88  ? 140  GLU A N     1 
ATOM   839   C  CA    . GLU A  1 146  ? 182.675 207.080 235.075 1.00 66.88  ? 140  GLU A CA    1 
ATOM   840   C  C     . GLU A  1 146  ? 182.592 208.514 235.566 1.00 66.88  ? 140  GLU A C     1 
ATOM   841   O  O     . GLU A  1 146  ? 181.656 209.223 235.186 1.00 66.88  ? 140  GLU A O     1 
ATOM   842   C  CB    . GLU A  1 146  ? 181.523 206.282 235.684 1.00 66.88  ? 140  GLU A CB    1 
ATOM   843   C  CG    . GLU A  1 146  ? 181.383 204.889 235.129 1.00 66.88  ? 140  GLU A CG    1 
ATOM   844   C  CD    . GLU A  1 146  ? 182.349 203.929 235.776 1.00 66.88  ? 140  GLU A CD    1 
ATOM   845   O  OE1   . GLU A  1 146  ? 183.085 204.358 236.689 1.00 66.88  ? 140  GLU A OE1   1 
ATOM   846   O  OE2   . GLU A  1 146  ? 182.382 202.751 235.372 1.00 66.88  ? 140  GLU A OE2   1 
ATOM   847   N  N     . GLU A  1 147  ? 183.533 208.962 236.391 1.00 80.17  ? 141  GLU A N     1 
ATOM   848   C  CA    . GLU A  1 147  ? 183.403 210.262 237.032 1.00 80.17  ? 141  GLU A CA    1 
ATOM   849   C  C     . GLU A  1 147  ? 183.464 211.423 236.057 1.00 80.17  ? 141  GLU A C     1 
ATOM   850   O  O     . GLU A  1 147  ? 183.144 212.549 236.452 1.00 80.17  ? 141  GLU A O     1 
ATOM   851   C  CB    . GLU A  1 147  ? 184.486 210.420 238.097 1.00 80.17  ? 141  GLU A CB    1 
ATOM   852   C  CG    . GLU A  1 147  ? 184.369 209.417 239.225 1.00 80.17  ? 141  GLU A CG    1 
ATOM   853   C  CD    . GLU A  1 147  ? 183.092 209.583 240.014 1.00 80.17  ? 141  GLU A CD    1 
ATOM   854   O  OE1   . GLU A  1 147  ? 182.609 210.726 240.130 1.00 80.17  ? 141  GLU A OE1   1 
ATOM   855   O  OE2   . GLU A  1 147  ? 182.569 208.568 240.517 1.00 80.17  ? 141  GLU A OE2   1 
ATOM   856   N  N     . CYS A  1 148  ? 183.854 211.193 234.812 1.00 67.51  ? 142  CYS A N     1 
ATOM   857   C  CA    . CYS A  1 148  ? 183.924 212.285 233.854 1.00 67.51  ? 142  CYS A CA    1 
ATOM   858   C  C     . CYS A  1 148  ? 183.400 211.833 232.501 1.00 67.51  ? 142  CYS A C     1 
ATOM   859   O  O     . CYS A  1 148  ? 184.132 211.197 231.731 1.00 67.51  ? 142  CYS A O     1 
ATOM   860   C  CB    . CYS A  1 148  ? 185.359 212.793 233.725 1.00 67.51  ? 142  CYS A CB    1 
ATOM   861   S  SG    . CYS A  1 148  ? 185.996 213.473 235.252 1.00 67.51  ? 142  CYS A SG    1 
ATOM   862   N  N     . PRO A  1 149  ? 182.143 212.133 232.179 1.00 55.06  ? 143  PRO A N     1 
ATOM   863   C  CA    . PRO A  1 149  ? 181.637 211.779 230.849 1.00 55.06  ? 143  PRO A CA    1 
ATOM   864   C  C     . PRO A  1 149  ? 182.404 212.452 229.731 1.00 55.06  ? 143  PRO A C     1 
ATOM   865   O  O     . PRO A  1 149  ? 182.544 211.876 228.644 1.00 55.06  ? 143  PRO A O     1 
ATOM   866   C  CB    . PRO A  1 149  ? 180.179 212.245 230.897 1.00 55.06  ? 143  PRO A CB    1 
ATOM   867   C  CG    . PRO A  1 149  ? 180.172 213.317 231.930 1.00 55.06  ? 143  PRO A CG    1 
ATOM   868   C  CD    . PRO A  1 149  ? 181.174 212.910 232.958 1.00 55.06  ? 143  PRO A CD    1 
ATOM   869   N  N     . LEU A  1 150  ? 182.915 213.656 229.971 1.00 54.82  ? 144  LEU A N     1 
ATOM   870   C  CA    . LEU A  1 150  ? 183.761 214.304 228.982 1.00 54.82  ? 144  LEU A CA    1 
ATOM   871   C  C     . LEU A  1 150  ? 184.992 213.459 228.698 1.00 54.82  ? 144  LEU A C     1 
ATOM   872   O  O     . LEU A  1 150  ? 185.449 213.369 227.552 1.00 54.82  ? 144  LEU A O     1 
ATOM   873   C  CB    . LEU A  1 150  ? 184.147 215.691 229.484 1.00 54.82  ? 144  LEU A CB    1 
ATOM   874   C  CG    . LEU A  1 150  ? 184.607 216.745 228.481 1.00 54.82  ? 144  LEU A CG    1 
ATOM   875   C  CD1   . LEU A  1 150  ? 186.014 216.500 227.975 1.00 54.82  ? 144  LEU A CD1   1 
ATOM   876   C  CD2   . LEU A  1 150  ? 183.623 216.789 227.336 1.00 54.82  ? 144  LEU A CD2   1 
ATOM   877   N  N     . ALA A  1 151  ? 185.537 212.817 229.734 1.00 54.17  ? 145  ALA A N     1 
ATOM   878   C  CA    . ALA A  1 151  ? 186.658 211.911 229.527 1.00 54.17  ? 145  ALA A CA    1 
ATOM   879   C  C     . ALA A  1 151  ? 186.245 210.719 228.684 1.00 54.17  ? 145  ALA A C     1 
ATOM   880   O  O     . ALA A  1 151  ? 187.034 210.210 227.884 1.00 54.17  ? 145  ALA A O     1 
ATOM   881   C  CB    . ALA A  1 151  ? 187.218 211.454 230.870 1.00 54.17  ? 145  ALA A CB    1 
ATOM   882   N  N     . ILE A  1 152  ? 185.005 210.265 228.840 1.00 53.88  ? 146  ILE A N     1 
ATOM   883   C  CA    . ILE A  1 152  ? 184.515 209.184 228.000 1.00 53.88  ? 146  ILE A CA    1 
ATOM   884   C  C     . ILE A  1 152  ? 184.460 209.630 226.550 1.00 53.88  ? 146  ILE A C     1 
ATOM   885   O  O     . ILE A  1 152  ? 184.801 208.871 225.633 1.00 53.88  ? 146  ILE A O     1 
ATOM   886   C  CB    . ILE A  1 152  ? 183.141 208.717 228.498 1.00 53.88  ? 146  ILE A CB    1 
ATOM   887   C  CG1   . ILE A  1 152  ? 183.259 208.205 229.925 1.00 53.88  ? 146  ILE A CG1   1 
ATOM   888   C  CG2   . ILE A  1 152  ? 182.604 207.636 227.605 1.00 53.88  ? 146  ILE A CG2   1 
ATOM   889   C  CD1   . ILE A  1 152  ? 181.937 208.018 230.592 1.00 53.88  ? 146  ILE A CD1   1 
ATOM   890   N  N     . LEU A  1 153  ? 184.021 210.866 226.321 1.00 55.49  ? 147  LEU A N     1 
ATOM   891   C  CA    . LEU A  1 153  ? 184.049 211.411 224.972 1.00 55.49  ? 147  LEU A CA    1 
ATOM   892   C  C     . LEU A  1 153  ? 185.461 211.420 224.417 1.00 55.49  ? 147  LEU A C     1 
ATOM   893   O  O     . LEU A  1 153  ? 185.686 211.029 223.269 1.00 55.49  ? 147  LEU A O     1 
ATOM   894   C  CB    . LEU A  1 153  ? 183.477 212.819 224.958 1.00 55.49  ? 147  LEU A CB    1 
ATOM   895   C  CG    . LEU A  1 153  ? 183.545 213.417 223.560 1.00 55.49  ? 147  LEU A CG    1 
ATOM   896   C  CD1   . LEU A  1 153  ? 182.740 212.562 222.598 1.00 55.49  ? 147  LEU A CD1   1 
ATOM   897   C  CD2   . LEU A  1 153  ? 183.047 214.847 223.563 1.00 55.49  ? 147  LEU A CD2   1 
ATOM   898   N  N     . ILE A  1 154  ? 186.422 211.886 225.211 1.00 52.46  ? 148  ILE A N     1 
ATOM   899   C  CA    . ILE A  1 154  ? 187.806 211.876 224.757 1.00 52.46  ? 148  ILE A CA    1 
ATOM   900   C  C     . ILE A  1 154  ? 188.251 210.467 224.411 1.00 52.46  ? 148  ILE A C     1 
ATOM   901   O  O     . ILE A  1 154  ? 188.948 210.257 223.415 1.00 52.46  ? 148  ILE A O     1 
ATOM   902   C  CB    . ILE A  1 154  ? 188.725 212.506 225.811 1.00 52.46  ? 148  ILE A CB    1 
ATOM   903   C  CG1   . ILE A  1 154  ? 188.475 214.001 225.881 1.00 52.46  ? 148  ILE A CG1   1 
ATOM   904   C  CG2   . ILE A  1 154  ? 190.164 212.280 225.451 1.00 52.46  ? 148  ILE A CG2   1 
ATOM   905   C  CD1   . ILE A  1 154  ? 188.829 214.699 224.595 1.00 52.46  ? 148  ILE A CD1   1 
ATOM   906   N  N     . LEU A  1 155  ? 187.874 209.485 225.225 1.00 47.97  ? 149  LEU A N     1 
ATOM   907   C  CA    . LEU A  1 155  ? 188.235 208.106 224.927 1.00 47.97  ? 149  LEU A CA    1 
ATOM   908   C  C     . LEU A  1 155  ? 187.683 207.672 223.580 1.00 47.97  ? 149  LEU A C     1 
ATOM   909   O  O     . LEU A  1 155  ? 188.406 207.089 222.762 1.00 47.97  ? 149  LEU A O     1 
ATOM   910   C  CB    . LEU A  1 155  ? 187.720 207.186 226.023 1.00 47.97  ? 149  LEU A CB    1 
ATOM   911   C  CG    . LEU A  1 155  ? 188.037 205.727 225.738 1.00 47.97  ? 149  LEU A CG    1 
ATOM   912   C  CD1   . LEU A  1 155  ? 189.528 205.551 225.665 1.00 47.97  ? 149  LEU A CD1   1 
ATOM   913   C  CD2   . LEU A  1 155  ? 187.444 204.844 226.805 1.00 47.97  ? 149  LEU A CD2   1 
ATOM   914   N  N     . ILE A  1 156  ? 186.398 207.928 223.346 1.00 52.41  ? 150  ILE A N     1 
ATOM   915   C  CA    . ILE A  1 156  ? 185.785 207.556 222.076 1.00 52.41  ? 150  ILE A CA    1 
ATOM   916   C  C     . ILE A  1 156  ? 186.513 208.229 220.926 1.00 52.41  ? 150  ILE A C     1 
ATOM   917   O  O     . ILE A  1 156  ? 186.818 207.603 219.901 1.00 52.41  ? 150  ILE A O     1 
ATOM   918   C  CB    . ILE A  1 156  ? 184.293 207.920 222.074 1.00 52.41  ? 150  ILE A CB    1 
ATOM   919   C  CG1   . ILE A  1 156  ? 183.545 207.090 223.109 1.00 52.41  ? 150  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A  1 156  ? 183.700 207.711 220.708 1.00 52.41  ? 150  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A  1 156  ? 182.139 207.545 223.321 1.00 52.41  ? 150  ILE A CD1   1 
ATOM   922   N  N     . VAL A  1 157  ? 186.801 209.517 221.086 1.00 54.61  ? 151  VAL A N     1 
ATOM   923   C  CA    . VAL A  1 157  ? 187.472 210.268 220.039 1.00 54.61  ? 151  VAL A CA    1 
ATOM   924   C  C     . VAL A  1 157  ? 188.826 209.659 219.735 1.00 54.61  ? 151  VAL A C     1 
ATOM   925   O  O     . VAL A  1 157  ? 189.188 209.466 218.569 1.00 54.61  ? 151  VAL A O     1 
ATOM   926   C  CB    . VAL A  1 157  ? 187.603 211.742 220.446 1.00 54.61  ? 151  VAL A CB    1 
ATOM   927   C  CG1   . VAL A  1 157  ? 188.468 212.469 219.452 1.00 54.61  ? 151  VAL A CG1   1 
ATOM   928   C  CG2   . VAL A  1 157  ? 186.240 212.373 220.511 1.00 54.61  ? 151  VAL A CG2   1 
ATOM   929   N  N     . GLN A  1 158  ? 189.599 209.347 220.771 1.00 55.49  ? 152  GLN A N     1 
ATOM   930   C  CA    . GLN A  1 158  ? 190.941 208.851 220.520 1.00 55.49  ? 152  GLN A CA    1 
ATOM   931   C  C     . GLN A  1 158  ? 190.895 207.466 219.908 1.00 55.49  ? 152  GLN A C     1 
ATOM   932   O  O     . GLN A  1 158  ? 191.729 207.134 219.066 1.00 55.49  ? 152  GLN A O     1 
ATOM   933   C  CB    . GLN A  1 158  ? 191.782 208.848 221.791 1.00 55.49  ? 152  GLN A CB    1 
ATOM   934   C  CG    . GLN A  1 158  ? 193.224 208.475 221.494 1.00 55.49  ? 152  GLN A CG    1 
ATOM   935   C  CD    . GLN A  1 158  ? 194.142 208.631 222.674 1.00 55.49  ? 152  GLN A CD    1 
ATOM   936   O  OE1   . GLN A  1 158  ? 193.709 208.963 223.773 1.00 55.49  ? 152  GLN A OE1   1 
ATOM   937   N  NE2   . GLN A  1 158  ? 195.426 208.413 222.448 1.00 55.49  ? 152  GLN A NE2   1 
ATOM   938   N  N     . ASN A  1 159  ? 189.913 206.652 220.285 1.00 54.43  ? 153  ASN A N     1 
ATOM   939   C  CA    . ASN A  1 159  ? 189.818 205.332 219.675 1.00 54.43  ? 153  ASN A CA    1 
ATOM   940   C  C     . ASN A  1 159  ? 189.464 205.430 218.203 1.00 54.43  ? 153  ASN A C     1 
ATOM   941   O  O     . ASN A  1 159  ? 190.057 204.738 217.368 1.00 54.43  ? 153  ASN A O     1 
ATOM   942   C  CB    . ASN A  1 159  ? 188.797 204.487 220.416 1.00 54.43  ? 153  ASN A CB    1 
ATOM   943   C  CG    . ASN A  1 159  ? 189.306 204.032 221.751 1.00 54.43  ? 153  ASN A CG    1 
ATOM   944   O  OD1   . ASN A  1 159  ? 190.456 203.623 221.876 1.00 54.43  ? 153  ASN A OD1   1 
ATOM   945   N  ND2   . ASN A  1 159  ? 188.461 204.113 222.763 1.00 54.43  ? 153  ASN A ND2   1 
ATOM   946   N  N     . ILE A  1 160  ? 188.505 206.290 217.863 1.00 66.54  ? 154  ILE A N     1 
ATOM   947   C  CA    . ILE A  1 160  ? 188.125 206.457 216.463 1.00 66.54  ? 154  ILE A CA    1 
ATOM   948   C  C     . ILE A  1 160  ? 189.303 206.976 215.655 1.00 66.54  ? 154  ILE A C     1 
ATOM   949   O  O     . ILE A  1 160  ? 189.613 206.467 214.572 1.00 66.54  ? 154  ILE A O     1 
ATOM   950   C  CB    . ILE A  1 160  ? 186.916 207.392 216.344 1.00 66.54  ? 154  ILE A CB    1 
ATOM   951   C  CG1   . ILE A  1 160  ? 185.669 206.712 216.893 1.00 66.54  ? 154  ILE A CG1   1 
ATOM   952   C  CG2   . ILE A  1 160  ? 186.732 207.827 214.912 1.00 66.54  ? 154  ILE A CG2   1 
ATOM   953   C  CD1   . ILE A  1 160  ? 184.506 207.640 217.036 1.00 66.54  ? 154  ILE A CD1   1 
ATOM   954   N  N     . VAL A  1 161  ? 189.960 208.016 216.163 1.00 66.03  ? 155  VAL A N     1 
ATOM   955   C  CA    . VAL A  1 161  ? 191.115 208.559 215.467 1.00 66.03  ? 155  VAL A CA    1 
ATOM   956   C  C     . VAL A  1 161  ? 192.206 207.514 215.338 1.00 66.03  ? 155  VAL A C     1 
ATOM   957   O  O     . VAL A  1 161  ? 192.855 207.413 214.293 1.00 66.03  ? 155  VAL A O     1 
ATOM   958   C  CB    . VAL A  1 161  ? 191.621 209.815 216.191 1.00 66.03  ? 155  VAL A CB    1 
ATOM   959   C  CG1   . VAL A  1 161  ? 192.905 210.295 215.568 1.00 66.03  ? 155  VAL A CG1   1 
ATOM   960   C  CG2   . VAL A  1 161  ? 190.571 210.893 216.125 1.00 66.03  ? 155  VAL A CG2   1 
ATOM   961   N  N     . GLY A  1 162  ? 192.427 206.718 216.382 1.00 67.45  ? 156  GLY A N     1 
ATOM   962   C  CA    . GLY A  1 162  ? 193.451 205.695 216.309 1.00 67.45  ? 156  GLY A CA    1 
ATOM   963   C  C     . GLY A  1 162  ? 193.152 204.669 215.241 1.00 67.45  ? 156  GLY A C     1 
ATOM   964   O  O     . GLY A  1 162  ? 194.034 204.279 214.476 1.00 67.45  ? 156  GLY A O     1 
ATOM   965   N  N     . LEU A  1 163  ? 191.897 204.237 215.152 1.00 73.75  ? 157  LEU A N     1 
ATOM   966   C  CA    . LEU A  1 163  ? 191.559 203.261 214.125 1.00 73.75  ? 157  LEU A CA    1 
ATOM   967   C  C     . LEU A  1 163  ? 191.685 203.857 212.733 1.00 73.75  ? 157  LEU A C     1 
ATOM   968   O  O     . LEU A  1 163  ? 192.205 203.207 211.820 1.00 73.75  ? 157  LEU A O     1 
ATOM   969   C  CB    . LEU A  1 163  ? 190.158 202.713 214.357 1.00 73.75  ? 157  LEU A CB    1 
ATOM   970   C  CG    . LEU A  1 163  ? 190.129 201.858 215.617 1.00 73.75  ? 157  LEU A CG    1 
ATOM   971   C  CD1   . LEU A  1 163  ? 188.743 201.302 215.888 1.00 73.75  ? 157  LEU A CD1   1 
ATOM   972   C  CD2   . LEU A  1 163  ? 191.153 200.746 215.501 1.00 73.75  ? 157  LEU A CD2   1 
ATOM   973   N  N     . MET A  1 164  ? 191.234 205.097 212.553 1.00 84.50  ? 158  MET A N     1 
ATOM   974   C  CA    . MET A  1 164  ? 191.335 205.728 211.242 1.00 84.50  ? 158  MET A CA    1 
ATOM   975   C  C     . MET A  1 164  ? 192.787 205.883 210.819 1.00 84.50  ? 158  MET A C     1 
ATOM   976   O  O     . MET A  1 164  ? 193.164 205.510 209.701 1.00 84.50  ? 158  MET A O     1 
ATOM   977   C  CB    . MET A  1 164  ? 190.629 207.081 211.262 1.00 84.50  ? 158  MET A CB    1 
ATOM   978   C  CG    . MET A  1 164  ? 189.111 206.996 211.351 1.00 84.50  ? 158  MET A CG    1 
ATOM   979   S  SD    . MET A  1 164  ? 188.363 206.250 209.886 1.00 84.50  ? 158  MET A SD    1 
ATOM   980   C  CE    . MET A  1 164  ? 187.933 204.620 210.484 1.00 84.50  ? 158  MET A CE    1 
ATOM   981   N  N     . ILE A  1 165  ? 193.621 206.424 211.705 1.00 78.11  ? 159  ILE A N     1 
ATOM   982   C  CA    . ILE A  1 165  ? 195.018 206.620 211.359 1.00 78.11  ? 159  ILE A CA    1 
ATOM   983   C  C     . ILE A  1 165  ? 195.705 205.286 211.157 1.00 78.11  ? 159  ILE A C     1 
ATOM   984   O  O     . ILE A  1 165  ? 196.563 205.152 210.281 1.00 78.11  ? 159  ILE A O     1 
ATOM   985   C  CB    . ILE A  1 165  ? 195.728 207.468 212.429 1.00 78.11  ? 159  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1 165  ? 197.124 207.842 211.957 1.00 78.11  ? 159  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1 165  ? 195.844 206.728 213.731 1.00 78.11  ? 159  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1 165  ? 197.780 208.869 212.821 1.00 78.11  ? 159  ILE A CD1   1 
ATOM   989   N  N     . ASN A  1 166  ? 195.329 204.268 211.925 1.00 78.01  ? 160  ASN A N     1 
ATOM   990   C  CA    . ASN A  1 166  ? 195.973 202.977 211.769 1.00 78.01  ? 160  ASN A CA    1 
ATOM   991   C  C     . ASN A  1 166  ? 195.637 202.373 210.417 1.00 78.01  ? 160  ASN A C     1 
ATOM   992   O  O     . ASN A  1 166  ? 196.519 201.857 209.726 1.00 78.01  ? 160  ASN A O     1 
ATOM   993   C  CB    . ASN A  1 166  ? 195.551 202.054 212.906 1.00 78.01  ? 160  ASN A CB    1 
ATOM   994   C  CG    . ASN A  1 166  ? 196.382 200.806 212.972 1.00 78.01  ? 160  ASN A CG    1 
ATOM   995   O  OD1   . ASN A  1 166  ? 197.266 200.597 212.147 1.00 78.01  ? 160  ASN A OD1   1 
ATOM   996   N  ND2   . ASN A  1 166  ? 196.112 199.965 213.957 1.00 78.01  ? 160  ASN A ND2   1 
ATOM   997   N  N     . ALA A  1 167  ? 194.371 202.457 210.013 1.00 87.18  ? 161  ALA A N     1 
ATOM   998   C  CA    . ALA A  1 167  ? 193.984 201.926 208.713 1.00 87.18  ? 161  ALA A CA    1 
ATOM   999   C  C     . ALA A  1 167  ? 194.654 202.691 207.586 1.00 87.18  ? 161  ALA A C     1 
ATOM   1000  O  O     . ALA A  1 167  ? 195.061 202.095 206.586 1.00 87.18  ? 161  ALA A O     1 
ATOM   1001  C  CB    . ALA A  1 167  ? 192.467 201.966 208.559 1.00 87.18  ? 161  ALA A CB    1 
ATOM   1002  N  N     . ILE A  1 168  ? 194.776 204.010 207.719 1.00 90.84  ? 162  ILE A N     1 
ATOM   1003  C  CA    . ILE A  1 168  ? 195.457 204.779 206.684 1.00 90.84  ? 162  ILE A CA    1 
ATOM   1004  C  C     . ILE A  1 168  ? 196.912 204.347 206.574 1.00 90.84  ? 162  ILE A C     1 
ATOM   1005  O  O     . ILE A  1 168  ? 197.415 204.074 205.477 1.00 90.84  ? 162  ILE A O     1 
ATOM   1006  C  CB    . ILE A  1 168  ? 195.334 206.285 206.962 1.00 90.84  ? 162  ILE A CB    1 
ATOM   1007  C  CG1   . ILE A  1 168  ? 193.886 206.737 206.799 1.00 90.84  ? 162  ILE A CG1   1 
ATOM   1008  C  CG2   . ILE A  1 168  ? 196.233 207.062 206.039 1.00 90.84  ? 162  ILE A CG2   1 
ATOM   1009  C  CD1   . ILE A  1 168  ? 193.357 206.556 205.399 1.00 90.84  ? 162  ILE A CD1   1 
ATOM   1010  N  N     . MET A  1 169  ? 197.610 204.283 207.710 1.00 102.83 ? 163  MET A N     1 
ATOM   1011  C  CA    . MET A  1 169  ? 199.003 203.861 207.685 1.00 102.83 ? 163  MET A CA    1 
ATOM   1012  C  C     . MET A  1 169  ? 199.143 202.474 207.094 1.00 102.83 ? 163  MET A C     1 
ATOM   1013  O  O     . MET A  1 169  ? 200.092 202.207 206.356 1.00 102.83 ? 163  MET A O     1 
ATOM   1014  C  CB    . MET A  1 169  ? 199.585 203.871 209.093 1.00 102.83 ? 163  MET A CB    1 
ATOM   1015  C  CG    . MET A  1 169  ? 199.496 205.202 209.811 1.00 102.83 ? 163  MET A CG    1 
ATOM   1016  S  SD    . MET A  1 169  ? 200.348 206.571 209.026 1.00 102.83 ? 163  MET A SD    1 
ATOM   1017  C  CE    . MET A  1 169  ? 198.981 207.461 208.280 1.00 102.83 ? 163  MET A CE    1 
ATOM   1018  N  N     . LEU A  1 170  ? 198.197 201.584 207.385 1.00 100.36 ? 164  LEU A N     1 
ATOM   1019  C  CA    . LEU A  1 170  ? 198.340 200.205 206.941 1.00 100.36 ? 164  LEU A CA    1 
ATOM   1020  C  C     . LEU A  1 170  ? 198.021 200.069 205.461 1.00 100.36 ? 164  LEU A C     1 
ATOM   1021  O  O     . LEU A  1 170  ? 198.677 199.303 204.752 1.00 100.36 ? 164  LEU A O     1 
ATOM   1022  C  CB    . LEU A  1 170  ? 197.453 199.300 207.791 1.00 100.36 ? 164  LEU A CB    1 
ATOM   1023  C  CG    . LEU A  1 170  ? 197.668 197.795 207.682 1.00 100.36 ? 164  LEU A CG    1 
ATOM   1024  C  CD1   . LEU A  1 170  ? 197.346 197.167 209.008 1.00 100.36 ? 164  LEU A CD1   1 
ATOM   1025  C  CD2   . LEU A  1 170  ? 196.778 197.214 206.614 1.00 100.36 ? 164  LEU A CD2   1 
ATOM   1026  N  N     . GLY A  1 171  ? 197.033 200.811 204.969 1.00 99.28  ? 165  GLY A N     1 
ATOM   1027  C  CA    . GLY A  1 171  ? 196.787 200.830 203.540 1.00 99.28  ? 165  GLY A CA    1 
ATOM   1028  C  C     . GLY A  1 171  ? 197.964 201.394 202.770 1.00 99.28  ? 165  GLY A C     1 
ATOM   1029  O  O     . GLY A  1 171  ? 198.337 200.875 201.711 1.00 99.28  ? 165  GLY A O     1 
ATOM   1030  N  N     . CYS A  1 172  ? 198.574 202.457 203.295 1.00 103.56 ? 166  CYS A N     1 
ATOM   1031  C  CA    . CYS A  1 172  ? 199.753 203.012 202.645 1.00 103.56 ? 166  CYS A CA    1 
ATOM   1032  C  C     . CYS A  1 172  ? 200.907 202.021 202.661 1.00 103.56 ? 166  CYS A C     1 
ATOM   1033  O  O     . CYS A  1 172  ? 201.565 201.808 201.638 1.00 103.56 ? 166  CYS A O     1 
ATOM   1034  C  CB    . CYS A  1 172  ? 200.159 204.319 203.314 1.00 103.56 ? 166  CYS A CB    1 
ATOM   1035  S  SG    . CYS A  1 172  ? 199.033 205.691 203.011 1.00 103.56 ? 166  CYS A SG    1 
ATOM   1036  N  N     . ILE A  1 173  ? 201.176 201.408 203.816 1.00 107.81 ? 167  ILE A N     1 
ATOM   1037  C  CA    . ILE A  1 173  ? 202.260 200.434 203.898 1.00 107.81 ? 167  ILE A CA    1 
ATOM   1038  C  C     . ILE A  1 173  ? 201.997 199.269 202.960 1.00 107.81 ? 167  ILE A C     1 
ATOM   1039  O  O     . ILE A  1 173  ? 202.921 198.723 202.350 1.00 107.81 ? 167  ILE A O     1 
ATOM   1040  C  CB    . ILE A  1 173  ? 202.457 199.959 205.348 1.00 107.81 ? 167  ILE A CB    1 
ATOM   1041  C  CG1   . ILE A  1 173  ? 203.019 201.086 206.206 1.00 107.81 ? 167  ILE A CG1   1 
ATOM   1042  C  CG2   . ILE A  1 173  ? 203.411 198.787 205.390 1.00 107.81 ? 167  ILE A CG2   1 
ATOM   1043  C  CD1   . ILE A  1 173  ? 204.421 201.475 205.819 1.00 107.81 ? 167  ILE A CD1   1 
ATOM   1044  N  N     . PHE A  1 174  ? 200.734 198.874 202.814 1.00 114.13 ? 168  PHE A N     1 
ATOM   1045  C  CA    . PHE A  1 174  ? 200.437 197.807 201.870 1.00 114.13 ? 168  PHE A CA    1 
ATOM   1046  C  C     . PHE A  1 174  ? 200.762 198.237 200.451 1.00 114.13 ? 168  PHE A C     1 
ATOM   1047  O  O     . PHE A  1 174  ? 201.625 197.651 199.788 1.00 114.13 ? 168  PHE A O     1 
ATOM   1048  C  CB    . PHE A  1 174  ? 198.982 197.370 201.944 1.00 114.13 ? 168  PHE A CB    1 
ATOM   1049  C  CG    . PHE A  1 174  ? 198.679 196.254 200.998 1.00 114.13 ? 168  PHE A CG    1 
ATOM   1050  C  CD1   . PHE A  1 174  ? 198.934 194.947 201.353 1.00 114.13 ? 168  PHE A CD1   1 
ATOM   1051  C  CD2   . PHE A  1 174  ? 198.264 196.520 199.712 1.00 114.13 ? 168  PHE A CD2   1 
ATOM   1052  C  CE1   . PHE A  1 174  ? 198.702 193.928 200.464 1.00 114.13 ? 168  PHE A CE1   1 
ATOM   1053  C  CE2   . PHE A  1 174  ? 198.022 195.515 198.821 1.00 114.13 ? 168  PHE A CE2   1 
ATOM   1054  C  CZ    . PHE A  1 174  ? 198.248 194.218 199.188 1.00 114.13 ? 168  PHE A CZ    1 
ATOM   1055  N  N     . MET A  1 175  ? 200.067 199.254 199.958 1.00 110.31 ? 169  MET A N     1 
ATOM   1056  C  CA    . MET A  1 175  ? 200.298 199.621 198.571 1.00 110.31 ? 169  MET A CA    1 
ATOM   1057  C  C     . MET A  1 175  ? 201.729 200.047 198.317 1.00 110.31 ? 169  MET A C     1 
ATOM   1058  O  O     . MET A  1 175  ? 202.136 200.117 197.155 1.00 110.31 ? 169  MET A O     1 
ATOM   1059  C  CB    . MET A  1 175  ? 199.332 200.723 198.144 1.00 110.31 ? 169  MET A CB    1 
ATOM   1060  C  CG    . MET A  1 175  ? 199.475 202.019 198.901 1.00 110.31 ? 169  MET A CG    1 
ATOM   1061  S  SD    . MET A  1 175  ? 198.171 203.158 198.414 1.00 110.31 ? 169  MET A SD    1 
ATOM   1062  C  CE    . MET A  1 175  ? 196.768 202.354 199.170 1.00 110.31 ? 169  MET A CE    1 
ATOM   1063  N  N     . LYS A  1 176  ? 202.512 200.301 199.358 1.00 112.38 ? 170  LYS A N     1 
ATOM   1064  C  CA    . LYS A  1 176  ? 203.928 200.538 199.150 1.00 112.38 ? 170  LYS A CA    1 
ATOM   1065  C  C     . LYS A  1 176  ? 204.715 199.242 199.086 1.00 112.38 ? 170  LYS A C     1 
ATOM   1066  O  O     . LYS A  1 176  ? 205.614 199.116 198.255 1.00 112.38 ? 170  LYS A O     1 
ATOM   1067  C  CB    . LYS A  1 176  ? 204.493 201.420 200.263 1.00 112.38 ? 170  LYS A CB    1 
ATOM   1068  C  CG    . LYS A  1 176  ? 205.889 201.934 199.967 1.00 112.38 ? 170  LYS A CG    1 
ATOM   1069  C  CD    . LYS A  1 176  ? 206.359 202.885 201.041 1.00 112.38 ? 170  LYS A CD    1 
ATOM   1070  C  CE    . LYS A  1 176  ? 207.755 203.440 200.744 1.00 112.38 ? 170  LYS A CE    1 
ATOM   1071  N  NZ    . LYS A  1 176  ? 207.814 204.284 199.495 1.00 112.38 ? 170  LYS A NZ    1 
ATOM   1072  N  N     . THR A  1 177  ? 204.400 198.268 199.935 1.00 122.61 ? 171  THR A N     1 
ATOM   1073  C  CA    . THR A  1 177  ? 205.079 196.985 199.893 1.00 122.61 ? 171  THR A CA    1 
ATOM   1074  C  C     . THR A  1 177  ? 204.660 196.146 198.698 1.00 122.61 ? 171  THR A C     1 
ATOM   1075  O  O     . THR A  1 177  ? 205.394 195.234 198.317 1.00 122.61 ? 171  THR A O     1 
ATOM   1076  C  CB    . THR A  1 177  ? 204.843 196.195 201.191 1.00 122.61 ? 171  THR A CB    1 
ATOM   1077  O  OG1   . THR A  1 177  ? 205.684 195.039 201.209 1.00 122.61 ? 171  THR A OG1   1 
ATOM   1078  C  CG2   . THR A  1 177  ? 203.406 195.743 201.312 1.00 122.61 ? 171  THR A CG2   1 
ATOM   1079  N  N     . ALA A  1 178  ? 203.505 196.429 198.103 1.00 122.89 ? 172  ALA A N     1 
ATOM   1080  C  CA    . ALA A  1 178  ? 203.161 195.846 196.816 1.00 122.89 ? 172  ALA A CA    1 
ATOM   1081  C  C     . ALA A  1 178  ? 203.723 196.648 195.654 1.00 122.89 ? 172  ALA A C     1 
ATOM   1082  O  O     . ALA A  1 178  ? 203.202 196.542 194.538 1.00 122.89 ? 172  ALA A O     1 
ATOM   1083  C  CB    . ALA A  1 178  ? 201.645 195.724 196.670 1.00 122.89 ? 172  ALA A CB    1 
ATOM   1084  N  N     . GLN A  1 179  ? 204.753 197.455 195.893 1.00 123.66 ? 173  GLN A N     1 
ATOM   1085  C  CA    . GLN A  1 179  ? 205.281 198.327 194.857 1.00 123.66 ? 173  GLN A CA    1 
ATOM   1086  C  C     . GLN A  1 179  ? 205.867 197.519 193.710 1.00 123.66 ? 173  GLN A C     1 
ATOM   1087  O  O     . GLN A  1 179  ? 206.380 196.413 193.897 1.00 123.66 ? 173  GLN A O     1 
ATOM   1088  C  CB    . GLN A  1 179  ? 206.349 199.251 195.441 1.00 123.66 ? 173  GLN A CB    1 
ATOM   1089  C  CG    . GLN A  1 179  ? 206.875 200.297 194.492 1.00 123.66 ? 173  GLN A CG    1 
ATOM   1090  C  CD    . GLN A  1 179  ? 205.785 201.216 194.002 1.00 123.66 ? 173  GLN A CD    1 
ATOM   1091  O  OE1   . GLN A  1 179  ? 205.364 201.135 192.852 1.00 123.66 ? 173  GLN A OE1   1 
ATOM   1092  N  NE2   . GLN A  1 179  ? 205.311 202.089 194.879 1.00 123.66 ? 173  GLN A NE2   1 
ATOM   1093  N  N     . ALA A  1 180  ? 205.768 198.090 192.516 1.00 131.48 ? 174  ALA A N     1 
ATOM   1094  C  CA    . ALA A  1 180  ? 206.424 197.599 191.318 1.00 131.48 ? 174  ALA A CA    1 
ATOM   1095  C  C     . ALA A  1 180  ? 207.792 198.264 191.165 1.00 131.48 ? 174  ALA A C     1 
ATOM   1096  O  O     . ALA A  1 180  ? 208.386 198.758 192.123 1.00 131.48 ? 174  ALA A O     1 
ATOM   1097  C  CB    . ALA A  1 180  ? 205.549 197.844 190.093 1.00 131.48 ? 174  ALA A CB    1 
ATOM   1098  N  N     . HIS A  1 181  ? 208.327 198.188 189.951 1.00 135.61 ? 175  HIS A N     1 
ATOM   1099  C  CA    . HIS A  1 181  ? 209.584 198.727 189.441 1.00 135.61 ? 175  HIS A CA    1 
ATOM   1100  C  C     . HIS A  1 181  ? 210.783 198.181 190.195 1.00 135.61 ? 175  HIS A C     1 
ATOM   1101  O  O     . HIS A  1 181  ? 211.906 198.587 189.905 1.00 135.61 ? 175  HIS A O     1 
ATOM   1102  C  CB    . HIS A  1 181  ? 209.654 200.269 189.423 1.00 135.61 ? 175  HIS A CB    1 
ATOM   1103  C  CG    . HIS A  1 181  ? 209.751 200.903 190.774 1.00 135.61 ? 175  HIS A CG    1 
ATOM   1104  N  ND1   . HIS A  1 181  ? 210.932 200.967 191.482 1.00 135.61 ? 175  HIS A ND1   1 
ATOM   1105  C  CD2   . HIS A  1 181  ? 208.831 201.564 191.515 1.00 135.61 ? 175  HIS A CD2   1 
ATOM   1106  C  CE1   . HIS A  1 181  ? 210.725 201.601 192.621 1.00 135.61 ? 175  HIS A CE1   1 
ATOM   1107  N  NE2   . HIS A  1 181  ? 209.459 201.975 192.666 1.00 135.61 ? 175  HIS A NE2   1 
ATOM   1108  N  N     . ARG A  1 182  ? 210.594 197.283 191.154 1.00 127.98 ? 176  ARG A N     1 
ATOM   1109  C  CA    . ARG A  1 182  ? 211.699 196.438 191.575 1.00 127.98 ? 176  ARG A CA    1 
ATOM   1110  C  C     . ARG A  1 182  ? 212.025 195.427 190.490 1.00 127.98 ? 176  ARG A C     1 
ATOM   1111  O  O     . ARG A  1 182  ? 213.198 195.137 190.228 1.00 127.98 ? 176  ARG A O     1 
ATOM   1112  C  CB    . ARG A  1 182  ? 211.354 195.736 192.884 1.00 127.98 ? 176  ARG A CB    1 
ATOM   1113  N  N     . ARG A  1 183  ? 210.993 194.891 189.836 1.00 129.67 ? 177  ARG A N     1 
ATOM   1114  C  CA    . ARG A  1 183  ? 211.218 194.015 188.696 1.00 129.67 ? 177  ARG A CA    1 
ATOM   1115  C  C     . ARG A  1 183  ? 211.706 194.795 187.483 1.00 129.67 ? 177  ARG A C     1 
ATOM   1116  O  O     . ARG A  1 183  ? 212.561 194.308 186.736 1.00 129.67 ? 177  ARG A O     1 
ATOM   1117  C  CB    . ARG A  1 183  ? 209.934 193.263 188.354 1.00 129.67 ? 177  ARG A CB    1 
ATOM   1118  C  CG    . ARG A  1 183  ? 210.075 192.354 187.158 1.00 129.67 ? 177  ARG A CG    1 
ATOM   1119  C  CD    . ARG A  1 183  ? 211.040 191.228 187.464 1.00 129.67 ? 177  ARG A CD    1 
ATOM   1120  N  NE    . ARG A  1 183  ? 211.261 190.367 186.309 1.00 129.67 ? 177  ARG A NE    1 
ATOM   1121  C  CZ    . ARG A  1 183  ? 210.498 189.324 186.011 1.00 129.67 ? 177  ARG A CZ    1 
ATOM   1122  N  NH1   . ARG A  1 183  ? 209.464 189.025 186.782 1.00 129.67 ? 177  ARG A NH1   1 
ATOM   1123  N  NH2   . ARG A  1 183  ? 210.761 188.583 184.946 1.00 129.67 ? 177  ARG A NH2   1 
ATOM   1124  N  N     . ALA A  1 184  ? 211.192 196.013 187.282 1.00 124.89 ? 178  ALA A N     1 
ATOM   1125  C  CA    . ALA A  1 184  ? 211.539 196.809 186.110 1.00 124.89 ? 178  ALA A CA    1 
ATOM   1126  C  C     . ALA A  1 184  ? 213.022 197.134 186.029 1.00 124.89 ? 178  ALA A C     1 
ATOM   1127  O  O     . ALA A  1 184  ? 213.474 197.631 184.993 1.00 124.89 ? 178  ALA A O     1 
ATOM   1128  C  CB    . ALA A  1 184  ? 210.734 198.103 186.102 1.00 124.89 ? 178  ALA A CB    1 
ATOM   1129  N  N     . GLU A  1 185  ? 213.785 196.885 187.088 1.00 129.84 ? 179  GLU A N     1 
ATOM   1130  C  CA    . GLU A  1 185  ? 215.228 197.047 187.025 1.00 129.84 ? 179  GLU A CA    1 
ATOM   1131  C  C     . GLU A  1 185  ? 215.921 195.798 186.520 1.00 129.84 ? 179  GLU A C     1 
ATOM   1132  O  O     . GLU A  1 185  ? 217.013 195.892 185.952 1.00 129.84 ? 179  GLU A O     1 
ATOM   1133  C  CB    . GLU A  1 185  ? 215.772 197.412 188.403 1.00 129.84 ? 179  GLU A CB    1 
ATOM   1134  C  CG    . GLU A  1 185  ? 215.323 198.774 188.884 1.00 129.84 ? 179  GLU A CG    1 
ATOM   1135  C  CD    . GLU A  1 185  ? 215.929 199.894 188.072 1.00 129.84 ? 179  GLU A CD    1 
ATOM   1136  O  OE1   . GLU A  1 185  ? 217.086 199.748 187.632 1.00 129.84 ? 179  GLU A OE1   1 
ATOM   1137  O  OE2   . GLU A  1 185  ? 215.248 200.917 187.866 1.00 129.84 ? 179  GLU A OE2   1 
ATOM   1138  N  N     . THR A  1 186  ? 215.312 194.630 186.714 1.00 129.14 ? 180  THR A N     1 
ATOM   1139  C  CA    . THR A  1 186  ? 215.905 193.389 186.231 1.00 129.14 ? 180  THR A CA    1 
ATOM   1140  C  C     . THR A  1 186  ? 215.729 193.225 184.728 1.00 129.14 ? 180  THR A C     1 
ATOM   1141  O  O     . THR A  1 186  ? 216.469 192.463 184.100 1.00 129.14 ? 180  THR A O     1 
ATOM   1142  C  CB    . THR A  1 186  ? 215.287 192.199 186.958 1.00 129.14 ? 180  THR A CB    1 
ATOM   1143  O  OG1   . THR A  1 186  ? 213.895 192.125 186.638 1.00 129.14 ? 180  THR A OG1   1 
ATOM   1144  C  CG2   . THR A  1 186  ? 215.438 192.372 188.457 1.00 129.14 ? 180  THR A CG2   1 
ATOM   1145  N  N     . LEU A  1 187  ? 214.760 193.918 184.141 1.00 121.59 ? 181  LEU A N     1 
ATOM   1146  C  CA    . LEU A  1 187  ? 214.545 193.846 182.705 1.00 121.59 ? 181  LEU A CA    1 
ATOM   1147  C  C     . LEU A  1 187  ? 215.653 194.604 181.992 1.00 121.59 ? 181  LEU A C     1 
ATOM   1148  O  O     . LEU A  1 187  ? 215.592 195.830 181.870 1.00 121.59 ? 181  LEU A O     1 
ATOM   1149  C  CB    . LEU A  1 187  ? 213.175 194.415 182.349 1.00 121.59 ? 181  LEU A CB    1 
ATOM   1150  C  CG    . LEU A  1 187  ? 212.011 193.649 182.976 1.00 121.59 ? 181  LEU A CG    1 
ATOM   1151  C  CD1   . LEU A  1 187  ? 210.687 194.315 182.657 1.00 121.59 ? 181  LEU A CD1   1 
ATOM   1152  C  CD2   . LEU A  1 187  ? 212.014 192.193 182.530 1.00 121.59 ? 181  LEU A CD2   1 
ATOM   1153  N  N     . ILE A  1 188  ? 216.659 193.897 181.526 1.00 116.57 ? 182  ILE A N     1 
ATOM   1154  C  CA    . ILE A  1 188  ? 217.879 194.537 181.050 1.00 116.57 ? 182  ILE A CA    1 
ATOM   1155  C  C     . ILE A  1 188  ? 217.864 194.675 179.538 1.00 116.57 ? 182  ILE A C     1 
ATOM   1156  O  O     . ILE A  1 188  ? 217.151 193.965 178.820 1.00 116.57 ? 182  ILE A O     1 
ATOM   1157  C  CB    . ILE A  1 188  ? 219.121 193.758 181.514 1.00 116.57 ? 182  ILE A CB    1 
ATOM   1158  C  CG1   . ILE A  1 188  ? 219.051 192.317 181.013 1.00 116.57 ? 182  ILE A CG1   1 
ATOM   1159  C  CG2   . ILE A  1 188  ? 219.252 193.837 183.019 1.00 116.57 ? 182  ILE A CG2   1 
ATOM   1160  C  CD1   . ILE A  1 188  ? 220.345 191.572 181.164 1.00 116.57 ? 182  ILE A CD1   1 
ATOM   1161  N  N     . PHE A  1 189  ? 218.684 195.602 179.052 1.00 106.65 ? 183  PHE A N     1 
ATOM   1162  C  CA    . PHE A  1 189  ? 218.801 195.903 177.638 1.00 106.65 ? 183  PHE A CA    1 
ATOM   1163  C  C     . PHE A  1 189  ? 220.254 196.208 177.321 1.00 106.65 ? 183  PHE A C     1 
ATOM   1164  O  O     . PHE A  1 189  ? 220.883 197.023 178.001 1.00 106.65 ? 183  PHE A O     1 
ATOM   1165  C  CB    . PHE A  1 189  ? 217.936 197.100 177.261 1.00 106.65 ? 183  PHE A CB    1 
ATOM   1166  C  CG    . PHE A  1 189  ? 216.490 196.903 177.551 1.00 106.65 ? 183  PHE A CG    1 
ATOM   1167  C  CD1   . PHE A  1 189  ? 215.698 196.163 176.700 1.00 106.65 ? 183  PHE A CD1   1 
ATOM   1168  C  CD2   . PHE A  1 189  ? 215.925 197.442 178.688 1.00 106.65 ? 183  PHE A CD2   1 
ATOM   1169  C  CE1   . PHE A  1 189  ? 214.368 195.974 176.972 1.00 106.65 ? 183  PHE A CE1   1 
ATOM   1170  C  CE2   . PHE A  1 189  ? 214.595 197.258 178.967 1.00 106.65 ? 183  PHE A CE2   1 
ATOM   1171  C  CZ    . PHE A  1 189  ? 213.812 196.522 178.107 1.00 106.65 ? 183  PHE A CZ    1 
ATOM   1172  N  N     . SER A  1 190  ? 220.779 195.557 176.287 1.00 115.70 ? 184  SER A N     1 
ATOM   1173  C  CA    . SER A  1 190  ? 222.152 195.781 175.875 1.00 115.70 ? 184  SER A CA    1 
ATOM   1174  C  C     . SER A  1 190  ? 222.398 197.267 175.629 1.00 115.70 ? 184  SER A C     1 
ATOM   1175  O  O     . SER A  1 190  ? 221.514 198.012 175.209 1.00 115.70 ? 184  SER A O     1 
ATOM   1176  C  CB    . SER A  1 190  ? 222.465 194.980 174.617 1.00 115.70 ? 184  SER A CB    1 
ATOM   1177  O  OG    . SER A  1 190  ? 221.677 195.431 173.529 1.00 115.70 ? 184  SER A OG    1 
ATOM   1178  N  N     . LYS A  1 191  ? 223.627 197.696 175.904 1.00 114.04 ? 185  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1 191  ? 223.985 199.098 175.748 1.00 114.04 ? 185  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1 191  ? 224.018 199.521 174.285 1.00 114.04 ? 185  LYS A C     1 
ATOM   1181  O  O     . LYS A  1 191  ? 224.098 200.719 173.992 1.00 114.04 ? 185  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1 191  ? 225.336 199.362 176.422 1.00 114.04 ? 185  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1 191  ? 225.767 200.821 176.479 1.00 114.04 ? 185  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1 191  ? 226.966 201.026 177.384 1.00 114.04 ? 185  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1 191  ? 228.228 200.488 176.751 1.00 114.04 ? 185  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1 191  ? 229.426 200.782 177.573 1.00 114.04 ? 185  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1 192  ? 223.920 198.566 173.363 1.00 116.26 ? 186  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1 192  ? 224.043 198.835 171.938 1.00 116.26 ? 186  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1 192  ? 222.933 198.128 171.179 1.00 116.26 ? 186  HIS A C     1 
ATOM   1190  O  O     . HIS A  1 192  ? 222.402 197.116 171.644 1.00 116.26 ? 186  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1 192  ? 225.401 198.380 171.420 1.00 116.26 ? 186  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1 192  ? 226.541 199.103 172.051 1.00 116.26 ? 186  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1 192  ? 227.140 198.667 173.213 1.00 116.26 ? 186  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1 192  ? 227.173 200.247 171.703 1.00 116.26 ? 186  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1 192  ? 228.104 199.505 173.543 1.00 116.26 ? 186  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1 192  ? 228.144 200.473 172.646 1.00 116.26 ? 186  HIS A NE2   1 
ATOM   1197  N  N     . ALA A  1 193  ? 222.585 198.671 170.022 1.00 121.18 ? 187  ALA A N     1 
ATOM   1198  C  CA    . ALA A  1 193  ? 221.689 198.022 169.082 1.00 121.18 ? 187  ALA A CA    1 
ATOM   1199  C  C     . ALA A  1 193  ? 222.393 197.896 167.740 1.00 121.18 ? 187  ALA A C     1 
ATOM   1200  O  O     . ALA A  1 193  ? 223.130 198.800 167.336 1.00 121.18 ? 187  ALA A O     1 
ATOM   1201  C  CB    . ALA A  1 193  ? 220.394 198.812 168.939 1.00 121.18 ? 187  ALA A CB    1 
ATOM   1202  N  N     . VAL A  1 194  ? 222.172 196.779 167.056 1.00 115.59 ? 188  VAL A N     1 
ATOM   1203  C  CA    . VAL A  1 194  ? 222.867 196.495 165.810 1.00 115.59 ? 188  VAL A CA    1 
ATOM   1204  C  C     . VAL A  1 194  ? 221.850 196.404 164.685 1.00 115.59 ? 188  VAL A C     1 
ATOM   1205  O  O     . VAL A  1 194  ? 220.675 196.098 164.905 1.00 115.59 ? 188  VAL A O     1 
ATOM   1206  C  CB    . VAL A  1 194  ? 223.690 195.195 165.896 1.00 115.59 ? 188  VAL A CB    1 
ATOM   1207  C  CG1   . VAL A  1 194  ? 224.625 195.240 167.090 1.00 115.59 ? 188  VAL A CG1   1 
ATOM   1208  C  CG2   . VAL A  1 194  ? 222.777 193.990 165.950 1.00 115.59 ? 188  VAL A CG2   1 
ATOM   1209  N  N     . ILE A  1 195  ? 222.306 196.690 163.476 1.00 117.61 ? 189  ILE A N     1 
ATOM   1210  C  CA    . ILE A  1 195  ? 221.528 196.448 162.268 1.00 117.61 ? 189  ILE A CA    1 
ATOM   1211  C  C     . ILE A  1 195  ? 222.250 195.363 161.488 1.00 117.61 ? 189  ILE A C     1 
ATOM   1212  O  O     . ILE A  1 195  ? 223.465 195.185 161.641 1.00 117.61 ? 189  ILE A O     1 
ATOM   1213  C  CB    . ILE A  1 195  ? 221.370 197.721 161.413 1.00 117.61 ? 189  ILE A CB    1 
ATOM   1214  C  CG1   . ILE A  1 195  ? 220.970 198.911 162.268 1.00 117.61 ? 189  ILE A CG1   1 
ATOM   1215  C  CG2   . ILE A  1 195  ? 220.316 197.525 160.349 1.00 117.61 ? 189  ILE A CG2   1 
ATOM   1216  C  CD1   . ILE A  1 195  ? 222.150 199.757 162.654 1.00 117.61 ? 189  ILE A CD1   1 
ATOM   1217  N  N     . ALA A  1 196  ? 221.515 194.635 160.656 1.00 116.35 ? 190  ALA A N     1 
ATOM   1218  C  CA    . ALA A  1 196  ? 222.121 193.640 159.791 1.00 116.35 ? 190  ALA A CA    1 
ATOM   1219  C  C     . ALA A  1 196  ? 221.157 193.348 158.650 1.00 116.35 ? 190  ALA A C     1 
ATOM   1220  O  O     . ALA A  1 196  ? 220.120 194.004 158.506 1.00 116.35 ? 190  ALA A O     1 
ATOM   1221  C  CB    . ALA A  1 196  ? 222.481 192.375 160.577 1.00 116.35 ? 190  ALA A CB    1 
ATOM   1222  N  N     . LEU A  1 197  ? 221.498 192.352 157.841 1.00 116.01 ? 191  LEU A N     1 
ATOM   1223  C  CA    . LEU A  1 197  ? 220.638 191.887 156.768 1.00 116.01 ? 191  LEU A CA    1 
ATOM   1224  C  C     . LEU A  1 197  ? 219.900 190.641 157.223 1.00 116.01 ? 191  LEU A C     1 
ATOM   1225  O  O     . LEU A  1 197  ? 220.521 189.667 157.660 1.00 116.01 ? 191  LEU A O     1 
ATOM   1226  C  CB    . LEU A  1 197  ? 221.440 191.600 155.500 1.00 116.01 ? 191  LEU A CB    1 
ATOM   1227  C  CG    . LEU A  1 197  ? 221.923 192.876 154.820 1.00 116.01 ? 191  LEU A CG    1 
ATOM   1228  C  CD1   . LEU A  1 197  ? 222.813 192.566 153.626 1.00 116.01 ? 191  LEU A CD1   1 
ATOM   1229  C  CD2   . LEU A  1 197  ? 220.722 193.703 154.404 1.00 116.01 ? 191  LEU A CD2   1 
ATOM   1230  N  N     . ARG A  1 198  ? 218.577 190.689 157.140 1.00 123.96 ? 192  ARG A N     1 
ATOM   1231  C  CA    . ARG A  1 198  ? 217.736 189.529 157.385 1.00 123.96 ? 192  ARG A CA    1 
ATOM   1232  C  C     . ARG A  1 198  ? 216.703 189.460 156.277 1.00 123.96 ? 192  ARG A C     1 
ATOM   1233  O  O     . ARG A  1 198  ? 216.083 190.472 155.946 1.00 123.96 ? 192  ARG A O     1 
ATOM   1234  C  CB    . ARG A  1 198  ? 217.055 189.598 158.757 1.00 123.96 ? 192  ARG A CB    1 
ATOM   1235  C  CG    . ARG A  1 198  ? 216.078 188.459 158.992 1.00 123.96 ? 192  ARG A CG    1 
ATOM   1236  C  CD    . ARG A  1 198  ? 215.543 188.423 160.414 1.00 123.96 ? 192  ARG A CD    1 
ATOM   1237  N  NE    . ARG A  1 198  ? 216.540 187.920 161.356 1.00 123.96 ? 192  ARG A NE    1 
ATOM   1238  C  CZ    . ARG A  1 198  ? 216.381 187.906 162.675 1.00 123.96 ? 192  ARG A CZ    1 
ATOM   1239  N  NH1   . ARG A  1 198  ? 215.264 188.370 163.210 1.00 123.96 ? 192  ARG A NH1   1 
ATOM   1240  N  NH2   . ARG A  1 198  ? 217.340 187.425 163.457 1.00 123.96 ? 192  ARG A NH2   1 
ATOM   1241  N  N     . HIS A  1 199  ? 216.540 188.269 155.698 1.00 117.95 ? 193  HIS A N     1 
ATOM   1242  C  CA    . HIS A  1 199  ? 215.610 188.061 154.591 1.00 117.95 ? 193  HIS A CA    1 
ATOM   1243  C  C     . HIS A  1 199  ? 215.941 188.991 153.430 1.00 117.95 ? 193  HIS A C     1 
ATOM   1244  O  O     . HIS A  1 199  ? 215.052 189.550 152.785 1.00 117.95 ? 193  HIS A O     1 
ATOM   1245  C  CB    . HIS A  1 199  ? 214.167 188.261 155.050 1.00 117.95 ? 193  HIS A CB    1 
ATOM   1246  C  CG    . HIS A  1 199  ? 213.737 187.295 156.104 1.00 117.95 ? 193  HIS A CG    1 
ATOM   1247  N  ND1   . HIS A  1 199  ? 212.600 187.475 156.860 1.00 117.95 ? 193  HIS A ND1   1 
ATOM   1248  C  CD2   . HIS A  1 199  ? 214.291 186.136 156.528 1.00 117.95 ? 193  HIS A CD2   1 
ATOM   1249  C  CE1   . HIS A  1 199  ? 212.476 186.471 157.709 1.00 117.95 ? 193  HIS A CE1   1 
ATOM   1250  N  NE2   . HIS A  1 199  ? 213.489 185.644 157.525 1.00 117.95 ? 193  HIS A NE2   1 
ATOM   1251  N  N     . GLY A  1 200  ? 217.235 189.179 153.174 1.00 124.04 ? 194  GLY A N     1 
ATOM   1252  C  CA    . GLY A  1 200  ? 217.654 190.148 152.188 1.00 124.04 ? 194  GLY A CA    1 
ATOM   1253  C  C     . GLY A  1 200  ? 217.278 191.571 152.511 1.00 124.04 ? 194  GLY A C     1 
ATOM   1254  O  O     . GLY A  1 200  ? 217.423 192.446 151.652 1.00 124.04 ? 194  GLY A O     1 
ATOM   1255  N  N     . ARG A  1 201  ? 216.792 191.835 153.718 1.00 119.48 ? 195  ARG A N     1 
ATOM   1256  C  CA    . ARG A  1 201  ? 216.361 193.162 154.113 1.00 119.48 ? 195  ARG A CA    1 
ATOM   1257  C  C     . ARG A  1 201  ? 217.210 193.654 155.274 1.00 119.48 ? 195  ARG A C     1 
ATOM   1258  O  O     . ARG A  1 201  ? 217.710 192.877 156.090 1.00 119.48 ? 195  ARG A O     1 
ATOM   1259  C  CB    . ARG A  1 201  ? 214.878 193.170 154.490 1.00 119.48 ? 195  ARG A CB    1 
ATOM   1260  C  CG    . ARG A  1 201  ? 213.973 192.810 153.334 1.00 119.48 ? 195  ARG A CG    1 
ATOM   1261  C  CD    . ARG A  1 201  ? 214.058 193.861 152.246 1.00 119.48 ? 195  ARG A CD    1 
ATOM   1262  N  NE    . ARG A  1 201  ? 213.664 195.178 152.735 1.00 119.48 ? 195  ARG A NE    1 
ATOM   1263  C  CZ    . ARG A  1 201  ? 212.408 195.609 152.781 1.00 119.48 ? 195  ARG A CZ    1 
ATOM   1264  N  NH1   . ARG A  1 201  ? 211.422 194.827 152.370 1.00 119.48 ? 195  ARG A NH1   1 
ATOM   1265  N  NH2   . ARG A  1 201  ? 212.138 196.823 153.240 1.00 119.48 ? 195  ARG A NH2   1 
ATOM   1266  N  N     . LEU A  1 202  ? 217.353 194.971 155.334 1.00 117.35 ? 196  LEU A N     1 
ATOM   1267  C  CA    . LEU A  1 202  ? 218.216 195.636 156.298 1.00 117.35 ? 196  LEU A CA    1 
ATOM   1268  C  C     . LEU A  1 202  ? 217.369 196.101 157.473 1.00 117.35 ? 196  LEU A C     1 
ATOM   1269  O  O     . LEU A  1 202  ? 216.693 197.131 157.387 1.00 117.35 ? 196  LEU A O     1 
ATOM   1270  C  CB    . LEU A  1 202  ? 218.931 196.811 155.634 1.00 117.35 ? 196  LEU A CB    1 
ATOM   1271  C  CG    . LEU A  1 202  ? 219.932 197.600 156.460 1.00 117.35 ? 196  LEU A CG    1 
ATOM   1272  C  CD1   . LEU A  1 202  ? 221.052 196.693 156.923 1.00 117.35 ? 196  LEU A CD1   1 
ATOM   1273  C  CD2   . LEU A  1 202  ? 220.474 198.736 155.622 1.00 117.35 ? 196  LEU A CD2   1 
ATOM   1274  N  N     . CYS A  1 203  ? 217.407 195.344 158.566 1.00 119.64 ? 197  CYS A N     1 
ATOM   1275  C  CA    . CYS A  1 203  ? 216.497 195.533 159.685 1.00 119.64 ? 197  CYS A CA    1 
ATOM   1276  C  C     . CYS A  1 203  ? 217.269 195.917 160.937 1.00 119.64 ? 197  CYS A C     1 
ATOM   1277  O  O     . CYS A  1 203  ? 218.298 195.313 161.250 1.00 119.64 ? 197  CYS A O     1 
ATOM   1278  C  CB    . CYS A  1 203  ? 215.674 194.265 159.930 1.00 119.64 ? 197  CYS A CB    1 
ATOM   1279  S  SG    . CYS A  1 203  ? 216.639 192.801 160.356 1.00 119.64 ? 197  CYS A SG    1 
ATOM   1280  N  N     . PHE A  1 204  ? 216.765 196.924 161.641 1.00 116.91 ? 198  PHE A N     1 
ATOM   1281  C  CA    . PHE A  1 204  ? 217.305 197.353 162.922 1.00 116.91 ? 198  PHE A CA    1 
ATOM   1282  C  C     . PHE A  1 204  ? 216.914 196.371 164.017 1.00 116.91 ? 198  PHE A C     1 
ATOM   1283  O  O     . PHE A  1 204  ? 215.758 195.954 164.091 1.00 116.91 ? 198  PHE A O     1 
ATOM   1284  C  CB    . PHE A  1 204  ? 216.785 198.746 163.262 1.00 116.91 ? 198  PHE A CB    1 
ATOM   1285  C  CG    . PHE A  1 204  ? 217.067 199.168 164.661 1.00 116.91 ? 198  PHE A CG    1 
ATOM   1286  C  CD1   . PHE A  1 204  ? 218.332 199.579 165.033 1.00 116.91 ? 198  PHE A CD1   1 
ATOM   1287  C  CD2   . PHE A  1 204  ? 216.066 199.150 165.609 1.00 116.91 ? 198  PHE A CD2   1 
ATOM   1288  C  CE1   . PHE A  1 204  ? 218.584 199.971 166.330 1.00 116.91 ? 198  PHE A CE1   1 
ATOM   1289  C  CE2   . PHE A  1 204  ? 216.315 199.539 166.907 1.00 116.91 ? 198  PHE A CE2   1 
ATOM   1290  C  CZ    . PHE A  1 204  ? 217.574 199.952 167.268 1.00 116.91 ? 198  PHE A CZ    1 
ATOM   1291  N  N     . MET A  1 205  ? 217.870 196.019 164.873 1.00 113.68 ? 199  MET A N     1 
ATOM   1292  C  CA    . MET A  1 205  ? 217.668 194.991 165.882 1.00 113.68 ? 199  MET A CA    1 
ATOM   1293  C  C     . MET A  1 205  ? 218.140 195.484 167.238 1.00 113.68 ? 199  MET A C     1 
ATOM   1294  O  O     . MET A  1 205  ? 218.826 196.502 167.330 1.00 113.68 ? 199  MET A O     1 
ATOM   1295  C  CB    . MET A  1 205  ? 218.421 193.705 165.531 1.00 113.68 ? 199  MET A CB    1 
ATOM   1296  C  CG    . MET A  1 205  ? 218.011 193.073 164.218 1.00 113.68 ? 199  MET A CG    1 
ATOM   1297  S  SD    . MET A  1 205  ? 218.791 191.482 163.927 1.00 113.68 ? 199  MET A SD    1 
ATOM   1298  C  CE    . MET A  1 205  ? 220.457 191.996 163.545 1.00 113.68 ? 199  MET A CE    1 
ATOM   1299  N  N     . LEU A  1 206  ? 217.752 194.759 168.285 1.00 111.38 ? 200  LEU A N     1 
ATOM   1300  C  CA    . LEU A  1 206  ? 218.353 194.873 169.607 1.00 111.38 ? 200  LEU A CA    1 
ATOM   1301  C  C     . LEU A  1 206  ? 217.926 193.671 170.438 1.00 111.38 ? 200  LEU A C     1 
ATOM   1302  O  O     . LEU A  1 206  ? 216.837 193.126 170.258 1.00 111.38 ? 200  LEU A O     1 
ATOM   1303  C  CB    . LEU A  1 206  ? 217.957 196.158 170.346 1.00 111.38 ? 200  LEU A CB    1 
ATOM   1304  C  CG    . LEU A  1 206  ? 216.559 196.157 170.960 1.00 111.38 ? 200  LEU A CG    1 
ATOM   1305  C  CD1   . LEU A  1 206  ? 216.484 197.161 172.078 1.00 111.38 ? 200  LEU A CD1   1 
ATOM   1306  C  CD2   . LEU A  1 206  ? 215.527 196.481 169.908 1.00 111.38 ? 200  LEU A CD2   1 
ATOM   1307  N  N     . ARG A  1 207  ? 218.790 193.270 171.361 1.00 110.14 ? 201  ARG A N     1 
ATOM   1308  C  CA    . ARG A  1 207  ? 218.512 192.151 172.245 1.00 110.14 ? 201  ARG A CA    1 
ATOM   1309  C  C     . ARG A  1 207  ? 217.844 192.652 173.515 1.00 110.14 ? 201  ARG A C     1 
ATOM   1310  O  O     . ARG A  1 207  ? 218.221 193.694 174.059 1.00 110.14 ? 201  ARG A O     1 
ATOM   1311  C  CB    . ARG A  1 207  ? 219.794 191.385 172.585 1.00 110.14 ? 201  ARG A CB    1 
ATOM   1312  C  CG    . ARG A  1 207  ? 219.602 190.177 173.500 1.00 110.14 ? 201  ARG A CG    1 
ATOM   1313  C  CD    . ARG A  1 207  ? 220.906 189.409 173.677 1.00 110.14 ? 201  ARG A CD    1 
ATOM   1314  N  NE    . ARG A  1 207  ? 221.266 188.645 172.484 1.00 110.14 ? 201  ARG A NE    1 
ATOM   1315  C  CZ    . ARG A  1 207  ? 222.469 188.124 172.261 1.00 110.14 ? 201  ARG A CZ    1 
ATOM   1316  N  NH1   . ARG A  1 207  ? 223.444 188.306 173.136 1.00 110.14 ? 201  ARG A NH1   1 
ATOM   1317  N  NH2   . ARG A  1 207  ? 222.703 187.437 171.153 1.00 110.14 ? 201  ARG A NH2   1 
ATOM   1318  N  N     . VAL A  1 208  ? 216.846 191.906 173.976 1.00 112.13 ? 202  VAL A N     1 
ATOM   1319  C  CA    . VAL A  1 208  ? 216.130 192.193 175.210 1.00 112.13 ? 202  VAL A CA    1 
ATOM   1320  C  C     . VAL A  1 208  ? 216.621 191.206 176.254 1.00 112.13 ? 202  VAL A C     1 
ATOM   1321  O  O     . VAL A  1 208  ? 217.117 190.131 175.909 1.00 112.13 ? 202  VAL A O     1 
ATOM   1322  C  CB    . VAL A  1 208  ? 214.605 192.071 175.022 1.00 112.13 ? 202  VAL A CB    1 
ATOM   1323  C  CG1   . VAL A  1 208  ? 214.225 190.631 174.777 1.00 112.13 ? 202  VAL A CG1   1 
ATOM   1324  C  CG2   . VAL A  1 208  ? 213.857 192.616 176.220 1.00 112.13 ? 202  VAL A CG2   1 
ATOM   1325  N  N     . GLY A  1 209  ? 216.499 191.571 177.524 1.00 120.23 ? 203  GLY A N     1 
ATOM   1326  C  CA    . GLY A  1 209  ? 216.935 190.672 178.573 1.00 120.23 ? 203  GLY A CA    1 
ATOM   1327  C  C     . GLY A  1 209  ? 216.063 190.754 179.801 1.00 120.23 ? 203  GLY A C     1 
ATOM   1328  O  O     . GLY A  1 209  ? 215.751 191.840 180.301 1.00 120.23 ? 203  GLY A O     1 
ATOM   1329  N  N     . ASP A  1 210  ? 215.675 189.580 180.287 1.00 124.49 ? 204  ASP A N     1 
ATOM   1330  C  CA    . ASP A  1 210  ? 215.020 189.428 181.576 1.00 124.49 ? 204  ASP A CA    1 
ATOM   1331  C  C     . ASP A  1 210  ? 215.872 188.538 182.466 1.00 124.49 ? 204  ASP A C     1 
ATOM   1332  O  O     . ASP A  1 210  ? 216.232 187.423 182.077 1.00 124.49 ? 204  ASP A O     1 
ATOM   1333  C  CB    . ASP A  1 210  ? 213.627 188.819 181.439 1.00 124.49 ? 204  ASP A CB    1 
ATOM   1334  C  CG    . ASP A  1 210  ? 212.851 188.856 182.739 1.00 124.49 ? 204  ASP A CG    1 
ATOM   1335  O  OD1   . ASP A  1 210  ? 213.380 189.398 183.729 1.00 124.49 ? 204  ASP A OD1   1 
ATOM   1336  O  OD2   . ASP A  1 210  ? 211.717 188.333 182.781 1.00 124.49 ? 204  ASP A OD2   1 
ATOM   1337  N  N     . LEU A  1 211  ? 216.181 189.029 183.664 1.00 122.00 ? 205  LEU A N     1 
ATOM   1338  C  CA    . LEU A  1 211  ? 217.073 188.326 184.571 1.00 122.00 ? 205  LEU A CA    1 
ATOM   1339  C  C     . LEU A  1 211  ? 216.350 187.509 185.628 1.00 122.00 ? 205  LEU A C     1 
ATOM   1340  O  O     . LEU A  1 211  ? 216.937 186.559 186.153 1.00 122.00 ? 205  LEU A O     1 
ATOM   1341  C  CB    . LEU A  1 211  ? 218.006 189.315 185.266 1.00 122.00 ? 205  LEU A CB    1 
ATOM   1342  C  CG    . LEU A  1 211  ? 218.986 190.020 184.341 1.00 122.00 ? 205  LEU A CG    1 
ATOM   1343  C  CD1   . LEU A  1 211  ? 219.797 191.017 185.130 1.00 122.00 ? 205  LEU A CD1   1 
ATOM   1344  C  CD2   . LEU A  1 211  ? 219.879 189.005 183.690 1.00 122.00 ? 205  LEU A CD2   1 
ATOM   1345  N  N     . ARG A  1 212  ? 215.111 187.841 185.954 1.00 126.38 ? 206  ARG A N     1 
ATOM   1346  C  CA    . ARG A  1 212  ? 214.355 187.097 186.947 1.00 126.38 ? 206  ARG A CA    1 
ATOM   1347  C  C     . ARG A  1 212  ? 213.701 185.885 186.308 1.00 126.38 ? 206  ARG A C     1 
ATOM   1348  O  O     . ARG A  1 212  ? 213.237 185.938 185.166 1.00 126.38 ? 206  ARG A O     1 
ATOM   1349  C  CB    . ARG A  1 212  ? 213.284 187.969 187.601 1.00 126.38 ? 206  ARG A CB    1 
ATOM   1350  C  CG    . ARG A  1 212  ? 213.834 189.118 188.399 1.00 126.38 ? 206  ARG A CG    1 
ATOM   1351  C  CD    . ARG A  1 212  ? 214.556 188.603 189.628 1.00 126.38 ? 206  ARG A CD    1 
ATOM   1352  N  NE    . ARG A  1 212  ? 215.074 189.691 190.448 1.00 126.38 ? 206  ARG A NE    1 
ATOM   1353  C  CZ    . ARG A  1 212  ? 214.395 190.267 191.434 1.00 126.38 ? 206  ARG A CZ    1 
ATOM   1354  N  NH1   . ARG A  1 212  ? 213.171 189.853 191.725 1.00 126.38 ? 206  ARG A NH1   1 
ATOM   1355  N  NH2   . ARG A  1 212  ? 214.942 191.253 192.130 1.00 126.38 ? 206  ARG A NH2   1 
ATOM   1356  N  N     . LYS A  1 213  ? 213.683 184.783 187.050 1.00 131.40 ? 207  LYS A N     1 
ATOM   1357  C  CA    . LYS A  1 213  ? 212.909 183.630 186.619 1.00 131.40 ? 207  LYS A CA    1 
ATOM   1358  C  C     . LYS A  1 213  ? 211.416 183.892 186.697 1.00 131.40 ? 207  LYS A C     1 
ATOM   1359  O  O     . LYS A  1 213  ? 210.648 183.234 185.990 1.00 131.40 ? 207  LYS A O     1 
ATOM   1360  C  CB    . LYS A  1 213  ? 213.266 182.405 187.461 1.00 131.40 ? 207  LYS A CB    1 
ATOM   1361  N  N     . SER A  1 214  ? 210.999 184.837 187.532 1.00 139.25 ? 208  SER A N     1 
ATOM   1362  C  CA    . SER A  1 214  ? 209.608 185.256 187.568 1.00 139.25 ? 208  SER A CA    1 
ATOM   1363  C  C     . SER A  1 214  ? 209.205 185.817 186.215 1.00 139.25 ? 208  SER A C     1 
ATOM   1364  O  O     . SER A  1 214  ? 209.989 186.491 185.543 1.00 139.25 ? 208  SER A O     1 
ATOM   1365  C  CB    . SER A  1 214  ? 209.401 186.299 188.664 1.00 139.25 ? 208  SER A CB    1 
ATOM   1366  O  OG    . SER A  1 214  ? 210.153 187.466 188.389 1.00 139.25 ? 208  SER A OG    1 
ATOM   1367  N  N     . MET A  1 215  ? 207.983 185.516 185.800 1.00 133.32 ? 209  MET A N     1 
ATOM   1368  C  CA    . MET A  1 215  ? 207.612 185.754 184.419 1.00 133.32 ? 209  MET A CA    1 
ATOM   1369  C  C     . MET A  1 215  ? 206.792 187.028 184.282 1.00 133.32 ? 209  MET A C     1 
ATOM   1370  O  O     . MET A  1 215  ? 206.007 187.388 185.159 1.00 133.32 ? 209  MET A O     1 
ATOM   1371  C  CB    . MET A  1 215  ? 206.837 184.556 183.873 1.00 133.32 ? 209  MET A CB    1 
ATOM   1372  C  CG    . MET A  1 215  ? 206.654 184.574 182.377 1.00 133.32 ? 209  MET A CG    1 
ATOM   1373  S  SD    . MET A  1 215  ? 208.274 184.677 181.612 1.00 133.32 ? 209  MET A SD    1 
ATOM   1374  C  CE    . MET A  1 215  ? 208.991 183.141 182.179 1.00 133.32 ? 209  MET A CE    1 
ATOM   1375  N  N     . ILE A  1 216  ? 206.998 187.715 183.177 1.00 114.94 ? 210  ILE A N     1 
ATOM   1376  C  CA    . ILE A  1 216  ? 206.201 188.876 182.817 1.00 114.94 ? 210  ILE A CA    1 
ATOM   1377  C  C     . ILE A  1 216  ? 205.100 188.406 181.884 1.00 114.94 ? 210  ILE A C     1 
ATOM   1378  O  O     . ILE A  1 216  ? 205.322 187.535 181.035 1.00 114.94 ? 210  ILE A O     1 
ATOM   1379  C  CB    . ILE A  1 216  ? 207.072 189.966 182.168 1.00 114.94 ? 210  ILE A CB    1 
ATOM   1380  C  CG1   . ILE A  1 216  ? 206.299 191.280 182.047 1.00 114.94 ? 210  ILE A CG1   1 
ATOM   1381  C  CG2   . ILE A  1 216  ? 207.620 189.496 180.832 1.00 114.94 ? 210  ILE A CG2   1 
ATOM   1382  C  CD1   . ILE A  1 216  ? 206.043 191.948 183.372 1.00 114.94 ? 210  ILE A CD1   1 
ATOM   1383  N  N     . ILE A  1 217  ? 203.902 188.948 182.058 1.00 107.22 ? 211  ILE A N     1 
ATOM   1384  C  CA    . ILE A  1 217  ? 202.735 188.519 181.299 1.00 107.22 ? 211  ILE A CA    1 
ATOM   1385  C  C     . ILE A  1 217  ? 202.380 189.612 180.308 1.00 107.22 ? 211  ILE A C     1 
ATOM   1386  O  O     . ILE A  1 217  ? 202.454 190.801 180.634 1.00 107.22 ? 211  ILE A O     1 
ATOM   1387  C  CB    . ILE A  1 217  ? 201.545 188.190 182.218 1.00 107.22 ? 211  ILE A CB    1 
ATOM   1388  C  CG1   . ILE A  1 217  ? 201.838 186.941 183.045 1.00 107.22 ? 211  ILE A CG1   1 
ATOM   1389  C  CG2   . ILE A  1 217  ? 200.291 187.971 181.413 1.00 107.22 ? 211  ILE A CG2   1 
ATOM   1390  C  CD1   . ILE A  1 217  ? 202.484 187.218 184.367 1.00 107.22 ? 211  ILE A CD1   1 
ATOM   1391  N  N     . SER A  1 218  ? 202.010 189.207 179.093 1.00 103.64 ? 212  SER A N     1 
ATOM   1392  C  CA    . SER A  1 218  ? 201.613 190.132 178.037 1.00 103.64 ? 212  SER A CA    1 
ATOM   1393  C  C     . SER A  1 218  ? 202.712 191.149 177.756 1.00 103.64 ? 212  SER A C     1 
ATOM   1394  O  O     . SER A  1 218  ? 202.447 192.318 177.472 1.00 103.64 ? 212  SER A O     1 
ATOM   1395  C  CB    . SER A  1 218  ? 200.299 190.833 178.379 1.00 103.64 ? 212  SER A CB    1 
ATOM   1396  O  OG    . SER A  1 218  ? 199.961 191.772 177.376 1.00 103.64 ? 212  SER A OG    1 
ATOM   1397  N  N     . ALA A  1 219  ? 203.960 190.696 177.851 1.00 105.67 ? 213  ALA A N     1 
ATOM   1398  C  CA    . ALA A  1 219  ? 205.108 191.540 177.554 1.00 105.67 ? 213  ALA A CA    1 
ATOM   1399  C  C     . ALA A  1 219  ? 204.975 192.133 176.161 1.00 105.67 ? 213  ALA A C     1 
ATOM   1400  O  O     . ALA A  1 219  ? 204.983 191.406 175.162 1.00 105.67 ? 213  ALA A O     1 
ATOM   1401  C  CB    . ALA A  1 219  ? 206.402 190.742 177.678 1.00 105.67 ? 213  ALA A CB    1 
ATOM   1402  N  N     . THR A  1 220  ? 204.852 193.452 176.089 1.00 103.27 ? 214  THR A N     1 
ATOM   1403  C  CA    . THR A  1 220  ? 204.542 194.152 174.854 1.00 103.27 ? 214  THR A CA    1 
ATOM   1404  C  C     . THR A  1 220  ? 205.624 195.182 174.570 1.00 103.27 ? 214  THR A C     1 
ATOM   1405  O  O     . THR A  1 220  ? 206.092 195.863 175.487 1.00 103.27 ? 214  THR A O     1 
ATOM   1406  C  CB    . THR A  1 220  ? 203.175 194.817 174.955 1.00 103.27 ? 214  THR A CB    1 
ATOM   1407  O  OG1   . THR A  1 220  ? 202.202 193.817 175.270 1.00 103.27 ? 214  THR A OG1   1 
ATOM   1408  C  CG2   . THR A  1 220  ? 202.806 195.458 173.644 1.00 103.27 ? 214  THR A CG2   1 
ATOM   1409  N  N     . ILE A  1 221  ? 206.021 195.284 173.305 1.00 97.30  ? 215  ILE A N     1 
ATOM   1410  C  CA    . ILE A  1 221  ? 207.121 196.139 172.880 1.00 97.30  ? 215  ILE A CA    1 
ATOM   1411  C  C     . ILE A  1 221  ? 206.563 197.312 172.097 1.00 97.30  ? 215  ILE A C     1 
ATOM   1412  O  O     . ILE A  1 221  ? 205.748 197.126 171.186 1.00 97.30  ? 215  ILE A O     1 
ATOM   1413  C  CB    . ILE A  1 221  ? 208.129 195.359 172.022 1.00 97.30  ? 215  ILE A CB    1 
ATOM   1414  C  CG1   . ILE A  1 221  ? 208.796 194.262 172.844 1.00 97.30  ? 215  ILE A CG1   1 
ATOM   1415  C  CG2   . ILE A  1 221  ? 209.158 196.299 171.423 1.00 97.30  ? 215  ILE A CG2   1 
ATOM   1416  C  CD1   . ILE A  1 221  ? 209.634 194.799 173.967 1.00 97.30  ? 215  ILE A CD1   1 
ATOM   1417  N  N     . HIS A  1 222  ? 207.013 198.511 172.427 1.00 98.88  ? 216  HIS A N     1 
ATOM   1418  C  CA    . HIS A  1 222  ? 206.707 199.694 171.633 1.00 98.88  ? 216  HIS A CA    1 
ATOM   1419  C  C     . HIS A  1 222  ? 208.007 200.424 171.351 1.00 98.88  ? 216  HIS A C     1 
ATOM   1420  O  O     . HIS A  1 222  ? 208.375 201.359 172.070 1.00 98.88  ? 216  HIS A O     1 
ATOM   1421  C  CB    . HIS A  1 222  ? 205.713 200.590 172.345 1.00 98.88  ? 216  HIS A CB    1 
ATOM   1422  C  CG    . HIS A  1 222  ? 204.352 199.991 172.459 1.00 98.88  ? 216  HIS A CG    1 
ATOM   1423  N  ND1   . HIS A  1 222  ? 203.996 199.151 173.491 1.00 98.88  ? 216  HIS A ND1   1 
ATOM   1424  C  CD2   . HIS A  1 222  ? 203.259 200.105 171.671 1.00 98.88  ? 216  HIS A CD2   1 
ATOM   1425  C  CE1   . HIS A  1 222  ? 202.739 198.775 173.334 1.00 98.88  ? 216  HIS A CE1   1 
ATOM   1426  N  NE2   . HIS A  1 222  ? 202.269 199.340 172.236 1.00 98.88  ? 216  HIS A NE2   1 
ATOM   1427  N  N     . MET A  1 223  ? 208.704 200.002 170.308 1.00 108.04 ? 217  MET A N     1 
ATOM   1428  C  CA    . MET A  1 223  ? 209.825 200.778 169.816 1.00 108.04 ? 217  MET A CA    1 
ATOM   1429  C  C     . MET A  1 223  ? 209.285 202.066 169.219 1.00 108.04 ? 217  MET A C     1 
ATOM   1430  O  O     . MET A  1 223  ? 208.259 202.066 168.535 1.00 108.04 ? 217  MET A O     1 
ATOM   1431  C  CB    . MET A  1 223  ? 210.616 199.986 168.780 1.00 108.04 ? 217  MET A CB    1 
ATOM   1432  C  CG    . MET A  1 223  ? 211.246 198.728 169.339 1.00 108.04 ? 217  MET A CG    1 
ATOM   1433  S  SD    . MET A  1 223  ? 212.334 197.908 168.163 1.00 108.04 ? 217  MET A SD    1 
ATOM   1434  C  CE    . MET A  1 223  ? 211.147 197.230 167.021 1.00 108.04 ? 217  MET A CE    1 
ATOM   1435  N  N     . GLN A  1 224  ? 209.966 203.174 169.490 1.00 110.56 ? 218  GLN A N     1 
ATOM   1436  C  CA    . GLN A  1 224  ? 209.417 204.467 169.111 1.00 110.56 ? 218  GLN A CA    1 
ATOM   1437  C  C     . GLN A  1 224  ? 210.580 205.413 168.833 1.00 110.56 ? 218  GLN A C     1 
ATOM   1438  O  O     . GLN A  1 224  ? 211.316 205.778 169.753 1.00 110.56 ? 218  GLN A O     1 
ATOM   1439  C  CB    . GLN A  1 224  ? 208.511 204.989 170.204 1.00 110.56 ? 218  GLN A CB    1 
ATOM   1440  C  CG    . GLN A  1 224  ? 207.789 206.263 169.881 1.00 110.56 ? 218  GLN A CG    1 
ATOM   1441  C  CD    . GLN A  1 224  ? 206.810 206.615 170.973 1.00 110.56 ? 218  GLN A CD    1 
ATOM   1442  O  OE1   . GLN A  1 224  ? 206.717 205.913 171.978 1.00 110.56 ? 218  GLN A OE1   1 
ATOM   1443  N  NE2   . GLN A  1 224  ? 206.061 207.688 170.782 1.00 110.56 ? 218  GLN A NE2   1 
ATOM   1444  N  N     . VAL A  1 225  ? 210.738 205.789 167.572 1.00 111.05 ? 219  VAL A N     1 
ATOM   1445  C  CA    . VAL A  1 225  ? 211.817 206.680 167.171 1.00 111.05 ? 219  VAL A CA    1 
ATOM   1446  C  C     . VAL A  1 225  ? 211.396 208.119 167.425 1.00 111.05 ? 219  VAL A C     1 
ATOM   1447  O  O     . VAL A  1 225  ? 210.246 208.506 167.187 1.00 111.05 ? 219  VAL A O     1 
ATOM   1448  C  CB    . VAL A  1 225  ? 212.190 206.449 165.698 1.00 111.05 ? 219  VAL A CB    1 
ATOM   1449  C  CG1   . VAL A  1 225  ? 211.003 206.721 164.797 1.00 111.05 ? 219  VAL A CG1   1 
ATOM   1450  C  CG2   . VAL A  1 225  ? 213.360 207.331 165.311 1.00 111.05 ? 219  VAL A CG2   1 
ATOM   1451  N  N     . VAL A  1 226  ? 212.326 208.916 167.936 1.00 108.52 ? 220  VAL A N     1 
ATOM   1452  C  CA    . VAL A  1 226  ? 212.055 210.300 168.290 1.00 108.52 ? 220  VAL A CA    1 
ATOM   1453  C  C     . VAL A  1 226  ? 213.148 211.186 167.723 1.00 108.52 ? 220  VAL A C     1 
ATOM   1454  O  O     . VAL A  1 226  ? 214.336 210.855 167.788 1.00 108.52 ? 220  VAL A O     1 
ATOM   1455  C  CB    . VAL A  1 226  ? 211.934 210.484 169.814 1.00 108.52 ? 220  VAL A CB    1 
ATOM   1456  C  CG1   . VAL A  1 226  ? 210.730 209.732 170.332 1.00 108.52 ? 220  VAL A CG1   1 
ATOM   1457  C  CG2   . VAL A  1 226  ? 213.189 210.002 170.509 1.00 108.52 ? 220  VAL A CG2   1 
ATOM   1458  N  N     . ARG A  1 227  ? 212.737 212.309 167.149 1.00 115.15 ? 221  ARG A N     1 
ATOM   1459  C  CA    . ARG A  1 227  ? 213.674 213.310 166.669 1.00 115.15 ? 221  ARG A CA    1 
ATOM   1460  C  C     . ARG A  1 227  ? 212.904 214.601 166.467 1.00 115.15 ? 221  ARG A C     1 
ATOM   1461  O  O     . ARG A  1 227  ? 211.689 214.660 166.665 1.00 115.15 ? 221  ARG A O     1 
ATOM   1462  C  CB    . ARG A  1 227  ? 214.353 212.894 165.363 1.00 115.15 ? 221  ARG A CB    1 
ATOM   1463  C  CG    . ARG A  1 227  ? 213.459 213.063 164.159 1.00 115.15 ? 221  ARG A CG    1 
ATOM   1464  C  CD    . ARG A  1 227  ? 214.143 212.670 162.870 1.00 115.15 ? 221  ARG A CD    1 
ATOM   1465  N  NE    . ARG A  1 227  ? 214.279 211.226 162.722 1.00 115.15 ? 221  ARG A NE    1 
ATOM   1466  C  CZ    . ARG A  1 227  ? 214.932 210.646 161.724 1.00 115.15 ? 221  ARG A CZ    1 
ATOM   1467  N  NH1   . ARG A  1 227  ? 215.506 211.391 160.789 1.00 115.15 ? 221  ARG A NH1   1 
ATOM   1468  N  NH2   . ARG A  1 227  ? 215.006 209.326 161.654 1.00 115.15 ? 221  ARG A NH2   1 
ATOM   1469  N  N     . LYS A  1 228  ? 213.627 215.630 166.058 1.00 127.58 ? 222  LYS A N     1 
ATOM   1470  C  CA    . LYS A  1 228  ? 213.043 216.921 165.725 1.00 127.58 ? 222  LYS A CA    1 
ATOM   1471  C  C     . LYS A  1 228  ? 212.758 216.909 164.231 1.00 127.58 ? 222  LYS A C     1 
ATOM   1472  O  O     . LYS A  1 228  ? 213.571 217.375 163.431 1.00 127.58 ? 222  LYS A O     1 
ATOM   1473  C  CB    . LYS A  1 228  ? 213.990 218.047 166.116 1.00 127.58 ? 222  LYS A CB    1 
ATOM   1474  C  CG    . LYS A  1 228  ? 213.426 219.433 165.954 1.00 127.58 ? 222  LYS A CG    1 
ATOM   1475  C  CD    . LYS A  1 228  ? 214.425 220.468 166.437 1.00 127.58 ? 222  LYS A CD    1 
ATOM   1476  C  CE    . LYS A  1 228  ? 213.912 221.884 166.242 1.00 127.58 ? 222  LYS A CE    1 
ATOM   1477  N  NZ    . LYS A  1 228  ? 214.907 222.888 166.722 1.00 127.58 ? 222  LYS A NZ    1 
ATOM   1478  N  N     . THR A  1 229  ? 211.610 216.364 163.853 1.00 120.20 ? 223  THR A N     1 
ATOM   1479  C  CA    . THR A  1 229  ? 211.265 216.228 162.448 1.00 120.20 ? 223  THR A CA    1 
ATOM   1480  C  C     . THR A  1 229  ? 210.219 217.261 162.054 1.00 120.20 ? 223  THR A C     1 
ATOM   1481  O  O     . THR A  1 229  ? 209.656 217.973 162.888 1.00 120.20 ? 223  THR A O     1 
ATOM   1482  C  CB    . THR A  1 229  ? 210.755 214.825 162.139 1.00 120.20 ? 223  THR A CB    1 
ATOM   1483  O  OG1   . THR A  1 229  ? 210.668 214.660 160.719 1.00 120.20 ? 223  THR A OG1   1 
ATOM   1484  C  CG2   . THR A  1 229  ? 209.386 214.643 162.723 1.00 120.20 ? 223  THR A CG2   1 
ATOM   1485  N  N     . THR A  1 230  ? 209.946 217.315 160.754 1.00 125.68 ? 224  THR A N     1 
ATOM   1486  C  CA    . THR A  1 230  ? 209.178 218.402 160.169 1.00 125.68 ? 224  THR A CA    1 
ATOM   1487  C  C     . THR A  1 230  ? 208.223 217.867 159.114 1.00 125.68 ? 224  THR A C     1 
ATOM   1488  O  O     . THR A  1 230  ? 208.591 216.995 158.320 1.00 125.68 ? 224  THR A O     1 
ATOM   1489  C  CB    . THR A  1 230  ? 210.114 219.438 159.554 1.00 125.68 ? 224  THR A CB    1 
ATOM   1490  O  OG1   . THR A  1 230  ? 211.027 219.901 160.559 1.00 125.68 ? 224  THR A OG1   1 
ATOM   1491  C  CG2   . THR A  1 230  ? 209.332 220.617 159.023 1.00 125.68 ? 224  THR A CG2   1 
ATOM   1492  N  N     . SER A  1 231  ? 206.998 218.387 159.114 1.00 126.97 ? 225  SER A N     1 
ATOM   1493  C  CA    . SER A  1 231  ? 206.045 218.093 158.061 1.00 126.97 ? 225  SER A CA    1 
ATOM   1494  C  C     . SER A  1 231  ? 206.472 218.786 156.771 1.00 126.97 ? 225  SER A C     1 
ATOM   1495  O  O     . SER A  1 231  ? 207.290 219.708 156.794 1.00 126.97 ? 225  SER A O     1 
ATOM   1496  C  CB    . SER A  1 231  ? 204.652 218.564 158.465 1.00 126.97 ? 225  SER A CB    1 
ATOM   1497  O  OG    . SER A  1 231  ? 204.592 219.978 158.489 1.00 126.97 ? 225  SER A OG    1 
ATOM   1498  N  N     . PRO A  1 232  ? 205.933 218.362 155.628 1.00 131.97 ? 226  PRO A N     1 
ATOM   1499  C  CA    . PRO A  1 232  ? 206.199 219.113 154.394 1.00 131.97 ? 226  PRO A CA    1 
ATOM   1500  C  C     . PRO A  1 232  ? 205.741 220.554 154.476 1.00 131.97 ? 226  PRO A C     1 
ATOM   1501  O  O     . PRO A  1 232  ? 206.420 221.443 153.947 1.00 131.97 ? 226  PRO A O     1 
ATOM   1502  C  CB    . PRO A  1 232  ? 205.412 218.338 153.327 1.00 131.97 ? 226  PRO A CB    1 
ATOM   1503  C  CG    . PRO A  1 232  ? 205.244 216.973 153.894 1.00 131.97 ? 226  PRO A CG    1 
ATOM   1504  C  CD    . PRO A  1 232  ? 205.100 217.175 155.372 1.00 131.97 ? 226  PRO A CD    1 
ATOM   1505  N  N     . GLU A  1 233  ? 204.620 220.812 155.142 1.00 124.87 ? 227  GLU A N     1 
ATOM   1506  C  CA    . GLU A  1 233  ? 204.095 222.168 155.239 1.00 124.87 ? 227  GLU A CA    1 
ATOM   1507  C  C     . GLU A  1 233  ? 205.023 223.058 156.050 1.00 124.87 ? 227  GLU A C     1 
ATOM   1508  O  O     . GLU A  1 233  ? 204.982 224.286 155.921 1.00 124.87 ? 227  GLU A O     1 
ATOM   1509  C  CB    . GLU A  1 233  ? 202.695 222.133 155.847 1.00 124.87 ? 227  GLU A CB    1 
ATOM   1510  C  CG    . GLU A  1 233  ? 201.674 221.458 154.952 1.00 124.87 ? 227  GLU A CG    1 
ATOM   1511  C  CD    . GLU A  1 233  ? 201.756 219.944 155.012 1.00 124.87 ? 227  GLU A CD    1 
ATOM   1512  O  OE1   . GLU A  1 233  ? 202.588 219.420 155.780 1.00 124.87 ? 227  GLU A OE1   1 
ATOM   1513  O  OE2   . GLU A  1 233  ? 200.991 219.276 154.290 1.00 124.87 ? 227  GLU A OE2   1 
ATOM   1514  N  N     . GLY A  1 234  ? 205.854 222.462 156.895 1.00 121.76 ? 228  GLY A N     1 
ATOM   1515  C  CA    . GLY A  1 234  ? 206.904 223.225 157.528 1.00 121.76 ? 228  GLY A CA    1 
ATOM   1516  C  C     . GLY A  1 234  ? 206.985 223.132 159.035 1.00 121.76 ? 228  GLY A C     1 
ATOM   1517  O  O     . GLY A  1 234  ? 208.038 223.426 159.606 1.00 121.76 ? 228  GLY A O     1 
ATOM   1518  N  N     . GLU A  1 235  ? 205.903 222.748 159.703 1.00 120.97 ? 229  GLU A N     1 
ATOM   1519  C  CA    . GLU A  1 235  ? 205.929 222.723 161.158 1.00 120.97 ? 229  GLU A CA    1 
ATOM   1520  C  C     . GLU A  1 235  ? 206.901 221.671 161.664 1.00 120.97 ? 229  GLU A C     1 
ATOM   1521  O  O     . GLU A  1 235  ? 206.913 220.527 161.201 1.00 120.97 ? 229  GLU A O     1 
ATOM   1522  C  CB    . GLU A  1 235  ? 204.541 222.474 161.743 1.00 120.97 ? 229  GLU A CB    1 
ATOM   1523  C  CG    . GLU A  1 235  ? 203.892 221.189 161.318 1.00 120.97 ? 229  GLU A CG    1 
ATOM   1524  C  CD    . GLU A  1 235  ? 202.602 220.946 162.056 1.00 120.97 ? 229  GLU A CD    1 
ATOM   1525  O  OE1   . GLU A  1 235  ? 202.297 221.726 162.982 1.00 120.97 ? 229  GLU A OE1   1 
ATOM   1526  O  OE2   . GLU A  1 235  ? 201.882 219.991 161.699 1.00 120.97 ? 229  GLU A OE2   1 
ATOM   1527  N  N     . VAL A  1 236  ? 207.732 222.078 162.612 1.00 110.79 ? 230  VAL A N     1 
ATOM   1528  C  CA    . VAL A  1 236  ? 208.694 221.202 163.262 1.00 110.79 ? 230  VAL A CA    1 
ATOM   1529  C  C     . VAL A  1 236  ? 208.308 221.089 164.728 1.00 110.79 ? 230  VAL A C     1 
ATOM   1530  O  O     . VAL A  1 236  ? 207.846 222.061 165.337 1.00 110.79 ? 230  VAL A O     1 
ATOM   1531  C  CB    . VAL A  1 236  ? 210.138 221.726 163.104 1.00 110.79 ? 230  VAL A CB    1 
ATOM   1532  C  CG1   . VAL A  1 236  ? 210.309 223.070 163.793 1.00 110.79 ? 230  VAL A CG1   1 
ATOM   1533  C  CG2   . VAL A  1 236  ? 211.122 220.727 163.656 1.00 110.79 ? 230  VAL A CG2   1 
ATOM   1534  N  N     . VAL A  1 237  ? 208.463 219.895 165.284 1.00 113.67 ? 231  VAL A N     1 
ATOM   1535  C  CA    . VAL A  1 237  ? 208.219 219.703 166.706 1.00 113.67 ? 231  VAL A CA    1 
ATOM   1536  C  C     . VAL A  1 237  ? 209.470 219.090 167.318 1.00 113.67 ? 231  VAL A C     1 
ATOM   1537  O  O     . VAL A  1 237  ? 210.066 218.174 166.734 1.00 113.67 ? 231  VAL A O     1 
ATOM   1538  C  CB    . VAL A  1 237  ? 206.961 218.856 166.944 1.00 113.67 ? 231  VAL A CB    1 
ATOM   1539  C  CG1   . VAL A  1 237  ? 205.741 219.625 166.484 1.00 113.67 ? 231  VAL A CG1   1 
ATOM   1540  C  CG2   . VAL A  1 237  ? 207.052 217.562 166.180 1.00 113.67 ? 231  VAL A CG2   1 
ATOM   1541  N  N     . PRO A  1 238  ? 209.923 219.590 168.463 1.00 122.99 ? 232  PRO A N     1 
ATOM   1542  C  CA    . PRO A  1 238  ? 211.242 219.204 168.976 1.00 122.99 ? 232  PRO A CA    1 
ATOM   1543  C  C     . PRO A  1 238  ? 211.376 217.716 169.225 1.00 122.99 ? 232  PRO A C     1 
ATOM   1544  O  O     . PRO A  1 238  ? 212.241 217.057 168.647 1.00 122.99 ? 232  PRO A O     1 
ATOM   1545  C  CB    . PRO A  1 238  ? 211.348 219.993 170.287 1.00 122.99 ? 232  PRO A CB    1 
ATOM   1546  C  CG    . PRO A  1 238  ? 210.393 221.124 170.126 1.00 122.99 ? 232  PRO A CG    1 
ATOM   1547  C  CD    . PRO A  1 238  ? 209.257 220.577 169.327 1.00 122.99 ? 232  PRO A CD    1 
ATOM   1548  N  N     . LEU A  1 239  ? 210.532 217.176 170.095 1.00 122.09 ? 233  LEU A N     1 
ATOM   1549  C  CA    . LEU A  1 239  ? 210.528 215.742 170.363 1.00 122.09 ? 233  LEU A CA    1 
ATOM   1550  C  C     . LEU A  1 239  ? 209.330 215.103 169.663 1.00 122.09 ? 233  LEU A C     1 
ATOM   1551  O  O     . LEU A  1 239  ? 208.303 214.789 170.266 1.00 122.09 ? 233  LEU A O     1 
ATOM   1552  C  CB    . LEU A  1 239  ? 210.516 215.479 171.862 1.00 122.09 ? 233  LEU A CB    1 
ATOM   1553  C  CG    . LEU A  1 239  ? 211.810 215.878 172.571 1.00 122.09 ? 233  LEU A CG    1 
ATOM   1554  C  CD1   . LEU A  1 239  ? 211.650 215.821 174.073 1.00 122.09 ? 233  LEU A CD1   1 
ATOM   1555  C  CD2   . LEU A  1 239  ? 212.943 214.977 172.122 1.00 122.09 ? 233  LEU A CD2   1 
ATOM   1556  N  N     . HIS A  1 240  ? 209.470 214.929 168.355 1.00 112.80 ? 234  HIS A N     1 
ATOM   1557  C  CA    . HIS A  1 240  ? 208.460 214.191 167.615 1.00 112.80 ? 234  HIS A CA    1 
ATOM   1558  C  C     . HIS A  1 240  ? 208.640 212.704 167.870 1.00 112.80 ? 234  HIS A C     1 
ATOM   1559  O  O     . HIS A  1 240  ? 209.753 212.239 168.121 1.00 112.80 ? 234  HIS A O     1 
ATOM   1560  C  CB    . HIS A  1 240  ? 208.536 214.464 166.124 1.00 112.80 ? 234  HIS A CB    1 
ATOM   1561  C  CG    . HIS A  1 240  ? 207.449 213.785 165.360 1.00 112.80 ? 234  HIS A CG    1 
ATOM   1562  N  ND1   . HIS A  1 240  ? 206.146 214.230 165.372 1.00 112.80 ? 234  HIS A ND1   1 
ATOM   1563  C  CD2   . HIS A  1 240  ? 207.458 212.663 164.606 1.00 112.80 ? 234  HIS A CD2   1 
ATOM   1564  C  CE1   . HIS A  1 240  ? 205.403 213.429 164.632 1.00 112.80 ? 234  HIS A CE1   1 
ATOM   1565  N  NE2   . HIS A  1 240  ? 206.174 212.469 164.155 1.00 112.80 ? 234  HIS A NE2   1 
ATOM   1566  N  N     . GLN A  1 241  ? 207.543 211.962 167.795 1.00 115.92 ? 235  GLN A N     1 
ATOM   1567  C  CA    . GLN A  1 241  ? 207.505 210.575 168.227 1.00 115.92 ? 235  GLN A CA    1 
ATOM   1568  C  C     . GLN A  1 241  ? 206.750 209.748 167.199 1.00 115.92 ? 235  GLN A C     1 
ATOM   1569  O  O     . GLN A  1 241  ? 205.577 210.016 166.927 1.00 115.92 ? 235  GLN A O     1 
ATOM   1570  C  CB    . GLN A  1 241  ? 206.827 210.477 169.590 1.00 115.92 ? 235  GLN A CB    1 
ATOM   1571  C  CG    . GLN A  1 241  ? 207.528 211.255 170.681 1.00 115.92 ? 235  GLN A CG    1 
ATOM   1572  C  CD    . GLN A  1 241  ? 206.774 211.219 171.986 1.00 115.92 ? 235  GLN A CD    1 
ATOM   1573  O  OE1   . GLN A  1 241  ? 205.693 210.644 172.073 1.00 115.92 ? 235  GLN A OE1   1 
ATOM   1574  N  NE2   . GLN A  1 241  ? 207.336 211.844 173.011 1.00 115.92 ? 235  GLN A NE2   1 
ATOM   1575  N  N     . VAL A  1 242  ? 207.418 208.746 166.636 1.00 107.02 ? 236  VAL A N     1 
ATOM   1576  C  CA    . VAL A  1 242  ? 206.803 207.863 165.655 1.00 107.02 ? 236  VAL A CA    1 
ATOM   1577  C  C     . VAL A  1 242  ? 206.928 206.437 166.156 1.00 107.02 ? 236  VAL A C     1 
ATOM   1578  O  O     . VAL A  1 242  ? 208.042 205.939 166.348 1.00 107.02 ? 236  VAL A O     1 
ATOM   1579  C  CB    . VAL A  1 242  ? 207.441 207.993 164.267 1.00 107.02 ? 236  VAL A CB    1 
ATOM   1580  C  CG1   . VAL A  1 242  ? 206.817 206.988 163.330 1.00 107.02 ? 236  VAL A CG1   1 
ATOM   1581  C  CG2   . VAL A  1 242  ? 207.254 209.388 163.743 1.00 107.02 ? 236  VAL A CG2   1 
ATOM   1582  N  N     . ASP A  1 243  ? 205.792 205.785 166.360 1.00 119.27 ? 237  ASP A N     1 
ATOM   1583  C  CA    . ASP A  1 243  ? 205.787 204.405 166.820 1.00 119.27 ? 237  ASP A CA    1 
ATOM   1584  C  C     . ASP A  1 243  ? 206.279 203.504 165.699 1.00 119.27 ? 237  ASP A C     1 
ATOM   1585  O  O     . ASP A  1 243  ? 205.547 203.229 164.744 1.00 119.27 ? 237  ASP A O     1 
ATOM   1586  C  CB    . ASP A  1 243  ? 204.384 204.014 167.271 1.00 119.27 ? 237  ASP A CB    1 
ATOM   1587  C  CG    . ASP A  1 243  ? 203.956 204.748 168.519 1.00 119.27 ? 237  ASP A CG    1 
ATOM   1588  O  OD1   . ASP A  1 243  ? 204.834 205.089 169.334 1.00 119.27 ? 237  ASP A OD1   1 
ATOM   1589  O  OD2   . ASP A  1 243  ? 202.745 204.991 168.688 1.00 119.27 ? 237  ASP A OD2   1 
ATOM   1590  N  N     . ILE A  1 244  ? 207.520 203.052 165.805 1.00 109.80 ? 238  ILE A N     1 
ATOM   1591  C  CA    . ILE A  1 244  ? 208.097 202.187 164.784 1.00 109.80 ? 238  ILE A CA    1 
ATOM   1592  C  C     . ILE A  1 244  ? 207.728 200.744 165.113 1.00 109.80 ? 238  ILE A C     1 
ATOM   1593  O  O     . ILE A  1 244  ? 208.049 200.244 166.199 1.00 109.80 ? 238  ILE A O     1 
ATOM   1594  C  CB    . ILE A  1 244  ? 209.612 202.411 164.669 1.00 109.80 ? 238  ILE A CB    1 
ATOM   1595  C  CG1   . ILE A  1 244  ? 210.203 201.566 163.545 1.00 109.80 ? 238  ILE A CG1   1 
ATOM   1596  C  CG2   . ILE A  1 244  ? 210.323 202.192 165.993 1.00 109.80 ? 238  ILE A CG2   1 
ATOM   1597  C  CD1   . ILE A  1 244  ? 211.588 201.991 163.168 1.00 109.80 ? 238  ILE A CD1   1 
ATOM   1598  N  N     . PRO A  1 245  ? 207.030 200.052 164.216 1.00 104.38 ? 239  PRO A N     1 
ATOM   1599  C  CA    . PRO A  1 245  ? 206.464 198.747 164.571 1.00 104.38 ? 239  PRO A CA    1 
ATOM   1600  C  C     . PRO A  1 245  ? 207.505 197.646 164.572 1.00 104.38 ? 239  PRO A C     1 
ATOM   1601  O  O     . PRO A  1 245  ? 208.339 197.553 163.668 1.00 104.38 ? 239  PRO A O     1 
ATOM   1602  C  CB    . PRO A  1 245  ? 205.416 198.514 163.480 1.00 104.38 ? 239  PRO A CB    1 
ATOM   1603  C  CG    . PRO A  1 245  ? 205.927 199.279 162.318 1.00 104.38 ? 239  PRO A CG    1 
ATOM   1604  C  CD    . PRO A  1 245  ? 206.609 200.495 162.879 1.00 104.38 ? 239  PRO A CD    1 
ATOM   1605  N  N     . MET A  1 246  ? 207.442 196.797 165.591 1.00 103.35 ? 240  MET A N     1 
ATOM   1606  C  CA    . MET A  1 246  ? 208.304 195.632 165.626 1.00 103.35 ? 240  MET A CA    1 
ATOM   1607  C  C     . MET A  1 246  ? 207.828 194.604 164.611 1.00 103.35 ? 240  MET A C     1 
ATOM   1608  O  O     . MET A  1 246  ? 206.630 194.446 164.369 1.00 103.35 ? 240  MET A O     1 
ATOM   1609  C  CB    . MET A  1 246  ? 208.335 195.000 167.018 1.00 103.35 ? 240  MET A CB    1 
ATOM   1610  C  CG    . MET A  1 246  ? 207.027 194.377 167.452 1.00 103.35 ? 240  MET A CG    1 
ATOM   1611  S  SD    . MET A  1 246  ? 207.160 193.538 169.039 1.00 103.35 ? 240  MET A SD    1 
ATOM   1612  C  CE    . MET A  1 246  ? 208.102 192.094 168.571 1.00 103.35 ? 240  MET A CE    1 
ATOM   1613  N  N     . GLU A  1 247  ? 208.782 193.907 164.012 1.00 104.27 ? 241  GLU A N     1 
ATOM   1614  C  CA    . GLU A  1 247  ? 208.450 192.866 163.056 1.00 104.27 ? 241  GLU A CA    1 
ATOM   1615  C  C     . GLU A  1 247  ? 208.037 191.608 163.804 1.00 104.27 ? 241  GLU A C     1 
ATOM   1616  O  O     . GLU A  1 247  ? 208.884 190.892 164.352 1.00 104.27 ? 241  GLU A O     1 
ATOM   1617  C  CB    . GLU A  1 247  ? 209.630 192.586 162.137 1.00 104.27 ? 241  GLU A CB    1 
ATOM   1618  C  CG    . GLU A  1 247  ? 209.344 191.504 161.125 1.00 104.27 ? 241  GLU A CG    1 
ATOM   1619  C  CD    . GLU A  1 247  ? 208.260 191.902 160.148 1.00 104.27 ? 241  GLU A CD    1 
ATOM   1620  O  OE1   . GLU A  1 247  ? 208.093 193.116 159.900 1.00 104.27 ? 241  GLU A OE1   1 
ATOM   1621  O  OE2   . GLU A  1 247  ? 207.568 190.999 159.631 1.00 104.27 ? 241  GLU A OE2   1 
ATOM   1622  N  N     . ASN A  1 248  ? 206.738 191.335 163.824 1.00 111.18 ? 242  ASN A N     1 
ATOM   1623  C  CA    . ASN A  1 248  ? 206.211 190.158 164.489 1.00 111.18 ? 242  ASN A CA    1 
ATOM   1624  C  C     . ASN A  1 248  ? 205.388 189.358 163.495 1.00 111.18 ? 242  ASN A C     1 
ATOM   1625  O  O     . ASN A  1 248  ? 204.614 189.914 162.713 1.00 111.18 ? 242  ASN A O     1 
ATOM   1626  C  CB    . ASN A  1 248  ? 205.360 190.528 165.705 1.00 111.18 ? 242  ASN A CB    1 
ATOM   1627  C  CG    . ASN A  1 248  ? 205.009 189.329 166.546 1.00 111.18 ? 242  ASN A CG    1 
ATOM   1628  O  OD1   . ASN A  1 248  ? 205.379 188.201 166.219 1.00 111.18 ? 242  ASN A OD1   1 
ATOM   1629  N  ND2   . ASN A  1 248  ? 204.295 189.559 167.638 1.00 111.18 ? 242  ASN A ND2   1 
ATOM   1630  N  N     . GLY A  1 249  ? 205.569 188.035 163.535 1.00 106.89 ? 243  GLY A N     1 
ATOM   1631  C  CA    . GLY A  1 249  ? 204.897 187.173 162.580 1.00 106.89 ? 243  GLY A CA    1 
ATOM   1632  C  C     . GLY A  1 249  ? 203.403 187.399 162.528 1.00 106.89 ? 243  GLY A C     1 
ATOM   1633  O  O     . GLY A  1 249  ? 202.793 187.309 161.461 1.00 106.89 ? 243  GLY A O     1 
ATOM   1634  N  N     . VAL A  1 250  ? 202.796 187.704 163.668 1.00 96.25  ? 244  VAL A N     1 
ATOM   1635  C  CA    . VAL A  1 250  ? 201.401 188.114 163.694 1.00 96.25  ? 244  VAL A CA    1 
ATOM   1636  C  C     . VAL A  1 250  ? 201.255 189.562 163.266 1.00 96.25  ? 244  VAL A C     1 
ATOM   1637  O  O     . VAL A  1 250  ? 200.298 189.931 162.581 1.00 96.25  ? 244  VAL A O     1 
ATOM   1638  C  CB    . VAL A  1 250  ? 200.816 187.883 165.104 1.00 96.25  ? 244  VAL A CB    1 
ATOM   1639  C  CG1   . VAL A  1 250  ? 199.390 188.392 165.181 1.00 96.25  ? 244  VAL A CG1   1 
ATOM   1640  C  CG2   . VAL A  1 250  ? 200.884 186.413 165.470 1.00 96.25  ? 244  VAL A CG2   1 
ATOM   1641  N  N     . GLY A  1 251  ? 202.218 190.389 163.643 1.00 102.34 ? 245  GLY A N     1 
ATOM   1642  C  CA    . GLY A  1 251  ? 202.133 191.823 163.469 1.00 102.34 ? 245  GLY A CA    1 
ATOM   1643  C  C     . GLY A  1 251  ? 201.905 192.573 164.758 1.00 102.34 ? 245  GLY A C     1 
ATOM   1644  O  O     . GLY A  1 251  ? 202.148 193.786 164.803 1.00 102.34 ? 245  GLY A O     1 
ATOM   1645  N  N     . GLY A  1 252  ? 201.458 191.898 165.811 1.00 104.75 ? 246  GLY A N     1 
ATOM   1646  C  CA    . GLY A  1 252  ? 201.217 192.553 167.078 1.00 104.75 ? 246  GLY A CA    1 
ATOM   1647  C  C     . GLY A  1 252  ? 202.500 192.912 167.792 1.00 104.75 ? 246  GLY A C     1 
ATOM   1648  O  O     . GLY A  1 252  ? 203.590 192.754 167.237 1.00 104.75 ? 246  GLY A O     1 
ATOM   1649  N  N     . ASN A  1 253  ? 202.386 193.381 169.033 1.00 95.81  ? 247  ASN A N     1 
ATOM   1650  C  CA    . ASN A  1 253  ? 203.552 193.873 169.750 1.00 95.81  ? 247  ASN A CA    1 
ATOM   1651  C  C     . ASN A  1 253  ? 203.859 193.076 171.009 1.00 95.81  ? 247  ASN A C     1 
ATOM   1652  O  O     . ASN A  1 253  ? 204.778 193.448 171.746 1.00 95.81  ? 247  ASN A O     1 
ATOM   1653  C  CB    . ASN A  1 253  ? 203.363 195.348 170.102 1.00 95.81  ? 247  ASN A CB    1 
ATOM   1654  C  CG    . ASN A  1 253  ? 203.385 196.244 168.881 1.00 95.81  ? 247  ASN A CG    1 
ATOM   1655  O  OD1   . ASN A  1 253  ? 202.365 196.809 168.491 1.00 95.81  ? 247  ASN A OD1   1 
ATOM   1656  N  ND2   . ASN A  1 253  ? 204.558 196.397 168.284 1.00 95.81  ? 247  ASN A ND2   1 
ATOM   1657  N  N     . SER A  1 254  ? 203.133 192.000 171.275 1.00 100.52 ? 248  SER A N     1 
ATOM   1658  C  CA    . SER A  1 254  ? 203.408 191.150 172.421 1.00 100.52 ? 248  SER A CA    1 
ATOM   1659  C  C     . SER A  1 254  ? 204.553 190.205 172.105 1.00 100.52 ? 248  SER A C     1 
ATOM   1660  O  O     . SER A  1 254  ? 204.738 189.797 170.956 1.00 100.52 ? 248  SER A O     1 
ATOM   1661  C  CB    . SER A  1 254  ? 202.169 190.345 172.809 1.00 100.52 ? 248  SER A CB    1 
ATOM   1662  O  OG    . SER A  1 254  ? 201.123 191.195 173.236 1.00 100.52 ? 248  SER A OG    1 
ATOM   1663  N  N     . ILE A  1 255  ? 205.326 189.864 173.132 1.00 99.84  ? 249  ILE A N     1 
ATOM   1664  C  CA    . ILE A  1 255  ? 206.369 188.860 173.033 1.00 99.84  ? 249  ILE A CA    1 
ATOM   1665  C  C     . ILE A  1 255  ? 206.188 187.868 174.176 1.00 99.84  ? 249  ILE A C     1 
ATOM   1666  O  O     . ILE A  1 255  ? 205.306 188.013 175.021 1.00 99.84  ? 249  ILE A O     1 
ATOM   1667  C  CB    . ILE A  1 255  ? 207.782 189.466 173.071 1.00 99.84  ? 249  ILE A CB    1 
ATOM   1668  C  CG1   . ILE A  1 255  ? 208.063 190.019 174.461 1.00 99.84  ? 249  ILE A CG1   1 
ATOM   1669  C  CG2   . ILE A  1 255  ? 207.916 190.569 172.050 1.00 99.84  ? 249  ILE A CG2   1 
ATOM   1670  C  CD1   . ILE A  1 255  ? 209.513 190.313 174.706 1.00 99.84  ? 249  ILE A CD1   1 
ATOM   1671  N  N     . PHE A  1 256  ? 207.050 186.855 174.195 1.00 108.08 ? 250  PHE A N     1 
ATOM   1672  C  CA    . PHE A  1 256  ? 207.096 185.864 175.272 1.00 108.08 ? 250  PHE A CA    1 
ATOM   1673  C  C     . PHE A  1 256  ? 208.566 185.703 175.647 1.00 108.08 ? 250  PHE A C     1 
ATOM   1674  O  O     . PHE A  1 256  ? 209.272 184.861 175.089 1.00 108.08 ? 250  PHE A O     1 
ATOM   1675  C  CB    . PHE A  1 256  ? 206.468 184.550 174.843 1.00 108.08 ? 250  PHE A CB    1 
ATOM   1676  C  CG    . PHE A  1 256  ? 206.567 183.465 175.868 1.00 108.08 ? 250  PHE A CG    1 
ATOM   1677  C  CD1   . PHE A  1 256  ? 205.784 183.489 177.005 1.00 108.08 ? 250  PHE A CD1   1 
ATOM   1678  C  CD2   . PHE A  1 256  ? 207.431 182.406 175.684 1.00 108.08 ? 250  PHE A CD2   1 
ATOM   1679  C  CE1   . PHE A  1 256  ? 205.874 182.482 177.943 1.00 108.08 ? 250  PHE A CE1   1 
ATOM   1680  C  CE2   . PHE A  1 256  ? 207.520 181.400 176.616 1.00 108.08 ? 250  PHE A CE2   1 
ATOM   1681  C  CZ    . PHE A  1 256  ? 206.742 181.437 177.747 1.00 108.08 ? 250  PHE A CZ    1 
ATOM   1682  N  N     . LEU A  1 257  ? 209.020 186.519 176.591 1.00 120.77 ? 251  LEU A N     1 
ATOM   1683  C  CA    . LEU A  1 257  ? 210.431 186.587 176.944 1.00 120.77 ? 251  LEU A CA    1 
ATOM   1684  C  C     . LEU A  1 257  ? 210.733 185.618 178.078 1.00 120.77 ? 251  LEU A C     1 
ATOM   1685  O  O     . LEU A  1 257  ? 210.373 185.867 179.233 1.00 120.77 ? 251  LEU A O     1 
ATOM   1686  C  CB    . LEU A  1 257  ? 210.827 188.006 177.333 1.00 120.77 ? 251  LEU A CB    1 
ATOM   1687  C  CG    . LEU A  1 257  ? 212.295 188.109 177.730 1.00 120.77 ? 251  LEU A CG    1 
ATOM   1688  C  CD1   . LEU A  1 257  ? 213.172 187.638 176.595 1.00 120.77 ? 251  LEU A CD1   1 
ATOM   1689  C  CD2   . LEU A  1 257  ? 212.631 189.538 178.080 1.00 120.77 ? 251  LEU A CD2   1 
ATOM   1690  N  N     . VAL A  1 258  ? 211.404 184.524 177.749 1.00 120.47 ? 252  VAL A N     1 
ATOM   1691  C  CA    . VAL A  1 258  ? 211.966 183.647 178.764 1.00 120.47 ? 252  VAL A CA    1 
ATOM   1692  C  C     . VAL A  1 258  ? 213.475 183.688 178.600 1.00 120.47 ? 252  VAL A C     1 
ATOM   1693  O  O     . VAL A  1 258  ? 214.198 184.113 179.509 1.00 120.47 ? 252  VAL A O     1 
ATOM   1694  C  CB    . VAL A  1 258  ? 211.411 182.220 178.646 1.00 120.47 ? 252  VAL A CB    1 
ATOM   1695  C  CG1   . VAL A  1 258  ? 212.123 181.295 179.608 1.00 120.47 ? 252  VAL A CG1   1 
ATOM   1696  C  CG2   . VAL A  1 258  ? 209.933 182.231 178.930 1.00 120.47 ? 252  VAL A CG2   1 
ATOM   1697  N  N     . ALA A  1 259  ? 213.947 183.281 177.454 1.00 117.38 ? 253  ALA A N     1 
ATOM   1698  C  CA    . ALA A  1 259  ? 215.358 183.497 177.192 1.00 117.38 ? 253  ALA A CA    1 
ATOM   1699  C  C     . ALA A  1 259  ? 215.559 184.847 176.517 1.00 117.38 ? 253  ALA A C     1 
ATOM   1700  O  O     . ALA A  1 259  ? 214.873 185.170 175.544 1.00 117.38 ? 253  ALA A O     1 
ATOM   1701  C  CB    . ALA A  1 259  ? 215.923 182.393 176.297 1.00 117.38 ? 253  ALA A CB    1 
ATOM   1702  N  N     . PRO A  1 260  ? 216.499 185.642 177.018 1.00 114.74 ? 254  PRO A N     1 
ATOM   1703  C  CA    . PRO A  1 260  ? 216.691 186.998 176.487 1.00 114.74 ? 254  PRO A CA    1 
ATOM   1704  C  C     . PRO A  1 260  ? 216.928 187.022 174.989 1.00 114.74 ? 254  PRO A C     1 
ATOM   1705  O  O     . PRO A  1 260  ? 217.962 186.563 174.491 1.00 114.74 ? 254  PRO A O     1 
ATOM   1706  C  CB    . PRO A  1 260  ? 217.907 187.507 177.268 1.00 114.74 ? 254  PRO A CB    1 
ATOM   1707  C  CG    . PRO A  1 260  ? 218.593 186.292 177.763 1.00 114.74 ? 254  PRO A CG    1 
ATOM   1708  C  CD    . PRO A  1 260  ? 217.505 185.300 178.030 1.00 114.74 ? 254  PRO A CD    1 
ATOM   1709  N  N     . LEU A  1 261  ? 215.965 187.581 174.265 1.00 108.84 ? 255  LEU A N     1 
ATOM   1710  C  CA    . LEU A  1 261  ? 215.910 187.486 172.818 1.00 108.84 ? 255  LEU A CA    1 
ATOM   1711  C  C     . LEU A  1 261  ? 216.225 188.834 172.174 1.00 108.84 ? 255  LEU A C     1 
ATOM   1712  O  O     . LEU A  1 261  ? 216.588 189.806 172.840 1.00 108.84 ? 255  LEU A O     1 
ATOM   1713  C  CB    . LEU A  1 261  ? 214.542 186.953 172.401 1.00 108.84 ? 255  LEU A CB    1 
ATOM   1714  C  CG    . LEU A  1 261  ? 213.312 187.724 172.886 1.00 108.84 ? 255  LEU A CG    1 
ATOM   1715  C  CD1   . LEU A  1 261  ? 212.923 188.821 171.913 1.00 108.84 ? 255  LEU A CD1   1 
ATOM   1716  C  CD2   . LEU A  1 261  ? 212.147 186.786 173.140 1.00 108.84 ? 255  LEU A CD2   1 
ATOM   1717  N  N     . ILE A  1 262  ? 216.085 188.893 170.853 1.00 110.65 ? 256  ILE A N     1 
ATOM   1718  C  CA    . ILE A  1 262  ? 216.386 190.089 170.074 1.00 110.65 ? 256  ILE A CA    1 
ATOM   1719  C  C     . ILE A  1 262  ? 215.079 190.683 169.568 1.00 110.65 ? 256  ILE A C     1 
ATOM   1720  O  O     . ILE A  1 262  ? 214.264 189.984 168.954 1.00 110.65 ? 256  ILE A O     1 
ATOM   1721  C  CB    . ILE A  1 262  ? 217.338 189.795 168.907 1.00 110.65 ? 256  ILE A CB    1 
ATOM   1722  C  CG1   . ILE A  1 262  ? 218.735 189.459 169.432 1.00 110.65 ? 256  ILE A CG1   1 
ATOM   1723  C  CG2   . ILE A  1 262  ? 217.384 190.965 167.944 1.00 110.65 ? 256  ILE A CG2   1 
ATOM   1724  C  CD1   . ILE A  1 262  ? 219.685 188.972 168.364 1.00 110.65 ? 256  ILE A CD1   1 
ATOM   1725  N  N     . ILE A  1 263  ? 214.877 191.974 169.832 1.00 112.28 ? 257  ILE A N     1 
ATOM   1726  C  CA    . ILE A  1 263  ? 213.789 192.716 169.209 1.00 112.28 ? 257  ILE A CA    1 
ATOM   1727  C  C     . ILE A  1 263  ? 214.317 193.423 167.973 1.00 112.28 ? 257  ILE A C     1 
ATOM   1728  O  O     . ILE A  1 263  ? 215.442 193.940 167.969 1.00 112.28 ? 257  ILE A O     1 
ATOM   1729  C  CB    . ILE A  1 263  ? 213.186 193.717 170.205 1.00 112.28 ? 257  ILE A CB    1 
ATOM   1730  C  CG1   . ILE A  1 263  ? 212.619 192.974 171.406 1.00 112.28 ? 257  ILE A CG1   1 
ATOM   1731  C  CG2   . ILE A  1 263  ? 212.105 194.543 169.545 1.00 112.28 ? 257  ILE A CG2   1 
ATOM   1732  C  CD1   . ILE A  1 263  ? 211.511 192.021 171.036 1.00 112.28 ? 257  ILE A CD1   1 
ATOM   1733  N  N     . TYR A  1 264  ? 213.517 193.451 166.912 1.00 108.71 ? 258  TYR A N     1 
ATOM   1734  C  CA    . TYR A  1 264  ? 214.018 194.018 165.673 1.00 108.71 ? 258  TYR A CA    1 
ATOM   1735  C  C     . TYR A  1 264  ? 212.897 194.639 164.860 1.00 108.71 ? 258  TYR A C     1 
ATOM   1736  O  O     . TYR A  1 264  ? 211.761 194.158 164.861 1.00 108.71 ? 258  TYR A O     1 
ATOM   1737  C  CB    . TYR A  1 264  ? 214.737 192.966 164.834 1.00 108.71 ? 258  TYR A CB    1 
ATOM   1738  C  CG    . TYR A  1 264  ? 213.865 191.878 164.268 1.00 108.71 ? 258  TYR A CG    1 
ATOM   1739  C  CD1   . TYR A  1 264  ? 213.574 190.742 165.003 1.00 108.71 ? 258  TYR A CD1   1 
ATOM   1740  C  CD2   . TYR A  1 264  ? 213.374 191.965 162.976 1.00 108.71 ? 258  TYR A CD2   1 
ATOM   1741  C  CE1   . TYR A  1 264  ? 212.790 189.737 164.478 1.00 108.71 ? 258  TYR A CE1   1 
ATOM   1742  C  CE2   . TYR A  1 264  ? 212.597 190.964 162.439 1.00 108.71 ? 258  TYR A CE2   1 
ATOM   1743  C  CZ    . TYR A  1 264  ? 212.308 189.852 163.192 1.00 108.71 ? 258  TYR A CZ    1 
ATOM   1744  O  OH    . TYR A  1 264  ? 211.528 188.851 162.661 1.00 108.71 ? 258  TYR A OH    1 
ATOM   1745  N  N     . HIS A  1 265  ? 213.243 195.703 164.150 1.00 109.94 ? 259  HIS A N     1 
ATOM   1746  C  CA    . HIS A  1 265  ? 212.360 196.340 163.191 1.00 109.94 ? 259  HIS A CA    1 
ATOM   1747  C  C     . HIS A  1 265  ? 212.913 196.192 161.783 1.00 109.94 ? 259  HIS A C     1 
ATOM   1748  O  O     . HIS A  1 265  ? 214.091 196.458 161.538 1.00 109.94 ? 259  HIS A O     1 
ATOM   1749  C  CB    . HIS A  1 265  ? 212.181 197.816 163.482 1.00 109.94 ? 259  HIS A CB    1 
ATOM   1750  C  CG    . HIS A  1 265  ? 211.403 198.525 162.424 1.00 109.94 ? 259  HIS A CG    1 
ATOM   1751  N  ND1   . HIS A  1 265  ? 210.035 198.420 162.309 1.00 109.94 ? 259  HIS A ND1   1 
ATOM   1752  C  CD2   . HIS A  1 265  ? 211.809 199.297 161.391 1.00 109.94 ? 259  HIS A CD2   1 
ATOM   1753  C  CE1   . HIS A  1 265  ? 209.627 199.128 161.273 1.00 109.94 ? 259  HIS A CE1   1 
ATOM   1754  N  NE2   . HIS A  1 265  ? 210.683 199.673 160.699 1.00 109.94 ? 259  HIS A NE2   1 
ATOM   1755  N  N     . VAL A  1 266  ? 212.046 195.792 160.860 1.00 109.61 ? 260  VAL A N     1 
ATOM   1756  C  CA    . VAL A  1 266  ? 212.383 195.736 159.443 1.00 109.61 ? 260  VAL A CA    1 
ATOM   1757  C  C     . VAL A  1 266  ? 212.153 197.125 158.866 1.00 109.61 ? 260  VAL A C     1 
ATOM   1758  O  O     . VAL A  1 266  ? 211.054 197.674 158.967 1.00 109.61 ? 260  VAL A O     1 
ATOM   1759  C  CB    . VAL A  1 266  ? 211.550 194.682 158.708 1.00 109.61 ? 260  VAL A CB    1 
ATOM   1760  C  CG1   . VAL A  1 266  ? 211.844 194.722 157.221 1.00 109.61 ? 260  VAL A CG1   1 
ATOM   1761  C  CG2   . VAL A  1 266  ? 211.837 193.309 159.272 1.00 109.61 ? 260  VAL A CG2   1 
ATOM   1762  N  N     . ILE A  1 267  ? 213.187 197.693 158.252 1.00 115.23 ? 261  ILE A N     1 
ATOM   1763  C  CA    . ILE A  1 267  ? 213.137 199.072 157.786 1.00 115.23 ? 261  ILE A CA    1 
ATOM   1764  C  C     . ILE A  1 267  ? 212.488 199.139 156.411 1.00 115.23 ? 261  ILE A C     1 
ATOM   1765  O  O     . ILE A  1 267  ? 213.138 198.878 155.392 1.00 115.23 ? 261  ILE A O     1 
ATOM   1766  C  CB    . ILE A  1 267  ? 214.546 199.680 157.755 1.00 115.23 ? 261  ILE A CB    1 
ATOM   1767  C  CG1   . ILE A  1 267  ? 215.186 199.561 159.133 1.00 115.23 ? 261  ILE A CG1   1 
ATOM   1768  C  CG2   . ILE A  1 267  ? 214.478 201.136 157.353 1.00 115.23 ? 261  ILE A CG2   1 
ATOM   1769  C  CD1   . ILE A  1 267  ? 216.663 199.822 159.130 1.00 115.23 ? 261  ILE A CD1   1 
ATOM   1770  N  N     . ASP A  1 268  ? 211.214 199.505 156.368 1.00 125.20 ? 262  ASP A N     1 
ATOM   1771  C  CA    . ASP A  1 268  ? 210.453 199.585 155.130 1.00 125.20 ? 262  ASP A CA    1 
ATOM   1772  C  C     . ASP A  1 268  ? 210.321 201.040 154.691 1.00 125.20 ? 262  ASP A C     1 
ATOM   1773  O  O     . ASP A  1 268  ? 210.599 201.975 155.448 1.00 125.20 ? 262  ASP A O     1 
ATOM   1774  C  CB    . ASP A  1 268  ? 209.077 198.939 155.303 1.00 125.20 ? 262  ASP A CB    1 
ATOM   1775  N  N     . ALA A  1 269  ? 209.871 201.224 153.448 1.00 123.03 ? 263  ALA A N     1 
ATOM   1776  C  CA    . ALA A  1 269  ? 209.724 202.570 152.907 1.00 123.03 ? 263  ALA A CA    1 
ATOM   1777  C  C     . ALA A  1 269  ? 208.742 203.401 153.720 1.00 123.03 ? 263  ALA A C     1 
ATOM   1778  O  O     . ALA A  1 269  ? 208.707 204.630 153.583 1.00 123.03 ? 263  ALA A O     1 
ATOM   1779  C  CB    . ALA A  1 269  ? 209.284 202.502 151.445 1.00 123.03 ? 263  ALA A CB    1 
ATOM   1780  N  N     . ASN A  1 270  ? 207.928 202.757 154.556 1.00 127.30 ? 264  ASN A N     1 
ATOM   1781  C  CA    . ASN A  1 270  ? 207.081 203.478 155.494 1.00 127.30 ? 264  ASN A CA    1 
ATOM   1782  C  C     . ASN A  1 270  ? 207.781 203.770 156.811 1.00 127.30 ? 264  ASN A C     1 
ATOM   1783  O  O     . ASN A  1 270  ? 207.348 204.672 157.534 1.00 127.30 ? 264  ASN A O     1 
ATOM   1784  C  CB    . ASN A  1 270  ? 205.801 202.690 155.764 1.00 127.30 ? 264  ASN A CB    1 
ATOM   1785  C  CG    . ASN A  1 270  ? 204.915 202.585 154.544 1.00 127.30 ? 264  ASN A CG    1 
ATOM   1786  O  OD1   . ASN A  1 270  ? 204.734 201.505 153.985 1.00 127.30 ? 264  ASN A OD1   1 
ATOM   1787  N  ND2   . ASN A  1 270  ? 204.344 203.709 154.130 1.00 127.30 ? 264  ASN A ND2   1 
ATOM   1788  N  N     . SER A  1 271  ? 208.832 203.041 157.136 1.00 124.55 ? 265  SER A N     1 
ATOM   1789  C  CA    . SER A  1 271  ? 209.562 203.361 158.351 1.00 124.55 ? 265  SER A CA    1 
ATOM   1790  C  C     . SER A  1 271  ? 210.320 204.673 158.178 1.00 124.55 ? 265  SER A C     1 
ATOM   1791  O  O     . SER A  1 271  ? 210.898 204.915 157.117 1.00 124.55 ? 265  SER A O     1 
ATOM   1792  C  CB    . SER A  1 271  ? 210.547 202.251 158.693 1.00 124.55 ? 265  SER A CB    1 
ATOM   1793  O  OG    . SER A  1 271  ? 211.316 202.605 159.829 1.00 124.55 ? 265  SER A OG    1 
ATOM   1794  N  N     . PRO A  1 272  ? 210.323 205.534 159.192 1.00 113.32 ? 266  PRO A N     1 
ATOM   1795  C  CA    . PRO A  1 272  ? 211.105 206.773 159.084 1.00 113.32 ? 266  PRO A CA    1 
ATOM   1796  C  C     . PRO A  1 272  ? 212.585 206.514 158.915 1.00 113.32 ? 266  PRO A C     1 
ATOM   1797  O  O     . PRO A  1 272  ? 213.292 207.345 158.332 1.00 113.32 ? 266  PRO A O     1 
ATOM   1798  C  CB    . PRO A  1 272  ? 210.807 207.493 160.404 1.00 113.32 ? 266  PRO A CB    1 
ATOM   1799  C  CG    . PRO A  1 272  ? 209.522 206.911 160.869 1.00 113.32 ? 266  PRO A CG    1 
ATOM   1800  C  CD    . PRO A  1 272  ? 209.553 205.478 160.441 1.00 113.32 ? 266  PRO A CD    1 
ATOM   1801  N  N     . LEU A  1 273  ? 213.074 205.377 159.398 1.00 119.40 ? 267  LEU A N     1 
ATOM   1802  C  CA    . LEU A  1 273  ? 214.471 204.999 159.273 1.00 119.40 ? 267  LEU A CA    1 
ATOM   1803  C  C     . LEU A  1 273  ? 214.834 204.557 157.871 1.00 119.40 ? 267  LEU A C     1 
ATOM   1804  O  O     . LEU A  1 273  ? 215.956 204.093 157.643 1.00 119.40 ? 267  LEU A O     1 
ATOM   1805  C  CB    . LEU A  1 273  ? 214.802 203.884 160.263 1.00 119.40 ? 267  LEU A CB    1 
ATOM   1806  C  CG    . LEU A  1 273  ? 215.031 204.289 161.717 1.00 119.40 ? 267  LEU A CG    1 
ATOM   1807  C  CD1   . LEU A  1 273  ? 213.734 204.719 162.378 1.00 119.40 ? 267  LEU A CD1   1 
ATOM   1808  C  CD2   . LEU A  1 273  ? 215.660 203.134 162.478 1.00 119.40 ? 267  LEU A CD2   1 
ATOM   1809  N  N     . TYR A  1 274  ? 213.909 204.680 156.923 1.00 129.60 ? 268  TYR A N     1 
ATOM   1810  C  CA    . TYR A  1 274  ? 214.187 204.267 155.560 1.00 129.60 ? 268  TYR A CA    1 
ATOM   1811  C  C     . TYR A  1 274  ? 215.080 205.257 154.826 1.00 129.60 ? 268  TYR A C     1 
ATOM   1812  O  O     . TYR A  1 274  ? 215.548 204.949 153.726 1.00 129.60 ? 268  TYR A O     1 
ATOM   1813  C  CB    . TYR A  1 274  ? 212.869 204.065 154.821 1.00 129.60 ? 268  TYR A CB    1 
ATOM   1814  C  CG    . TYR A  1 274  ? 213.010 203.455 153.461 1.00 129.60 ? 268  TYR A CG    1 
ATOM   1815  C  CD1   . TYR A  1 274  ? 213.293 202.110 153.314 1.00 129.60 ? 268  TYR A CD1   1 
ATOM   1816  C  CD2   . TYR A  1 274  ? 212.849 204.223 152.321 1.00 129.60 ? 268  TYR A CD2   1 
ATOM   1817  C  CE1   . TYR A  1 274  ? 213.423 201.549 152.074 1.00 129.60 ? 268  TYR A CE1   1 
ATOM   1818  C  CE2   . TYR A  1 274  ? 212.974 203.672 151.077 1.00 129.60 ? 268  TYR A CE2   1 
ATOM   1819  C  CZ    . TYR A  1 274  ? 213.261 202.337 150.958 1.00 129.60 ? 268  TYR A CZ    1 
ATOM   1820  O  OH    . TYR A  1 274  ? 213.385 201.798 149.704 1.00 129.60 ? 268  TYR A OH    1 
ATOM   1821  N  N     . ASP A  1 275  ? 215.330 206.430 155.407 1.00 133.35 ? 269  ASP A N     1 
ATOM   1822  C  CA    . ASP A  1 275  ? 216.308 207.371 154.880 1.00 133.35 ? 269  ASP A CA    1 
ATOM   1823  C  C     . ASP A  1 275  ? 217.618 207.321 155.654 1.00 133.35 ? 269  ASP A C     1 
ATOM   1824  O  O     . ASP A  1 275  ? 218.547 208.075 155.348 1.00 133.35 ? 269  ASP A O     1 
ATOM   1825  C  CB    . ASP A  1 275  ? 215.747 208.793 154.888 1.00 133.35 ? 269  ASP A CB    1 
ATOM   1826  C  CG    . ASP A  1 275  ? 214.677 209.000 153.841 1.00 133.35 ? 269  ASP A CG    1 
ATOM   1827  O  OD1   . ASP A  1 275  ? 214.722 208.312 152.801 1.00 133.35 ? 269  ASP A OD1   1 
ATOM   1828  O  OD2   . ASP A  1 275  ? 213.797 209.857 154.053 1.00 133.35 ? 269  ASP A OD2   1 
ATOM   1829  N  N     . LEU A  1 276  ? 217.712 206.442 156.644 1.00 130.38 ? 270  LEU A N     1 
ATOM   1830  C  CA    . LEU A  1 276  ? 218.924 206.324 157.437 1.00 130.38 ? 270  LEU A CA    1 
ATOM   1831  C  C     . LEU A  1 276  ? 220.023 205.643 156.633 1.00 130.38 ? 270  LEU A C     1 
ATOM   1832  O  O     . LEU A  1 276  ? 219.757 204.789 155.785 1.00 130.38 ? 270  LEU A O     1 
ATOM   1833  C  CB    . LEU A  1 276  ? 218.642 205.542 158.722 1.00 130.38 ? 270  LEU A CB    1 
ATOM   1834  C  CG    . LEU A  1 276  ? 219.740 205.463 159.782 1.00 130.38 ? 270  LEU A CG    1 
ATOM   1835  C  CD1   . LEU A  1 276  ? 219.105 205.380 161.148 1.00 130.38 ? 270  LEU A CD1   1 
ATOM   1836  C  CD2   . LEU A  1 276  ? 220.648 204.261 159.561 1.00 130.38 ? 270  LEU A CD2   1 
ATOM   1837  N  N     . ALA A  1 277  ? 221.258 206.036 156.907 1.00 132.94 ? 271  ALA A N     1 
ATOM   1838  C  CA    . ALA A  1 277  ? 222.450 205.480 156.289 1.00 132.94 ? 271  ALA A CA    1 
ATOM   1839  C  C     . ALA A  1 277  ? 223.484 205.269 157.380 1.00 132.94 ? 271  ALA A C     1 
ATOM   1840  O  O     . ALA A  1 277  ? 223.421 205.912 158.432 1.00 132.94 ? 271  ALA A O     1 
ATOM   1841  C  CB    . ALA A  1 277  ? 223.018 206.416 155.215 1.00 132.94 ? 271  ALA A CB    1 
ATOM   1842  N  N     . PRO A  1 278  ? 224.445 204.380 157.165 1.00 133.80 ? 272  PRO A N     1 
ATOM   1843  C  CA    . PRO A  1 278  ? 225.595 204.330 158.066 1.00 133.80 ? 272  PRO A CA    1 
ATOM   1844  C  C     . PRO A  1 278  ? 226.345 205.646 158.010 1.00 133.80 ? 272  PRO A C     1 
ATOM   1845  O  O     . PRO A  1 278  ? 226.229 206.422 157.060 1.00 133.80 ? 272  PRO A O     1 
ATOM   1846  C  CB    . PRO A  1 278  ? 226.441 203.184 157.516 1.00 133.80 ? 272  PRO A CB    1 
ATOM   1847  C  CG    . PRO A  1 278  ? 226.074 203.114 156.100 1.00 133.80 ? 272  PRO A CG    1 
ATOM   1848  C  CD    . PRO A  1 278  ? 224.623 203.479 156.016 1.00 133.80 ? 272  PRO A CD    1 
ATOM   1849  N  N     . SER A  1 279  ? 227.067 205.923 159.092 1.00 152.16 ? 273  SER A N     1 
ATOM   1850  C  CA    . SER A  1 279  ? 227.906 207.109 159.222 1.00 152.16 ? 273  SER A CA    1 
ATOM   1851  C  C     . SER A  1 279  ? 227.037 208.355 159.339 1.00 152.16 ? 273  SER A C     1 
ATOM   1852  O  O     . SER A  1 279  ? 227.539 209.450 159.613 1.00 152.16 ? 273  SER A O     1 
ATOM   1853  C  CB    . SER A  1 279  ? 228.883 207.238 158.050 1.00 152.16 ? 273  SER A CB    1 
ATOM   1854  O  OG    . SER A  1 279  ? 228.200 207.532 156.842 1.00 152.16 ? 273  SER A OG    1 
ATOM   1855  N  N     . ASP A  1 280  ? 225.729 208.194 159.139 1.00 146.12 ? 274  ASP A N     1 
ATOM   1856  C  CA    . ASP A  1 280  ? 224.793 209.234 159.539 1.00 146.12 ? 274  ASP A CA    1 
ATOM   1857  C  C     . ASP A  1 280  ? 224.543 209.151 161.034 1.00 146.12 ? 274  ASP A C     1 
ATOM   1858  O  O     . ASP A  1 280  ? 224.320 210.173 161.690 1.00 146.12 ? 274  ASP A O     1 
ATOM   1859  C  CB    . ASP A  1 280  ? 223.489 209.090 158.750 1.00 146.12 ? 274  ASP A CB    1 
ATOM   1860  C  CG    . ASP A  1 280  ? 222.586 210.304 158.875 1.00 146.12 ? 274  ASP A CG    1 
ATOM   1861  O  OD1   . ASP A  1 280  ? 222.959 211.263 159.582 1.00 146.12 ? 274  ASP A OD1   1 
ATOM   1862  O  OD2   . ASP A  1 280  ? 221.501 210.299 158.258 1.00 146.12 ? 274  ASP A OD2   1 
ATOM   1863  N  N     . LEU A  1 281  ? 224.608 207.944 161.587 1.00 129.02 ? 275  LEU A N     1 
ATOM   1864  C  CA    . LEU A  1 281  ? 224.488 207.745 163.020 1.00 129.02 ? 275  LEU A CA    1 
ATOM   1865  C  C     . LEU A  1 281  ? 225.750 208.225 163.719 1.00 129.02 ? 275  LEU A C     1 
ATOM   1866  O  O     . LEU A  1 281  ? 226.867 207.928 163.279 1.00 129.02 ? 275  LEU A O     1 
ATOM   1867  C  CB    . LEU A  1 281  ? 224.217 206.270 163.324 1.00 129.02 ? 275  LEU A CB    1 
ATOM   1868  C  CG    . LEU A  1 281  ? 225.202 205.194 162.856 1.00 129.02 ? 275  LEU A CG    1 
ATOM   1869  C  CD1   . LEU A  1 281  ? 226.283 204.907 163.889 1.00 129.02 ? 275  LEU A CD1   1 
ATOM   1870  C  CD2   . LEU A  1 281  ? 224.461 203.921 162.487 1.00 129.02 ? 275  LEU A CD2   1 
ATOM   1871  N  N     . HIS A  1 282  ? 225.568 208.991 164.789 1.00 140.95 ? 276  HIS A N     1 
ATOM   1872  C  CA    . HIS A  1 282  ? 226.645 209.510 165.619 1.00 140.95 ? 276  HIS A CA    1 
ATOM   1873  C  C     . HIS A  1 282  ? 226.010 210.269 166.774 1.00 140.95 ? 276  HIS A C     1 
ATOM   1874  O  O     . HIS A  1 282  ? 224.851 210.686 166.704 1.00 140.95 ? 276  HIS A O     1 
ATOM   1875  C  CB    . HIS A  1 282  ? 227.604 210.403 164.827 1.00 140.95 ? 276  HIS A CB    1 
ATOM   1876  C  CG    . HIS A  1 282  ? 226.945 211.578 164.178 1.00 140.95 ? 276  HIS A CG    1 
ATOM   1877  N  ND1   . HIS A  1 282  ? 226.312 211.494 162.957 1.00 140.95 ? 276  HIS A ND1   1 
ATOM   1878  C  CD2   . HIS A  1 282  ? 226.826 212.866 164.575 1.00 140.95 ? 276  HIS A CD2   1 
ATOM   1879  C  CE1   . HIS A  1 282  ? 225.838 212.681 162.627 1.00 140.95 ? 276  HIS A CE1   1 
ATOM   1880  N  NE2   . HIS A  1 282  ? 226.127 213.530 163.597 1.00 140.95 ? 276  HIS A NE2   1 
ATOM   1881  N  N     . HIS A  1 283  ? 226.790 210.461 167.839 1.00 150.52 ? 277  HIS A N     1 
ATOM   1882  C  CA    . HIS A  1 283  ? 226.230 211.061 169.045 1.00 150.52 ? 277  HIS A CA    1 
ATOM   1883  C  C     . HIS A  1 283  ? 225.852 212.525 168.854 1.00 150.52 ? 277  HIS A C     1 
ATOM   1884  O  O     . HIS A  1 283  ? 225.382 213.156 169.803 1.00 150.52 ? 277  HIS A O     1 
ATOM   1885  C  CB    . HIS A  1 283  ? 227.203 210.939 170.218 1.00 150.52 ? 277  HIS A CB    1 
ATOM   1886  C  CG    . HIS A  1 283  ? 226.605 211.341 171.531 1.00 150.52 ? 277  HIS A CG    1 
ATOM   1887  N  ND1   . HIS A  1 283  ? 226.541 212.655 171.944 1.00 150.52 ? 277  HIS A ND1   1 
ATOM   1888  C  CD2   . HIS A  1 283  ? 226.029 210.611 172.512 1.00 150.52 ? 277  HIS A CD2   1 
ATOM   1889  C  CE1   . HIS A  1 283  ? 225.957 212.715 173.126 1.00 150.52 ? 277  HIS A CE1   1 
ATOM   1890  N  NE2   . HIS A  1 283  ? 225.639 211.488 173.495 1.00 150.52 ? 277  HIS A NE2   1 
ATOM   1891  N  N     . HIS A  1 284  ? 226.055 213.087 167.672 1.00 150.24 ? 278  HIS A N     1 
ATOM   1892  C  CA    . HIS A  1 284  ? 225.640 214.456 167.396 1.00 150.24 ? 278  HIS A CA    1 
ATOM   1893  C  C     . HIS A  1 284  ? 224.607 214.501 166.277 1.00 150.24 ? 278  HIS A C     1 
ATOM   1894  O  O     . HIS A  1 284  ? 224.302 215.558 165.722 1.00 150.24 ? 278  HIS A O     1 
ATOM   1895  C  CB    . HIS A  1 284  ? 226.853 215.321 167.083 1.00 150.24 ? 278  HIS A CB    1 
ATOM   1896  C  CG    . HIS A  1 284  ? 227.741 215.534 168.267 1.00 150.24 ? 278  HIS A CG    1 
ATOM   1897  N  ND1   . HIS A  1 284  ? 228.995 216.097 168.170 1.00 150.24 ? 278  HIS A ND1   1 
ATOM   1898  C  CD2   . HIS A  1 284  ? 227.549 215.264 169.580 1.00 150.24 ? 278  HIS A CD2   1 
ATOM   1899  C  CE1   . HIS A  1 284  ? 229.539 216.158 169.372 1.00 150.24 ? 278  HIS A CE1   1 
ATOM   1900  N  NE2   . HIS A  1 284  ? 228.683 215.660 170.244 1.00 150.24 ? 278  HIS A NE2   1 
ATOM   1901  N  N     . GLN A  1 285  ? 224.048 213.340 165.950 1.00 142.97 ? 279  GLN A N     1 
ATOM   1902  C  CA    . GLN A  1 285  ? 222.962 213.222 164.992 1.00 142.97 ? 279  GLN A CA    1 
ATOM   1903  C  C     . GLN A  1 285  ? 221.655 213.184 165.763 1.00 142.97 ? 279  GLN A C     1 
ATOM   1904  O  O     . GLN A  1 285  ? 221.462 212.306 166.615 1.00 142.97 ? 279  GLN A O     1 
ATOM   1905  C  CB    . GLN A  1 285  ? 223.099 211.966 164.139 1.00 142.97 ? 279  GLN A CB    1 
ATOM   1906  C  CG    . GLN A  1 285  ? 222.057 211.878 163.048 1.00 142.97 ? 279  GLN A CG    1 
ATOM   1907  C  CD    . GLN A  1 285  ? 222.183 213.013 162.060 1.00 142.97 ? 279  GLN A CD    1 
ATOM   1908  O  OE1   . GLN A  1 285  ? 221.414 213.973 162.098 1.00 142.97 ? 279  GLN A OE1   1 
ATOM   1909  N  NE2   . GLN A  1 285  ? 223.156 212.910 161.162 1.00 142.97 ? 279  GLN A NE2   1 
ATOM   1910  N  N     . ASP A  1 286  ? 220.755 214.116 165.458 1.00 137.56 ? 280  ASP A N     1 
ATOM   1911  C  CA    . ASP A  1 286  ? 219.494 214.150 166.179 1.00 137.56 ? 280  ASP A CA    1 
ATOM   1912  C  C     . ASP A  1 286  ? 218.709 212.900 165.813 1.00 137.56 ? 280  ASP A C     1 
ATOM   1913  O  O     . ASP A  1 286  ? 218.157 212.791 164.708 1.00 137.56 ? 280  ASP A O     1 
ATOM   1914  C  CB    . ASP A  1 286  ? 218.697 215.405 165.850 1.00 137.56 ? 280  ASP A CB    1 
ATOM   1915  C  CG    . ASP A  1 286  ? 217.397 215.484 166.615 1.00 137.56 ? 280  ASP A CG    1 
ATOM   1916  O  OD1   . ASP A  1 286  ? 217.440 215.681 167.843 1.00 137.56 ? 280  ASP A OD1   1 
ATOM   1917  O  OD2   . ASP A  1 286  ? 216.328 215.348 165.981 1.00 137.56 ? 280  ASP A OD2   1 
ATOM   1918  N  N     . LEU A  1 287  ? 218.680 211.943 166.734 1.00 124.57 ? 281  LEU A N     1 
ATOM   1919  C  CA    . LEU A  1 287  ? 218.101 210.641 166.462 1.00 124.57 ? 281  LEU A CA    1 
ATOM   1920  C  C     . LEU A  1 287  ? 218.053 209.855 167.757 1.00 124.57 ? 281  LEU A C     1 
ATOM   1921  O  O     . LEU A  1 287  ? 218.997 209.904 168.548 1.00 124.57 ? 281  LEU A O     1 
ATOM   1922  C  CB    . LEU A  1 287  ? 218.924 209.881 165.420 1.00 124.57 ? 281  LEU A CB    1 
ATOM   1923  C  CG    . LEU A  1 287  ? 218.341 208.534 165.017 1.00 124.57 ? 281  LEU A CG    1 
ATOM   1924  C  CD1   . LEU A  1 287  ? 217.013 208.780 164.334 1.00 124.57 ? 281  LEU A CD1   1 
ATOM   1925  C  CD2   . LEU A  1 287  ? 219.305 207.775 164.116 1.00 124.57 ? 281  LEU A CD2   1 
ATOM   1926  N  N     . GLU A  1 288  ? 216.962 209.124 167.952 1.00 122.92 ? 282  GLU A N     1 
ATOM   1927  C  CA    . GLU A  1 288  ? 216.783 208.314 169.142 1.00 122.92 ? 282  GLU A CA    1 
ATOM   1928  C  C     . GLU A  1 288  ? 215.547 207.456 168.952 1.00 122.92 ? 282  GLU A C     1 
ATOM   1929  O  O     . GLU A  1 288  ? 214.541 207.899 168.393 1.00 122.92 ? 282  GLU A O     1 
ATOM   1930  C  CB    . GLU A  1 288  ? 216.647 209.182 170.394 1.00 122.92 ? 282  GLU A CB    1 
ATOM   1931  C  CG    . GLU A  1 288  ? 216.553 208.403 171.683 1.00 122.92 ? 282  GLU A CG    1 
ATOM   1932  C  CD    . GLU A  1 288  ? 216.486 209.318 172.888 1.00 122.92 ? 282  GLU A CD    1 
ATOM   1933  O  OE1   . GLU A  1 288  ? 216.517 210.549 172.690 1.00 122.92 ? 282  GLU A OE1   1 
ATOM   1934  O  OE2   . GLU A  1 288  ? 216.398 208.817 174.025 1.00 122.92 ? 282  GLU A OE2   1 
ATOM   1935  N  N     . ILE A  1 289  ? 215.632 206.216 169.426 1.00 118.43 ? 283  ILE A N     1 
ATOM   1936  C  CA    . ILE A  1 289  ? 214.544 205.260 169.275 1.00 118.43 ? 283  ILE A CA    1 
ATOM   1937  C  C     . ILE A  1 289  ? 214.162 204.764 170.660 1.00 118.43 ? 283  ILE A C     1 
ATOM   1938  O  O     . ILE A  1 289  ? 214.939 204.051 171.302 1.00 118.43 ? 283  ILE A O     1 
ATOM   1939  C  CB    . ILE A  1 289  ? 214.934 204.082 168.376 1.00 118.43 ? 283  ILE A CB    1 
ATOM   1940  C  CG1   . ILE A  1 289  ? 215.350 204.588 167.002 1.00 118.43 ? 283  ILE A CG1   1 
ATOM   1941  C  CG2   . ILE A  1 289  ? 213.769 203.125 168.245 1.00 118.43 ? 283  ILE A CG2   1 
ATOM   1942  C  CD1   . ILE A  1 289  ? 216.015 203.532 166.152 1.00 118.43 ? 283  ILE A CD1   1 
ATOM   1943  N  N     . ILE A  1 290  ? 212.972 205.114 171.108 1.00 107.25 ? 284  ILE A N     1 
ATOM   1944  C  CA    . ILE A  1 290  ? 212.542 204.856 172.473 1.00 107.25 ? 284  ILE A CA    1 
ATOM   1945  C  C     . ILE A  1 290  ? 211.940 203.465 172.532 1.00 107.25 ? 284  ILE A C     1 
ATOM   1946  O  O     . ILE A  1 290  ? 211.040 203.134 171.753 1.00 107.25 ? 284  ILE A O     1 
ATOM   1947  C  CB    . ILE A  1 290  ? 211.533 205.922 172.933 1.00 107.25 ? 284  ILE A CB    1 
ATOM   1948  C  CG1   . ILE A  1 290  ? 212.083 207.309 172.642 1.00 107.25 ? 284  ILE A CG1   1 
ATOM   1949  C  CG2   . ILE A  1 290  ? 211.269 205.792 174.412 1.00 107.25 ? 284  ILE A CG2   1 
ATOM   1950  C  CD1   . ILE A  1 290  ? 213.390 207.588 173.315 1.00 107.25 ? 284  ILE A CD1   1 
ATOM   1951  N  N     . VAL A  1 291  ? 212.428 202.649 173.460 1.00 110.81 ? 285  VAL A N     1 
ATOM   1952  C  CA    . VAL A  1 291  ? 212.017 201.257 173.564 1.00 110.81 ? 285  VAL A CA    1 
ATOM   1953  C  C     . VAL A  1 291  ? 211.233 201.080 174.854 1.00 110.81 ? 285  VAL A C     1 
ATOM   1954  O  O     . VAL A  1 291  ? 211.746 201.359 175.941 1.00 110.81 ? 285  VAL A O     1 
ATOM   1955  C  CB    . VAL A  1 291  ? 213.222 200.303 173.525 1.00 110.81 ? 285  VAL A CB    1 
ATOM   1956  C  CG1   . VAL A  1 291  ? 212.764 198.868 173.648 1.00 110.81 ? 285  VAL A CG1   1 
ATOM   1957  C  CG2   . VAL A  1 291  ? 214.002 200.510 172.248 1.00 110.81 ? 285  VAL A CG2   1 
ATOM   1958  N  N     . ILE A  1 292  ? 209.999 200.607 174.726 1.00 96.10  ? 286  ILE A N     1 
ATOM   1959  C  CA    . ILE A  1 292  ? 209.067 200.472 175.837 1.00 96.10  ? 286  ILE A CA    1 
ATOM   1960  C  C     . ILE A  1 292  ? 208.707 199.006 176.011 1.00 96.10  ? 286  ILE A C     1 
ATOM   1961  O  O     . ILE A  1 292  ? 208.381 198.314 175.041 1.00 96.10  ? 286  ILE A O     1 
ATOM   1962  C  CB    . ILE A  1 292  ? 207.805 201.324 175.611 1.00 96.10  ? 286  ILE A CB    1 
ATOM   1963  C  CG1   . ILE A  1 292  ? 208.110 202.802 175.845 1.00 96.10  ? 286  ILE A CG1   1 
ATOM   1964  C  CG2   . ILE A  1 292  ? 206.655 200.829 176.452 1.00 96.10  ? 286  ILE A CG2   1 
ATOM   1965  C  CD1   . ILE A  1 292  ? 208.535 203.534 174.608 1.00 96.10  ? 286  ILE A CD1   1 
ATOM   1966  N  N     . LEU A  1 293  ? 208.762 198.540 177.254 1.00 98.14  ? 287  LEU A N     1 
ATOM   1967  C  CA    . LEU A  1 293  ? 208.416 197.171 177.613 1.00 98.14  ? 287  LEU A CA    1 
ATOM   1968  C  C     . LEU A  1 293  ? 207.362 197.225 178.706 1.00 98.14  ? 287  LEU A C     1 
ATOM   1969  O  O     . LEU A  1 293  ? 207.602 197.791 179.776 1.00 98.14  ? 287  LEU A O     1 
ATOM   1970  C  CB    . LEU A  1 293  ? 209.646 196.402 178.082 1.00 98.14  ? 287  LEU A CB    1 
ATOM   1971  C  CG    . LEU A  1 293  ? 209.395 194.972 178.540 1.00 98.14  ? 287  LEU A CG    1 
ATOM   1972  C  CD1   . LEU A  1 293  ? 208.831 194.146 177.411 1.00 98.14  ? 287  LEU A CD1   1 
ATOM   1973  C  CD2   . LEU A  1 293  ? 210.688 194.376 179.042 1.00 98.14  ? 287  LEU A CD2   1 
ATOM   1974  N  N     . GLU A  1 294  ? 206.199 196.639 178.442 1.00 110.73 ? 288  GLU A N     1 
ATOM   1975  C  CA    . GLU A  1 294  ? 205.054 196.730 179.336 1.00 110.73 ? 288  GLU A CA    1 
ATOM   1976  C  C     . GLU A  1 294  ? 204.424 195.355 179.494 1.00 110.73 ? 288  GLU A C     1 
ATOM   1977  O  O     . GLU A  1 294  ? 204.101 194.697 178.498 1.00 110.73 ? 288  GLU A O     1 
ATOM   1978  C  CB    . GLU A  1 294  ? 204.037 197.734 178.801 1.00 110.73 ? 288  GLU A CB    1 
ATOM   1979  C  CG    . GLU A  1 294  ? 204.573 199.147 178.789 1.00 110.73 ? 288  GLU A CG    1 
ATOM   1980  C  CD    . GLU A  1 294  ? 203.600 200.141 178.204 1.00 110.73 ? 288  GLU A CD    1 
ATOM   1981  O  OE1   . GLU A  1 294  ? 202.527 199.717 177.724 1.00 110.73 ? 288  GLU A OE1   1 
ATOM   1982  O  OE2   . GLU A  1 294  ? 203.913 201.350 178.210 1.00 110.73 ? 288  GLU A OE2   1 
ATOM   1983  N  N     . GLY A  1 295  ? 204.258 194.927 180.735 1.00 107.89 ? 289  GLY A N     1 
ATOM   1984  C  CA    . GLY A  1 295  ? 203.666 193.636 181.018 1.00 107.89 ? 289  GLY A CA    1 
ATOM   1985  C  C     . GLY A  1 295  ? 203.217 193.556 182.459 1.00 107.89 ? 289  GLY A C     1 
ATOM   1986  O  O     . GLY A  1 295  ? 203.368 194.501 183.232 1.00 107.89 ? 289  GLY A O     1 
ATOM   1987  N  N     . VAL A  1 296  ? 202.673 192.407 182.816 1.00 118.67 ? 290  VAL A N     1 
ATOM   1988  C  CA    . VAL A  1 296  ? 202.142 192.189 184.153 1.00 118.67 ? 290  VAL A CA    1 
ATOM   1989  C  C     . VAL A  1 296  ? 203.105 191.318 184.942 1.00 118.67 ? 290  VAL A C     1 
ATOM   1990  O  O     . VAL A  1 296  ? 203.547 190.268 184.461 1.00 118.67 ? 290  VAL A O     1 
ATOM   1991  C  CB    . VAL A  1 296  ? 200.750 191.545 184.088 1.00 118.67 ? 290  VAL A CB    1 
ATOM   1992  C  CG1   . VAL A  1 296  ? 200.289 191.150 185.472 1.00 118.67 ? 290  VAL A CG1   1 
ATOM   1993  C  CG2   . VAL A  1 296  ? 199.763 192.504 183.450 1.00 118.67 ? 290  VAL A CG2   1 
ATOM   1994  N  N     . VAL A  1 297  ? 203.429 191.752 186.160 1.00 120.71 ? 291  VAL A N     1 
ATOM   1995  C  CA    . VAL A  1 297  ? 204.243 190.937 187.048 1.00 120.71 ? 291  VAL A CA    1 
ATOM   1996  C  C     . VAL A  1 297  ? 203.480 189.669 187.403 1.00 120.71 ? 291  VAL A C     1 
ATOM   1997  O  O     . VAL A  1 297  ? 202.257 189.679 187.582 1.00 120.71 ? 291  VAL A O     1 
ATOM   1998  C  CB    . VAL A  1 297  ? 204.627 191.732 188.308 1.00 120.71 ? 291  VAL A CB    1 
ATOM   1999  C  CG1   . VAL A  1 297  ? 205.431 190.872 189.267 1.00 120.71 ? 291  VAL A CG1   1 
ATOM   2000  C  CG2   . VAL A  1 297  ? 205.398 192.973 187.923 1.00 120.71 ? 291  VAL A CG2   1 
ATOM   2001  N  N     . GLU A  1 298  ? 204.210 188.560 187.498 1.00 129.55 ? 292  GLU A N     1 
ATOM   2002  C  CA    . GLU A  1 298  ? 203.568 187.274 187.731 1.00 129.55 ? 292  GLU A CA    1 
ATOM   2003  C  C     . GLU A  1 298  ? 202.958 187.200 189.122 1.00 129.55 ? 292  GLU A C     1 
ATOM   2004  O  O     . GLU A  1 298  ? 201.767 186.905 189.269 1.00 129.55 ? 292  GLU A O     1 
ATOM   2005  C  CB    . GLU A  1 298  ? 204.578 186.151 187.526 1.00 129.55 ? 292  GLU A CB    1 
ATOM   2006  C  CG    . GLU A  1 298  ? 203.994 184.764 187.573 1.00 129.55 ? 292  GLU A CG    1 
ATOM   2007  C  CD    . GLU A  1 298  ? 205.031 183.702 187.270 1.00 129.55 ? 292  GLU A CD    1 
ATOM   2008  O  OE1   . GLU A  1 298  ? 206.210 184.062 187.071 1.00 129.55 ? 292  GLU A OE1   1 
ATOM   2009  O  OE2   . GLU A  1 298  ? 204.662 182.511 187.221 1.00 129.55 ? 292  GLU A OE2   1 
ATOM   2010  N  N     . THR A  1 299  ? 203.752 187.474 190.151 1.00 130.53 ? 293  THR A N     1 
ATOM   2011  C  CA    . THR A  1 299  ? 203.263 187.392 191.519 1.00 130.53 ? 293  THR A CA    1 
ATOM   2012  C  C     . THR A  1 299  ? 202.244 188.469 191.841 1.00 130.53 ? 293  THR A C     1 
ATOM   2013  O  O     . THR A  1 299  ? 201.184 188.167 192.397 1.00 130.53 ? 293  THR A O     1 
ATOM   2014  C  CB    . THR A  1 299  ? 204.430 187.505 192.498 1.00 130.53 ? 293  THR A CB    1 
ATOM   2015  O  OG1   . THR A  1 299  ? 205.032 188.799 192.370 1.00 130.53 ? 293  THR A OG1   1 
ATOM   2016  C  CG2   . THR A  1 299  ? 205.466 186.462 192.176 1.00 130.53 ? 293  THR A CG2   1 
ATOM   2017  N  N     . THR A  1 300  ? 202.537 189.713 191.493 1.00 132.33 ? 294  THR A N     1 
ATOM   2018  C  CA    . THR A  1 300  ? 201.623 190.820 191.699 1.00 132.33 ? 294  THR A CA    1 
ATOM   2019  C  C     . THR A  1 300  ? 200.958 191.161 190.376 1.00 132.33 ? 294  THR A C     1 
ATOM   2020  O  O     . THR A  1 300  ? 201.620 191.574 189.422 1.00 132.33 ? 294  THR A O     1 
ATOM   2021  C  CB    . THR A  1 300  ? 202.354 192.048 192.240 1.00 132.33 ? 294  THR A CB    1 
ATOM   2022  O  OG1   . THR A  1 300  ? 203.277 192.523 191.254 1.00 132.33 ? 294  THR A OG1   1 
ATOM   2023  C  CG2   . THR A  1 300  ? 203.124 191.683 193.489 1.00 132.33 ? 294  THR A CG2   1 
ATOM   2024  N  N     . GLY A  1 301  ? 199.638 191.004 190.333 1.00 137.08 ? 295  GLY A N     1 
ATOM   2025  C  CA    . GLY A  1 301  ? 198.903 191.211 189.098 1.00 137.08 ? 295  GLY A CA    1 
ATOM   2026  C  C     . GLY A  1 301  ? 199.023 192.600 188.512 1.00 137.08 ? 295  GLY A C     1 
ATOM   2027  O  O     . GLY A  1 301  ? 198.393 192.877 187.486 1.00 137.08 ? 295  GLY A O     1 
ATOM   2028  N  N     . ILE A  1 302  ? 199.802 193.477 189.136 1.00 127.29 ? 296  ILE A N     1 
ATOM   2029  C  CA    . ILE A  1 302  ? 199.965 194.845 188.671 1.00 127.29 ? 296  ILE A CA    1 
ATOM   2030  C  C     . ILE A  1 302  ? 200.903 194.873 187.474 1.00 127.29 ? 296  ILE A C     1 
ATOM   2031  O  O     . ILE A  1 302  ? 201.572 193.881 187.165 1.00 127.29 ? 296  ILE A O     1 
ATOM   2032  C  CB    . ILE A  1 302  ? 200.479 195.744 189.803 1.00 127.29 ? 296  ILE A CB    1 
ATOM   2033  C  CG1   . ILE A  1 302  ? 201.826 195.238 190.306 1.00 127.29 ? 296  ILE A CG1   1 
ATOM   2034  C  CG2   . ILE A  1 302  ? 199.479 195.768 190.938 1.00 127.29 ? 296  ILE A CG2   1 
ATOM   2035  C  CD1   . ILE A  1 302  ? 202.488 196.177 191.277 1.00 127.29 ? 296  ILE A CD1   1 
ATOM   2036  N  N     . THR A  1 303  ? 200.951 196.013 186.792 1.00 114.78 ? 297  THR A N     1 
ATOM   2037  C  CA    . THR A  1 303  ? 201.699 196.174 185.554 1.00 114.78 ? 297  THR A CA    1 
ATOM   2038  C  C     . THR A  1 303  ? 202.921 197.032 185.827 1.00 114.78 ? 297  THR A C     1 
ATOM   2039  O  O     . THR A  1 303  ? 202.861 197.961 186.638 1.00 114.78 ? 297  THR A O     1 
ATOM   2040  C  CB    . THR A  1 303  ? 200.823 196.810 184.476 1.00 114.78 ? 297  THR A CB    1 
ATOM   2041  O  OG1   . THR A  1 303  ? 199.733 195.933 184.176 1.00 114.78 ? 297  THR A OG1   1 
ATOM   2042  C  CG2   . THR A  1 303  ? 201.612 197.080 183.214 1.00 114.78 ? 297  THR A CG2   1 
ATOM   2043  N  N     . THR A  1 304  ? 204.023 196.710 185.172 1.00 109.09 ? 298  THR A N     1 
ATOM   2044  C  CA    . THR A  1 304  ? 205.220 197.529 185.225 1.00 109.09 ? 298  THR A CA    1 
ATOM   2045  C  C     . THR A  1 304  ? 205.692 197.875 183.822 1.00 109.09 ? 298  THR A C     1 
ATOM   2046  O  O     . THR A  1 304  ? 205.320 197.238 182.834 1.00 109.09 ? 298  THR A O     1 
ATOM   2047  C  CB    . THR A  1 304  ? 206.334 196.815 185.984 1.00 109.09 ? 298  THR A CB    1 
ATOM   2048  O  OG1   . THR A  1 304  ? 207.451 197.700 186.126 1.00 109.09 ? 298  THR A OG1   1 
ATOM   2049  C  CG2   . THR A  1 304  ? 206.762 195.566 185.233 1.00 109.09 ? 298  THR A CG2   1 
ATOM   2050  N  N     . GLN A  1 305  ? 206.529 198.905 183.750 1.00 105.75 ? 299  GLN A N     1 
ATOM   2051  C  CA    . GLN A  1 305  ? 207.097 199.364 182.490 1.00 105.75 ? 299  GLN A CA    1 
ATOM   2052  C  C     . GLN A  1 305  ? 208.570 199.660 182.691 1.00 105.75 ? 299  GLN A C     1 
ATOM   2053  O  O     . GLN A  1 305  ? 208.937 200.371 183.630 1.00 105.75 ? 299  GLN A O     1 
ATOM   2054  C  CB    . GLN A  1 305  ? 206.386 200.611 181.974 1.00 105.75 ? 299  GLN A CB    1 
ATOM   2055  C  CG    . GLN A  1 305  ? 206.958 201.103 180.671 1.00 105.75 ? 299  GLN A CG    1 
ATOM   2056  C  CD    . GLN A  1 305  ? 206.276 202.349 180.172 1.00 105.75 ? 299  GLN A CD    1 
ATOM   2057  O  OE1   . GLN A  1 305  ? 205.372 202.874 180.819 1.00 105.75 ? 299  GLN A OE1   1 
ATOM   2058  N  NE2   . GLN A  1 305  ? 206.709 202.838 179.022 1.00 105.75 ? 299  GLN A NE2   1 
ATOM   2059  N  N     . ALA A  1 306  ? 209.405 199.122 181.815 1.00 104.90 ? 300  ALA A N     1 
ATOM   2060  C  CA    . ALA A  1 306  ? 210.807 199.495 181.738 1.00 104.90 ? 300  ALA A CA    1 
ATOM   2061  C  C     . ALA A  1 306  ? 211.019 200.321 180.480 1.00 104.90 ? 300  ALA A C     1 
ATOM   2062  O  O     . ALA A  1 306  ? 210.314 200.134 179.483 1.00 104.90 ? 300  ALA A O     1 
ATOM   2063  C  CB    . ALA A  1 306  ? 211.709 198.259 181.731 1.00 104.90 ? 300  ALA A CB    1 
ATOM   2064  N  N     . ARG A  1 307  ? 211.966 201.245 180.533 1.00 108.28 ? 301  ARG A N     1 
ATOM   2065  C  CA    . ARG A  1 307  ? 212.305 202.065 179.386 1.00 108.28 ? 301  ARG A CA    1 
ATOM   2066  C  C     . ARG A  1 307  ? 213.799 201.996 179.126 1.00 108.28 ? 301  ARG A C     1 
ATOM   2067  O  O     . ARG A  1 307  ? 214.611 201.956 180.055 1.00 108.28 ? 301  ARG A O     1 
ATOM   2068  C  CB    . ARG A  1 307  ? 211.898 203.526 179.593 1.00 108.28 ? 301  ARG A CB    1 
ATOM   2069  C  CG    . ARG A  1 307  ? 210.447 203.806 179.292 1.00 108.28 ? 301  ARG A CG    1 
ATOM   2070  C  CD    . ARG A  1 307  ? 209.570 203.402 180.453 1.00 108.28 ? 301  ARG A CD    1 
ATOM   2071  N  NE    . ARG A  1 307  ? 209.836 204.198 181.642 1.00 108.28 ? 301  ARG A NE    1 
ATOM   2072  C  CZ    . ARG A  1 307  ? 209.392 203.892 182.853 1.00 108.28 ? 301  ARG A CZ    1 
ATOM   2073  N  NH1   . ARG A  1 307  ? 208.660 202.803 183.033 1.00 108.28 ? 301  ARG A NH1   1 
ATOM   2074  N  NH2   . ARG A  1 307  ? 209.680 204.677 183.884 1.00 108.28 ? 301  ARG A NH2   1 
ATOM   2075  N  N     . THR A  1 308  ? 214.151 201.979 177.849 1.00 114.31 ? 302  THR A N     1 
ATOM   2076  C  CA    . THR A  1 308  ? 215.529 202.154 177.431 1.00 114.31 ? 302  THR A CA    1 
ATOM   2077  C  C     . THR A  1 308  ? 215.512 202.891 176.107 1.00 114.31 ? 302  THR A C     1 
ATOM   2078  O  O     . THR A  1 308  ? 214.532 202.848 175.361 1.00 114.31 ? 302  THR A O     1 
ATOM   2079  C  CB    . THR A  1 308  ? 216.268 200.824 177.310 1.00 114.31 ? 302  THR A CB    1 
ATOM   2080  O  OG1   . THR A  1 308  ? 217.651 201.076 177.036 1.00 114.31 ? 302  THR A OG1   1 
ATOM   2081  C  CG2   . THR A  1 308  ? 215.684 199.998 176.190 1.00 114.31 ? 302  THR A CG2   1 
ATOM   2082  N  N     . SER A  1 309  ? 216.610 203.575 175.820 1.00 121.01 ? 303  SER A N     1 
ATOM   2083  C  CA    . SER A  1 309  ? 216.659 204.389 174.621 1.00 121.01 ? 303  SER A CA    1 
ATOM   2084  C  C     . SER A  1 309  ? 218.000 204.188 173.943 1.00 121.01 ? 303  SER A C     1 
ATOM   2085  O  O     . SER A  1 309  ? 218.984 203.786 174.567 1.00 121.01 ? 303  SER A O     1 
ATOM   2086  C  CB    . SER A  1 309  ? 216.420 205.865 174.940 1.00 121.01 ? 303  SER A CB    1 
ATOM   2087  O  OG    . SER A  1 309  ? 217.448 206.377 175.768 1.00 121.01 ? 303  SER A OG    1 
ATOM   2088  N  N     . TYR A  1 310  ? 218.024 204.473 172.649 1.00 115.62 ? 304  TYR A N     1 
ATOM   2089  C  CA    . TYR A  1 310  ? 219.248 204.364 171.871 1.00 115.62 ? 304  TYR A CA    1 
ATOM   2090  C  C     . TYR A  1 310  ? 219.297 205.565 170.945 1.00 115.62 ? 304  TYR A C     1 
ATOM   2091  O  O     . TYR A  1 310  ? 218.420 205.723 170.092 1.00 115.62 ? 304  TYR A O     1 
ATOM   2092  C  CB    . TYR A  1 310  ? 219.296 203.064 171.080 1.00 115.62 ? 304  TYR A CB    1 
ATOM   2093  C  CG    . TYR A  1 310  ? 219.401 201.837 171.940 1.00 115.62 ? 304  TYR A CG    1 
ATOM   2094  C  CD1   . TYR A  1 310  ? 220.609 201.468 172.501 1.00 115.62 ? 304  TYR A CD1   1 
ATOM   2095  C  CD2   . TYR A  1 310  ? 218.295 201.047 172.186 1.00 115.62 ? 304  TYR A CD2   1 
ATOM   2096  C  CE1   . TYR A  1 310  ? 220.709 200.347 173.287 1.00 115.62 ? 304  TYR A CE1   1 
ATOM   2097  C  CE2   . TYR A  1 310  ? 218.387 199.928 172.970 1.00 115.62 ? 304  TYR A CE2   1 
ATOM   2098  C  CZ    . TYR A  1 310  ? 219.594 199.581 173.519 1.00 115.62 ? 304  TYR A CZ    1 
ATOM   2099  O  OH    . TYR A  1 310  ? 219.687 198.459 174.304 1.00 115.62 ? 304  TYR A OH    1 
ATOM   2100  N  N     . LEU A  1 311  ? 220.297 206.414 171.124 1.00 127.12 ? 305  LEU A N     1 
ATOM   2101  C  CA    . LEU A  1 311  ? 220.521 207.479 170.167 1.00 127.12 ? 305  LEU A CA    1 
ATOM   2102  C  C     . LEU A  1 311  ? 221.467 206.948 169.093 1.00 127.12 ? 305  LEU A C     1 
ATOM   2103  O  O     . LEU A  1 311  ? 221.805 205.763 169.069 1.00 127.12 ? 305  LEU A O     1 
ATOM   2104  C  CB    . LEU A  1 311  ? 221.006 208.741 170.879 1.00 127.12 ? 305  LEU A CB    1 
ATOM   2105  C  CG    . LEU A  1 311  ? 222.336 208.802 171.621 1.00 127.12 ? 305  LEU A CG    1 
ATOM   2106  C  CD1   . LEU A  1 311  ? 223.433 209.266 170.686 1.00 127.12 ? 305  LEU A CD1   1 
ATOM   2107  C  CD2   . LEU A  1 311  ? 222.219 209.735 172.806 1.00 127.12 ? 305  LEU A CD2   1 
ATOM   2108  N  N     . ALA A  1 312  ? 221.904 207.825 168.193 1.00 128.67 ? 306  ALA A N     1 
ATOM   2109  C  CA    . ALA A  1 312  ? 222.426 207.367 166.910 1.00 128.67 ? 306  ALA A CA    1 
ATOM   2110  C  C     . ALA A  1 312  ? 223.685 206.521 167.067 1.00 128.67 ? 306  ALA A C     1 
ATOM   2111  O  O     . ALA A  1 312  ? 223.844 205.508 166.378 1.00 128.67 ? 306  ALA A O     1 
ATOM   2112  C  CB    . ALA A  1 312  ? 222.679 208.569 166.007 1.00 128.67 ? 306  ALA A CB    1 
ATOM   2113  N  N     . ASP A  1 313  ? 224.581 206.902 167.978 1.00 133.65 ? 307  ASP A N     1 
ATOM   2114  C  CA    . ASP A  1 313  ? 225.873 206.224 168.048 1.00 133.65 ? 307  ASP A CA    1 
ATOM   2115  C  C     . ASP A  1 313  ? 225.741 204.826 168.641 1.00 133.65 ? 307  ASP A C     1 
ATOM   2116  O  O     . ASP A  1 313  ? 226.367 203.878 168.154 1.00 133.65 ? 307  ASP A O     1 
ATOM   2117  C  CB    . ASP A  1 313  ? 226.865 207.068 168.850 1.00 133.65 ? 307  ASP A CB    1 
ATOM   2118  C  CG    . ASP A  1 313  ? 226.441 207.264 170.295 1.00 133.65 ? 307  ASP A CG    1 
ATOM   2119  O  OD1   . ASP A  1 313  ? 225.353 206.787 170.681 1.00 133.65 ? 307  ASP A OD1   1 
ATOM   2120  O  OD2   . ASP A  1 313  ? 227.204 207.894 171.054 1.00 133.65 ? 307  ASP A OD2   1 
ATOM   2121  N  N     . GLU A  1 314  ? 224.933 204.682 169.697 1.00 125.19 ? 308  GLU A N     1 
ATOM   2122  C  CA    . GLU A  1 314  ? 224.710 203.380 170.316 1.00 125.19 ? 308  GLU A CA    1 
ATOM   2123  C  C     . GLU A  1 314  ? 224.132 202.377 169.340 1.00 125.19 ? 308  GLU A C     1 
ATOM   2124  O  O     . GLU A  1 314  ? 224.205 201.169 169.587 1.00 125.19 ? 308  GLU A O     1 
ATOM   2125  C  CB    . GLU A  1 314  ? 223.774 203.517 171.516 1.00 125.19 ? 308  GLU A CB    1 
ATOM   2126  C  CG    . GLU A  1 314  ? 224.357 204.294 172.675 1.00 125.19 ? 308  GLU A CG    1 
ATOM   2127  C  CD    . GLU A  1 314  ? 223.388 204.426 173.823 1.00 125.19 ? 308  GLU A CD    1 
ATOM   2128  O  OE1   . GLU A  1 314  ? 222.218 204.030 173.658 1.00 125.19 ? 308  GLU A OE1   1 
ATOM   2129  O  OE2   . GLU A  1 314  ? 223.796 204.922 174.891 1.00 125.19 ? 308  GLU A OE2   1 
ATOM   2130  N  N     . ILE A  1 315  ? 223.556 202.852 168.243 1.00 123.89 ? 309  ILE A N     1 
ATOM   2131  C  CA    . ILE A  1 315  ? 223.017 201.991 167.204 1.00 123.89 ? 309  ILE A CA    1 
ATOM   2132  C  C     . ILE A  1 315  ? 224.197 201.566 166.339 1.00 123.89 ? 309  ILE A C     1 
ATOM   2133  O  O     . ILE A  1 315  ? 224.539 202.229 165.360 1.00 123.89 ? 309  ILE A O     1 
ATOM   2134  C  CB    . ILE A  1 315  ? 221.948 202.709 166.384 1.00 123.89 ? 309  ILE A CB    1 
ATOM   2135  C  CG1   . ILE A  1 315  ? 220.828 203.188 167.296 1.00 123.89 ? 309  ILE A CG1   1 
ATOM   2136  C  CG2   . ILE A  1 315  ? 221.388 201.779 165.359 1.00 123.89 ? 309  ILE A CG2   1 
ATOM   2137  C  CD1   . ILE A  1 315  ? 219.890 204.169 166.634 1.00 123.89 ? 309  ILE A CD1   1 
ATOM   2138  N  N     . LEU A  1 316  ? 224.827 200.456 166.706 1.00 124.90 ? 310  LEU A N     1 
ATOM   2139  C  CA    . LEU A  1 316  ? 225.963 199.984 165.938 1.00 124.90 ? 310  LEU A CA    1 
ATOM   2140  C  C     . LEU A  1 316  ? 225.507 199.515 164.562 1.00 124.90 ? 310  LEU A C     1 
ATOM   2141  O  O     . LEU A  1 316  ? 224.551 198.751 164.420 1.00 124.90 ? 310  LEU A O     1 
ATOM   2142  C  CB    . LEU A  1 316  ? 226.677 198.851 166.674 1.00 124.90 ? 310  LEU A CB    1 
ATOM   2143  C  CG    . LEU A  1 316  ? 227.295 199.253 168.012 1.00 124.90 ? 310  LEU A CG    1 
ATOM   2144  C  CD1   . LEU A  1 316  ? 227.876 198.050 168.739 1.00 124.90 ? 310  LEU A CD1   1 
ATOM   2145  C  CD2   . LEU A  1 316  ? 228.351 200.324 167.810 1.00 124.90 ? 310  LEU A CD2   1 
ATOM   2146  N  N     . TRP A  1 317  ? 226.218 199.971 163.539 1.00 123.42 ? 311  TRP A N     1 
ATOM   2147  C  CA    . TRP A  1 317  ? 225.880 199.661 162.160 1.00 123.42 ? 311  TRP A CA    1 
ATOM   2148  C  C     . TRP A  1 317  ? 226.602 198.397 161.727 1.00 123.42 ? 311  TRP A C     1 
ATOM   2149  O  O     . TRP A  1 317  ? 227.816 198.268 161.912 1.00 123.42 ? 311  TRP A O     1 
ATOM   2150  C  CB    . TRP A  1 317  ? 226.257 200.805 161.226 1.00 123.42 ? 311  TRP A CB    1 
ATOM   2151  C  CG    . TRP A  1 317  ? 225.910 200.528 159.805 1.00 123.42 ? 311  TRP A CG    1 
ATOM   2152  C  CD1   . TRP A  1 317  ? 226.740 200.042 158.843 1.00 123.42 ? 311  TRP A CD1   1 
ATOM   2153  C  CD2   . TRP A  1 317  ? 224.644 200.737 159.171 1.00 123.42 ? 311  TRP A CD2   1 
ATOM   2154  N  NE1   . TRP A  1 317  ? 226.070 199.926 157.655 1.00 123.42 ? 311  TRP A NE1   1 
ATOM   2155  C  CE2   . TRP A  1 317  ? 224.779 200.343 157.830 1.00 123.42 ? 311  TRP A CE2   1 
ATOM   2156  C  CE3   . TRP A  1 317  ? 223.407 201.215 159.611 1.00 123.42 ? 311  TRP A CE3   1 
ATOM   2157  C  CZ2   . TRP A  1 317  ? 223.730 200.411 156.919 1.00 123.42 ? 311  TRP A CZ2   1 
ATOM   2158  C  CZ3   . TRP A  1 317  ? 222.365 201.283 158.705 1.00 123.42 ? 311  TRP A CZ3   1 
ATOM   2159  C  CH2   . TRP A  1 317  ? 222.535 200.886 157.376 1.00 123.42 ? 311  TRP A CH2   1 
ATOM   2160  N  N     . GLY A  1 318  ? 225.853 197.468 161.148 1.00 112.92 ? 312  GLY A N     1 
ATOM   2161  C  CA    . GLY A  1 318  ? 226.462 196.279 160.583 1.00 112.92 ? 312  GLY A CA    1 
ATOM   2162  C  C     . GLY A  1 318  ? 227.077 195.340 161.593 1.00 112.92 ? 312  GLY A C     1 
ATOM   2163  O  O     . GLY A  1 318  ? 228.287 195.086 161.539 1.00 112.92 ? 312  GLY A O     1 
ATOM   2164  N  N     . GLN A  1 319  ? 226.280 194.824 162.522 1.00 108.36 ? 313  GLN A N     1 
ATOM   2165  C  CA    . GLN A  1 319  ? 226.728 193.787 163.436 1.00 108.36 ? 313  GLN A CA    1 
ATOM   2166  C  C     . GLN A  1 319  ? 225.588 192.820 163.699 1.00 108.36 ? 313  GLN A C     1 
ATOM   2167  O  O     . GLN A  1 319  ? 224.456 193.026 163.256 1.00 108.36 ? 313  GLN A O     1 
ATOM   2168  C  CB    . GLN A  1 319  ? 227.227 194.357 164.766 1.00 108.36 ? 313  GLN A CB    1 
ATOM   2169  C  CG    . GLN A  1 319  ? 228.513 195.132 164.674 1.00 108.36 ? 313  GLN A CG    1 
ATOM   2170  C  CD    . GLN A  1 319  ? 228.943 195.659 166.016 1.00 108.36 ? 313  GLN A CD    1 
ATOM   2171  O  OE1   . GLN A  1 319  ? 228.257 195.460 167.013 1.00 108.36 ? 313  GLN A OE1   1 
ATOM   2172  N  NE2   . GLN A  1 319  ? 230.075 196.348 166.050 1.00 108.36 ? 313  GLN A NE2   1 
ATOM   2173  N  N     . ARG A  1 320  ? 225.900 191.757 164.430 1.00 105.30 ? 314  ARG A N     1 
ATOM   2174  C  CA    . ARG A  1 320  ? 224.901 190.793 164.858 1.00 105.30 ? 314  ARG A CA    1 
ATOM   2175  C  C     . ARG A  1 320  ? 225.221 190.352 166.276 1.00 105.30 ? 314  ARG A C     1 
ATOM   2176  O  O     . ARG A  1 320  ? 226.364 190.003 166.582 1.00 105.30 ? 314  ARG A O     1 
ATOM   2177  C  CB    . ARG A  1 320  ? 224.843 189.579 163.907 1.00 105.30 ? 314  ARG A CB    1 
ATOM   2178  C  CG    . ARG A  1 320  ? 224.277 189.911 162.520 1.00 105.30 ? 314  ARG A CG    1 
ATOM   2179  C  CD    . ARG A  1 320  ? 224.197 188.718 161.559 1.00 105.30 ? 314  ARG A CD    1 
ATOM   2180  N  NE    . ARG A  1 320  ? 225.494 188.273 161.051 1.00 105.30 ? 314  ARG A NE    1 
ATOM   2181  C  CZ    . ARG A  1 320  ? 225.657 187.229 160.244 1.00 105.30 ? 314  ARG A CZ    1 
ATOM   2182  N  NH1   . ARG A  1 320  ? 224.610 186.525 159.845 1.00 105.30 ? 314  ARG A NH1   1 
ATOM   2183  N  NH2   . ARG A  1 320  ? 226.868 186.895 159.824 1.00 105.30 ? 314  ARG A NH2   1 
ATOM   2184  N  N     . PHE A  1 321  ? 224.215 190.397 167.146 1.00 107.54 ? 315  PHE A N     1 
ATOM   2185  C  CA    . PHE A  1 321  ? 224.381 189.881 168.496 1.00 107.54 ? 315  PHE A CA    1 
ATOM   2186  C  C     . PHE A  1 321  ? 224.694 188.390 168.450 1.00 107.54 ? 315  PHE A C     1 
ATOM   2187  O  O     . PHE A  1 321  ? 223.944 187.599 167.872 1.00 107.54 ? 315  PHE A O     1 
ATOM   2188  C  CB    . PHE A  1 321  ? 223.120 190.125 169.329 1.00 107.54 ? 315  PHE A CB    1 
ATOM   2189  C  CG    . PHE A  1 321  ? 222.893 191.565 169.686 1.00 107.54 ? 315  PHE A CG    1 
ATOM   2190  C  CD1   . PHE A  1 321  ? 223.550 192.138 170.756 1.00 107.54 ? 315  PHE A CD1   1 
ATOM   2191  C  CD2   . PHE A  1 321  ? 222.016 192.347 168.957 1.00 107.54 ? 315  PHE A CD2   1 
ATOM   2192  C  CE1   . PHE A  1 321  ? 223.345 193.464 171.090 1.00 107.54 ? 315  PHE A CE1   1 
ATOM   2193  C  CE2   . PHE A  1 321  ? 221.806 193.672 169.287 1.00 107.54 ? 315  PHE A CE2   1 
ATOM   2194  C  CZ    . PHE A  1 321  ? 222.472 194.229 170.354 1.00 107.54 ? 315  PHE A CZ    1 
ATOM   2195  N  N     . VAL A  1 322  ? 225.808 188.012 169.059 1.00 103.98 ? 316  VAL A N     1 
ATOM   2196  C  CA    . VAL A  1 322  ? 226.231 186.611 169.051 1.00 103.98 ? 316  VAL A CA    1 
ATOM   2197  C  C     . VAL A  1 322  ? 225.247 185.800 169.888 1.00 103.98 ? 316  VAL A C     1 
ATOM   2198  O  O     . VAL A  1 322  ? 224.823 186.267 170.958 1.00 103.98 ? 316  VAL A O     1 
ATOM   2199  C  CB    . VAL A  1 322  ? 227.649 186.478 169.590 1.00 103.98 ? 316  VAL A CB    1 
ATOM   2200  N  N     . PRO A  1 323  ? 224.853 184.616 169.441 1.00 109.22 ? 317  PRO A N     1 
ATOM   2201  C  CA    . PRO A  1 323  ? 223.889 183.823 170.211 1.00 109.22 ? 317  PRO A CA    1 
ATOM   2202  C  C     . PRO A  1 323  ? 224.442 183.407 171.563 1.00 109.22 ? 317  PRO A C     1 
ATOM   2203  O  O     . PRO A  1 323  ? 225.380 182.609 171.644 1.00 109.22 ? 317  PRO A O     1 
ATOM   2204  C  CB    . PRO A  1 323  ? 223.637 182.608 169.312 1.00 109.22 ? 317  PRO A CB    1 
ATOM   2205  C  CG    . PRO A  1 323  ? 223.979 183.076 167.948 1.00 109.22 ? 317  PRO A CG    1 
ATOM   2206  C  CD    . PRO A  1 323  ? 225.128 184.018 168.130 1.00 109.22 ? 317  PRO A CD    1 
ATOM   2207  N  N     . ILE A  1 324  ? 223.850 183.950 172.634 1.00 118.07 ? 318  ILE A N     1 
ATOM   2208  C  CA    . ILE A  1 324  ? 224.276 183.642 173.995 1.00 118.07 ? 318  ILE A CA    1 
ATOM   2209  C  C     . ILE A  1 324  ? 223.554 182.435 174.575 1.00 118.07 ? 318  ILE A C     1 
ATOM   2210  O  O     . ILE A  1 324  ? 223.628 182.204 175.790 1.00 118.07 ? 318  ILE A O     1 
ATOM   2211  C  CB    . ILE A  1 324  ? 224.084 184.867 174.911 1.00 118.07 ? 318  ILE A CB    1 
ATOM   2212  C  CG1   . ILE A  1 324  ? 222.656 185.394 174.805 1.00 118.07 ? 318  ILE A CG1   1 
ATOM   2213  C  CG2   . ILE A  1 324  ? 225.099 185.957 174.604 1.00 118.07 ? 318  ILE A CG2   1 
ATOM   2214  C  CD1   . ILE A  1 324  ? 222.343 186.463 175.810 1.00 118.07 ? 318  ILE A CD1   1 
ATOM   2215  N  N     . VAL A  1 325  ? 222.849 181.668 173.753 1.00 115.21 ? 319  VAL A N     1 
ATOM   2216  C  CA    . VAL A  1 325  ? 222.149 180.474 174.208 1.00 115.21 ? 319  VAL A CA    1 
ATOM   2217  C  C     . VAL A  1 325  ? 222.855 179.256 173.634 1.00 115.21 ? 319  VAL A C     1 
ATOM   2218  O  O     . VAL A  1 325  ? 223.367 179.294 172.511 1.00 115.21 ? 319  VAL A O     1 
ATOM   2219  C  CB    . VAL A  1 325  ? 220.676 180.508 173.782 1.00 115.21 ? 319  VAL A CB    1 
ATOM   2220  C  CG1   . VAL A  1 325  ? 219.943 179.283 174.298 1.00 115.21 ? 319  VAL A CG1   1 
ATOM   2221  C  CG2   . VAL A  1 325  ? 220.019 181.783 174.259 1.00 115.21 ? 319  VAL A CG2   1 
ATOM   2222  N  N     . ALA A  1 326  ? 222.913 178.184 174.414 1.00 124.08 ? 320  ALA A N     1 
ATOM   2223  C  CA    . ALA A  1 326  ? 223.431 176.914 173.939 1.00 124.08 ? 320  ALA A CA    1 
ATOM   2224  C  C     . ALA A  1 326  ? 222.648 175.786 174.590 1.00 124.08 ? 320  ALA A C     1 
ATOM   2225  O  O     . ALA A  1 326  ? 222.160 175.919 175.714 1.00 124.08 ? 320  ALA A O     1 
ATOM   2226  C  CB    . ALA A  1 326  ? 224.931 176.770 174.231 1.00 124.08 ? 320  ALA A CB    1 
ATOM   2227  N  N     . GLU A  1 327  ? 222.517 174.678 173.872 1.00 136.03 ? 321  GLU A N     1 
ATOM   2228  C  CA    . GLU A  1 327  ? 221.801 173.519 174.398 1.00 136.03 ? 321  GLU A CA    1 
ATOM   2229  C  C     . GLU A  1 327  ? 222.666 172.924 175.498 1.00 136.03 ? 321  GLU A C     1 
ATOM   2230  O  O     . GLU A  1 327  ? 223.654 172.241 175.227 1.00 136.03 ? 321  GLU A O     1 
ATOM   2231  C  CB    . GLU A  1 327  ? 221.515 172.505 173.295 1.00 136.03 ? 321  GLU A CB    1 
ATOM   2232  C  CG    . GLU A  1 327  ? 220.477 171.454 173.663 1.00 136.03 ? 321  GLU A CG    1 
ATOM   2233  C  CD    . GLU A  1 327  ? 221.054 170.304 174.460 1.00 136.03 ? 321  GLU A CD    1 
ATOM   2234  O  OE1   . GLU A  1 327  ? 222.257 170.011 174.302 1.00 136.03 ? 321  GLU A OE1   1 
ATOM   2235  O  OE2   . GLU A  1 327  ? 220.305 169.690 175.248 1.00 136.03 ? 321  GLU A OE2   1 
ATOM   2236  N  N     . GLU A  1 328  ? 222.308 173.205 176.746 1.00 144.28 ? 322  GLU A N     1 
ATOM   2237  C  CA    . GLU A  1 328  ? 223.040 172.673 177.882 1.00 144.28 ? 322  GLU A CA    1 
ATOM   2238  C  C     . GLU A  1 328  ? 222.825 171.170 177.986 1.00 144.28 ? 322  GLU A C     1 
ATOM   2239  O  O     . GLU A  1 328  ? 222.075 170.565 177.219 1.00 144.28 ? 322  GLU A O     1 
ATOM   2240  C  CB    . GLU A  1 328  ? 222.605 173.358 179.175 1.00 144.28 ? 322  GLU A CB    1 
ATOM   2241  N  N     . ASP A  1 329  ? 223.492 170.563 178.959 1.00 157.01 ? 323  ASP A N     1 
ATOM   2242  C  CA    . ASP A  1 329  ? 223.265 169.148 179.191 1.00 157.01 ? 323  ASP A CA    1 
ATOM   2243  C  C     . ASP A  1 329  ? 221.834 168.970 179.676 1.00 157.01 ? 323  ASP A C     1 
ATOM   2244  O  O     . ASP A  1 329  ? 221.524 169.256 180.836 1.00 157.01 ? 323  ASP A O     1 
ATOM   2245  C  CB    . ASP A  1 329  ? 224.265 168.594 180.208 1.00 157.01 ? 323  ASP A CB    1 
ATOM   2246  N  N     . GLY A  1 330  ? 220.959 168.503 178.790 1.00 151.24 ? 324  GLY A N     1 
ATOM   2247  C  CA    . GLY A  1 330  ? 219.554 168.387 179.131 1.00 151.24 ? 324  GLY A CA    1 
ATOM   2248  C  C     . GLY A  1 330  ? 218.921 169.688 179.567 1.00 151.24 ? 324  GLY A C     1 
ATOM   2249  O  O     . GLY A  1 330  ? 218.072 169.687 180.464 1.00 151.24 ? 324  GLY A O     1 
ATOM   2250  N  N     . ARG A  1 331  ? 219.309 170.800 178.954 1.00 139.80 ? 325  ARG A N     1 
ATOM   2251  C  CA    . ARG A  1 331  ? 218.854 172.114 179.376 1.00 139.80 ? 325  ARG A CA    1 
ATOM   2252  C  C     . ARG A  1 331  ? 219.211 173.105 178.281 1.00 139.80 ? 325  ARG A C     1 
ATOM   2253  O  O     . ARG A  1 331  ? 219.960 172.796 177.352 1.00 139.80 ? 325  ARG A O     1 
ATOM   2254  C  CB    . ARG A  1 331  ? 219.487 172.504 180.714 1.00 139.80 ? 325  ARG A CB    1 
ATOM   2255  C  CG    . ARG A  1 331  ? 218.936 173.749 181.364 1.00 139.80 ? 325  ARG A CG    1 
ATOM   2256  C  CD    . ARG A  1 331  ? 219.678 174.030 182.651 1.00 139.80 ? 325  ARG A CD    1 
ATOM   2257  N  NE    . ARG A  1 331  ? 219.515 172.942 183.609 1.00 139.80 ? 325  ARG A NE    1 
ATOM   2258  C  CZ    . ARG A  1 331  ? 218.457 172.797 184.400 1.00 139.80 ? 325  ARG A CZ    1 
ATOM   2259  N  NH1   . ARG A  1 331  ? 217.462 173.672 184.343 1.00 139.80 ? 325  ARG A NH1   1 
ATOM   2260  N  NH2   . ARG A  1 331  ? 218.392 171.775 185.241 1.00 139.80 ? 325  ARG A NH2   1 
ATOM   2261  N  N     . TYR A  1 332  ? 218.650 174.299 178.389 1.00 128.46 ? 326  TYR A N     1 
ATOM   2262  C  CA    . TYR A  1 332  ? 218.960 175.400 177.492 1.00 128.46 ? 326  TYR A CA    1 
ATOM   2263  C  C     . TYR A  1 332  ? 219.813 176.391 178.270 1.00 128.46 ? 326  TYR A C     1 
ATOM   2264  O  O     . TYR A  1 332  ? 219.377 176.935 179.289 1.00 128.46 ? 326  TYR A O     1 
ATOM   2265  C  CB    . TYR A  1 332  ? 217.683 176.033 176.957 1.00 128.46 ? 326  TYR A CB    1 
ATOM   2266  C  CG    . TYR A  1 332  ? 216.902 175.105 176.060 1.00 128.46 ? 326  TYR A CG    1 
ATOM   2267  C  CD1   . TYR A  1 332  ? 217.254 174.939 174.732 1.00 128.46 ? 326  TYR A CD1   1 
ATOM   2268  C  CD2   . TYR A  1 332  ? 215.822 174.384 176.544 1.00 128.46 ? 326  TYR A CD2   1 
ATOM   2269  C  CE1   . TYR A  1 332  ? 216.548 174.091 173.908 1.00 128.46 ? 326  TYR A CE1   1 
ATOM   2270  C  CE2   . TYR A  1 332  ? 215.109 173.533 175.727 1.00 128.46 ? 326  TYR A CE2   1 
ATOM   2271  C  CZ    . TYR A  1 332  ? 215.475 173.392 174.409 1.00 128.46 ? 326  TYR A CZ    1 
ATOM   2272  O  OH    . TYR A  1 332  ? 214.771 172.546 173.588 1.00 128.46 ? 326  TYR A OH    1 
ATOM   2273  N  N     . SER A  1 333  ? 221.037 176.592 177.810 1.00 127.37 ? 327  SER A N     1 
ATOM   2274  C  CA    . SER A  1 333  ? 222.021 177.376 178.534 1.00 127.37 ? 327  SER A CA    1 
ATOM   2275  C  C     . SER A  1 333  ? 222.052 178.784 177.970 1.00 127.37 ? 327  SER A C     1 
ATOM   2276  O  O     . SER A  1 333  ? 222.661 179.019 176.922 1.00 127.37 ? 327  SER A O     1 
ATOM   2277  C  CB    . SER A  1 333  ? 223.402 176.730 178.431 1.00 127.37 ? 327  SER A CB    1 
ATOM   2278  O  OG    . SER A  1 333  ? 223.842 176.698 177.091 1.00 127.37 ? 327  SER A OG    1 
ATOM   2279  N  N     . VAL A  1 334  ? 221.413 179.714 178.656 1.00 116.93 ? 328  VAL A N     1 
ATOM   2280  C  CA    . VAL A  1 334  ? 221.503 181.109 178.273 1.00 116.93 ? 328  VAL A CA    1 
ATOM   2281  C  C     . VAL A  1 334  ? 222.741 181.666 178.944 1.00 116.93 ? 328  VAL A C     1 
ATOM   2282  O  O     . VAL A  1 334  ? 222.720 182.005 180.127 1.00 116.93 ? 328  VAL A O     1 
ATOM   2283  C  CB    . VAL A  1 334  ? 220.256 181.901 178.658 1.00 116.93 ? 328  VAL A CB    1 
ATOM   2284  C  CG1   . VAL A  1 334  ? 220.468 183.352 178.290 1.00 116.93 ? 328  VAL A CG1   1 
ATOM   2285  C  CG2   . VAL A  1 334  ? 219.062 181.343 177.932 1.00 116.93 ? 328  VAL A CG2   1 
ATOM   2286  N  N     . ASP A  1 335  ? 223.827 181.753 178.194 1.00 123.44 ? 329  ASP A N     1 
ATOM   2287  C  CA    . ASP A  1 335  ? 225.043 182.346 178.723 1.00 123.44 ? 329  ASP A CA    1 
ATOM   2288  C  C     . ASP A  1 335  ? 224.777 183.835 178.848 1.00 123.44 ? 329  ASP A C     1 
ATOM   2289  O  O     . ASP A  1 335  ? 224.935 184.590 177.891 1.00 123.44 ? 329  ASP A O     1 
ATOM   2290  C  CB    . ASP A  1 335  ? 226.223 182.053 177.812 1.00 123.44 ? 329  ASP A CB    1 
ATOM   2291  C  CG    . ASP A  1 335  ? 227.533 182.500 178.400 1.00 123.44 ? 329  ASP A CG    1 
ATOM   2292  O  OD1   . ASP A  1 335  ? 227.525 183.076 179.508 1.00 123.44 ? 329  ASP A OD1   1 
ATOM   2293  O  OD2   . ASP A  1 335  ? 228.573 182.280 177.752 1.00 123.44 ? 329  ASP A OD2   1 
ATOM   2294  N  N     . TYR A  1 336  ? 224.336 184.247 180.028 1.00 116.98 ? 330  TYR A N     1 
ATOM   2295  C  CA    . TYR A  1 336  ? 224.095 185.653 180.305 1.00 116.98 ? 330  TYR A CA    1 
ATOM   2296  C  C     . TYR A  1 336  ? 225.359 186.487 180.260 1.00 116.98 ? 330  TYR A C     1 
ATOM   2297  O  O     . TYR A  1 336  ? 225.273 187.693 180.012 1.00 116.98 ? 330  TYR A O     1 
ATOM   2298  C  CB    . TYR A  1 336  ? 223.405 185.798 181.657 1.00 116.98 ? 330  TYR A CB    1 
ATOM   2299  C  CG    . TYR A  1 336  ? 221.911 185.669 181.554 1.00 116.98 ? 330  TYR A CG    1 
ATOM   2300  C  CD1   . TYR A  1 336  ? 221.131 186.789 181.319 1.00 116.98 ? 330  TYR A CD1   1 
ATOM   2301  C  CD2   . TYR A  1 336  ? 221.284 184.434 181.634 1.00 116.98 ? 330  TYR A CD2   1 
ATOM   2302  C  CE1   . TYR A  1 336  ? 219.773 186.696 181.211 1.00 116.98 ? 330  TYR A CE1   1 
ATOM   2303  C  CE2   . TYR A  1 336  ? 219.915 184.328 181.518 1.00 116.98 ? 330  TYR A CE2   1 
ATOM   2304  C  CZ    . TYR A  1 336  ? 219.157 185.468 181.310 1.00 116.98 ? 330  TYR A CZ    1 
ATOM   2305  O  OH    . TYR A  1 336  ? 217.794 185.381 181.200 1.00 116.98 ? 330  TYR A OH    1 
ATOM   2306  N  N     . SER A  1 337  ? 226.522 185.888 180.485 1.00 114.06 ? 331  SER A N     1 
ATOM   2307  C  CA    . SER A  1 337  ? 227.755 186.577 180.168 1.00 114.06 ? 331  SER A CA    1 
ATOM   2308  C  C     . SER A  1 337  ? 227.781 186.897 178.677 1.00 114.06 ? 331  SER A C     1 
ATOM   2309  O  O     . SER A  1 337  ? 226.979 186.382 177.894 1.00 114.06 ? 331  SER A O     1 
ATOM   2310  C  CB    . SER A  1 337  ? 228.958 185.721 180.540 1.00 114.06 ? 331  SER A CB    1 
ATOM   2311  O  OG    . SER A  1 337  ? 229.025 184.589 179.698 1.00 114.06 ? 331  SER A OG    1 
ATOM   2312  N  N     . LYS A  1 338  ? 228.716 187.768 178.292 1.00 115.90 ? 332  LYS A N     1 
ATOM   2313  C  CA    . LYS A  1 338  ? 228.808 188.327 176.942 1.00 115.90 ? 332  LYS A CA    1 
ATOM   2314  C  C     . LYS A  1 338  ? 227.440 188.688 176.383 1.00 115.90 ? 332  LYS A C     1 
ATOM   2315  O  O     . LYS A  1 338  ? 227.198 188.563 175.179 1.00 115.90 ? 332  LYS A O     1 
ATOM   2316  C  CB    . LYS A  1 338  ? 229.542 187.372 175.980 1.00 115.90 ? 332  LYS A CB    1 
ATOM   2317  C  CG    . LYS A  1 338  ? 228.804 186.082 175.590 1.00 115.90 ? 332  LYS A CG    1 
ATOM   2318  C  CD    . LYS A  1 338  ? 229.588 185.289 174.549 1.00 115.90 ? 332  LYS A CD    1 
ATOM   2319  C  CE    . LYS A  1 338  ? 228.909 183.969 174.197 1.00 115.90 ? 332  LYS A CE    1 
ATOM   2320  N  NZ    . LYS A  1 338  ? 227.600 184.158 173.515 1.00 115.90 ? 332  LYS A NZ    1 
ATOM   2321  N  N     . PHE A  1 339  ? 226.560 189.171 177.251 1.00 112.03 ? 333  PHE A N     1 
ATOM   2322  C  CA    . PHE A  1 339  ? 225.153 189.367 176.937 1.00 112.03 ? 333  PHE A CA    1 
ATOM   2323  C  C     . PHE A  1 339  ? 224.940 190.209 175.687 1.00 112.03 ? 333  PHE A C     1 
ATOM   2324  O  O     . PHE A  1 339  ? 224.276 189.774 174.742 1.00 112.03 ? 333  PHE A O     1 
ATOM   2325  C  CB    . PHE A  1 339  ? 224.447 190.021 178.124 1.00 112.03 ? 333  PHE A CB    1 
ATOM   2326  C  CG    . PHE A  1 339  ? 222.985 190.265 177.904 1.00 112.03 ? 333  PHE A CG    1 
ATOM   2327  C  CD1   . PHE A  1 339  ? 222.077 189.228 177.975 1.00 112.03 ? 333  PHE A CD1   1 
ATOM   2328  C  CD2   . PHE A  1 339  ? 222.518 191.539 177.638 1.00 112.03 ? 333  PHE A CD2   1 
ATOM   2329  C  CE1   . PHE A  1 339  ? 220.733 189.457 177.780 1.00 112.03 ? 333  PHE A CE1   1 
ATOM   2330  C  CE2   . PHE A  1 339  ? 221.176 191.771 177.442 1.00 112.03 ? 333  PHE A CE2   1 
ATOM   2331  C  CZ    . PHE A  1 339  ? 220.284 190.728 177.512 1.00 112.03 ? 333  PHE A CZ    1 
ATOM   2332  N  N     . GLY A  1 340  ? 225.483 191.419 175.683 1.00 109.87 ? 334  GLY A N     1 
ATOM   2333  C  CA    . GLY A  1 340  ? 225.308 192.311 174.558 1.00 109.87 ? 334  GLY A CA    1 
ATOM   2334  C  C     . GLY A  1 340  ? 226.480 192.276 173.604 1.00 109.87 ? 334  GLY A C     1 
ATOM   2335  O  O     . GLY A  1 340  ? 226.539 193.077 172.665 1.00 109.87 ? 334  GLY A O     1 
ATOM   2336  N  N     . ASN A  1 341  ? 227.427 191.369 173.834 1.00 108.64 ? 335  ASN A N     1 
ATOM   2337  C  CA    . ASN A  1 341  ? 228.561 191.234 172.933 1.00 108.64 ? 335  ASN A CA    1 
ATOM   2338  C  C     . ASN A  1 341  ? 228.089 190.837 171.545 1.00 108.64 ? 335  ASN A C     1 
ATOM   2339  O  O     . ASN A  1 341  ? 227.319 189.888 171.383 1.00 108.64 ? 335  ASN A O     1 
ATOM   2340  C  CB    . ASN A  1 341  ? 229.576 190.223 173.463 1.00 108.64 ? 335  ASN A CB    1 
ATOM   2341  C  CG    . ASN A  1 341  ? 230.484 190.816 174.522 1.00 108.64 ? 335  ASN A CG    1 
ATOM   2342  O  OD1   . ASN A  1 341  ? 230.459 190.419 175.683 1.00 108.64 ? 335  ASN A OD1   1 
ATOM   2343  N  ND2   . ASN A  1 341  ? 231.307 191.772 174.114 1.00 108.64 ? 335  ASN A ND2   1 
ATOM   2344  N  N     . THR A  1 342  ? 228.559 191.576 170.549 1.00 116.05 ? 336  THR A N     1 
ATOM   2345  C  CA    . THR A  1 342  ? 228.158 191.447 169.158 1.00 116.05 ? 336  THR A CA    1 
ATOM   2346  C  C     . THR A  1 342  ? 229.325 190.953 168.316 1.00 116.05 ? 336  THR A C     1 
ATOM   2347  O  O     . THR A  1 342  ? 230.389 190.594 168.825 1.00 116.05 ? 336  THR A O     1 
ATOM   2348  C  CB    . THR A  1 342  ? 227.655 192.783 168.616 1.00 116.05 ? 336  THR A CB    1 
ATOM   2349  O  OG1   . THR A  1 342  ? 228.723 193.733 168.638 1.00 116.05 ? 336  THR A OG1   1 
ATOM   2350  C  CG2   . THR A  1 342  ? 226.535 193.302 169.477 1.00 116.05 ? 336  THR A CG2   1 
ATOM   2351  N  N     . ILE A  1 343  ? 229.105 190.935 167.005 1.00 122.83 ? 337  ILE A N     1 
ATOM   2352  C  CA    . ILE A  1 343  ? 230.140 190.623 166.026 1.00 122.83 ? 337  ILE A CA    1 
ATOM   2353  C  C     . ILE A  1 343  ? 229.935 191.504 164.801 1.00 122.83 ? 337  ILE A C     1 
ATOM   2354  O  O     . ILE A  1 343  ? 228.803 191.704 164.351 1.00 122.83 ? 337  ILE A O     1 
ATOM   2355  C  CB    . ILE A  1 343  ? 230.137 189.122 165.655 1.00 122.83 ? 337  ILE A CB    1 
ATOM   2356  C  CG1   . ILE A  1 343  ? 231.303 188.789 164.718 1.00 122.83 ? 337  ILE A CG1   1 
ATOM   2357  C  CG2   . ILE A  1 343  ? 228.785 188.688 165.088 1.00 122.83 ? 337  ILE A CG2   1 
ATOM   2358  C  CD1   . ILE A  1 343  ? 232.671 188.968 165.345 1.00 122.83 ? 337  ILE A CD1   1 
ATOM   2359  N  N     . LYS A  1 344  ? 231.031 192.041 164.269 1.00 122.49 ? 338  LYS A N     1 
ATOM   2360  C  CA    . LYS A  1 344  ? 230.939 192.958 163.139 1.00 122.49 ? 338  LYS A CA    1 
ATOM   2361  C  C     . LYS A  1 344  ? 230.739 192.200 161.834 1.00 122.49 ? 338  LYS A C     1 
ATOM   2362  O  O     . LYS A  1 344  ? 231.377 191.170 161.600 1.00 122.49 ? 338  LYS A O     1 
ATOM   2363  C  CB    . LYS A  1 344  ? 232.193 193.823 163.050 1.00 122.49 ? 338  LYS A CB    1 
ATOM   2364  C  CG    . LYS A  1 344  ? 232.336 194.828 164.170 1.00 122.49 ? 338  LYS A CG    1 
ATOM   2365  C  CD    . LYS A  1 344  ? 233.568 195.683 163.959 1.00 122.49 ? 338  LYS A CD    1 
ATOM   2366  C  CE    . LYS A  1 344  ? 233.665 196.782 164.997 1.00 122.49 ? 338  LYS A CE    1 
ATOM   2367  N  NZ    . LYS A  1 344  ? 233.906 196.243 166.362 1.00 122.49 ? 338  LYS A NZ    1 
ATOM   2368  N  N     . VAL A  1 345  ? 229.853 192.717 160.986 1.00 128.41 ? 339  VAL A N     1 
ATOM   2369  C  CA    . VAL A  1 345  ? 229.603 192.172 159.653 1.00 128.41 ? 339  VAL A CA    1 
ATOM   2370  C  C     . VAL A  1 345  ? 229.418 193.332 158.679 1.00 128.41 ? 339  VAL A C     1 
ATOM   2371  O  O     . VAL A  1 345  ? 228.646 194.258 158.963 1.00 128.41 ? 339  VAL A O     1 
ATOM   2372  C  CB    . VAL A  1 345  ? 228.373 191.251 159.640 1.00 128.41 ? 339  VAL A CB    1 
ATOM   2373  C  CG1   . VAL A  1 345  ? 228.076 190.797 158.226 1.00 128.41 ? 339  VAL A CG1   1 
ATOM   2374  C  CG2   . VAL A  1 345  ? 228.572 190.050 160.552 1.00 128.41 ? 339  VAL A CG2   1 
ATOM   2375  N  N     . PRO A  1 346  ? 230.095 193.333 157.530 1.00 137.14 ? 340  PRO A N     1 
ATOM   2376  C  CA    . PRO A  1 346  ? 229.868 194.396 156.543 1.00 137.14 ? 340  PRO A CA    1 
ATOM   2377  C  C     . PRO A  1 346  ? 228.460 194.348 155.970 1.00 137.14 ? 340  PRO A C     1 
ATOM   2378  O  O     . PRO A  1 346  ? 227.660 193.467 156.290 1.00 137.14 ? 340  PRO A O     1 
ATOM   2379  C  CB    . PRO A  1 346  ? 230.918 194.108 155.463 1.00 137.14 ? 340  PRO A CB    1 
ATOM   2380  C  CG    . PRO A  1 346  ? 231.969 193.331 156.163 1.00 137.14 ? 340  PRO A CG    1 
ATOM   2381  C  CD    . PRO A  1 346  ? 231.238 192.485 157.161 1.00 137.14 ? 340  PRO A CD    1 
ATOM   2382  N  N     . THR A  1 347  ? 228.173 195.310 155.093 1.00 140.94 ? 341  THR A N     1 
ATOM   2383  C  CA    . THR A  1 347  ? 226.837 195.524 154.550 1.00 140.94 ? 341  THR A CA    1 
ATOM   2384  C  C     . THR A  1 347  ? 226.912 196.633 153.516 1.00 140.94 ? 341  THR A C     1 
ATOM   2385  O  O     . THR A  1 347  ? 227.854 197.434 153.546 1.00 140.94 ? 341  THR A O     1 
ATOM   2386  C  CB    . THR A  1 347  ? 225.849 195.895 155.669 1.00 140.94 ? 341  THR A CB    1 
ATOM   2387  O  OG1   . THR A  1 347  ? 224.547 196.129 155.125 1.00 140.94 ? 341  THR A OG1   1 
ATOM   2388  C  CG2   . THR A  1 347  ? 226.320 197.118 156.402 1.00 140.94 ? 341  THR A CG2   1 
ATOM   2389  N  N     . PRO A  1 348  ? 225.966 196.697 152.580 1.00 144.73 ? 342  PRO A N     1 
ATOM   2390  C  CA    . PRO A  1 348  ? 225.877 197.876 151.710 1.00 144.73 ? 342  PRO A CA    1 
ATOM   2391  C  C     . PRO A  1 348  ? 225.709 199.142 152.535 1.00 144.73 ? 342  PRO A C     1 
ATOM   2392  O  O     . PRO A  1 348  ? 224.730 199.306 153.268 1.00 144.73 ? 342  PRO A O     1 
ATOM   2393  C  CB    . PRO A  1 348  ? 224.643 197.590 150.848 1.00 144.73 ? 342  PRO A CB    1 
ATOM   2394  C  CG    . PRO A  1 348  ? 224.566 196.107 150.808 1.00 144.73 ? 342  PRO A CG    1 
ATOM   2395  C  CD    . PRO A  1 348  ? 225.030 195.639 152.161 1.00 144.73 ? 342  PRO A CD    1 
ATOM   2396  N  N     . LEU A  1 349  ? 226.681 200.039 152.406 1.00 133.84 ? 343  LEU A N     1 
ATOM   2397  C  CA    . LEU A  1 349  ? 226.804 201.187 153.301 1.00 133.84 ? 343  LEU A CA    1 
ATOM   2398  C  C     . LEU A  1 349  ? 226.026 202.384 152.761 1.00 133.84 ? 343  LEU A C     1 
ATOM   2399  O  O     . LEU A  1 349  ? 226.537 203.494 152.625 1.00 133.84 ? 343  LEU A O     1 
ATOM   2400  C  CB    . LEU A  1 349  ? 228.271 201.534 153.498 1.00 133.84 ? 343  LEU A CB    1 
ATOM   2401  C  CG    . LEU A  1 349  ? 229.049 200.384 154.113 1.00 133.84 ? 343  LEU A CG    1 
ATOM   2402  C  CD1   . LEU A  1 349  ? 230.507 200.763 154.240 1.00 133.84 ? 343  LEU A CD1   1 
ATOM   2403  C  CD2   . LEU A  1 349  ? 228.451 200.010 155.449 1.00 133.84 ? 343  LEU A CD2   1 
ATOM   2404  N  N     . CYS A  1 350  ? 224.757 202.137 152.461 1.00 141.70 ? 344  CYS A N     1 
ATOM   2405  C  CA    . CYS A  1 350  ? 223.896 203.172 151.918 1.00 141.70 ? 344  CYS A CA    1 
ATOM   2406  C  C     . CYS A  1 350  ? 222.508 203.015 152.515 1.00 141.70 ? 344  CYS A C     1 
ATOM   2407  O  O     . CYS A  1 350  ? 222.225 202.062 153.244 1.00 141.70 ? 344  CYS A O     1 
ATOM   2408  C  CB    . CYS A  1 350  ? 223.860 203.117 150.389 1.00 141.70 ? 344  CYS A CB    1 
ATOM   2409  S  SG    . CYS A  1 350  ? 223.126 201.633 149.700 1.00 141.70 ? 344  CYS A SG    1 
ATOM   2410  N  N     . THR A  1 351  ? 221.643 203.974 152.211 1.00 145.85 ? 345  THR A N     1 
ATOM   2411  C  CA    . THR A  1 351  ? 220.314 203.969 152.797 1.00 145.85 ? 345  THR A CA    1 
ATOM   2412  C  C     . THR A  1 351  ? 219.500 202.796 152.275 1.00 145.85 ? 345  THR A C     1 
ATOM   2413  O  O     . THR A  1 351  ? 219.696 202.324 151.155 1.00 145.85 ? 345  THR A O     1 
ATOM   2414  C  CB    . THR A  1 351  ? 219.575 205.272 152.489 1.00 145.85 ? 345  THR A CB    1 
ATOM   2415  O  OG1   . THR A  1 351  ? 219.431 205.412 151.071 1.00 145.85 ? 345  THR A OG1   1 
ATOM   2416  C  CG2   . THR A  1 351  ? 220.320 206.466 153.038 1.00 145.85 ? 345  THR A CG2   1 
ATOM   2417  N  N     . ALA A  1 352  ? 218.569 202.332 153.107 1.00 143.35 ? 346  ALA A N     1 
ATOM   2418  C  CA    . ALA A  1 352  ? 217.574 201.386 152.620 1.00 143.35 ? 346  ALA A CA    1 
ATOM   2419  C  C     . ALA A  1 352  ? 216.865 201.934 151.391 1.00 143.35 ? 346  ALA A C     1 
ATOM   2420  O  O     . ALA A  1 352  ? 216.426 201.166 150.528 1.00 143.35 ? 346  ALA A O     1 
ATOM   2421  C  CB    . ALA A  1 352  ? 216.574 201.061 153.728 1.00 143.35 ? 346  ALA A CB    1 
ATOM   2422  N  N     . ARG A  1 353  ? 216.758 203.260 151.289 1.00 142.43 ? 347  ARG A N     1 
ATOM   2423  C  CA    . ARG A  1 353  ? 216.329 203.878 150.043 1.00 142.43 ? 347  ARG A CA    1 
ATOM   2424  C  C     . ARG A  1 353  ? 217.233 203.472 148.891 1.00 142.43 ? 347  ARG A C     1 
ATOM   2425  O  O     . ARG A  1 353  ? 216.778 202.865 147.919 1.00 142.43 ? 347  ARG A O     1 
ATOM   2426  C  CB    . ARG A  1 353  ? 216.305 205.396 150.191 1.00 142.43 ? 347  ARG A CB    1 
ATOM   2427  C  CG    . ARG A  1 353  ? 215.824 206.102 148.947 1.00 142.43 ? 347  ARG A CG    1 
ATOM   2428  C  CD    . ARG A  1 353  ? 215.610 207.563 149.220 1.00 142.43 ? 347  ARG A CD    1 
ATOM   2429  N  NE    . ARG A  1 353  ? 214.605 207.709 150.266 1.00 142.43 ? 347  ARG A NE    1 
ATOM   2430  C  CZ    . ARG A  1 353  ? 213.298 207.581 150.066 1.00 142.43 ? 347  ARG A CZ    1 
ATOM   2431  N  NH1   . ARG A  1 353  ? 212.835 207.290 148.858 1.00 142.43 ? 347  ARG A NH1   1 
ATOM   2432  N  NH2   . ARG A  1 353  ? 212.455 207.728 151.076 1.00 142.43 ? 347  ARG A NH2   1 
ATOM   2433  N  N     . GLN A  1 354  ? 218.521 203.806 148.980 1.00 151.05 ? 348  GLN A N     1 
ATOM   2434  C  CA    . GLN A  1 354  ? 219.460 203.393 147.947 1.00 151.05 ? 348  GLN A CA    1 
ATOM   2435  C  C     . GLN A  1 354  ? 219.604 201.882 147.870 1.00 151.05 ? 348  GLN A C     1 
ATOM   2436  O  O     . GLN A  1 354  ? 219.931 201.363 146.800 1.00 151.05 ? 348  GLN A O     1 
ATOM   2437  C  CB    . GLN A  1 354  ? 220.824 204.042 148.182 1.00 151.05 ? 348  GLN A CB    1 
ATOM   2438  C  CG    . GLN A  1 354  ? 220.785 205.557 148.113 1.00 151.05 ? 348  GLN A CG    1 
ATOM   2439  C  CD    . GLN A  1 354  ? 222.126 206.200 148.396 1.00 151.05 ? 348  GLN A CD    1 
ATOM   2440  O  OE1   . GLN A  1 354  ? 223.124 205.516 148.611 1.00 151.05 ? 348  GLN A OE1   1 
ATOM   2441  N  NE2   . GLN A  1 354  ? 222.149 207.526 148.429 1.00 151.05 ? 348  GLN A NE2   1 
ATOM   2442  N  N     . LEU A  1 355  ? 219.354 201.161 148.969 1.00 153.32 ? 349  LEU A N     1 
ATOM   2443  C  CA    . LEU A  1 355  ? 219.250 199.710 148.870 1.00 153.32 ? 349  LEU A CA    1 
ATOM   2444  C  C     . LEU A  1 355  ? 218.188 199.300 147.863 1.00 153.32 ? 349  LEU A C     1 
ATOM   2445  O  O     . LEU A  1 355  ? 218.471 198.539 146.937 1.00 153.32 ? 349  LEU A O     1 
ATOM   2446  C  CB    . LEU A  1 355  ? 218.941 199.083 150.227 1.00 153.32 ? 349  LEU A CB    1 
ATOM   2447  C  CG    . LEU A  1 355  ? 220.090 198.545 151.066 1.00 153.32 ? 349  LEU A CG    1 
ATOM   2448  C  CD1   . LEU A  1 355  ? 220.759 197.442 150.276 1.00 153.32 ? 349  LEU A CD1   1 
ATOM   2449  C  CD2   . LEU A  1 355  ? 221.070 199.626 151.446 1.00 153.32 ? 349  LEU A CD2   1 
ATOM   2450  N  N     . ASP A  1 356  ? 216.957 199.779 148.035 1.00 160.36 ? 350  ASP A N     1 
ATOM   2451  C  CA    . ASP A  1 356  ? 215.911 199.419 147.088 1.00 160.36 ? 350  ASP A CA    1 
ATOM   2452  C  C     . ASP A  1 356  ? 216.177 199.990 145.708 1.00 160.36 ? 350  ASP A C     1 
ATOM   2453  O  O     . ASP A  1 356  ? 215.789 199.380 144.709 1.00 160.36 ? 350  ASP A O     1 
ATOM   2454  C  CB    . ASP A  1 356  ? 214.544 199.879 147.590 1.00 160.36 ? 350  ASP A CB    1 
ATOM   2455  C  CG    . ASP A  1 356  ? 214.059 199.066 148.769 1.00 160.36 ? 350  ASP A CG    1 
ATOM   2456  O  OD1   . ASP A  1 356  ? 214.478 197.898 148.885 1.00 160.36 ? 350  ASP A OD1   1 
ATOM   2457  O  OD2   . ASP A  1 356  ? 213.255 199.586 149.573 1.00 160.36 ? 350  ASP A OD2   1 
ATOM   2458  N  N     . GLU A  1 357  ? 216.860 201.130 145.632 1.00 169.34 ? 351  GLU A N     1 
ATOM   2459  C  CA    . GLU A  1 357  ? 217.240 201.685 144.336 1.00 169.34 ? 351  GLU A CA    1 
ATOM   2460  C  C     . GLU A  1 357  ? 218.139 200.725 143.570 1.00 169.34 ? 351  GLU A C     1 
ATOM   2461  O  O     . GLU A  1 357  ? 217.808 200.299 142.455 1.00 169.34 ? 351  GLU A O     1 
ATOM   2462  C  CB    . GLU A  1 357  ? 217.942 203.025 144.533 1.00 169.34 ? 351  GLU A CB    1 
ATOM   2463  C  CG    . GLU A  1 357  ? 217.039 204.121 145.040 1.00 169.34 ? 351  GLU A CG    1 
ATOM   2464  C  CD    . GLU A  1 357  ? 217.784 205.413 145.261 1.00 169.34 ? 351  GLU A CD    1 
ATOM   2465  O  OE1   . GLU A  1 357  ? 219.027 205.399 145.162 1.00 169.34 ? 351  GLU A OE1   1 
ATOM   2466  O  OE2   . GLU A  1 357  ? 217.126 206.441 145.523 1.00 169.34 ? 351  GLU A OE2   1 
ATOM   2467  N  N     . ASP A  1 358  ? 219.281 200.371 144.159 1.00 187.80 ? 352  ASP A N     1 
ATOM   2468  C  CA    . ASP A  1 358  ? 220.214 199.464 143.501 1.00 187.80 ? 352  ASP A CA    1 
ATOM   2469  C  C     . ASP A  1 358  ? 219.607 198.077 143.321 1.00 187.80 ? 352  ASP A C     1 
ATOM   2470  O  O     . ASP A  1 358  ? 219.899 197.390 142.337 1.00 187.80 ? 352  ASP A O     1 
ATOM   2471  C  CB    . ASP A  1 358  ? 221.515 199.388 144.298 1.00 187.80 ? 352  ASP A CB    1 
ATOM   2472  N  N     . HIS A  1 359  ? 218.737 197.658 144.241 1.00 210.03 ? 353  HIS A N     1 
ATOM   2473  C  CA    . HIS A  1 359  ? 218.106 196.350 144.123 1.00 210.03 ? 353  HIS A CA    1 
ATOM   2474  C  C     . HIS A  1 359  ? 217.142 196.309 142.947 1.00 210.03 ? 353  HIS A C     1 
ATOM   2475  O  O     . HIS A  1 359  ? 217.115 195.331 142.195 1.00 210.03 ? 353  HIS A O     1 
ATOM   2476  C  CB    . HIS A  1 359  ? 217.380 196.001 145.422 1.00 210.03 ? 353  HIS A CB    1 
ATOM   2477  N  N     . SER A  1 360  ? 216.337 197.359 142.776 1.00 220.77 ? 354  SER A N     1 
ATOM   2478  C  CA    . SER A  1 360  ? 215.463 197.436 141.615 1.00 220.77 ? 354  SER A CA    1 
ATOM   2479  C  C     . SER A  1 360  ? 216.276 197.536 140.332 1.00 220.77 ? 354  SER A C     1 
ATOM   2480  O  O     . SER A  1 360  ? 215.913 196.939 139.313 1.00 220.77 ? 354  SER A O     1 
ATOM   2481  C  CB    . SER A  1 360  ? 214.517 198.628 141.756 1.00 220.77 ? 354  SER A CB    1 
ATOM   2482  N  N     . LEU A  1 361  ? 217.389 198.270 140.368 1.00 230.57 ? 355  LEU A N     1 
ATOM   2483  C  CA    . LEU A  1 361  ? 218.241 198.360 139.188 1.00 230.57 ? 355  LEU A CA    1 
ATOM   2484  C  C     . LEU A  1 361  ? 218.863 197.014 138.837 1.00 230.57 ? 355  LEU A C     1 
ATOM   2485  O  O     . LEU A  1 361  ? 219.084 196.722 137.657 1.00 230.57 ? 355  LEU A O     1 
ATOM   2486  C  CB    . LEU A  1 361  ? 219.331 199.410 139.403 1.00 230.57 ? 355  LEU A CB    1 
ATOM   2487  N  N     . LEU A  1 362  ? 219.153 196.184 139.840 1.00 247.43 ? 356  LEU A N     1 
ATOM   2488  C  CA    . LEU A  1 362  ? 219.771 194.888 139.582 1.00 247.43 ? 356  LEU A CA    1 
ATOM   2489  C  C     . LEU A  1 362  ? 218.743 193.812 139.256 1.00 247.43 ? 356  LEU A C     1 
ATOM   2490  O  O     . LEU A  1 362  ? 219.083 192.815 138.609 1.00 247.43 ? 356  LEU A O     1 
ATOM   2491  C  CB    . LEU A  1 362  ? 220.616 194.461 140.784 1.00 247.43 ? 356  LEU A CB    1 
ATOM   2492  N  N     . GLU A  1 363  ? 217.495 193.987 139.695 1.00 254.24 ? 357  GLU A N     1 
ATOM   2493  C  CA    . GLU A  1 363  ? 216.449 193.010 139.415 1.00 254.24 ? 357  GLU A CA    1 
ATOM   2494  C  C     . GLU A  1 363  ? 215.734 193.272 138.094 1.00 254.24 ? 357  GLU A C     1 
ATOM   2495  O  O     . GLU A  1 363  ? 215.349 192.314 137.416 1.00 254.24 ? 357  GLU A O     1 
ATOM   2496  C  CB    . GLU A  1 363  ? 215.428 192.989 140.553 1.00 254.24 ? 357  GLU A CB    1 
ATOM   2497  N  N     . ALA A  1 364  ? 215.545 194.538 137.716 1.00 257.48 ? 358  ALA A N     1 
ATOM   2498  C  CA    . ALA A  1 364  ? 214.951 194.858 136.426 1.00 257.48 ? 358  ALA A CA    1 
ATOM   2499  C  C     . ALA A  1 364  ? 215.967 194.828 135.292 1.00 257.48 ? 358  ALA A C     1 
ATOM   2500  O  O     . ALA A  1 364  ? 215.639 195.238 134.173 1.00 257.48 ? 358  ALA A O     1 
ATOM   2501  C  CB    . ALA A  1 364  ? 214.276 196.228 136.475 1.00 257.48 ? 358  ALA A CB    1 
ATOM   2502  N  N     . LEU A  1 365  ? 217.188 194.369 135.556 1.00 253.21 ? 359  LEU A N     1 
ATOM   2503  C  CA    . LEU A  1 365  ? 218.222 194.283 134.534 1.00 253.21 ? 359  LEU A CA    1 
ATOM   2504  C  C     . LEU A  1 365  ? 217.988 193.094 133.607 1.00 253.21 ? 359  LEU A C     1 
ATOM   2505  O  O     . LEU A  1 365  ? 218.061 191.941 134.030 1.00 253.21 ? 359  LEU A O     1 
ATOM   2506  C  CB    . LEU A  1 365  ? 219.603 194.181 135.180 1.00 253.21 ? 359  LEU A CB    1 
ATOM   2507  N  N     . ARG B  1 38   ? 170.959 222.056 173.921 1.00 152.91 ? 32   ARG D N     1 
ATOM   2508  C  CA    . ARG B  1 38   ? 172.303 221.750 173.443 1.00 152.91 ? 32   ARG D CA    1 
ATOM   2509  C  C     . ARG B  1 38   ? 173.306 221.667 174.593 1.00 152.91 ? 32   ARG D C     1 
ATOM   2510  O  O     . ARG B  1 38   ? 173.999 222.639 174.894 1.00 152.91 ? 32   ARG D O     1 
ATOM   2511  C  CB    . ARG B  1 38   ? 172.760 222.799 172.434 1.00 152.91 ? 32   ARG D CB    1 
ATOM   2512  C  CG    . ARG B  1 38   ? 174.109 222.508 171.821 1.00 152.91 ? 32   ARG D CG    1 
ATOM   2513  C  CD    . ARG B  1 38   ? 174.458 223.560 170.804 1.00 152.91 ? 32   ARG D CD    1 
ATOM   2514  N  NE    . ARG B  1 38   ? 175.815 223.411 170.293 1.00 152.91 ? 32   ARG D NE    1 
ATOM   2515  C  CZ    . ARG B  1 38   ? 176.142 222.657 169.251 1.00 152.91 ? 32   ARG D CZ    1 
ATOM   2516  N  NH1   . ARG B  1 38   ? 175.204 221.985 168.606 1.00 152.91 ? 32   ARG D NH1   1 
ATOM   2517  N  NH2   . ARG B  1 38   ? 177.404 222.584 168.851 1.00 152.91 ? 32   ARG D NH2   1 
ATOM   2518  N  N     . ALA B  1 39   ? 173.366 220.505 175.244 1.00 147.47 ? 33   ALA D N     1 
ATOM   2519  C  CA    . ALA B  1 39   ? 174.311 220.283 176.331 1.00 147.47 ? 33   ALA D CA    1 
ATOM   2520  C  C     . ALA B  1 39   ? 175.614 219.701 175.800 1.00 147.47 ? 33   ALA D C     1 
ATOM   2521  O  O     . ALA B  1 39   ? 175.661 219.232 174.658 1.00 147.47 ? 33   ALA D O     1 
ATOM   2522  C  CB    . ALA B  1 39   ? 173.699 219.352 177.379 1.00 147.47 ? 33   ALA D CB    1 
ATOM   2523  N  N     . ARG B  1 40   ? 176.676 219.736 176.600 1.00 125.09 ? 34   ARG D N     1 
ATOM   2524  C  CA    . ARG B  1 40   ? 177.896 219.003 176.297 1.00 125.09 ? 34   ARG D CA    1 
ATOM   2525  C  C     . ARG B  1 40   ? 177.730 217.561 176.741 1.00 125.09 ? 34   ARG D C     1 
ATOM   2526  O  O     . ARG B  1 40   ? 177.289 217.297 177.861 1.00 125.09 ? 34   ARG D O     1 
ATOM   2527  C  CB    . ARG B  1 40   ? 179.117 219.585 176.995 1.00 125.09 ? 34   ARG D CB    1 
ATOM   2528  C  CG    . ARG B  1 40   ? 179.523 220.952 176.529 1.00 125.09 ? 34   ARG D CG    1 
ATOM   2529  C  CD    . ARG B  1 40   ? 180.810 221.346 177.211 1.00 125.09 ? 34   ARG D CD    1 
ATOM   2530  N  NE    . ARG B  1 40   ? 181.877 220.441 176.798 1.00 125.09 ? 34   ARG D NE    1 
ATOM   2531  C  CZ    . ARG B  1 40   ? 182.651 220.637 175.737 1.00 125.09 ? 34   ARG D CZ    1 
ATOM   2532  N  NH1   . ARG B  1 40   ? 182.498 221.719 174.992 1.00 125.09 ? 34   ARG D NH1   1 
ATOM   2533  N  NH2   . ARG B  1 40   ? 183.587 219.757 175.428 1.00 125.09 ? 34   ARG D NH2   1 
ATOM   2534  N  N     . PHE B  1 41   ? 178.087 216.633 175.855 1.00 120.61 ? 35   PHE D N     1 
ATOM   2535  C  CA    . PHE B  1 41   ? 178.061 215.223 176.221 1.00 120.61 ? 35   PHE D CA    1 
ATOM   2536  C  C     . PHE B  1 41   ? 178.921 214.966 177.450 1.00 120.61 ? 35   PHE D C     1 
ATOM   2537  O  O     . PHE B  1 41   ? 178.419 214.516 178.487 1.00 120.61 ? 35   PHE D O     1 
ATOM   2538  C  CB    . PHE B  1 41   ? 178.539 214.383 175.046 1.00 120.61 ? 35   PHE D CB    1 
ATOM   2539  C  CG    . PHE B  1 41   ? 178.489 212.914 175.294 1.00 120.61 ? 35   PHE D CG    1 
ATOM   2540  C  CD1   . PHE B  1 41   ? 177.299 212.227 175.209 1.00 120.61 ? 35   PHE D CD1   1 
ATOM   2541  C  CD2   . PHE B  1 41   ? 179.635 212.220 175.612 1.00 120.61 ? 35   PHE D CD2   1 
ATOM   2542  C  CE1   . PHE B  1 41   ? 177.256 210.871 175.436 1.00 120.61 ? 35   PHE D CE1   1 
ATOM   2543  C  CE2   . PHE B  1 41   ? 179.598 210.865 175.845 1.00 120.61 ? 35   PHE D CE2   1 
ATOM   2544  C  CZ    . PHE B  1 41   ? 178.407 210.189 175.757 1.00 120.61 ? 35   PHE D CZ    1 
ATOM   2545  N  N     . VAL B  1 42   ? 180.210 215.271 177.363 1.00 121.61 ? 36   VAL D N     1 
ATOM   2546  C  CA    . VAL B  1 42   ? 181.118 215.199 178.498 1.00 121.61 ? 36   VAL D CA    1 
ATOM   2547  C  C     . VAL B  1 42   ? 181.668 216.592 178.747 1.00 121.61 ? 36   VAL D C     1 
ATOM   2548  O  O     . VAL B  1 42   ? 182.047 217.291 177.801 1.00 121.61 ? 36   VAL D O     1 
ATOM   2549  C  CB    . VAL B  1 42   ? 182.259 214.194 178.264 1.00 121.61 ? 36   VAL D CB    1 
ATOM   2550  C  CG1   . VAL B  1 42   ? 183.285 214.298 179.366 1.00 121.61 ? 36   VAL D CG1   1 
ATOM   2551  C  CG2   . VAL B  1 42   ? 181.707 212.793 178.222 1.00 121.61 ? 36   VAL D CG2   1 
ATOM   2552  N  N     . SER B  1 43   ? 181.695 216.998 180.010 1.00 125.13 ? 37   SER D N     1 
ATOM   2553  C  CA    . SER B  1 43   ? 182.226 218.300 180.369 1.00 125.13 ? 37   SER D CA    1 
ATOM   2554  C  C     . SER B  1 43   ? 183.698 218.392 179.985 1.00 125.13 ? 37   SER D C     1 
ATOM   2555  O  O     . SER B  1 43   ? 184.395 217.387 179.823 1.00 125.13 ? 37   SER D O     1 
ATOM   2556  C  CB    . SER B  1 43   ? 182.049 218.548 181.861 1.00 125.13 ? 37   SER D CB    1 
ATOM   2557  O  OG    . SER B  1 43   ? 182.645 219.774 182.240 1.00 125.13 ? 37   SER D OG    1 
ATOM   2558  N  N     . LYS B  1 44   ? 184.191 219.629 179.874 1.00 128.61 ? 38   LYS D N     1 
ATOM   2559  C  CA    . LYS B  1 44   ? 185.612 219.846 179.622 1.00 128.61 ? 38   LYS D CA    1 
ATOM   2560  C  C     . LYS B  1 44   ? 186.493 219.282 180.727 1.00 128.61 ? 38   LYS D C     1 
ATOM   2561  O  O     . LYS B  1 44   ? 187.717 219.420 180.653 1.00 128.61 ? 38   LYS D O     1 
ATOM   2562  C  CB    . LYS B  1 44   ? 185.909 221.339 179.447 1.00 128.61 ? 38   LYS D CB    1 
ATOM   2563  C  CG    . LYS B  1 44   ? 185.303 221.967 178.195 1.00 128.61 ? 38   LYS D CG    1 
ATOM   2564  C  CD    . LYS B  1 44   ? 185.872 221.339 176.923 1.00 128.61 ? 38   LYS D CD    1 
ATOM   2565  C  CE    . LYS B  1 44   ? 187.335 221.701 176.685 1.00 128.61 ? 38   LYS D CE    1 
ATOM   2566  N  NZ    . LYS B  1 44   ? 187.513 223.125 176.307 1.00 128.61 ? 38   LYS D NZ    1 
ATOM   2567  N  N     . LYS B  1 45   ? 185.906 218.667 181.751 1.00 124.98 ? 39   LYS D N     1 
ATOM   2568  C  CA    . LYS B  1 45   ? 186.657 218.062 182.838 1.00 124.98 ? 39   LYS D CA    1 
ATOM   2569  C  C     . LYS B  1 45   ? 186.245 216.622 183.111 1.00 124.98 ? 39   LYS D C     1 
ATOM   2570  O  O     . LYS B  1 45   ? 186.487 216.116 184.210 1.00 124.98 ? 39   LYS D O     1 
ATOM   2571  C  CB    . LYS B  1 45   ? 186.513 218.905 184.103 1.00 124.98 ? 39   LYS D CB    1 
ATOM   2572  C  CG    . LYS B  1 45   ? 187.046 220.312 183.932 1.00 124.98 ? 39   LYS D CG    1 
ATOM   2573  C  CD    . LYS B  1 45   ? 188.544 220.275 183.678 1.00 124.98 ? 39   LYS D CD    1 
ATOM   2574  C  CE    . LYS B  1 45   ? 189.155 221.665 183.612 1.00 124.98 ? 39   LYS D CE    1 
ATOM   2575  N  NZ    . LYS B  1 45   ? 188.773 222.386 182.371 1.00 124.98 ? 39   LYS D NZ    1 
ATOM   2576  N  N     . GLY B  1 46   ? 185.624 215.952 182.146 1.00 128.10 ? 40   GLY D N     1 
ATOM   2577  C  CA    . GLY B  1 46   ? 185.351 214.538 182.270 1.00 128.10 ? 40   GLY D CA    1 
ATOM   2578  C  C     . GLY B  1 46   ? 184.007 214.179 182.857 1.00 128.10 ? 40   GLY D C     1 
ATOM   2579  O  O     . GLY B  1 46   ? 183.748 212.992 183.074 1.00 128.10 ? 40   GLY D O     1 
ATOM   2580  N  N     . ASN B  1 47   ? 183.147 215.154 183.125 1.00 132.94 ? 41   ASN D N     1 
ATOM   2581  C  CA    . ASN B  1 47   ? 181.847 214.848 183.701 1.00 132.94 ? 41   ASN D CA    1 
ATOM   2582  C  C     . ASN B  1 47   ? 180.879 214.384 182.623 1.00 132.94 ? 41   ASN D C     1 
ATOM   2583  O  O     . ASN B  1 47   ? 180.573 215.118 181.681 1.00 132.94 ? 41   ASN D O     1 
ATOM   2584  C  CB    . ASN B  1 47   ? 181.281 216.072 184.413 1.00 132.94 ? 41   ASN D CB    1 
ATOM   2585  C  CG    . ASN B  1 47   ? 182.160 216.536 185.544 1.00 132.94 ? 41   ASN D CG    1 
ATOM   2586  O  OD1   . ASN B  1 47   ? 182.712 217.632 185.505 1.00 132.94 ? 41   ASN D OD1   1 
ATOM   2587  N  ND2   . ASN B  1 47   ? 182.307 215.696 186.558 1.00 132.94 ? 41   ASN D ND2   1 
ATOM   2588  N  N     . CYS B  1 48   ? 180.378 213.166 182.783 1.00 129.70 ? 42   CYS D N     1 
ATOM   2589  C  CA    . CYS B  1 48   ? 179.413 212.594 181.858 1.00 129.70 ? 42   CYS D CA    1 
ATOM   2590  C  C     . CYS B  1 48   ? 178.068 213.255 182.114 1.00 129.70 ? 42   CYS D C     1 
ATOM   2591  O  O     . CYS B  1 48   ? 177.315 212.823 182.992 1.00 129.70 ? 42   CYS D O     1 
ATOM   2592  C  CB    . CYS B  1 48   ? 179.325 211.082 182.034 1.00 129.70 ? 42   CYS D CB    1 
ATOM   2593  S  SG    . CYS B  1 48   ? 180.876 210.240 181.666 1.00 129.70 ? 42   CYS D SG    1 
ATOM   2594  N  N     . ASN B  1 49   ? 177.768 214.291 181.337 1.00 132.89 ? 43   ASN D N     1 
ATOM   2595  C  CA    . ASN B  1 49   ? 176.644 215.182 181.614 1.00 132.89 ? 43   ASN D CA    1 
ATOM   2596  C  C     . ASN B  1 49   ? 175.333 214.613 181.094 1.00 132.89 ? 43   ASN D C     1 
ATOM   2597  O  O     . ASN B  1 49   ? 174.662 215.205 180.255 1.00 132.89 ? 43   ASN D O     1 
ATOM   2598  C  CB    . ASN B  1 49   ? 176.926 216.549 181.009 1.00 132.89 ? 43   ASN D CB    1 
ATOM   2599  C  CG    . ASN B  1 49   ? 178.148 217.204 181.611 1.00 132.89 ? 43   ASN D CG    1 
ATOM   2600  O  OD1   . ASN B  1 49   ? 178.390 217.113 182.812 1.00 132.89 ? 43   ASN D OD1   1 
ATOM   2601  N  ND2   . ASN B  1 49   ? 178.932 217.870 180.770 1.00 132.89 ? 43   ASN D ND2   1 
ATOM   2602  N  N     . VAL B  1 50   ? 174.968 213.438 181.593 1.00 131.05 ? 44   VAL D N     1 
ATOM   2603  C  CA    . VAL B  1 50   ? 173.784 212.713 181.148 1.00 131.05 ? 44   VAL D CA    1 
ATOM   2604  C  C     . VAL B  1 50   ? 173.121 212.128 182.390 1.00 131.05 ? 44   VAL D C     1 
ATOM   2605  O  O     . VAL B  1 50   ? 173.784 211.474 183.202 1.00 131.05 ? 44   VAL D O     1 
ATOM   2606  C  CB    . VAL B  1 50   ? 174.121 211.608 180.146 1.00 131.05 ? 44   VAL D CB    1 
ATOM   2607  C  CG1   . VAL B  1 50   ? 172.869 210.846 179.803 1.00 131.05 ? 44   VAL D CG1   1 
ATOM   2608  C  CG2   . VAL B  1 50   ? 174.765 212.180 178.894 1.00 131.05 ? 44   VAL D CG2   1 
ATOM   2609  N  N     . ALA B  1 51   ? 171.822 212.366 182.548 1.00 133.95 ? 45   ALA D N     1 
ATOM   2610  C  CA    . ALA B  1 51   ? 171.078 211.746 183.634 1.00 133.95 ? 45   ALA D CA    1 
ATOM   2611  C  C     . ALA B  1 51   ? 170.339 210.508 183.150 1.00 133.95 ? 45   ALA D C     1 
ATOM   2612  O  O     . ALA B  1 51   ? 170.015 210.377 181.966 1.00 133.95 ? 45   ALA D O     1 
ATOM   2613  C  CB    . ALA B  1 51   ? 170.096 212.733 184.255 1.00 133.95 ? 45   ALA D CB    1 
ATOM   2614  N  N     . HIS B  1 52   ? 170.069 209.603 184.085 1.00 135.11 ? 46   HIS D N     1 
ATOM   2615  C  CA    . HIS B  1 52   ? 169.467 208.319 183.771 1.00 135.11 ? 46   HIS D CA    1 
ATOM   2616  C  C     . HIS B  1 52   ? 167.950 208.398 183.736 1.00 135.11 ? 46   HIS D C     1 
ATOM   2617  O  O     . HIS B  1 52   ? 167.351 207.978 182.753 1.00 135.11 ? 46   HIS D O     1 
ATOM   2618  C  CB    . HIS B  1 52   ? 169.929 207.262 184.772 1.00 135.11 ? 46   HIS D CB    1 
ATOM   2619  C  CG    . HIS B  1 52   ? 171.397 206.979 184.722 1.00 135.11 ? 46   HIS D CG    1 
ATOM   2620  N  ND1   . HIS B  1 52   ? 172.322 207.709 185.438 1.00 135.11 ? 46   HIS D ND1   1 
ATOM   2621  C  CD2   . HIS B  1 52   ? 172.095 206.022 184.067 1.00 135.11 ? 46   HIS D CD2   1 
ATOM   2622  C  CE1   . HIS B  1 52   ? 173.530 207.221 185.208 1.00 135.11 ? 46   HIS D CE1   1 
ATOM   2623  N  NE2   . HIS B  1 52   ? 173.418 206.199 184.380 1.00 135.11 ? 46   HIS D NE2   1 
ATOM   2624  N  N     . LYS B  1 53   ? 167.315 208.922 184.784 1.00 133.26 ? 47   LYS D N     1 
ATOM   2625  C  CA    . LYS B  1 53   ? 165.880 209.171 184.701 1.00 133.26 ? 47   LYS D CA    1 
ATOM   2626  C  C     . LYS B  1 53   ? 165.053 207.915 184.431 1.00 133.26 ? 47   LYS D C     1 
ATOM   2627  O  O     . LYS B  1 53   ? 164.758 207.601 183.273 1.00 133.26 ? 47   LYS D O     1 
ATOM   2628  C  CB    . LYS B  1 53   ? 165.566 210.248 183.664 1.00 133.26 ? 47   LYS D CB    1 
ATOM   2629  C  CG    . LYS B  1 53   ? 166.052 211.618 184.095 1.00 133.26 ? 47   LYS D CG    1 
ATOM   2630  C  CD    . LYS B  1 53   ? 165.590 212.676 183.127 1.00 133.26 ? 47   LYS D CD    1 
ATOM   2631  C  CE    . LYS B  1 53   ? 166.360 212.568 181.848 1.00 133.26 ? 47   LYS D CE    1 
ATOM   2632  N  NZ    . LYS B  1 53   ? 167.778 212.981 182.013 1.00 133.26 ? 47   LYS D NZ    1 
ATOM   2633  N  N     . ASN B  1 54   ? 164.754 207.162 185.500 1.00 139.53 ? 48   ASN D N     1 
ATOM   2634  C  CA    . ASN B  1 54   ? 163.830 206.019 185.484 1.00 139.53 ? 48   ASN D CA    1 
ATOM   2635  C  C     . ASN B  1 54   ? 164.477 204.708 185.042 1.00 139.53 ? 48   ASN D C     1 
ATOM   2636  O  O     . ASN B  1 54   ? 163.973 204.027 184.146 1.00 139.53 ? 48   ASN D O     1 
ATOM   2637  C  CB    . ASN B  1 54   ? 162.618 206.309 184.596 1.00 139.53 ? 48   ASN D CB    1 
ATOM   2638  C  CG    . ASN B  1 54   ? 161.911 207.581 184.985 1.00 139.53 ? 48   ASN D CG    1 
ATOM   2639  O  OD1   . ASN B  1 54   ? 161.736 207.875 186.165 1.00 139.53 ? 48   ASN D OD1   1 
ATOM   2640  N  ND2   . ASN B  1 54   ? 161.528 208.369 183.985 1.00 139.53 ? 48   ASN D ND2   1 
ATOM   2641  N  N     . ILE B  1 55   ? 165.590 204.341 185.674 1.00 134.54 ? 49   ILE D N     1 
ATOM   2642  C  CA    . ILE B  1 55   ? 166.038 202.951 185.687 1.00 134.54 ? 49   ILE D CA    1 
ATOM   2643  C  C     . ILE B  1 55   ? 164.863 202.096 186.153 1.00 134.54 ? 49   ILE D C     1 
ATOM   2644  O  O     . ILE B  1 55   ? 164.157 202.463 187.093 1.00 134.54 ? 49   ILE D O     1 
ATOM   2645  C  CB    . ILE B  1 55   ? 167.248 202.745 186.605 1.00 134.54 ? 49   ILE D CB    1 
ATOM   2646  C  CG1   . ILE B  1 55   ? 168.454 203.575 186.162 1.00 134.54 ? 49   ILE D CG1   1 
ATOM   2647  C  CG2   . ILE B  1 55   ? 167.602 201.272 186.695 1.00 134.54 ? 49   ILE D CG2   1 
ATOM   2648  C  CD1   . ILE B  1 55   ? 168.592 204.874 186.909 1.00 134.54 ? 49   ILE D CD1   1 
ATOM   2649  N  N     . ARG B  1 56   ? 164.656 200.951 185.505 1.00 125.53 ? 50   ARG D N     1 
ATOM   2650  C  CA    . ARG B  1 56   ? 163.582 200.043 185.889 1.00 125.53 ? 50   ARG D CA    1 
ATOM   2651  C  C     . ARG B  1 56   ? 163.774 199.481 187.291 1.00 125.53 ? 50   ARG D C     1 
ATOM   2652  O  O     . ARG B  1 56   ? 162.977 199.741 188.199 1.00 125.53 ? 50   ARG D O     1 
ATOM   2653  C  CB    . ARG B  1 56   ? 163.518 198.898 184.882 1.00 125.53 ? 50   ARG D CB    1 
ATOM   2654  C  CG    . ARG B  1 56   ? 162.353 197.960 184.981 1.00 125.53 ? 50   ARG D CG    1 
ATOM   2655  C  CD    . ARG B  1 56   ? 162.471 196.990 183.826 1.00 125.53 ? 50   ARG D CD    1 
ATOM   2656  N  NE    . ARG B  1 56   ? 161.375 196.041 183.743 1.00 125.53 ? 50   ARG D NE    1 
ATOM   2657  C  CZ    . ARG B  1 56   ? 161.285 195.106 182.806 1.00 125.53 ? 50   ARG D CZ    1 
ATOM   2658  N  NH1   . ARG B  1 56   ? 162.235 195.000 181.891 1.00 125.53 ? 50   ARG D NH1   1 
ATOM   2659  N  NH2   . ARG B  1 56   ? 160.256 194.275 182.785 1.00 125.53 ? 50   ARG D NH2   1 
ATOM   2660  N  N     . GLU B  1 57   ? 164.846 198.719 187.478 1.00 130.25 ? 51   GLU D N     1 
ATOM   2661  C  CA    . GLU B  1 57   ? 164.955 197.810 188.610 1.00 130.25 ? 51   GLU D CA    1 
ATOM   2662  C  C     . GLU B  1 57   ? 165.546 198.517 189.827 1.00 130.25 ? 51   GLU D C     1 
ATOM   2663  O  O     . GLU B  1 57   ? 165.757 199.733 189.841 1.00 130.25 ? 51   GLU D O     1 
ATOM   2664  C  CB    . GLU B  1 57   ? 165.783 196.592 188.213 1.00 130.25 ? 51   GLU D CB    1 
ATOM   2665  C  CG    . GLU B  1 57   ? 165.169 195.790 187.091 1.00 130.25 ? 51   GLU D CG    1 
ATOM   2666  C  CD    . GLU B  1 57   ? 163.839 195.186 187.475 1.00 130.25 ? 51   GLU D CD    1 
ATOM   2667  O  OE1   . GLU B  1 57   ? 163.657 194.858 188.665 1.00 130.25 ? 51   GLU D OE1   1 
ATOM   2668  O  OE2   . GLU B  1 57   ? 162.972 195.035 186.587 1.00 130.25 ? 51   GLU D OE2   1 
ATOM   2669  N  N     . GLN B  1 58   ? 165.801 197.741 190.873 1.00 128.65 ? 52   GLN D N     1 
ATOM   2670  C  CA    . GLN B  1 58   ? 166.430 198.215 192.093 1.00 128.65 ? 52   GLN D CA    1 
ATOM   2671  C  C     . GLN B  1 58   ? 167.943 198.018 191.978 1.00 128.65 ? 52   GLN D C     1 
ATOM   2672  O  O     . GLN B  1 58   ? 168.458 197.716 190.899 1.00 128.65 ? 52   GLN D O     1 
ATOM   2673  C  CB    . GLN B  1 58   ? 165.830 197.489 193.297 1.00 128.65 ? 52   GLN D CB    1 
ATOM   2674  N  N     . GLY B  1 59   ? 168.665 198.176 193.077 1.00 147.05 ? 53   GLY D N     1 
ATOM   2675  C  CA    . GLY B  1 59   ? 170.117 198.069 193.060 1.00 147.05 ? 53   GLY D CA    1 
ATOM   2676  C  C     . GLY B  1 59   ? 170.587 196.674 193.398 1.00 147.05 ? 53   GLY D C     1 
ATOM   2677  O  O     . GLY B  1 59   ? 169.851 195.700 193.236 1.00 147.05 ? 53   GLY D O     1 
ATOM   2678  N  N     . ARG B  1 60   ? 171.834 196.581 193.859 1.00 145.15 ? 54   ARG D N     1 
ATOM   2679  C  CA    . ARG B  1 60   ? 172.425 195.307 194.263 1.00 145.15 ? 54   ARG D CA    1 
ATOM   2680  C  C     . ARG B  1 60   ? 171.966 194.990 195.681 1.00 145.15 ? 54   ARG D C     1 
ATOM   2681  O  O     . ARG B  1 60   ? 171.965 195.867 196.549 1.00 145.15 ? 54   ARG D O     1 
ATOM   2682  C  CB    . ARG B  1 60   ? 173.947 195.354 194.168 1.00 145.15 ? 54   ARG D CB    1 
ATOM   2683  N  N     . PHE B  1 61   ? 171.572 193.737 195.908 1.00 140.77 ? 55   PHE D N     1 
ATOM   2684  C  CA    . PHE B  1 61   ? 170.951 193.309 197.156 1.00 140.77 ? 55   PHE D CA    1 
ATOM   2685  C  C     . PHE B  1 61   ? 171.718 193.779 198.391 1.00 140.77 ? 55   PHE D C     1 
ATOM   2686  O  O     . PHE B  1 61   ? 171.200 194.590 199.165 1.00 140.77 ? 55   PHE D O     1 
ATOM   2687  C  CB    . PHE B  1 61   ? 170.784 191.780 197.143 1.00 140.77 ? 55   PHE D CB    1 
ATOM   2688  C  CG    . PHE B  1 61   ? 172.074 191.017 196.962 1.00 140.77 ? 55   PHE D CG    1 
ATOM   2689  C  CD1   . PHE B  1 61   ? 172.623 190.846 195.703 1.00 140.77 ? 55   PHE D CD1   1 
ATOM   2690  C  CD2   . PHE B  1 61   ? 172.708 190.428 198.045 1.00 140.77 ? 55   PHE D CD2   1 
ATOM   2691  C  CE1   . PHE B  1 61   ? 173.796 190.147 195.530 1.00 140.77 ? 55   PHE D CE1   1 
ATOM   2692  C  CE2   . PHE B  1 61   ? 173.883 189.727 197.874 1.00 140.77 ? 55   PHE D CE2   1 
ATOM   2693  C  CZ    . PHE B  1 61   ? 174.425 189.584 196.615 1.00 140.77 ? 55   PHE D CZ    1 
ATOM   2694  N  N     . LEU B  1 62   ? 172.952 193.312 198.576 1.00 135.43 ? 56   LEU D N     1 
ATOM   2695  C  CA    . LEU B  1 62   ? 173.807 193.745 199.674 1.00 135.43 ? 56   LEU D CA    1 
ATOM   2696  C  C     . LEU B  1 62   ? 175.268 193.868 199.268 1.00 135.43 ? 56   LEU D C     1 
ATOM   2697  O  O     . LEU B  1 62   ? 176.147 193.781 200.130 1.00 135.43 ? 56   LEU D O     1 
ATOM   2698  C  CB    . LEU B  1 62   ? 173.689 192.799 200.870 1.00 135.43 ? 56   LEU D CB    1 
ATOM   2699  C  CG    . LEU B  1 62   ? 172.518 192.962 201.842 1.00 135.43 ? 56   LEU D CG    1 
ATOM   2700  C  CD1   . LEU B  1 62   ? 171.229 192.352 201.314 1.00 135.43 ? 56   LEU D CD1   1 
ATOM   2701  C  CD2   . LEU B  1 62   ? 172.868 192.394 203.212 1.00 135.43 ? 56   LEU D CD2   1 
ATOM   2702  N  N     . GLN B  1 63   ? 175.555 194.049 197.982 1.00 134.14 ? 57   GLN D N     1 
ATOM   2703  C  CA    . GLN B  1 63   ? 176.918 194.270 197.519 1.00 134.14 ? 57   GLN D CA    1 
ATOM   2704  C  C     . GLN B  1 63   ? 177.147 195.711 197.093 1.00 134.14 ? 57   GLN D C     1 
ATOM   2705  O  O     . GLN B  1 63   ? 178.263 196.224 197.207 1.00 134.14 ? 57   GLN D O     1 
ATOM   2706  C  CB    . GLN B  1 63   ? 177.250 193.321 196.360 1.00 134.14 ? 57   GLN D CB    1 
ATOM   2707  N  N     . ASP B  1 64   ? 176.097 196.371 196.607 1.00 133.95 ? 58   ASP D N     1 
ATOM   2708  C  CA    . ASP B  1 64   ? 176.160 197.785 196.264 1.00 133.95 ? 58   ASP D CA    1 
ATOM   2709  C  C     . ASP B  1 64   ? 176.662 198.606 197.444 1.00 133.95 ? 58   ASP D C     1 
ATOM   2710  O  O     . ASP B  1 64   ? 177.137 199.728 197.268 1.00 133.95 ? 58   ASP D O     1 
ATOM   2711  C  CB    . ASP B  1 64   ? 174.789 198.296 195.806 1.00 133.95 ? 58   ASP D CB    1 
ATOM   2712  C  CG    . ASP B  1 64   ? 173.712 198.141 196.872 1.00 133.95 ? 58   ASP D CG    1 
ATOM   2713  O  OD1   . ASP B  1 64   ? 173.989 197.577 197.951 1.00 133.95 ? 58   ASP D OD1   1 
ATOM   2714  O  OD2   . ASP B  1 64   ? 172.573 198.583 196.623 1.00 133.95 ? 58   ASP D OD2   1 
ATOM   2715  N  N     . VAL B  1 65   ? 176.549 198.055 198.653 1.00 126.49 ? 59   VAL D N     1 
ATOM   2716  C  CA    . VAL B  1 65   ? 177.037 198.762 199.829 1.00 126.49 ? 59   VAL D CA    1 
ATOM   2717  C  C     . VAL B  1 65   ? 178.523 199.061 199.688 1.00 126.49 ? 59   VAL D C     1 
ATOM   2718  O  O     . VAL B  1 65   ? 178.961 200.201 199.863 1.00 126.49 ? 59   VAL D O     1 
ATOM   2719  C  CB    . VAL B  1 65   ? 176.723 197.957 201.103 1.00 126.49 ? 59   VAL D CB    1 
ATOM   2720  C  CG1   . VAL B  1 65   ? 175.225 197.885 201.305 1.00 126.49 ? 59   VAL D CG1   1 
ATOM   2721  C  CG2   . VAL B  1 65   ? 177.283 196.560 201.006 1.00 126.49 ? 59   VAL D CG2   1 
ATOM   2722  N  N     . PHE B  1 66   ? 179.310 198.061 199.290 1.00 123.19 ? 60   PHE D N     1 
ATOM   2723  C  CA    . PHE B  1 66   ? 180.754 198.252 199.209 1.00 123.19 ? 60   PHE D CA    1 
ATOM   2724  C  C     . PHE B  1 66   ? 181.129 199.200 198.080 1.00 123.19 ? 60   PHE D C     1 
ATOM   2725  O  O     . PHE B  1 66   ? 181.912 200.135 198.284 1.00 123.19 ? 60   PHE D O     1 
ATOM   2726  C  CB    . PHE B  1 66   ? 181.438 196.900 199.042 1.00 123.19 ? 60   PHE D CB    1 
ATOM   2727  C  CG    . PHE B  1 66   ? 181.343 196.033 200.259 1.00 123.19 ? 60   PHE D CG    1 
ATOM   2728  C  CD1   . PHE B  1 66   ? 181.097 196.595 201.497 1.00 123.19 ? 60   PHE D CD1   1 
ATOM   2729  C  CD2   . PHE B  1 66   ? 181.447 194.657 200.164 1.00 123.19 ? 60   PHE D CD2   1 
ATOM   2730  C  CE1   . PHE B  1 66   ? 180.993 195.809 202.619 1.00 123.19 ? 60   PHE D CE1   1 
ATOM   2731  C  CE2   . PHE B  1 66   ? 181.338 193.865 201.288 1.00 123.19 ? 60   PHE D CE2   1 
ATOM   2732  C  CZ    . PHE B  1 66   ? 181.113 194.442 202.515 1.00 123.19 ? 60   PHE D CZ    1 
ATOM   2733  N  N     . THR B  1 67   ? 180.580 198.979 196.888 1.00 137.00 ? 61   THR D N     1 
ATOM   2734  C  CA    . THR B  1 67   ? 180.886 199.847 195.756 1.00 137.00 ? 61   THR D CA    1 
ATOM   2735  C  C     . THR B  1 67   ? 180.476 201.289 196.036 1.00 137.00 ? 61   THR D C     1 
ATOM   2736  O  O     . THR B  1 67   ? 181.277 202.216 195.875 1.00 137.00 ? 61   THR D O     1 
ATOM   2737  C  CB    . THR B  1 67   ? 180.198 199.320 194.498 1.00 137.00 ? 61   THR D CB    1 
ATOM   2738  O  OG1   . THR B  1 67   ? 178.789 199.188 194.741 1.00 137.00 ? 61   THR D OG1   1 
ATOM   2739  C  CG2   . THR B  1 67   ? 180.773 197.969 194.104 1.00 137.00 ? 61   THR D CG2   1 
ATOM   2740  N  N     . THR B  1 68   ? 179.228 201.496 196.456 1.00 132.54 ? 62   THR D N     1 
ATOM   2741  C  CA    . THR B  1 68   ? 178.761 202.835 196.797 1.00 132.54 ? 62   THR D CA    1 
ATOM   2742  C  C     . THR B  1 68   ? 179.534 203.403 197.976 1.00 132.54 ? 62   THR D C     1 
ATOM   2743  O  O     . THR B  1 68   ? 179.563 204.621 198.184 1.00 132.54 ? 62   THR D O     1 
ATOM   2744  C  CB    . THR B  1 68   ? 177.264 202.807 197.106 1.00 132.54 ? 62   THR D CB    1 
ATOM   2745  O  OG1   . THR B  1 68   ? 177.015 201.862 198.153 1.00 132.54 ? 62   THR D OG1   1 
ATOM   2746  C  CG2   . THR B  1 68   ? 176.464 202.424 195.869 1.00 132.54 ? 62   THR D CG2   1 
ATOM   2747  N  N     . LEU B  1 69   ? 180.178 202.535 198.752 1.00 122.55 ? 63   LEU D N     1 
ATOM   2748  C  CA    . LEU B  1 69   ? 180.946 202.994 199.891 1.00 122.55 ? 63   LEU D CA    1 
ATOM   2749  C  C     . LEU B  1 69   ? 182.300 203.529 199.447 1.00 122.55 ? 63   LEU D C     1 
ATOM   2750  O  O     . LEU B  1 69   ? 182.773 204.557 199.945 1.00 122.55 ? 63   LEU D O     1 
ATOM   2751  C  CB    . LEU B  1 69   ? 181.089 201.839 200.880 1.00 122.55 ? 63   LEU D CB    1 
ATOM   2752  C  CG    . LEU B  1 69   ? 181.503 202.098 202.321 1.00 122.55 ? 63   LEU D CG    1 
ATOM   2753  C  CD1   . LEU B  1 69   ? 182.989 202.352 202.429 1.00 122.55 ? 63   LEU D CD1   1 
ATOM   2754  C  CD2   . LEU B  1 69   ? 180.710 203.270 202.869 1.00 122.55 ? 63   LEU D CD2   1 
ATOM   2755  N  N     . VAL B  1 70   ? 182.931 202.849 198.488 1.00 127.47 ? 64   VAL D N     1 
ATOM   2756  C  CA    . VAL B  1 70   ? 184.287 203.217 198.088 1.00 127.47 ? 64   VAL D CA    1 
ATOM   2757  C  C     . VAL B  1 70   ? 184.327 204.646 197.568 1.00 127.47 ? 64   VAL D C     1 
ATOM   2758  O  O     . VAL B  1 70   ? 184.916 205.537 198.193 1.00 127.47 ? 64   VAL D O     1 
ATOM   2759  C  CB    . VAL B  1 70   ? 184.823 202.234 197.034 1.00 127.47 ? 64   VAL D CB    1 
ATOM   2760  C  CG1   . VAL B  1 70   ? 186.212 202.654 196.580 1.00 127.47 ? 64   VAL D CG1   1 
ATOM   2761  C  CG2   . VAL B  1 70   ? 184.837 200.834 197.583 1.00 127.47 ? 64   VAL D CG2   1 
ATOM   2762  N  N     . ASP B  1 71   ? 183.679 204.895 196.433 1.00 137.88 ? 65   ASP D N     1 
ATOM   2763  C  CA    . ASP B  1 71   ? 183.687 206.211 195.814 1.00 137.88 ? 65   ASP D CA    1 
ATOM   2764  C  C     . ASP B  1 71   ? 182.629 207.057 196.492 1.00 137.88 ? 65   ASP D C     1 
ATOM   2765  O  O     . ASP B  1 71   ? 181.433 206.889 196.230 1.00 137.88 ? 65   ASP D O     1 
ATOM   2766  C  CB    . ASP B  1 71   ? 183.419 206.143 194.314 1.00 137.88 ? 65   ASP D CB    1 
ATOM   2767  C  CG    . ASP B  1 71   ? 183.628 207.482 193.625 1.00 137.88 ? 65   ASP D CG    1 
ATOM   2768  O  OD1   . ASP B  1 71   ? 184.794 207.870 193.409 1.00 137.88 ? 65   ASP D OD1   1 
ATOM   2769  O  OD2   . ASP B  1 71   ? 182.624 208.152 193.310 1.00 137.88 ? 65   ASP D OD2   1 
ATOM   2770  N  N     . LEU B  1 72   ? 183.073 207.965 197.351 1.00 113.21 ? 66   LEU D N     1 
ATOM   2771  C  CA    . LEU B  1 72   ? 182.163 208.730 198.179 1.00 113.21 ? 66   LEU D CA    1 
ATOM   2772  C  C     . LEU B  1 72   ? 183.000 209.761 198.914 1.00 113.21 ? 66   LEU D C     1 
ATOM   2773  O  O     . LEU B  1 72   ? 184.190 209.549 199.162 1.00 113.21 ? 66   LEU D O     1 
ATOM   2774  C  CB    . LEU B  1 72   ? 181.407 207.817 199.149 1.00 113.21 ? 66   LEU D CB    1 
ATOM   2775  C  CG    . LEU B  1 72   ? 180.213 208.367 199.912 1.00 113.21 ? 66   LEU D CG    1 
ATOM   2776  C  CD1   . LEU B  1 72   ? 179.223 207.256 200.170 1.00 113.21 ? 66   LEU D CD1   1 
ATOM   2777  C  CD2   . LEU B  1 72   ? 180.681 208.930 201.208 1.00 113.21 ? 66   LEU D CD2   1 
ATOM   2778  N  N     . LYS B  1 73   ? 182.373 210.880 199.252 1.00 112.67 ? 67   LYS D N     1 
ATOM   2779  C  CA    . LYS B  1 73   ? 183.113 211.974 199.857 1.00 112.67 ? 67   LYS D CA    1 
ATOM   2780  C  C     . LYS B  1 73   ? 183.718 211.530 201.189 1.00 112.67 ? 67   LYS D C     1 
ATOM   2781  O  O     . LYS B  1 73   ? 183.091 210.814 201.976 1.00 112.67 ? 67   LYS D O     1 
ATOM   2782  C  CB    . LYS B  1 73   ? 182.198 213.185 200.041 1.00 112.67 ? 67   LYS D CB    1 
ATOM   2783  C  CG    . LYS B  1 73   ? 182.923 214.453 200.443 1.00 112.67 ? 67   LYS D CG    1 
ATOM   2784  C  CD    . LYS B  1 73   ? 181.973 215.631 200.597 1.00 112.67 ? 67   LYS D CD    1 
ATOM   2785  C  CE    . LYS B  1 73   ? 182.718 216.876 201.062 1.00 112.67 ? 67   LYS D CE    1 
ATOM   2786  N  NZ    . LYS B  1 73   ? 181.813 218.031 201.307 1.00 112.67 ? 67   LYS D NZ    1 
ATOM   2787  N  N     . TRP B  1 74   ? 184.970 211.945 201.423 1.00 104.26 ? 68   TRP D N     1 
ATOM   2788  C  CA    . TRP B  1 74   ? 185.714 211.490 202.597 1.00 104.26 ? 68   TRP D CA    1 
ATOM   2789  C  C     . TRP B  1 74   ? 184.977 211.717 203.908 1.00 104.26 ? 68   TRP D C     1 
ATOM   2790  O  O     . TRP B  1 74   ? 184.814 210.755 204.671 1.00 104.26 ? 68   TRP D O     1 
ATOM   2791  C  CB    . TRP B  1 74   ? 187.097 212.145 202.612 1.00 104.26 ? 68   TRP D CB    1 
ATOM   2792  C  CG    . TRP B  1 74   ? 188.003 211.567 201.599 1.00 104.26 ? 68   TRP D CG    1 
ATOM   2793  C  CD1   . TRP B  1 74   ? 188.258 212.051 200.352 1.00 104.26 ? 68   TRP D CD1   1 
ATOM   2794  C  CD2   . TRP B  1 74   ? 188.770 210.369 201.734 1.00 104.26 ? 68   TRP D CD2   1 
ATOM   2795  N  NE1   . TRP B  1 74   ? 189.143 211.230 199.701 1.00 104.26 ? 68   TRP D NE1   1 
ATOM   2796  C  CE2   . TRP B  1 74   ? 189.474 210.189 200.529 1.00 104.26 ? 68   TRP D CE2   1 
ATOM   2797  C  CE3   . TRP B  1 74   ? 188.930 209.433 202.758 1.00 104.26 ? 68   TRP D CE3   1 
ATOM   2798  C  CZ2   . TRP B  1 74   ? 190.326 209.109 200.318 1.00 104.26 ? 68   TRP D CZ2   1 
ATOM   2799  C  CZ3   . TRP B  1 74   ? 189.778 208.362 202.547 1.00 104.26 ? 68   TRP D CZ3   1 
ATOM   2800  C  CH2   . TRP B  1 74   ? 190.465 208.210 201.338 1.00 104.26 ? 68   TRP D CH2   1 
ATOM   2801  N  N     . PRO B  1 75   ? 184.539 212.934 204.245 1.00 106.98 ? 69   PRO D N     1 
ATOM   2802  C  CA    . PRO B  1 75   ? 183.879 213.116 205.544 1.00 106.98 ? 69   PRO D CA    1 
ATOM   2803  C  C     . PRO B  1 75   ? 182.654 212.248 205.719 1.00 106.98 ? 69   PRO D C     1 
ATOM   2804  O  O     . PRO B  1 75   ? 182.427 211.749 206.826 1.00 106.98 ? 69   PRO D O     1 
ATOM   2805  C  CB    . PRO B  1 75   ? 183.527 214.608 205.554 1.00 106.98 ? 69   PRO D CB    1 
ATOM   2806  C  CG    . PRO B  1 75   ? 183.501 215.002 204.123 1.00 106.98 ? 69   PRO D CG    1 
ATOM   2807  C  CD    . PRO B  1 75   ? 184.557 214.185 203.473 1.00 106.98 ? 69   PRO D CD    1 
ATOM   2808  N  N     . HIS B  1 76   ? 181.871 212.025 204.666 1.00 109.45 ? 70   HIS D N     1 
ATOM   2809  C  CA    . HIS B  1 76   ? 180.709 211.156 204.805 1.00 109.45 ? 70   HIS D CA    1 
ATOM   2810  C  C     . HIS B  1 76   ? 181.126 209.729 205.144 1.00 109.45 ? 70   HIS D C     1 
ATOM   2811  O  O     . HIS B  1 76   ? 180.546 209.106 206.040 1.00 109.45 ? 70   HIS D O     1 
ATOM   2812  C  CB    . HIS B  1 76   ? 179.871 211.178 203.530 1.00 109.45 ? 70   HIS D CB    1 
ATOM   2813  C  CG    . HIS B  1 76   ? 179.283 212.515 203.204 1.00 109.45 ? 70   HIS D CG    1 
ATOM   2814  N  ND1   . HIS B  1 76   ? 179.922 213.434 202.401 1.00 109.45 ? 70   HIS D ND1   1 
ATOM   2815  C  CD2   . HIS B  1 76   ? 178.111 213.085 203.568 1.00 109.45 ? 70   HIS D CD2   1 
ATOM   2816  C  CE1   . HIS B  1 76   ? 179.171 214.513 202.286 1.00 109.45 ? 70   HIS D CE1   1 
ATOM   2817  N  NE2   . HIS B  1 76   ? 178.066 214.330 202.985 1.00 109.45 ? 70   HIS D NE2   1 
ATOM   2818  N  N     . THR B  1 77   ? 182.136 209.200 204.450 1.00 105.21 ? 71   THR D N     1 
ATOM   2819  C  CA    . THR B  1 77   ? 182.614 207.851 204.741 1.00 105.21 ? 71   THR D CA    1 
ATOM   2820  C  C     . THR B  1 77   ? 183.165 207.752 206.157 1.00 105.21 ? 71   THR D C     1 
ATOM   2821  O  O     . THR B  1 77   ? 182.846 206.809 206.899 1.00 105.21 ? 71   THR D O     1 
ATOM   2822  C  CB    . THR B  1 77   ? 183.690 207.456 203.731 1.00 105.21 ? 71   THR D CB    1 
ATOM   2823  O  OG1   . THR B  1 77   ? 183.139 207.486 202.409 1.00 105.21 ? 71   THR D OG1   1 
ATOM   2824  C  CG2   . THR B  1 77   ? 184.225 206.066 204.025 1.00 105.21 ? 71   THR D CG2   1 
ATOM   2825  N  N     . LEU B  1 78   ? 184.032 208.694 206.525 1.00 100.92 ? 72   LEU D N     1 
ATOM   2826  C  CA    . LEU B  1 78   ? 184.501 208.813 207.898 1.00 100.92 ? 72   LEU D CA    1 
ATOM   2827  C  C     . LEU B  1 78   ? 183.351 208.727 208.884 1.00 100.92 ? 72   LEU D C     1 
ATOM   2828  O  O     . LEU B  1 78   ? 183.378 207.907 209.807 1.00 100.92 ? 72   LEU D O     1 
ATOM   2829  C  CB    . LEU B  1 78   ? 185.246 210.138 208.063 1.00 100.92 ? 72   LEU D CB    1 
ATOM   2830  C  CG    . LEU B  1 78   ? 185.824 210.553 209.416 1.00 100.92 ? 72   LEU D CG    1 
ATOM   2831  C  CD1   . LEU B  1 78   ? 184.785 211.206 210.330 1.00 100.92 ? 72   LEU D CD1   1 
ATOM   2832  C  CD2   . LEU B  1 78   ? 186.454 209.356 210.098 1.00 100.92 ? 72   LEU D CD2   1 
ATOM   2833  N  N     . LEU B  1 79   ? 182.353 209.591 208.719 1.00 103.76 ? 73   LEU D N     1 
ATOM   2834  C  CA    . LEU B  1 79   ? 181.236 209.626 209.647 1.00 103.76 ? 73   LEU D CA    1 
ATOM   2835  C  C     . LEU B  1 79   ? 180.533 208.285 209.701 1.00 103.76 ? 73   LEU D C     1 
ATOM   2836  O  O     . LEU B  1 79   ? 180.137 207.827 210.778 1.00 103.76 ? 73   LEU D O     1 
ATOM   2837  C  CB    . LEU B  1 79   ? 180.264 210.729 209.234 1.00 103.76 ? 73   LEU D CB    1 
ATOM   2838  C  CG    . LEU B  1 79   ? 179.098 211.055 210.160 1.00 103.76 ? 73   LEU D CG    1 
ATOM   2839  C  CD1   . LEU B  1 79   ? 178.733 212.518 210.013 1.00 103.76 ? 73   LEU D CD1   1 
ATOM   2840  C  CD2   . LEU B  1 79   ? 177.890 210.183 209.850 1.00 103.76 ? 73   LEU D CD2   1 
ATOM   2841  N  N     . ILE B  1 80   ? 180.360 207.641 208.549 1.00 104.46 ? 74   ILE D N     1 
ATOM   2842  C  CA    . ILE B  1 80   ? 179.683 206.353 208.532 1.00 104.46 ? 74   ILE D CA    1 
ATOM   2843  C  C     . ILE B  1 80   ? 180.446 205.338 209.368 1.00 104.46 ? 74   ILE D C     1 
ATOM   2844  O  O     . ILE B  1 80   ? 179.856 204.600 210.166 1.00 104.46 ? 74   ILE D O     1 
ATOM   2845  C  CB    . ILE B  1 80   ? 179.496 205.872 207.086 1.00 104.46 ? 74   ILE D CB    1 
ATOM   2846  C  CG1   . ILE B  1 80   ? 178.536 206.806 206.346 1.00 104.46 ? 74   ILE D CG1   1 
ATOM   2847  C  CG2   . ILE B  1 80   ? 178.989 204.444 207.067 1.00 104.46 ? 74   ILE D CG2   1 
ATOM   2848  C  CD1   . ILE B  1 80   ? 178.514 206.621 204.845 1.00 104.46 ? 74   ILE D CD1   1 
ATOM   2849  N  N     . PHE B  1 81   ? 181.767 205.305 209.231 1.00 103.14 ? 75   PHE D N     1 
ATOM   2850  C  CA    . PHE B  1 81   ? 182.534 204.319 209.985 1.00 103.14 ? 75   PHE D CA    1 
ATOM   2851  C  C     . PHE B  1 81   ? 182.513 204.633 211.474 1.00 103.14 ? 75   PHE D C     1 
ATOM   2852  O  O     . PHE B  1 81   ? 182.325 203.738 212.308 1.00 103.14 ? 75   PHE D O     1 
ATOM   2853  C  CB    . PHE B  1 81   ? 183.966 204.250 209.481 1.00 103.14 ? 75   PHE D CB    1 
ATOM   2854  C  CG    . PHE B  1 81   ? 184.099 203.647 208.125 1.00 103.14 ? 75   PHE D CG    1 
ATOM   2855  C  CD1   . PHE B  1 81   ? 183.006 203.113 207.474 1.00 103.14 ? 75   PHE D CD1   1 
ATOM   2856  C  CD2   . PHE B  1 81   ? 185.332 203.563 207.521 1.00 103.14 ? 75   PHE D CD2   1 
ATOM   2857  C  CE1   . PHE B  1 81   ? 183.140 202.541 206.226 1.00 103.14 ? 75   PHE D CE1   1 
ATOM   2858  C  CE2   . PHE B  1 81   ? 185.468 202.991 206.275 1.00 103.14 ? 75   PHE D CE2   1 
ATOM   2859  C  CZ    . PHE B  1 81   ? 184.375 202.483 205.629 1.00 103.14 ? 75   PHE D CZ    1 
ATOM   2860  N  N     . THR B  1 82   ? 182.733 205.900 211.821 1.00 95.12  ? 76   THR D N     1 
ATOM   2861  C  CA    . THR B  1 82   ? 182.650 206.316 213.215 1.00 95.12  ? 76   THR D CA    1 
ATOM   2862  C  C     . THR B  1 82   ? 181.323 205.910 213.826 1.00 95.12  ? 76   THR D C     1 
ATOM   2863  O  O     . THR B  1 82   ? 181.276 205.380 214.939 1.00 95.12  ? 76   THR D O     1 
ATOM   2864  C  CB    . THR B  1 82   ? 182.814 207.826 213.317 1.00 95.12  ? 76   THR D CB    1 
ATOM   2865  O  OG1   . THR B  1 82   ? 181.751 208.459 212.599 1.00 95.12  ? 76   THR D OG1   1 
ATOM   2866  C  CG2   . THR B  1 82   ? 184.128 208.255 212.719 1.00 95.12  ? 76   THR D CG2   1 
ATOM   2867  N  N     . MET B  1 83   ? 180.231 206.157 213.116 1.00 92.37  ? 77   MET D N     1 
ATOM   2868  C  CA    . MET B  1 83   ? 178.931 205.897 213.704 1.00 92.37  ? 77   MET D CA    1 
ATOM   2869  C  C     . MET B  1 83   ? 178.659 204.402 213.752 1.00 92.37  ? 77   MET D C     1 
ATOM   2870  O  O     . MET B  1 83   ? 177.963 203.929 214.657 1.00 92.37  ? 77   MET D O     1 
ATOM   2871  C  CB    . MET B  1 83   ? 177.853 206.662 212.932 1.00 92.37  ? 77   MET D CB    1 
ATOM   2872  C  CG    . MET B  1 83   ? 176.566 206.845 213.711 1.00 92.37  ? 77   MET D CG    1 
ATOM   2873  S  SD    . MET B  1 83   ? 175.393 207.980 212.946 1.00 92.37  ? 77   MET D SD    1 
ATOM   2874  C  CE    . MET B  1 83   ? 174.084 207.957 214.167 1.00 92.37  ? 77   MET D CE    1 
ATOM   2875  N  N     . SER B  1 84   ? 179.249 203.635 212.832 1.00 83.21  ? 78   SER D N     1 
ATOM   2876  C  CA    . SER B  1 84   ? 179.208 202.182 212.953 1.00 83.21  ? 78   SER D CA    1 
ATOM   2877  C  C     . SER B  1 84   ? 179.885 201.720 214.235 1.00 83.21  ? 78   SER D C     1 
ATOM   2878  O  O     . SER B  1 84   ? 179.358 200.862 214.952 1.00 83.21  ? 78   SER D O     1 
ATOM   2879  C  CB    . SER B  1 84   ? 179.876 201.535 211.742 1.00 83.21  ? 78   SER D CB    1 
ATOM   2880  O  OG    . SER B  1 84   ? 181.262 201.824 211.723 1.00 83.21  ? 78   SER D OG    1 
ATOM   2881  N  N     . PHE B  1 85   ? 181.059 202.268 214.532 1.00 73.15  ? 79   PHE D N     1 
ATOM   2882  C  CA    . PHE B  1 85   ? 181.729 201.911 215.778 1.00 73.15  ? 79   PHE D CA    1 
ATOM   2883  C  C     . PHE B  1 85   ? 180.910 202.329 216.989 1.00 73.15  ? 79   PHE D C     1 
ATOM   2884  O  O     . PHE B  1 85   ? 180.811 201.580 217.966 1.00 73.15  ? 79   PHE D O     1 
ATOM   2885  C  CB    . PHE B  1 85   ? 183.120 202.531 215.822 1.00 73.15  ? 79   PHE D CB    1 
ATOM   2886  C  CG    . PHE B  1 85   ? 184.131 201.792 215.006 1.00 73.15  ? 79   PHE D CG    1 
ATOM   2887  C  CD1   . PHE B  1 85   ? 183.952 200.459 214.715 1.00 73.15  ? 79   PHE D CD1   1 
ATOM   2888  C  CD2   . PHE B  1 85   ? 185.238 202.437 214.497 1.00 73.15  ? 79   PHE D CD2   1 
ATOM   2889  C  CE1   . PHE B  1 85   ? 184.875 199.772 213.961 1.00 73.15  ? 79   PHE D CE1   1 
ATOM   2890  C  CE2   . PHE B  1 85   ? 186.160 201.757 213.735 1.00 73.15  ? 79   PHE D CE2   1 
ATOM   2891  C  CZ    . PHE B  1 85   ? 185.980 200.422 213.467 1.00 73.15  ? 79   PHE D CZ    1 
ATOM   2892  N  N     . LEU B  1 86   ? 180.310 203.517 216.945 1.00 70.92  ? 80   LEU D N     1 
ATOM   2893  C  CA    . LEU B  1 86   ? 179.476 203.951 218.060 1.00 70.92  ? 80   LEU D CA    1 
ATOM   2894  C  C     . LEU B  1 86   ? 178.310 203.007 218.283 1.00 70.92  ? 80   LEU D C     1 
ATOM   2895  O  O     . LEU B  1 86   ? 178.020 202.632 219.422 1.00 70.92  ? 80   LEU D O     1 
ATOM   2896  C  CB    . LEU B  1 86   ? 178.959 205.367 217.834 1.00 70.92  ? 80   LEU D CB    1 
ATOM   2897  C  CG    . LEU B  1 86   ? 179.795 206.458 218.483 1.00 70.92  ? 80   LEU D CG    1 
ATOM   2898  C  CD1   . LEU B  1 86   ? 179.707 206.270 219.976 1.00 70.92  ? 80   LEU D CD1   1 
ATOM   2899  C  CD2   . LEU B  1 86   ? 181.229 206.379 218.022 1.00 70.92  ? 80   LEU D CD2   1 
ATOM   2900  N  N     . CYS B  1 87   ? 177.609 202.633 217.217 1.00 81.20  ? 81   CYS D N     1 
ATOM   2901  C  CA    . CYS B  1 87   ? 176.445 201.782 217.406 1.00 81.20  ? 81   CYS D CA    1 
ATOM   2902  C  C     . CYS B  1 87   ? 176.866 200.396 217.867 1.00 81.20  ? 81   CYS D C     1 
ATOM   2903  O  O     . CYS B  1 87   ? 176.218 199.801 218.735 1.00 81.20  ? 81   CYS D O     1 
ATOM   2904  C  CB    . CYS B  1 87   ? 175.613 201.721 216.126 1.00 81.20  ? 81   CYS D CB    1 
ATOM   2905  S  SG    . CYS B  1 87   ? 176.365 200.891 214.727 1.00 81.20  ? 81   CYS D SG    1 
ATOM   2906  N  N     . SER B  1 88   ? 177.972 199.879 217.329 1.00 69.64  ? 82   SER D N     1 
ATOM   2907  C  CA    . SER B  1 88   ? 178.464 198.587 217.788 1.00 69.64  ? 82   SER D CA    1 
ATOM   2908  C  C     . SER B  1 88   ? 178.849 198.627 219.259 1.00 69.64  ? 82   SER D C     1 
ATOM   2909  O  O     . SER B  1 88   ? 178.611 197.660 219.987 1.00 69.64  ? 82   SER D O     1 
ATOM   2910  C  CB    . SER B  1 88   ? 179.653 198.154 216.941 1.00 69.64  ? 82   SER D CB    1 
ATOM   2911  O  OG    . SER B  1 88   ? 180.178 196.935 217.422 1.00 69.64  ? 82   SER D OG    1 
ATOM   2912  N  N     . TRP B  1 89   ? 179.433 199.731 219.715 1.00 62.80  ? 83   TRP D N     1 
ATOM   2913  C  CA    . TRP B  1 89   ? 179.798 199.829 221.119 1.00 62.80  ? 83   TRP D CA    1 
ATOM   2914  C  C     . TRP B  1 89   ? 178.564 199.935 221.994 1.00 62.80  ? 83   TRP D C     1 
ATOM   2915  O  O     . TRP B  1 89   ? 178.423 199.181 222.957 1.00 62.80  ? 83   TRP D O     1 
ATOM   2916  C  CB    . TRP B  1 89   ? 180.723 201.023 221.333 1.00 62.80  ? 83   TRP D CB    1 
ATOM   2917  C  CG    . TRP B  1 89   ? 182.016 200.841 220.643 1.00 62.80  ? 83   TRP D CG    1 
ATOM   2918  C  CD1   . TRP B  1 89   ? 182.484 199.694 220.096 1.00 62.80  ? 83   TRP D CD1   1 
ATOM   2919  C  CD2   . TRP B  1 89   ? 182.996 201.843 220.369 1.00 62.80  ? 83   TRP D CD2   1 
ATOM   2920  N  NE1   . TRP B  1 89   ? 183.707 199.905 219.517 1.00 62.80  ? 83   TRP D NE1   1 
ATOM   2921  C  CE2   . TRP B  1 89   ? 184.041 201.221 219.672 1.00 62.80  ? 83   TRP D CE2   1 
ATOM   2922  C  CE3   . TRP B  1 89   ? 183.098 203.204 220.654 1.00 62.80  ? 83   TRP D CE3   1 
ATOM   2923  C  CZ2   . TRP B  1 89   ? 185.169 201.909 219.256 1.00 62.80  ? 83   TRP D CZ2   1 
ATOM   2924  C  CZ3   . TRP B  1 89   ? 184.221 203.882 220.242 1.00 62.80  ? 83   TRP D CZ3   1 
ATOM   2925  C  CH2   . TRP B  1 89   ? 185.241 203.236 219.552 1.00 62.80  ? 83   TRP D CH2   1 
ATOM   2926  N  N     . LEU B  1 90   ? 177.651 200.842 221.657 1.00 61.70  ? 84   LEU D N     1 
ATOM   2927  C  CA    . LEU B  1 90   ? 176.460 201.045 222.466 1.00 61.70  ? 84   LEU D CA    1 
ATOM   2928  C  C     . LEU B  1 90   ? 175.571 199.815 222.526 1.00 61.70  ? 84   LEU D C     1 
ATOM   2929  O  O     . LEU B  1 90   ? 174.963 199.555 223.568 1.00 61.70  ? 84   LEU D O     1 
ATOM   2930  C  CB    . LEU B  1 90   ? 175.659 202.230 221.930 1.00 61.70  ? 84   LEU D CB    1 
ATOM   2931  C  CG    . LEU B  1 90   ? 176.204 203.617 222.231 1.00 61.70  ? 84   LEU D CG    1 
ATOM   2932  C  CD1   . LEU B  1 90   ? 175.491 204.654 221.403 1.00 61.70  ? 84   LEU D CD1   1 
ATOM   2933  C  CD2   . LEU B  1 90   ? 175.966 203.878 223.694 1.00 61.70  ? 84   LEU D CD2   1 
ATOM   2934  N  N     . LEU B  1 91   ? 175.457 199.059 221.437 1.00 56.84  ? 85   LEU D N     1 
ATOM   2935  C  CA    . LEU B  1 91   ? 174.578 197.897 221.456 1.00 56.84  ? 85   LEU D CA    1 
ATOM   2936  C  C     . LEU B  1 91   ? 175.050 196.895 222.501 1.00 56.84  ? 85   LEU D C     1 
ATOM   2937  O  O     . LEU B  1 91   ? 174.300 196.509 223.406 1.00 56.84  ? 85   LEU D O     1 
ATOM   2938  C  CB    . LEU B  1 91   ? 174.525 197.278 220.061 1.00 56.84  ? 85   LEU D CB    1 
ATOM   2939  C  CG    . LEU B  1 91   ? 173.492 196.202 219.740 1.00 56.84  ? 85   LEU D CG    1 
ATOM   2940  C  CD1   . LEU B  1 91   ? 173.117 196.294 218.279 1.00 56.84  ? 85   LEU D CD1   1 
ATOM   2941  C  CD2   . LEU B  1 91   ? 174.042 194.824 220.040 1.00 56.84  ? 85   LEU D CD2   1 
ATOM   2942  N  N     . PHE B  1 92   ? 176.313 196.493 222.420 1.00 51.76  ? 86   PHE D N     1 
ATOM   2943  C  CA    . PHE B  1 92   ? 176.831 195.591 223.431 1.00 51.76  ? 86   PHE D CA    1 
ATOM   2944  C  C     . PHE B  1 92   ? 176.923 196.252 224.794 1.00 51.76  ? 86   PHE D C     1 
ATOM   2945  O  O     . PHE B  1 92   ? 176.926 195.551 225.804 1.00 51.76  ? 86   PHE D O     1 
ATOM   2946  C  CB    . PHE B  1 92   ? 178.193 195.060 223.014 1.00 51.76  ? 86   PHE D CB    1 
ATOM   2947  C  CG    . PHE B  1 92   ? 178.142 194.164 221.825 1.00 51.76  ? 86   PHE D CG    1 
ATOM   2948  C  CD1   . PHE B  1 92   ? 177.747 192.852 221.957 1.00 51.76  ? 86   PHE D CD1   1 
ATOM   2949  C  CD2   . PHE B  1 92   ? 178.486 194.631 220.576 1.00 51.76  ? 86   PHE D CD2   1 
ATOM   2950  C  CE1   . PHE B  1 92   ? 177.697 192.025 220.867 1.00 51.76  ? 86   PHE D CE1   1 
ATOM   2951  C  CE2   . PHE B  1 92   ? 178.437 193.805 219.485 1.00 51.76  ? 86   PHE D CE2   1 
ATOM   2952  C  CZ    . PHE B  1 92   ? 178.043 192.501 219.629 1.00 51.76  ? 86   PHE D CZ    1 
ATOM   2953  N  N     . ALA B  1 93   ? 177.000 197.580 224.855 1.00 53.65  ? 87   ALA D N     1 
ATOM   2954  C  CA    . ALA B  1 93   ? 176.954 198.246 226.149 1.00 53.65  ? 87   ALA D CA    1 
ATOM   2955  C  C     . ALA B  1 93   ? 175.618 197.997 226.823 1.00 53.65  ? 87   ALA D C     1 
ATOM   2956  O  O     . ALA B  1 93   ? 175.555 197.620 228.000 1.00 53.65  ? 87   ALA D O     1 
ATOM   2957  C  CB    . ALA B  1 93   ? 177.201 199.741 225.980 1.00 53.65  ? 87   ALA D CB    1 
ATOM   2958  N  N     . MET B  1 94   ? 174.538 198.216 226.082 1.00 57.67  ? 88   MET D N     1 
ATOM   2959  C  CA    . MET B  1 94   ? 173.219 197.864 226.576 1.00 57.67  ? 88   MET D CA    1 
ATOM   2960  C  C     . MET B  1 94   ? 173.161 196.396 226.954 1.00 57.67  ? 88   MET D C     1 
ATOM   2961  O  O     . MET B  1 94   ? 172.573 196.043 227.980 1.00 57.67  ? 88   MET D O     1 
ATOM   2962  C  CB    . MET B  1 94   ? 172.166 198.190 225.523 1.00 57.67  ? 88   MET D CB    1 
ATOM   2963  C  CG    . MET B  1 94   ? 170.739 197.963 225.975 1.00 57.67  ? 88   MET D CG    1 
ATOM   2964  S  SD    . MET B  1 94   ? 170.299 199.001 227.381 1.00 57.67  ? 88   MET D SD    1 
ATOM   2965  C  CE    . MET B  1 94   ? 170.250 200.618 226.618 1.00 57.67  ? 88   MET D CE    1 
ATOM   2966  N  N     . ALA B  1 95   ? 173.793 195.534 226.159 1.00 52.62  ? 89   ALA D N     1 
ATOM   2967  C  CA    . ALA B  1 95   ? 173.790 194.107 226.462 1.00 52.62  ? 89   ALA D CA    1 
ATOM   2968  C  C     . ALA B  1 95   ? 174.428 193.827 227.818 1.00 52.62  ? 89   ALA D C     1 
ATOM   2969  O  O     . ALA B  1 95   ? 173.828 193.179 228.680 1.00 52.62  ? 89   ALA D O     1 
ATOM   2970  C  CB    . ALA B  1 95   ? 174.511 193.333 225.361 1.00 52.62  ? 89   ALA D CB    1 
ATOM   2971  N  N     . TRP B  1 96   ? 175.657 194.301 228.019 1.00 50.83  ? 90   TRP D N     1 
ATOM   2972  C  CA    . TRP B  1 96   ? 176.348 194.040 229.275 1.00 50.83  ? 90   TRP D CA    1 
ATOM   2973  C  C     . TRP B  1 96   ? 175.592 194.636 230.449 1.00 50.83  ? 90   TRP D C     1 
ATOM   2974  O  O     . TRP B  1 96   ? 175.473 194.003 231.505 1.00 50.83  ? 90   TRP D O     1 
ATOM   2975  C  CB    . TRP B  1 96   ? 177.768 194.598 229.246 1.00 50.83  ? 90   TRP D CB    1 
ATOM   2976  C  CG    . TRP B  1 96   ? 178.686 193.906 228.319 1.00 50.83  ? 90   TRP D CG    1 
ATOM   2977  C  CD1   . TRP B  1 96   ? 179.216 194.400 227.173 1.00 50.83  ? 90   TRP D CD1   1 
ATOM   2978  C  CD2   . TRP B  1 96   ? 179.157 192.565 228.435 1.00 50.83  ? 90   TRP D CD2   1 
ATOM   2979  N  NE1   . TRP B  1 96   ? 180.014 193.458 226.576 1.00 50.83  ? 90   TRP D NE1   1 
ATOM   2980  C  CE2   . TRP B  1 96   ? 179.988 192.319 227.331 1.00 50.83  ? 90   TRP D CE2   1 
ATOM   2981  C  CE3   . TRP B  1 96   ? 178.960 191.549 229.369 1.00 50.83  ? 90   TRP D CE3   1 
ATOM   2982  C  CZ2   . TRP B  1 96   ? 180.624 191.106 227.139 1.00 50.83  ? 90   TRP D CZ2   1 
ATOM   2983  C  CZ3   . TRP B  1 96   ? 179.587 190.346 229.176 1.00 50.83  ? 90   TRP D CZ3   1 
ATOM   2984  C  CH2   . TRP B  1 96   ? 180.409 190.131 228.069 1.00 50.83  ? 90   TRP D CH2   1 
ATOM   2985  N  N     . TRP B  1 97   ? 175.106 195.866 230.299 1.00 55.09  ? 91   TRP D N     1 
ATOM   2986  C  CA    . TRP B  1 97   ? 174.356 196.492 231.377 1.00 55.09  ? 91   TRP D CA    1 
ATOM   2987  C  C     . TRP B  1 97   ? 173.137 195.667 231.737 1.00 55.09  ? 91   TRP D C     1 
ATOM   2988  O  O     . TRP B  1 97   ? 172.873 195.407 232.916 1.00 55.09  ? 91   TRP D O     1 
ATOM   2989  C  CB    . TRP B  1 97   ? 173.944 197.896 230.962 1.00 55.09  ? 91   TRP D CB    1 
ATOM   2990  C  CG    . TRP B  1 97   ? 173.119 198.571 231.966 1.00 55.09  ? 91   TRP D CG    1 
ATOM   2991  C  CD1   . TRP B  1 97   ? 173.497 198.957 233.211 1.00 55.09  ? 91   TRP D CD1   1 
ATOM   2992  C  CD2   . TRP B  1 97   ? 171.755 198.948 231.821 1.00 55.09  ? 91   TRP D CD2   1 
ATOM   2993  N  NE1   . TRP B  1 97   ? 172.447 199.559 233.856 1.00 55.09  ? 91   TRP D NE1   1 
ATOM   2994  C  CE2   . TRP B  1 97   ? 171.365 199.567 233.019 1.00 55.09  ? 91   TRP D CE2   1 
ATOM   2995  C  CE3   . TRP B  1 97   ? 170.824 198.827 230.792 1.00 55.09  ? 91   TRP D CE3   1 
ATOM   2996  C  CZ2   . TRP B  1 97   ? 170.086 200.058 233.213 1.00 55.09  ? 91   TRP D CZ2   1 
ATOM   2997  C  CZ3   . TRP B  1 97   ? 169.562 199.313 230.986 1.00 55.09  ? 91   TRP D CZ3   1 
ATOM   2998  C  CH2   . TRP B  1 97   ? 169.200 199.921 232.186 1.00 55.09  ? 91   TRP D CH2   1 
ATOM   2999  N  N     . LEU B  1 98   ? 172.390 195.233 230.726 1.00 53.18  ? 92   LEU D N     1 
ATOM   3000  C  CA    . LEU B  1 98   ? 171.215 194.416 230.963 1.00 53.18  ? 92   LEU D CA    1 
ATOM   3001  C  C     . LEU B  1 98   ? 171.582 193.116 231.654 1.00 53.18  ? 92   LEU D C     1 
ATOM   3002  O  O     . LEU B  1 98   ? 170.849 192.642 232.522 1.00 53.18  ? 92   LEU D O     1 
ATOM   3003  C  CB    . LEU B  1 98   ? 170.522 194.141 229.637 1.00 53.18  ? 92   LEU D CB    1 
ATOM   3004  C  CG    . LEU B  1 98   ? 169.217 193.371 229.727 1.00 53.18  ? 92   LEU D CG    1 
ATOM   3005  C  CD1   . LEU B  1 98   ? 168.199 194.206 230.468 1.00 53.18  ? 92   LEU D CD1   1 
ATOM   3006  C  CD2   . LEU B  1 98   ? 168.731 193.016 228.339 1.00 53.18  ? 92   LEU D CD2   1 
ATOM   3007  N  N     . ILE B  1 99   ? 172.710 192.520 231.277 1.00 54.66  ? 93   ILE D N     1 
ATOM   3008  C  CA    . ILE B  1 99   ? 173.112 191.271 231.909 1.00 54.66  ? 93   ILE D CA    1 
ATOM   3009  C  C     . ILE B  1 99   ? 173.433 191.490 233.374 1.00 54.66  ? 93   ILE D C     1 
ATOM   3010  O  O     . ILE B  1 99   ? 173.001 190.721 234.238 1.00 54.66  ? 93   ILE D O     1 
ATOM   3011  C  CB    . ILE B  1 99   ? 174.303 190.649 231.170 1.00 54.66  ? 93   ILE D CB    1 
ATOM   3012  C  CG1   . ILE B  1 99   ? 173.897 190.288 229.747 1.00 54.66  ? 93   ILE D CG1   1 
ATOM   3013  C  CG2   . ILE B  1 99   ? 174.807 189.435 231.923 1.00 54.66  ? 93   ILE D CG2   1 
ATOM   3014  C  CD1   . ILE B  1 99   ? 172.731 189.342 229.688 1.00 54.66  ? 93   ILE D CD1   1 
ATOM   3015  N  N     . ALA B  1 100  ? 174.209 192.527 233.677 1.00 59.62  ? 94   ALA D N     1 
ATOM   3016  C  CA    . ALA B  1 100  ? 174.504 192.826 235.070 1.00 59.62  ? 94   ALA D CA    1 
ATOM   3017  C  C     . ALA B  1 100  ? 173.232 193.078 235.849 1.00 59.62  ? 94   ALA D C     1 
ATOM   3018  O  O     . ALA B  1 100  ? 173.133 192.707 237.023 1.00 59.62  ? 94   ALA D O     1 
ATOM   3019  C  CB    . ALA B  1 100  ? 175.417 194.037 235.173 1.00 59.62  ? 94   ALA D CB    1 
ATOM   3020  N  N     . PHE B  1 101  ? 172.247 193.695 235.214 1.00 66.14  ? 95   PHE D N     1 
ATOM   3021  C  CA    . PHE B  1 101  ? 171.028 193.994 235.935 1.00 66.14  ? 95   PHE D CA    1 
ATOM   3022  C  C     . PHE B  1 101  ? 170.154 192.766 236.117 1.00 66.14  ? 95   PHE D C     1 
ATOM   3023  O  O     . PHE B  1 101  ? 169.455 192.662 237.126 1.00 66.14  ? 95   PHE D O     1 
ATOM   3024  C  CB    . PHE B  1 101  ? 170.268 195.092 235.213 1.00 66.14  ? 95   PHE D CB    1 
ATOM   3025  C  CG    . PHE B  1 101  ? 169.090 195.580 235.961 1.00 66.14  ? 95   PHE D CG    1 
ATOM   3026  C  CD1   . PHE B  1 101  ? 169.256 196.268 237.136 1.00 66.14  ? 95   PHE D CD1   1 
ATOM   3027  C  CD2   . PHE B  1 101  ? 167.819 195.384 235.483 1.00 66.14  ? 95   PHE D CD2   1 
ATOM   3028  C  CE1   . PHE B  1 101  ? 168.183 196.727 237.831 1.00 66.14  ? 95   PHE D CE1   1 
ATOM   3029  C  CE2   . PHE B  1 101  ? 166.740 195.849 236.181 1.00 66.14  ? 95   PHE D CE2   1 
ATOM   3030  C  CZ    . PHE B  1 101  ? 166.921 196.521 237.354 1.00 66.14  ? 95   PHE D CZ    1 
ATOM   3031  N  N     . ALA B  1 102  ? 170.189 191.832 235.171 1.00 65.18  ? 96   ALA D N     1 
ATOM   3032  C  CA    . ALA B  1 102  ? 169.425 190.601 235.306 1.00 65.18  ? 96   ALA D CA    1 
ATOM   3033  C  C     . ALA B  1 102  ? 170.064 189.672 236.319 1.00 65.18  ? 96   ALA D C     1 
ATOM   3034  O  O     . ALA B  1 102  ? 169.367 188.934 237.022 1.00 65.18  ? 96   ALA D O     1 
ATOM   3035  C  CB    . ALA B  1 102  ? 169.307 189.906 233.953 1.00 65.18  ? 96   ALA D CB    1 
ATOM   3036  N  N     . HIS B  1 103  ? 171.392 189.699 236.407 1.00 67.08  ? 97   HIS D N     1 
ATOM   3037  C  CA    . HIS B  1 103  ? 172.094 188.925 237.417 1.00 67.08  ? 97   HIS D CA    1 
ATOM   3038  C  C     . HIS B  1 103  ? 171.829 189.438 238.821 1.00 67.08  ? 97   HIS D C     1 
ATOM   3039  O  O     . HIS B  1 103  ? 172.277 188.820 239.792 1.00 67.08  ? 97   HIS D O     1 
ATOM   3040  C  CB    . HIS B  1 103  ? 173.588 188.947 237.119 1.00 67.08  ? 97   HIS D CB    1 
ATOM   3041  C  CG    . HIS B  1 103  ? 174.403 188.124 238.060 1.00 67.08  ? 97   HIS D CG    1 
ATOM   3042  N  ND1   . HIS B  1 103  ? 174.929 188.635 239.224 1.00 67.08  ? 97   HIS D ND1   1 
ATOM   3043  C  CD2   . HIS B  1 103  ? 174.763 186.821 238.023 1.00 67.08  ? 97   HIS D CD2   1 
ATOM   3044  C  CE1   . HIS B  1 103  ? 175.595 187.687 239.858 1.00 67.08  ? 97   HIS D CE1   1 
ATOM   3045  N  NE2   . HIS B  1 103  ? 175.510 186.575 239.149 1.00 67.08  ? 97   HIS D NE2   1 
ATOM   3046  N  N     . GLY B  1 104  ? 171.097 190.538 238.954 1.00 72.98  ? 98   GLY D N     1 
ATOM   3047  C  CA    . GLY B  1 104  ? 170.887 191.127 240.253 1.00 72.98  ? 98   GLY D CA    1 
ATOM   3048  C  C     . GLY B  1 104  ? 172.213 191.580 240.802 1.00 72.98  ? 98   GLY D C     1 
ATOM   3049  O  O     . GLY B  1 104  ? 172.592 191.222 241.919 1.00 72.98  ? 98   GLY D O     1 
ATOM   3050  N  N     . ASP B  1 105  ? 172.939 192.355 240.007 1.00 77.97  ? 99   ASP D N     1 
ATOM   3051  C  CA    . ASP B  1 105  ? 174.287 192.745 240.364 1.00 77.97  ? 99   ASP D CA    1 
ATOM   3052  C  C     . ASP B  1 105  ? 174.458 194.241 240.579 1.00 77.97  ? 99   ASP D C     1 
ATOM   3053  O  O     . ASP B  1 105  ? 175.536 194.663 241.004 1.00 77.97  ? 99   ASP D O     1 
ATOM   3054  C  CB    . ASP B  1 105  ? 175.274 192.267 239.291 1.00 77.97  ? 99   ASP D CB    1 
ATOM   3055  C  CG    . ASP B  1 105  ? 176.704 192.381 239.736 1.00 77.97  ? 99   ASP D CG    1 
ATOM   3056  O  OD1   . ASP B  1 105  ? 177.102 191.604 240.628 1.00 77.97  ? 99   ASP D OD1   1 
ATOM   3057  O  OD2   . ASP B  1 105  ? 177.430 193.244 239.205 1.00 77.97  ? 99   ASP D OD2   1 
ATOM   3058  N  N     . LEU B  1 106  ? 173.437 195.048 240.312 1.00 80.04  ? 100  LEU D N     1 
ATOM   3059  C  CA    . LEU B  1 106  ? 173.553 196.481 240.538 1.00 80.04  ? 100  LEU D CA    1 
ATOM   3060  C  C     . LEU B  1 106  ? 173.120 196.863 241.945 1.00 80.04  ? 100  LEU D C     1 
ATOM   3061  O  O     . LEU B  1 106  ? 173.703 197.758 242.562 1.00 80.04  ? 100  LEU D O     1 
ATOM   3062  C  CB    . LEU B  1 106  ? 172.731 197.245 239.504 1.00 80.04  ? 100  LEU D CB    1 
ATOM   3063  C  CG    . LEU B  1 106  ? 173.332 197.150 238.110 1.00 80.04  ? 100  LEU D CG    1 
ATOM   3064  C  CD1   . LEU B  1 106  ? 172.426 197.778 237.076 1.00 80.04  ? 100  LEU D CD1   1 
ATOM   3065  C  CD2   . LEU B  1 106  ? 174.674 197.837 238.127 1.00 80.04  ? 100  LEU D CD2   1 
ATOM   3066  N  N     . ALA B  1 107  ? 172.099 196.197 242.455 1.00 91.92  ? 101  ALA D N     1 
ATOM   3067  C  CA    . ALA B  1 107  ? 171.550 196.554 243.755 1.00 91.92  ? 101  ALA D CA    1 
ATOM   3068  C  C     . ALA B  1 107  ? 172.390 196.068 244.934 1.00 91.92  ? 101  ALA D C     1 
ATOM   3069  O  O     . ALA B  1 107  ? 172.778 196.883 245.781 1.00 91.92  ? 101  ALA D O     1 
ATOM   3070  C  CB    . ALA B  1 107  ? 170.130 196.008 243.895 1.00 91.92  ? 101  ALA D CB    1 
ATOM   3071  N  N     . PRO B  1 108  ? 172.689 194.760 245.042 1.00 99.87  ? 102  PRO D N     1 
ATOM   3072  C  CA    . PRO B  1 108  ? 173.092 194.220 246.349 1.00 99.87  ? 102  PRO D CA    1 
ATOM   3073  C  C     . PRO B  1 108  ? 174.399 194.774 246.884 1.00 99.87  ? 102  PRO D C     1 
ATOM   3074  O  O     . PRO B  1 108  ? 174.421 195.361 247.970 1.00 99.87  ? 102  PRO D O     1 
ATOM   3075  C  CB    . PRO B  1 108  ? 173.199 192.716 246.081 1.00 99.87  ? 102  PRO D CB    1 
ATOM   3076  C  CG    . PRO B  1 108  ? 173.522 192.614 244.646 1.00 99.87  ? 102  PRO D CG    1 
ATOM   3077  C  CD    . PRO B  1 108  ? 172.798 193.743 243.979 1.00 99.87  ? 102  PRO D CD    1 
ATOM   3078  N  N     . SER B  1 109  ? 175.486 194.605 246.131 1.00 110.89 ? 103  SER D N     1 
ATOM   3079  C  CA    . SER B  1 109  ? 176.836 194.893 246.618 1.00 110.89 ? 103  SER D CA    1 
ATOM   3080  C  C     . SER B  1 109  ? 177.075 194.232 247.974 1.00 110.89 ? 103  SER D C     1 
ATOM   3081  O  O     . SER B  1 109  ? 177.831 194.729 248.810 1.00 110.89 ? 103  SER D O     1 
ATOM   3082  C  CB    . SER B  1 109  ? 177.086 196.400 246.688 1.00 110.89 ? 103  SER D CB    1 
ATOM   3083  O  OG    . SER B  1 109  ? 176.254 197.013 247.655 1.00 110.89 ? 103  SER D OG    1 
ATOM   3084  N  N     . GLU B  1 110  ? 176.417 193.088 248.187 1.00 110.91 ? 104  GLU D N     1 
ATOM   3085  C  CA    . GLU B  1 110  ? 176.462 192.426 249.485 1.00 110.91 ? 104  GLU D CA    1 
ATOM   3086  C  C     . GLU B  1 110  ? 177.844 191.869 249.789 1.00 110.91 ? 104  GLU D C     1 
ATOM   3087  O  O     . GLU B  1 110  ? 178.156 191.593 250.952 1.00 110.91 ? 104  GLU D O     1 
ATOM   3088  C  CB    . GLU B  1 110  ? 175.418 191.312 249.539 1.00 110.91 ? 104  GLU D CB    1 
ATOM   3089  N  N     . GLY B  1 111  ? 178.674 191.689 248.767 1.00 115.71 ? 105  GLY D N     1 
ATOM   3090  C  CA    . GLY B  1 111  ? 180.013 191.172 248.961 1.00 115.71 ? 105  GLY D CA    1 
ATOM   3091  C  C     . GLY B  1 111  ? 180.126 189.699 248.634 1.00 115.71 ? 105  GLY D C     1 
ATOM   3092  O  O     . GLY B  1 111  ? 181.180 189.233 248.194 1.00 115.71 ? 105  GLY D O     1 
ATOM   3093  N  N     . THR B  1 112  ? 179.041 188.956 248.846 1.00 104.76 ? 106  THR D N     1 
ATOM   3094  C  CA    . THR B  1 112  ? 179.072 187.517 248.608 1.00 104.76 ? 106  THR D CA    1 
ATOM   3095  C  C     . THR B  1 112  ? 178.957 187.186 247.125 1.00 104.76 ? 106  THR D C     1 
ATOM   3096  O  O     . THR B  1 112  ? 179.891 186.627 246.538 1.00 104.76 ? 106  THR D O     1 
ATOM   3097  C  CB    . THR B  1 112  ? 177.950 186.834 249.389 1.00 104.76 ? 106  THR D CB    1 
ATOM   3098  N  N     . ALA B  1 113  ? 177.834 187.534 246.502 1.00 93.25  ? 107  ALA D N     1 
ATOM   3099  C  CA    . ALA B  1 113  ? 177.585 187.156 245.119 1.00 93.25  ? 107  ALA D CA    1 
ATOM   3100  C  C     . ALA B  1 113  ? 178.534 187.895 244.188 1.00 93.25  ? 107  ALA D C     1 
ATOM   3101  O  O     . ALA B  1 113  ? 178.636 189.125 244.236 1.00 93.25  ? 107  ALA D O     1 
ATOM   3102  C  CB    . ALA B  1 113  ? 176.136 187.445 244.738 1.00 93.25  ? 107  ALA D CB    1 
ATOM   3103  N  N     . GLU B  1 114  ? 179.213 187.150 243.344 1.00 86.82  ? 108  GLU D N     1 
ATOM   3104  C  CA    . GLU B  1 114  ? 180.196 187.700 242.424 1.00 86.82  ? 108  GLU D CA    1 
ATOM   3105  C  C     . GLU B  1 114  ? 179.516 188.086 241.122 1.00 86.82  ? 108  GLU D C     1 
ATOM   3106  O  O     . GLU B  1 114  ? 178.620 187.371 240.664 1.00 86.82  ? 108  GLU D O     1 
ATOM   3107  C  CB    . GLU B  1 114  ? 181.292 186.689 242.150 1.00 86.82  ? 108  GLU D CB    1 
ATOM   3108  C  CG    . GLU B  1 114  ? 182.066 186.303 243.385 1.00 86.82  ? 108  GLU D CG    1 
ATOM   3109  C  CD    . GLU B  1 114  ? 181.325 185.286 244.217 1.00 86.82  ? 108  GLU D CD    1 
ATOM   3110  O  OE1   . GLU B  1 114  ? 180.233 184.862 243.794 1.00 86.82  ? 108  GLU D OE1   1 
ATOM   3111  O  OE2   . GLU B  1 114  ? 181.825 184.915 245.296 1.00 86.82  ? 108  GLU D OE2   1 
ATOM   3112  N  N     . PRO B  1 115  ? 179.909 189.182 240.506 1.00 77.26  ? 109  PRO D N     1 
ATOM   3113  C  CA    . PRO B  1 115  ? 179.192 189.660 239.321 1.00 77.26  ? 109  PRO D CA    1 
ATOM   3114  C  C     . PRO B  1 115  ? 179.428 188.802 238.096 1.00 77.26  ? 109  PRO D C     1 
ATOM   3115  O  O     . PRO B  1 115  ? 180.366 188.000 238.063 1.00 77.26  ? 109  PRO D O     1 
ATOM   3116  C  CB    . PRO B  1 115  ? 179.766 191.065 239.121 1.00 77.26  ? 109  PRO D CB    1 
ATOM   3117  C  CG    . PRO B  1 115  ? 181.129 190.984 239.690 1.00 77.26  ? 109  PRO D CG    1 
ATOM   3118  C  CD    . PRO B  1 115  ? 181.041 190.053 240.859 1.00 77.26  ? 109  PRO D CD    1 
ATOM   3119  N  N     . CYS B  1 116  ? 178.573 188.958 237.085 1.00 80.82  ? 110  CYS D N     1 
ATOM   3120  C  CA    . CYS B  1 116  ? 178.926 188.462 235.762 1.00 80.82  ? 110  CYS D CA    1 
ATOM   3121  C  C     . CYS B  1 116  ? 180.222 189.099 235.294 1.00 80.82  ? 110  CYS D C     1 
ATOM   3122  O  O     . CYS B  1 116  ? 181.120 188.413 234.791 1.00 80.82  ? 110  CYS D O     1 
ATOM   3123  C  CB    . CYS B  1 116  ? 177.813 188.762 234.760 1.00 80.82  ? 110  CYS D CB    1 
ATOM   3124  S  SG    . CYS B  1 116  ? 176.208 187.995 235.073 1.00 80.82  ? 110  CYS D SG    1 
ATOM   3125  N  N     . VAL B  1 117  ? 180.338 190.408 235.469 1.00 67.13  ? 111  VAL D N     1 
ATOM   3126  C  CA    . VAL B  1 117  ? 181.521 191.168 235.104 1.00 67.13  ? 111  VAL D CA    1 
ATOM   3127  C  C     . VAL B  1 117  ? 181.870 192.082 236.267 1.00 67.13  ? 111  VAL D C     1 
ATOM   3128  O  O     . VAL B  1 117  ? 180.992 192.722 236.852 1.00 67.13  ? 111  VAL D O     1 
ATOM   3129  C  CB    . VAL B  1 117  ? 181.301 191.966 233.804 1.00 67.13  ? 111  VAL D CB    1 
ATOM   3130  C  CG1   . VAL B  1 117  ? 180.115 192.891 233.949 1.00 67.13  ? 111  VAL D CG1   1 
ATOM   3131  C  CG2   . VAL B  1 117  ? 182.540 192.753 233.446 1.00 67.13  ? 111  VAL D CG2   1 
ATOM   3132  N  N     . THR B  1 118  ? 183.148 192.130 236.611 1.00 67.34  ? 112  THR D N     1 
ATOM   3133  C  CA    . THR B  1 118  ? 183.583 192.821 237.812 1.00 67.34  ? 112  THR D CA    1 
ATOM   3134  C  C     . THR B  1 118  ? 183.315 194.312 237.725 1.00 67.34  ? 112  THR D C     1 
ATOM   3135  O  O     . THR B  1 118  ? 183.558 194.945 236.695 1.00 67.34  ? 112  THR D O     1 
ATOM   3136  C  CB    . THR B  1 118  ? 185.071 192.592 238.051 1.00 67.34  ? 112  THR D CB    1 
ATOM   3137  O  OG1   . THR B  1 118  ? 185.811 193.073 236.925 1.00 67.34  ? 112  THR D OG1   1 
ATOM   3138  C  CG2   . THR B  1 118  ? 185.353 191.122 238.245 1.00 67.34  ? 112  THR D CG2   1 
ATOM   3139  N  N     . SER B  1 119  ? 182.797 194.865 238.821 1.00 65.58  ? 113  SER D N     1 
ATOM   3140  C  CA    . SER B  1 119  ? 182.814 196.297 239.101 1.00 65.58  ? 113  SER D CA    1 
ATOM   3141  C  C     . SER B  1 119  ? 182.186 197.105 237.964 1.00 65.58  ? 113  SER D C     1 
ATOM   3142  O  O     . SER B  1 119  ? 182.837 197.907 237.301 1.00 65.58  ? 113  SER D O     1 
ATOM   3143  C  CB    . SER B  1 119  ? 184.244 196.773 239.364 1.00 65.58  ? 113  SER D CB    1 
ATOM   3144  O  OG    . SER B  1 119  ? 185.022 196.693 238.183 1.00 65.58  ? 113  SER D OG    1 
ATOM   3145  N  N     . ILE B  1 120  ? 180.896 196.875 237.755 1.00 61.32  ? 114  ILE D N     1 
ATOM   3146  C  CA    . ILE B  1 120  ? 180.106 197.797 236.953 1.00 61.32  ? 114  ILE D CA    1 
ATOM   3147  C  C     . ILE B  1 120  ? 178.864 198.166 237.746 1.00 61.32  ? 114  ILE D C     1 
ATOM   3148  O  O     . ILE B  1 120  ? 178.205 197.315 238.346 1.00 61.32  ? 114  ILE D O     1 
ATOM   3149  C  CB    . ILE B  1 120  ? 179.724 197.251 235.561 1.00 61.32  ? 114  ILE D CB    1 
ATOM   3150  C  CG1   . ILE B  1 120  ? 178.714 196.130 235.644 1.00 61.32  ? 114  ILE D CG1   1 
ATOM   3151  C  CG2   . ILE B  1 120  ? 180.942 196.746 234.832 1.00 61.32  ? 114  ILE D CG2   1 
ATOM   3152  C  CD1   . ILE B  1 120  ? 178.146 195.849 234.305 1.00 61.32  ? 114  ILE D CD1   1 
ATOM   3153  N  N     . HIS B  1 121  ? 178.565 199.458 237.762 1.00 63.91  ? 115  HIS D N     1 
ATOM   3154  C  CA    . HIS B  1 121  ? 177.505 199.965 238.616 1.00 63.91  ? 115  HIS D CA    1 
ATOM   3155  C  C     . HIS B  1 121  ? 176.599 200.926 237.872 1.00 63.91  ? 115  HIS D C     1 
ATOM   3156  O  O     . HIS B  1 121  ? 175.542 201.293 238.398 1.00 63.91  ? 115  HIS D O     1 
ATOM   3157  C  CB    . HIS B  1 121  ? 178.114 200.649 239.833 1.00 63.91  ? 115  HIS D CB    1 
ATOM   3158  C  CG    . HIS B  1 121  ? 179.067 199.773 240.580 1.00 63.91  ? 115  HIS D CG    1 
ATOM   3159  N  ND1   . HIS B  1 121  ? 180.417 199.752 240.308 1.00 63.91  ? 115  HIS D ND1   1 
ATOM   3160  C  CD2   . HIS B  1 121  ? 178.860 198.850 241.547 1.00 63.91  ? 115  HIS D CD2   1 
ATOM   3161  C  CE1   . HIS B  1 121  ? 181.006 198.875 241.098 1.00 63.91  ? 115  HIS D CE1   1 
ATOM   3162  N  NE2   . HIS B  1 121  ? 180.083 198.312 241.859 1.00 63.91  ? 115  HIS D NE2   1 
ATOM   3163  N  N     . SER B  1 122  ? 176.970 201.330 236.667 1.00 60.84  ? 116  SER D N     1 
ATOM   3164  C  CA    . SER B  1 122  ? 176.179 202.271 235.897 1.00 60.84  ? 116  SER D CA    1 
ATOM   3165  C  C     . SER B  1 122  ? 176.259 201.854 234.442 1.00 60.84  ? 116  SER D C     1 
ATOM   3166  O  O     . SER B  1 122  ? 177.187 201.158 234.032 1.00 60.84  ? 116  SER D O     1 
ATOM   3167  C  CB    . SER B  1 122  ? 176.683 203.702 236.077 1.00 60.84  ? 116  SER D CB    1 
ATOM   3168  O  OG    . SER B  1 122  ? 177.976 203.845 235.521 1.00 60.84  ? 116  SER D OG    1 
ATOM   3169  N  N     . PHE B  1 123  ? 175.266 202.281 233.665 1.00 57.24  ? 117  PHE D N     1 
ATOM   3170  C  CA    . PHE B  1 123  ? 175.354 202.053 232.232 1.00 57.24  ? 117  PHE D CA    1 
ATOM   3171  C  C     . PHE B  1 123  ? 176.639 202.629 231.668 1.00 57.24  ? 117  PHE D C     1 
ATOM   3172  O  O     . PHE B  1 123  ? 177.190 202.091 230.703 1.00 57.24  ? 117  PHE D O     1 
ATOM   3173  C  CB    . PHE B  1 123  ? 174.155 202.650 231.511 1.00 57.24  ? 117  PHE D CB    1 
ATOM   3174  C  CG    . PHE B  1 123  ? 174.227 202.500 230.030 1.00 57.24  ? 117  PHE D CG    1 
ATOM   3175  C  CD1   . PHE B  1 123  ? 174.012 201.276 229.438 1.00 57.24  ? 117  PHE D CD1   1 
ATOM   3176  C  CD2   . PHE B  1 123  ? 174.539 203.578 229.229 1.00 57.24  ? 117  PHE D CD2   1 
ATOM   3177  C  CE1   . PHE B  1 123  ? 174.094 201.133 228.077 1.00 57.24  ? 117  PHE D CE1   1 
ATOM   3178  C  CE2   . PHE B  1 123  ? 174.619 203.438 227.868 1.00 57.24  ? 117  PHE D CE2   1 
ATOM   3179  C  CZ    . PHE B  1 123  ? 174.398 202.215 227.292 1.00 57.24  ? 117  PHE D CZ    1 
ATOM   3180  N  N     . SER B  1 124  ? 177.133 203.714 232.259 1.00 59.32  ? 118  SER D N     1 
ATOM   3181  C  CA    . SER B  1 124  ? 178.443 204.223 231.880 1.00 59.32  ? 118  SER D CA    1 
ATOM   3182  C  C     . SER B  1 124  ? 179.510 203.155 232.054 1.00 59.32  ? 118  SER D C     1 
ATOM   3183  O  O     . SER B  1 124  ? 180.411 203.022 231.219 1.00 59.32  ? 118  SER D O     1 
ATOM   3184  C  CB    . SER B  1 124  ? 178.779 205.456 232.711 1.00 59.32  ? 118  SER D CB    1 
ATOM   3185  O  OG    . SER B  1 124  ? 180.072 205.929 232.399 1.00 59.32  ? 118  SER D OG    1 
ATOM   3186  N  N     . SER B  1 125  ? 179.421 202.383 233.136 1.00 58.54  ? 119  SER D N     1 
ATOM   3187  C  CA    . SER B  1 125  ? 180.387 201.316 233.348 1.00 58.54  ? 119  SER D CA    1 
ATOM   3188  C  C     . SER B  1 125  ? 180.313 200.285 232.239 1.00 58.54  ? 119  SER D C     1 
ATOM   3189  O  O     . SER B  1 125  ? 181.341 199.900 231.674 1.00 58.54  ? 119  SER D O     1 
ATOM   3190  C  CB    . SER B  1 125  ? 180.148 200.652 234.698 1.00 58.54  ? 119  SER D CB    1 
ATOM   3191  O  OG    . SER B  1 125  ? 180.331 201.574 235.752 1.00 58.54  ? 119  SER D OG    1 
ATOM   3192  N  N     . ALA B  1 126  ? 179.107 199.821 231.916 1.00 54.39  ? 120  ALA D N     1 
ATOM   3193  C  CA    . ALA B  1 126  ? 178.971 198.828 230.862 1.00 54.39  ? 120  ALA D CA    1 
ATOM   3194  C  C     . ALA B  1 126  ? 179.443 199.372 229.528 1.00 54.39  ? 120  ALA D C     1 
ATOM   3195  O  O     . ALA B  1 126  ? 179.975 198.623 228.705 1.00 54.39  ? 120  ALA D O     1 
ATOM   3196  C  CB    . ALA B  1 126  ? 177.524 198.361 230.760 1.00 54.39  ? 120  ALA D CB    1 
ATOM   3197  N  N     . PHE B  1 127  ? 179.291 200.671 229.305 1.00 52.43  ? 121  PHE D N     1 
ATOM   3198  C  CA    . PHE B  1 127  ? 179.741 201.241 228.045 1.00 52.43  ? 121  PHE D CA    1 
ATOM   3199  C  C     . PHE B  1 127  ? 181.259 201.290 227.976 1.00 52.43  ? 121  PHE D C     1 
ATOM   3200  O  O     . PHE B  1 127  ? 181.857 200.919 226.957 1.00 52.43  ? 121  PHE D O     1 
ATOM   3201  C  CB    . PHE B  1 127  ? 179.142 202.625 227.860 1.00 52.43  ? 121  PHE D CB    1 
ATOM   3202  C  CG    . PHE B  1 127  ? 179.526 203.262 226.581 1.00 52.43  ? 121  PHE D CG    1 
ATOM   3203  C  CD1   . PHE B  1 127  ? 179.097 202.727 225.387 1.00 52.43  ? 121  PHE D CD1   1 
ATOM   3204  C  CD2   . PHE B  1 127  ? 180.284 204.408 226.565 1.00 52.43  ? 121  PHE D CD2   1 
ATOM   3205  C  CE1   . PHE B  1 127  ? 179.441 203.306 224.195 1.00 52.43  ? 121  PHE D CE1   1 
ATOM   3206  C  CE2   . PHE B  1 127  ? 180.621 204.999 225.376 1.00 52.43  ? 121  PHE D CE2   1 
ATOM   3207  C  CZ    . PHE B  1 127  ? 180.201 204.447 224.187 1.00 52.43  ? 121  PHE D CZ    1 
ATOM   3208  N  N     . LEU B  1 128  ? 181.899 201.761 229.044 1.00 52.30  ? 122  LEU D N     1 
ATOM   3209  C  CA    . LEU B  1 128  ? 183.350 201.677 229.111 1.00 52.30  ? 122  LEU D CA    1 
ATOM   3210  C  C     . LEU B  1 128  ? 183.825 200.253 228.903 1.00 52.30  ? 122  LEU D C     1 
ATOM   3211  O  O     . LEU B  1 128  ? 184.816 200.022 228.205 1.00 52.30  ? 122  LEU D O     1 
ATOM   3212  C  CB    . LEU B  1 128  ? 183.857 202.183 230.453 1.00 52.30  ? 122  LEU D CB    1 
ATOM   3213  C  CG    . LEU B  1 128  ? 183.744 203.668 230.739 1.00 52.30  ? 122  LEU D CG    1 
ATOM   3214  C  CD1   . LEU B  1 128  ? 184.210 203.935 232.148 1.00 52.30  ? 122  LEU D CD1   1 
ATOM   3215  C  CD2   . LEU B  1 128  ? 184.584 204.429 229.753 1.00 52.30  ? 122  LEU D CD2   1 
ATOM   3216  N  N     . PHE B  1 129  ? 183.132 199.291 229.501 1.00 50.40  ? 123  PHE D N     1 
ATOM   3217  C  CA    . PHE B  1 129  ? 183.525 197.902 229.345 1.00 50.40  ? 123  PHE D CA    1 
ATOM   3218  C  C     . PHE B  1 129  ? 183.414 197.458 227.899 1.00 50.40  ? 123  PHE D C     1 
ATOM   3219  O  O     . PHE B  1 129  ? 184.295 196.759 227.388 1.00 50.40  ? 123  PHE D O     1 
ATOM   3220  C  CB    . PHE B  1 129  ? 182.671 197.016 230.234 1.00 50.40  ? 123  PHE D CB    1 
ATOM   3221  C  CG    . PHE B  1 129  ? 182.993 195.578 230.105 1.00 50.40  ? 123  PHE D CG    1 
ATOM   3222  C  CD1   . PHE B  1 129  ? 184.132 195.066 230.681 1.00 50.40  ? 123  PHE D CD1   1 
ATOM   3223  C  CD2   . PHE B  1 129  ? 182.175 194.738 229.384 1.00 50.40  ? 123  PHE D CD2   1 
ATOM   3224  C  CE1   . PHE B  1 129  ? 184.441 193.739 230.555 1.00 50.40  ? 123  PHE D CE1   1 
ATOM   3225  C  CE2   . PHE B  1 129  ? 182.479 193.410 229.256 1.00 50.40  ? 123  PHE D CE2   1 
ATOM   3226  C  CZ    . PHE B  1 129  ? 183.614 192.912 229.840 1.00 50.40  ? 123  PHE D CZ    1 
ATOM   3227  N  N     . SER B  1 130  ? 182.333 197.839 227.226 1.00 53.04  ? 124  SER D N     1 
ATOM   3228  C  CA    . SER B  1 130  ? 182.177 197.450 225.832 1.00 53.04  ? 124  SER D CA    1 
ATOM   3229  C  C     . SER B  1 130  ? 183.279 198.043 224.982 1.00 53.04  ? 124  SER D C     1 
ATOM   3230  O  O     . SER B  1 130  ? 183.809 197.377 224.085 1.00 53.04  ? 124  SER D O     1 
ATOM   3231  C  CB    . SER B  1 130  ? 180.812 197.881 225.317 1.00 53.04  ? 124  SER D CB    1 
ATOM   3232  O  OG    . SER B  1 130  ? 179.796 197.194 226.018 1.00 53.04  ? 124  SER D OG    1 
ATOM   3233  N  N     . ILE B  1 131  ? 183.647 199.294 225.252 1.00 53.23  ? 125  ILE D N     1 
ATOM   3234  C  CA    . ILE B  1 131  ? 184.732 199.906 224.495 1.00 53.23  ? 125  ILE D CA    1 
ATOM   3235  C  C     . ILE B  1 131  ? 186.036 199.175 224.759 1.00 53.23  ? 125  ILE D C     1 
ATOM   3236  O  O     . ILE B  1 131  ? 186.791 198.870 223.831 1.00 53.23  ? 125  ILE D O     1 
ATOM   3237  C  CB    . ILE B  1 131  ? 184.851 201.401 224.821 1.00 53.23  ? 125  ILE D CB    1 
ATOM   3238  C  CG1   . ILE B  1 131  ? 183.621 202.152 224.332 1.00 53.23  ? 125  ILE D CG1   1 
ATOM   3239  C  CG2   . ILE B  1 131  ? 186.085 201.978 224.185 1.00 53.23  ? 125  ILE D CG2   1 
ATOM   3240  C  CD1   . ILE B  1 131  ? 183.628 203.599 224.724 1.00 53.23  ? 125  ILE D CD1   1 
ATOM   3241  N  N     . GLU B  1 132  ? 186.316 198.870 226.024 1.00 59.49  ? 126  GLU D N     1 
ATOM   3242  C  CA    . GLU B  1 132  ? 187.532 198.137 226.346 1.00 59.49  ? 126  GLU D CA    1 
ATOM   3243  C  C     . GLU B  1 132  ? 187.581 196.804 225.629 1.00 59.49  ? 126  GLU D C     1 
ATOM   3244  O  O     . GLU B  1 132  ? 188.634 196.414 225.115 1.00 59.49  ? 126  GLU D O     1 
ATOM   3245  C  CB    . GLU B  1 132  ? 187.633 197.908 227.845 1.00 59.49  ? 126  GLU D CB    1 
ATOM   3246  C  CG    . GLU B  1 132  ? 187.807 199.166 228.648 1.00 59.49  ? 126  GLU D CG    1 
ATOM   3247  C  CD    . GLU B  1 132  ? 187.852 198.877 230.122 1.00 59.49  ? 126  GLU D CD    1 
ATOM   3248  O  OE1   . GLU B  1 132  ? 187.677 197.699 230.489 1.00 59.49  ? 126  GLU D OE1   1 
ATOM   3249  O  OE2   . GLU B  1 132  ? 188.038 199.818 230.914 1.00 59.49  ? 126  GLU D OE2   1 
ATOM   3250  N  N     . VAL B  1 133  ? 186.459 196.100 225.573 1.00 49.65  ? 127  VAL D N     1 
ATOM   3251  C  CA    . VAL B  1 133  ? 186.419 194.788 224.951 1.00 49.65  ? 127  VAL D CA    1 
ATOM   3252  C  C     . VAL B  1 133  ? 186.642 194.912 223.457 1.00 49.65  ? 127  VAL D C     1 
ATOM   3253  O  O     . VAL B  1 133  ? 187.605 194.363 222.914 1.00 49.65  ? 127  VAL D O     1 
ATOM   3254  C  CB    . VAL B  1 133  ? 185.087 194.084 225.235 1.00 49.65  ? 127  VAL D CB    1 
ATOM   3255  C  CG1   . VAL B  1 133  ? 184.991 192.825 224.411 1.00 49.65  ? 127  VAL D CG1   1 
ATOM   3256  C  CG2   . VAL B  1 133  ? 184.983 193.760 226.702 1.00 49.65  ? 127  VAL D CG2   1 
ATOM   3257  N  N     . GLN B  1 134  ? 185.760 195.640 222.779 1.00 56.57  ? 128  GLN D N     1 
ATOM   3258  C  CA    . GLN B  1 134  ? 185.758 195.603 221.325 1.00 56.57  ? 128  GLN D CA    1 
ATOM   3259  C  C     . GLN B  1 134  ? 186.993 196.278 220.742 1.00 56.57  ? 128  GLN D C     1 
ATOM   3260  O  O     . GLN B  1 134  ? 187.482 195.876 219.682 1.00 56.57  ? 128  GLN D O     1 
ATOM   3261  C  CB    . GLN B  1 134  ? 184.479 196.234 220.793 1.00 56.57  ? 128  GLN D CB    1 
ATOM   3262  C  CG    . GLN B  1 134  ? 184.384 196.212 219.297 1.00 56.57  ? 128  GLN D CG    1 
ATOM   3263  C  CD    . GLN B  1 134  ? 183.018 196.594 218.812 1.00 56.57  ? 128  GLN D CD    1 
ATOM   3264  O  OE1   . GLN B  1 134  ? 182.107 196.820 219.602 1.00 56.57  ? 128  GLN D OE1   1 
ATOM   3265  N  NE2   . GLN B  1 134  ? 182.865 196.677 217.499 1.00 56.57  ? 128  GLN D NE2   1 
ATOM   3266  N  N     . VAL B  1 135  ? 187.524 197.294 221.421 1.00 49.86  ? 129  VAL D N     1 
ATOM   3267  C  CA    . VAL B  1 135  ? 188.766 197.910 220.958 1.00 49.86  ? 129  VAL D CA    1 
ATOM   3268  C  C     . VAL B  1 135  ? 189.982 197.112 221.399 1.00 49.86  ? 129  VAL D C     1 
ATOM   3269  O  O     . VAL B  1 135  ? 191.108 197.441 221.013 1.00 49.86  ? 129  VAL D O     1 
ATOM   3270  C  CB    . VAL B  1 135  ? 188.781 199.373 221.438 1.00 49.86  ? 129  VAL D CB    1 
ATOM   3271  C  CG1   . VAL B  1 135  ? 190.011 200.109 220.966 1.00 49.86  ? 129  VAL D CG1   1 
ATOM   3272  C  CG2   . VAL B  1 135  ? 187.550 200.072 220.943 1.00 49.86  ? 129  VAL D CG2   1 
ATOM   3273  N  N     . THR B  1 136  ? 189.774 196.045 222.171 1.00 53.20  ? 130  THR D N     1 
ATOM   3274  C  CA    . THR B  1 136  ? 190.842 195.147 222.614 1.00 53.20  ? 130  THR D CA    1 
ATOM   3275  C  C     . THR B  1 136  ? 191.795 195.844 223.576 1.00 53.20  ? 130  THR D C     1 
ATOM   3276  O  O     . THR B  1 136  ? 192.998 195.580 223.585 1.00 53.20  ? 130  THR D O     1 
ATOM   3277  C  CB    . THR B  1 136  ? 191.619 194.558 221.437 1.00 53.20  ? 130  THR D CB    1 
ATOM   3278  O  OG1   . THR B  1 136  ? 192.337 195.600 220.770 1.00 53.20  ? 130  THR D OG1   1 
ATOM   3279  C  CG2   . THR B  1 136  ? 190.672 193.907 220.454 1.00 53.20  ? 130  THR D CG2   1 
ATOM   3280  N  N     . ILE B  1 137  ? 191.257 196.741 224.397 1.00 51.55  ? 131  ILE D N     1 
ATOM   3281  C  CA    . ILE B  1 137  ? 192.078 197.438 225.374 1.00 51.55  ? 131  ILE D CA    1 
ATOM   3282  C  C     . ILE B  1 137  ? 192.116 196.634 226.662 1.00 51.55  ? 131  ILE D C     1 
ATOM   3283  O  O     . ILE B  1 137  ? 193.175 196.149 227.073 1.00 51.55  ? 131  ILE D O     1 
ATOM   3284  C  CB    . ILE B  1 137  ? 191.544 198.852 225.635 1.00 51.55  ? 131  ILE D CB    1 
ATOM   3285  C  CG1   . ILE B  1 137  ? 191.649 199.692 224.366 1.00 51.55  ? 131  ILE D CG1   1 
ATOM   3286  C  CG2   . ILE B  1 137  ? 192.310 199.505 226.748 1.00 51.55  ? 131  ILE D CG2   1 
ATOM   3287  C  CD1   . ILE B  1 137  ? 190.954 201.015 224.476 1.00 51.55  ? 131  ILE D CD1   1 
ATOM   3288  N  N     . GLY B  1 138  ? 190.960 196.470 227.297 1.00 55.85  ? 132  GLY D N     1 
ATOM   3289  C  CA    . GLY B  1 138  ? 190.863 195.631 228.473 1.00 55.85  ? 132  GLY D CA    1 
ATOM   3290  C  C     . GLY B  1 138  ? 191.732 196.069 229.628 1.00 55.85  ? 132  GLY D C     1 
ATOM   3291  O  O     . GLY B  1 138  ? 192.723 195.403 229.940 1.00 55.85  ? 132  GLY D O     1 
ATOM   3292  N  N     . PHE B  1 139  ? 191.398 197.193 230.257 1.00 57.83  ? 133  PHE D N     1 
ATOM   3293  C  CA    . PHE B  1 139  ? 192.193 197.684 231.375 1.00 57.83  ? 133  PHE D CA    1 
ATOM   3294  C  C     . PHE B  1 139  ? 192.284 196.654 232.489 1.00 57.83  ? 133  PHE D C     1 
ATOM   3295  O  O     . PHE B  1 139  ? 193.384 196.298 232.918 1.00 57.83  ? 133  PHE D O     1 
ATOM   3296  C  CB    . PHE B  1 139  ? 191.627 198.993 231.911 1.00 57.83  ? 133  PHE D CB    1 
ATOM   3297  C  CG    . PHE B  1 139  ? 191.842 200.151 230.998 1.00 57.83  ? 133  PHE D CG    1 
ATOM   3298  C  CD1   . PHE B  1 139  ? 193.084 200.735 230.898 1.00 57.83  ? 133  PHE D CD1   1 
ATOM   3299  C  CD2   . PHE B  1 139  ? 190.808 200.660 230.247 1.00 57.83  ? 133  PHE D CD2   1 
ATOM   3300  C  CE1   . PHE B  1 139  ? 193.292 201.795 230.060 1.00 57.83  ? 133  PHE D CE1   1 
ATOM   3301  C  CE2   . PHE B  1 139  ? 191.008 201.725 229.411 1.00 57.83  ? 133  PHE D CE2   1 
ATOM   3302  C  CZ    . PHE B  1 139  ? 192.250 202.292 229.316 1.00 57.83  ? 133  PHE D CZ    1 
ATOM   3303  N  N     . GLY B  1 140  ? 191.146 196.169 232.967 1.00 58.40  ? 134  GLY D N     1 
ATOM   3304  C  CA    . GLY B  1 140  ? 191.181 195.107 233.947 1.00 58.40  ? 134  GLY D CA    1 
ATOM   3305  C  C     . GLY B  1 140  ? 190.343 195.376 235.175 1.00 58.40  ? 134  GLY D C     1 
ATOM   3306  O  O     . GLY B  1 140  ? 189.932 194.442 235.868 1.00 58.40  ? 134  GLY D O     1 
ATOM   3307  N  N     . GLY B  1 141  ? 190.097 196.654 235.463 1.00 61.91  ? 135  GLY D N     1 
ATOM   3308  C  CA    . GLY B  1 141  ? 189.249 196.998 236.586 1.00 61.91  ? 135  GLY D CA    1 
ATOM   3309  C  C     . GLY B  1 141  ? 187.840 196.474 236.453 1.00 61.91  ? 135  GLY D C     1 
ATOM   3310  O  O     . GLY B  1 141  ? 187.161 196.271 237.465 1.00 61.91  ? 135  GLY D O     1 
ATOM   3311  N  N     . ARG B  1 142  ? 187.383 196.247 235.229 1.00 56.99  ? 136  ARG D N     1 
ATOM   3312  C  CA    . ARG B  1 142  ? 186.072 195.679 234.969 1.00 56.99  ? 136  ARG D CA    1 
ATOM   3313  C  C     . ARG B  1 142  ? 186.247 194.502 234.019 1.00 56.99  ? 136  ARG D C     1 
ATOM   3314  O  O     . ARG B  1 142  ? 186.625 194.682 232.858 1.00 56.99  ? 136  ARG D O     1 
ATOM   3315  C  CB    . ARG B  1 142  ? 185.133 196.757 234.426 1.00 56.99  ? 136  ARG D CB    1 
ATOM   3316  C  CG    . ARG B  1 142  ? 185.624 197.480 233.197 1.00 56.99  ? 136  ARG D CG    1 
ATOM   3317  C  CD    . ARG B  1 142  ? 184.764 198.689 232.920 1.00 56.99  ? 136  ARG D CD    1 
ATOM   3318  N  NE    . ARG B  1 142  ? 184.882 199.649 234.012 1.00 56.99  ? 136  ARG D NE    1 
ATOM   3319  C  CZ    . ARG B  1 142  ? 185.840 200.564 234.096 1.00 56.99  ? 136  ARG D CZ    1 
ATOM   3320  N  NH1   . ARG B  1 142  ? 186.762 200.642 233.150 1.00 56.99  ? 136  ARG D NH1   1 
ATOM   3321  N  NH2   . ARG B  1 142  ? 185.885 201.395 235.123 1.00 56.99  ? 136  ARG D NH2   1 
ATOM   3322  N  N     . MET B  1 143  ? 185.995 193.298 234.528 1.00 63.26  ? 137  MET D N     1 
ATOM   3323  C  CA    . MET B  1 143  ? 186.501 192.083 233.909 1.00 63.26  ? 137  MET D CA    1 
ATOM   3324  C  C     . MET B  1 143  ? 185.450 190.987 233.967 1.00 63.26  ? 137  MET D C     1 
ATOM   3325  O  O     . MET B  1 143  ? 184.714 190.864 234.949 1.00 63.26  ? 137  MET D O     1 
ATOM   3326  C  CB    . MET B  1 143  ? 187.782 191.629 234.614 1.00 63.26  ? 137  MET D CB    1 
ATOM   3327  C  CG    . MET B  1 143  ? 188.383 190.348 234.104 1.00 63.26  ? 137  MET D CG    1 
ATOM   3328  S  SD    . MET B  1 143  ? 189.908 190.019 234.992 1.00 63.26  ? 137  MET D SD    1 
ATOM   3329  C  CE    . MET B  1 143  ? 189.273 189.695 236.631 1.00 63.26  ? 137  MET D CE    1 
ATOM   3330  N  N     . VAL B  1 144  ? 185.398 190.184 232.904 1.00 64.20  ? 138  VAL D N     1 
ATOM   3331  C  CA    . VAL B  1 144  ? 184.430 189.096 232.834 1.00 64.20  ? 138  VAL D CA    1 
ATOM   3332  C  C     . VAL B  1 144  ? 184.797 188.022 233.847 1.00 64.20  ? 138  VAL D C     1 
ATOM   3333  O  O     . VAL B  1 144  ? 185.978 187.759 234.101 1.00 64.20  ? 138  VAL D O     1 
ATOM   3334  C  CB    . VAL B  1 144  ? 184.376 188.517 231.413 1.00 64.20  ? 138  VAL D CB    1 
ATOM   3335  C  CG1   . VAL B  1 144  ? 183.357 187.406 231.332 1.00 64.20  ? 138  VAL D CG1   1 
ATOM   3336  C  CG2   . VAL B  1 144  ? 184.053 189.597 230.423 1.00 64.20  ? 138  VAL D CG2   1 
ATOM   3337  N  N     . THR B  1 145  ? 183.781 187.402 234.437 1.00 64.16  ? 139  THR D N     1 
ATOM   3338  C  CA    . THR B  1 145  ? 183.968 186.373 235.443 1.00 64.16  ? 139  THR D CA    1 
ATOM   3339  C  C     . THR B  1 145  ? 183.226 185.119 235.007 1.00 64.16  ? 139  THR D C     1 
ATOM   3340  O  O     . THR B  1 145  ? 182.311 185.191 234.183 1.00 64.16  ? 139  THR D O     1 
ATOM   3341  C  CB    . THR B  1 145  ? 183.453 186.855 236.800 1.00 64.16  ? 139  THR D CB    1 
ATOM   3342  O  OG1   . THR B  1 145  ? 184.013 188.142 237.077 1.00 64.16  ? 139  THR D OG1   1 
ATOM   3343  C  CG2   . THR B  1 145  ? 183.883 185.911 237.909 1.00 64.16  ? 139  THR D CG2   1 
ATOM   3344  N  N     . GLU B  1 146  ? 183.622 183.973 235.555 1.00 65.72  ? 140  GLU D N     1 
ATOM   3345  C  CA    . GLU B  1 146  ? 182.975 182.706 235.242 1.00 65.72  ? 140  GLU D CA    1 
ATOM   3346  C  C     . GLU B  1 146  ? 181.544 182.628 235.738 1.00 65.72  ? 140  GLU D C     1 
ATOM   3347  O  O     . GLU B  1 146  ? 180.830 181.694 235.361 1.00 65.72  ? 140  GLU D O     1 
ATOM   3348  C  CB    . GLU B  1 146  ? 183.773 181.552 235.846 1.00 65.72  ? 140  GLU D CB    1 
ATOM   3349  C  CG    . GLU B  1 146  ? 185.163 181.406 235.286 1.00 65.72  ? 140  GLU D CG    1 
ATOM   3350  C  CD    . GLU B  1 146  ? 186.129 182.370 235.927 1.00 65.72  ? 140  GLU D CD    1 
ATOM   3351  O  OE1   . GLU B  1 146  ? 185.706 183.105 236.843 1.00 65.72  ? 140  GLU D OE1   1 
ATOM   3352  O  OE2   . GLU B  1 146  ? 187.305 182.398 235.517 1.00 65.72  ? 140  GLU D OE2   1 
ATOM   3353  N  N     . GLU B  1 147  ? 181.103 183.570 236.566 1.00 76.78  ? 141  GLU D N     1 
ATOM   3354  C  CA    . GLU B  1 147  ? 179.806 183.444 237.213 1.00 76.78  ? 141  GLU D CA    1 
ATOM   3355  C  C     . GLU B  1 147  ? 178.640 183.509 236.243 1.00 76.78  ? 141  GLU D C     1 
ATOM   3356  O  O     . GLU B  1 147  ? 177.515 183.191 236.644 1.00 76.78  ? 141  GLU D O     1 
ATOM   3357  C  CB    . GLU B  1 147  ? 179.655 184.526 238.278 1.00 76.78  ? 141  GLU D CB    1 
ATOM   3358  C  CG    . GLU B  1 147  ? 180.662 184.406 239.402 1.00 76.78  ? 141  GLU D CG    1 
ATOM   3359  C  CD    . GLU B  1 147  ? 180.496 183.130 240.192 1.00 76.78  ? 141  GLU D CD    1 
ATOM   3360  O  OE1   . GLU B  1 147  ? 179.351 182.650 240.312 1.00 76.78  ? 141  GLU D OE1   1 
ATOM   3361  O  OE2   . GLU B  1 147  ? 181.512 182.604 240.691 1.00 76.78  ? 141  GLU D OE2   1 
ATOM   3362  N  N     . CYS B  1 148  ? 178.865 183.897 234.997 1.00 70.19  ? 142  CYS D N     1 
ATOM   3363  C  CA    . CYS B  1 148  ? 177.768 183.972 234.043 1.00 70.19  ? 142  CYS D CA    1 
ATOM   3364  C  C     . CYS B  1 148  ? 178.214 183.447 232.689 1.00 70.19  ? 142  CYS D C     1 
ATOM   3365  O  O     . CYS B  1 148  ? 178.848 184.177 231.915 1.00 70.19  ? 142  CYS D O     1 
ATOM   3366  C  CB    . CYS B  1 148  ? 177.266 185.408 233.919 1.00 70.19  ? 142  CYS D CB    1 
ATOM   3367  S  SG    . CYS B  1 148  ? 176.594 186.046 235.448 1.00 70.19  ? 142  CYS D SG    1 
ATOM   3368  N  N     . PRO B  1 149  ? 177.908 182.192 232.367 1.00 55.35  ? 143  PRO D N     1 
ATOM   3369  C  CA    . PRO B  1 149  ? 178.254 181.684 231.036 1.00 55.35  ? 143  PRO D CA    1 
ATOM   3370  C  C     . PRO B  1 149  ? 177.579 182.454 229.922 1.00 55.35  ? 143  PRO D C     1 
ATOM   3371  O  O     . PRO B  1 149  ? 178.150 182.592 228.832 1.00 55.35  ? 143  PRO D O     1 
ATOM   3372  C  CB    . PRO B  1 149  ? 177.782 180.228 231.086 1.00 55.35  ? 143  PRO D CB    1 
ATOM   3373  C  CG    . PRO B  1 149  ? 176.717 180.224 232.124 1.00 55.35  ? 143  PRO D CG    1 
ATOM   3374  C  CD    . PRO B  1 149  ? 177.131 181.225 233.149 1.00 55.35  ? 143  PRO D CD    1 
ATOM   3375  N  N     . LEU B  1 150  ? 176.378 182.969 230.167 1.00 53.21  ? 144  LEU D N     1 
ATOM   3376  C  CA    . LEU B  1 150  ? 175.728 183.816 229.180 1.00 53.21  ? 144  LEU D CA    1 
ATOM   3377  C  C     . LEU B  1 150  ? 176.577 185.046 228.895 1.00 53.21  ? 144  LEU D C     1 
ATOM   3378  O  O     . LEU B  1 150  ? 176.663 185.502 227.747 1.00 53.21  ? 144  LEU D O     1 
ATOM   3379  C  CB    . LEU B  1 150  ? 174.344 184.208 229.690 1.00 53.21  ? 144  LEU D CB    1 
ATOM   3380  C  CG    . LEU B  1 150  ? 173.288 184.673 228.691 1.00 53.21  ? 144  LEU D CG    1 
ATOM   3381  C  CD1   . LEU B  1 150  ? 173.535 186.077 228.185 1.00 53.21  ? 144  LEU D CD1   1 
ATOM   3382  C  CD2   . LEU B  1 150  ? 173.235 183.687 227.546 1.00 53.21  ? 144  LEU D CD2   1 
ATOM   3383  N  N     . ALA B  1 151  ? 177.224 185.588 229.926 1.00 52.40  ? 145  ALA D N     1 
ATOM   3384  C  CA    . ALA B  1 151  ? 178.131 186.707 229.716 1.00 52.40  ? 145  ALA D CA    1 
ATOM   3385  C  C     . ALA B  1 151  ? 179.320 186.289 228.868 1.00 52.40  ? 145  ALA D C     1 
ATOM   3386  O  O     . ALA B  1 151  ? 179.828 187.077 228.065 1.00 52.40  ? 145  ALA D O     1 
ATOM   3387  C  CB    . ALA B  1 151  ? 178.596 187.265 231.058 1.00 52.40  ? 145  ALA D CB    1 
ATOM   3388  N  N     . ILE B  1 152  ? 179.770 185.048 229.022 1.00 54.25  ? 146  ILE D N     1 
ATOM   3389  C  CA    . ILE B  1 152  ? 180.845 184.555 228.176 1.00 54.25  ? 146  ILE D CA    1 
ATOM   3390  C  C     . ILE B  1 152  ? 180.393 184.501 226.729 1.00 54.25  ? 146  ILE D C     1 
ATOM   3391  O  O     . ILE B  1 152  ? 181.148 184.841 225.808 1.00 54.25  ? 146  ILE D O     1 
ATOM   3392  C  CB    . ILE B  1 152  ? 181.311 183.179 228.672 1.00 54.25  ? 146  ILE D CB    1 
ATOM   3393  C  CG1   . ILE B  1 152  ? 181.829 183.295 230.097 1.00 54.25  ? 146  ILE D CG1   1 
ATOM   3394  C  CG2   . ILE B  1 152  ? 182.385 182.639 227.775 1.00 54.25  ? 146  ILE D CG2   1 
ATOM   3395  C  CD1   . ILE B  1 152  ? 182.015 181.973 230.762 1.00 54.25  ? 146  ILE D CD1   1 
ATOM   3396  N  N     . LEU B  1 153  ? 179.155 184.067 226.505 1.00 54.06  ? 147  LEU D N     1 
ATOM   3397  C  CA    . LEU B  1 153  ? 178.604 184.097 225.158 1.00 54.06  ? 147  LEU D CA    1 
ATOM   3398  C  C     . LEU B  1 153  ? 178.597 185.510 224.603 1.00 54.06  ? 147  LEU D C     1 
ATOM   3399  O  O     . LEU B  1 153  ? 178.983 185.733 223.453 1.00 54.06  ? 147  LEU D O     1 
ATOM   3400  C  CB    . LEU B  1 153  ? 177.193 183.529 225.150 1.00 54.06  ? 147  LEU D CB    1 
ATOM   3401  C  CG    . LEU B  1 153  ? 176.590 183.599 223.754 1.00 54.06  ? 147  LEU D CG    1 
ATOM   3402  C  CD1   . LEU B  1 153  ? 177.438 182.792 222.789 1.00 54.06  ? 147  LEU D CD1   1 
ATOM   3403  C  CD2   . LEU B  1 153  ? 175.157 183.107 223.765 1.00 54.06  ? 147  LEU D CD2   1 
ATOM   3404  N  N     . ILE B  1 154  ? 178.137 186.471 225.400 1.00 54.34  ? 148  ILE D N     1 
ATOM   3405  C  CA    . ILE B  1 154  ? 178.151 187.856 224.945 1.00 54.34  ? 148  ILE D CA    1 
ATOM   3406  C  C     . ILE B  1 154  ? 179.558 188.297 224.594 1.00 54.34  ? 148  ILE D C     1 
ATOM   3407  O  O     . ILE B  1 154  ? 179.765 188.993 223.598 1.00 54.34  ? 148  ILE D O     1 
ATOM   3408  C  CB    . ILE B  1 154  ? 177.528 188.776 226.004 1.00 54.34  ? 148  ILE D CB    1 
ATOM   3409  C  CG1   . ILE B  1 154  ? 176.031 188.530 226.080 1.00 54.34  ? 148  ILE D CG1   1 
ATOM   3410  C  CG2   . ILE B  1 154  ? 177.755 190.213 225.644 1.00 54.34  ? 148  ILE D CG2   1 
ATOM   3411  C  CD1   . ILE B  1 154  ? 175.329 188.888 224.797 1.00 54.34  ? 148  ILE D CD1   1 
ATOM   3412  N  N     . LEU B  1 155  ? 180.543 187.915 225.402 1.00 50.38  ? 149  LEU D N     1 
ATOM   3413  C  CA    . LEU B  1 155  ? 181.921 188.271 225.099 1.00 50.38  ? 149  LEU D CA    1 
ATOM   3414  C  C     . LEU B  1 155  ? 182.347 187.719 223.751 1.00 50.38  ? 149  LEU D C     1 
ATOM   3415  O  O     . LEU B  1 155  ? 182.930 188.440 222.929 1.00 50.38  ? 149  LEU D O     1 
ATOM   3416  C  CB    . LEU B  1 155  ? 182.845 187.753 226.191 1.00 50.38  ? 149  LEU D CB    1 
ATOM   3417  C  CG    . LEU B  1 155  ? 184.304 188.067 225.899 1.00 50.38  ? 149  LEU D CG    1 
ATOM   3418  C  CD1   . LEU B  1 155  ? 184.484 189.557 225.826 1.00 50.38  ? 149  LEU D CD1   1 
ATOM   3419  C  CD2   . LEU B  1 155  ? 185.189 187.471 226.962 1.00 50.38  ? 149  LEU D CD2   1 
ATOM   3420  N  N     . ILE B  1 156  ? 182.087 186.435 223.517 1.00 56.45  ? 150  ILE D N     1 
ATOM   3421  C  CA    . ILE B  1 156  ? 182.452 185.821 222.245 1.00 56.45  ? 150  ILE D CA    1 
ATOM   3422  C  C     . ILE B  1 156  ? 181.776 186.552 221.099 1.00 56.45  ? 150  ILE D C     1 
ATOM   3423  O  O     . ILE B  1 156  ? 182.397 186.856 220.071 1.00 56.45  ? 150  ILE D O     1 
ATOM   3424  C  CB    . ILE B  1 156  ? 182.083 184.331 222.245 1.00 56.45  ? 150  ILE D CB    1 
ATOM   3425  C  CG1   . ILE B  1 156  ? 182.913 183.579 223.276 1.00 56.45  ? 150  ILE D CG1   1 
ATOM   3426  C  CG2   . ILE B  1 156  ? 182.283 183.738 220.877 1.00 56.45  ? 150  ILE D CG2   1 
ATOM   3427  C  CD1   . ILE B  1 156  ? 182.455 182.176 223.489 1.00 56.45  ? 150  ILE D CD1   1 
ATOM   3428  N  N     . VAL B  1 157  ? 180.489 186.844 221.263 1.00 55.36  ? 151  VAL D N     1 
ATOM   3429  C  CA    . VAL B  1 157  ? 179.735 187.518 220.221 1.00 55.36  ? 151  VAL D CA    1 
ATOM   3430  C  C     . VAL B  1 157  ? 180.348 188.869 219.914 1.00 55.36  ? 151  VAL D C     1 
ATOM   3431  O  O     . VAL B  1 157  ? 180.536 189.232 218.749 1.00 55.36  ? 151  VAL D O     1 
ATOM   3432  C  CB    . VAL B  1 157  ? 178.264 187.652 220.634 1.00 55.36  ? 151  VAL D CB    1 
ATOM   3433  C  CG1   . VAL B  1 157  ? 177.535 188.521 219.644 1.00 55.36  ? 151  VAL D CG1   1 
ATOM   3434  C  CG2   . VAL B  1 157  ? 177.629 186.292 220.703 1.00 55.36  ? 151  VAL D CG2   1 
ATOM   3435  N  N     . GLN B  1 158  ? 180.665 189.641 220.950 1.00 52.49  ? 152  GLN D N     1 
ATOM   3436  C  CA    . GLN B  1 158  ? 181.166 190.981 220.696 1.00 52.49  ? 152  GLN D CA    1 
ATOM   3437  C  C     . GLN B  1 158  ? 182.549 190.933 220.079 1.00 52.49  ? 152  GLN D C     1 
ATOM   3438  O  O     . GLN B  1 158  ? 182.879 191.765 219.235 1.00 52.49  ? 152  GLN D O     1 
ATOM   3439  C  CB    . GLN B  1 158  ? 181.177 191.822 221.967 1.00 52.49  ? 152  GLN D CB    1 
ATOM   3440  C  CG    . GLN B  1 158  ? 181.553 193.264 221.670 1.00 52.49  ? 152  GLN D CG    1 
ATOM   3441  C  CD    . GLN B  1 158  ? 181.406 194.182 222.851 1.00 52.49  ? 152  GLN D CD    1 
ATOM   3442  O  OE1   . GLN B  1 158  ? 181.076 193.750 223.951 1.00 52.49  ? 152  GLN D OE1   1 
ATOM   3443  N  NE2   . GLN B  1 158  ? 181.627 195.466 222.624 1.00 52.49  ? 152  GLN D NE2   1 
ATOM   3444  N  N     . ASN B  1 159  ? 183.361 189.947 220.451 1.00 55.08  ? 153  ASN D N     1 
ATOM   3445  C  CA    . ASN B  1 159  ? 184.677 189.848 219.836 1.00 55.08  ? 153  ASN D CA    1 
ATOM   3446  C  C     . ASN B  1 159  ? 184.570 189.495 218.363 1.00 55.08  ? 153  ASN D C     1 
ATOM   3447  O  O     . ASN B  1 159  ? 185.260 190.086 217.525 1.00 55.08  ? 153  ASN D O     1 
ATOM   3448  C  CB    . ASN B  1 159  ? 185.522 188.826 220.574 1.00 55.08  ? 153  ASN D CB    1 
ATOM   3449  C  CG    . ASN B  1 159  ? 185.985 189.330 221.905 1.00 55.08  ? 153  ASN D CG    1 
ATOM   3450  O  OD1   . ASN B  1 159  ? 186.398 190.480 222.029 1.00 55.08  ? 153  ASN D OD1   1 
ATOM   3451  N  ND2   . ASN B  1 159  ? 185.905 188.486 222.918 1.00 55.08  ? 153  ASN D ND2   1 
ATOM   3452  N  N     . ILE B  1 160  ? 183.707 188.538 218.029 1.00 62.21  ? 154  ILE D N     1 
ATOM   3453  C  CA    . ILE B  1 160  ? 183.532 188.161 216.629 1.00 62.21  ? 154  ILE D CA    1 
ATOM   3454  C  C     . ILE B  1 160  ? 183.013 189.339 215.823 1.00 62.21  ? 154  ILE D C     1 
ATOM   3455  O  O     . ILE B  1 160  ? 183.519 189.649 214.737 1.00 62.21  ? 154  ILE D O     1 
ATOM   3456  C  CB    . ILE B  1 160  ? 182.592 186.953 216.513 1.00 62.21  ? 154  ILE D CB    1 
ATOM   3457  C  CG1   . ILE B  1 160  ? 183.271 185.704 217.058 1.00 62.21  ? 154  ILE D CG1   1 
ATOM   3458  C  CG2   . ILE B  1 160  ? 182.151 186.772 215.083 1.00 62.21  ? 154  ILE D CG2   1 
ATOM   3459  C  CD1   . ILE B  1 160  ? 182.341 184.544 217.205 1.00 62.21  ? 154  ILE D CD1   1 
ATOM   3460  N  N     . VAL B  1 161  ? 181.978 190.001 216.335 1.00 61.46  ? 155  VAL D N     1 
ATOM   3461  C  CA    . VAL B  1 161  ? 181.435 191.157 215.642 1.00 61.46  ? 155  VAL D CA    1 
ATOM   3462  C  C     . VAL B  1 161  ? 182.483 192.245 215.509 1.00 61.46  ? 155  VAL D C     1 
ATOM   3463  O  O     . VAL B  1 161  ? 182.581 192.893 214.464 1.00 61.46  ? 155  VAL D O     1 
ATOM   3464  C  CB    . VAL B  1 161  ? 180.185 191.666 216.373 1.00 61.46  ? 155  VAL D CB    1 
ATOM   3465  C  CG1   . VAL B  1 161  ? 179.707 192.953 215.751 1.00 61.46  ? 155  VAL D CG1   1 
ATOM   3466  C  CG2   . VAL B  1 161  ? 179.102 190.620 216.312 1.00 61.46  ? 155  VAL D CG2   1 
ATOM   3467  N  N     . GLY B  1 162  ? 183.285 192.463 216.548 1.00 66.95  ? 156  GLY D N     1 
ATOM   3468  C  CA    . GLY B  1 162  ? 184.309 193.483 216.473 1.00 66.95  ? 156  GLY D CA    1 
ATOM   3469  C  C     . GLY B  1 162  ? 185.331 193.181 215.398 1.00 66.95  ? 156  GLY D C     1 
ATOM   3470  O  O     . GLY B  1 162  ? 185.719 194.063 214.633 1.00 66.95  ? 156  GLY D O     1 
ATOM   3471  N  N     . LEU B  1 163  ? 185.757 191.925 215.308 1.00 74.95  ? 157  LEU D N     1 
ATOM   3472  C  CA    . LEU B  1 163  ? 186.729 191.583 214.278 1.00 74.95  ? 157  LEU D CA    1 
ATOM   3473  C  C     . LEU B  1 163  ? 186.127 191.712 212.888 1.00 74.95  ? 157  LEU D C     1 
ATOM   3474  O  O     . LEU B  1 163  ? 186.775 192.231 211.972 1.00 74.95  ? 157  LEU D O     1 
ATOM   3475  C  CB    . LEU B  1 163  ? 187.273 190.181 214.505 1.00 74.95  ? 157  LEU D CB    1 
ATOM   3476  C  CG    . LEU B  1 163  ? 188.133 190.149 215.762 1.00 74.95  ? 157  LEU D CG    1 
ATOM   3477  C  CD1   . LEU B  1 163  ? 188.686 188.761 216.030 1.00 74.95  ? 157  LEU D CD1   1 
ATOM   3478  C  CD2   . LEU B  1 163  ? 189.248 191.170 215.641 1.00 74.95  ? 157  LEU D CD2   1 
ATOM   3479  N  N     . MET B  1 164  ? 184.884 191.266 212.713 1.00 76.49  ? 158  MET D N     1 
ATOM   3480  C  CA    . MET B  1 164  ? 184.248 191.368 211.405 1.00 76.49  ? 158  MET D CA    1 
ATOM   3481  C  C     . MET B  1 164  ? 184.097 192.821 210.984 1.00 76.49  ? 158  MET D C     1 
ATOM   3482  O  O     . MET B  1 164  ? 184.465 193.197 209.863 1.00 76.49  ? 158  MET D O     1 
ATOM   3483  C  CB    . MET B  1 164  ? 182.893 190.667 211.430 1.00 76.49  ? 158  MET D CB    1 
ATOM   3484  C  CG    . MET B  1 164  ? 182.973 189.150 211.519 1.00 76.49  ? 158  MET D CG    1 
ATOM   3485  S  SD    . MET B  1 164  ? 183.710 188.399 210.050 1.00 76.49  ? 158  MET D SD    1 
ATOM   3486  C  CE    . MET B  1 164  ? 185.342 187.964 210.641 1.00 76.49  ? 158  MET D CE    1 
ATOM   3487  N  N     . ILE B  1 165  ? 183.561 193.656 211.872 1.00 77.86  ? 159  ILE D N     1 
ATOM   3488  C  CA    . ILE B  1 165  ? 183.368 195.054 211.527 1.00 77.86  ? 159  ILE D CA    1 
ATOM   3489  C  C     . ILE B  1 165  ? 184.704 195.738 211.320 1.00 77.86  ? 159  ILE D C     1 
ATOM   3490  O  O     . ILE B  1 165  ? 184.835 196.595 210.443 1.00 77.86  ? 159  ILE D O     1 
ATOM   3491  C  CB    . ILE B  1 165  ? 182.528 195.767 212.600 1.00 77.86  ? 159  ILE D CB    1 
ATOM   3492  C  CG1   . ILE B  1 165  ? 182.155 197.165 212.131 1.00 77.86  ? 159  ILE D CG1   1 
ATOM   3493  C  CG2   . ILE B  1 165  ? 183.273 195.880 213.899 1.00 77.86  ? 159  ILE D CG2   1 
ATOM   3494  C  CD1   . ILE B  1 165  ? 181.135 197.824 213.000 1.00 77.86  ? 159  ILE D CD1   1 
ATOM   3495  N  N     . ASN B  1 166  ? 185.725 195.358 212.082 1.00 78.43  ? 160  ASN D N     1 
ATOM   3496  C  CA    . ASN B  1 166  ? 187.017 195.998 211.920 1.00 78.43  ? 160  ASN D CA    1 
ATOM   3497  C  C     . ASN B  1 166  ? 187.613 195.661 210.567 1.00 78.43  ? 160  ASN D C     1 
ATOM   3498  O  O     . ASN B  1 166  ? 188.130 196.541 209.872 1.00 78.43  ? 160  ASN D O     1 
ATOM   3499  C  CB    . ASN B  1 166  ? 187.943 195.573 213.053 1.00 78.43  ? 160  ASN D CB    1 
ATOM   3500  C  CG    . ASN B  1 166  ? 189.194 196.399 213.113 1.00 78.43  ? 160  ASN D CG    1 
ATOM   3501  O  OD1   . ASN B  1 166  ? 189.401 197.284 212.289 1.00 78.43  ? 160  ASN D OD1   1 
ATOM   3502  N  ND2   . ASN B  1 166  ? 190.038 196.127 214.094 1.00 78.43  ? 160  ASN D ND2   1 
ATOM   3503  N  N     . ALA B  1 167  ? 187.523 194.396 210.162 1.00 84.18  ? 161  ALA D N     1 
ATOM   3504  C  CA    . ALA B  1 167  ? 188.047 194.006 208.860 1.00 84.18  ? 161  ALA D CA    1 
ATOM   3505  C  C     . ALA B  1 167  ? 187.279 194.679 207.737 1.00 84.18  ? 161  ALA D C     1 
ATOM   3506  O  O     . ALA B  1 167  ? 187.871 195.084 206.734 1.00 84.18  ? 161  ALA D O     1 
ATOM   3507  C  CB    . ALA B  1 167  ? 188.002 192.489 208.705 1.00 84.18  ? 161  ALA D CB    1 
ATOM   3508  N  N     . ILE B  1 168  ? 185.961 194.805 207.875 1.00 89.75  ? 162  ILE D N     1 
ATOM   3509  C  CA    . ILE B  1 168  ? 185.190 195.490 206.845 1.00 89.75  ? 162  ILE D CA    1 
ATOM   3510  C  C     . ILE B  1 168  ? 185.626 196.943 206.731 1.00 89.75  ? 162  ILE D C     1 
ATOM   3511  O  O     . ILE B  1 168  ? 185.896 197.446 205.633 1.00 89.75  ? 162  ILE D O     1 
ATOM   3512  C  CB    . ILE B  1 168  ? 183.685 195.371 207.129 1.00 89.75  ? 162  ILE D CB    1 
ATOM   3513  C  CG1   . ILE B  1 168  ? 183.227 193.924 206.968 1.00 89.75  ? 162  ILE D CG1   1 
ATOM   3514  C  CG2   . ILE B  1 168  ? 182.906 196.273 206.208 1.00 89.75  ? 162  ILE D CG2   1 
ATOM   3515  C  CD1   . ILE B  1 168  ? 183.400 193.397 205.566 1.00 89.75  ? 162  ILE D CD1   1 
ATOM   3516  N  N     . MET B  1 169  ? 185.698 197.640 207.868 1.00 102.48 ? 163  MET D N     1 
ATOM   3517  C  CA    . MET B  1 169  ? 186.123 199.033 207.842 1.00 102.48 ? 163  MET D CA    1 
ATOM   3518  C  C     . MET B  1 169  ? 187.509 199.168 207.244 1.00 102.48 ? 163  MET D C     1 
ATOM   3519  O  O     . MET B  1 169  ? 187.777 200.117 206.505 1.00 102.48 ? 163  MET D O     1 
ATOM   3520  C  CB    . MET B  1 169  ? 186.122 199.613 209.249 1.00 102.48 ? 163  MET D CB    1 
ATOM   3521  C  CG    . MET B  1 169  ? 184.794 199.528 209.974 1.00 102.48 ? 163  MET D CG    1 
ATOM   3522  S  SD    . MET B  1 169  ? 183.423 200.385 209.195 1.00 102.48 ? 163  MET D SD    1 
ATOM   3523  C  CE    . MET B  1 169  ? 182.527 199.021 208.453 1.00 102.48 ? 163  MET D CE    1 
ATOM   3524  N  N     . LEU B  1 170  ? 188.397 198.219 207.532 1.00 102.72 ? 164  LEU D N     1 
ATOM   3525  C  CA    . LEU B  1 170  ? 189.774 198.356 207.082 1.00 102.72 ? 164  LEU D CA    1 
ATOM   3526  C  C     . LEU B  1 170  ? 189.903 198.039 205.600 1.00 102.72 ? 164  LEU D C     1 
ATOM   3527  O  O     . LEU B  1 170  ? 190.668 198.692 204.887 1.00 102.72 ? 164  LEU D O     1 
ATOM   3528  C  CB    . LEU B  1 170  ? 190.680 197.468 207.926 1.00 102.72 ? 164  LEU D CB    1 
ATOM   3529  C  CG    . LEU B  1 170  ? 192.184 197.678 207.811 1.00 102.72 ? 164  LEU D CG    1 
ATOM   3530  C  CD1   . LEU B  1 170  ? 192.818 197.353 209.134 1.00 102.72 ? 164  LEU D CD1   1 
ATOM   3531  C  CD2   . LEU B  1 170  ? 192.760 196.786 206.739 1.00 102.72 ? 164  LEU D CD2   1 
ATOM   3532  N  N     . GLY B  1 171  ? 189.154 197.052 205.111 1.00 99.72  ? 165  GLY D N     1 
ATOM   3533  C  CA    . GLY B  1 171  ? 189.128 196.809 203.683 1.00 99.72  ? 165  GLY D CA    1 
ATOM   3534  C  C     . GLY B  1 171  ? 188.565 197.987 202.915 1.00 99.72  ? 165  GLY D C     1 
ATOM   3535  O  O     . GLY B  1 171  ? 189.082 198.358 201.854 1.00 99.72  ? 165  GLY D O     1 
ATOM   3536  N  N     . CYS B  1 172  ? 187.507 198.600 203.445 1.00 105.59 ? 166  CYS D N     1 
ATOM   3537  C  CA    . CYS B  1 172  ? 186.953 199.781 202.798 1.00 105.59 ? 166  CYS D CA    1 
ATOM   3538  C  C     . CYS B  1 172  ? 187.948 200.931 202.810 1.00 105.59 ? 166  CYS D C     1 
ATOM   3539  O  O     . CYS B  1 172  ? 188.157 201.588 201.786 1.00 105.59 ? 166  CYS D O     1 
ATOM   3540  C  CB    . CYS B  1 172  ? 185.649 200.192 203.473 1.00 105.59 ? 166  CYS D CB    1 
ATOM   3541  S  SG    . CYS B  1 172  ? 184.274 199.070 203.174 1.00 105.59 ? 166  CYS D SG    1 
ATOM   3542  N  N     . ILE B  1 173  ? 188.566 201.197 203.961 1.00 105.33 ? 167  ILE D N     1 
ATOM   3543  C  CA    . ILE B  1 173  ? 189.544 202.279 204.040 1.00 105.33 ? 167  ILE D CA    1 
ATOM   3544  C  C     . ILE B  1 173  ? 190.704 202.012 203.096 1.00 105.33 ? 167  ILE D C     1 
ATOM   3545  O  O     . ILE B  1 173  ? 191.251 202.935 202.486 1.00 105.33 ? 167  ILE D O     1 
ATOM   3546  C  CB    . ILE B  1 173  ? 190.026 202.474 205.487 1.00 105.33 ? 167  ILE D CB    1 
ATOM   3547  C  CG1   . ILE B  1 173  ? 188.905 203.039 206.351 1.00 105.33 ? 167  ILE D CG1   1 
ATOM   3548  C  CG2   . ILE B  1 173  ? 191.202 203.424 205.526 1.00 105.33 ? 167  ILE D CG2   1 
ATOM   3549  C  CD1   . ILE B  1 173  ? 188.518 204.444 205.967 1.00 105.33 ? 167  ILE D CD1   1 
ATOM   3550  N  N     . PHE B  1 174  ? 191.094 200.749 202.948 1.00 111.34 ? 168  PHE D N     1 
ATOM   3551  C  CA    . PHE B  1 174  ? 192.156 200.449 202.000 1.00 111.34 ? 168  PHE D CA    1 
ATOM   3552  C  C     . PHE B  1 174  ? 191.721 200.776 200.583 1.00 111.34 ? 168  PHE D C     1 
ATOM   3553  O  O     . PHE B  1 174  ? 192.305 201.636 199.917 1.00 111.34 ? 168  PHE D O     1 
ATOM   3554  C  CB    . PHE B  1 174  ? 192.588 198.991 202.071 1.00 111.34 ? 168  PHE D CB    1 
ATOM   3555  C  CG    . PHE B  1 174  ? 193.700 198.686 201.121 1.00 111.34 ? 168  PHE D CG    1 
ATOM   3556  C  CD1   . PHE B  1 174  ? 195.010 198.937 201.469 1.00 111.34 ? 168  PHE D CD1   1 
ATOM   3557  C  CD2   . PHE B  1 174  ? 193.426 198.271 199.835 1.00 111.34 ? 168  PHE D CD2   1 
ATOM   3558  C  CE1   . PHE B  1 174  ? 196.023 198.702 200.575 1.00 111.34 ? 168  PHE D CE1   1 
ATOM   3559  C  CE2   . PHE B  1 174  ? 194.425 198.027 198.940 1.00 111.34 ? 168  PHE D CE2   1 
ATOM   3560  C  CZ    . PHE B  1 174  ? 195.726 198.249 199.302 1.00 111.34 ? 168  PHE D CZ    1 
ATOM   3561  N  N     . MET B  1 175  ? 190.701 200.083 200.094 1.00 108.12 ? 169  MET D N     1 
ATOM   3562  C  CA    . MET B  1 175  ? 190.326 200.316 198.709 1.00 108.12 ? 169  MET D CA    1 
ATOM   3563  C  C     . MET B  1 175  ? 189.905 201.749 198.457 1.00 108.12 ? 169  MET D C     1 
ATOM   3564  O  O     . MET B  1 175  ? 189.831 202.155 197.295 1.00 108.12 ? 169  MET D O     1 
ATOM   3565  C  CB    . MET B  1 175  ? 189.219 199.354 198.286 1.00 108.12 ? 169  MET D CB    1 
ATOM   3566  C  CG    . MET B  1 175  ? 187.926 199.500 199.049 1.00 108.12 ? 169  MET D CG    1 
ATOM   3567  S  SD    . MET B  1 175  ? 186.782 198.201 198.568 1.00 108.12 ? 169  MET D SD    1 
ATOM   3568  C  CE    . MET B  1 175  ? 187.585 196.795 199.320 1.00 108.12 ? 169  MET D CE    1 
ATOM   3569  N  N     . LYS B  1 176  ? 189.658 202.533 199.499 1.00 106.07 ? 170  LYS D N     1 
ATOM   3570  C  CA    . LYS B  1 176  ? 189.424 203.948 199.294 1.00 106.07 ? 170  LYS D CA    1 
ATOM   3571  C  C     . LYS B  1 176  ? 190.722 204.732 199.224 1.00 106.07 ? 170  LYS D C     1 
ATOM   3572  O  O     . LYS B  1 176  ? 190.847 205.630 198.392 1.00 106.07 ? 170  LYS D O     1 
ATOM   3573  C  CB    . LYS B  1 176  ? 188.549 204.516 200.411 1.00 106.07 ? 170  LYS D CB    1 
ATOM   3574  C  CG    . LYS B  1 176  ? 188.039 205.914 200.116 1.00 106.07 ? 170  LYS D CG    1 
ATOM   3575  C  CD    . LYS B  1 176  ? 187.093 206.387 201.196 1.00 106.07 ? 170  LYS D CD    1 
ATOM   3576  C  CE    . LYS B  1 176  ? 186.540 207.784 200.901 1.00 106.07 ? 170  LYS D CE    1 
ATOM   3577  N  NZ    . LYS B  1 176  ? 185.693 207.847 199.656 1.00 106.07 ? 170  LYS D NZ    1 
ATOM   3578  N  N     . THR B  1 177  ? 191.698 204.412 200.069 1.00 115.51 ? 171  THR D N     1 
ATOM   3579  C  CA    . THR B  1 177  ? 192.983 205.089 200.021 1.00 115.51 ? 171  THR D CA    1 
ATOM   3580  C  C     . THR B  1 177  ? 193.815 204.667 198.823 1.00 115.51 ? 171  THR D C     1 
ATOM   3581  O  O     . THR B  1 177  ? 194.729 205.399 198.437 1.00 115.51 ? 171  THR D O     1 
ATOM   3582  C  CB    . THR B  1 177  ? 193.777 204.850 201.316 1.00 115.51 ? 171  THR D CB    1 
ATOM   3583  O  OG1   . THR B  1 177  ? 194.938 205.687 201.328 1.00 115.51 ? 171  THR D OG1   1 
ATOM   3584  C  CG2   . THR B  1 177  ? 194.228 203.411 201.434 1.00 115.51 ? 171  THR D CG2   1 
ATOM   3585  N  N     . ALA B  1 178  ? 193.526 203.513 198.228 1.00 110.46 ? 172  ALA D N     1 
ATOM   3586  C  CA    . ALA B  1 178  ? 194.103 203.168 196.938 1.00 110.46 ? 172  ALA D CA    1 
ATOM   3587  C  C     . ALA B  1 178  ? 193.297 203.732 195.779 1.00 110.46 ? 172  ALA D C     1 
ATOM   3588  O  O     . ALA B  1 178  ? 193.396 203.212 194.664 1.00 110.46 ? 172  ALA D O     1 
ATOM   3589  C  CB    . ALA B  1 178  ? 194.219 201.651 196.791 1.00 110.46 ? 172  ALA D CB    1 
ATOM   3590  N  N     . GLN B  1 179  ? 192.494 204.765 196.022 1.00 109.83 ? 173  GLN D N     1 
ATOM   3591  C  CA    . GLN B  1 179  ? 191.620 205.297 194.991 1.00 109.83 ? 173  GLN D CA    1 
ATOM   3592  C  C     . GLN B  1 179  ? 192.424 205.880 193.840 1.00 109.83 ? 173  GLN D C     1 
ATOM   3593  O  O     . GLN B  1 179  ? 193.533 206.389 194.022 1.00 109.83 ? 173  GLN D O     1 
ATOM   3594  C  CB    . GLN B  1 179  ? 190.702 206.367 195.580 1.00 109.83 ? 173  GLN D CB    1 
ATOM   3595  C  CG    . GLN B  1 179  ? 189.653 206.896 194.635 1.00 109.83 ? 173  GLN D CG    1 
ATOM   3596  C  CD    . GLN B  1 179  ? 188.729 205.812 194.150 1.00 109.83 ? 173  GLN D CD    1 
ATOM   3597  O  OE1   . GLN B  1 179  ? 188.804 205.388 192.998 1.00 109.83 ? 173  GLN D OE1   1 
ATOM   3598  N  NE2   . GLN B  1 179  ? 187.858 205.338 195.030 1.00 109.83 ? 173  GLN D NE2   1 
ATOM   3599  N  N     . ALA B  1 180  ? 191.848 205.784 192.648 1.00 120.65 ? 174  ALA D N     1 
ATOM   3600  C  CA    . ALA B  1 180  ? 192.335 206.437 191.450 1.00 120.65 ? 174  ALA D CA    1 
ATOM   3601  C  C     . ALA B  1 180  ? 191.675 207.808 191.299 1.00 120.65 ? 174  ALA D C     1 
ATOM   3602  O  O     . ALA B  1 180  ? 191.186 208.404 192.260 1.00 120.65 ? 174  ALA D O     1 
ATOM   3603  C  CB    . ALA B  1 180  ? 192.083 205.564 190.225 1.00 120.65 ? 174  ALA D CB    1 
ATOM   3604  N  N     . HIS B  1 181  ? 191.748 208.343 190.083 1.00 129.91 ? 175  HIS D N     1 
ATOM   3605  C  CA    . HIS B  1 181  ? 191.210 209.602 189.578 1.00 129.91 ? 175  HIS D CA    1 
ATOM   3606  C  C     . HIS B  1 181  ? 191.762 210.800 190.329 1.00 129.91 ? 175  HIS D C     1 
ATOM   3607  O  O     . HIS B  1 181  ? 191.358 211.923 190.042 1.00 129.91 ? 175  HIS D O     1 
ATOM   3608  C  CB    . HIS B  1 181  ? 189.667 209.677 189.567 1.00 129.91 ? 175  HIS D CB    1 
ATOM   3609  C  CG    . HIS B  1 181  ? 189.040 209.776 190.919 1.00 129.91 ? 175  HIS D CG    1 
ATOM   3610  N  ND1   . HIS B  1 181  ? 188.984 210.956 191.628 1.00 129.91 ? 175  HIS D ND1   1 
ATOM   3611  C  CD2   . HIS B  1 181  ? 188.379 208.858 191.665 1.00 129.91 ? 175  HIS D CD2   1 
ATOM   3612  C  CE1   . HIS B  1 181  ? 188.352 210.751 192.770 1.00 129.91 ? 175  HIS D CE1   1 
ATOM   3613  N  NE2   . HIS B  1 181  ? 187.976 209.488 192.817 1.00 129.91 ? 175  HIS D NE2   1 
ATOM   3614  N  N     . ARG B  1 182  ? 192.665 210.607 191.283 1.00 121.67 ? 176  ARG D N     1 
ATOM   3615  C  CA    . ARG B  1 182  ? 193.514 211.709 191.701 1.00 121.67 ? 176  ARG D CA    1 
ATOM   3616  C  C     . ARG B  1 182  ? 194.522 212.032 190.611 1.00 121.67 ? 176  ARG D C     1 
ATOM   3617  O  O     . ARG B  1 182  ? 194.815 213.204 190.349 1.00 121.67 ? 176  ARG D O     1 
ATOM   3618  C  CB    . ARG B  1 182  ? 194.222 211.361 193.008 1.00 121.67 ? 176  ARG D CB    1 
ATOM   3619  N  N     . ARG B  1 183  ? 195.050 211.000 189.955 1.00 128.95 ? 177  ARG D N     1 
ATOM   3620  C  CA    . ARG B  1 183  ? 195.923 211.221 188.813 1.00 128.95 ? 177  ARG D CA    1 
ATOM   3621  C  C     . ARG B  1 183  ? 195.139 211.712 187.603 1.00 128.95 ? 177  ARG D C     1 
ATOM   3622  O  O     . ARG B  1 183  ? 195.625 212.567 186.854 1.00 128.95 ? 177  ARG D O     1 
ATOM   3623  C  CB    . ARG B  1 183  ? 196.668 209.936 188.467 1.00 128.95 ? 177  ARG D CB    1 
ATOM   3624  C  CG    . ARG B  1 183  ? 197.574 210.075 187.266 1.00 128.95 ? 177  ARG D CG    1 
ATOM   3625  C  CD    . ARG B  1 183  ? 198.704 211.034 187.568 1.00 128.95 ? 177  ARG D CD    1 
ATOM   3626  N  NE    . ARG B  1 183  ? 199.561 211.254 186.409 1.00 128.95 ? 177  ARG D NE    1 
ATOM   3627  C  CZ    . ARG B  1 183  ? 200.600 210.488 186.106 1.00 128.95 ? 177  ARG D CZ    1 
ATOM   3628  N  NH1   . ARG B  1 183  ? 200.898 209.452 186.876 1.00 128.95 ? 177  ARG D NH1   1 
ATOM   3629  N  NH2   . ARG B  1 183  ? 201.337 210.749 185.037 1.00 128.95 ? 177  ARG D NH2   1 
ATOM   3630  N  N     . ALA B  1 184  ? 193.919 211.203 187.407 1.00 127.53 ? 178  ALA D N     1 
ATOM   3631  C  CA    . ALA B  1 184  ? 193.119 211.552 186.239 1.00 127.53 ? 178  ALA D CA    1 
ATOM   3632  C  C     . ALA B  1 184  ? 192.798 213.036 186.160 1.00 127.53 ? 178  ALA D C     1 
ATOM   3633  O  O     . ALA B  1 184  ? 192.298 213.490 185.126 1.00 127.53 ? 178  ALA D O     1 
ATOM   3634  C  CB    . ALA B  1 184  ? 191.821 210.751 186.237 1.00 127.53 ? 178  ALA D CB    1 
ATOM   3635  N  N     . GLU B  1 185  ? 193.054 213.797 187.218 1.00 127.79 ? 179  GLU D N     1 
ATOM   3636  C  CA    . GLU B  1 185  ? 192.896 215.241 187.156 1.00 127.79 ? 179  GLU D CA    1 
ATOM   3637  C  C     . GLU B  1 185  ? 194.145 215.931 186.645 1.00 127.79 ? 179  GLU D C     1 
ATOM   3638  O  O     . GLU B  1 185  ? 194.051 217.024 186.078 1.00 127.79 ? 179  GLU D O     1 
ATOM   3639  C  CB    . GLU B  1 185  ? 192.539 215.786 188.535 1.00 127.79 ? 179  GLU D CB    1 
ATOM   3640  C  CG    . GLU B  1 185  ? 191.180 215.342 189.022 1.00 127.79 ? 179  GLU D CG    1 
ATOM   3641  C  CD    . GLU B  1 185  ? 190.057 215.951 188.216 1.00 127.79 ? 179  GLU D CD    1 
ATOM   3642  O  OE1   . GLU B  1 185  ? 190.204 217.108 187.775 1.00 127.79 ? 179  GLU D OE1   1 
ATOM   3643  O  OE2   . GLU B  1 185  ? 189.031 215.273 188.013 1.00 127.79 ? 179  GLU D OE2   1 
ATOM   3644  N  N     . THR B  1 186  ? 195.313 215.318 186.833 1.00 122.16 ? 180  THR D N     1 
ATOM   3645  C  CA    . THR B  1 186  ? 196.552 215.906 186.346 1.00 122.16 ? 180  THR D CA    1 
ATOM   3646  C  C     . THR B  1 186  ? 196.710 215.731 184.842 1.00 122.16 ? 180  THR D C     1 
ATOM   3647  O  O     . THR B  1 186  ? 197.472 216.469 184.211 1.00 122.16 ? 180  THR D O     1 
ATOM   3648  C  CB    . THR B  1 186  ? 197.743 215.285 187.067 1.00 122.16 ? 180  THR D CB    1 
ATOM   3649  O  OG1   . THR B  1 186  ? 197.814 213.891 186.746 1.00 122.16 ? 180  THR D OG1   1 
ATOM   3650  C  CG2   . THR B  1 186  ? 197.578 215.436 188.566 1.00 122.16 ? 180  THR D CG2   1 
ATOM   3651  N  N     . LEU B  1 187  ? 196.010 214.764 184.258 1.00 118.48 ? 181  LEU D N     1 
ATOM   3652  C  CA    . LEU B  1 187  ? 196.076 214.549 182.822 1.00 118.48 ? 181  LEU D CA    1 
ATOM   3653  C  C     . LEU B  1 187  ? 195.319 215.660 182.112 1.00 118.48 ? 181  LEU D C     1 
ATOM   3654  O  O     . LEU B  1 187  ? 194.092 215.604 181.996 1.00 118.48 ? 181  LEU D O     1 
ATOM   3655  C  CB    . LEU B  1 187  ? 195.500 213.181 182.467 1.00 118.48 ? 181  LEU D CB    1 
ATOM   3656  C  CG    . LEU B  1 187  ? 196.266 212.015 183.091 1.00 118.48 ? 181  LEU D CG    1 
ATOM   3657  C  CD1   . LEU B  1 187  ? 195.594 210.693 182.774 1.00 118.48 ? 181  LEU D CD1   1 
ATOM   3658  C  CD2   . LEU B  1 187  ? 197.719 212.012 182.639 1.00 118.48 ? 181  LEU D CD2   1 
ATOM   3659  N  N     . ILE B  1 188  ? 196.027 216.664 181.643 1.00 111.26 ? 182  ILE D N     1 
ATOM   3660  C  CA    . ILE B  1 188  ? 195.388 217.886 181.169 1.00 111.26 ? 182  ILE D CA    1 
ATOM   3661  C  C     . ILE B  1 188  ? 195.242 217.872 179.659 1.00 111.26 ? 182  ILE D C     1 
ATOM   3662  O  O     . ILE B  1 188  ? 195.947 217.157 178.938 1.00 111.26 ? 182  ILE D O     1 
ATOM   3663  C  CB    . ILE B  1 188  ? 196.173 219.126 181.632 1.00 111.26 ? 182  ILE D CB    1 
ATOM   3664  C  CG1   . ILE B  1 188  ? 197.611 219.051 181.123 1.00 111.26 ? 182  ILE D CG1   1 
ATOM   3665  C  CG2   . ILE B  1 188  ? 196.102 219.257 183.137 1.00 111.26 ? 182  ILE D CG2   1 
ATOM   3666  C  CD1   . ILE B  1 188  ? 198.360 220.343 181.273 1.00 111.26 ? 182  ILE D CD1   1 
ATOM   3667  N  N     . PHE B  1 189  ? 194.318 218.695 179.178 1.00 106.77 ? 183  PHE D N     1 
ATOM   3668  C  CA    . PHE B  1 189  ? 194.010 218.814 177.764 1.00 106.77 ? 183  PHE D CA    1 
ATOM   3669  C  C     . PHE B  1 189  ? 193.709 220.268 177.449 1.00 106.77 ? 183  PHE D C     1 
ATOM   3670  O  O     . PHE B  1 189  ? 192.898 220.899 178.133 1.00 106.77 ? 183  PHE D O     1 
ATOM   3671  C  CB    . PHE B  1 189  ? 192.808 217.953 177.393 1.00 106.77 ? 183  PHE D CB    1 
ATOM   3672  C  CG    . PHE B  1 189  ? 193.003 216.506 177.681 1.00 106.77 ? 183  PHE D CG    1 
ATOM   3673  C  CD1   . PHE B  1 189  ? 193.736 215.712 176.826 1.00 106.77 ? 183  PHE D CD1   1 
ATOM   3674  C  CD2   . PHE B  1 189  ? 192.466 215.942 178.820 1.00 106.77 ? 183  PHE D CD2   1 
ATOM   3675  C  CE1   . PHE B  1 189  ? 193.922 214.380 177.098 1.00 106.77 ? 183  PHE D CE1   1 
ATOM   3676  C  CE2   . PHE B  1 189  ? 192.648 214.611 179.097 1.00 106.77 ? 183  PHE D CE2   1 
ATOM   3677  C  CZ    . PHE B  1 189  ? 193.378 213.828 178.235 1.00 106.77 ? 183  PHE D CZ    1 
ATOM   3678  N  N     . SER B  1 190  ? 194.356 220.790 176.412 1.00 120.93 ? 184  SER D N     1 
ATOM   3679  C  CA    . SER B  1 190  ? 194.134 222.165 176.002 1.00 120.93 ? 184  SER D CA    1 
ATOM   3680  C  C     . SER B  1 190  ? 192.647 222.415 175.763 1.00 120.93 ? 184  SER D C     1 
ATOM   3681  O  O     . SER B  1 190  ? 191.898 221.534 175.346 1.00 120.93 ? 184  SER D O     1 
ATOM   3682  C  CB    . SER B  1 190  ? 194.932 222.476 174.740 1.00 120.93 ? 184  SER D CB    1 
ATOM   3683  O  OG    . SER B  1 190  ? 194.472 221.690 173.655 1.00 120.93 ? 184  SER D OG    1 
ATOM   3684  N  N     . LYS B  1 191  ? 192.225 223.646 176.040 1.00 118.34 ? 185  LYS D N     1 
ATOM   3685  C  CA    . LYS B  1 191  ? 190.823 224.008 175.891 1.00 118.34 ? 185  LYS D CA    1 
ATOM   3686  C  C     . LYS B  1 191  ? 190.394 224.044 174.431 1.00 118.34 ? 185  LYS D C     1 
ATOM   3687  O  O     . LYS B  1 191  ? 189.195 224.127 174.142 1.00 118.34 ? 185  LYS D O     1 
ATOM   3688  C  CB    . LYS B  1 191  ? 190.566 225.360 176.566 1.00 118.34 ? 185  LYS D CB    1 
ATOM   3689  C  CG    . LYS B  1 191  ? 189.109 225.794 176.629 1.00 118.34 ? 185  LYS D CG    1 
ATOM   3690  C  CD    . LYS B  1 191  ? 188.912 226.995 177.536 1.00 118.34 ? 185  LYS D CD    1 
ATOM   3691  C  CE    . LYS B  1 191  ? 189.451 228.255 176.901 1.00 118.34 ? 185  LYS D CE    1 
ATOM   3692  N  NZ    . LYS B  1 191  ? 189.164 229.454 177.725 1.00 118.34 ? 185  LYS D NZ    1 
ATOM   3693  N  N     . HIS B  1 192  ? 191.343 223.943 173.504 1.00 121.30 ? 186  HIS D N     1 
ATOM   3694  C  CA    . HIS B  1 192  ? 191.068 224.066 172.079 1.00 121.30 ? 186  HIS D CA    1 
ATOM   3695  C  C     . HIS B  1 192  ? 191.768 222.955 171.317 1.00 121.30 ? 186  HIS D C     1 
ATOM   3696  O  O     . HIS B  1 192  ? 192.781 222.421 171.778 1.00 121.30 ? 186  HIS D O     1 
ATOM   3697  C  CB    . HIS B  1 192  ? 191.525 225.424 171.560 1.00 121.30 ? 186  HIS D CB    1 
ATOM   3698  C  CG    . HIS B  1 192  ? 190.810 226.566 172.195 1.00 121.30 ? 186  HIS D CG    1 
ATOM   3699  N  ND1   . HIS B  1 192  ? 191.250 227.163 173.353 1.00 121.30 ? 186  HIS D ND1   1 
ATOM   3700  C  CD2   . HIS B  1 192  ? 189.666 227.201 171.853 1.00 121.30 ? 186  HIS D CD2   1 
ATOM   3701  C  CE1   . HIS B  1 192  ? 190.418 228.130 173.689 1.00 121.30 ? 186  HIS D CE1   1 
ATOM   3702  N  NE2   . HIS B  1 192  ? 189.447 228.173 172.796 1.00 121.30 ? 186  HIS D NE2   1 
ATOM   3703  N  N     . ALA B  1 193  ? 191.220 222.609 170.161 1.00 126.98 ? 187  ALA D N     1 
ATOM   3704  C  CA    . ALA B  1 193  ? 191.862 221.710 169.219 1.00 126.98 ? 187  ALA D CA    1 
ATOM   3705  C  C     . ALA B  1 193  ? 191.983 222.415 167.876 1.00 126.98 ? 187  ALA D C     1 
ATOM   3706  O  O     . ALA B  1 193  ? 191.080 223.156 167.476 1.00 126.98 ? 187  ALA D O     1 
ATOM   3707  C  CB    . ALA B  1 193  ? 191.067 220.417 169.080 1.00 126.98 ? 187  ALA D CB    1 
ATOM   3708  N  N     . VAL B  1 194  ? 193.098 222.191 167.187 1.00 120.32 ? 188  VAL D N     1 
ATOM   3709  C  CA    . VAL B  1 194  ? 193.377 222.885 165.941 1.00 120.32 ? 188  VAL D CA    1 
ATOM   3710  C  C     . VAL B  1 194  ? 193.460 221.867 164.815 1.00 120.32 ? 188  VAL D C     1 
ATOM   3711  O  O     . VAL B  1 194  ? 193.762 220.691 165.034 1.00 120.32 ? 188  VAL D O     1 
ATOM   3712  C  CB    . VAL B  1 194  ? 194.681 223.704 166.021 1.00 120.32 ? 188  VAL D CB    1 
ATOM   3713  C  CG1   . VAL B  1 194  ? 194.643 224.639 167.216 1.00 120.32 ? 188  VAL D CG1   1 
ATOM   3714  C  CG2   . VAL B  1 194  ? 195.882 222.787 166.070 1.00 120.32 ? 188  VAL D CG2   1 
ATOM   3715  N  N     . ILE B  1 195  ? 193.170 222.325 163.607 1.00 120.04 ? 189  ILE D N     1 
ATOM   3716  C  CA    . ILE B  1 195  ? 193.405 221.547 162.398 1.00 120.04 ? 189  ILE D CA    1 
ATOM   3717  C  C     . ILE B  1 195  ? 194.488 222.266 161.614 1.00 120.04 ? 189  ILE D C     1 
ATOM   3718  O  O     . ILE B  1 195  ? 194.672 223.479 161.766 1.00 120.04 ? 189  ILE D O     1 
ATOM   3719  C  CB    . ILE B  1 195  ? 192.127 221.394 161.550 1.00 120.04 ? 189  ILE D CB    1 
ATOM   3720  C  CG1   . ILE B  1 195  ? 190.939 220.997 162.409 1.00 120.04 ? 189  ILE D CG1   1 
ATOM   3721  C  CG2   . ILE B  1 195  ? 192.315 220.339 160.484 1.00 120.04 ? 189  ILE D CG2   1 
ATOM   3722  C  CD1   . ILE B  1 195  ? 190.098 222.180 162.800 1.00 120.04 ? 189  ILE D CD1   1 
ATOM   3723  N  N     . ALA B  1 196  ? 195.209 221.529 160.778 1.00 124.72 ? 190  ALA D N     1 
ATOM   3724  C  CA    . ALA B  1 196  ? 196.203 222.133 159.908 1.00 124.72 ? 190  ALA D CA    1 
ATOM   3725  C  C     . ALA B  1 196  ? 196.486 221.167 158.766 1.00 124.72 ? 190  ALA D C     1 
ATOM   3726  O  O     . ALA B  1 196  ? 195.827 220.133 158.625 1.00 124.72 ? 190  ALA D O     1 
ATOM   3727  C  CB    . ALA B  1 196  ? 197.473 222.488 160.690 1.00 124.72 ? 190  ALA D CB    1 
ATOM   3728  N  N     . LEU B  1 197  ? 197.480 221.505 157.953 1.00 124.18 ? 191  LEU D N     1 
ATOM   3729  C  CA    . LEU B  1 197  ? 197.938 220.644 156.876 1.00 124.18 ? 191  LEU D CA    1 
ATOM   3730  C  C     . LEU B  1 197  ? 199.184 219.902 157.326 1.00 124.18 ? 191  LEU D C     1 
ATOM   3731  O  O     . LEU B  1 197  ? 200.161 220.520 157.759 1.00 124.18 ? 191  LEU D O     1 
ATOM   3732  C  CB    . LEU B  1 197  ? 198.221 221.445 155.609 1.00 124.18 ? 191  LEU D CB    1 
ATOM   3733  C  CG    . LEU B  1 197  ? 196.945 221.934 154.934 1.00 124.18 ? 191  LEU D CG    1 
ATOM   3734  C  CD1   . LEU B  1 197  ? 197.251 222.823 153.739 1.00 124.18 ? 191  LEU D CD1   1 
ATOM   3735  C  CD2   . LEU B  1 197  ? 196.112 220.736 154.521 1.00 124.18 ? 191  LEU D CD2   1 
ATOM   3736  N  N     . ARG B  1 198  ? 199.131 218.579 157.243 1.00 126.90 ? 192  ARG D N     1 
ATOM   3737  C  CA    . ARG B  1 198  ? 200.288 217.734 157.483 1.00 126.90 ? 192  ARG D CA    1 
ATOM   3738  C  C     . ARG B  1 198  ? 200.352 216.701 156.376 1.00 126.90 ? 192  ARG D C     1 
ATOM   3739  O  O     . ARG B  1 198  ? 199.333 216.084 156.047 1.00 126.90 ? 192  ARG D O     1 
ATOM   3740  C  CB    . ARG B  1 198  ? 200.224 217.053 158.855 1.00 126.90 ? 192  ARG D CB    1 
ATOM   3741  C  CG    . ARG B  1 198  ? 201.360 216.072 159.085 1.00 126.90 ? 192  ARG D CG    1 
ATOM   3742  C  CD    . ARG B  1 198  ? 201.401 215.537 160.507 1.00 126.90 ? 192  ARG D CD    1 
ATOM   3743  N  NE    . ARG B  1 198  ? 201.912 216.532 161.447 1.00 126.90 ? 192  ARG D NE    1 
ATOM   3744  C  CZ    . ARG B  1 198  ? 201.933 216.373 162.765 1.00 126.90 ? 192  ARG D CZ    1 
ATOM   3745  N  NH1   . ARG B  1 198  ? 201.466 215.257 163.302 1.00 126.90 ? 192  ARG D NH1   1 
ATOM   3746  N  NH2   . ARG B  1 198  ? 202.418 217.329 163.545 1.00 126.90 ? 192  ARG D NH2   1 
ATOM   3747  N  N     . HIS B  1 199  ? 201.537 216.535 155.790 1.00 129.22 ? 193  HIS D N     1 
ATOM   3748  C  CA    . HIS B  1 199  ? 201.737 215.605 154.682 1.00 129.22 ? 193  HIS D CA    1 
ATOM   3749  C  C     . HIS B  1 199  ? 200.802 215.938 153.524 1.00 129.22 ? 193  HIS D C     1 
ATOM   3750  O  O     . HIS B  1 199  ? 200.238 215.052 152.882 1.00 129.22 ? 193  HIS D O     1 
ATOM   3751  C  CB    . HIS B  1 199  ? 201.534 214.162 155.142 1.00 129.22 ? 193  HIS D CB    1 
ATOM   3752  C  CG    . HIS B  1 199  ? 202.504 213.729 156.192 1.00 129.22 ? 193  HIS D CG    1 
ATOM   3753  N  ND1   . HIS B  1 199  ? 202.324 212.592 156.948 1.00 129.22 ? 193  HIS D ND1   1 
ATOM   3754  C  CD2   . HIS B  1 199  ? 203.668 214.280 156.609 1.00 129.22 ? 193  HIS D CD2   1 
ATOM   3755  C  CE1   . HIS B  1 199  ? 203.331 212.465 157.792 1.00 129.22 ? 193  HIS D CE1   1 
ATOM   3756  N  NE2   . HIS B  1 199  ? 204.161 213.475 157.605 1.00 129.22 ? 193  HIS D NE2   1 
ATOM   3757  N  N     . GLY B  1 200  ? 200.620 217.233 153.270 1.00 124.35 ? 194  GLY D N     1 
ATOM   3758  C  CA    . GLY B  1 200  ? 199.646 217.656 152.289 1.00 124.35 ? 194  GLY D CA    1 
ATOM   3759  C  C     . GLY B  1 200  ? 198.222 217.285 152.619 1.00 124.35 ? 194  GLY D C     1 
ATOM   3760  O  O     . GLY B  1 200  ? 197.345 217.433 151.764 1.00 124.35 ? 194  GLY D O     1 
ATOM   3761  N  N     . ARG B  1 201  ? 197.965 216.798 153.826 1.00 119.73 ? 195  ARG D N     1 
ATOM   3762  C  CA    . ARG B  1 201  ? 196.637 216.372 154.228 1.00 119.73 ? 195  ARG D CA    1 
ATOM   3763  C  C     . ARG B  1 201  ? 196.153 217.222 155.390 1.00 119.73 ? 195  ARG D C     1 
ATOM   3764  O  O     . ARG B  1 201  ? 196.936 217.720 156.204 1.00 119.73 ? 195  ARG D O     1 
ATOM   3765  C  CB    . ARG B  1 201  ? 196.625 214.888 154.604 1.00 119.73 ? 195  ARG D CB    1 
ATOM   3766  C  CG    . ARG B  1 201  ? 196.978 213.982 153.446 1.00 119.73 ? 195  ARG D CG    1 
ATOM   3767  C  CD    . ARG B  1 201  ? 195.922 214.071 152.363 1.00 119.73 ? 195  ARG D CD    1 
ATOM   3768  N  NE    . ARG B  1 201  ? 194.607 213.681 152.858 1.00 119.73 ? 195  ARG D NE    1 
ATOM   3769  C  CZ    . ARG B  1 201  ? 194.171 212.427 152.905 1.00 119.73 ? 195  ARG D CZ    1 
ATOM   3770  N  NH1   . ARG B  1 201  ? 194.948 211.439 152.489 1.00 119.73 ? 195  ARG D NH1   1 
ATOM   3771  N  NH2   . ARG B  1 201  ? 192.959 212.160 153.370 1.00 119.73 ? 195  ARG D NH2   1 
ATOM   3772  N  N     . LEU B  1 202  ? 194.837 217.369 155.457 1.00 118.89 ? 196  LEU D N     1 
ATOM   3773  C  CA    . LEU B  1 202  ? 194.179 218.235 156.423 1.00 118.89 ? 196  LEU D CA    1 
ATOM   3774  C  C     . LEU B  1 202  ? 193.717 217.388 157.601 1.00 118.89 ? 196  LEU D C     1 
ATOM   3775  O  O     . LEU B  1 202  ? 192.683 216.715 157.518 1.00 118.89 ? 196  LEU D O     1 
ATOM   3776  C  CB    . LEU B  1 202  ? 193.003 218.953 155.766 1.00 118.89 ? 196  LEU D CB    1 
ATOM   3777  C  CG    . LEU B  1 202  ? 192.221 219.957 156.596 1.00 118.89 ? 196  LEU D CG    1 
ATOM   3778  C  CD1   . LEU B  1 202  ? 193.135 221.073 157.053 1.00 118.89 ? 196  LEU D CD1   1 
ATOM   3779  C  CD2   . LEU B  1 202  ? 191.083 220.503 155.763 1.00 118.89 ? 196  LEU D CD2   1 
ATOM   3780  N  N     . CYS B  1 203  ? 194.479 217.424 158.690 1.00 122.56 ? 197  CYS D N     1 
ATOM   3781  C  CA    . CYS B  1 203  ? 194.292 216.514 159.809 1.00 122.56 ? 197  CYS D CA    1 
ATOM   3782  C  C     . CYS B  1 203  ? 193.916 217.287 161.064 1.00 122.56 ? 197  CYS D C     1 
ATOM   3783  O  O     . CYS B  1 203  ? 194.525 218.314 161.375 1.00 122.56 ? 197  CYS D O     1 
ATOM   3784  C  CB    . CYS B  1 203  ? 195.557 215.685 160.049 1.00 122.56 ? 197  CYS D CB    1 
ATOM   3785  S  SG    . CYS B  1 203  ? 197.027 216.647 160.469 1.00 122.56 ? 197  CYS D SG    1 
ATOM   3786  N  N     . PHE B  1 204  ? 192.911 216.786 161.772 1.00 116.55 ? 198  PHE D N     1 
ATOM   3787  C  CA    . PHE B  1 204  ? 192.488 217.327 163.056 1.00 116.55 ? 198  PHE D CA    1 
ATOM   3788  C  C     . PHE B  1 204  ? 193.474 216.932 164.145 1.00 116.55 ? 198  PHE D C     1 
ATOM   3789  O  O     . PHE B  1 204  ? 193.888 215.774 164.219 1.00 116.55 ? 198  PHE D O     1 
ATOM   3790  C  CB    . PHE B  1 204  ? 191.096 216.811 163.400 1.00 116.55 ? 198  PHE D CB    1 
ATOM   3791  C  CG    . PHE B  1 204  ? 190.680 217.094 164.801 1.00 116.55 ? 198  PHE D CG    1 
ATOM   3792  C  CD1   . PHE B  1 204  ? 190.276 218.361 165.176 1.00 116.55 ? 198  PHE D CD1   1 
ATOM   3793  C  CD2   . PHE B  1 204  ? 190.700 216.092 165.751 1.00 116.55 ? 198  PHE D CD2   1 
ATOM   3794  C  CE1   . PHE B  1 204  ? 189.890 218.613 166.475 1.00 116.55 ? 198  PHE D CE1   1 
ATOM   3795  C  CE2   . PHE B  1 204  ? 190.318 216.341 167.049 1.00 116.55 ? 198  PHE D CE2   1 
ATOM   3796  C  CZ    . PHE B  1 204  ? 189.909 217.602 167.413 1.00 116.55 ? 198  PHE D CZ    1 
ATOM   3797  N  N     . MET B  1 205  ? 193.833 217.886 165.000 1.00 114.50 ? 199  MET D N     1 
ATOM   3798  C  CA    . MET B  1 205  ? 194.865 217.680 166.003 1.00 114.50 ? 199  MET D CA    1 
ATOM   3799  C  C     . MET B  1 205  ? 194.380 218.154 167.362 1.00 114.50 ? 199  MET D C     1 
ATOM   3800  O  O     . MET B  1 205  ? 193.363 218.843 167.460 1.00 114.50 ? 199  MET D O     1 
ATOM   3801  C  CB    . MET B  1 205  ? 196.151 218.430 165.647 1.00 114.50 ? 199  MET D CB    1 
ATOM   3802  C  CG    . MET B  1 205  ? 196.776 218.018 164.332 1.00 114.50 ? 199  MET D CG    1 
ATOM   3803  S  SD    . MET B  1 205  ? 198.368 218.794 164.033 1.00 114.50 ? 199  MET D SD    1 
ATOM   3804  C  CE    . MET B  1 205  ? 197.859 220.462 163.655 1.00 114.50 ? 199  MET D CE    1 
ATOM   3805  N  N     . LEU B  1 206  ? 195.108 217.764 168.407 1.00 111.81 ? 200  LEU D N     1 
ATOM   3806  C  CA    . LEU B  1 206  ? 195.003 218.364 169.731 1.00 111.81 ? 200  LEU D CA    1 
ATOM   3807  C  C     . LEU B  1 206  ? 196.206 217.934 170.554 1.00 111.81 ? 200  LEU D C     1 
ATOM   3808  O  O     . LEU B  1 206  ? 196.747 216.842 170.373 1.00 111.81 ? 200  LEU D O     1 
ATOM   3809  C  CB    . LEU B  1 206  ? 193.720 217.973 170.474 1.00 111.81 ? 200  LEU D CB    1 
ATOM   3810  C  CG    . LEU B  1 206  ? 193.719 216.575 171.087 1.00 111.81 ? 200  LEU D CG    1 
ATOM   3811  C  CD1   . LEU B  1 206  ? 192.719 216.503 172.210 1.00 111.81 ? 200  LEU D CD1   1 
ATOM   3812  C  CD2   . LEU B  1 206  ? 193.387 215.544 170.036 1.00 111.81 ? 200  LEU D CD2   1 
ATOM   3813  N  N     . ARG B  1 207  ? 196.613 218.796 171.476 1.00 109.89 ? 201  ARG D N     1 
ATOM   3814  C  CA    . ARG B  1 207  ? 197.736 218.514 172.354 1.00 109.89 ? 201  ARG D CA    1 
ATOM   3815  C  C     . ARG B  1 207  ? 197.238 217.847 173.627 1.00 109.89 ? 201  ARG D C     1 
ATOM   3816  O  O     . ARG B  1 207  ? 196.200 218.228 174.177 1.00 109.89 ? 201  ARG D O     1 
ATOM   3817  C  CB    . ARG B  1 207  ? 198.508 219.794 172.693 1.00 109.89 ? 201  ARG D CB    1 
ATOM   3818  C  CG    . ARG B  1 207  ? 199.720 219.597 173.600 1.00 109.89 ? 201  ARG D CG    1 
ATOM   3819  C  CD    . ARG B  1 207  ? 200.492 220.898 173.775 1.00 109.89 ? 201  ARG D CD    1 
ATOM   3820  N  NE    . ARG B  1 207  ? 201.252 221.257 172.578 1.00 109.89 ? 201  ARG D NE    1 
ATOM   3821  C  CZ    . ARG B  1 207  ? 201.776 222.458 172.354 1.00 109.89 ? 201  ARG D CZ    1 
ATOM   3822  N  NH1   . ARG B  1 207  ? 201.601 223.433 173.230 1.00 109.89 ? 201  ARG D NH1   1 
ATOM   3823  N  NH2   . ARG B  1 207  ? 202.459 222.692 171.243 1.00 109.89 ? 201  ARG D NH2   1 
ATOM   3824  N  N     . VAL B  1 208  ? 197.984 216.846 174.084 1.00 111.71 ? 202  VAL D N     1 
ATOM   3825  C  CA    . VAL B  1 208  ? 197.701 216.131 175.320 1.00 111.71 ? 202  VAL D CA    1 
ATOM   3826  C  C     . VAL B  1 208  ? 198.693 216.619 176.359 1.00 111.71 ? 202  VAL D C     1 
ATOM   3827  O  O     . VAL B  1 208  ? 199.769 217.113 176.009 1.00 111.71 ? 202  VAL D O     1 
ATOM   3828  C  CB    . VAL B  1 208  ? 197.816 214.605 175.130 1.00 111.71 ? 202  VAL D CB    1 
ATOM   3829  C  CG1   . VAL B  1 208  ? 199.254 214.222 174.878 1.00 111.71 ? 202  VAL D CG1   1 
ATOM   3830  C  CG2   . VAL B  1 208  ? 197.275 213.859 176.330 1.00 111.71 ? 202  VAL D CG2   1 
ATOM   3831  N  N     . GLY B  1 209  ? 198.334 216.497 177.630 1.00 116.73 ? 203  GLY D N     1 
ATOM   3832  C  CA    . GLY B  1 209  ? 199.237 216.932 178.676 1.00 116.73 ? 203  GLY D CA    1 
ATOM   3833  C  C     . GLY B  1 209  ? 199.159 216.058 179.905 1.00 116.73 ? 203  GLY D C     1 
ATOM   3834  O  O     . GLY B  1 209  ? 198.075 215.749 180.408 1.00 116.73 ? 203  GLY D O     1 
ATOM   3835  N  N     . ASP B  1 210  ? 200.335 215.666 180.384 1.00 126.81 ? 204  ASP D N     1 
ATOM   3836  C  CA    . ASP B  1 210  ? 200.490 215.011 181.673 1.00 126.81 ? 204  ASP D CA    1 
ATOM   3837  C  C     . ASP B  1 210  ? 201.387 215.860 182.558 1.00 126.81 ? 204  ASP D C     1 
ATOM   3838  O  O     . ASP B  1 210  ? 202.501 216.217 182.165 1.00 126.81 ? 204  ASP D O     1 
ATOM   3839  C  CB    . ASP B  1 210  ? 201.094 213.616 181.533 1.00 126.81 ? 204  ASP D CB    1 
ATOM   3840  C  CG    . ASP B  1 210  ? 201.061 212.839 182.831 1.00 126.81 ? 204  ASP D CG    1 
ATOM   3841  O  OD1   . ASP B  1 210  ? 200.523 213.371 183.825 1.00 126.81 ? 204  ASP D OD1   1 
ATOM   3842  O  OD2   . ASP B  1 210  ? 201.580 211.705 182.872 1.00 126.81 ? 204  ASP D OD2   1 
ATOM   3843  N  N     . LEU B  1 211  ? 200.902 216.169 183.759 1.00 125.96 ? 205  LEU D N     1 
ATOM   3844  C  CA    . LEU B  1 211  ? 201.612 217.060 184.663 1.00 125.96 ? 205  LEU D CA    1 
ATOM   3845  C  C     . LEU B  1 211  ? 202.431 216.334 185.717 1.00 125.96 ? 205  LEU D C     1 
ATOM   3846  O  O     . LEU B  1 211  ? 203.385 216.917 186.237 1.00 125.96 ? 205  LEU D O     1 
ATOM   3847  C  CB    . LEU B  1 211  ? 200.629 217.995 185.364 1.00 125.96 ? 205  LEU D CB    1 
ATOM   3848  C  CG    . LEU B  1 211  ? 199.922 218.978 184.442 1.00 125.96 ? 205  LEU D CG    1 
ATOM   3849  C  CD1   . LEU B  1 211  ? 198.933 219.791 185.235 1.00 125.96 ? 205  LEU D CD1   1 
ATOM   3850  C  CD2   . LEU B  1 211  ? 200.937 219.868 183.786 1.00 125.96 ? 205  LEU D CD2   1 
ATOM   3851  N  N     . ARG B  1 212  ? 202.097 215.095 186.044 1.00 127.62 ? 206  ARG D N     1 
ATOM   3852  C  CA    . ARG B  1 212  ? 202.842 214.337 187.034 1.00 127.62 ? 206  ARG D CA    1 
ATOM   3853  C  C     . ARG B  1 212  ? 204.051 213.680 186.388 1.00 127.62 ? 206  ARG D C     1 
ATOM   3854  O  O     . ARG B  1 212  ? 203.990 213.215 185.247 1.00 127.62 ? 206  ARG D O     1 
ATOM   3855  C  CB    . ARG B  1 212  ? 201.971 213.269 187.690 1.00 127.62 ? 206  ARG D CB    1 
ATOM   3856  C  CG    . ARG B  1 212  ? 200.827 213.822 188.494 1.00 127.62 ? 206  ARG D CG    1 
ATOM   3857  C  CD    . ARG B  1 212  ? 201.350 214.541 189.720 1.00 127.62 ? 206  ARG D CD    1 
ATOM   3858  N  NE    . ARG B  1 212  ? 200.266 215.063 190.545 1.00 127.62 ? 206  ARG D NE    1 
ATOM   3859  C  CZ    . ARG B  1 212  ? 199.694 214.386 191.533 1.00 127.62 ? 206  ARG D CZ    1 
ATOM   3860  N  NH1   . ARG B  1 212  ? 200.105 213.160 191.822 1.00 127.62 ? 206  ARG D NH1   1 
ATOM   3861  N  NH2   . ARG B  1 212  ? 198.713 214.935 192.234 1.00 127.62 ? 206  ARG D NH2   1 
ATOM   3862  N  N     . LYS B  1 213  ? 205.156 213.659 187.125 1.00 129.49 ? 207  LYS D N     1 
ATOM   3863  C  CA    . LYS B  1 213  ? 206.303 212.881 186.688 1.00 129.49 ? 207  LYS D CA    1 
ATOM   3864  C  C     . LYS B  1 213  ? 206.037 211.389 186.767 1.00 129.49 ? 207  LYS D C     1 
ATOM   3865  O  O     . LYS B  1 213  ? 206.690 210.618 186.058 1.00 129.49 ? 207  LYS D O     1 
ATOM   3866  C  CB    . LYS B  1 213  ? 207.534 213.232 187.526 1.00 129.49 ? 207  LYS D CB    1 
ATOM   3867  N  N     . SER B  1 214  ? 205.094 210.974 187.607 1.00 135.47 ? 208  SER D N     1 
ATOM   3868  C  CA    . SER B  1 214  ? 204.671 209.583 187.645 1.00 135.47 ? 208  SER D CA    1 
ATOM   3869  C  C     . SER B  1 214  ? 204.103 209.182 186.294 1.00 135.47 ? 208  SER D C     1 
ATOM   3870  O  O     . SER B  1 214  ? 203.429 209.969 185.625 1.00 135.47 ? 208  SER D O     1 
ATOM   3871  C  CB    . SER B  1 214  ? 203.633 209.380 188.744 1.00 135.47 ? 208  SER D CB    1 
ATOM   3872  O  OG    . SER B  1 214  ? 202.466 210.135 188.474 1.00 135.47 ? 208  SER D OG    1 
ATOM   3873  N  N     . MET B  1 215  ? 204.397 207.959 185.877 1.00 134.36 ? 209  MET D N     1 
ATOM   3874  C  CA    . MET B  1 215  ? 204.154 207.590 184.497 1.00 134.36 ? 209  MET D CA    1 
ATOM   3875  C  C     . MET B  1 215  ? 202.876 206.775 184.366 1.00 134.36 ? 209  MET D C     1 
ATOM   3876  O  O     . MET B  1 215  ? 202.517 205.989 185.244 1.00 134.36 ? 209  MET D O     1 
ATOM   3877  C  CB    . MET B  1 215  ? 205.346 206.811 183.945 1.00 134.36 ? 209  MET D CB    1 
ATOM   3878  C  CG    . MET B  1 215  ? 205.321 206.630 182.450 1.00 134.36 ? 209  MET D CG    1 
ATOM   3879  S  SD    . MET B  1 215  ? 205.219 208.249 181.685 1.00 134.36 ? 209  MET D SD    1 
ATOM   3880  C  CE    . MET B  1 215  ? 206.761 208.962 182.246 1.00 134.36 ? 209  MET D CE    1 
ATOM   3881  N  N     . ILE B  1 216  ? 202.184 206.982 183.264 1.00 118.28 ? 210  ILE D N     1 
ATOM   3882  C  CA    . ILE B  1 216  ? 201.020 206.190 182.909 1.00 118.28 ? 210  ILE D CA    1 
ATOM   3883  C  C     . ILE B  1 216  ? 201.483 205.088 181.974 1.00 118.28 ? 210  ILE D C     1 
ATOM   3884  O  O     . ILE B  1 216  ? 202.350 205.308 181.120 1.00 118.28 ? 210  ILE D O     1 
ATOM   3885  C  CB    . ILE B  1 216  ? 199.929 207.065 182.264 1.00 118.28 ? 210  ILE D CB    1 
ATOM   3886  C  CG1   . ILE B  1 216  ? 198.611 206.296 182.149 1.00 118.28 ? 210  ILE D CG1   1 
ATOM   3887  C  CG2   . ILE B  1 216  ? 200.395 207.610 180.927 1.00 118.28 ? 210  ILE D CG2   1 
ATOM   3888  C  CD1   . ILE B  1 216  ? 197.949 206.041 183.477 1.00 118.28 ? 210  ILE D CD1   1 
ATOM   3889  N  N     . ILE B  1 217  ? 200.937 203.891 182.148 1.00 113.38 ? 211  ILE D N     1 
ATOM   3890  C  CA    . ILE B  1 217  ? 201.358 202.723 181.387 1.00 113.38 ? 211  ILE D CA    1 
ATOM   3891  C  C     . ILE B  1 217  ? 200.258 202.372 180.400 1.00 113.38 ? 211  ILE D C     1 
ATOM   3892  O  O     . ILE B  1 217  ? 199.072 202.449 180.733 1.00 113.38 ? 211  ILE D O     1 
ATOM   3893  C  CB    . ILE B  1 217  ? 201.688 201.533 182.305 1.00 113.38 ? 211  ILE D CB    1 
ATOM   3894  C  CG1   . ILE B  1 217  ? 202.942 201.820 183.127 1.00 113.38 ? 211  ILE D CG1   1 
ATOM   3895  C  CG2   . ILE B  1 217  ? 201.899 200.278 181.498 1.00 113.38 ? 211  ILE D CG2   1 
ATOM   3896  C  CD1   . ILE B  1 217  ? 202.673 202.466 184.450 1.00 113.38 ? 211  ILE D CD1   1 
ATOM   3897  N  N     . SER B  1 218  ? 200.658 202.002 179.184 1.00 104.85 ? 212  SER D N     1 
ATOM   3898  C  CA    . SER B  1 218  ? 199.726 201.607 178.133 1.00 104.85 ? 212  SER D CA    1 
ATOM   3899  C  C     . SER B  1 218  ? 198.712 202.709 177.857 1.00 104.85 ? 212  SER D C     1 
ATOM   3900  O  O     . SER B  1 218  ? 197.541 202.448 177.579 1.00 104.85 ? 212  SER D O     1 
ATOM   3901  C  CB    . SER B  1 218  ? 199.024 200.296 178.477 1.00 104.85 ? 212  SER D CB    1 
ATOM   3902  O  OG    . SER B  1 218  ? 198.080 199.961 177.478 1.00 104.85 ? 212  SER D OG    1 
ATOM   3903  N  N     . ALA B  1 219  ? 199.169 203.956 177.950 1.00 108.84 ? 213  ALA D N     1 
ATOM   3904  C  CA    . ALA B  1 219  ? 198.328 205.106 177.657 1.00 108.84 ? 213  ALA D CA    1 
ATOM   3905  C  C     . ALA B  1 219  ? 197.729 204.976 176.266 1.00 108.84 ? 213  ALA D C     1 
ATOM   3906  O  O     . ALA B  1 219  ? 198.451 204.983 175.266 1.00 108.84 ? 213  ALA D O     1 
ATOM   3907  C  CB    . ALA B  1 219  ? 199.131 206.399 177.778 1.00 108.84 ? 213  ALA D CB    1 
ATOM   3908  N  N     . THR B  1 220  ? 196.408 204.858 176.201 1.00 106.17 ? 214  THR D N     1 
ATOM   3909  C  CA    . THR B  1 220  ? 195.703 204.550 174.968 1.00 106.17 ? 214  THR D CA    1 
ATOM   3910  C  C     . THR B  1 220  ? 194.676 205.635 174.690 1.00 106.17 ? 214  THR D C     1 
ATOM   3911  O  O     . THR B  1 220  ? 193.999 206.106 175.610 1.00 106.17 ? 214  THR D O     1 
ATOM   3912  C  CB    . THR B  1 220  ? 195.034 203.186 175.071 1.00 106.17 ? 214  THR D CB    1 
ATOM   3913  O  OG1   . THR B  1 220  ? 196.033 202.207 175.383 1.00 106.17 ? 214  THR D OG1   1 
ATOM   3914  C  CG2   . THR B  1 220  ? 194.386 202.818 173.764 1.00 106.17 ? 214  THR D CG2   1 
ATOM   3915  N  N     . ILE B  1 221  ? 194.569 206.033 173.426 1.00 102.33 ? 215  ILE D N     1 
ATOM   3916  C  CA    . ILE B  1 221  ? 193.714 207.135 173.004 1.00 102.33 ? 215  ILE D CA    1 
ATOM   3917  C  C     . ILE B  1 221  ? 192.538 206.582 172.226 1.00 102.33 ? 215  ILE D C     1 
ATOM   3918  O  O     . ILE B  1 221  ? 192.716 205.768 171.316 1.00 102.33 ? 215  ILE D O     1 
ATOM   3919  C  CB    . ILE B  1 221  ? 194.494 208.142 172.143 1.00 102.33 ? 215  ILE D CB    1 
ATOM   3920  C  CG1   . ILE B  1 221  ? 195.595 208.805 172.960 1.00 102.33 ? 215  ILE D CG1   1 
ATOM   3921  C  CG2   . ILE B  1 221  ? 193.555 209.174 171.548 1.00 102.33 ? 215  ILE D CG2   1 
ATOM   3922  C  CD1   . ILE B  1 221  ? 195.068 209.644 174.086 1.00 102.33 ? 215  ILE D CD1   1 
ATOM   3923  N  N     . HIS B  1 222  ? 191.341 207.035 172.562 1.00 96.49  ? 216  HIS D N     1 
ATOM   3924  C  CA    . HIS B  1 222  ? 190.154 206.734 171.774 1.00 96.49  ? 216  HIS D CA    1 
ATOM   3925  C  C     . HIS B  1 222  ? 189.425 208.036 171.496 1.00 96.49  ? 216  HIS D C     1 
ATOM   3926  O  O     . HIS B  1 222  ? 188.495 208.406 172.218 1.00 96.49  ? 216  HIS D O     1 
ATOM   3927  C  CB    . HIS B  1 222  ? 189.257 205.742 172.489 1.00 96.49  ? 216  HIS D CB    1 
ATOM   3928  C  CG    . HIS B  1 222  ? 189.853 204.379 172.600 1.00 96.49  ? 216  HIS D CG    1 
ATOM   3929  N  ND1   . HIS B  1 222  ? 190.696 204.020 173.628 1.00 96.49  ? 216  HIS D ND1   1 
ATOM   3930  C  CD2   . HIS B  1 222  ? 189.732 203.287 171.811 1.00 96.49  ? 216  HIS D CD2   1 
ATOM   3931  C  CE1   . HIS B  1 222  ? 191.067 202.763 173.469 1.00 96.49  ? 216  HIS D CE1   1 
ATOM   3932  N  NE2   . HIS B  1 222  ? 190.497 202.295 172.374 1.00 96.49  ? 216  HIS D NE2   1 
ATOM   3933  N  N     . MET B  1 223  ? 189.845 208.732 170.450 1.00 106.62 ? 217  MET D N     1 
ATOM   3934  C  CA    . MET B  1 223  ? 189.071 209.856 169.963 1.00 106.62 ? 217  MET D CA    1 
ATOM   3935  C  C     . MET B  1 223  ? 187.778 209.320 169.370 1.00 106.62 ? 217  MET D C     1 
ATOM   3936  O  O     . MET B  1 223  ? 187.772 208.294 168.686 1.00 106.62 ? 217  MET D O     1 
ATOM   3937  C  CB    . MET B  1 223  ? 189.860 210.644 168.923 1.00 106.62 ? 217  MET D CB    1 
ATOM   3938  C  CG    . MET B  1 223  ? 191.123 211.271 169.477 1.00 106.62 ? 217  MET D CG    1 
ATOM   3939  S  SD    . MET B  1 223  ? 191.941 212.356 168.298 1.00 106.62 ? 217  MET D SD    1 
ATOM   3940  C  CE    . MET B  1 223  ? 192.610 211.166 167.152 1.00 106.62 ? 217  MET D CE    1 
ATOM   3941  N  N     . GLN B  1 224  ? 186.675 210.005 169.647 1.00 108.22 ? 218  GLN D N     1 
ATOM   3942  C  CA    . GLN B  1 224  ? 185.377 209.459 169.273 1.00 108.22 ? 218  GLN D CA    1 
ATOM   3943  C  C     . GLN B  1 224  ? 184.435 210.626 169.000 1.00 108.22 ? 218  GLN D C     1 
ATOM   3944  O  O     . GLN B  1 224  ? 184.076 211.362 169.922 1.00 108.22 ? 218  GLN D O     1 
ATOM   3945  C  CB    . GLN B  1 224  ? 184.857 208.554 170.368 1.00 108.22 ? 218  GLN D CB    1 
ATOM   3946  C  CG    . GLN B  1 224  ? 183.579 207.837 170.052 1.00 108.22 ? 218  GLN D CG    1 
ATOM   3947  C  CD    . GLN B  1 224  ? 183.229 206.858 171.144 1.00 108.22 ? 218  GLN D CD    1 
ATOM   3948  O  OE1   . GLN B  1 224  ? 183.935 206.764 172.147 1.00 108.22 ? 218  GLN D OE1   1 
ATOM   3949  N  NE2   . GLN B  1 224  ? 182.153 206.114 170.957 1.00 108.22 ? 218  GLN D NE2   1 
ATOM   3950  N  N     . VAL B  1 225  ? 184.054 210.785 167.741 1.00 109.82 ? 219  VAL D N     1 
ATOM   3951  C  CA    . VAL B  1 225  ? 183.164 211.867 167.345 1.00 109.82 ? 219  VAL D CA    1 
ATOM   3952  C  C     . VAL B  1 225  ? 181.724 211.451 167.604 1.00 109.82 ? 219  VAL D C     1 
ATOM   3953  O  O     . VAL B  1 225  ? 181.334 210.302 167.368 1.00 109.82 ? 219  VAL D O     1 
ATOM   3954  C  CB    . VAL B  1 225  ? 183.388 212.239 165.870 1.00 109.82 ? 219  VAL D CB    1 
ATOM   3955  C  CG1   . VAL B  1 225  ? 183.110 211.054 164.969 1.00 109.82 ? 219  VAL D CG1   1 
ATOM   3956  C  CG2   . VAL B  1 225  ? 182.509 213.412 165.487 1.00 109.82 ? 219  VAL D CG2   1 
ATOM   3957  N  N     . VAL B  1 226  ? 180.932 212.383 168.119 1.00 110.66 ? 220  VAL D N     1 
ATOM   3958  C  CA    . VAL B  1 226  ? 179.550 212.115 168.480 1.00 110.66 ? 220  VAL D CA    1 
ATOM   3959  C  C     . VAL B  1 226  ? 178.663 213.212 167.917 1.00 110.66 ? 220  VAL D C     1 
ATOM   3960  O  O     . VAL B  1 226  ? 178.998 214.400 167.982 1.00 110.66 ? 220  VAL D O     1 
ATOM   3961  C  CB    . VAL B  1 226  ? 179.371 211.995 170.005 1.00 110.66 ? 220  VAL D CB    1 
ATOM   3962  C  CG1   . VAL B  1 226  ? 180.122 210.789 170.518 1.00 110.66 ? 220  VAL D CG1   1 
ATOM   3963  C  CG2   . VAL B  1 226  ? 179.860 213.249 170.698 1.00 110.66 ? 220  VAL D CG2   1 
ATOM   3964  N  N     . ARG B  1 227  ? 177.538 212.805 167.347 1.00 114.90 ? 221  ARG D N     1 
ATOM   3965  C  CA    . ARG B  1 227  ? 176.537 213.746 166.873 1.00 114.90 ? 221  ARG D CA    1 
ATOM   3966  C  C     . ARG B  1 227  ? 175.244 212.979 166.677 1.00 114.90 ? 221  ARG D C     1 
ATOM   3967  O  O     . ARG B  1 227  ? 175.180 211.765 166.875 1.00 114.90 ? 221  ARG D O     1 
ATOM   3968  C  CB    . ARG B  1 227  ? 176.950 214.423 165.566 1.00 114.90 ? 221  ARG D CB    1 
ATOM   3969  C  CG    . ARG B  1 227  ? 176.772 213.531 164.362 1.00 114.90 ? 221  ARG D CG    1 
ATOM   3970  C  CD    . ARG B  1 227  ? 177.161 214.214 163.070 1.00 114.90 ? 221  ARG D CD    1 
ATOM   3971  N  NE    . ARG B  1 227  ? 178.605 214.346 162.917 1.00 114.90 ? 221  ARG D NE    1 
ATOM   3972  C  CZ    . ARG B  1 227  ? 179.184 214.996 161.915 1.00 114.90 ? 221  ARG D CZ    1 
ATOM   3973  N  NH1   . ARG B  1 227  ? 178.437 215.573 160.985 1.00 114.90 ? 221  ARG D NH1   1 
ATOM   3974  N  NH2   . ARG B  1 227  ? 180.504 215.066 161.841 1.00 114.90 ? 221  ARG D NH2   1 
ATOM   3975  N  N     . LYS B  1 228  ? 174.215 213.705 166.271 1.00 125.86 ? 222  LYS D N     1 
ATOM   3976  C  CA    . LYS B  1 228  ? 172.920 213.126 165.944 1.00 125.86 ? 222  LYS D CA    1 
ATOM   3977  C  C     . LYS B  1 228  ? 172.925 212.841 164.450 1.00 125.86 ? 222  LYS D C     1 
ATOM   3978  O  O     . LYS B  1 228  ? 172.457 213.657 163.652 1.00 125.86 ? 222  LYS D O     1 
ATOM   3979  C  CB    . LYS B  1 228  ? 171.799 214.076 166.342 1.00 125.86 ? 222  LYS D CB    1 
ATOM   3980  C  CG    . LYS B  1 228  ? 170.411 213.517 166.185 1.00 125.86 ? 222  LYS D CG    1 
ATOM   3981  C  CD    . LYS B  1 228  ? 169.381 214.518 166.673 1.00 125.86 ? 222  LYS D CD    1 
ATOM   3982  C  CE    . LYS B  1 228  ? 167.962 214.012 166.485 1.00 125.86 ? 222  LYS D CE    1 
ATOM   3983  N  NZ    . LYS B  1 228  ? 166.965 215.008 166.970 1.00 125.86 ? 222  LYS D NZ    1 
ATOM   3984  N  N     . THR B  1 229  ? 173.464 211.692 164.070 1.00 113.93 ? 223  THR D N     1 
ATOM   3985  C  CA    . THR B  1 229  ? 173.591 211.347 162.664 1.00 113.93 ? 223  THR D CA    1 
ATOM   3986  C  C     . THR B  1 229  ? 172.555 210.304 162.274 1.00 113.93 ? 223  THR D C     1 
ATOM   3987  O  O     . THR B  1 229  ? 171.844 209.745 163.111 1.00 113.93 ? 223  THR D O     1 
ATOM   3988  C  CB    . THR B  1 229  ? 174.994 210.832 162.348 1.00 113.93 ? 223  THR D CB    1 
ATOM   3989  O  OG1   . THR B  1 229  ? 175.150 210.745 160.928 1.00 113.93 ? 223  THR D OG1   1 
ATOM   3990  C  CG2   . THR B  1 229  ? 175.173 209.463 162.931 1.00 113.93 ? 223  THR D CG2   1 
ATOM   3991  N  N     . THR B  1 230  ? 172.494 210.033 160.975 1.00 115.21 ? 224  THR D N     1 
ATOM   3992  C  CA    . THR B  1 230  ? 171.402 209.268 160.393 1.00 115.21 ? 224  THR D CA    1 
ATOM   3993  C  C     . THR B  1 230  ? 171.930 208.312 159.335 1.00 115.21 ? 224  THR D C     1 
ATOM   3994  O  O     . THR B  1 230  ? 172.798 208.677 158.538 1.00 115.21 ? 224  THR D O     1 
ATOM   3995  C  CB    . THR B  1 230  ? 170.366 210.208 159.786 1.00 115.21 ? 224  THR D CB    1 
ATOM   3996  O  OG1   . THR B  1 230  ? 169.911 211.120 160.792 1.00 115.21 ? 224  THR D OG1   1 
ATOM   3997  C  CG2   . THR B  1 230  ? 169.182 209.428 159.259 1.00 115.21 ? 224  THR D CG2   1 
ATOM   3998  N  N     . SER B  1 231  ? 171.406 207.088 159.339 1.00 114.21 ? 225  SER D N     1 
ATOM   3999  C  CA    . SER B  1 231  ? 171.691 206.135 158.285 1.00 114.21 ? 225  SER D CA    1 
ATOM   4000  C  C     . SER B  1 231  ? 170.994 206.563 156.998 1.00 114.21 ? 225  SER D C     1 
ATOM   4001  O  O     . SER B  1 231  ? 170.076 207.384 157.024 1.00 114.21 ? 225  SER D O     1 
ATOM   4002  C  CB    . SER B  1 231  ? 171.218 204.743 158.690 1.00 114.21 ? 225  SER D CB    1 
ATOM   4003  O  OG    . SER B  1 231  ? 169.803 204.688 158.721 1.00 114.21 ? 225  SER D OG    1 
ATOM   4004  N  N     . PRO B  1 232  ? 171.410 206.024 155.852 1.00 114.29 ? 226  PRO D N     1 
ATOM   4005  C  CA    . PRO B  1 232  ? 170.655 206.294 154.621 1.00 114.29 ? 226  PRO D CA    1 
ATOM   4006  C  C     . PRO B  1 232  ? 169.213 205.840 154.710 1.00 114.29 ? 226  PRO D C     1 
ATOM   4007  O  O     . PRO B  1 232  ? 168.324 206.521 154.186 1.00 114.29 ? 226  PRO D O     1 
ATOM   4008  C  CB    . PRO B  1 232  ? 171.423 205.505 153.550 1.00 114.29 ? 226  PRO D CB    1 
ATOM   4009  C  CG    . PRO B  1 232  ? 172.790 205.331 154.112 1.00 114.29 ? 226  PRO D CG    1 
ATOM   4010  C  CD    . PRO B  1 232  ? 172.595 205.187 155.591 1.00 114.29 ? 226  PRO D CD    1 
ATOM   4011  N  N     . GLU B  1 233  ? 168.953 204.718 155.377 1.00 105.59 ? 227  GLU D N     1 
ATOM   4012  C  CA    . GLU B  1 233  ? 167.598 204.199 155.480 1.00 105.59 ? 227  GLU D CA    1 
ATOM   4013  C  C     . GLU B  1 233  ? 166.713 205.128 156.294 1.00 105.59 ? 227  GLU D C     1 
ATOM   4014  O  O     . GLU B  1 233  ? 165.485 205.092 156.173 1.00 105.59 ? 227  GLU D O     1 
ATOM   4015  C  CB    . GLU B  1 233  ? 167.632 202.798 156.088 1.00 105.59 ? 227  GLU D CB    1 
ATOM   4016  C  CG    . GLU B  1 233  ? 168.299 201.774 155.189 1.00 105.59 ? 227  GLU D CG    1 
ATOM   4017  C  CD    . GLU B  1 233  ? 169.812 201.852 155.241 1.00 105.59 ? 227  GLU D CD    1 
ATOM   4018  O  OE1   . GLU B  1 233  ? 170.342 202.682 156.008 1.00 105.59 ? 227  GLU D OE1   1 
ATOM   4019  O  OE2   . GLU B  1 233  ? 170.475 201.085 154.516 1.00 105.59 ? 227  GLU D OE2   1 
ATOM   4020  N  N     . GLY B  1 234  ? 167.316 205.958 157.138 1.00 106.97 ? 228  GLY D N     1 
ATOM   4021  C  CA    . GLY B  1 234  ? 166.559 207.010 157.775 1.00 106.97 ? 228  GLY D CA    1 
ATOM   4022  C  C     . GLY B  1 234  ? 166.658 207.090 159.282 1.00 106.97 ? 228  GLY D C     1 
ATOM   4023  O  O     . GLY B  1 234  ? 166.372 208.144 159.853 1.00 106.97 ? 228  GLY D O     1 
ATOM   4024  N  N     . GLU B  1 235  ? 167.044 206.006 159.948 1.00 114.42 ? 229  GLU D N     1 
ATOM   4025  C  CA    . GLU B  1 235  ? 167.076 206.032 161.403 1.00 114.42 ? 229  GLU D CA    1 
ATOM   4026  C  C     . GLU B  1 235  ? 168.133 207.001 161.903 1.00 114.42 ? 229  GLU D C     1 
ATOM   4027  O  O     . GLU B  1 235  ? 169.273 207.009 161.435 1.00 114.42 ? 229  GLU D O     1 
ATOM   4028  C  CB    . GLU B  1 235  ? 167.322 204.642 161.984 1.00 114.42 ? 229  GLU D CB    1 
ATOM   4029  C  CG    . GLU B  1 235  ? 168.603 203.990 161.555 1.00 114.42 ? 229  GLU D CG    1 
ATOM   4030  C  CD    . GLU B  1 235  ? 168.844 202.699 162.291 1.00 114.42 ? 229  GLU D CD    1 
ATOM   4031  O  OE1   . GLU B  1 235  ? 168.069 202.396 163.220 1.00 114.42 ? 229  GLU D OE1   1 
ATOM   4032  O  OE2   . GLU B  1 235  ? 169.797 201.977 161.930 1.00 114.42 ? 229  GLU D OE2   1 
ATOM   4033  N  N     . VAL B  1 236  ? 167.733 207.834 162.854 1.00 106.74 ? 230  VAL D N     1 
ATOM   4034  C  CA    . VAL B  1 236  ? 168.614 208.791 163.499 1.00 106.74 ? 230  VAL D CA    1 
ATOM   4035  C  C     . VAL B  1 236  ? 168.733 208.405 164.965 1.00 106.74 ? 230  VAL D C     1 
ATOM   4036  O  O     . VAL B  1 236  ? 167.762 207.946 165.578 1.00 106.74 ? 230  VAL D O     1 
ATOM   4037  C  CB    . VAL B  1 236  ? 168.096 210.238 163.344 1.00 106.74 ? 230  VAL D CB    1 
ATOM   4038  C  CG1   . VAL B  1 236  ? 166.755 210.412 164.039 1.00 106.74 ? 230  VAL D CG1   1 
ATOM   4039  C  CG2   . VAL B  1 236  ? 169.098 211.218 163.891 1.00 106.74 ? 230  VAL D CG2   1 
ATOM   4040  N  N     . VAL B  1 237  ? 169.929 208.557 165.516 1.00 113.40 ? 231  VAL D N     1 
ATOM   4041  C  CA    . VAL B  1 237  ? 170.127 208.309 166.937 1.00 113.40 ? 231  VAL D CA    1 
ATOM   4042  C  C     . VAL B  1 237  ? 170.747 209.560 167.546 1.00 113.40 ? 231  VAL D C     1 
ATOM   4043  O  O     . VAL B  1 237  ? 171.662 210.152 166.957 1.00 113.40 ? 231  VAL D O     1 
ATOM   4044  C  CB    . VAL B  1 237  ? 170.971 207.051 167.170 1.00 113.40 ? 231  VAL D CB    1 
ATOM   4045  C  CG1   . VAL B  1 237  ? 170.196 205.833 166.713 1.00 113.40 ? 231  VAL D CG1   1 
ATOM   4046  C  CG2   . VAL B  1 237  ? 172.263 207.138 166.401 1.00 113.40 ? 231  VAL D CG2   1 
ATOM   4047  N  N     . PRO B  1 238  ? 170.254 210.014 168.694 1.00 121.86 ? 232  PRO D N     1 
ATOM   4048  C  CA    . PRO B  1 238  ? 170.646 211.332 169.206 1.00 121.86 ? 232  PRO D CA    1 
ATOM   4049  C  C     . PRO B  1 238  ? 172.135 211.460 169.447 1.00 121.86 ? 232  PRO D C     1 
ATOM   4050  O  O     . PRO B  1 238  ? 172.795 212.324 168.867 1.00 121.86 ? 232  PRO D O     1 
ATOM   4051  C  CB    . PRO B  1 238  ? 169.864 211.439 170.519 1.00 121.86 ? 232  PRO D CB    1 
ATOM   4052  C  CG    . PRO B  1 238  ? 168.728 210.488 170.364 1.00 121.86 ? 232  PRO D CG    1 
ATOM   4053  C  CD    . PRO B  1 238  ? 169.269 209.351 169.561 1.00 121.86 ? 232  PRO D CD    1 
ATOM   4054  N  N     . LEU B  1 239  ? 172.677 210.614 170.315 1.00 121.65 ? 233  LEU D N     1 
ATOM   4055  C  CA    . LEU B  1 239  ? 174.112 210.606 170.577 1.00 121.65 ? 233  LEU D CA    1 
ATOM   4056  C  C     . LEU B  1 239  ? 174.744 209.406 169.873 1.00 121.65 ? 233  LEU D C     1 
ATOM   4057  O  O     . LEU B  1 239  ? 175.058 208.380 170.474 1.00 121.65 ? 233  LEU D O     1 
ATOM   4058  C  CB    . LEU B  1 239  ? 174.382 210.593 172.076 1.00 121.65 ? 233  LEU D CB    1 
ATOM   4059  C  CG    . LEU B  1 239  ? 173.989 211.888 172.785 1.00 121.65 ? 233  LEU D CG    1 
ATOM   4060  C  CD1   . LEU B  1 239  ? 174.054 211.727 174.288 1.00 121.65 ? 233  LEU D CD1   1 
ATOM   4061  C  CD2   . LEU B  1 239  ? 174.893 213.018 172.334 1.00 121.65 ? 233  LEU D CD2   1 
ATOM   4062  N  N     . HIS B  1 240  ? 174.913 209.546 168.564 1.00 108.30 ? 234  HIS D N     1 
ATOM   4063  C  CA    . HIS B  1 240  ? 175.644 208.535 167.820 1.00 108.30 ? 234  HIS D CA    1 
ATOM   4064  C  C     . HIS B  1 240  ? 177.131 208.708 168.070 1.00 108.30 ? 234  HIS D C     1 
ATOM   4065  O  O     . HIS B  1 240  ? 177.602 209.822 168.319 1.00 108.30 ? 234  HIS D O     1 
ATOM   4066  C  CB    . HIS B  1 240  ? 175.364 208.611 166.331 1.00 108.30 ? 234  HIS D CB    1 
ATOM   4067  C  CG    . HIS B  1 240  ? 176.037 207.523 165.564 1.00 108.30 ? 234  HIS D CG    1 
ATOM   4068  N  ND1   . HIS B  1 240  ? 175.587 206.221 165.578 1.00 108.30 ? 234  HIS D ND1   1 
ATOM   4069  C  CD2   . HIS B  1 240  ? 177.155 207.528 164.805 1.00 108.30 ? 234  HIS D CD2   1 
ATOM   4070  C  CE1   . HIS B  1 240  ? 176.383 205.475 164.834 1.00 108.30 ? 234  HIS D CE1   1 
ATOM   4071  N  NE2   . HIS B  1 240  ? 177.342 206.244 164.352 1.00 108.30 ? 234  HIS D NE2   1 
ATOM   4072  N  N     . GLN B  1 241  ? 177.871 207.611 167.991 1.00 108.17 ? 235  GLN D N     1 
ATOM   4073  C  CA    . GLN B  1 241  ? 179.259 207.567 168.417 1.00 108.17 ? 235  GLN D CA    1 
ATOM   4074  C  C     . GLN B  1 241  ? 180.080 206.811 167.385 1.00 108.17 ? 235  GLN D C     1 
ATOM   4075  O  O     . GLN B  1 241  ? 179.806 205.637 167.114 1.00 108.17 ? 235  GLN D O     1 
ATOM   4076  C  CB    . GLN B  1 241  ? 179.361 206.887 169.778 1.00 108.17 ? 235  GLN D CB    1 
ATOM   4077  C  CG    . GLN B  1 241  ? 178.591 207.592 170.874 1.00 108.17 ? 235  GLN D CG    1 
ATOM   4078  C  CD    . GLN B  1 241  ? 178.629 206.838 172.178 1.00 108.17 ? 235  GLN D CD    1 
ATOM   4079  O  OE1   . GLN B  1 241  ? 179.201 205.753 172.262 1.00 108.17 ? 235  GLN D OE1   1 
ATOM   4080  N  NE2   . GLN B  1 241  ? 178.011 207.401 173.206 1.00 108.17 ? 235  GLN D NE2   1 
ATOM   4081  N  N     . VAL B  1 242  ? 181.080 207.475 166.817 1.00 99.94  ? 236  VAL D N     1 
ATOM   4082  C  CA    . VAL B  1 242  ? 181.958 206.858 165.831 1.00 99.94  ? 236  VAL D CA    1 
ATOM   4083  C  C     . VAL B  1 242  ? 183.386 206.978 166.326 1.00 99.94  ? 236  VAL D C     1 
ATOM   4084  O  O     . VAL B  1 242  ? 183.889 208.090 166.517 1.00 99.94  ? 236  VAL D O     1 
ATOM   4085  C  CB    . VAL B  1 242  ? 181.823 207.496 164.445 1.00 99.94  ? 236  VAL D CB    1 
ATOM   4086  C  CG1   . VAL B  1 242  ? 182.823 206.870 163.503 1.00 99.94  ? 236  VAL D CG1   1 
ATOM   4087  C  CG2   . VAL B  1 242  ? 180.425 207.314 163.926 1.00 99.94  ? 236  VAL D CG2   1 
ATOM   4088  N  N     . ASP B  1 243  ? 184.035 205.840 166.527 1.00 107.72 ? 237  ASP D N     1 
ATOM   4089  C  CA    . ASP B  1 243  ? 185.418 205.829 166.982 1.00 107.72 ? 237  ASP D CA    1 
ATOM   4090  C  C     . ASP B  1 243  ? 186.315 206.319 165.856 1.00 107.72 ? 237  ASP D C     1 
ATOM   4091  O  O     . ASP B  1 243  ? 186.583 205.587 164.901 1.00 107.72 ? 237  ASP D O     1 
ATOM   4092  C  CB    . ASP B  1 243  ? 185.805 204.426 167.429 1.00 107.72 ? 237  ASP D CB    1 
ATOM   4093  C  CG    . ASP B  1 243  ? 185.076 204.000 168.680 1.00 107.72 ? 237  ASP D CG    1 
ATOM   4094  O  OD1   . ASP B  1 243  ? 184.741 204.879 169.497 1.00 107.72 ? 237  ASP D OD1   1 
ATOM   4095  O  OD2   . ASP B  1 243  ? 184.829 202.789 168.851 1.00 107.72 ? 237  ASP D OD2   1 
ATOM   4096  N  N     . ILE B  1 244  ? 186.771 207.558 165.962 1.00 100.90 ? 238  ILE D N     1 
ATOM   4097  C  CA    . ILE B  1 244  ? 187.634 208.132 164.937 1.00 100.90 ? 238  ILE D CA    1 
ATOM   4098  C  C     . ILE B  1 244  ? 189.076 207.759 165.258 1.00 100.90 ? 238  ILE D C     1 
ATOM   4099  O  O     . ILE B  1 244  ? 189.583 208.078 166.343 1.00 100.90 ? 238  ILE D O     1 
ATOM   4100  C  CB    . ILE B  1 244  ? 187.414 209.649 164.822 1.00 100.90 ? 238  ILE D CB    1 
ATOM   4101  C  CG1   . ILE B  1 244  ? 188.256 210.238 163.695 1.00 100.90 ? 238  ILE D CG1   1 
ATOM   4102  C  CG2   . ILE B  1 244  ? 187.642 210.361 166.146 1.00 100.90 ? 238  ILE D CG2   1 
ATOM   4103  C  CD1   . ILE B  1 244  ? 187.834 211.625 163.320 1.00 100.90 ? 238  ILE D CD1   1 
ATOM   4104  N  N     . PRO B  1 245  ? 189.762 207.061 164.358 1.00 96.87  ? 239  PRO D N     1 
ATOM   4105  C  CA    . PRO B  1 245  ? 191.067 206.489 164.708 1.00 96.87  ? 239  PRO D CA    1 
ATOM   4106  C  C     . PRO B  1 245  ? 192.172 207.528 164.702 1.00 96.87  ? 239  PRO D C     1 
ATOM   4107  O  O     . PRO B  1 245  ? 192.263 208.360 163.800 1.00 96.87  ? 239  PRO D O     1 
ATOM   4108  C  CB    . PRO B  1 245  ? 191.292 205.440 163.615 1.00 96.87  ? 239  PRO D CB    1 
ATOM   4109  C  CG    . PRO B  1 245  ? 190.524 205.955 162.456 1.00 96.87  ? 239  PRO D CG    1 
ATOM   4110  C  CD    . PRO B  1 245  ? 189.313 206.640 163.023 1.00 96.87  ? 239  PRO D CD    1 
ATOM   4111  N  N     . MET B  1 246  ? 193.024 207.461 165.719 1.00 102.04 ? 240  MET D N     1 
ATOM   4112  C  CA    . MET B  1 246  ? 194.193 208.320 165.749 1.00 102.04 ? 240  MET D CA    1 
ATOM   4113  C  C     . MET B  1 246  ? 195.215 207.840 164.730 1.00 102.04 ? 240  MET D C     1 
ATOM   4114  O  O     . MET B  1 246  ? 195.369 206.640 164.487 1.00 102.04 ? 240  MET D O     1 
ATOM   4115  C  CB    . MET B  1 246  ? 194.831 208.348 167.138 1.00 102.04 ? 240  MET D CB    1 
ATOM   4116  C  CG    . MET B  1 246  ? 195.453 207.037 167.569 1.00 102.04 ? 240  MET D CG    1 
ATOM   4117  S  SD    . MET B  1 246  ? 196.299 207.168 169.152 1.00 102.04 ? 240  MET D SD    1 
ATOM   4118  C  CE    . MET B  1 246  ? 197.742 208.105 168.679 1.00 102.04 ? 240  MET D CE    1 
ATOM   4119  N  N     . GLU B  1 247  ? 195.911 208.793 164.127 1.00 112.20 ? 241  GLU D N     1 
ATOM   4120  C  CA    . GLU B  1 247  ? 196.949 208.456 163.167 1.00 112.20 ? 241  GLU D CA    1 
ATOM   4121  C  C     . GLU B  1 247  ? 198.209 208.040 163.908 1.00 112.20 ? 241  GLU D C     1 
ATOM   4122  O  O     . GLU B  1 247  ? 198.928 208.885 164.454 1.00 112.20 ? 241  GLU D O     1 
ATOM   4123  C  CB    . GLU B  1 247  ? 197.228 209.637 162.246 1.00 112.20 ? 241  GLU D CB    1 
ATOM   4124  C  CG    . GLU B  1 247  ? 198.303 209.348 161.229 1.00 112.20 ? 241  GLU D CG    1 
ATOM   4125  C  CD    . GLU B  1 247  ? 197.898 208.264 160.254 1.00 112.20 ? 241  GLU D CD    1 
ATOM   4126  O  OE1   . GLU B  1 247  ? 196.683 208.102 160.012 1.00 112.20 ? 241  GLU D OE1   1 
ATOM   4127  O  OE2   . GLU B  1 247  ? 198.796 207.570 159.733 1.00 112.20 ? 241  GLU D OE2   1 
ATOM   4128  N  N     . ASN B  1 248  ? 198.476 206.741 163.927 1.00 118.65 ? 242  ASN D N     1 
ATOM   4129  C  CA    . ASN B  1 248  ? 199.656 206.209 164.586 1.00 118.65 ? 242  ASN D CA    1 
ATOM   4130  C  C     . ASN B  1 248  ? 200.449 205.385 163.588 1.00 118.65 ? 242  ASN D C     1 
ATOM   4131  O  O     . ASN B  1 248  ? 199.887 204.612 162.810 1.00 118.65 ? 242  ASN D O     1 
ATOM   4132  C  CB    . ASN B  1 248  ? 199.288 205.359 165.803 1.00 118.65 ? 242  ASN D CB    1 
ATOM   4133  C  CG    . ASN B  1 248  ? 200.490 205.004 166.639 1.00 118.65 ? 242  ASN D CG    1 
ATOM   4134  O  OD1   . ASN B  1 248  ? 201.617 205.370 166.308 1.00 118.65 ? 242  ASN D OD1   1 
ATOM   4135  N  ND2   . ASN B  1 248  ? 200.262 204.290 167.733 1.00 118.65 ? 242  ASN D ND2   1 
ATOM   4136  N  N     . GLY B  1 249  ? 201.771 205.562 163.623 1.00 116.62 ? 243  GLY D N     1 
ATOM   4137  C  CA    . GLY B  1 249  ? 202.628 204.887 162.664 1.00 116.62 ? 243  GLY D CA    1 
ATOM   4138  C  C     . GLY B  1 249  ? 202.397 203.392 162.613 1.00 116.62 ? 243  GLY D C     1 
ATOM   4139  O  O     . GLY B  1 249  ? 202.479 202.783 161.546 1.00 116.62 ? 243  GLY D O     1 
ATOM   4140  N  N     . VAL B  1 250  ? 202.095 202.787 163.753 1.00 113.35 ? 244  VAL D N     1 
ATOM   4141  C  CA    . VAL B  1 250  ? 201.682 201.392 163.782 1.00 113.35 ? 244  VAL D CA    1 
ATOM   4142  C  C     . VAL B  1 250  ? 200.231 201.251 163.359 1.00 113.35 ? 244  VAL D C     1 
ATOM   4143  O  O     . VAL B  1 250  ? 199.853 200.296 162.676 1.00 113.35 ? 244  VAL D O     1 
ATOM   4144  C  CB    . VAL B  1 250  ? 201.916 200.808 165.190 1.00 113.35 ? 244  VAL D CB    1 
ATOM   4145  C  CG1   . VAL B  1 250  ? 201.403 199.383 165.269 1.00 113.35 ? 244  VAL D CG1   1 
ATOM   4146  C  CG2   . VAL B  1 250  ? 203.388 200.870 165.549 1.00 113.35 ? 244  VAL D CG2   1 
ATOM   4147  N  N     . GLY B  1 251  ? 199.407 202.218 163.741 1.00 108.97 ? 245  GLY D N     1 
ATOM   4148  C  CA    . GLY B  1 251  ? 197.973 202.137 163.573 1.00 108.97 ? 245  GLY D CA    1 
ATOM   4149  C  C     . GLY B  1 251  ? 197.228 201.911 164.864 1.00 108.97 ? 245  GLY D C     1 
ATOM   4150  O  O     . GLY B  1 251  ? 196.015 202.157 164.916 1.00 108.97 ? 245  GLY D O     1 
ATOM   4151  N  N     . GLY B  1 252  ? 197.906 201.462 165.915 1.00 109.72 ? 246  GLY D N     1 
ATOM   4152  C  CA    . GLY B  1 252  ? 197.256 201.222 167.185 1.00 109.72 ? 246  GLY D CA    1 
ATOM   4153  C  C     . GLY B  1 252  ? 196.904 202.507 167.901 1.00 109.72 ? 246  GLY D C     1 
ATOM   4154  O  O     . GLY B  1 252  ? 197.064 203.596 167.346 1.00 109.72 ? 246  GLY D O     1 
ATOM   4155  N  N     . ASN B  1 253  ? 196.442 202.394 169.144 1.00 105.86 ? 247  ASN D N     1 
ATOM   4156  C  CA    . ASN B  1 253  ? 195.955 203.561 169.864 1.00 105.86 ? 247  ASN D CA    1 
ATOM   4157  C  C     . ASN B  1 253  ? 196.759 203.865 171.118 1.00 105.86 ? 247  ASN D C     1 
ATOM   4158  O  O     . ASN B  1 253  ? 196.394 204.785 171.858 1.00 105.86 ? 247  ASN D O     1 
ATOM   4159  C  CB    . ASN B  1 253  ? 194.481 203.377 170.222 1.00 105.86 ? 247  ASN D CB    1 
ATOM   4160  C  CG    . ASN B  1 253  ? 193.579 203.401 169.004 1.00 105.86 ? 247  ASN D CG    1 
ATOM   4161  O  OD1   . ASN B  1 253  ? 193.010 202.383 168.617 1.00 105.86 ? 247  ASN D OD1   1 
ATOM   4162  N  ND2   . ASN B  1 253  ? 193.427 204.575 168.408 1.00 105.86 ? 247  ASN D ND2   1 
ATOM   4163  N  N     . SER B  1 254  ? 197.834 203.135 171.380 1.00 107.04 ? 248  SER D N     1 
ATOM   4164  C  CA    . SER B  1 254  ? 198.690 203.407 172.523 1.00 107.04 ? 248  SER D CA    1 
ATOM   4165  C  C     . SER B  1 254  ? 199.638 204.550 172.202 1.00 107.04 ? 248  SER D C     1 
ATOM   4166  O  O     . SER B  1 254  ? 200.041 204.733 171.052 1.00 107.04 ? 248  SER D O     1 
ATOM   4167  C  CB    . SER B  1 254  ? 199.493 202.165 172.905 1.00 107.04 ? 248  SER D CB    1 
ATOM   4168  O  OG    . SER B  1 254  ? 198.640 201.121 173.336 1.00 107.04 ? 248  SER D OG    1 
ATOM   4169  N  N     . ILE B  1 255  ? 199.986 205.321 173.229 1.00 101.52 ? 249  ILE D N     1 
ATOM   4170  C  CA    . ILE B  1 255  ? 200.993 206.360 173.125 1.00 101.52 ? 249  ILE D CA    1 
ATOM   4171  C  C     . ILE B  1 255  ? 201.989 206.176 174.263 1.00 101.52 ? 249  ILE D C     1 
ATOM   4172  O  O     . ILE B  1 255  ? 201.844 205.295 175.109 1.00 101.52 ? 249  ILE D O     1 
ATOM   4173  C  CB    . ILE B  1 255  ? 200.391 207.776 173.167 1.00 101.52 ? 249  ILE D CB    1 
ATOM   4174  C  CG1   . ILE B  1 255  ? 199.845 208.059 174.559 1.00 101.52 ? 249  ILE D CG1   1 
ATOM   4175  C  CG2   . ILE B  1 255  ? 199.284 207.913 172.150 1.00 101.52 ? 249  ILE D CG2   1 
ATOM   4176  C  CD1   . ILE B  1 255  ? 199.556 209.508 174.805 1.00 101.52 ? 249  ILE D CD1   1 
ATOM   4177  N  N     . PHE B  1 256  ? 203.005 207.035 174.278 1.00 112.73 ? 250  PHE D N     1 
ATOM   4178  C  CA    . PHE B  1 256  ? 204.000 207.078 175.351 1.00 112.73 ? 250  PHE D CA    1 
ATOM   4179  C  C     . PHE B  1 256  ? 204.168 208.547 175.725 1.00 112.73 ? 250  PHE D C     1 
ATOM   4180  O  O     . PHE B  1 256  ? 205.011 209.251 175.163 1.00 112.73 ? 250  PHE D O     1 
ATOM   4181  C  CB    . PHE B  1 256  ? 205.311 206.446 174.915 1.00 112.73 ? 250  PHE D CB    1 
ATOM   4182  C  CG    . PHE B  1 256  ? 206.400 206.540 175.935 1.00 112.73 ? 250  PHE D CG    1 
ATOM   4183  C  CD1   . PHE B  1 256  ? 206.378 205.757 177.071 1.00 112.73 ? 250  PHE D CD1   1 
ATOM   4184  C  CD2   . PHE B  1 256  ? 207.461 207.402 175.746 1.00 112.73 ? 250  PHE D CD2   1 
ATOM   4185  C  CE1   . PHE B  1 256  ? 207.391 205.843 178.005 1.00 112.73 ? 250  PHE D CE1   1 
ATOM   4186  C  CE2   . PHE B  1 256  ? 208.472 207.487 176.674 1.00 112.73 ? 250  PHE D CE2   1 
ATOM   4187  C  CZ    . PHE B  1 256  ? 208.437 206.707 177.805 1.00 112.73 ? 250  PHE D CZ    1 
ATOM   4188  N  N     . LEU B  1 257  ? 203.356 209.002 176.673 1.00 118.34 ? 251  LEU D N     1 
ATOM   4189  C  CA    . LEU B  1 257  ? 203.295 210.415 177.027 1.00 118.34 ? 251  LEU D CA    1 
ATOM   4190  C  C     . LEU B  1 257  ? 204.270 210.713 178.156 1.00 118.34 ? 251  LEU D C     1 
ATOM   4191  O  O     . LEU B  1 257  ? 204.025 210.353 179.313 1.00 118.34 ? 251  LEU D O     1 
ATOM   4192  C  CB    . LEU B  1 257  ? 201.880 210.814 177.422 1.00 118.34 ? 251  LEU D CB    1 
ATOM   4193  C  CG    . LEU B  1 257  ? 201.784 212.284 177.820 1.00 118.34 ? 251  LEU D CG    1 
ATOM   4194  C  CD1   . LEU B  1 257  ? 202.252 213.158 176.683 1.00 118.34 ? 251  LEU D CD1   1 
ATOM   4195  C  CD2   . LEU B  1 257  ? 200.357 212.622 178.178 1.00 118.34 ? 251  LEU D CD2   1 
ATOM   4196  N  N     . VAL B  1 258  ? 205.366 211.381 177.822 1.00 120.65 ? 252  VAL D N     1 
ATOM   4197  C  CA    . VAL B  1 258  ? 206.248 211.939 178.834 1.00 120.65 ? 252  VAL D CA    1 
ATOM   4198  C  C     . VAL B  1 258  ? 206.211 213.448 178.671 1.00 120.65 ? 252  VAL D C     1 
ATOM   4199  O  O     . VAL B  1 258  ? 205.793 214.172 179.581 1.00 120.65 ? 252  VAL D O     1 
ATOM   4200  C  CB    . VAL B  1 258  ? 207.673 211.380 178.709 1.00 120.65 ? 252  VAL D CB    1 
ATOM   4201  C  CG1   . VAL B  1 258  ? 208.606 212.089 179.667 1.00 120.65 ? 252  VAL D CG1   1 
ATOM   4202  C  CG2   . VAL B  1 258  ? 207.659 209.901 178.992 1.00 120.65 ? 252  VAL D CG2   1 
ATOM   4203  N  N     . ALA B  1 259  ? 206.616 213.920 177.523 1.00 119.52 ? 253  ALA D N     1 
ATOM   4204  C  CA    . ALA B  1 259  ? 206.401 215.330 177.262 1.00 119.52 ? 253  ALA D CA    1 
ATOM   4205  C  C     . ALA B  1 259  ? 205.050 215.537 176.594 1.00 119.52 ? 253  ALA D C     1 
ATOM   4206  O  O     . ALA B  1 259  ? 204.720 214.852 175.622 1.00 119.52 ? 253  ALA D O     1 
ATOM   4207  C  CB    . ALA B  1 259  ? 207.505 215.892 176.362 1.00 119.52 ? 253  ALA D CB    1 
ATOM   4208  N  N     . PRO B  1 260  ? 204.261 216.479 177.098 1.00 119.58 ? 254  PRO D N     1 
ATOM   4209  C  CA    . PRO B  1 260  ? 202.904 216.675 176.573 1.00 119.58 ? 254  PRO D CA    1 
ATOM   4210  C  C     . PRO B  1 260  ? 202.872 216.914 175.075 1.00 119.58 ? 254  PRO D C     1 
ATOM   4211  O  O     . PRO B  1 260  ? 203.334 217.944 174.576 1.00 119.58 ? 254  PRO D O     1 
ATOM   4212  C  CB    . PRO B  1 260  ? 202.400 217.894 177.357 1.00 119.58 ? 254  PRO D CB    1 
ATOM   4213  C  CG    . PRO B  1 260  ? 203.620 218.575 177.846 1.00 119.58 ? 254  PRO D CG    1 
ATOM   4214  C  CD    . PRO B  1 260  ? 204.611 217.483 178.109 1.00 119.58 ? 254  PRO D CD    1 
ATOM   4215  N  N     . LEU B  1 261  ? 202.307 215.951 174.354 1.00 110.86 ? 255  LEU D N     1 
ATOM   4216  C  CA    . LEU B  1 261  ? 202.395 215.897 172.907 1.00 110.86 ? 255  LEU D CA    1 
ATOM   4217  C  C     . LEU B  1 261  ? 201.045 216.218 172.268 1.00 110.86 ? 255  LEU D C     1 
ATOM   4218  O  O     . LEU B  1 261  ? 200.078 216.583 172.939 1.00 110.86 ? 255  LEU D O     1 
ATOM   4219  C  CB    . LEU B  1 261  ? 202.923 214.527 172.486 1.00 110.86 ? 255  LEU D CB    1 
ATOM   4220  C  CG    . LEU B  1 261  ? 202.150 213.299 172.974 1.00 110.86 ? 255  LEU D CG    1 
ATOM   4221  C  CD1   . LEU B  1 261  ? 201.047 212.915 172.007 1.00 110.86 ? 255  LEU D CD1   1 
ATOM   4222  C  CD2   . LEU B  1 261  ? 203.085 212.132 173.224 1.00 110.86 ? 255  LEU D CD2   1 
ATOM   4223  N  N     . ILE B  1 262  ? 200.979 216.077 170.948 1.00 111.08 ? 256  ILE D N     1 
ATOM   4224  C  CA    . ILE B  1 262  ? 199.782 216.382 170.174 1.00 111.08 ? 256  ILE D CA    1 
ATOM   4225  C  C     . ILE B  1 262  ? 199.182 215.078 169.671 1.00 111.08 ? 256  ILE D C     1 
ATOM   4226  O  O     . ILE B  1 262  ? 199.876 214.262 169.053 1.00 111.08 ? 256  ILE D O     1 
ATOM   4227  C  CB    . ILE B  1 262  ? 200.073 217.334 169.007 1.00 111.08 ? 256  ILE D CB    1 
ATOM   4228  C  CG1   . ILE B  1 262  ? 200.416 218.729 169.529 1.00 111.08 ? 256  ILE D CG1   1 
ATOM   4229  C  CG2   . ILE B  1 262  ? 198.899 217.384 168.048 1.00 111.08 ? 256  ILE D CG2   1 
ATOM   4230  C  CD1   . ILE B  1 262  ? 200.900 219.679 168.460 1.00 111.08 ? 256  ILE D CD1   1 
ATOM   4231  N  N     . ILE B  1 263  ? 197.890 214.879 169.940 1.00 114.71 ? 257  ILE D N     1 
ATOM   4232  C  CA    . ILE B  1 263  ? 197.143 213.793 169.320 1.00 114.71 ? 257  ILE D CA    1 
ATOM   4233  C  C     . ILE B  1 263  ? 196.432 214.325 168.088 1.00 114.71 ? 257  ILE D C     1 
ATOM   4234  O  O     . ILE B  1 263  ? 195.918 215.451 168.085 1.00 114.71 ? 257  ILE D O     1 
ATOM   4235  C  CB    . ILE B  1 263  ? 196.144 213.195 170.322 1.00 114.71 ? 257  ILE D CB    1 
ATOM   4236  C  CG1   . ILE B  1 263  ? 196.891 212.625 171.518 1.00 114.71 ? 257  ILE D CG1   1 
ATOM   4237  C  CG2   . ILE B  1 263  ? 195.312 212.115 169.664 1.00 114.71 ? 257  ILE D CG2   1 
ATOM   4238  C  CD1   . ILE B  1 263  ? 197.839 211.514 171.143 1.00 114.71 ? 257  ILE D CD1   1 
ATOM   4239  N  N     . TYR B  1 264  ? 196.396 213.525 167.026 1.00 107.82 ? 258  TYR D N     1 
ATOM   4240  C  CA    . TYR B  1 264  ? 195.826 214.028 165.791 1.00 107.82 ? 258  TYR D CA    1 
ATOM   4241  C  C     . TYR B  1 264  ? 195.197 212.910 164.980 1.00 107.82 ? 258  TYR D C     1 
ATOM   4242  O  O     . TYR B  1 264  ? 195.675 211.771 164.978 1.00 107.82 ? 258  TYR D O     1 
ATOM   4243  C  CB    . TYR B  1 264  ? 196.875 214.744 164.947 1.00 107.82 ? 258  TYR D CB    1 
ATOM   4244  C  CG    . TYR B  1 264  ? 197.958 213.869 164.375 1.00 107.82 ? 258  TYR D CG    1 
ATOM   4245  C  CD1   . TYR B  1 264  ? 199.096 213.573 165.105 1.00 107.82 ? 258  TYR D CD1   1 
ATOM   4246  C  CD2   . TYR B  1 264  ? 197.864 213.378 163.083 1.00 107.82 ? 258  TYR D CD2   1 
ATOM   4247  C  CE1   . TYR B  1 264  ? 200.097 212.787 164.574 1.00 107.82 ? 258  TYR D CE1   1 
ATOM   4248  C  CE2   . TYR B  1 264  ? 198.861 212.599 162.542 1.00 107.82 ? 258  TYR D CE2   1 
ATOM   4249  C  CZ    . TYR B  1 264  ? 199.975 212.305 163.291 1.00 107.82 ? 258  TYR D CZ    1 
ATOM   4250  O  OH    . TYR B  1 264  ? 200.971 211.522 162.756 1.00 107.82 ? 258  TYR D OH    1 
ATOM   4251  N  N     . HIS B  1 265  ? 194.131 213.260 164.274 1.00 109.45 ? 259  HIS D N     1 
ATOM   4252  C  CA    . HIS B  1 265  ? 193.487 212.379 163.318 1.00 109.45 ? 259  HIS D CA    1 
ATOM   4253  C  C     . HIS B  1 265  ? 193.630 212.932 161.910 1.00 109.45 ? 259  HIS D C     1 
ATOM   4254  O  O     . HIS B  1 265  ? 193.367 214.112 161.666 1.00 109.45 ? 259  HIS D O     1 
ATOM   4255  C  CB    . HIS B  1 265  ? 192.012 212.203 163.615 1.00 109.45 ? 259  HIS D CB    1 
ATOM   4256  C  CG    . HIS B  1 265  ? 191.295 211.428 162.561 1.00 109.45 ? 259  HIS D CG    1 
ATOM   4257  N  ND1   . HIS B  1 265  ? 191.396 210.059 162.445 1.00 109.45 ? 259  HIS D ND1   1 
ATOM   4258  C  CD2   . HIS B  1 265  ? 190.520 211.837 161.530 1.00 109.45 ? 259  HIS D CD2   1 
ATOM   4259  C  CE1   . HIS B  1 265  ? 190.683 209.654 161.411 1.00 109.45 ? 259  HIS D CE1   1 
ATOM   4260  N  NE2   . HIS B  1 265  ? 190.137 210.713 160.842 1.00 109.45 ? 259  HIS D NE2   1 
ATOM   4261  N  N     . VAL B  1 266  ? 194.024 212.064 160.984 1.00 112.62 ? 260  VAL D N     1 
ATOM   4262  C  CA    . VAL B  1 266  ? 194.074 212.401 159.568 1.00 112.62 ? 260  VAL D CA    1 
ATOM   4263  C  C     . VAL B  1 266  ? 192.681 212.176 158.997 1.00 112.62 ? 260  VAL D C     1 
ATOM   4264  O  O     . VAL B  1 266  ? 192.129 211.079 159.098 1.00 112.62 ? 260  VAL D O     1 
ATOM   4265  C  CB    . VAL B  1 266  ? 195.122 211.564 158.828 1.00 112.62 ? 260  VAL D CB    1 
ATOM   4266  C  CG1   . VAL B  1 266  ? 195.077 211.860 157.341 1.00 112.62 ? 260  VAL D CG1   1 
ATOM   4267  C  CG2   . VAL B  1 266  ? 196.498 211.847 159.385 1.00 112.62 ? 260  VAL D CG2   1 
ATOM   4268  N  N     . ILE B  1 267  ? 192.115 213.211 158.386 1.00 121.54 ? 261  ILE D N     1 
ATOM   4269  C  CA    . ILE B  1 267  ? 190.732 213.166 157.925 1.00 121.54 ? 261  ILE D CA    1 
ATOM   4270  C  C     . ILE B  1 267  ? 190.657 212.518 156.550 1.00 121.54 ? 261  ILE D C     1 
ATOM   4271  O  O     . ILE B  1 267  ? 190.916 213.167 155.532 1.00 121.54 ? 261  ILE D O     1 
ATOM   4272  C  CB    . ILE B  1 267  ? 190.128 214.576 157.898 1.00 121.54 ? 261  ILE D CB    1 
ATOM   4273  C  CG1   . ILE B  1 267  ? 190.256 215.215 159.275 1.00 121.54 ? 261  ILE D CG1   1 
ATOM   4274  C  CG2   . ILE B  1 267  ? 188.672 214.514 157.501 1.00 121.54 ? 261  ILE D CG2   1 
ATOM   4275  C  CD1   . ILE B  1 267  ? 190.001 216.695 159.273 1.00 121.54 ? 261  ILE D CD1   1 
ATOM   4276  N  N     . ASP B  1 268  ? 190.288 211.244 156.509 1.00 139.18 ? 262  ASP D N     1 
ATOM   4277  C  CA    . ASP B  1 268  ? 190.199 210.484 155.272 1.00 139.18 ? 262  ASP D CA    1 
ATOM   4278  C  C     . ASP B  1 268  ? 188.742 210.356 154.839 1.00 139.18 ? 262  ASP D C     1 
ATOM   4279  O  O     . ASP B  1 268  ? 187.813 210.638 155.599 1.00 139.18 ? 262  ASP D O     1 
ATOM   4280  C  CB    . ASP B  1 268  ? 190.841 209.106 155.440 1.00 139.18 ? 262  ASP D CB    1 
ATOM   4281  N  N     . ALA B  1 269  ? 188.551 209.908 153.596 1.00 133.62 ? 263  ALA D N     1 
ATOM   4282  C  CA    . ALA B  1 269  ? 187.203 209.765 153.060 1.00 133.62 ? 263  ALA D CA    1 
ATOM   4283  C  C     . ALA B  1 269  ? 186.372 208.786 153.877 1.00 133.62 ? 263  ALA D C     1 
ATOM   4284  O  O     . ALA B  1 269  ? 185.143 208.755 153.746 1.00 133.62 ? 263  ALA D O     1 
ATOM   4285  C  CB    . ALA B  1 269  ? 187.262 209.325 151.599 1.00 133.62 ? 263  ALA D CB    1 
ATOM   4286  N  N     . ASN B  1 270  ? 187.017 207.970 154.711 1.00 139.39 ? 264  ASN D N     1 
ATOM   4287  C  CA    . ASN B  1 270  ? 186.298 207.124 155.652 1.00 139.39 ? 264  ASN D CA    1 
ATOM   4288  C  C     . ASN B  1 270  ? 186.014 207.825 156.969 1.00 139.39 ? 264  ASN D C     1 
ATOM   4289  O  O     . ASN B  1 270  ? 185.112 207.395 157.698 1.00 139.39 ? 264  ASN D O     1 
ATOM   4290  C  CB    . ASN B  1 270  ? 187.084 205.842 155.919 1.00 139.39 ? 264  ASN D CB    1 
ATOM   4291  C  CG    . ASN B  1 270  ? 187.179 204.956 154.696 1.00 139.39 ? 264  ASN D CG    1 
ATOM   4292  O  OD1   . ASN B  1 270  ? 188.257 204.772 154.133 1.00 139.39 ? 264  ASN D OD1   1 
ATOM   4293  N  ND2   . ASN B  1 270  ? 186.052 204.389 154.287 1.00 139.39 ? 264  ASN D ND2   1 
ATOM   4294  N  N     . SER B  1 271  ? 186.748 208.874 157.293 1.00 130.23 ? 265  SER D N     1 
ATOM   4295  C  CA    . SER B  1 271  ? 186.436 209.604 158.509 1.00 130.23 ? 265  SER D CA    1 
ATOM   4296  C  C     . SER B  1 271  ? 185.126 210.366 158.341 1.00 130.23 ? 265  SER D C     1 
ATOM   4297  O  O     . SER B  1 271  ? 184.879 210.946 157.282 1.00 130.23 ? 265  SER D O     1 
ATOM   4298  C  CB    . SER B  1 271  ? 187.551 210.586 158.846 1.00 130.23 ? 265  SER D CB    1 
ATOM   4299  O  OG    . SER B  1 271  ? 187.204 211.355 159.983 1.00 130.23 ? 265  SER D OG    1 
ATOM   4300  N  N     . PRO B  1 272  ? 184.268 210.372 159.360 1.00 124.03 ? 266  PRO D N     1 
ATOM   4301  C  CA    . PRO B  1 272  ? 183.032 211.159 159.257 1.00 124.03 ? 266  PRO D CA    1 
ATOM   4302  C  C     . PRO B  1 272  ? 183.294 212.638 159.086 1.00 124.03 ? 266  PRO D C     1 
ATOM   4303  O  O     . PRO B  1 272  ? 182.464 213.347 158.508 1.00 124.03 ? 266  PRO D O     1 
ATOM   4304  C  CB    . PRO B  1 272  ? 182.317 210.863 160.581 1.00 124.03 ? 266  PRO D CB    1 
ATOM   4305  C  CG    . PRO B  1 272  ? 182.897 209.575 161.043 1.00 124.03 ? 266  PRO D CG    1 
ATOM   4306  C  CD    . PRO B  1 272  ? 184.328 209.601 160.609 1.00 124.03 ? 266  PRO D CD    1 
ATOM   4307  N  N     . LEU B  1 273  ? 184.435 213.123 159.567 1.00 126.91 ? 267  LEU D N     1 
ATOM   4308  C  CA    . LEU B  1 273  ? 184.817 214.518 159.440 1.00 126.91 ? 267  LEU D CA    1 
ATOM   4309  C  C     . LEU B  1 273  ? 185.255 214.880 158.035 1.00 126.91 ? 267  LEU D C     1 
ATOM   4310  O  O     . LEU B  1 273  ? 185.721 216.000 157.805 1.00 126.91 ? 267  LEU D O     1 
ATOM   4311  C  CB    . LEU B  1 273  ? 185.937 214.845 160.424 1.00 126.91 ? 267  LEU D CB    1 
ATOM   4312  C  CG    . LEU B  1 273  ? 185.541 215.075 161.881 1.00 126.91 ? 267  LEU D CG    1 
ATOM   4313  C  CD1   . LEU B  1 273  ? 185.110 213.779 162.543 1.00 126.91 ? 267  LEU D CD1   1 
ATOM   4314  C  CD2   . LEU B  1 273  ? 186.700 215.701 162.637 1.00 126.91 ? 267  LEU D CD2   1 
ATOM   4315  N  N     . TYR B  1 274  ? 185.123 213.956 157.089 1.00 139.99 ? 268  TYR D N     1 
ATOM   4316  C  CA    . TYR B  1 274  ? 185.533 214.234 155.723 1.00 139.99 ? 268  TYR D CA    1 
ATOM   4317  C  C     . TYR B  1 274  ? 184.541 215.129 154.994 1.00 139.99 ? 268  TYR D C     1 
ATOM   4318  O  O     . TYR B  1 274  ? 184.846 215.597 153.893 1.00 139.99 ? 268  TYR D O     1 
ATOM   4319  C  CB    . TYR B  1 274  ? 185.727 212.914 154.984 1.00 139.99 ? 268  TYR D CB    1 
ATOM   4320  C  CG    . TYR B  1 274  ? 186.331 213.054 153.620 1.00 139.99 ? 268  TYR D CG    1 
ATOM   4321  C  CD1   . TYR B  1 274  ? 187.675 213.333 153.467 1.00 139.99 ? 268  TYR D CD1   1 
ATOM   4322  C  CD2   . TYR B  1 274  ? 185.557 212.896 152.483 1.00 139.99 ? 268  TYR D CD2   1 
ATOM   4323  C  CE1   . TYR B  1 274  ? 188.231 213.462 152.225 1.00 139.99 ? 268  TYR D CE1   1 
ATOM   4324  C  CE2   . TYR B  1 274  ? 186.102 213.019 151.238 1.00 139.99 ? 268  TYR D CE2   1 
ATOM   4325  C  CZ    . TYR B  1 274  ? 187.438 213.303 151.112 1.00 139.99 ? 268  TYR D CZ    1 
ATOM   4326  O  OH    . TYR B  1 274  ? 187.972 213.424 149.857 1.00 139.99 ? 268  TYR D OH    1 
ATOM   4327  N  N     . ASP B  1 275  ? 183.371 215.382 155.580 1.00 142.78 ? 269  ASP D N     1 
ATOM   4328  C  CA    . ASP B  1 275  ? 182.431 216.364 155.058 1.00 142.78 ? 269  ASP D CA    1 
ATOM   4329  C  C     . ASP B  1 275  ? 182.489 217.674 155.831 1.00 142.78 ? 269  ASP D C     1 
ATOM   4330  O  O     . ASP B  1 275  ? 181.736 218.606 155.531 1.00 142.78 ? 269  ASP D O     1 
ATOM   4331  C  CB    . ASP B  1 275  ? 181.009 215.807 155.071 1.00 142.78 ? 269  ASP D CB    1 
ATOM   4332  C  CG    . ASP B  1 275  ? 180.793 214.738 154.026 1.00 142.78 ? 269  ASP D CG    1 
ATOM   4333  O  OD1   . ASP B  1 275  ? 181.476 214.782 152.982 1.00 142.78 ? 269  ASP D OD1   1 
ATOM   4334  O  OD2   . ASP B  1 275  ? 179.934 213.861 154.242 1.00 142.78 ? 269  ASP D OD2   1 
ATOM   4335  N  N     . LEU B  1 276  ? 183.373 217.765 156.817 1.00 140.03 ? 270  LEU D N     1 
ATOM   4336  C  CA    . LEU B  1 276  ? 183.499 218.976 157.611 1.00 140.03 ? 270  LEU D CA    1 
ATOM   4337  C  C     . LEU B  1 276  ? 184.179 220.074 156.804 1.00 140.03 ? 270  LEU D C     1 
ATOM   4338  O  O     . LEU B  1 276  ? 185.029 219.805 155.952 1.00 140.03 ? 270  LEU D O     1 
ATOM   4339  C  CB    . LEU B  1 276  ? 184.284 218.692 158.892 1.00 140.03 ? 270  LEU D CB    1 
ATOM   4340  C  CG    . LEU B  1 276  ? 184.372 219.789 159.952 1.00 140.03 ? 270  LEU D CG    1 
ATOM   4341  C  CD1   . LEU B  1 276  ? 184.460 219.153 161.317 1.00 140.03 ? 270  LEU D CD1   1 
ATOM   4342  C  CD2   . LEU B  1 276  ? 185.577 220.692 159.725 1.00 140.03 ? 270  LEU D CD2   1 
ATOM   4343  N  N     . ALA B  1 277  ? 183.793 221.310 157.080 1.00 136.08 ? 271  ALA D N     1 
ATOM   4344  C  CA    . ALA B  1 277  ? 184.349 222.500 156.461 1.00 136.08 ? 271  ALA D CA    1 
ATOM   4345  C  C     . ALA B  1 277  ? 184.567 223.532 157.550 1.00 136.08 ? 271  ALA D C     1 
ATOM   4346  O  O     . ALA B  1 277  ? 183.928 223.470 158.605 1.00 136.08 ? 271  ALA D O     1 
ATOM   4347  C  CB    . ALA B  1 277  ? 183.410 223.071 155.390 1.00 136.08 ? 271  ALA D CB    1 
ATOM   4348  N  N     . PRO B  1 278  ? 185.458 224.491 157.332 1.00 129.60 ? 272  PRO D N     1 
ATOM   4349  C  CA    . PRO B  1 278  ? 185.516 225.641 158.231 1.00 129.60 ? 272  PRO D CA    1 
ATOM   4350  C  C     . PRO B  1 278  ? 184.202 226.394 158.183 1.00 129.60 ? 272  PRO D C     1 
ATOM   4351  O  O     . PRO B  1 278  ? 183.423 226.281 157.236 1.00 129.60 ? 272  PRO D O     1 
ATOM   4352  C  CB    . PRO B  1 278  ? 186.663 226.482 157.677 1.00 129.60 ? 272  PRO D CB    1 
ATOM   4353  C  CG    . PRO B  1 278  ? 186.725 226.116 156.261 1.00 129.60 ? 272  PRO D CG    1 
ATOM   4354  C  CD    . PRO B  1 278  ? 186.355 224.665 156.179 1.00 129.60 ? 272  PRO D CD    1 
ATOM   4355  N  N     . SER B  1 279  ? 183.933 227.117 159.266 1.00 155.16 ? 273  SER D N     1 
ATOM   4356  C  CA    . SER B  1 279  ? 182.750 227.960 159.402 1.00 155.16 ? 273  SER D CA    1 
ATOM   4357  C  C     . SER B  1 279  ? 181.502 227.095 159.525 1.00 155.16 ? 273  SER D C     1 
ATOM   4358  O  O     . SER B  1 279  ? 180.410 227.600 159.803 1.00 155.16 ? 273  SER D O     1 
ATOM   4359  C  CB    . SER B  1 279  ? 182.619 228.938 158.230 1.00 155.16 ? 273  SER D CB    1 
ATOM   4360  O  OG    . SER B  1 279  ? 182.316 228.257 157.024 1.00 155.16 ? 273  SER D OG    1 
ATOM   4361  N  N     . ASP B  1 280  ? 181.658 225.786 159.322 1.00 150.24 ? 274  ASP D N     1 
ATOM   4362  C  CA    . ASP B  1 280  ? 180.618 224.853 159.727 1.00 150.24 ? 274  ASP D CA    1 
ATOM   4363  C  C     . ASP B  1 280  ? 180.705 224.602 161.222 1.00 150.24 ? 274  ASP D C     1 
ATOM   4364  O  O     . ASP B  1 280  ? 179.684 224.383 161.883 1.00 150.24 ? 274  ASP D O     1 
ATOM   4365  C  CB    . ASP B  1 280  ? 180.752 223.549 158.937 1.00 150.24 ? 274  ASP D CB    1 
ATOM   4366  C  CG    . ASP B  1 280  ? 179.537 222.650 159.069 1.00 150.24 ? 274  ASP D CG    1 
ATOM   4367  O  OD1   . ASP B  1 280  ? 178.582 223.025 159.778 1.00 150.24 ? 274  ASP D OD1   1 
ATOM   4368  O  OD2   . ASP B  1 280  ? 179.534 221.565 158.451 1.00 150.24 ? 274  ASP D OD2   1 
ATOM   4369  N  N     . LEU B  1 281  ? 181.914 224.663 161.770 1.00 131.26 ? 275  LEU D N     1 
ATOM   4370  C  CA    . LEU B  1 281  ? 182.121 224.543 163.202 1.00 131.26 ? 275  LEU D CA    1 
ATOM   4371  C  C     . LEU B  1 281  ? 181.647 225.808 163.902 1.00 131.26 ? 275  LEU D C     1 
ATOM   4372  O  O     . LEU B  1 281  ? 181.946 226.922 163.463 1.00 131.26 ? 275  LEU D O     1 
ATOM   4373  C  CB    . LEU B  1 281  ? 183.596 224.266 163.500 1.00 131.26 ? 275  LEU D CB    1 
ATOM   4374  C  CG    . LEU B  1 281  ? 184.673 225.249 163.028 1.00 131.26 ? 275  LEU D CG    1 
ATOM   4375  C  CD1   . LEU B  1 281  ? 184.968 226.329 164.058 1.00 131.26 ? 275  LEU D CD1   1 
ATOM   4376  C  CD2   . LEU B  1 281  ? 185.943 224.503 162.651 1.00 131.26 ? 275  LEU D CD2   1 
ATOM   4377  N  N     . HIS B  1 282  ? 180.886 225.625 164.976 1.00 145.70 ? 276  HIS D N     1 
ATOM   4378  C  CA    . HIS B  1 282  ? 180.373 226.705 165.809 1.00 145.70 ? 276  HIS D CA    1 
ATOM   4379  C  C     . HIS B  1 282  ? 179.617 226.072 166.967 1.00 145.70 ? 276  HIS D C     1 
ATOM   4380  O  O     . HIS B  1 282  ? 179.197 224.915 166.898 1.00 145.70 ? 276  HIS D O     1 
ATOM   4381  C  CB    . HIS B  1 282  ? 179.480 227.667 165.021 1.00 145.70 ? 276  HIS D CB    1 
ATOM   4382  C  CG    . HIS B  1 282  ? 178.299 227.012 164.376 1.00 145.70 ? 276  HIS D CG    1 
ATOM   4383  N  ND1   . HIS B  1 282  ? 178.378 226.379 163.156 1.00 145.70 ? 276  HIS D ND1   1 
ATOM   4384  C  CD2   . HIS B  1 282  ? 177.013 226.897 164.780 1.00 145.70 ? 276  HIS D CD2   1 
ATOM   4385  C  CE1   . HIS B  1 282  ? 177.186 225.908 162.831 1.00 145.70 ? 276  HIS D CE1   1 
ATOM   4386  N  NE2   . HIS B  1 282  ? 176.343 226.200 163.805 1.00 145.70 ? 276  HIS D NE2   1 
ATOM   4387  N  N     . HIS B  1 283  ? 179.434 226.852 168.034 1.00 160.78 ? 277  HIS D N     1 
ATOM   4388  C  CA    . HIS B  1 283  ? 178.837 226.294 169.241 1.00 160.78 ? 277  HIS D CA    1 
ATOM   4389  C  C     . HIS B  1 283  ? 177.372 225.920 169.057 1.00 160.78 ? 277  HIS D C     1 
ATOM   4390  O  O     . HIS B  1 283  ? 176.742 225.452 170.009 1.00 160.78 ? 277  HIS D O     1 
ATOM   4391  C  CB    . HIS B  1 283  ? 178.968 227.266 170.414 1.00 160.78 ? 277  HIS D CB    1 
ATOM   4392  C  CG    . HIS B  1 283  ? 178.569 226.668 171.729 1.00 160.78 ? 277  HIS D CG    1 
ATOM   4393  N  ND1   . HIS B  1 283  ? 177.257 226.610 172.149 1.00 160.78 ? 277  HIS D ND1   1 
ATOM   4394  C  CD2   . HIS B  1 283  ? 179.302 226.090 172.708 1.00 160.78 ? 277  HIS D CD2   1 
ATOM   4395  C  CE1   . HIS B  1 283  ? 177.201 226.025 173.331 1.00 160.78 ? 277  HIS D CE1   1 
ATOM   4396  N  NE2   . HIS B  1 283  ? 178.428 225.703 173.694 1.00 160.78 ? 277  HIS D NE2   1 
ATOM   4397  N  N     . HIS B  1 284  ? 176.803 226.126 167.879 1.00 157.89 ? 278  HIS D N     1 
ATOM   4398  C  CA    . HIS B  1 284  ? 175.433 225.715 167.608 1.00 157.89 ? 278  HIS D CA    1 
ATOM   4399  C  C     . HIS B  1 284  ? 175.381 224.681 166.490 1.00 157.89 ? 278  HIS D C     1 
ATOM   4400  O  O     . HIS B  1 284  ? 174.318 224.381 165.939 1.00 157.89 ? 278  HIS D O     1 
ATOM   4401  C  CB    . HIS B  1 284  ? 174.570 226.930 167.300 1.00 157.89 ? 278  HIS D CB    1 
ATOM   4402  C  CG    . HIS B  1 284  ? 174.365 227.818 168.484 1.00 157.89 ? 278  HIS D CG    1 
ATOM   4403  N  ND1   . HIS B  1 284  ? 173.807 229.074 168.391 1.00 157.89 ? 278  HIS D ND1   1 
ATOM   4404  C  CD2   . HIS B  1 284  ? 174.641 227.626 169.796 1.00 157.89 ? 278  HIS D CD2   1 
ATOM   4405  C  CE1   . HIS B  1 284  ? 173.752 229.619 169.593 1.00 157.89 ? 278  HIS D CE1   1 
ATOM   4406  N  NE2   . HIS B  1 284  ? 174.251 228.760 170.464 1.00 157.89 ? 278  HIS D NE2   1 
ATOM   4407  N  N     . GLN B  1 285  ? 176.537 224.119 166.157 1.00 148.13 ? 279  GLN D N     1 
ATOM   4408  C  CA    . GLN B  1 285  ? 176.647 223.033 165.197 1.00 148.13 ? 279  GLN D CA    1 
ATOM   4409  C  C     . GLN B  1 285  ? 176.685 221.726 165.969 1.00 148.13 ? 279  GLN D C     1 
ATOM   4410  O  O     . GLN B  1 285  ? 177.566 221.531 166.816 1.00 148.13 ? 279  GLN D O     1 
ATOM   4411  C  CB    . GLN B  1 285  ? 177.900 223.167 164.340 1.00 148.13 ? 279  GLN D CB    1 
ATOM   4412  C  CG    . GLN B  1 285  ? 177.979 222.125 163.247 1.00 148.13 ? 279  GLN D CG    1 
ATOM   4413  C  CD    . GLN B  1 285  ? 176.840 222.256 162.264 1.00 148.13 ? 279  GLN D CD    1 
ATOM   4414  O  OE1   . GLN B  1 285  ? 175.878 221.489 162.307 1.00 148.13 ? 279  GLN D OE1   1 
ATOM   4415  N  NE2   . GLN B  1 285  ? 176.942 223.228 161.368 1.00 148.13 ? 279  GLN D NE2   1 
ATOM   4416  N  N     . ASP B  1 286  ? 175.749 220.829 165.666 1.00 135.58 ? 280  ASP D N     1 
ATOM   4417  C  CA    . ASP B  1 286  ? 175.714 219.568 166.388 1.00 135.58 ? 280  ASP D CA    1 
ATOM   4418  C  C     . ASP B  1 286  ? 176.959 218.779 166.016 1.00 135.58 ? 280  ASP D C     1 
ATOM   4419  O  O     . ASP B  1 286  ? 177.062 218.228 164.911 1.00 135.58 ? 280  ASP D O     1 
ATOM   4420  C  CB    . ASP B  1 286  ? 174.455 218.775 166.063 1.00 135.58 ? 280  ASP D CB    1 
ATOM   4421  C  CG    . ASP B  1 286  ? 174.374 217.476 166.830 1.00 135.58 ? 280  ASP D CG    1 
ATOM   4422  O  OD1   . ASP B  1 286  ? 174.184 217.519 168.058 1.00 135.58 ? 280  ASP D OD1   1 
ATOM   4423  O  OD2   . ASP B  1 286  ? 174.506 216.405 166.195 1.00 135.58 ? 280  ASP D OD2   1 
ATOM   4424  N  N     . LEU B  1 287  ? 177.921 218.747 166.933 1.00 127.78 ? 281  LEU D N     1 
ATOM   4425  C  CA    . LEU B  1 287  ? 179.219 218.162 166.655 1.00 127.78 ? 281  LEU D CA    1 
ATOM   4426  C  C     . LEU B  1 287  ? 180.011 218.114 167.945 1.00 127.78 ? 281  LEU D C     1 
ATOM   4427  O  O     . LEU B  1 287  ? 179.969 219.057 168.737 1.00 127.78 ? 281  LEU D O     1 
ATOM   4428  C  CB    . LEU B  1 287  ? 179.977 218.985 165.610 1.00 127.78 ? 281  LEU D CB    1 
ATOM   4429  C  CG    . LEU B  1 287  ? 181.320 218.398 165.201 1.00 127.78 ? 281  LEU D CG    1 
ATOM   4430  C  CD1   . LEU B  1 287  ? 181.068 217.072 164.518 1.00 127.78 ? 281  LEU D CD1   1 
ATOM   4431  C  CD2   . LEU B  1 287  ? 182.078 219.359 164.297 1.00 127.78 ? 281  LEU D CD2   1 
ATOM   4432  N  N     . GLU B  1 288  ? 180.739 217.020 168.136 1.00 125.05 ? 282  GLU D N     1 
ATOM   4433  C  CA    . GLU B  1 288  ? 181.554 216.838 169.324 1.00 125.05 ? 282  GLU D CA    1 
ATOM   4434  C  C     . GLU B  1 288  ? 182.407 215.599 169.130 1.00 125.05 ? 282  GLU D C     1 
ATOM   4435  O  O     . GLU B  1 288  ? 181.959 214.594 168.572 1.00 125.05 ? 282  GLU D O     1 
ATOM   4436  C  CB    . GLU B  1 288  ? 180.693 216.704 170.580 1.00 125.05 ? 282  GLU D CB    1 
ATOM   4437  C  CG    . GLU B  1 288  ? 181.475 216.608 171.866 1.00 125.05 ? 282  GLU D CG    1 
ATOM   4438  C  CD    . GLU B  1 288  ? 180.566 216.543 173.073 1.00 125.05 ? 282  GLU D CD    1 
ATOM   4439  O  OE1   . GLU B  1 288  ? 179.333 216.578 172.883 1.00 125.05 ? 282  GLU D OE1   1 
ATOM   4440  O  OE2   . GLU B  1 288  ? 181.071 216.452 174.209 1.00 125.05 ? 282  GLU D OE2   1 
ATOM   4441  N  N     . ILE B  1 289  ? 183.649 215.680 169.599 1.00 120.22 ? 283  ILE D N     1 
ATOM   4442  C  CA    . ILE B  1 289  ? 184.601 214.589 169.443 1.00 120.22 ? 283  ILE D CA    1 
ATOM   4443  C  C     . ILE B  1 289  ? 185.102 214.205 170.825 1.00 120.22 ? 283  ILE D C     1 
ATOM   4444  O  O     . ILE B  1 289  ? 185.822 214.980 171.463 1.00 120.22 ? 283  ILE D O     1 
ATOM   4445  C  CB    . ILE B  1 289  ? 185.777 214.977 168.538 1.00 120.22 ? 283  ILE D CB    1 
ATOM   4446  C  CG1   . ILE B  1 289  ? 185.267 215.393 167.167 1.00 120.22 ? 283  ILE D CG1   1 
ATOM   4447  C  CG2   . ILE B  1 289  ? 186.730 213.806 168.404 1.00 120.22 ? 283  ILE D CG2   1 
ATOM   4448  C  CD1   . ILE B  1 289  ? 186.319 216.055 166.312 1.00 120.22 ? 283  ILE D CD1   1 
ATOM   4449  N  N     . ILE B  1 290  ? 184.751 213.015 171.274 1.00 110.70 ? 284  ILE D N     1 
ATOM   4450  C  CA    . ILE B  1 290  ? 185.013 212.585 172.638 1.00 110.70 ? 284  ILE D CA    1 
ATOM   4451  C  C     . ILE B  1 290  ? 186.403 211.979 172.691 1.00 110.70 ? 284  ILE D C     1 
ATOM   4452  O  O     . ILE B  1 290  ? 186.727 211.077 171.909 1.00 110.70 ? 284  ILE D O     1 
ATOM   4453  C  CB    . ILE B  1 290  ? 183.948 211.579 173.102 1.00 110.70 ? 284  ILE D CB    1 
ATOM   4454  C  CG1   . ILE B  1 290  ? 182.560 212.133 172.819 1.00 110.70 ? 284  ILE D CG1   1 
ATOM   4455  C  CG2   . ILE B  1 290  ? 184.081 211.314 174.582 1.00 110.70 ? 284  ILE D CG2   1 
ATOM   4456  C  CD1   . ILE B  1 290  ? 182.289 213.442 173.492 1.00 110.70 ? 284  ILE D CD1   1 
ATOM   4457  N  N     . VAL B  1 291  ? 187.225 212.464 173.616 1.00 110.12 ? 285  VAL D N     1 
ATOM   4458  C  CA    . VAL B  1 291  ? 188.617 212.049 173.713 1.00 110.12 ? 285  VAL D CA    1 
ATOM   4459  C  C     . VAL B  1 291  ? 188.796 211.263 175.002 1.00 110.12 ? 285  VAL D C     1 
ATOM   4460  O  O     . VAL B  1 291  ? 188.525 211.776 176.090 1.00 110.12 ? 285  VAL D O     1 
ATOM   4461  C  CB    . VAL B  1 291  ? 189.573 213.251 173.669 1.00 110.12 ? 285  VAL D CB    1 
ATOM   4462  C  CG1   . VAL B  1 291  ? 191.007 212.787 173.787 1.00 110.12 ? 285  VAL D CG1   1 
ATOM   4463  C  CG2   . VAL B  1 291  ? 189.364 214.031 172.394 1.00 110.12 ? 285  VAL D CG2   1 
ATOM   4464  N  N     . ILE B  1 292  ? 189.265 210.026 174.871 1.00 98.87  ? 286  ILE D N     1 
ATOM   4465  C  CA    . ILE B  1 292  ? 189.402 209.096 175.981 1.00 98.87  ? 286  ILE D CA    1 
ATOM   4466  C  C     . ILE B  1 292  ? 190.868 208.730 176.149 1.00 98.87  ? 286  ILE D C     1 
ATOM   4467  O  O     . ILE B  1 292  ? 191.553 208.401 175.176 1.00 98.87  ? 286  ILE D O     1 
ATOM   4468  C  CB    . ILE B  1 292  ? 188.544 207.835 175.759 1.00 98.87  ? 286  ILE D CB    1 
ATOM   4469  C  CG1   . ILE B  1 292  ? 187.068 208.146 175.999 1.00 98.87  ? 286  ILE D CG1   1 
ATOM   4470  C  CG2   . ILE B  1 292  ? 189.040 206.684 176.598 1.00 98.87  ? 286  ILE D CG2   1 
ATOM   4471  C  CD1   . ILE B  1 292  ? 186.333 208.573 174.766 1.00 98.87  ? 286  ILE D CD1   1 
ATOM   4472  N  N     . LEU B  1 293  ? 191.339 208.784 177.390 1.00 103.37 ? 287  LEU D N     1 
ATOM   4473  C  CA    . LEU B  1 293  ? 192.709 208.434 177.743 1.00 103.37 ? 287  LEU D CA    1 
ATOM   4474  C  C     . LEU B  1 293  ? 192.657 207.379 178.836 1.00 103.37 ? 287  LEU D C     1 
ATOM   4475  O  O     . LEU B  1 293  ? 192.095 207.619 179.908 1.00 103.37 ? 287  LEU D O     1 
ATOM   4476  C  CB    . LEU B  1 293  ? 193.483 209.660 178.208 1.00 103.37 ? 287  LEU D CB    1 
ATOM   4477  C  CG    . LEU B  1 293  ? 194.914 209.404 178.659 1.00 103.37 ? 287  LEU D CG    1 
ATOM   4478  C  CD1   . LEU B  1 293  ? 195.734 208.838 177.527 1.00 103.37 ? 287  LEU D CD1   1 
ATOM   4479  C  CD2   . LEU B  1 293  ? 195.517 210.697 179.159 1.00 103.37 ? 287  LEU D CD2   1 
ATOM   4480  N  N     . GLU B  1 294  ? 193.237 206.214 178.569 1.00 113.93 ? 288  GLU D N     1 
ATOM   4481  C  CA    . GLU B  1 294  ? 193.146 205.069 179.462 1.00 113.93 ? 288  GLU D CA    1 
ATOM   4482  C  C     . GLU B  1 294  ? 194.520 204.436 179.613 1.00 113.93 ? 288  GLU D C     1 
ATOM   4483  O  O     . GLU B  1 294  ? 195.171 204.110 178.616 1.00 113.93 ? 288  GLU D O     1 
ATOM   4484  C  CB    . GLU B  1 294  ? 192.136 204.055 178.933 1.00 113.93 ? 288  GLU D CB    1 
ATOM   4485  C  CG    . GLU B  1 294  ? 190.725 204.595 178.927 1.00 113.93 ? 288  GLU D CG    1 
ATOM   4486  C  CD    . GLU B  1 294  ? 189.725 203.626 178.345 1.00 113.93 ? 288  GLU D CD    1 
ATOM   4487  O  OE1   . GLU B  1 294  ? 190.143 202.552 177.864 1.00 113.93 ? 288  GLU D OE1   1 
ATOM   4488  O  OE2   . GLU B  1 294  ? 188.517 203.942 178.356 1.00 113.93 ? 288  GLU D OE2   1 
ATOM   4489  N  N     . GLY B  1 295  ? 194.952 204.267 180.854 1.00 112.63 ? 289  GLY D N     1 
ATOM   4490  C  CA    . GLY B  1 295  ? 196.244 203.670 181.130 1.00 112.63 ? 289  GLY D CA    1 
ATOM   4491  C  C     . GLY B  1 295  ? 196.329 203.222 182.571 1.00 112.63 ? 289  GLY D C     1 
ATOM   4492  O  O     . GLY B  1 295  ? 195.387 203.374 183.347 1.00 112.63 ? 289  GLY D O     1 
ATOM   4493  N  N     . VAL B  1 296  ? 197.477 202.673 182.923 1.00 124.83 ? 290  VAL D N     1 
ATOM   4494  C  CA    . VAL B  1 296  ? 197.700 202.140 184.259 1.00 124.83 ? 290  VAL D CA    1 
ATOM   4495  C  C     . VAL B  1 296  ? 198.577 203.101 185.044 1.00 124.83 ? 290  VAL D C     1 
ATOM   4496  O  O     . VAL B  1 296  ? 199.625 203.538 184.559 1.00 124.83 ? 290  VAL D O     1 
ATOM   4497  C  CB    . VAL B  1 296  ? 198.339 200.746 184.190 1.00 124.83 ? 290  VAL D CB    1 
ATOM   4498  C  CG1   . VAL B  1 296  ? 198.738 200.284 185.573 1.00 124.83 ? 290  VAL D CG1   1 
ATOM   4499  C  CG2   . VAL B  1 296  ? 197.374 199.763 183.555 1.00 124.83 ? 290  VAL D CG2   1 
ATOM   4500  N  N     . VAL B  1 297  ? 198.150 203.426 186.264 1.00 129.17 ? 291  VAL D N     1 
ATOM   4501  C  CA    . VAL B  1 297  ? 198.971 204.236 187.148 1.00 129.17 ? 291  VAL D CA    1 
ATOM   4502  C  C     . VAL B  1 297  ? 200.238 203.469 187.499 1.00 129.17 ? 291  VAL D C     1 
ATOM   4503  O  O     . VAL B  1 297  ? 200.225 202.248 187.677 1.00 129.17 ? 291  VAL D O     1 
ATOM   4504  C  CB    . VAL B  1 297  ? 198.184 204.622 188.411 1.00 129.17 ? 291  VAL D CB    1 
ATOM   4505  C  CG1   . VAL B  1 297  ? 199.049 205.424 189.366 1.00 129.17 ? 291  VAL D CG1   1 
ATOM   4506  C  CG2   . VAL B  1 297  ? 196.943 205.399 188.031 1.00 129.17 ? 291  VAL D CG2   1 
ATOM   4507  N  N     . GLU B  1 298  ? 201.350 204.196 187.588 1.00 137.50 ? 292  GLU D N     1 
ATOM   4508  C  CA    . GLU B  1 298  ? 202.635 203.550 187.814 1.00 137.50 ? 292  GLU D CA    1 
ATOM   4509  C  C     . GLU B  1 298  ? 202.713 202.939 189.204 1.00 137.50 ? 292  GLU D C     1 
ATOM   4510  O  O     . GLU B  1 298  ? 203.005 201.747 189.351 1.00 137.50 ? 292  GLU D O     1 
ATOM   4511  C  CB    . GLU B  1 298  ? 203.761 204.557 187.605 1.00 137.50 ? 292  GLU D CB    1 
ATOM   4512  C  CG    . GLU B  1 298  ? 205.146 203.968 187.646 1.00 137.50 ? 292  GLU D CG    1 
ATOM   4513  C  CD    . GLU B  1 298  ? 206.209 205.001 187.338 1.00 137.50 ? 292  GLU D CD    1 
ATOM   4514  O  OE1   . GLU B  1 298  ? 205.852 206.182 187.141 1.00 137.50 ? 292  GLU D OE1   1 
ATOM   4515  O  OE2   . GLU B  1 298  ? 207.400 204.630 187.281 1.00 137.50 ? 292  GLU D OE2   1 
ATOM   4516  N  N     . THR B  1 299  ? 202.447 203.734 190.236 1.00 135.35 ? 293  THR D N     1 
ATOM   4517  C  CA    . THR B  1 299  ? 202.533 203.245 191.604 1.00 135.35 ? 293  THR D CA    1 
ATOM   4518  C  C     . THR B  1 299  ? 201.454 202.228 191.929 1.00 135.35 ? 293  THR D C     1 
ATOM   4519  O  O     . THR B  1 299  ? 201.756 201.167 192.484 1.00 135.35 ? 293  THR D O     1 
ATOM   4520  C  CB    . THR B  1 299  ? 202.429 204.412 192.583 1.00 135.35 ? 293  THR D CB    1 
ATOM   4521  O  OG1   . THR B  1 299  ? 201.135 205.016 192.461 1.00 135.35 ? 293  THR D OG1   1 
ATOM   4522  C  CG2   . THR B  1 299  ? 203.473 205.444 192.257 1.00 135.35 ? 293  THR D CG2   1 
ATOM   4523  N  N     . THR B  1 300  ? 200.210 202.526 191.588 1.00 140.13 ? 294  THR D N     1 
ATOM   4524  C  CA    . THR B  1 300  ? 199.101 201.616 191.797 1.00 140.13 ? 294  THR D CA    1 
ATOM   4525  C  C     . THR B  1 300  ? 198.752 200.952 190.477 1.00 140.13 ? 294  THR D C     1 
ATOM   4526  O  O     . THR B  1 300  ? 198.336 201.616 189.524 1.00 140.13 ? 294  THR D O     1 
ATOM   4527  C  CB    . THR B  1 300  ? 197.878 202.350 192.344 1.00 140.13 ? 294  THR D CB    1 
ATOM   4528  O  OG1   . THR B  1 300  ? 197.400 203.276 191.361 1.00 140.13 ? 294  THR D OG1   1 
ATOM   4529  C  CG2   . THR B  1 300  ? 198.251 203.118 193.592 1.00 140.13 ? 294  THR D CG2   1 
ATOM   4530  N  N     . GLY B  1 301  ? 198.905 199.630 190.432 1.00 142.93 ? 295  GLY D N     1 
ATOM   4531  C  CA    . GLY B  1 301  ? 198.691 198.898 189.198 1.00 142.93 ? 295  GLY D CA    1 
ATOM   4532  C  C     . GLY B  1 301  ? 197.297 199.022 188.618 1.00 142.93 ? 295  GLY D C     1 
ATOM   4533  O  O     . GLY B  1 301  ? 197.015 198.394 187.593 1.00 142.93 ? 295  GLY D O     1 
ATOM   4534  N  N     . ILE B  1 302  ? 196.426 199.803 189.246 1.00 135.68 ? 296  ILE D N     1 
ATOM   4535  C  CA    . ILE B  1 302  ? 195.057 199.971 188.787 1.00 135.68 ? 296  ILE D CA    1 
ATOM   4536  C  C     . ILE B  1 302  ? 195.027 200.910 187.591 1.00 135.68 ? 296  ILE D C     1 
ATOM   4537  O  O     . ILE B  1 302  ? 196.020 201.575 187.278 1.00 135.68 ? 296  ILE D O     1 
ATOM   4538  C  CB    . ILE B  1 302  ? 194.165 200.487 189.925 1.00 135.68 ? 296  ILE D CB    1 
ATOM   4539  C  CG1   . ILE B  1 302  ? 194.676 201.832 190.425 1.00 135.68 ? 296  ILE D CG1   1 
ATOM   4540  C  CG2   . ILE B  1 302  ? 194.142 199.487 191.058 1.00 135.68 ? 296  ILE D CG2   1 
ATOM   4541  C  CD1   . ILE B  1 302  ? 193.744 202.499 191.400 1.00 135.68 ? 296  ILE D CD1   1 
ATOM   4542  N  N     . THR B  1 303  ? 193.885 200.962 186.913 1.00 120.01 ? 297  THR D N     1 
ATOM   4543  C  CA    . THR B  1 303  ? 193.720 201.710 185.677 1.00 120.01 ? 297  THR D CA    1 
ATOM   4544  C  C     . THR B  1 303  ? 192.867 202.934 185.954 1.00 120.01 ? 297  THR D C     1 
ATOM   4545  O  O     . THR B  1 303  ? 191.940 202.877 186.769 1.00 120.01 ? 297  THR D O     1 
ATOM   4546  C  CB    . THR B  1 303  ? 193.075 200.836 184.602 1.00 120.01 ? 297  THR D CB    1 
ATOM   4547  O  OG1   . THR B  1 303  ? 193.949 199.743 184.298 1.00 120.01 ? 297  THR D OG1   1 
ATOM   4548  C  CG2   . THR B  1 303  ? 192.801 201.627 183.340 1.00 120.01 ? 297  THR D CG2   1 
ATOM   4549  N  N     . THR B  1 304  ? 193.190 204.037 185.297 1.00 110.78 ? 298  THR D N     1 
ATOM   4550  C  CA    . THR B  1 304  ? 192.374 205.235 185.355 1.00 110.78 ? 298  THR D CA    1 
ATOM   4551  C  C     . THR B  1 304  ? 192.023 205.710 183.954 1.00 110.78 ? 298  THR D C     1 
ATOM   4552  O  O     . THR B  1 304  ? 192.655 205.337 182.963 1.00 110.78 ? 298  THR D O     1 
ATOM   4553  C  CB    . THR B  1 304  ? 193.095 206.346 186.111 1.00 110.78 ? 298  THR D CB    1 
ATOM   4554  O  OG1   . THR B  1 304  ? 192.214 207.466 186.259 1.00 110.78 ? 298  THR D OG1   1 
ATOM   4555  C  CG2   . THR B  1 304  ? 194.343 206.771 185.354 1.00 110.78 ? 298  THR D CG2   1 
ATOM   4556  N  N     . GLN B  1 305  ? 190.995 206.548 183.886 1.00 111.43 ? 299  GLN D N     1 
ATOM   4557  C  CA    . GLN B  1 305  ? 190.534 207.118 182.629 1.00 111.43 ? 299  GLN D CA    1 
ATOM   4558  C  C     . GLN B  1 305  ? 190.242 208.592 182.832 1.00 111.43 ? 299  GLN D C     1 
ATOM   4559  O  O     . GLN B  1 305  ? 189.537 208.964 183.773 1.00 111.43 ? 299  GLN D O     1 
ATOM   4560  C  CB    . GLN B  1 305  ? 189.281 206.412 182.117 1.00 111.43 ? 299  GLN D CB    1 
ATOM   4561  C  CG    . GLN B  1 305  ? 188.785 206.987 180.819 1.00 111.43 ? 299  GLN D CG    1 
ATOM   4562  C  CD    . GLN B  1 305  ? 187.536 206.309 180.325 1.00 111.43 ? 299  GLN D CD    1 
ATOM   4563  O  OE1   . GLN B  1 305  ? 187.010 205.405 180.973 1.00 111.43 ? 299  GLN D OE1   1 
ATOM   4564  N  NE2   . GLN B  1 305  ? 187.044 206.743 179.176 1.00 111.43 ? 299  GLN D NE2   1 
ATOM   4565  N  N     . ALA B  1 306  ? 190.780 209.427 181.953 1.00 110.54 ? 300  ALA D N     1 
ATOM   4566  C  CA    . ALA B  1 306  ? 190.410 210.831 181.879 1.00 110.54 ? 300  ALA D CA    1 
ATOM   4567  C  C     . ALA B  1 306  ? 189.580 211.045 180.624 1.00 110.54 ? 300  ALA D C     1 
ATOM   4568  O  O     . ALA B  1 306  ? 189.761 210.340 179.626 1.00 110.54 ? 300  ALA D O     1 
ATOM   4569  C  CB    . ALA B  1 306  ? 191.648 211.727 181.866 1.00 110.54 ? 300  ALA D CB    1 
ATOM   4570  N  N     . ARG B  1 307  ? 188.660 211.995 180.682 1.00 111.41 ? 301  ARG D N     1 
ATOM   4571  C  CA    . ARG B  1 307  ? 187.834 212.337 179.539 1.00 111.41 ? 301  ARG D CA    1 
ATOM   4572  C  C     . ARG B  1 307  ? 187.907 213.832 179.279 1.00 111.41 ? 301  ARG D C     1 
ATOM   4573  O  O     . ARG B  1 307  ? 187.955 214.642 180.208 1.00 111.41 ? 301  ARG D O     1 
ATOM   4574  C  CB    . ARG B  1 307  ? 186.375 211.934 179.751 1.00 111.41 ? 301  ARG D CB    1 
ATOM   4575  C  CG    . ARG B  1 307  ? 186.089 210.485 179.452 1.00 111.41 ? 301  ARG D CG    1 
ATOM   4576  C  CD    . ARG B  1 307  ? 186.494 209.606 180.612 1.00 111.41 ? 301  ARG D CD    1 
ATOM   4577  N  NE    . ARG B  1 307  ? 185.703 209.874 181.804 1.00 111.41 ? 301  ARG D NE    1 
ATOM   4578  C  CZ    . ARG B  1 307  ? 186.013 209.429 183.014 1.00 111.41 ? 301  ARG D CZ    1 
ATOM   4579  N  NH1   . ARG B  1 307  ? 187.101 208.694 183.188 1.00 111.41 ? 301  ARG D NH1   1 
ATOM   4580  N  NH2   . ARG B  1 307  ? 185.236 209.719 184.046 1.00 111.41 ? 301  ARG D NH2   1 
ATOM   4581  N  N     . THR B  1 308  ? 187.919 214.183 178.001 1.00 116.94 ? 302  THR D N     1 
ATOM   4582  C  CA    . THR B  1 308  ? 187.747 215.561 177.585 1.00 116.94 ? 302  THR D CA    1 
ATOM   4583  C  C     . THR B  1 308  ? 187.005 215.547 176.264 1.00 116.94 ? 302  THR D C     1 
ATOM   4584  O  O     . THR B  1 308  ? 187.040 214.566 175.517 1.00 116.94 ? 302  THR D O     1 
ATOM   4585  C  CB    . THR B  1 308  ? 189.079 216.297 177.458 1.00 116.94 ? 302  THR D CB    1 
ATOM   4586  O  OG1   . THR B  1 308  ? 188.831 217.681 177.185 1.00 116.94 ? 302  THR D OG1   1 
ATOM   4587  C  CG2   . THR B  1 308  ? 189.898 215.710 176.334 1.00 116.94 ? 302  THR D CG2   1 
ATOM   4588  N  N     . SER B  1 309  ? 186.322 216.647 175.980 1.00 123.21 ? 303  SER D N     1 
ATOM   4589  C  CA    . SER B  1 309  ? 185.504 216.700 174.785 1.00 123.21 ? 303  SER D CA    1 
ATOM   4590  C  C     . SER B  1 309  ? 185.706 218.041 174.107 1.00 123.21 ? 303  SER D C     1 
ATOM   4591  O  O     . SER B  1 309  ? 186.115 219.022 174.730 1.00 123.21 ? 303  SER D O     1 
ATOM   4592  C  CB    . SER B  1 309  ? 184.027 216.467 175.110 1.00 123.21 ? 303  SER D CB    1 
ATOM   4593  O  OG    . SER B  1 309  ? 183.523 217.494 175.940 1.00 123.21 ? 303  SER D OG    1 
ATOM   4594  N  N     . TYR B  1 310  ? 185.415 218.065 172.815 1.00 118.11 ? 304  TYR D N     1 
ATOM   4595  C  CA    . TYR B  1 310  ? 185.524 219.290 172.037 1.00 118.11 ? 304  TYR D CA    1 
ATOM   4596  C  C     . TYR B  1 310  ? 184.319 219.342 171.115 1.00 118.11 ? 304  TYR D C     1 
ATOM   4597  O  O     . TYR B  1 310  ? 184.154 218.466 170.262 1.00 118.11 ? 304  TYR D O     1 
ATOM   4598  C  CB    . TYR B  1 310  ? 186.822 219.334 171.238 1.00 118.11 ? 304  TYR D CB    1 
ATOM   4599  C  CG    . TYR B  1 310  ? 188.051 219.434 172.093 1.00 118.11 ? 304  TYR D CG    1 
ATOM   4600  C  CD1   . TYR B  1 310  ? 188.427 220.640 172.652 1.00 118.11 ? 304  TYR D CD1   1 
ATOM   4601  C  CD2   . TYR B  1 310  ? 188.839 218.326 172.336 1.00 118.11 ? 304  TYR D CD2   1 
ATOM   4602  C  CE1   . TYR B  1 310  ? 189.551 220.737 173.435 1.00 118.11 ? 304  TYR D CE1   1 
ATOM   4603  C  CE2   . TYR B  1 310  ? 189.963 218.413 173.116 1.00 118.11 ? 304  TYR D CE2   1 
ATOM   4604  C  CZ    . TYR B  1 310  ? 190.316 219.620 173.662 1.00 118.11 ? 304  TYR D CZ    1 
ATOM   4605  O  OH    . TYR B  1 310  ? 191.441 219.709 174.444 1.00 118.11 ? 304  TYR D OH    1 
ATOM   4606  N  N     . LEU B  1 311  ? 183.475 220.346 171.298 1.00 133.10 ? 305  LEU D N     1 
ATOM   4607  C  CA    . LEU B  1 311  ? 182.406 220.572 170.347 1.00 133.10 ? 305  LEU D CA    1 
ATOM   4608  C  C     . LEU B  1 311  ? 182.935 221.517 169.270 1.00 133.10 ? 305  LEU D C     1 
ATOM   4609  O  O     . LEU B  1 311  ? 184.122 221.852 169.241 1.00 133.10 ? 305  LEU D O     1 
ATOM   4610  C  CB    . LEU B  1 311  ? 181.147 221.061 171.063 1.00 133.10 ? 305  LEU D CB    1 
ATOM   4611  C  CG    . LEU B  1 311  ? 181.095 222.392 171.806 1.00 133.10 ? 305  LEU D CG    1 
ATOM   4612  C  CD1   . LEU B  1 311  ? 180.631 223.490 170.874 1.00 133.10 ? 305  LEU D CD1   1 
ATOM   4613  C  CD2   . LEU B  1 311  ? 180.167 222.279 172.996 1.00 133.10 ? 305  LEU D CD2   1 
ATOM   4614  N  N     . ALA B  1 312  ? 182.055 221.957 168.373 1.00 134.57 ? 306  ALA D N     1 
ATOM   4615  C  CA    . ALA B  1 312  ? 182.509 222.478 167.090 1.00 134.57 ? 306  ALA D CA    1 
ATOM   4616  C  C     . ALA B  1 312  ? 183.359 223.735 167.243 1.00 134.57 ? 306  ALA D C     1 
ATOM   4617  O  O     . ALA B  1 312  ? 184.371 223.891 166.550 1.00 134.57 ? 306  ALA D O     1 
ATOM   4618  C  CB    . ALA B  1 312  ? 181.304 222.736 166.192 1.00 134.57 ? 306  ALA D CB    1 
ATOM   4619  N  N     . ASP B  1 313  ? 182.987 224.631 168.155 1.00 142.17 ? 307  ASP D N     1 
ATOM   4620  C  CA    . ASP B  1 313  ? 183.668 225.922 168.224 1.00 142.17 ? 307  ASP D CA    1 
ATOM   4621  C  C     . ASP B  1 313  ? 185.068 225.785 168.811 1.00 142.17 ? 307  ASP D C     1 
ATOM   4622  O  O     . ASP B  1 313  ? 186.016 226.407 168.319 1.00 142.17 ? 307  ASP D O     1 
ATOM   4623  C  CB    . ASP B  1 313  ? 182.831 226.916 169.029 1.00 142.17 ? 307  ASP D CB    1 
ATOM   4624  C  CG    . ASP B  1 313  ? 182.639 226.491 170.474 1.00 142.17 ? 307  ASP D CG    1 
ATOM   4625  O  OD1   . ASP B  1 313  ? 183.115 225.403 170.859 1.00 142.17 ? 307  ASP D OD1   1 
ATOM   4626  O  OD2   . ASP B  1 313  ? 182.016 227.256 171.237 1.00 142.17 ? 307  ASP D OD2   1 
ATOM   4627  N  N     . GLU B  1 314  ? 185.215 224.975 169.865 1.00 129.91 ? 308  GLU D N     1 
ATOM   4628  C  CA    . GLU B  1 314  ? 186.519 224.749 170.479 1.00 129.91 ? 308  GLU D CA    1 
ATOM   4629  C  C     . GLU B  1 314  ? 187.516 224.168 169.497 1.00 129.91 ? 308  GLU D C     1 
ATOM   4630  O  O     . GLU B  1 314  ? 188.725 224.236 169.740 1.00 129.91 ? 308  GLU D O     1 
ATOM   4631  C  CB    . GLU B  1 314  ? 186.384 223.812 171.679 1.00 129.91 ? 308  GLU D CB    1 
ATOM   4632  C  CG    . GLU B  1 314  ? 185.614 224.398 172.840 1.00 129.91 ? 308  GLU D CG    1 
ATOM   4633  C  CD    . GLU B  1 314  ? 185.483 223.429 173.989 1.00 129.91 ? 308  GLU D CD    1 
ATOM   4634  O  OE1   . GLU B  1 314  ? 185.875 222.257 173.822 1.00 129.91 ? 308  GLU D OE1   1 
ATOM   4635  O  OE2   . GLU B  1 314  ? 184.994 223.837 175.060 1.00 129.91 ? 308  GLU D OE2   1 
ATOM   4636  N  N     . ILE B  1 315  ? 187.033 223.594 168.402 1.00 128.68 ? 309  ILE D N     1 
ATOM   4637  C  CA    . ILE B  1 315  ? 187.888 223.052 167.359 1.00 128.68 ? 309  ILE D CA    1 
ATOM   4638  C  C     . ILE B  1 315  ? 188.313 224.232 166.494 1.00 128.68 ? 309  ILE D C     1 
ATOM   4639  O  O     . ILE B  1 315  ? 187.647 224.576 165.517 1.00 128.68 ? 309  ILE D O     1 
ATOM   4640  C  CB    . ILE B  1 315  ? 187.163 221.986 166.543 1.00 128.68 ? 309  ILE D CB    1 
ATOM   4641  C  CG1   . ILE B  1 315  ? 186.685 220.866 167.456 1.00 128.68 ? 309  ILE D CG1   1 
ATOM   4642  C  CG2   . ILE B  1 315  ? 188.087 221.422 165.514 1.00 128.68 ? 309  ILE D CG2   1 
ATOM   4643  C  CD1   . ILE B  1 315  ? 185.698 219.934 166.798 1.00 128.68 ? 309  ILE D CD1   1 
ATOM   4644  N  N     . LEU B  1 316  ? 189.427 224.858 166.855 1.00 124.45 ? 310  LEU D N     1 
ATOM   4645  C  CA    . LEU B  1 316  ? 189.899 225.993 166.086 1.00 124.45 ? 310  LEU D CA    1 
ATOM   4646  C  C     . LEU B  1 316  ? 190.360 225.535 164.707 1.00 124.45 ? 310  LEU D C     1 
ATOM   4647  O  O     . LEU B  1 316  ? 191.121 224.576 164.563 1.00 124.45 ? 310  LEU D O     1 
ATOM   4648  C  CB    . LEU B  1 316  ? 191.037 226.703 166.817 1.00 124.45 ? 310  LEU D CB    1 
ATOM   4649  C  CG    . LEU B  1 316  ? 190.644 227.323 168.157 1.00 124.45 ? 310  LEU D CG    1 
ATOM   4650  C  CD1   . LEU B  1 316  ? 191.851 227.897 168.879 1.00 124.45 ? 310  LEU D CD1   1 
ATOM   4651  C  CD2   . LEU B  1 316  ? 189.575 228.379 167.959 1.00 124.45 ? 310  LEU D CD2   1 
ATOM   4652  N  N     . TRP B  1 317  ? 189.902 226.248 163.687 1.00 118.55 ? 311  TRP D N     1 
ATOM   4653  C  CA    . TRP B  1 317  ? 190.204 225.911 162.306 1.00 118.55 ? 311  TRP D CA    1 
ATOM   4654  C  C     . TRP B  1 317  ? 191.469 226.628 161.867 1.00 118.55 ? 311  TRP D C     1 
ATOM   4655  O  O     . TRP B  1 317  ? 191.603 227.841 162.052 1.00 118.55 ? 311  TRP D O     1 
ATOM   4656  C  CB    . TRP B  1 317  ? 189.058 226.291 161.376 1.00 118.55 ? 311  TRP D CB    1 
ATOM   4657  C  CG    . TRP B  1 317  ? 189.328 225.942 159.955 1.00 118.55 ? 311  TRP D CG    1 
ATOM   4658  C  CD1   . TRP B  1 317  ? 189.812 226.770 158.991 1.00 118.55 ? 311  TRP D CD1   1 
ATOM   4659  C  CD2   . TRP B  1 317  ? 189.111 224.676 159.321 1.00 118.55 ? 311  TRP D CD2   1 
ATOM   4660  N  NE1   . TRP B  1 317  ? 189.920 226.101 157.802 1.00 118.55 ? 311  TRP D NE1   1 
ATOM   4661  C  CE2   . TRP B  1 317  ? 189.499 224.812 157.977 1.00 118.55 ? 311  TRP D CE2   1 
ATOM   4662  C  CE3   . TRP B  1 317  ? 188.632 223.442 159.762 1.00 118.55 ? 311  TRP D CE3   1 
ATOM   4663  C  CZ2   . TRP B  1 317  ? 189.424 223.763 157.068 1.00 118.55 ? 311  TRP D CZ2   1 
ATOM   4664  C  CZ3   . TRP B  1 317  ? 188.557 222.400 158.858 1.00 118.55 ? 311  TRP D CZ3   1 
ATOM   4665  C  CH2   . TRP B  1 317  ? 188.947 222.569 157.525 1.00 118.55 ? 311  TRP D CH2   1 
ATOM   4666  N  N     . GLY B  1 318  ? 192.394 225.876 161.284 1.00 112.40 ? 312  GLY D N     1 
ATOM   4667  C  CA    . GLY B  1 318  ? 193.581 226.480 160.714 1.00 112.40 ? 312  GLY D CA    1 
ATOM   4668  C  C     . GLY B  1 318  ? 194.528 227.094 161.719 1.00 112.40 ? 312  GLY D C     1 
ATOM   4669  O  O     . GLY B  1 318  ? 194.784 228.302 161.665 1.00 112.40 ? 312  GLY D O     1 
ATOM   4670  N  N     . GLN B  1 319  ? 195.045 226.294 162.646 1.00 112.60 ? 313  GLN D N     1 
ATOM   4671  C  CA    . GLN B  1 319  ? 196.086 226.739 163.556 1.00 112.60 ? 313  GLN D CA    1 
ATOM   4672  C  C     . GLN B  1 319  ? 197.050 225.594 163.813 1.00 112.60 ? 313  GLN D C     1 
ATOM   4673  O  O     . GLN B  1 319  ? 196.840 224.463 163.372 1.00 112.60 ? 313  GLN D O     1 
ATOM   4674  C  CB    . GLN B  1 319  ? 195.525 227.237 164.889 1.00 112.60 ? 313  GLN D CB    1 
ATOM   4675  C  CG    . GLN B  1 319  ? 194.753 228.527 164.800 1.00 112.60 ? 313  GLN D CG    1 
ATOM   4676  C  CD    . GLN B  1 319  ? 194.234 228.958 166.145 1.00 112.60 ? 313  GLN D CD    1 
ATOM   4677  O  OE1   . GLN B  1 319  ? 194.435 228.271 167.141 1.00 112.60 ? 313  GLN D OE1   1 
ATOM   4678  N  NE2   . GLN B  1 319  ? 193.548 230.092 166.182 1.00 112.60 ? 313  GLN D NE2   1 
ATOM   4679  N  N     . ARG B  1 320  ? 198.118 225.904 164.540 1.00 106.72 ? 314  ARG D N     1 
ATOM   4680  C  CA    . ARG B  1 320  ? 199.082 224.901 164.963 1.00 106.72 ? 314  ARG D CA    1 
ATOM   4681  C  C     . ARG B  1 320  ? 199.530 225.219 166.380 1.00 106.72 ? 314  ARG D C     1 
ATOM   4682  O  O     . ARG B  1 320  ? 199.884 226.361 166.683 1.00 106.72 ? 314  ARG D O     1 
ATOM   4683  C  CB    . ARG B  1 320  ? 200.290 224.839 164.007 1.00 106.72 ? 314  ARG D CB    1 
ATOM   4684  C  CG    . ARG B  1 320  ? 199.950 224.274 162.622 1.00 106.72 ? 314  ARG D CG    1 
ATOM   4685  C  CD    . ARG B  1 320  ? 201.140 224.191 161.654 1.00 106.72 ? 314  ARG D CD    1 
ATOM   4686  N  NE    . ARG B  1 320  ? 201.586 225.487 161.145 1.00 106.72 ? 314  ARG D NE    1 
ATOM   4687  C  CZ    . ARG B  1 320  ? 202.627 225.648 160.334 1.00 106.72 ? 314  ARG D CZ    1 
ATOM   4688  N  NH1   . ARG B  1 320  ? 203.326 224.597 159.931 1.00 106.72 ? 314  ARG D NH1   1 
ATOM   4689  N  NH2   . ARG B  1 320  ? 202.963 226.858 159.913 1.00 106.72 ? 314  ARG D NH2   1 
ATOM   4690  N  N     . PHE B  1 321  ? 199.486 224.213 167.250 1.00 108.76 ? 315  PHE D N     1 
ATOM   4691  C  CA    . PHE B  1 321  ? 200.008 224.377 168.599 1.00 108.76 ? 315  PHE D CA    1 
ATOM   4692  C  C     . PHE B  1 321  ? 201.499 224.685 168.544 1.00 108.76 ? 315  PHE D C     1 
ATOM   4693  O  O     . PHE B  1 321  ? 202.286 223.932 167.962 1.00 108.76 ? 315  PHE D O     1 
ATOM   4694  C  CB    . PHE B  1 321  ? 199.764 223.115 169.430 1.00 108.76 ? 315  PHE D CB    1 
ATOM   4695  C  CG    . PHE B  1 321  ? 198.323 222.894 169.794 1.00 108.76 ? 315  PHE D CG    1 
ATOM   4696  C  CD1   . PHE B  1 321  ? 197.759 223.553 170.867 1.00 108.76 ? 315  PHE D CD1   1 
ATOM   4697  C  CD2   . PHE B  1 321  ? 197.537 222.019 169.068 1.00 108.76 ? 315  PHE D CD2   1 
ATOM   4698  C  CE1   . PHE B  1 321  ? 196.434 223.351 171.207 1.00 108.76 ? 315  PHE D CE1   1 
ATOM   4699  C  CE2   . PHE B  1 321  ? 196.213 221.814 169.405 1.00 108.76 ? 315  PHE D CE2   1 
ATOM   4700  C  CZ    . PHE B  1 321  ? 195.662 222.482 170.474 1.00 108.76 ? 315  PHE D CZ    1 
ATOM   4701  N  N     . VAL B  1 322  ? 201.884 225.797 169.151 1.00 109.81 ? 316  VAL D N     1 
ATOM   4702  C  CA    . VAL B  1 322  ? 203.286 226.217 169.139 1.00 109.81 ? 316  VAL D CA    1 
ATOM   4703  C  C     . VAL B  1 322  ? 204.099 225.231 169.972 1.00 109.81 ? 316  VAL D C     1 
ATOM   4704  O  O     . VAL B  1 322  ? 203.634 224.808 171.043 1.00 109.81 ? 316  VAL D O     1 
ATOM   4705  C  CB    . VAL B  1 322  ? 203.426 227.634 169.677 1.00 109.81 ? 316  VAL D CB    1 
ATOM   4706  N  N     . PRO B  1 323  ? 205.279 224.831 169.520 1.00 121.16 ? 317  PRO D N     1 
ATOM   4707  C  CA    . PRO B  1 323  ? 206.072 223.865 170.287 1.00 121.16 ? 317  PRO D CA    1 
ATOM   4708  C  C     . PRO B  1 323  ? 206.495 224.417 171.635 1.00 121.16 ? 317  PRO D C     1 
ATOM   4709  O  O     . PRO B  1 323  ? 207.298 225.352 171.712 1.00 121.16 ? 317  PRO D O     1 
ATOM   4710  C  CB    . PRO B  1 323  ? 207.283 223.609 169.381 1.00 121.16 ? 317  PRO D CB    1 
ATOM   4711  C  CG    . PRO B  1 323  ? 206.809 223.952 168.019 1.00 121.16 ? 317  PRO D CG    1 
ATOM   4712  C  CD    . PRO B  1 323  ? 205.872 225.106 168.205 1.00 121.16 ? 317  PRO D CD    1 
ATOM   4713  N  N     . ILE B  1 324  ? 205.956 223.827 172.708 1.00 123.95 ? 318  ILE D N     1 
ATOM   4714  C  CA    . ILE B  1 324  ? 206.273 224.252 174.068 1.00 123.95 ? 318  ILE D CA    1 
ATOM   4715  C  C     . ILE B  1 324  ? 207.478 223.524 174.643 1.00 123.95 ? 318  ILE D C     1 
ATOM   4716  O  O     . ILE B  1 324  ? 207.715 223.598 175.857 1.00 123.95 ? 318  ILE D O     1 
ATOM   4717  C  CB    . ILE B  1 324  ? 205.049 224.063 174.990 1.00 123.95 ? 318  ILE D CB    1 
ATOM   4718  C  CG1   . ILE B  1 324  ? 204.519 222.636 174.887 1.00 123.95 ? 318  ILE D CG1   1 
ATOM   4719  C  CG2   . ILE B  1 324  ? 203.962 225.081 174.688 1.00 123.95 ? 318  ILE D CG2   1 
ATOM   4720  C  CD1   . ILE B  1 324  ? 203.452 222.326 175.894 1.00 123.95 ? 318  ILE D CD1   1 
ATOM   4721  N  N     . VAL B  1 325  ? 208.240 222.817 173.816 1.00 121.86 ? 319  VAL D N     1 
ATOM   4722  C  CA    . VAL B  1 325  ? 209.432 222.115 174.266 1.00 121.86 ? 319  VAL D CA    1 
ATOM   4723  C  C     . VAL B  1 325  ? 210.651 222.815 173.688 1.00 121.86 ? 319  VAL D C     1 
ATOM   4724  O  O     . VAL B  1 325  ? 210.610 223.328 172.564 1.00 121.86 ? 319  VAL D O     1 
ATOM   4725  C  CB    . VAL B  1 325  ? 209.394 220.641 173.840 1.00 121.86 ? 319  VAL D CB    1 
ATOM   4726  C  CG1   . VAL B  1 325  ? 210.618 219.904 174.352 1.00 121.86 ? 319  VAL D CG1   1 
ATOM   4727  C  CG2   . VAL B  1 325  ? 208.119 219.988 174.323 1.00 121.86 ? 319  VAL D CG2   1 
ATOM   4728  N  N     . ALA B  1 326  ? 211.727 222.869 174.463 1.00 131.39 ? 320  ALA D N     1 
ATOM   4729  C  CA    . ALA B  1 326  ? 212.997 223.385 173.982 1.00 131.39 ? 320  ALA D CA    1 
ATOM   4730  C  C     . ALA B  1 326  ? 214.125 222.598 174.627 1.00 131.39 ? 320  ALA D C     1 
ATOM   4731  O  O     . ALA B  1 326  ? 213.995 222.109 175.751 1.00 131.39 ? 320  ALA D O     1 
ATOM   4732  C  CB    . ALA B  1 326  ? 213.146 224.883 174.273 1.00 131.39 ? 320  ALA D CB    1 
ATOM   4733  N  N     . GLU B  1 327  ? 215.229 222.461 173.906 1.00 143.03 ? 321  GLU D N     1 
ATOM   4734  C  CA    . GLU B  1 327  ? 216.389 221.743 174.425 1.00 143.03 ? 321  GLU D CA    1 
ATOM   4735  C  C     . GLU B  1 327  ? 216.990 222.606 175.523 1.00 143.03 ? 321  GLU D C     1 
ATOM   4736  O  O     . GLU B  1 327  ? 217.677 223.593 175.249 1.00 143.03 ? 321  GLU D O     1 
ATOM   4737  C  CB    . GLU B  1 327  ? 217.395 221.454 173.317 1.00 143.03 ? 321  GLU D CB    1 
ATOM   4738  C  CG    . GLU B  1 327  ? 218.447 220.413 173.680 1.00 143.03 ? 321  GLU D CG    1 
ATOM   4739  C  CD    . GLU B  1 327  ? 219.600 220.987 174.473 1.00 143.03 ? 321  GLU D CD    1 
ATOM   4740  O  OE1   . GLU B  1 327  ? 219.897 222.188 174.314 1.00 143.03 ? 321  GLU D OE1   1 
ATOM   4741  O  OE2   . GLU B  1 327  ? 220.215 220.234 175.258 1.00 143.03 ? 321  GLU D OE2   1 
ATOM   4742  N  N     . GLU B  1 328  ? 216.714 222.249 176.771 1.00 148.29 ? 322  GLU D N     1 
ATOM   4743  C  CA    . GLU B  1 328  ? 217.253 222.979 177.905 1.00 148.29 ? 322  GLU D CA    1 
ATOM   4744  C  C     . GLU B  1 328  ? 218.756 222.759 178.003 1.00 148.29 ? 322  GLU D C     1 
ATOM   4745  O  O     . GLU B  1 328  ? 219.354 222.006 177.233 1.00 148.29 ? 322  GLU D O     1 
ATOM   4746  C  CB    . GLU B  1 328  ? 216.572 222.546 179.203 1.00 148.29 ? 322  GLU D CB    1 
ATOM   4747  N  N     . ASP B  1 329  ? 219.371 223.424 178.975 1.00 155.77 ? 323  ASP D N     1 
ATOM   4748  C  CA    . ASP B  1 329  ? 220.786 223.191 179.199 1.00 155.77 ? 323  ASP D CA    1 
ATOM   4749  C  C     . ASP B  1 329  ? 220.963 221.760 179.683 1.00 155.77 ? 323  ASP D C     1 
ATOM   4750  O  O     . ASP B  1 329  ? 220.679 221.450 180.844 1.00 155.77 ? 323  ASP D O     1 
ATOM   4751  C  CB    . ASP B  1 329  ? 221.346 224.190 180.213 1.00 155.77 ? 323  ASP D CB    1 
ATOM   4752  N  N     . GLY B  1 330  ? 221.420 220.883 178.795 1.00 157.71 ? 324  GLY D N     1 
ATOM   4753  C  CA    . GLY B  1 330  ? 221.535 219.478 179.134 1.00 157.71 ? 324  GLY D CA    1 
ATOM   4754  C  C     . GLY B  1 330  ? 220.235 218.849 179.576 1.00 157.71 ? 324  GLY D C     1 
ATOM   4755  O  O     . GLY B  1 330  ? 220.236 218.001 180.473 1.00 157.71 ? 324  GLY D O     1 
ATOM   4756  N  N     . ARG B  1 331  ? 219.119 219.242 178.968 1.00 146.51 ? 325  ARG D N     1 
ATOM   4757  C  CA    . ARG B  1 331  ? 217.806 218.790 179.396 1.00 146.51 ? 325  ARG D CA    1 
ATOM   4758  C  C     . ARG B  1 331  ? 216.810 219.150 178.304 1.00 146.51 ? 325  ARG D C     1 
ATOM   4759  O  O     . ARG B  1 331  ? 217.119 219.899 177.375 1.00 146.51 ? 325  ARG D O     1 
ATOM   4760  C  CB    . ARG B  1 331  ? 217.424 219.425 180.736 1.00 146.51 ? 325  ARG D CB    1 
ATOM   4761  C  CG    . ARG B  1 331  ? 216.180 218.877 181.392 1.00 146.51 ? 325  ARG D CG    1 
ATOM   4762  C  CD    . ARG B  1 331  ? 215.908 219.620 182.681 1.00 146.51 ? 325  ARG D CD    1 
ATOM   4763  N  NE    . ARG B  1 331  ? 216.999 219.452 183.633 1.00 146.51 ? 325  ARG D NE    1 
ATOM   4764  C  CZ    . ARG B  1 331  ? 217.144 218.395 184.422 1.00 146.51 ? 325  ARG D CZ    1 
ATOM   4765  N  NH1   . ARG B  1 331  ? 216.266 217.401 184.369 1.00 146.51 ? 325  ARG D NH1   1 
ATOM   4766  N  NH2   . ARG B  1 331  ? 218.170 218.325 185.260 1.00 146.51 ? 325  ARG D NH2   1 
ATOM   4767  N  N     . TYR B  1 332  ? 215.616 218.593 178.419 1.00 138.67 ? 326  TYR D N     1 
ATOM   4768  C  CA    . TYR B  1 332  ? 214.511 218.907 177.527 1.00 138.67 ? 326  TYR D CA    1 
ATOM   4769  C  C     . TYR B  1 332  ? 213.528 219.764 178.310 1.00 138.67 ? 326  TYR D C     1 
ATOM   4770  O  O     . TYR B  1 332  ? 212.987 219.330 179.332 1.00 138.67 ? 326  TYR D O     1 
ATOM   4771  C  CB    . TYR B  1 332  ? 213.872 217.632 176.995 1.00 138.67 ? 326  TYR D CB    1 
ATOM   4772  C  CG    . TYR B  1 332  ? 214.794 216.848 176.093 1.00 138.67 ? 326  TYR D CG    1 
ATOM   4773  C  CD1   . TYR B  1 332  ? 214.955 217.201 174.764 1.00 138.67 ? 326  TYR D CD1   1 
ATOM   4774  C  CD2   . TYR B  1 332  ? 215.515 215.765 176.574 1.00 138.67 ? 326  TYR D CD2   1 
ATOM   4775  C  CE1   . TYR B  1 332  ? 215.797 216.491 173.936 1.00 138.67 ? 326  TYR D CE1   1 
ATOM   4776  C  CE2   . TYR B  1 332  ? 216.359 215.051 175.752 1.00 138.67 ? 326  TYR D CE2   1 
ATOM   4777  C  CZ    . TYR B  1 332  ? 216.496 215.417 174.435 1.00 138.67 ? 326  TYR D CZ    1 
ATOM   4778  O  OH    . TYR B  1 332  ? 217.335 214.711 173.609 1.00 138.67 ? 326  TYR D OH    1 
ATOM   4779  N  N     . SER B  1 333  ? 213.327 220.988 177.851 1.00 136.63 ? 327  SER D N     1 
ATOM   4780  C  CA    . SER B  1 333  ? 212.550 221.975 178.579 1.00 136.63 ? 327  SER D CA    1 
ATOM   4781  C  C     . SER B  1 333  ? 211.141 222.011 178.020 1.00 136.63 ? 327  SER D C     1 
ATOM   4782  O  O     . SER B  1 333  ? 210.902 222.620 176.974 1.00 136.63 ? 327  SER D O     1 
ATOM   4783  C  CB    . SER B  1 333  ? 213.201 223.353 178.473 1.00 136.63 ? 327  SER D CB    1 
ATOM   4784  O  OG    . SER B  1 333  ? 213.228 223.794 177.133 1.00 136.63 ? 327  SER D OG    1 
ATOM   4785  N  N     . VAL B  1 334  ? 210.210 221.373 178.712 1.00 121.90 ? 328  VAL D N     1 
ATOM   4786  C  CA    . VAL B  1 334  ? 208.816 221.469 178.334 1.00 121.90 ? 328  VAL D CA    1 
ATOM   4787  C  C     . VAL B  1 334  ? 208.266 222.708 179.008 1.00 121.90 ? 328  VAL D C     1 
ATOM   4788  O  O     . VAL B  1 334  ? 207.932 222.688 180.192 1.00 121.90 ? 328  VAL D O     1 
ATOM   4789  C  CB    . VAL B  1 334  ? 208.020 220.222 178.722 1.00 121.90 ? 328  VAL D CB    1 
ATOM   4790  C  CG1   . VAL B  1 334  ? 206.568 220.439 178.362 1.00 121.90 ? 328  VAL D CG1   1 
ATOM   4791  C  CG2   . VAL B  1 334  ? 208.571 219.028 177.993 1.00 121.90 ? 328  VAL D CG2   1 
ATOM   4792  N  N     . ASP B  1 335  ? 208.178 223.793 178.259 1.00 127.91 ? 329  ASP D N     1 
ATOM   4793  C  CA    . ASP B  1 335  ? 207.591 225.012 178.792 1.00 127.91 ? 329  ASP D CA    1 
ATOM   4794  C  C     . ASP B  1 335  ? 206.102 224.752 178.922 1.00 127.91 ? 329  ASP D C     1 
ATOM   4795  O  O     . ASP B  1 335  ? 205.341 224.912 177.968 1.00 127.91 ? 329  ASP D O     1 
ATOM   4796  C  CB    . ASP B  1 335  ? 207.884 226.192 177.878 1.00 127.91 ? 329  ASP D CB    1 
ATOM   4797  C  CG    . ASP B  1 335  ? 207.444 227.503 178.469 1.00 127.91 ? 329  ASP D CG    1 
ATOM   4798  O  OD1   . ASP B  1 335  ? 206.873 227.497 179.579 1.00 127.91 ? 329  ASP D OD1   1 
ATOM   4799  O  OD2   . ASP B  1 335  ? 207.663 228.542 177.820 1.00 127.91 ? 329  ASP D OD2   1 
ATOM   4800  N  N     . TYR B  1 336  ? 205.694 224.310 180.104 1.00 123.69 ? 330  TYR D N     1 
ATOM   4801  C  CA    . TYR B  1 336  ? 204.288 224.075 180.387 1.00 123.69 ? 330  TYR D CA    1 
ATOM   4802  C  C     . TYR B  1 336  ? 203.459 225.341 180.346 1.00 123.69 ? 330  TYR D C     1 
ATOM   4803  O  O     . TYR B  1 336  ? 202.251 225.260 180.104 1.00 123.69 ? 330  TYR D O     1 
ATOM   4804  C  CB    . TYR B  1 336  ? 204.146 223.383 181.739 1.00 123.69 ? 330  TYR D CB    1 
ATOM   4805  C  CG    . TYR B  1 336  ? 204.271 221.890 181.636 1.00 123.69 ? 330  TYR D CG    1 
ATOM   4806  C  CD1   . TYR B  1 336  ? 203.147 221.113 181.405 1.00 123.69 ? 330  TYR D CD1   1 
ATOM   4807  C  CD2   . TYR B  1 336  ? 205.505 221.258 181.711 1.00 123.69 ? 330  TYR D CD2   1 
ATOM   4808  C  CE1   . TYR B  1 336  ? 203.235 219.756 181.296 1.00 123.69 ? 330  TYR D CE1   1 
ATOM   4809  C  CE2   . TYR B  1 336  ? 205.607 219.890 181.593 1.00 123.69 ? 330  TYR D CE2   1 
ATOM   4810  C  CZ    . TYR B  1 336  ? 204.463 219.136 181.390 1.00 123.69 ? 330  TYR D CZ    1 
ATOM   4811  O  OH    . TYR B  1 336  ? 204.545 217.772 181.280 1.00 123.69 ? 330  TYR D OH    1 
ATOM   4812  N  N     . SER B  1 337  ? 204.063 226.502 180.568 1.00 116.79 ? 331  SER D N     1 
ATOM   4813  C  CA    . SER B  1 337  ? 203.377 227.737 180.255 1.00 116.79 ? 331  SER D CA    1 
ATOM   4814  C  C     . SER B  1 337  ? 203.048 227.764 178.766 1.00 116.79 ? 331  SER D C     1 
ATOM   4815  O  O     . SER B  1 337  ? 203.558 226.961 177.980 1.00 116.79 ? 331  SER D O     1 
ATOM   4816  C  CB    . SER B  1 337  ? 204.237 228.937 180.624 1.00 116.79 ? 331  SER D CB    1 
ATOM   4817  O  OG    . SER B  1 337  ? 205.365 229.001 179.776 1.00 116.79 ? 331  SER D OG    1 
ATOM   4818  N  N     . LYS B  1 338  ? 202.178 228.702 178.384 1.00 120.23 ? 332  LYS D N     1 
ATOM   4819  C  CA    . LYS B  1 338  ? 201.616 228.797 177.038 1.00 120.23 ? 332  LYS D CA    1 
ATOM   4820  C  C     . LYS B  1 338  ? 201.246 227.430 176.479 1.00 120.23 ? 332  LYS D C     1 
ATOM   4821  O  O     . LYS B  1 338  ? 201.366 227.188 175.275 1.00 120.23 ? 332  LYS D O     1 
ATOM   4822  C  CB    . LYS B  1 338  ? 202.567 229.528 176.070 1.00 120.23 ? 332  LYS D CB    1 
ATOM   4823  C  CG    . LYS B  1 338  ? 203.852 228.786 175.676 1.00 120.23 ? 332  LYS D CG    1 
ATOM   4824  C  CD    . LYS B  1 338  ? 204.644 229.568 174.631 1.00 120.23 ? 332  LYS D CD    1 
ATOM   4825  C  CE    . LYS B  1 338  ? 205.960 228.884 174.273 1.00 120.23 ? 332  LYS D CE    1 
ATOM   4826  N  NZ    . LYS B  1 338  ? 205.763 227.577 173.592 1.00 120.23 ? 332  LYS D NZ    1 
ATOM   4827  N  N     . PHE B  1 339  ? 200.765 226.551 177.350 1.00 120.25 ? 333  PHE D N     1 
ATOM   4828  C  CA    . PHE B  1 339  ? 200.563 225.144 177.036 1.00 120.25 ? 333  PHE D CA    1 
ATOM   4829  C  C     . PHE B  1 339  ? 199.714 224.935 175.789 1.00 120.25 ? 333  PHE D C     1 
ATOM   4830  O  O     . PHE B  1 339  ? 200.144 224.271 174.842 1.00 120.25 ? 333  PHE D O     1 
ATOM   4831  C  CB    . PHE B  1 339  ? 199.912 224.440 178.226 1.00 120.25 ? 333  PHE D CB    1 
ATOM   4832  C  CG    . PHE B  1 339  ? 199.661 222.979 178.007 1.00 120.25 ? 333  PHE D CG    1 
ATOM   4833  C  CD1   . PHE B  1 339  ? 200.697 222.068 178.073 1.00 120.25 ? 333  PHE D CD1   1 
ATOM   4834  C  CD2   . PHE B  1 339  ? 198.385 222.518 177.747 1.00 120.25 ? 333  PHE D CD2   1 
ATOM   4835  C  CE1   . PHE B  1 339  ? 200.463 220.726 177.878 1.00 120.25 ? 333  PHE D CE1   1 
ATOM   4836  C  CE2   . PHE B  1 339  ? 198.148 221.176 177.551 1.00 120.25 ? 333  PHE D CE2   1 
ATOM   4837  C  CZ    . PHE B  1 339  ? 199.189 220.279 177.616 1.00 120.25 ? 333  PHE D CZ    1 
ATOM   4838  N  N     . GLY B  1 340  ? 198.507 225.482 175.791 1.00 118.13 ? 334  GLY D N     1 
ATOM   4839  C  CA    . GLY B  1 340  ? 197.608 225.312 174.671 1.00 118.13 ? 334  GLY D CA    1 
ATOM   4840  C  C     . GLY B  1 340  ? 197.641 226.483 173.717 1.00 118.13 ? 334  GLY D C     1 
ATOM   4841  O  O     . GLY B  1 340  ? 196.839 226.545 172.782 1.00 118.13 ? 334  GLY D O     1 
ATOM   4842  N  N     . ASN B  1 341  ? 198.554 227.425 173.943 1.00 119.00 ? 335  ASN D N     1 
ATOM   4843  C  CA    . ASN B  1 341  ? 198.689 228.559 173.042 1.00 119.00 ? 335  ASN D CA    1 
ATOM   4844  C  C     . ASN B  1 341  ? 199.078 228.087 171.651 1.00 119.00 ? 335  ASN D C     1 
ATOM   4845  O  O     . ASN B  1 341  ? 200.024 227.315 171.486 1.00 119.00 ? 335  ASN D O     1 
ATOM   4846  C  CB    . ASN B  1 341  ? 199.705 229.572 173.567 1.00 119.00 ? 335  ASN D CB    1 
ATOM   4847  C  CG    . ASN B  1 341  ? 199.120 230.482 174.629 1.00 119.00 ? 335  ASN D CG    1 
ATOM   4848  O  OD1   . ASN B  1 341  ? 199.522 230.454 175.787 1.00 119.00 ? 335  ASN D OD1   1 
ATOM   4849  N  ND2   . ASN B  1 341  ? 198.165 231.307 174.226 1.00 119.00 ? 335  ASN D ND2   1 
ATOM   4850  N  N     . THR B  1 342  ? 198.335 228.560 170.659 1.00 125.43 ? 336  THR D N     1 
ATOM   4851  C  CA    . THR B  1 342  ? 198.458 228.160 169.268 1.00 125.43 ? 336  THR D CA    1 
ATOM   4852  C  C     . THR B  1 342  ? 198.951 229.325 168.423 1.00 125.43 ? 336  THR D C     1 
ATOM   4853  O  O     . THR B  1 342  ? 199.315 230.388 168.930 1.00 125.43 ? 336  THR D O     1 
ATOM   4854  C  CB    . THR B  1 342  ? 197.117 227.661 168.732 1.00 125.43 ? 336  THR D CB    1 
ATOM   4855  O  OG1   . THR B  1 342  ? 196.171 228.731 168.756 1.00 125.43 ? 336  THR D OG1   1 
ATOM   4856  C  CG2   . THR B  1 342  ? 196.599 226.541 169.594 1.00 125.43 ? 336  THR D CG2   1 
ATOM   4857  N  N     . ILE B  1 343  ? 198.963 229.104 167.113 1.00 129.84 ? 337  ILE D N     1 
ATOM   4858  C  CA    . ILE B  1 343  ? 199.272 230.138 166.133 1.00 129.84 ? 337  ILE D CA    1 
ATOM   4859  C  C     . ILE B  1 343  ? 198.386 229.938 164.911 1.00 129.84 ? 337  ILE D C     1 
ATOM   4860  O  O     . ILE B  1 343  ? 198.181 228.806 164.461 1.00 129.84 ? 337  ILE D O     1 
ATOM   4861  C  CB    . ILE B  1 343  ? 200.772 230.130 165.754 1.00 129.84 ? 337  ILE D CB    1 
ATOM   4862  C  CG1   . ILE B  1 343  ? 201.106 231.297 164.816 1.00 129.84 ? 337  ILE D CG1   1 
ATOM   4863  C  CG2   . ILE B  1 343  ? 201.200 228.778 165.184 1.00 129.84 ? 337  ILE D CG2   1 
ATOM   4864  C  CD1   . ILE B  1 343  ? 200.934 232.665 165.445 1.00 129.84 ? 337  ILE D CD1   1 
ATOM   4865  N  N     . LYS B  1 344  ? 197.850 231.035 164.382 1.00 124.33 ? 338  LYS D N     1 
ATOM   4866  C  CA    . LYS B  1 344  ? 196.928 230.946 163.256 1.00 124.33 ? 338  LYS D CA    1 
ATOM   4867  C  C     . LYS B  1 344  ? 197.680 230.745 161.948 1.00 124.33 ? 338  LYS D C     1 
ATOM   4868  O  O     . LYS B  1 344  ? 198.710 231.380 161.708 1.00 124.33 ? 338  LYS D O     1 
ATOM   4869  C  CB    . LYS B  1 344  ? 196.067 232.203 163.171 1.00 124.33 ? 338  LYS D CB    1 
ATOM   4870  C  CG    . LYS B  1 344  ? 195.067 232.349 164.296 1.00 124.33 ? 338  LYS D CG    1 
ATOM   4871  C  CD    . LYS B  1 344  ? 194.216 233.584 164.089 1.00 124.33 ? 338  LYS D CD    1 
ATOM   4872  C  CE    . LYS B  1 344  ? 193.121 233.685 165.132 1.00 124.33 ? 338  LYS D CE    1 
ATOM   4873  N  NZ    . LYS B  1 344  ? 193.668 233.922 166.495 1.00 124.33 ? 338  LYS D NZ    1 
ATOM   4874  N  N     . VAL B  1 345  ? 197.155 229.860 161.102 1.00 118.16 ? 339  VAL D N     1 
ATOM   4875  C  CA    . VAL B  1 345  ? 197.694 229.609 159.766 1.00 118.16 ? 339  VAL D CA    1 
ATOM   4876  C  C     . VAL B  1 345  ? 196.530 229.428 158.797 1.00 118.16 ? 339  VAL D C     1 
ATOM   4877  O  O     . VAL B  1 345  ? 195.601 228.659 159.086 1.00 118.16 ? 339  VAL D O     1 
ATOM   4878  C  CB    . VAL B  1 345  ? 198.611 228.375 159.749 1.00 118.16 ? 339  VAL D CB    1 
ATOM   4879  C  CG1   . VAL B  1 345  ? 199.057 228.078 158.332 1.00 118.16 ? 339  VAL D CG1   1 
ATOM   4880  C  CG2   . VAL B  1 345  ? 199.817 228.571 160.655 1.00 118.16 ? 339  VAL D CG2   1 
ATOM   4881  N  N     . PRO B  1 346  ? 196.527 230.105 157.649 1.00 123.35 ? 340  PRO D N     1 
ATOM   4882  C  CA    . PRO B  1 346  ? 195.457 229.882 156.666 1.00 123.35 ? 340  PRO D CA    1 
ATOM   4883  C  C     . PRO B  1 346  ? 195.498 228.475 156.092 1.00 123.35 ? 340  PRO D C     1 
ATOM   4884  O  O     . PRO B  1 346  ? 196.378 227.672 156.409 1.00 123.35 ? 340  PRO D O     1 
ATOM   4885  C  CB    . PRO B  1 346  ? 195.744 230.931 155.586 1.00 123.35 ? 340  PRO D CB    1 
ATOM   4886  C  CG    . PRO B  1 346  ? 196.527 231.979 156.283 1.00 123.35 ? 340  PRO D CG    1 
ATOM   4887  C  CD    . PRO B  1 346  ? 197.375 231.246 157.277 1.00 123.35 ? 340  PRO D CD    1 
ATOM   4888  N  N     . THR B  1 347  ? 194.531 228.190 155.221 1.00 131.42 ? 341  THR D N     1 
ATOM   4889  C  CA    . THR B  1 347  ? 194.311 226.856 154.678 1.00 131.42 ? 341  THR D CA    1 
ATOM   4890  C  C     . THR B  1 347  ? 193.197 226.934 153.649 1.00 131.42 ? 341  THR D C     1 
ATOM   4891  O  O     . THR B  1 347  ? 192.401 227.879 153.682 1.00 131.42 ? 341  THR D O     1 
ATOM   4892  C  CB    . THR B  1 347  ? 193.942 225.868 155.798 1.00 131.42 ? 341  THR D CB    1 
ATOM   4893  O  OG1   . THR B  1 347  ? 193.701 224.567 155.255 1.00 131.42 ? 341  THR D OG1   1 
ATOM   4894  C  CG2   . THR B  1 347  ? 192.724 226.343 156.536 1.00 131.42 ? 341  THR D CG2   1 
ATOM   4895  N  N     . PRO B  1 348  ? 193.127 225.988 152.712 1.00 136.81 ? 342  PRO D N     1 
ATOM   4896  C  CA    . PRO B  1 348  ? 191.941 225.903 151.848 1.00 136.81 ? 342  PRO D CA    1 
ATOM   4897  C  C     . PRO B  1 348  ? 190.681 225.741 152.679 1.00 136.81 ? 342  PRO D C     1 
ATOM   4898  O  O     . PRO B  1 348  ? 190.516 224.761 153.411 1.00 136.81 ? 342  PRO D O     1 
ATOM   4899  C  CB    . PRO B  1 348  ? 192.221 224.669 150.984 1.00 136.81 ? 342  PRO D CB    1 
ATOM   4900  C  CG    . PRO B  1 348  ? 193.703 224.589 150.937 1.00 136.81 ? 342  PRO D CG    1 
ATOM   4901  C  CD    . PRO B  1 348  ? 194.179 225.049 152.289 1.00 136.81 ? 342  PRO D CD    1 
ATOM   4902  N  N     . LEU B  1 349  ? 189.785 226.715 152.554 1.00 131.65 ? 343  LEU D N     1 
ATOM   4903  C  CA    . LEU B  1 349  ? 188.641 226.841 153.454 1.00 131.65 ? 343  LEU D CA    1 
ATOM   4904  C  C     . LEU B  1 349  ? 187.440 226.066 152.918 1.00 131.65 ? 343  LEU D C     1 
ATOM   4905  O  O     . LEU B  1 349  ? 186.330 226.581 152.788 1.00 131.65 ? 343  LEU D O     1 
ATOM   4906  C  CB    . LEU B  1 349  ? 188.300 228.309 153.653 1.00 131.65 ? 343  LEU D CB    1 
ATOM   4907  C  CG    . LEU B  1 349  ? 189.455 229.084 154.263 1.00 131.65 ? 343  LEU D CG    1 
ATOM   4908  C  CD1   . LEU B  1 349  ? 189.082 230.542 154.392 1.00 131.65 ? 343  LEU D CD1   1 
ATOM   4909  C  CD2   . LEU B  1 349  ? 189.834 228.484 155.598 1.00 131.65 ? 343  LEU D CD2   1 
ATOM   4910  N  N     . CYS B  1 350  ? 187.682 224.797 152.618 1.00 145.79 ? 344  CYS D N     1 
ATOM   4911  C  CA    . CYS B  1 350  ? 186.642 223.941 152.079 1.00 145.79 ? 344  CYS D CA    1 
ATOM   4912  C  C     . CYS B  1 350  ? 186.797 222.550 152.675 1.00 145.79 ? 344  CYS D C     1 
ATOM   4913  O  O     . CYS B  1 350  ? 187.752 222.263 153.399 1.00 145.79 ? 344  CYS D O     1 
ATOM   4914  C  CB    . CYS B  1 350  ? 186.688 223.904 150.551 1.00 145.79 ? 344  CYS D CB    1 
ATOM   4915  S  SG    . CYS B  1 350  ? 188.167 223.164 149.854 1.00 145.79 ? 344  CYS D SG    1 
ATOM   4916  N  N     . THR B  1 351  ? 185.832 221.689 152.375 1.00 159.28 ? 345  THR D N     1 
ATOM   4917  C  CA    . THR B  1 351  ? 185.836 220.361 152.961 1.00 159.28 ? 345  THR D CA    1 
ATOM   4918  C  C     . THR B  1 351  ? 187.004 219.542 152.434 1.00 159.28 ? 345  THR D C     1 
ATOM   4919  O  O     . THR B  1 351  ? 187.472 219.736 151.310 1.00 159.28 ? 345  THR D O     1 
ATOM   4920  C  CB    . THR B  1 351  ? 184.531 219.624 152.658 1.00 159.28 ? 345  THR D CB    1 
ATOM   4921  O  OG1   . THR B  1 351  ? 184.384 219.481 151.241 1.00 159.28 ? 345  THR D OG1   1 
ATOM   4922  C  CG2   . THR B  1 351  ? 183.342 220.374 153.213 1.00 159.28 ? 345  THR D CG2   1 
ATOM   4923  N  N     . ALA B  1 352  ? 187.471 218.608 153.263 1.00 155.24 ? 346  ALA D N     1 
ATOM   4924  C  CA    . ALA B  1 352  ? 188.410 217.611 152.771 1.00 155.24 ? 346  ALA D CA    1 
ATOM   4925  C  C     . ALA B  1 352  ? 187.854 216.904 151.543 1.00 155.24 ? 346  ALA D C     1 
ATOM   4926  O  O     . ALA B  1 352  ? 188.618 216.464 150.678 1.00 155.24 ? 346  ALA D O     1 
ATOM   4927  C  CB    . ALA B  1 352  ? 188.737 216.611 153.876 1.00 155.24 ? 346  ALA D CB    1 
ATOM   4928  N  N     . ARG B  1 353  ? 186.528 216.802 151.449 1.00 158.42 ? 347  ARG D N     1 
ATOM   4929  C  CA    . ARG B  1 353  ? 185.902 216.375 150.205 1.00 158.42 ? 347  ARG D CA    1 
ATOM   4930  C  C     . ARG B  1 353  ? 186.307 217.279 149.052 1.00 158.42 ? 347  ARG D C     1 
ATOM   4931  O  O     . ARG B  1 353  ? 186.908 216.823 148.076 1.00 158.42 ? 347  ARG D O     1 
ATOM   4932  C  CB    . ARG B  1 353  ? 184.385 216.356 150.360 1.00 158.42 ? 347  ARG D CB    1 
ATOM   4933  C  CG    . ARG B  1 353  ? 183.673 215.877 149.119 1.00 158.42 ? 347  ARG D CG    1 
ATOM   4934  C  CD    . ARG B  1 353  ? 182.212 215.668 149.399 1.00 158.42 ? 347  ARG D CD    1 
ATOM   4935  N  NE    . ARG B  1 353  ? 182.067 214.664 150.445 1.00 158.42 ? 347  ARG D NE    1 
ATOM   4936  C  CZ    . ARG B  1 353  ? 182.191 213.356 150.244 1.00 158.42 ? 347  ARG D CZ    1 
ATOM   4937  N  NH1   . ARG B  1 353  ? 182.475 212.892 149.034 1.00 158.42 ? 347  ARG D NH1   1 
ATOM   4938  N  NH2   . ARG B  1 353  ? 182.044 212.513 151.254 1.00 158.42 ? 347  ARG D NH2   1 
ATOM   4939  N  N     . GLN B  1 354  ? 185.978 218.567 149.143 1.00 170.91 ? 348  GLN D N     1 
ATOM   4940  C  CA    . GLN B  1 354  ? 186.388 219.505 148.108 1.00 170.91 ? 348  GLN D CA    1 
ATOM   4941  C  C     . GLN B  1 354  ? 187.900 219.645 148.025 1.00 170.91 ? 348  GLN D C     1 
ATOM   4942  O  O     . GLN B  1 354  ? 188.415 219.970 146.951 1.00 170.91 ? 348  GLN D O     1 
ATOM   4943  C  CB    . GLN B  1 354  ? 185.746 220.872 148.347 1.00 170.91 ? 348  GLN D CB    1 
ATOM   4944  C  CG    . GLN B  1 354  ? 184.230 220.837 148.284 1.00 170.91 ? 348  GLN D CG    1 
ATOM   4945  C  CD    . GLN B  1 354  ? 183.593 222.181 148.570 1.00 170.91 ? 348  GLN D CD    1 
ATOM   4946  O  OE1   . GLN B  1 354  ? 184.280 223.175 148.783 1.00 170.91 ? 348  GLN D OE1   1 
ATOM   4947  N  NE2   . GLN B  1 354  ? 182.266 222.208 148.609 1.00 170.91 ? 348  GLN D NE2   1 
ATOM   4948  N  N     . LEU B  1 355  ? 188.625 219.392 149.120 1.00 166.88 ? 349  LEU D N     1 
ATOM   4949  C  CA    . LEU B  1 355  ? 190.075 219.284 149.015 1.00 166.88 ? 349  LEU D CA    1 
ATOM   4950  C  C     . LEU B  1 355  ? 190.477 218.221 148.006 1.00 166.88 ? 349  LEU D C     1 
ATOM   4951  O  O     . LEU B  1 355  ? 191.235 218.501 147.075 1.00 166.88 ? 349  LEU D O     1 
ATOM   4952  C  CB    . LEU B  1 355  ? 190.707 218.971 150.368 1.00 166.88 ? 349  LEU D CB    1 
ATOM   4953  C  CG    . LEU B  1 355  ? 191.252 220.120 151.206 1.00 166.88 ? 349  LEU D CG    1 
ATOM   4954  C  CD1   . LEU B  1 355  ? 192.354 220.785 150.411 1.00 166.88 ? 349  LEU D CD1   1 
ATOM   4955  C  CD2   . LEU B  1 355  ? 190.177 221.102 151.589 1.00 166.88 ? 349  LEU D CD2   1 
ATOM   4956  N  N     . ASP B  1 356  ? 189.994 216.991 148.180 1.00 172.58 ? 350  ASP D N     1 
ATOM   4957  C  CA    . ASP B  1 356  ? 190.347 215.943 147.230 1.00 172.58 ? 350  ASP D CA    1 
ATOM   4958  C  C     . ASP B  1 356  ? 189.771 216.213 145.852 1.00 172.58 ? 350  ASP D C     1 
ATOM   4959  O  O     . ASP B  1 356  ? 190.374 215.823 144.852 1.00 172.58 ? 350  ASP D O     1 
ATOM   4960  C  CB    . ASP B  1 356  ? 189.885 214.579 147.733 1.00 172.58 ? 350  ASP D CB    1 
ATOM   4961  C  CG    . ASP B  1 356  ? 190.701 214.092 148.909 1.00 172.58 ? 350  ASP D CG    1 
ATOM   4962  O  OD1   . ASP B  1 356  ? 191.872 214.505 149.020 1.00 172.58 ? 350  ASP D OD1   1 
ATOM   4963  O  OD2   . ASP B  1 356  ? 190.183 213.288 149.715 1.00 172.58 ? 350  ASP D OD2   1 
ATOM   4964  N  N     . GLU B  1 357  ? 188.632 216.899 145.781 1.00 190.54 ? 351  GLU D N     1 
ATOM   4965  C  CA    . GLU B  1 357  ? 188.072 217.281 144.489 1.00 190.54 ? 351  GLU D CA    1 
ATOM   4966  C  C     . GLU B  1 357  ? 189.033 218.177 143.719 1.00 190.54 ? 351  GLU D C     1 
ATOM   4967  O  O     . GLU B  1 357  ? 189.452 217.846 142.602 1.00 190.54 ? 351  GLU D O     1 
ATOM   4968  C  CB    . GLU B  1 357  ? 186.736 217.987 144.692 1.00 190.54 ? 351  GLU D CB    1 
ATOM   4969  C  CG    . GLU B  1 357  ? 185.639 217.088 145.203 1.00 190.54 ? 351  GLU D CG    1 
ATOM   4970  C  CD    . GLU B  1 357  ? 184.352 217.836 145.431 1.00 190.54 ? 351  GLU D CD    1 
ATOM   4971  O  OE1   . GLU B  1 357  ? 184.369 219.080 145.333 1.00 190.54 ? 351  GLU D OE1   1 
ATOM   4972  O  OE2   . GLU B  1 357  ? 183.322 217.183 145.698 1.00 190.54 ? 351  GLU D OE2   1 
ATOM   4973  N  N     . ASP B  1 358  ? 189.393 219.318 144.307 1.00 211.25 ? 352  ASP D N     1 
ATOM   4974  C  CA    . ASP B  1 358  ? 190.300 220.249 143.645 1.00 211.25 ? 352  ASP D CA    1 
ATOM   4975  C  C     . ASP B  1 358  ? 191.684 219.638 143.458 1.00 211.25 ? 352  ASP D C     1 
ATOM   4976  O  O     . ASP B  1 358  ? 192.367 219.927 142.472 1.00 211.25 ? 352  ASP D O     1 
ATOM   4977  C  CB    . ASP B  1 358  ? 190.384 221.548 144.442 1.00 211.25 ? 352  ASP D CB    1 
ATOM   4978  N  N     . HIS B  1 359  ? 192.105 218.765 144.378 1.00 232.95 ? 353  HIS D N     1 
ATOM   4979  C  CA    . HIS B  1 359  ? 193.410 218.129 144.251 1.00 232.95 ? 353  HIS D CA    1 
ATOM   4980  C  C     . HIS B  1 359  ? 193.442 217.166 143.075 1.00 232.95 ? 353  HIS D C     1 
ATOM   4981  O  O     . HIS B  1 359  ? 194.417 217.137 142.320 1.00 232.95 ? 353  HIS D O     1 
ATOM   4982  C  CB    . HIS B  1 359  ? 193.762 217.403 145.548 1.00 232.95 ? 353  HIS D CB    1 
ATOM   4983  N  N     . SER B  1 360  ? 192.390 216.365 142.908 1.00 247.97 ? 354  SER D N     1 
ATOM   4984  C  CA    . SER B  1 360  ? 192.304 215.492 141.748 1.00 247.97 ? 354  SER D CA    1 
ATOM   4985  C  C     . SER B  1 360  ? 192.201 216.305 140.466 1.00 247.97 ? 354  SER D C     1 
ATOM   4986  O  O     . SER B  1 360  ? 192.792 215.939 139.444 1.00 247.97 ? 354  SER D O     1 
ATOM   4987  C  CB    . SER B  1 360  ? 191.110 214.549 141.894 1.00 247.97 ? 354  SER D CB    1 
ATOM   4988  N  N     . LEU B  1 361  ? 191.470 217.421 140.505 1.00 261.47 ? 355  LEU D N     1 
ATOM   4989  C  CA    . LEU B  1 361  ? 191.379 218.273 139.326 1.00 261.47 ? 355  LEU D CA    1 
ATOM   4990  C  C     . LEU B  1 361  ? 192.725 218.891 138.969 1.00 261.47 ? 355  LEU D C     1 
ATOM   4991  O  O     . LEU B  1 361  ? 193.012 219.111 137.787 1.00 261.47 ? 355  LEU D O     1 
ATOM   4992  C  CB    . LEU B  1 361  ? 190.333 219.365 139.546 1.00 261.47 ? 355  LEU D CB    1 
ATOM   4993  N  N     . LEU B  1 362  ? 193.560 219.177 139.969 1.00 281.99 ? 356  LEU D N     1 
ATOM   4994  C  CA    . LEU B  1 362  ? 194.856 219.791 139.705 1.00 281.99 ? 356  LEU D CA    1 
ATOM   4995  C  C     . LEU B  1 362  ? 195.928 218.761 139.374 1.00 281.99 ? 356  LEU D C     1 
ATOM   4996  O  O     . LEU B  1 362  ? 196.923 219.097 138.723 1.00 281.99 ? 356  LEU D O     1 
ATOM   4997  C  CB    . LEU B  1 362  ? 195.291 220.633 140.906 1.00 281.99 ? 356  LEU D CB    1 
ATOM   4998  N  N     . GLU B  1 363  ? 195.752 217.512 139.813 1.00 292.11 ? 357  GLU D N     1 
ATOM   4999  C  CA    . GLU B  1 363  ? 196.723 216.464 139.528 1.00 292.11 ? 357  GLU D CA    1 
ATOM   5000  C  C     . GLU B  1 363  ? 196.453 215.750 138.208 1.00 292.11 ? 357  GLU D C     1 
ATOM   5001  O  O     . GLU B  1 363  ? 197.407 215.363 137.527 1.00 292.11 ? 357  GLU D O     1 
ATOM   5002  C  CB    . GLU B  1 363  ? 196.746 215.442 140.666 1.00 292.11 ? 357  GLU D CB    1 
ATOM   5003  N  N     . ALA B  1 364  ? 195.184 215.565 137.837 1.00 299.01 ? 358  ALA D N     1 
ATOM   5004  C  CA    . ALA B  1 364  ? 194.858 214.973 136.546 1.00 299.01 ? 358  ALA D CA    1 
ATOM   5005  C  C     . ALA B  1 364  ? 194.885 215.989 135.414 1.00 299.01 ? 358  ALA D C     1 
ATOM   5006  O  O     . ALA B  1 364  ? 194.469 215.662 134.297 1.00 299.01 ? 358  ALA D O     1 
ATOM   5007  C  CB    . ALA B  1 364  ? 193.485 214.302 136.603 1.00 299.01 ? 358  ALA D CB    1 
ATOM   5008  N  N     . LEU B  1 365  ? 195.349 217.208 135.676 1.00 298.39 ? 359  LEU D N     1 
ATOM   5009  C  CA    . LEU B  1 365  ? 195.433 218.243 134.654 1.00 298.39 ? 359  LEU D CA    1 
ATOM   5010  C  C     . LEU B  1 365  ? 196.618 218.004 133.721 1.00 298.39 ? 359  LEU D C     1 
ATOM   5011  O  O     . LEU B  1 365  ? 197.774 218.073 134.139 1.00 298.39 ? 359  LEU D O     1 
ATOM   5012  C  CB    . LEU B  1 365  ? 195.544 219.623 135.300 1.00 298.39 ? 359  LEU D CB    1 
ATOM   5013  N  N     . ARG C  1 38   ? 218.910 167.874 173.931 1.00 135.18 ? 32   ARG B N     1 
ATOM   5014  C  CA    . ARG C  1 38   ? 217.565 168.177 173.454 1.00 135.18 ? 32   ARG B CA    1 
ATOM   5015  C  C     . ARG C  1 38   ? 216.565 168.260 174.604 1.00 135.18 ? 32   ARG B C     1 
ATOM   5016  O  O     . ARG C  1 38   ? 215.872 167.289 174.908 1.00 135.18 ? 32   ARG B O     1 
ATOM   5017  C  CB    . ARG C  1 38   ? 217.110 167.126 172.447 1.00 135.18 ? 32   ARG B CB    1 
ATOM   5018  C  CG    . ARG C  1 38   ? 215.758 167.413 171.835 1.00 135.18 ? 32   ARG B CG    1 
ATOM   5019  C  CD    . ARG C  1 38   ? 215.412 166.357 170.821 1.00 135.18 ? 32   ARG B CD    1 
ATOM   5020  N  NE    . ARG C  1 38   ? 214.053 166.504 170.310 1.00 135.18 ? 32   ARG B NE    1 
ATOM   5021  C  CZ    . ARG C  1 38   ? 213.724 167.254 169.268 1.00 135.18 ? 32   ARG B CZ    1 
ATOM   5022  N  NH1   . ARG C  1 38   ? 214.661 167.927 168.620 1.00 135.18 ? 32   ARG B NH1   1 
ATOM   5023  N  NH2   . ARG C  1 38   ? 212.462 167.324 168.868 1.00 135.18 ? 32   ARG B NH2   1 
ATOM   5024  N  N     . ALA C  1 39   ? 216.502 169.424 175.252 1.00 134.48 ? 33   ALA B N     1 
ATOM   5025  C  CA    . ALA C  1 39   ? 215.558 169.649 176.340 1.00 134.48 ? 33   ALA B CA    1 
ATOM   5026  C  C     . ALA C  1 39   ? 214.255 170.227 175.808 1.00 134.48 ? 33   ALA B C     1 
ATOM   5027  O  O     . ALA C  1 39   ? 214.204 170.693 174.667 1.00 134.48 ? 33   ALA B O     1 
ATOM   5028  C  CB    . ALA C  1 39   ? 216.169 170.582 177.386 1.00 134.48 ? 33   ALA B CB    1 
ATOM   5029  N  N     . ARG C  1 40   ? 213.193 170.191 176.610 1.00 120.21 ? 34   ARG B N     1 
ATOM   5030  C  CA    . ARG C  1 40   ? 211.971 170.921 176.307 1.00 120.21 ? 34   ARG B CA    1 
ATOM   5031  C  C     . ARG C  1 40   ? 212.134 172.363 176.747 1.00 120.21 ? 34   ARG B C     1 
ATOM   5032  O  O     . ARG C  1 40   ? 212.576 172.632 177.868 1.00 120.21 ? 34   ARG B O     1 
ATOM   5033  C  CB    . ARG C  1 40   ? 210.750 170.339 177.006 1.00 120.21 ? 34   ARG B CB    1 
ATOM   5034  C  CG    . ARG C  1 40   ? 210.349 168.970 176.544 1.00 120.21 ? 34   ARG B CG    1 
ATOM   5035  C  CD    . ARG C  1 40   ? 209.061 168.575 177.229 1.00 120.21 ? 34   ARG B CD    1 
ATOM   5036  N  NE    . ARG C  1 40   ? 207.992 169.477 176.815 1.00 120.21 ? 34   ARG B NE    1 
ATOM   5037  C  CZ    . ARG C  1 40   ? 207.218 169.277 175.754 1.00 120.21 ? 34   ARG B CZ    1 
ATOM   5038  N  NH1   . ARG C  1 40   ? 207.372 168.194 175.011 1.00 120.21 ? 34   ARG B NH1   1 
ATOM   5039  N  NH2   . ARG C  1 40   ? 206.281 170.155 175.445 1.00 120.21 ? 34   ARG B NH2   1 
ATOM   5040  N  N     . PHE C  1 41   ? 211.776 173.289 175.859 1.00 119.80 ? 35   PHE B N     1 
ATOM   5041  C  CA    . PHE C  1 41   ? 211.799 174.701 176.223 1.00 119.80 ? 35   PHE B CA    1 
ATOM   5042  C  C     . PHE C  1 41   ? 210.940 174.959 177.453 1.00 119.80 ? 35   PHE B C     1 
ATOM   5043  O  O     . PHE C  1 41   ? 211.441 175.412 178.488 1.00 119.80 ? 35   PHE B O     1 
ATOM   5044  C  CB    . PHE C  1 41   ? 211.318 175.538 175.044 1.00 119.80 ? 35   PHE B CB    1 
ATOM   5045  C  CG    . PHE C  1 41   ? 211.365 177.006 175.291 1.00 119.80 ? 35   PHE B CG    1 
ATOM   5046  C  CD1   . PHE C  1 41   ? 212.555 177.695 175.204 1.00 119.80 ? 35   PHE B CD1   1 
ATOM   5047  C  CD2   . PHE C  1 41   ? 210.218 177.699 175.608 1.00 119.80 ? 35   PHE B CD2   1 
ATOM   5048  C  CE1   . PHE C  1 41   ? 212.596 179.051 175.427 1.00 119.80 ? 35   PHE B CE1   1 
ATOM   5049  C  CE2   . PHE C  1 41   ? 210.253 179.055 175.838 1.00 119.80 ? 35   PHE B CE2   1 
ATOM   5050  C  CZ    . PHE C  1 41   ? 211.443 179.732 175.747 1.00 119.80 ? 35   PHE B CZ    1 
ATOM   5051  N  N     . VAL C  1 42   ? 209.651 174.653 177.366 1.00 115.75 ? 36   VAL B N     1 
ATOM   5052  C  CA    . VAL C  1 42   ? 208.745 174.724 178.502 1.00 115.75 ? 36   VAL B CA    1 
ATOM   5053  C  C     . VAL C  1 42   ? 208.196 173.330 178.755 1.00 115.75 ? 36   VAL B C     1 
ATOM   5054  O  O     . VAL C  1 42   ? 207.819 172.628 177.811 1.00 115.75 ? 36   VAL B O     1 
ATOM   5055  C  CB    . VAL C  1 42   ? 207.602 175.726 178.267 1.00 115.75 ? 36   VAL B CB    1 
ATOM   5056  C  CG1   . VAL C  1 42   ? 206.577 175.624 179.370 1.00 115.75 ? 36   VAL B CG1   1 
ATOM   5057  C  CG2   . VAL C  1 42   ? 208.151 177.128 178.223 1.00 115.75 ? 36   VAL B CG2   1 
ATOM   5058  N  N     . SER C  1 43   ? 208.171 172.928 180.019 1.00 117.96 ? 37   SER B N     1 
ATOM   5059  C  CA    . SER C  1 43   ? 207.644 171.626 180.380 1.00 117.96 ? 37   SER B CA    1 
ATOM   5060  C  C     . SER C  1 43   ? 206.171 171.529 179.998 1.00 117.96 ? 37   SER B C     1 
ATOM   5061  O  O     . SER C  1 43   ? 205.473 172.534 179.836 1.00 117.96 ? 37   SER B O     1 
ATOM   5062  C  CB    . SER C  1 43   ? 207.822 171.380 181.873 1.00 117.96 ? 37   SER B CB    1 
ATOM   5063  O  OG    . SER C  1 43   ? 207.228 170.156 182.257 1.00 117.96 ? 37   SER B OG    1 
ATOM   5064  N  N     . LYS C  1 44   ? 205.680 170.292 179.891 1.00 120.05 ? 38   LYS B N     1 
ATOM   5065  C  CA    . LYS C  1 44   ? 204.260 170.072 179.641 1.00 120.05 ? 38   LYS B CA    1 
ATOM   5066  C  C     . LYS C  1 44   ? 203.379 170.637 180.745 1.00 120.05 ? 38   LYS B C     1 
ATOM   5067  O  O     . LYS C  1 44   ? 202.155 170.497 180.673 1.00 120.05 ? 38   LYS B O     1 
ATOM   5068  C  CB    . LYS C  1 44   ? 203.965 168.578 179.471 1.00 120.05 ? 38   LYS B CB    1 
ATOM   5069  C  CG    . LYS C  1 44   ? 204.571 167.948 178.217 1.00 120.05 ? 38   LYS B CG    1 
ATOM   5070  C  CD    . LYS C  1 44   ? 203.999 168.573 176.945 1.00 120.05 ? 38   LYS B CD    1 
ATOM   5071  C  CE    . LYS C  1 44   ? 202.536 168.207 176.709 1.00 120.05 ? 38   LYS B CE    1 
ATOM   5072  N  NZ    . LYS C  1 44   ? 202.361 166.781 176.334 1.00 120.05 ? 38   LYS B NZ    1 
ATOM   5073  N  N     . LYS C  1 45   ? 203.966 171.255 181.767 1.00 119.29 ? 39   LYS B N     1 
ATOM   5074  C  CA    . LYS C  1 45   ? 203.214 171.862 182.854 1.00 119.29 ? 39   LYS B CA    1 
ATOM   5075  C  C     . LYS C  1 45   ? 203.624 173.302 183.123 1.00 119.29 ? 39   LYS B C     1 
ATOM   5076  O  O     . LYS C  1 45   ? 203.383 173.810 184.221 1.00 119.29 ? 39   LYS B O     1 
ATOM   5077  C  CB    . LYS C  1 45   ? 203.361 171.022 184.121 1.00 119.29 ? 39   LYS B CB    1 
ATOM   5078  C  CG    . LYS C  1 45   ? 202.830 169.613 183.953 1.00 119.29 ? 39   LYS B CG    1 
ATOM   5079  C  CD    . LYS C  1 45   ? 201.332 169.647 183.699 1.00 119.29 ? 39   LYS B CD    1 
ATOM   5080  C  CE    . LYS C  1 45   ? 200.724 168.255 183.638 1.00 119.29 ? 39   LYS B CE    1 
ATOM   5081  N  NZ    . LYS C  1 45   ? 201.104 167.533 182.399 1.00 119.29 ? 39   LYS B NZ    1 
ATOM   5082  N  N     . GLY C  1 46   ? 204.243 173.972 182.156 1.00 115.76 ? 40   GLY B N     1 
ATOM   5083  C  CA    . GLY C  1 46   ? 204.513 175.386 182.275 1.00 115.76 ? 40   GLY B CA    1 
ATOM   5084  C  C     . GLY C  1 46   ? 205.857 175.749 182.862 1.00 115.76 ? 40   GLY B C     1 
ATOM   5085  O  O     . GLY C  1 46   ? 206.115 176.938 183.076 1.00 115.76 ? 40   GLY B O     1 
ATOM   5086  N  N     . ASN C  1 47   ? 206.720 174.777 183.131 1.00 117.33 ? 41   ASN B N     1 
ATOM   5087  C  CA    . ASN C  1 47   ? 208.020 175.085 183.704 1.00 117.33 ? 41   ASN B CA    1 
ATOM   5088  C  C     . ASN C  1 47   ? 208.985 175.549 182.627 1.00 117.33 ? 41   ASN B C     1 
ATOM   5089  O  O     . ASN C  1 47   ? 209.292 174.815 181.685 1.00 117.33 ? 41   ASN B O     1 
ATOM   5090  C  CB    . ASN C  1 47   ? 208.588 173.865 184.419 1.00 117.33 ? 41   ASN B CB    1 
ATOM   5091  C  CG    . ASN C  1 47   ? 207.711 173.403 185.552 1.00 117.33 ? 41   ASN B CG    1 
ATOM   5092  O  OD1   . ASN C  1 47   ? 207.161 172.304 185.515 1.00 117.33 ? 41   ASN B OD1   1 
ATOM   5093  N  ND2   . ASN C  1 47   ? 207.564 174.243 186.565 1.00 117.33 ? 41   ASN B ND2   1 
ATOM   5094  N  N     . CYS C  1 48   ? 209.485 176.768 182.781 1.00 118.45 ? 42   CYS B N     1 
ATOM   5095  C  CA    . CYS C  1 48   ? 210.447 177.340 181.855 1.00 118.45 ? 42   CYS B CA    1 
ATOM   5096  C  C     . CYS C  1 48   ? 211.794 176.683 182.110 1.00 118.45 ? 42   CYS B C     1 
ATOM   5097  O  O     . CYS C  1 48   ? 212.548 177.118 182.986 1.00 118.45 ? 42   CYS B O     1 
ATOM   5098  C  CB    . CYS C  1 48   ? 210.534 178.852 182.028 1.00 118.45 ? 42   CYS B CB    1 
ATOM   5099  S  SG    . CYS C  1 48   ? 208.981 179.691 181.658 1.00 118.45 ? 42   CYS B SG    1 
ATOM   5100  N  N     . ASN C  1 49   ? 212.095 175.645 181.337 1.00 122.55 ? 43   ASN B N     1 
ATOM   5101  C  CA    . ASN C  1 49   ? 213.220 174.757 181.613 1.00 122.55 ? 43   ASN B CA    1 
ATOM   5102  C  C     . ASN C  1 49   ? 214.532 175.326 181.090 1.00 122.55 ? 43   ASN B C     1 
ATOM   5103  O  O     . ASN C  1 49   ? 215.202 174.733 180.253 1.00 122.55 ? 43   ASN B O     1 
ATOM   5104  C  CB    . ASN C  1 49   ? 212.941 173.387 181.013 1.00 122.55 ? 43   ASN B CB    1 
ATOM   5105  C  CG    . ASN C  1 49   ? 211.720 172.731 181.616 1.00 122.55 ? 43   ASN B CG    1 
ATOM   5106  O  OD1   . ASN C  1 49   ? 211.480 172.824 182.818 1.00 122.55 ? 43   ASN B OD1   1 
ATOM   5107  N  ND2   . ASN C  1 49   ? 210.937 172.061 180.778 1.00 122.55 ? 43   ASN B ND2   1 
ATOM   5108  N  N     . VAL C  1 50   ? 214.895 176.504 181.588 1.00 119.55 ? 44   VAL B N     1 
ATOM   5109  C  CA    . VAL C  1 50   ? 216.077 177.230 181.139 1.00 119.55 ? 44   VAL B CA    1 
ATOM   5110  C  C     . VAL C  1 50   ? 216.739 177.818 182.380 1.00 119.55 ? 44   VAL B C     1 
ATOM   5111  O  O     . VAL C  1 50   ? 216.075 178.472 183.191 1.00 119.55 ? 44   VAL B O     1 
ATOM   5112  C  CB    . VAL C  1 50   ? 215.737 178.332 180.135 1.00 119.55 ? 44   VAL B CB    1 
ATOM   5113  C  CG1   . VAL C  1 50   ? 216.986 179.095 179.790 1.00 119.55 ? 44   VAL B CG1   1 
ATOM   5114  C  CG2   . VAL C  1 50   ? 215.093 177.756 178.885 1.00 119.55 ? 44   VAL B CG2   1 
ATOM   5115  N  N     . ALA C  1 51   ? 218.039 177.584 182.537 1.00 115.87 ? 45   ALA B N     1 
ATOM   5116  C  CA    . ALA C  1 51   ? 218.782 178.207 183.621 1.00 115.87 ? 45   ALA B CA    1 
ATOM   5117  C  C     . ALA C  1 51   ? 219.519 179.443 183.134 1.00 115.87 ? 45   ALA B C     1 
ATOM   5118  O  O     . ALA C  1 51   ? 219.842 179.574 181.949 1.00 115.87 ? 45   ALA B O     1 
ATOM   5119  C  CB    . ALA C  1 51   ? 219.768 177.222 184.244 1.00 115.87 ? 45   ALA B CB    1 
ATOM   5120  N  N     . HIS C  1 52   ? 219.789 180.352 184.066 1.00 122.70 ? 46   HIS B N     1 
ATOM   5121  C  CA    . HIS C  1 52   ? 220.389 181.636 183.749 1.00 122.70 ? 46   HIS B CA    1 
ATOM   5122  C  C     . HIS C  1 52   ? 221.905 181.560 183.713 1.00 122.70 ? 46   HIS B C     1 
ATOM   5123  O  O     . HIS C  1 52   ? 222.504 181.979 182.728 1.00 122.70 ? 46   HIS B O     1 
ATOM   5124  C  CB    . HIS C  1 52   ? 219.924 182.696 184.748 1.00 122.70 ? 46   HIS B CB    1 
ATOM   5125  C  CG    . HIS C  1 52   ? 218.457 182.976 184.698 1.00 122.70 ? 46   HIS B CG    1 
ATOM   5126  N  ND1   . HIS C  1 52   ? 217.533 182.245 185.417 1.00 122.70 ? 46   HIS B ND1   1 
ATOM   5127  C  CD2   . HIS C  1 52   ? 217.757 183.929 184.042 1.00 122.70 ? 46   HIS B CD2   1 
ATOM   5128  C  CE1   . HIS C  1 52   ? 216.325 182.731 185.188 1.00 122.70 ? 46   HIS B CE1   1 
ATOM   5129  N  NE2   . HIS C  1 52   ? 216.433 183.751 184.357 1.00 122.70 ? 46   HIS B NE2   1 
ATOM   5130  N  N     . LYS C  1 53   ? 222.542 181.040 184.760 1.00 124.60 ? 47   LYS B N     1 
ATOM   5131  C  CA    . LYS C  1 53   ? 223.977 180.792 184.676 1.00 124.60 ? 47   LYS B CA    1 
ATOM   5132  C  C     . LYS C  1 53   ? 224.801 182.050 184.404 1.00 124.60 ? 47   LYS B C     1 
ATOM   5133  O  O     . LYS C  1 53   ? 225.095 182.362 183.245 1.00 124.60 ? 47   LYS B O     1 
ATOM   5134  C  CB    . LYS C  1 53   ? 224.291 179.714 183.642 1.00 124.60 ? 47   LYS B CB    1 
ATOM   5135  C  CG    . LYS C  1 53   ? 223.808 178.343 184.076 1.00 124.60 ? 47   LYS B CG    1 
ATOM   5136  C  CD    . LYS C  1 53   ? 224.272 177.285 183.112 1.00 124.60 ? 47   LYS B CD    1 
ATOM   5137  C  CE    . LYS C  1 53   ? 223.500 177.389 181.833 1.00 124.60 ? 47   LYS B CE    1 
ATOM   5138  N  NZ    . LYS C  1 53   ? 222.083 176.974 181.999 1.00 124.60 ? 47   LYS B NZ    1 
ATOM   5139  N  N     . ASN C  1 54   ? 225.101 182.805 185.471 1.00 130.89 ? 48   ASN B N     1 
ATOM   5140  C  CA    . ASN C  1 54   ? 226.023 183.951 185.452 1.00 130.89 ? 48   ASN B CA    1 
ATOM   5141  C  C     . ASN C  1 54   ? 225.373 185.259 185.007 1.00 130.89 ? 48   ASN B C     1 
ATOM   5142  O  O     . ASN C  1 54   ? 225.875 185.940 184.110 1.00 130.89 ? 48   ASN B O     1 
ATOM   5143  C  CB    . ASN C  1 54   ? 227.234 183.660 184.564 1.00 130.89 ? 48   ASN B CB    1 
ATOM   5144  C  CG    . ASN C  1 54   ? 227.944 182.389 184.954 1.00 130.89 ? 48   ASN B CG    1 
ATOM   5145  O  OD1   . ASN C  1 54   ? 228.121 182.099 186.136 1.00 130.89 ? 48   ASN B OD1   1 
ATOM   5146  N  ND2   . ASN C  1 54   ? 228.328 181.601 183.955 1.00 130.89 ? 48   ASN B ND2   1 
ATOM   5147  N  N     . ILE C  1 55   ? 224.261 185.625 185.640 1.00 121.49 ? 49   ILE B N     1 
ATOM   5148  C  CA    . ILE C  1 55   ? 223.809 187.015 185.649 1.00 121.49 ? 49   ILE B CA    1 
ATOM   5149  C  C     . ILE C  1 55   ? 224.984 187.872 186.112 1.00 121.49 ? 49   ILE B C     1 
ATOM   5150  O  O     . ILE C  1 55   ? 225.691 187.509 187.053 1.00 121.49 ? 49   ILE B O     1 
ATOM   5151  C  CB    . ILE C  1 55   ? 222.600 187.221 186.568 1.00 121.49 ? 49   ILE B CB    1 
ATOM   5152  C  CG1   . ILE C  1 55   ? 221.395 186.388 186.127 1.00 121.49 ? 49   ILE B CG1   1 
ATOM   5153  C  CG2   . ILE C  1 55   ? 222.243 188.692 186.657 1.00 121.49 ? 49   ILE B CG2   1 
ATOM   5154  C  CD1   . ILE C  1 55   ? 221.260 185.090 186.879 1.00 121.49 ? 49   ILE B CD1   1 
ATOM   5155  N  N     . ARG C  1 56   ? 225.188 189.016 185.462 1.00 122.29 ? 50   ARG B N     1 
ATOM   5156  C  CA    . ARG C  1 56   ? 226.261 189.929 185.842 1.00 122.29 ? 50   ARG B CA    1 
ATOM   5157  C  C     . ARG C  1 56   ? 226.069 190.492 187.244 1.00 122.29 ? 50   ARG B C     1 
ATOM   5158  O  O     . ARG C  1 56   ? 226.867 190.234 188.151 1.00 122.29 ? 50   ARG B O     1 
ATOM   5159  C  CB    . ARG C  1 56   ? 226.323 191.070 184.833 1.00 122.29 ? 50   ARG B CB    1 
ATOM   5160  C  CG    . ARG C  1 56   ? 227.486 192.010 184.928 1.00 122.29 ? 50   ARG B CG    1 
ATOM   5161  C  CD    . ARG C  1 56   ? 227.363 192.978 183.771 1.00 122.29 ? 50   ARG B CD    1 
ATOM   5162  N  NE    . ARG C  1 56   ? 228.459 193.928 183.686 1.00 122.29 ? 50   ARG B NE    1 
ATOM   5163  C  CZ    . ARG C  1 56   ? 228.545 194.861 182.746 1.00 122.29 ? 50   ARG B CZ    1 
ATOM   5164  N  NH1   . ARG C  1 56   ? 227.595 194.963 181.832 1.00 122.29 ? 50   ARG B NH1   1 
ATOM   5165  N  NH2   . ARG C  1 56   ? 229.574 195.693 182.723 1.00 122.29 ? 50   ARG B NH2   1 
ATOM   5166  N  N     . GLU C  1 57   ? 224.997 191.253 187.429 1.00 130.73 ? 51   GLU B N     1 
ATOM   5167  C  CA    . GLU C  1 57   ? 224.886 192.164 188.559 1.00 130.73 ? 51   GLU B CA    1 
ATOM   5168  C  C     . GLU C  1 57   ? 224.299 191.458 189.778 1.00 130.73 ? 51   GLU B C     1 
ATOM   5169  O  O     . GLU C  1 57   ? 224.089 190.243 189.796 1.00 130.73 ? 51   GLU B O     1 
ATOM   5170  C  CB    . GLU C  1 57   ? 224.055 193.378 188.161 1.00 130.73 ? 51   GLU B CB    1 
ATOM   5171  C  CG    . GLU C  1 57   ? 224.667 194.180 187.037 1.00 130.73 ? 51   GLU B CG    1 
ATOM   5172  C  CD    . GLU C  1 57   ? 225.997 194.788 187.418 1.00 130.73 ? 51   GLU B CD    1 
ATOM   5173  O  OE1   . GLU C  1 57   ? 226.179 195.118 188.608 1.00 130.73 ? 51   GLU B OE1   1 
ATOM   5174  O  OE2   . GLU C  1 57   ? 226.862 194.937 186.529 1.00 130.73 ? 51   GLU B OE2   1 
ATOM   5175  N  N     . GLN C  1 58   ? 224.042 192.236 190.824 1.00 133.29 ? 52   GLN B N     1 
ATOM   5176  C  CA    . GLN C  1 58   ? 223.414 191.763 192.045 1.00 133.29 ? 52   GLN B CA    1 
ATOM   5177  C  C     . GLN C  1 58   ? 221.900 191.958 191.932 1.00 133.29 ? 52   GLN B C     1 
ATOM   5178  O  O     . GLN C  1 58   ? 221.385 192.257 190.853 1.00 133.29 ? 52   GLN B O     1 
ATOM   5179  C  CB    . GLN C  1 58   ? 224.015 192.494 193.247 1.00 133.29 ? 52   GLN B CB    1 
ATOM   5180  N  N     . GLY C  1 59   ? 221.182 191.802 193.031 1.00 155.16 ? 53   GLY B N     1 
ATOM   5181  C  CA    . GLY C  1 59   ? 219.728 191.906 193.015 1.00 155.16 ? 53   GLY B CA    1 
ATOM   5182  C  C     . GLY C  1 59   ? 219.257 193.301 193.350 1.00 155.16 ? 53   GLY B C     1 
ATOM   5183  O  O     . GLY C  1 59   ? 219.991 194.276 193.186 1.00 155.16 ? 53   GLY B O     1 
ATOM   5184  N  N     . ARG C  1 60   ? 218.010 193.393 193.812 1.00 161.93 ? 54   ARG B N     1 
ATOM   5185  C  CA    . ARG C  1 60   ? 217.417 194.667 194.214 1.00 161.93 ? 54   ARG B CA    1 
ATOM   5186  C  C     . ARG C  1 60   ? 217.876 194.987 195.631 1.00 161.93 ? 54   ARG B C     1 
ATOM   5187  O  O     . ARG C  1 60   ? 217.880 194.112 196.502 1.00 161.93 ? 54   ARG B O     1 
ATOM   5188  C  CB    . ARG C  1 60   ? 215.895 194.617 194.121 1.00 161.93 ? 54   ARG B CB    1 
ATOM   5189  N  N     . PHE C  1 61   ? 218.269 196.241 195.855 1.00 165.30 ? 55   PHE B N     1 
ATOM   5190  C  CA    . PHE C  1 61   ? 218.891 196.674 197.102 1.00 165.30 ? 55   PHE B CA    1 
ATOM   5191  C  C     . PHE C  1 61   ? 218.125 196.204 198.338 1.00 165.30 ? 55   PHE B C     1 
ATOM   5192  O  O     . PHE C  1 61   ? 218.645 195.397 199.114 1.00 165.30 ? 55   PHE B O     1 
ATOM   5193  C  CB    . PHE C  1 61   ? 219.054 198.202 197.084 1.00 165.30 ? 55   PHE B CB    1 
ATOM   5194  C  CG    . PHE C  1 61   ? 217.762 198.963 196.904 1.00 165.30 ? 55   PHE B CG    1 
ATOM   5195  C  CD1   . PHE C  1 61   ? 217.212 199.131 195.645 1.00 165.30 ? 55   PHE B CD1   1 
ATOM   5196  C  CD2   . PHE C  1 61   ? 217.129 199.553 197.986 1.00 165.30 ? 55   PHE B CD2   1 
ATOM   5197  C  CE1   . PHE C  1 61   ? 216.037 199.826 195.471 1.00 165.30 ? 55   PHE B CE1   1 
ATOM   5198  C  CE2   . PHE C  1 61   ? 215.952 200.252 197.815 1.00 165.30 ? 55   PHE B CE2   1 
ATOM   5199  C  CZ    . PHE C  1 61   ? 215.411 200.392 196.555 1.00 165.30 ? 55   PHE B CZ    1 
ATOM   5200  N  N     . LEU C  1 62   ? 216.891 196.670 198.523 1.00 156.82 ? 56   LEU B N     1 
ATOM   5201  C  CA    . LEU C  1 62   ? 216.037 196.238 199.623 1.00 156.82 ? 56   LEU B CA    1 
ATOM   5202  C  C     . LEU C  1 62   ? 214.576 196.111 199.220 1.00 156.82 ? 56   LEU B C     1 
ATOM   5203  O  O     . LEU C  1 62   ? 213.698 196.199 200.081 1.00 156.82 ? 56   LEU B O     1 
ATOM   5204  C  CB    . LEU C  1 62   ? 216.154 197.188 200.818 1.00 156.82 ? 56   LEU B CB    1 
ATOM   5205  C  CG    . LEU C  1 62   ? 217.327 197.028 201.790 1.00 156.82 ? 56   LEU B CG    1 
ATOM   5206  C  CD1   . LEU C  1 62   ? 218.614 197.641 201.257 1.00 156.82 ? 56   LEU B CD1   1 
ATOM   5207  C  CD2   . LEU C  1 62   ? 216.977 197.599 203.156 1.00 156.82 ? 56   LEU B CD2   1 
ATOM   5208  N  N     . GLN C  1 63   ? 214.289 195.929 197.934 1.00 153.48 ? 57   GLN B N     1 
ATOM   5209  C  CA    . GLN C  1 63   ? 212.925 195.703 197.472 1.00 153.48 ? 57   GLN B CA    1 
ATOM   5210  C  C     . GLN C  1 63   ? 212.699 194.261 197.049 1.00 153.48 ? 57   GLN B C     1 
ATOM   5211  O  O     . GLN C  1 63   ? 211.584 193.746 197.166 1.00 153.48 ? 57   GLN B O     1 
ATOM   5212  C  CB    . GLN C  1 63   ? 212.590 196.649 196.313 1.00 153.48 ? 57   GLN B CB    1 
ATOM   5213  N  N     . ASP C  1 64   ? 213.748 193.600 196.565 1.00 152.02 ? 58   ASP B N     1 
ATOM   5214  C  CA    . ASP C  1 64   ? 213.687 192.186 196.225 1.00 152.02 ? 58   ASP B CA    1 
ATOM   5215  C  C     . ASP C  1 64   ? 213.190 191.368 197.406 1.00 152.02 ? 58   ASP B C     1 
ATOM   5216  O  O     . ASP C  1 64   ? 212.715 190.245 197.233 1.00 152.02 ? 58   ASP B O     1 
ATOM   5217  C  CB    . ASP C  1 64   ? 215.059 191.676 195.767 1.00 152.02 ? 58   ASP B CB    1 
ATOM   5218  C  CG    . ASP C  1 64   ? 216.138 191.835 196.831 1.00 152.02 ? 58   ASP B CG    1 
ATOM   5219  O  OD1   . ASP C  1 64   ? 215.861 192.403 197.909 1.00 152.02 ? 58   ASP B OD1   1 
ATOM   5220  O  OD2   . ASP C  1 64   ? 217.277 191.396 196.582 1.00 152.02 ? 58   ASP B OD2   1 
ATOM   5221  N  N     . VAL C  1 65   ? 213.302 191.920 198.614 1.00 147.27 ? 59   VAL B N     1 
ATOM   5222  C  CA    . VAL C  1 65   ? 212.816 191.216 199.793 1.00 147.27 ? 59   VAL B CA    1 
ATOM   5223  C  C     . VAL C  1 65   ? 211.331 190.914 199.653 1.00 147.27 ? 59   VAL B C     1 
ATOM   5224  O  O     . VAL C  1 65   ? 210.894 189.775 199.832 1.00 147.27 ? 59   VAL B O     1 
ATOM   5225  C  CB    . VAL C  1 65   ? 213.131 192.024 201.064 1.00 147.27 ? 59   VAL B CB    1 
ATOM   5226  C  CG1   . VAL C  1 65   ? 214.628 192.100 201.265 1.00 147.27 ? 59   VAL B CG1   1 
ATOM   5227  C  CG2   . VAL C  1 65   ? 212.568 193.420 200.965 1.00 147.27 ? 59   VAL B CG2   1 
ATOM   5228  N  N     . PHE C  1 66   ? 210.541 191.911 199.254 1.00 140.87 ? 60   PHE B N     1 
ATOM   5229  C  CA    . PHE C  1 66   ? 209.098 191.719 199.176 1.00 140.87 ? 60   PHE B CA    1 
ATOM   5230  C  C     . PHE C  1 66   ? 208.722 190.767 198.049 1.00 140.87 ? 60   PHE B C     1 
ATOM   5231  O  O     . PHE C  1 66   ? 207.943 189.831 198.254 1.00 140.87 ? 60   PHE B O     1 
ATOM   5232  C  CB    . PHE C  1 66   ? 208.410 193.069 199.005 1.00 140.87 ? 60   PHE B CB    1 
ATOM   5233  C  CG    . PHE C  1 66   ? 208.507 193.939 200.221 1.00 140.87 ? 60   PHE B CG    1 
ATOM   5234  C  CD1   . PHE C  1 66   ? 208.754 193.380 201.459 1.00 140.87 ? 60   PHE B CD1   1 
ATOM   5235  C  CD2   . PHE C  1 66   ? 208.400 195.313 200.123 1.00 140.87 ? 60   PHE B CD2   1 
ATOM   5236  C  CE1   . PHE C  1 66   ? 208.858 194.168 202.580 1.00 140.87 ? 60   PHE B CE1   1 
ATOM   5237  C  CE2   . PHE C  1 66   ? 208.506 196.109 201.244 1.00 140.87 ? 60   PHE B CE2   1 
ATOM   5238  C  CZ    . PHE C  1 66   ? 208.735 195.535 202.473 1.00 140.87 ? 60   PHE B CZ    1 
ATOM   5239  N  N     . THR C  1 67   ? 209.271 190.986 196.854 1.00 148.28 ? 61   THR B N     1 
ATOM   5240  C  CA    . THR C  1 67   ? 208.966 190.115 195.726 1.00 148.28 ? 61   THR B CA    1 
ATOM   5241  C  C     . THR C  1 67   ? 209.378 188.675 196.008 1.00 148.28 ? 61   THR B C     1 
ATOM   5242  O  O     . THR C  1 67   ? 208.579 187.746 195.849 1.00 148.28 ? 61   THR B O     1 
ATOM   5243  C  CB    . THR C  1 67   ? 209.652 190.640 194.466 1.00 148.28 ? 61   THR B CB    1 
ATOM   5244  O  OG1   . THR C  1 67   ? 211.060 190.775 194.706 1.00 148.28 ? 61   THR B OG1   1 
ATOM   5245  C  CG2   . THR C  1 67   ? 209.074 191.990 194.069 1.00 148.28 ? 61   THR B CG2   1 
ATOM   5246  N  N     . THR C  1 68   ? 210.628 188.471 196.428 1.00 142.14 ? 62   THR B N     1 
ATOM   5247  C  CA    . THR C  1 68   ? 211.097 187.132 196.771 1.00 142.14 ? 62   THR B CA    1 
ATOM   5248  C  C     . THR C  1 68   ? 210.326 186.567 197.952 1.00 142.14 ? 62   THR B C     1 
ATOM   5249  O  O     . THR C  1 68   ? 210.300 185.350 198.164 1.00 142.14 ? 62   THR B O     1 
ATOM   5250  C  CB    . THR C  1 68   ? 212.593 187.166 197.079 1.00 142.14 ? 62   THR B CB    1 
ATOM   5251  O  OG1   . THR C  1 68   ? 212.842 188.113 198.124 1.00 142.14 ? 62   THR B OG1   1 
ATOM   5252  C  CG2   . THR C  1 68   ? 213.391 187.547 195.841 1.00 142.14 ? 62   THR B CG2   1 
ATOM   5253  N  N     . LEU C  1 69   ? 209.682 187.435 198.726 1.00 125.87 ? 63   LEU B N     1 
ATOM   5254  C  CA    . LEU C  1 69   ? 208.913 186.976 199.868 1.00 125.87 ? 63   LEU B CA    1 
ATOM   5255  C  C     . LEU C  1 69   ? 207.560 186.440 199.426 1.00 125.87 ? 63   LEU B C     1 
ATOM   5256  O  O     . LEU C  1 69   ? 207.091 185.412 199.927 1.00 125.87 ? 63   LEU B O     1 
ATOM   5257  C  CB    . LEU C  1 69   ? 208.770 188.134 200.853 1.00 125.87 ? 63   LEU B CB    1 
ATOM   5258  C  CG    . LEU C  1 69   ? 208.358 187.878 202.296 1.00 125.87 ? 63   LEU B CG    1 
ATOM   5259  C  CD1   . LEU C  1 69   ? 206.872 187.622 202.406 1.00 125.87 ? 63   LEU B CD1   1 
ATOM   5260  C  CD2   . LEU C  1 69   ? 209.154 186.708 202.846 1.00 125.87 ? 63   LEU B CD2   1 
ATOM   5261  N  N     . VAL C  1 70   ? 206.927 187.116 198.466 1.00 134.34 ? 64   VAL B N     1 
ATOM   5262  C  CA    . VAL C  1 70   ? 205.571 186.746 198.067 1.00 134.34 ? 64   VAL B CA    1 
ATOM   5263  C  C     . VAL C  1 70   ? 205.535 185.314 197.551 1.00 134.34 ? 64   VAL B C     1 
ATOM   5264  O  O     . VAL C  1 70   ? 204.948 184.424 198.179 1.00 134.34 ? 64   VAL B O     1 
ATOM   5265  C  CB    . VAL C  1 70   ? 205.033 187.726 197.013 1.00 134.34 ? 64   VAL B CB    1 
ATOM   5266  C  CG1   . VAL C  1 70   ? 203.645 187.302 196.561 1.00 134.34 ? 64   VAL B CG1   1 
ATOM   5267  C  CG2   . VAL C  1 70   ? 205.018 189.126 197.558 1.00 134.34 ? 64   VAL B CG2   1 
ATOM   5268  N  N     . ASP C  1 71   ? 206.181 185.064 196.417 1.00 143.47 ? 65   ASP B N     1 
ATOM   5269  C  CA    . ASP C  1 71   ? 206.176 183.747 195.800 1.00 143.47 ? 65   ASP B CA    1 
ATOM   5270  C  C     . ASP C  1 71   ? 207.235 182.903 196.478 1.00 143.47 ? 65   ASP B C     1 
ATOM   5271  O  O     . ASP C  1 71   ? 208.430 183.073 196.216 1.00 143.47 ? 65   ASP B O     1 
ATOM   5272  C  CB    . ASP C  1 71   ? 206.443 183.812 194.300 1.00 143.47 ? 65   ASP B CB    1 
ATOM   5273  C  CG    . ASP C  1 71   ? 206.236 182.471 193.614 1.00 143.47 ? 65   ASP B CG    1 
ATOM   5274  O  OD1   . ASP C  1 71   ? 205.068 182.079 193.400 1.00 143.47 ? 65   ASP B OD1   1 
ATOM   5275  O  OD2   . ASP C  1 71   ? 207.239 181.802 193.300 1.00 143.47 ? 65   ASP B OD2   1 
ATOM   5276  N  N     . LEU C  1 72   ? 206.794 181.997 197.341 1.00 114.20 ? 66   LEU B N     1 
ATOM   5277  C  CA    . LEU C  1 72   ? 207.706 181.235 198.169 1.00 114.20 ? 66   LEU B CA    1 
ATOM   5278  C  C     . LEU C  1 72   ? 206.872 180.204 198.908 1.00 114.20 ? 66   LEU B C     1 
ATOM   5279  O  O     . LEU C  1 72   ? 205.682 180.415 199.156 1.00 114.20 ? 66   LEU B O     1 
ATOM   5280  C  CB    . LEU C  1 72   ? 208.460 182.151 199.137 1.00 114.20 ? 66   LEU B CB    1 
ATOM   5281  C  CG    . LEU C  1 72   ? 209.657 181.606 199.899 1.00 114.20 ? 66   LEU B CG    1 
ATOM   5282  C  CD1   . LEU C  1 72   ? 210.645 182.720 200.155 1.00 114.20 ? 66   LEU B CD1   1 
ATOM   5283  C  CD2   . LEU C  1 72   ? 209.191 181.044 201.197 1.00 114.20 ? 66   LEU B CD2   1 
ATOM   5284  N  N     . LYS C  1 73   ? 207.501 179.087 199.248 1.00 112.75 ? 67   LYS B N     1 
ATOM   5285  C  CA    . LYS C  1 73   ? 206.763 177.994 199.856 1.00 112.75 ? 67   LYS B CA    1 
ATOM   5286  C  C     . LYS C  1 73   ? 206.158 178.440 201.188 1.00 112.75 ? 67   LYS B C     1 
ATOM   5287  O  O     . LYS C  1 73   ? 206.785 179.159 201.971 1.00 112.75 ? 67   LYS B O     1 
ATOM   5288  C  CB    . LYS C  1 73   ? 207.680 176.785 200.041 1.00 112.75 ? 67   LYS B CB    1 
ATOM   5289  C  CG    . LYS C  1 73   ? 206.958 175.515 200.448 1.00 112.75 ? 67   LYS B CG    1 
ATOM   5290  C  CD    . LYS C  1 73   ? 207.911 174.340 200.603 1.00 112.75 ? 67   LYS B CD    1 
ATOM   5291  C  CE    . LYS C  1 73   ? 207.167 173.096 201.072 1.00 112.75 ? 67   LYS B CE    1 
ATOM   5292  N  NZ    . LYS C  1 73   ? 208.075 171.941 201.318 1.00 112.75 ? 67   LYS B NZ    1 
ATOM   5293  N  N     . TRP C  1 74   ? 204.908 178.023 201.423 1.00 103.81 ? 68   TRP B N     1 
ATOM   5294  C  CA    . TRP C  1 74   ? 204.164 178.478 202.597 1.00 103.81 ? 68   TRP B CA    1 
ATOM   5295  C  C     . TRP C  1 74   ? 204.902 178.256 203.907 1.00 103.81 ? 68   TRP B C     1 
ATOM   5296  O  O     . TRP C  1 74   ? 205.065 179.221 204.669 1.00 103.81 ? 68   TRP B O     1 
ATOM   5297  C  CB    . TRP C  1 74   ? 202.783 177.822 202.614 1.00 103.81 ? 68   TRP B CB    1 
ATOM   5298  C  CG    . TRP C  1 74   ? 201.873 178.396 201.601 1.00 103.81 ? 68   TRP B CG    1 
ATOM   5299  C  CD1   . TRP C  1 74   ? 201.618 177.908 200.356 1.00 103.81 ? 68   TRP B CD1   1 
ATOM   5300  C  CD2   . TRP C  1 74   ? 201.105 179.592 201.734 1.00 103.81 ? 68   TRP B CD2   1 
ATOM   5301  N  NE1   . TRP C  1 74   ? 200.732 178.726 199.704 1.00 103.81 ? 68   TRP B NE1   1 
ATOM   5302  C  CE2   . TRP C  1 74   ? 200.401 179.769 200.529 1.00 103.81 ? 68   TRP B CE2   1 
ATOM   5303  C  CE3   . TRP C  1 74   ? 200.944 180.531 202.757 1.00 103.81 ? 68   TRP B CE3   1 
ATOM   5304  C  CZ2   . TRP C  1 74   ? 199.546 180.848 200.318 1.00 103.81 ? 68   TRP B CZ2   1 
ATOM   5305  C  CZ3   . TRP C  1 74   ? 200.094 181.601 202.543 1.00 103.81 ? 68   TRP B CZ3   1 
ATOM   5306  C  CH2   . TRP C  1 74   ? 199.406 181.747 201.337 1.00 103.81 ? 68   TRP B CH2   1 
ATOM   5307  N  N     . PRO C  1 75   ? 205.344 177.041 204.246 1.00 108.11 ? 69   PRO B N     1 
ATOM   5308  C  CA    . PRO C  1 75   ? 206.003 176.863 205.545 1.00 108.11 ? 69   PRO B CA    1 
ATOM   5309  C  C     . PRO C  1 75   ? 207.229 177.734 205.720 1.00 108.11 ? 69   PRO B C     1 
ATOM   5310  O  O     . PRO C  1 75   ? 207.455 178.235 206.825 1.00 108.11 ? 69   PRO B O     1 
ATOM   5311  C  CB    . PRO C  1 75   ? 206.360 175.372 205.559 1.00 108.11 ? 69   PRO B CB    1 
ATOM   5312  C  CG    . PRO C  1 75   ? 206.385 174.974 204.129 1.00 108.11 ? 69   PRO B CG    1 
ATOM   5313  C  CD    . PRO C  1 75   ? 205.327 175.787 203.477 1.00 108.11 ? 69   PRO B CD    1 
ATOM   5314  N  N     . HIS C  1 76   ? 208.011 177.956 204.663 1.00 114.89 ? 70   HIS B N     1 
ATOM   5315  C  CA    . HIS C  1 76   ? 209.171 178.826 204.800 1.00 114.89 ? 70   HIS B CA    1 
ATOM   5316  C  C     . HIS C  1 76   ? 208.751 180.254 205.137 1.00 114.89 ? 70   HIS B C     1 
ATOM   5317  O  O     . HIS C  1 76   ? 209.332 180.881 206.029 1.00 114.89 ? 70   HIS B O     1 
ATOM   5318  C  CB    . HIS C  1 76   ? 210.007 178.804 203.524 1.00 114.89 ? 70   HIS B CB    1 
ATOM   5319  C  CG    . HIS C  1 76   ? 210.597 177.467 203.200 1.00 114.89 ? 70   HIS B CG    1 
ATOM   5320  N  ND1   . HIS C  1 76   ? 209.959 176.546 202.400 1.00 114.89 ? 70   HIS B ND1   1 
ATOM   5321  C  CD2   . HIS C  1 76   ? 211.771 176.899 203.564 1.00 114.89 ? 70   HIS B CD2   1 
ATOM   5322  C  CE1   . HIS C  1 76   ? 210.712 175.466 202.285 1.00 114.89 ? 70   HIS B CE1   1 
ATOM   5323  N  NE2   . HIS C  1 76   ? 211.817 175.654 202.984 1.00 114.89 ? 70   HIS B NE2   1 
ATOM   5324  N  N     . THR C  1 77   ? 207.740 180.779 204.441 1.00 107.19 ? 71   THR B N     1 
ATOM   5325  C  CA    . THR C  1 77   ? 207.260 182.129 204.730 1.00 107.19 ? 71   THR B CA    1 
ATOM   5326  C  C     . THR C  1 77   ? 206.711 182.230 206.147 1.00 107.19 ? 71   THR B C     1 
ATOM   5327  O  O     . THR C  1 77   ? 207.028 183.174 206.886 1.00 107.19 ? 71   THR B O     1 
ATOM   5328  C  CB    . THR C  1 77   ? 206.183 182.518 203.720 1.00 107.19 ? 71   THR B CB    1 
ATOM   5329  O  OG1   . THR C  1 77   ? 206.731 182.487 202.398 1.00 107.19 ? 71   THR B OG1   1 
ATOM   5330  C  CG2   . THR C  1 77   ? 205.645 183.909 204.011 1.00 107.19 ? 71   THR B CG2   1 
ATOM   5331  N  N     . LEU C  1 78   ? 205.845 181.287 206.516 1.00 101.92 ? 72   LEU B N     1 
ATOM   5332  C  CA    . LEU C  1 78   ? 205.377 181.170 207.891 1.00 101.92 ? 72   LEU B CA    1 
ATOM   5333  C  C     . LEU C  1 78   ? 206.528 181.262 208.875 1.00 101.92 ? 72   LEU B C     1 
ATOM   5334  O  O     . LEU C  1 78   ? 206.501 182.083 209.797 1.00 101.92 ? 72   LEU B O     1 
ATOM   5335  C  CB    . LEU C  1 78   ? 204.634 179.844 208.060 1.00 101.92 ? 72   LEU B CB    1 
ATOM   5336  C  CG    . LEU C  1 78   ? 204.058 179.431 209.414 1.00 101.92 ? 72   LEU B CG    1 
ATOM   5337  C  CD1   . LEU C  1 78   ? 205.099 178.781 210.329 1.00 101.92 ? 72   LEU B CD1   1 
ATOM   5338  C  CD2   . LEU C  1 78   ? 203.427 180.628 210.094 1.00 101.92 ? 72   LEU B CD2   1 
ATOM   5339  N  N     . LEU C  1 79   ? 207.527 180.399 208.712 1.00 103.22 ? 73   LEU B N     1 
ATOM   5340  C  CA    . LEU C  1 79   ? 208.646 180.366 209.639 1.00 103.22 ? 73   LEU B CA    1 
ATOM   5341  C  C     . LEU C  1 79   ? 209.346 181.709 209.690 1.00 103.22 ? 73   LEU B C     1 
ATOM   5342  O  O     . LEU C  1 79   ? 209.741 182.170 210.764 1.00 103.22 ? 73   LEU B O     1 
ATOM   5343  C  CB    . LEU C  1 79   ? 209.619 179.264 209.227 1.00 103.22 ? 73   LEU B CB    1 
ATOM   5344  C  CG    . LEU C  1 79   ? 210.787 178.942 210.152 1.00 103.22 ? 73   LEU B CG    1 
ATOM   5345  C  CD1   . LEU C  1 79   ? 211.154 177.479 210.010 1.00 103.22 ? 73   LEU B CD1   1 
ATOM   5346  C  CD2   . LEU C  1 79   ? 211.992 179.816 209.841 1.00 103.22 ? 73   LEU B CD2   1 
ATOM   5347  N  N     . ILE C  1 80   ? 209.517 182.350 208.535 1.00 103.15 ? 74   ILE B N     1 
ATOM   5348  C  CA    . ILE C  1 80   ? 210.192 183.640 208.515 1.00 103.15 ? 74   ILE B CA    1 
ATOM   5349  C  C     . ILE C  1 80   ? 209.428 184.655 209.350 1.00 103.15 ? 74   ILE B C     1 
ATOM   5350  O  O     . ILE C  1 80   ? 210.017 185.396 210.144 1.00 103.15 ? 74   ILE B O     1 
ATOM   5351  C  CB    . ILE C  1 80   ? 210.377 184.119 207.068 1.00 103.15 ? 74   ILE B CB    1 
ATOM   5352  C  CG1   . ILE C  1 80   ? 211.337 183.185 206.330 1.00 103.15 ? 74   ILE B CG1   1 
ATOM   5353  C  CG2   . ILE C  1 80   ? 210.881 185.547 207.046 1.00 103.15 ? 74   ILE B CG2   1 
ATOM   5354  C  CD1   . ILE C  1 80   ? 211.358 183.365 204.827 1.00 103.15 ? 74   ILE B CD1   1 
ATOM   5355  N  N     . PHE C  1 81   ? 208.106 184.685 209.213 1.00 105.62 ? 75   PHE B N     1 
ATOM   5356  C  CA    . PHE C  1 81   ? 207.339 185.672 209.966 1.00 105.62 ? 75   PHE B CA    1 
ATOM   5357  C  C     . PHE C  1 81   ? 207.362 185.362 211.456 1.00 105.62 ? 75   PHE B C     1 
ATOM   5358  O  O     . PHE C  1 81   ? 207.548 186.258 212.288 1.00 105.62 ? 75   PHE B O     1 
ATOM   5359  C  CB    . PHE C  1 81   ? 205.905 185.736 209.464 1.00 105.62 ? 75   PHE B CB    1 
ATOM   5360  C  CG    . PHE C  1 81   ? 205.771 186.337 208.107 1.00 105.62 ? 75   PHE B CG    1 
ATOM   5361  C  CD1   . PHE C  1 81   ? 206.861 186.872 207.452 1.00 105.62 ? 75   PHE B CD1   1 
ATOM   5362  C  CD2   . PHE C  1 81   ? 204.535 186.418 207.502 1.00 105.62 ? 75   PHE B CD2   1 
ATOM   5363  C  CE1   . PHE C  1 81   ? 206.726 187.439 206.203 1.00 105.62 ? 75   PHE B CE1   1 
ATOM   5364  C  CE2   . PHE C  1 81   ? 204.399 186.987 206.255 1.00 105.62 ? 75   PHE B CE2   1 
ATOM   5365  C  CZ    . PHE C  1 81   ? 205.490 187.497 205.607 1.00 105.62 ? 75   PHE B CZ    1 
ATOM   5366  N  N     . THR C  1 82   ? 207.144 184.096 211.805 1.00 97.20  ? 76   THR B N     1 
ATOM   5367  C  CA    . THR C  1 82   ? 207.229 183.682 213.200 1.00 97.20  ? 76   THR B CA    1 
ATOM   5368  C  C     . THR C  1 82   ? 208.555 184.091 213.810 1.00 97.20  ? 76   THR B C     1 
ATOM   5369  O  O     . THR C  1 82   ? 208.603 184.625 214.921 1.00 97.20  ? 76   THR B O     1 
ATOM   5370  C  CB    . THR C  1 82   ? 207.067 182.173 213.306 1.00 97.20  ? 76   THR B CB    1 
ATOM   5371  O  OG1   . THR C  1 82   ? 208.131 181.539 212.587 1.00 97.20  ? 76   THR B OG1   1 
ATOM   5372  C  CG2   . THR C  1 82   ? 205.755 181.739 212.710 1.00 97.20  ? 76   THR B CG2   1 
ATOM   5373  N  N     . MET C  1 83   ? 209.648 183.845 213.100 1.00 95.08  ? 77   MET B N     1 
ATOM   5374  C  CA    . MET C  1 83   ? 210.948 184.109 213.685 1.00 95.08  ? 77   MET B CA    1 
ATOM   5375  C  C     . MET C  1 83   ? 211.217 185.606 213.730 1.00 95.08  ? 77   MET B C     1 
ATOM   5376  O  O     . MET C  1 83   ? 211.914 186.080 214.633 1.00 95.08  ? 77   MET B O     1 
ATOM   5377  C  CB    . MET C  1 83   ? 212.027 183.343 212.914 1.00 95.08  ? 77   MET B CB    1 
ATOM   5378  C  CG    . MET C  1 83   ? 213.315 183.165 213.692 1.00 95.08  ? 77   MET B CG    1 
ATOM   5379  S  SD    . MET C  1 83   ? 214.489 182.031 212.928 1.00 95.08  ? 77   MET B SD    1 
ATOM   5380  C  CE    . MET C  1 83   ? 215.799 182.059 214.148 1.00 95.08  ? 77   MET B CE    1 
ATOM   5381  N  N     . SER C  1 84   ? 210.623 186.369 212.809 1.00 84.15  ? 78   SER B N     1 
ATOM   5382  C  CA    . SER C  1 84   ? 210.663 187.821 212.926 1.00 84.15  ? 78   SER B CA    1 
ATOM   5383  C  C     . SER C  1 84   ? 209.987 188.285 214.207 1.00 84.15  ? 78   SER B C     1 
ATOM   5384  O  O     . SER C  1 84   ? 210.514 189.145 214.922 1.00 84.15  ? 78   SER B O     1 
ATOM   5385  C  CB    . SER C  1 84   ? 209.994 188.465 211.715 1.00 84.15  ? 78   SER B CB    1 
ATOM   5386  O  OG    . SER C  1 84   ? 208.608 188.174 211.698 1.00 84.15  ? 78   SER B OG    1 
ATOM   5387  N  N     . PHE C  1 85   ? 208.814 187.735 214.508 1.00 72.41  ? 79   PHE B N     1 
ATOM   5388  C  CA    . PHE C  1 85   ? 208.144 188.094 215.753 1.00 72.41  ? 79   PHE B CA    1 
ATOM   5389  C  C     . PHE C  1 85   ? 208.965 187.680 216.964 1.00 72.41  ? 79   PHE B C     1 
ATOM   5390  O  O     . PHE C  1 85   ? 209.064 188.432 217.939 1.00 72.41  ? 79   PHE B O     1 
ATOM   5391  C  CB    . PHE C  1 85   ? 206.754 187.472 215.800 1.00 72.41  ? 79   PHE B CB    1 
ATOM   5392  C  CG    . PHE C  1 85   ? 205.743 188.207 214.982 1.00 72.41  ? 79   PHE B CG    1 
ATOM   5393  C  CD1   . PHE C  1 85   ? 205.918 189.540 214.689 1.00 72.41  ? 79   PHE B CD1   1 
ATOM   5394  C  CD2   . PHE C  1 85   ? 204.636 187.559 214.476 1.00 72.41  ? 79   PHE B CD2   1 
ATOM   5395  C  CE1   . PHE C  1 85   ? 204.992 190.224 213.934 1.00 72.41  ? 79   PHE B CE1   1 
ATOM   5396  C  CE2   . PHE C  1 85   ? 203.712 188.235 213.713 1.00 72.41  ? 79   PHE B CE2   1 
ATOM   5397  C  CZ    . PHE C  1 85   ? 203.890 189.570 213.443 1.00 72.41  ? 79   PHE B CZ    1 
ATOM   5398  N  N     . LEU C  1 86   ? 209.568 186.494 216.922 1.00 69.18  ? 80   LEU B N     1 
ATOM   5399  C  CA    . LEU C  1 86   ? 210.403 186.063 218.037 1.00 69.18  ? 80   LEU B CA    1 
ATOM   5400  C  C     . LEU C  1 86   ? 211.568 187.010 218.257 1.00 69.18  ? 80   LEU B C     1 
ATOM   5401  O  O     . LEU C  1 86   ? 211.858 187.388 219.395 1.00 69.18  ? 80   LEU B O     1 
ATOM   5402  C  CB    . LEU C  1 86   ? 210.923 184.648 217.813 1.00 69.18  ? 80   LEU B CB    1 
ATOM   5403  C  CG    . LEU C  1 86   ? 210.089 183.557 218.465 1.00 69.18  ? 80   LEU B CG    1 
ATOM   5404  C  CD1   . LEU C  1 86   ? 210.178 183.748 219.959 1.00 69.18  ? 80   LEU B CD1   1 
ATOM   5405  C  CD2   . LEU C  1 86   ? 208.654 183.633 218.006 1.00 69.18  ? 80   LEU B CD2   1 
ATOM   5406  N  N     . CYS C  1 87   ? 212.267 187.382 217.189 1.00 80.65  ? 81   CYS B N     1 
ATOM   5407  C  CA    . CYS C  1 87   ? 213.429 188.235 217.376 1.00 80.65  ? 81   CYS B CA    1 
ATOM   5408  C  C     . CYS C  1 87   ? 213.007 189.623 217.834 1.00 80.65  ? 81   CYS B C     1 
ATOM   5409  O  O     . CYS C  1 87   ? 213.655 190.220 218.700 1.00 80.65  ? 81   CYS B O     1 
ATOM   5410  C  CB    . CYS C  1 87   ? 214.262 188.297 216.095 1.00 80.65  ? 81   CYS B CB    1 
ATOM   5411  S  SG    . CYS C  1 87   ? 213.506 189.121 214.695 1.00 80.65  ? 81   CYS B SG    1 
ATOM   5412  N  N     . SER C  1 88   ? 211.900 190.137 217.295 1.00 69.50  ? 82   SER B N     1 
ATOM   5413  C  CA    . SER C  1 88   ? 211.406 191.428 217.753 1.00 69.50  ? 82   SER B CA    1 
ATOM   5414  C  C     . SER C  1 88   ? 211.022 191.390 219.223 1.00 69.50  ? 82   SER B C     1 
ATOM   5415  O  O     . SER C  1 88   ? 211.258 192.359 219.950 1.00 69.50  ? 82   SER B O     1 
ATOM   5416  C  CB    . SER C  1 88   ? 210.215 191.858 216.907 1.00 69.50  ? 82   SER B CB    1 
ATOM   5417  O  OG    . SER C  1 88   ? 209.688 193.078 217.385 1.00 69.50  ? 82   SER B OG    1 
ATOM   5418  N  N     . TRP C  1 89   ? 210.441 190.287 219.682 1.00 59.95  ? 83   TRP B N     1 
ATOM   5419  C  CA    . TRP C  1 89   ? 210.077 190.190 221.087 1.00 59.95  ? 83   TRP B CA    1 
ATOM   5420  C  C     . TRP C  1 89   ? 211.313 190.089 221.961 1.00 59.95  ? 83   TRP B C     1 
ATOM   5421  O  O     . TRP C  1 89   ? 211.454 190.847 222.923 1.00 59.95  ? 83   TRP B O     1 
ATOM   5422  C  CB    . TRP C  1 89   ? 209.154 188.997 221.306 1.00 59.95  ? 83   TRP B CB    1 
ATOM   5423  C  CG    . TRP C  1 89   ? 207.861 189.174 220.617 1.00 59.95  ? 83   TRP B CG    1 
ATOM   5424  C  CD1   . TRP C  1 89   ? 207.390 190.321 220.067 1.00 59.95  ? 83   TRP B CD1   1 
ATOM   5425  C  CD2   . TRP C  1 89   ? 206.881 188.171 220.345 1.00 59.95  ? 83   TRP B CD2   1 
ATOM   5426  N  NE1   . TRP C  1 89   ? 206.166 190.106 219.490 1.00 59.95  ? 83   TRP B NE1   1 
ATOM   5427  C  CE2   . TRP C  1 89   ? 205.835 188.789 219.647 1.00 59.95  ? 83   TRP B CE2   1 
ATOM   5428  C  CE3   . TRP C  1 89   ? 206.782 186.810 220.633 1.00 59.95  ? 83   TRP B CE3   1 
ATOM   5429  C  CZ2   . TRP C  1 89   ? 204.709 188.099 219.234 1.00 59.95  ? 83   TRP B CZ2   1 
ATOM   5430  C  CZ3   . TRP C  1 89   ? 205.659 186.130 220.223 1.00 59.95  ? 83   TRP B CZ3   1 
ATOM   5431  C  CH2   . TRP C  1 89   ? 204.638 186.773 219.534 1.00 59.95  ? 83   TRP B CH2   1 
ATOM   5432  N  N     . LEU C  1 90   ? 212.225 189.183 221.627 1.00 62.37  ? 84   LEU B N     1 
ATOM   5433  C  CA    . LEU C  1 90   ? 213.420 188.985 222.434 1.00 62.37  ? 84   LEU B CA    1 
ATOM   5434  C  C     . LEU C  1 90   ? 214.305 190.217 222.490 1.00 62.37  ? 84   LEU B C     1 
ATOM   5435  O  O     . LEU C  1 90   ? 214.914 190.480 223.531 1.00 62.37  ? 84   LEU B O     1 
ATOM   5436  C  CB    . LEU C  1 90   ? 214.221 187.800 221.901 1.00 62.37  ? 84   LEU B CB    1 
ATOM   5437  C  CG    . LEU C  1 90   ? 213.678 186.414 222.204 1.00 62.37  ? 84   LEU B CG    1 
ATOM   5438  C  CD1   . LEU C  1 90   ? 214.391 185.375 221.379 1.00 62.37  ? 84   LEU B CD1   1 
ATOM   5439  C  CD2   . LEU C  1 90   ? 213.919 186.156 223.668 1.00 62.37  ? 84   LEU B CD2   1 
ATOM   5440  N  N     . LEU C  1 91   ? 214.418 190.971 221.401 1.00 56.66  ? 85   LEU B N     1 
ATOM   5441  C  CA    . LEU C  1 91   ? 215.293 192.133 221.415 1.00 56.66  ? 85   LEU B CA    1 
ATOM   5442  C  C     . LEU C  1 91   ? 214.821 193.137 222.459 1.00 56.66  ? 85   LEU B C     1 
ATOM   5443  O  O     . LEU C  1 91   ? 215.571 193.526 223.362 1.00 56.66  ? 85   LEU B O     1 
ATOM   5444  C  CB    . LEU C  1 91   ? 215.344 192.750 220.020 1.00 56.66  ? 85   LEU B CB    1 
ATOM   5445  C  CG    . LEU C  1 91   ? 216.375 193.827 219.694 1.00 56.66  ? 85   LEU B CG    1 
ATOM   5446  C  CD1   . LEU C  1 91   ? 216.750 193.732 218.233 1.00 56.66  ? 85   LEU B CD1   1 
ATOM   5447  C  CD2   . LEU C  1 91   ? 215.823 195.204 219.993 1.00 56.66  ? 85   LEU B CD2   1 
ATOM   5448  N  N     . PHE C  1 92   ? 213.559 193.537 222.377 1.00 53.82  ? 86   PHE B N     1 
ATOM   5449  C  CA    . PHE C  1 92   ? 213.038 194.440 223.388 1.00 53.82  ? 86   PHE B CA    1 
ATOM   5450  C  C     . PHE C  1 92   ? 212.950 193.781 224.752 1.00 53.82  ? 86   PHE B C     1 
ATOM   5451  O  O     . PHE C  1 92   ? 212.946 194.486 225.761 1.00 53.82  ? 86   PHE B O     1 
ATOM   5452  C  CB    . PHE C  1 92   ? 211.675 194.968 222.970 1.00 53.82  ? 86   PHE B CB    1 
ATOM   5453  C  CG    . PHE C  1 92   ? 211.722 195.861 221.779 1.00 53.82  ? 86   PHE B CG    1 
ATOM   5454  C  CD1   . PHE C  1 92   ? 212.115 197.174 221.907 1.00 53.82  ? 86   PHE B CD1   1 
ATOM   5455  C  CD2   . PHE C  1 92   ? 211.379 195.391 220.532 1.00 53.82  ? 86   PHE B CD2   1 
ATOM   5456  C  CE1   . PHE C  1 92   ? 212.164 197.999 220.816 1.00 53.82  ? 86   PHE B CE1   1 
ATOM   5457  C  CE2   . PHE C  1 92   ? 211.424 196.214 219.438 1.00 53.82  ? 86   PHE B CE2   1 
ATOM   5458  C  CZ    . PHE C  1 92   ? 211.817 197.520 219.580 1.00 53.82  ? 86   PHE B CZ    1 
ATOM   5459  N  N     . ALA C  1 93   ? 212.874 192.455 224.816 1.00 55.39  ? 87   ALA B N     1 
ATOM   5460  C  CA    . ALA C  1 93   ? 212.924 191.792 226.112 1.00 55.39  ? 87   ALA B CA    1 
ATOM   5461  C  C     . ALA C  1 93   ? 214.258 192.045 226.783 1.00 55.39  ? 87   ALA B C     1 
ATOM   5462  O  O     . ALA C  1 93   ? 214.323 192.424 227.959 1.00 55.39  ? 87   ALA B O     1 
ATOM   5463  C  CB    . ALA C  1 93   ? 212.678 190.295 225.945 1.00 55.39  ? 87   ALA B CB    1 
ATOM   5464  N  N     . MET C  1 94   ? 215.339 191.824 226.042 1.00 61.67  ? 88   MET B N     1 
ATOM   5465  C  CA    . MET C  1 94   ? 216.658 192.182 226.535 1.00 61.67  ? 88   MET B CA    1 
ATOM   5466  C  C     . MET C  1 94   ? 216.713 193.650 226.909 1.00 61.67  ? 88   MET B C     1 
ATOM   5467  O  O     . MET C  1 94   ? 217.301 194.005 227.932 1.00 61.67  ? 88   MET B O     1 
ATOM   5468  C  CB    . MET C  1 94   ? 217.711 191.854 225.480 1.00 61.67  ? 88   MET B CB    1 
ATOM   5469  C  CG    . MET C  1 94   ? 219.137 192.084 225.931 1.00 61.67  ? 88   MET B CG    1 
ATOM   5470  S  SD    . MET C  1 94   ? 219.580 191.050 227.339 1.00 61.67  ? 88   MET B SD    1 
ATOM   5471  C  CE    . MET C  1 94   ? 219.632 189.432 226.579 1.00 61.67  ? 88   MET B CE    1 
ATOM   5472  N  N     . ALA C  1 95   ? 216.079 194.509 226.112 1.00 54.29  ? 89   ALA B N     1 
ATOM   5473  C  CA    . ALA C  1 95   ? 216.079 195.938 226.413 1.00 54.29  ? 89   ALA B CA    1 
ATOM   5474  C  C     . ALA C  1 95   ? 215.443 196.217 227.768 1.00 54.29  ? 89   ALA B C     1 
ATOM   5475  O  O     . ALA C  1 95   ? 216.043 196.869 228.628 1.00 54.29  ? 89   ALA B O     1 
ATOM   5476  C  CB    . ALA C  1 95   ? 215.356 196.706 225.310 1.00 54.29  ? 89   ALA B CB    1 
ATOM   5477  N  N     . TRP C  1 96   ? 214.216 195.743 227.970 1.00 52.50  ? 90   TRP B N     1 
ATOM   5478  C  CA    . TRP C  1 96   ? 213.525 196.005 229.227 1.00 52.50  ? 90   TRP B CA    1 
ATOM   5479  C  C     . TRP C  1 96   ? 214.283 195.414 230.402 1.00 52.50  ? 90   TRP B C     1 
ATOM   5480  O  O     . TRP C  1 96   ? 214.401 196.049 231.457 1.00 52.50  ? 90   TRP B O     1 
ATOM   5481  C  CB    . TRP C  1 96   ? 212.106 195.443 229.201 1.00 52.50  ? 90   TRP B CB    1 
ATOM   5482  C  CG    . TRP C  1 96   ? 211.185 196.134 228.274 1.00 52.50  ? 90   TRP B CG    1 
ATOM   5483  C  CD1   . TRP C  1 96   ? 210.655 195.636 227.128 1.00 52.50  ? 90   TRP B CD1   1 
ATOM   5484  C  CD2   . TRP C  1 96   ? 210.712 197.473 228.387 1.00 52.50  ? 90   TRP B CD2   1 
ATOM   5485  N  NE1   . TRP C  1 96   ? 209.855 196.575 226.530 1.00 52.50  ? 90   TRP B NE1   1 
ATOM   5486  C  CE2   . TRP C  1 96   ? 209.880 197.716 227.284 1.00 52.50  ? 90   TRP B CE2   1 
ATOM   5487  C  CE3   . TRP C  1 96   ? 210.909 198.490 229.319 1.00 52.50  ? 90   TRP B CE3   1 
ATOM   5488  C  CZ2   . TRP C  1 96   ? 209.242 198.926 227.090 1.00 52.50  ? 90   TRP B CZ2   1 
ATOM   5489  C  CZ3   . TRP C  1 96   ? 210.279 199.693 229.123 1.00 52.50  ? 90   TRP B CZ3   1 
ATOM   5490  C  CH2   . TRP C  1 96   ? 209.455 199.905 228.015 1.00 52.50  ? 90   TRP B CH2   1 
ATOM   5491  N  N     . TRP C  1 97   ? 214.769 194.183 230.254 1.00 54.17  ? 91   TRP B N     1 
ATOM   5492  C  CA    . TRP C  1 97   ? 215.523 193.562 231.333 1.00 54.17  ? 91   TRP B CA    1 
ATOM   5493  C  C     . TRP C  1 97   ? 216.739 194.390 231.689 1.00 54.17  ? 91   TRP B C     1 
ATOM   5494  O  O     . TRP C  1 97   ? 217.005 194.652 232.868 1.00 54.17  ? 91   TRP B O     1 
ATOM   5495  C  CB    . TRP C  1 97   ? 215.937 192.157 230.920 1.00 54.17  ? 91   TRP B CB    1 
ATOM   5496  C  CG    . TRP C  1 97   ? 216.764 191.485 231.926 1.00 54.17  ? 91   TRP B CG    1 
ATOM   5497  C  CD1   . TRP C  1 97   ? 216.388 191.103 233.171 1.00 54.17  ? 91   TRP B CD1   1 
ATOM   5498  C  CD2   . TRP C  1 97   ? 218.129 191.110 231.781 1.00 54.17  ? 91   TRP B CD2   1 
ATOM   5499  N  NE1   . TRP C  1 97   ? 217.439 190.502 233.817 1.00 54.17  ? 91   TRP B NE1   1 
ATOM   5500  C  CE2   . TRP C  1 97   ? 218.521 190.495 232.979 1.00 54.17  ? 91   TRP B CE2   1 
ATOM   5501  C  CE3   . TRP C  1 97   ? 219.057 191.232 230.750 1.00 54.17  ? 91   TRP B CE3   1 
ATOM   5502  C  CZ2   . TRP C  1 97   ? 219.800 190.006 233.173 1.00 54.17  ? 91   TRP B CZ2   1 
ATOM   5503  C  CZ3   . TRP C  1 97   ? 220.322 190.747 230.945 1.00 54.17  ? 91   TRP B CZ3   1 
ATOM   5504  C  CH2   . TRP C  1 97   ? 220.686 190.143 232.146 1.00 54.17  ? 91   TRP B CH2   1 
ATOM   5505  N  N     . LEU C  1 98   ? 217.485 194.821 230.676 1.00 52.21  ? 92   LEU B N     1 
ATOM   5506  C  CA    . LEU C  1 98   ? 218.659 195.640 230.910 1.00 52.21  ? 92   LEU B CA    1 
ATOM   5507  C  C     . LEU C  1 98   ? 218.290 196.943 231.599 1.00 52.21  ? 92   LEU B C     1 
ATOM   5508  O  O     . LEU C  1 98   ? 219.024 197.420 232.467 1.00 52.21  ? 92   LEU B O     1 
ATOM   5509  C  CB    . LEU C  1 98   ? 219.351 195.916 229.585 1.00 52.21  ? 92   LEU B CB    1 
ATOM   5510  C  CG    . LEU C  1 98   ? 220.655 196.687 229.671 1.00 52.21  ? 92   LEU B CG    1 
ATOM   5511  C  CD1   . LEU C  1 98   ? 221.675 195.855 230.413 1.00 52.21  ? 92   LEU B CD1   1 
ATOM   5512  C  CD2   . LEU C  1 98   ? 221.139 197.039 228.282 1.00 52.21  ? 92   LEU B CD2   1 
ATOM   5513  N  N     . ILE C  1 99   ? 217.161 197.537 231.223 1.00 55.07  ? 93   ILE B N     1 
ATOM   5514  C  CA    . ILE C  1 99   ? 216.757 198.786 231.853 1.00 55.07  ? 93   ILE B CA    1 
ATOM   5515  C  C     . ILE C  1 99   ? 216.438 198.569 233.317 1.00 55.07  ? 93   ILE B C     1 
ATOM   5516  O  O     . ILE C  1 99   ? 216.869 199.340 234.179 1.00 55.07  ? 93   ILE B O     1 
ATOM   5517  C  CB    . ILE C  1 99   ? 215.565 199.404 231.112 1.00 55.07  ? 93   ILE B CB    1 
ATOM   5518  C  CG1   . ILE C  1 99   ? 215.969 199.762 229.689 1.00 55.07  ? 93   ILE B CG1   1 
ATOM   5519  C  CG2   . ILE C  1 99   ? 215.059 200.619 231.863 1.00 55.07  ? 93   ILE B CG2   1 
ATOM   5520  C  CD1   . ILE C  1 99   ? 217.134 200.710 229.627 1.00 55.07  ? 93   ILE B CD1   1 
ATOM   5521  N  N     . ALA C  1 100  ? 215.665 197.532 233.624 1.00 62.17  ? 94   ALA B N     1 
ATOM   5522  C  CA    . ALA C  1 100  ? 215.372 197.235 235.017 1.00 62.17  ? 94   ALA B CA    1 
ATOM   5523  C  C     . ALA C  1 100  ? 216.644 196.987 235.797 1.00 62.17  ? 94   ALA B C     1 
ATOM   5524  O  O     . ALA C  1 100  ? 216.744 197.363 236.970 1.00 62.17  ? 94   ALA B O     1 
ATOM   5525  C  CB    . ALA C  1 100  ? 214.461 196.024 235.124 1.00 62.17  ? 94   ALA B CB    1 
ATOM   5526  N  N     . PHE C  1 101  ? 217.630 196.371 235.161 1.00 62.09  ? 95   PHE B N     1 
ATOM   5527  C  CA    . PHE C  1 101  ? 218.850 196.075 235.882 1.00 62.09  ? 95   PHE B CA    1 
ATOM   5528  C  C     . PHE C  1 101  ? 219.722 197.306 236.060 1.00 62.09  ? 95   PHE B C     1 
ATOM   5529  O  O     . PHE C  1 101  ? 220.423 197.412 237.070 1.00 62.09  ? 95   PHE B O     1 
ATOM   5530  C  CB    . PHE C  1 101  ? 219.612 194.977 235.162 1.00 62.09  ? 95   PHE B CB    1 
ATOM   5531  C  CG    . PHE C  1 101  ? 220.792 194.493 235.911 1.00 62.09  ? 95   PHE B CG    1 
ATOM   5532  C  CD1   . PHE C  1 101  ? 220.626 193.806 237.088 1.00 62.09  ? 95   PHE B CD1   1 
ATOM   5533  C  CD2   . PHE C  1 101  ? 222.062 194.690 235.431 1.00 62.09  ? 95   PHE B CD2   1 
ATOM   5534  C  CE1   . PHE C  1 101  ? 221.702 193.352 237.781 1.00 62.09  ? 95   PHE B CE1   1 
ATOM   5535  C  CE2   . PHE C  1 101  ? 223.141 194.229 236.128 1.00 62.09  ? 95   PHE B CE2   1 
ATOM   5536  C  CZ    . PHE C  1 101  ? 222.964 193.559 237.303 1.00 62.09  ? 95   PHE B CZ    1 
ATOM   5537  N  N     . ALA C  1 102  ? 219.684 198.236 235.113 1.00 61.99  ? 96   ALA B N     1 
ATOM   5538  C  CA    . ALA C  1 102  ? 220.448 199.468 235.244 1.00 61.99  ? 96   ALA B CA    1 
ATOM   5539  C  C     . ALA C  1 102  ? 219.807 200.400 236.257 1.00 61.99  ? 96   ALA B C     1 
ATOM   5540  O  O     . ALA C  1 102  ? 220.503 201.141 236.955 1.00 61.99  ? 96   ALA B O     1 
ATOM   5541  C  CB    . ALA C  1 102  ? 220.564 200.162 233.890 1.00 61.99  ? 96   ALA B CB    1 
ATOM   5542  N  N     . HIS C  1 103  ? 218.480 200.372 236.345 1.00 69.32  ? 97   HIS B N     1 
ATOM   5543  C  CA    . HIS C  1 103  ? 217.776 201.146 237.354 1.00 69.32  ? 97   HIS B CA    1 
ATOM   5544  C  C     . HIS C  1 103  ? 218.045 200.636 238.758 1.00 69.32  ? 97   HIS B C     1 
ATOM   5545  O  O     . HIS C  1 103  ? 217.596 201.256 239.728 1.00 69.32  ? 97   HIS B O     1 
ATOM   5546  C  CB    . HIS C  1 103  ? 216.283 201.120 237.057 1.00 69.32  ? 97   HIS B CB    1 
ATOM   5547  C  CG    . HIS C  1 103  ? 215.467 201.945 237.997 1.00 69.32  ? 97   HIS B CG    1 
ATOM   5548  N  ND1   . HIS C  1 103  ? 214.942 201.434 239.163 1.00 69.32  ? 97   HIS B ND1   1 
ATOM   5549  C  CD2   . HIS C  1 103  ? 215.105 203.247 237.958 1.00 69.32  ? 97   HIS B CD2   1 
ATOM   5550  C  CE1   . HIS C  1 103  ? 214.275 202.383 239.794 1.00 69.32  ? 97   HIS B CE1   1 
ATOM   5551  N  NE2   . HIS C  1 103  ? 214.359 203.493 239.084 1.00 69.32  ? 97   HIS B NE2   1 
ATOM   5552  N  N     . GLY C  1 104  ? 218.779 199.538 238.893 1.00 72.09  ? 98   GLY B N     1 
ATOM   5553  C  CA    . GLY C  1 104  ? 218.991 198.953 240.195 1.00 72.09  ? 98   GLY B CA    1 
ATOM   5554  C  C     . GLY C  1 104  ? 217.666 198.498 240.746 1.00 72.09  ? 98   GLY B C     1 
ATOM   5555  O  O     . GLY C  1 104  ? 217.287 198.858 241.861 1.00 72.09  ? 98   GLY B O     1 
ATOM   5556  N  N     . ASP C  1 105  ? 216.941 197.720 239.952 1.00 73.15  ? 99   ASP B N     1 
ATOM   5557  C  CA    . ASP C  1 105  ? 215.593 197.328 240.312 1.00 73.15  ? 99   ASP B CA    1 
ATOM   5558  C  C     . ASP C  1 105  ? 215.426 195.833 240.529 1.00 73.15  ? 99   ASP B C     1 
ATOM   5559  O  O     . ASP C  1 105  ? 214.349 195.409 240.957 1.00 73.15  ? 99   ASP B O     1 
ATOM   5560  C  CB    . ASP C  1 105  ? 214.604 197.802 239.238 1.00 73.15  ? 99   ASP B CB    1 
ATOM   5561  C  CG    . ASP C  1 105  ? 213.176 197.687 239.686 1.00 73.15  ? 99   ASP B CG    1 
ATOM   5562  O  OD1   . ASP C  1 105  ? 212.777 198.465 240.576 1.00 73.15  ? 99   ASP B OD1   1 
ATOM   5563  O  OD2   . ASP C  1 105  ? 212.451 196.820 239.157 1.00 73.15  ? 99   ASP B OD2   1 
ATOM   5564  N  N     . LEU C  1 106  ? 216.448 195.027 240.263 1.00 72.86  ? 100  LEU B N     1 
ATOM   5565  C  CA    . LEU C  1 106  ? 216.335 193.594 240.492 1.00 72.86  ? 100  LEU B CA    1 
ATOM   5566  C  C     . LEU C  1 106  ? 216.770 193.217 241.901 1.00 72.86  ? 100  LEU B C     1 
ATOM   5567  O  O     . LEU C  1 106  ? 216.188 192.321 242.520 1.00 72.86  ? 100  LEU B O     1 
ATOM   5568  C  CB    . LEU C  1 106  ? 217.156 192.829 239.461 1.00 72.86  ? 100  LEU B CB    1 
ATOM   5569  C  CG    . LEU C  1 106  ? 216.555 192.920 238.066 1.00 72.86  ? 100  LEU B CG    1 
ATOM   5570  C  CD1   . LEU C  1 106  ? 217.460 192.291 237.033 1.00 72.86  ? 100  LEU B CD1   1 
ATOM   5571  C  CD2   . LEU C  1 106  ? 215.213 192.232 238.087 1.00 72.86  ? 100  LEU B CD2   1 
ATOM   5572  N  N     . ALA C  1 107  ? 217.788 193.885 242.409 1.00 90.29  ? 101  ALA B N     1 
ATOM   5573  C  CA    . ALA C  1 107  ? 218.340 193.531 243.710 1.00 90.29  ? 101  ALA B CA    1 
ATOM   5574  C  C     . ALA C  1 107  ? 217.500 194.019 244.887 1.00 90.29  ? 101  ALA B C     1 
ATOM   5575  O  O     . ALA C  1 107  ? 217.114 193.205 245.735 1.00 90.29  ? 101  ALA B O     1 
ATOM   5576  C  CB    . ALA C  1 107  ? 219.760 194.080 243.846 1.00 90.29  ? 101  ALA B CB    1 
ATOM   5577  N  N     . PRO C  1 108  ? 217.199 195.326 244.992 1.00 96.25  ? 102  PRO B N     1 
ATOM   5578  C  CA    . PRO C  1 108  ? 216.798 195.869 246.298 1.00 96.25  ? 102  PRO B CA    1 
ATOM   5579  C  C     . PRO C  1 108  ? 215.491 195.313 246.836 1.00 96.25  ? 102  PRO B C     1 
ATOM   5580  O  O     . PRO C  1 108  ? 215.471 194.730 247.924 1.00 96.25  ? 102  PRO B O     1 
ATOM   5581  C  CB    . PRO C  1 108  ? 216.686 197.373 246.027 1.00 96.25  ? 102  PRO B CB    1 
ATOM   5582  C  CG    . PRO C  1 108  ? 216.363 197.470 244.593 1.00 96.25  ? 102  PRO B CG    1 
ATOM   5583  C  CD    . PRO C  1 108  ? 217.088 196.341 243.926 1.00 96.25  ? 102  PRO B CD    1 
ATOM   5584  N  N     . SER C  1 109  ? 214.402 195.480 246.084 1.00 103.46 ? 103  SER B N     1 
ATOM   5585  C  CA    . SER C  1 109  ? 213.054 195.189 246.573 1.00 103.46 ? 103  SER B CA    1 
ATOM   5586  C  C     . SER C  1 109  ? 212.817 195.852 247.928 1.00 103.46 ? 103  SER B C     1 
ATOM   5587  O  O     . SER C  1 109  ? 212.060 195.358 248.765 1.00 103.46 ? 103  SER B O     1 
ATOM   5588  C  CB    . SER C  1 109  ? 212.807 193.682 246.646 1.00 103.46 ? 103  SER B CB    1 
ATOM   5589  O  OG    . SER C  1 109  ? 213.640 193.074 247.613 1.00 103.46 ? 103  SER B OG    1 
ATOM   5590  N  N     . GLU C  1 110  ? 213.470 196.998 248.137 1.00 102.19 ? 104  GLU B N     1 
ATOM   5591  C  CA    . GLU C  1 110  ? 213.427 197.663 249.435 1.00 102.19 ? 104  GLU B CA    1 
ATOM   5592  C  C     . GLU C  1 110  ? 212.044 198.220 249.738 1.00 102.19 ? 104  GLU B C     1 
ATOM   5593  O  O     . GLU C  1 110  ? 211.733 198.497 250.900 1.00 102.19 ? 104  GLU B O     1 
ATOM   5594  C  CB    . GLU C  1 110  ? 214.469 198.780 249.484 1.00 102.19 ? 104  GLU B CB    1 
ATOM   5595  N  N     . GLY C  1 111  ? 211.213 198.395 248.716 1.00 105.65 ? 105  GLY B N     1 
ATOM   5596  C  CA    . GLY C  1 111  ? 209.874 198.910 248.911 1.00 105.65 ? 105  GLY B CA    1 
ATOM   5597  C  C     . GLY C  1 111  ? 209.756 200.382 248.581 1.00 105.65 ? 105  GLY B C     1 
ATOM   5598  O  O     . GLY C  1 111  ? 208.701 200.847 248.140 1.00 105.65 ? 105  GLY B O     1 
ATOM   5599  N  N     . THR C  1 112  ? 210.841 201.129 248.790 1.00 98.07  ? 106  THR B N     1 
ATOM   5600  C  CA    . THR C  1 112  ? 210.806 202.566 248.549 1.00 98.07  ? 106  THR B CA    1 
ATOM   5601  C  C     . THR C  1 112  ? 210.919 202.894 247.065 1.00 98.07  ? 106  THR B C     1 
ATOM   5602  O  O     . THR C  1 112  ? 209.985 203.451 246.477 1.00 98.07  ? 106  THR B O     1 
ATOM   5603  C  CB    . THR C  1 112  ? 211.928 203.254 249.328 1.00 98.07  ? 106  THR B CB    1 
ATOM   5604  N  N     . ALA C  1 113  ? 212.043 202.547 246.441 1.00 84.81  ? 107  ALA B N     1 
ATOM   5605  C  CA    . ALA C  1 113  ? 212.289 202.922 245.057 1.00 84.81  ? 107  ALA B CA    1 
ATOM   5606  C  C     . ALA C  1 113  ? 211.342 202.179 244.128 1.00 84.81  ? 107  ALA B C     1 
ATOM   5607  O  O     . ALA C  1 113  ? 211.241 200.949 244.180 1.00 84.81  ? 107  ALA B O     1 
ATOM   5608  C  CB    . ALA C  1 113  ? 213.739 202.634 244.676 1.00 84.81  ? 107  ALA B CB    1 
ATOM   5609  N  N     . GLU C  1 114  ? 210.660 202.922 243.284 1.00 77.22  ? 108  GLU B N     1 
ATOM   5610  C  CA    . GLU C  1 114  ? 209.678 202.368 242.366 1.00 77.22  ? 108  GLU B CA    1 
ATOM   5611  C  C     . GLU C  1 114  ? 210.356 201.980 241.065 1.00 77.22  ? 108  GLU B C     1 
ATOM   5612  O  O     . GLU C  1 114  ? 211.252 202.696 240.605 1.00 77.22  ? 108  GLU B O     1 
ATOM   5613  C  CB    . GLU C  1 114  ? 208.580 203.375 242.090 1.00 77.22  ? 108  GLU B CB    1 
ATOM   5614  C  CG    . GLU C  1 114  ? 207.806 203.764 243.324 1.00 77.22  ? 108  GLU B CG    1 
ATOM   5615  C  CD    . GLU C  1 114  ? 208.546 204.784 244.155 1.00 77.22  ? 108  GLU B CD    1 
ATOM   5616  O  OE1   . GLU C  1 114  ? 209.637 205.209 243.729 1.00 77.22  ? 108  GLU B OE1   1 
ATOM   5617  O  OE2   . GLU C  1 114  ? 208.046 205.156 245.233 1.00 77.22  ? 108  GLU B OE2   1 
ATOM   5618  N  N     . PRO C  1 115  ? 209.965 200.882 240.451 1.00 74.56  ? 109  PRO B N     1 
ATOM   5619  C  CA    . PRO C  1 115  ? 210.682 200.402 239.266 1.00 74.56  ? 109  PRO B CA    1 
ATOM   5620  C  C     . PRO C  1 115  ? 210.443 201.258 238.040 1.00 74.56  ? 109  PRO B C     1 
ATOM   5621  O  O     . PRO C  1 115  ? 209.504 202.057 238.004 1.00 74.56  ? 109  PRO B O     1 
ATOM   5622  C  CB    . PRO C  1 115  ? 210.110 198.997 239.072 1.00 74.56  ? 109  PRO B CB    1 
ATOM   5623  C  CG    . PRO C  1 115  ? 208.748 199.077 239.640 1.00 74.56  ? 109  PRO B CG    1 
ATOM   5624  C  CD    . PRO C  1 115  ? 208.835 200.011 240.806 1.00 74.56  ? 109  PRO B CD    1 
ATOM   5625  N  N     . CYS C  1 116  ? 211.297 201.101 237.029 1.00 78.13  ? 110  CYS B N     1 
ATOM   5626  C  CA    . CYS C  1 116  ? 210.943 201.593 235.705 1.00 78.13  ? 110  CYS B CA    1 
ATOM   5627  C  C     . CYS C  1 116  ? 209.647 200.953 235.239 1.00 78.13  ? 110  CYS B C     1 
ATOM   5628  O  O     . CYS C  1 116  ? 208.748 201.637 234.735 1.00 78.13  ? 110  CYS B O     1 
ATOM   5629  C  CB    . CYS C  1 116  ? 212.056 201.293 234.703 1.00 78.13  ? 110  CYS B CB    1 
ATOM   5630  S  SG    . CYS C  1 116  ? 213.659 202.063 235.013 1.00 78.13  ? 110  CYS B SG    1 
ATOM   5631  N  N     . VAL C  1 117  ? 209.534 199.644 235.416 1.00 67.53  ? 111  VAL B N     1 
ATOM   5632  C  CA    . VAL C  1 117  ? 208.351 198.881 235.055 1.00 67.53  ? 111  VAL B CA    1 
ATOM   5633  C  C     . VAL C  1 117  ? 208.006 197.968 236.220 1.00 67.53  ? 111  VAL B C     1 
ATOM   5634  O  O     . VAL C  1 117  ? 208.886 197.332 236.807 1.00 67.53  ? 111  VAL B O     1 
ATOM   5635  C  CB    . VAL C  1 117  ? 208.572 198.080 233.756 1.00 67.53  ? 111  VAL B CB    1 
ATOM   5636  C  CG1   . VAL C  1 117  ? 209.759 197.157 233.902 1.00 67.53  ? 111  VAL B CG1   1 
ATOM   5637  C  CG2   . VAL C  1 117  ? 207.334 197.292 233.400 1.00 67.53  ? 111  VAL B CG2   1 
ATOM   5638  N  N     . THR C  1 118  ? 206.728 197.920 236.564 1.00 68.91  ? 112  THR B N     1 
ATOM   5639  C  CA    . THR C  1 118  ? 206.296 197.231 237.769 1.00 68.91  ? 112  THR B CA    1 
ATOM   5640  C  C     . THR C  1 118  ? 206.567 195.739 237.684 1.00 68.91  ? 112  THR B C     1 
ATOM   5641  O  O     . THR C  1 118  ? 206.324 195.104 236.656 1.00 68.91  ? 112  THR B O     1 
ATOM   5642  C  CB    . THR C  1 118  ? 204.807 197.457 238.008 1.00 68.91  ? 112  THR B CB    1 
ATOM   5643  O  OG1   . THR C  1 118  ? 204.067 196.973 236.885 1.00 68.91  ? 112  THR B OG1   1 
ATOM   5644  C  CG2   . THR C  1 118  ? 204.523 198.926 238.198 1.00 68.91  ? 112  THR B CG2   1 
ATOM   5645  N  N     . SER C  1 119  ? 207.086 195.190 238.782 1.00 65.61  ? 113  SER B N     1 
ATOM   5646  C  CA    . SER C  1 119  ? 207.071 193.758 239.065 1.00 65.61  ? 113  SER B CA    1 
ATOM   5647  C  C     . SER C  1 119  ? 207.700 192.949 237.929 1.00 65.61  ? 113  SER B C     1 
ATOM   5648  O  O     . SER C  1 119  ? 207.050 192.144 237.266 1.00 65.61  ? 113  SER B O     1 
ATOM   5649  C  CB    . SER C  1 119  ? 205.642 193.281 239.329 1.00 65.61  ? 113  SER B CB    1 
ATOM   5650  O  OG    . SER C  1 119  ? 204.864 193.358 238.149 1.00 65.61  ? 113  SER B OG    1 
ATOM   5651  N  N     . ILE C  1 120  ? 208.989 193.181 237.717 1.00 60.62  ? 114  ILE B N     1 
ATOM   5652  C  CA    . ILE C  1 120  ? 209.781 192.258 236.917 1.00 60.62  ? 114  ILE B CA    1 
ATOM   5653  C  C     . ILE C  1 120  ? 211.024 191.893 237.710 1.00 60.62  ? 114  ILE B C     1 
ATOM   5654  O  O     . ILE C  1 120  ? 211.682 192.747 238.307 1.00 60.62  ? 114  ILE B O     1 
ATOM   5655  C  CB    . ILE C  1 120  ? 210.159 192.802 235.524 1.00 60.62  ? 114  ILE B CB    1 
ATOM   5656  C  CG1   . ILE C  1 120  ? 211.169 193.924 235.603 1.00 60.62  ? 114  ILE B CG1   1 
ATOM   5657  C  CG2   . ILE C  1 120  ? 208.940 193.303 234.794 1.00 60.62  ? 114  ILE B CG2   1 
ATOM   5658  C  CD1   . ILE C  1 120  ? 211.734 194.205 234.263 1.00 60.62  ? 114  ILE B CD1   1 
ATOM   5659  N  N     . HIS C  1 121  ? 211.325 190.601 237.728 1.00 61.60  ? 115  HIS B N     1 
ATOM   5660  C  CA    . HIS C  1 121  ? 212.387 190.098 238.582 1.00 61.60  ? 115  HIS B CA    1 
ATOM   5661  C  C     . HIS C  1 121  ? 213.294 189.137 237.840 1.00 61.60  ? 115  HIS B C     1 
ATOM   5662  O  O     . HIS C  1 121  ? 214.351 188.774 238.365 1.00 61.60  ? 115  HIS B O     1 
ATOM   5663  C  CB    . HIS C  1 121  ? 211.779 189.417 239.801 1.00 61.60  ? 115  HIS B CB    1 
ATOM   5664  C  CG    . HIS C  1 121  ? 210.827 190.292 240.547 1.00 61.60  ? 115  HIS B CG    1 
ATOM   5665  N  ND1   . HIS C  1 121  ? 209.476 190.310 240.276 1.00 61.60  ? 115  HIS B ND1   1 
ATOM   5666  C  CD2   . HIS C  1 121  ? 211.032 191.218 241.512 1.00 61.60  ? 115  HIS B CD2   1 
ATOM   5667  C  CE1   . HIS C  1 121  ? 208.887 191.189 241.067 1.00 61.60  ? 115  HIS B CE1   1 
ATOM   5668  N  NE2   . HIS C  1 121  ? 209.808 191.756 241.824 1.00 61.60  ? 115  HIS B NE2   1 
ATOM   5669  N  N     . SER C  1 122  ? 212.922 188.730 236.636 1.00 56.61  ? 116  SER B N     1 
ATOM   5670  C  CA    . SER C  1 122  ? 213.714 187.789 235.867 1.00 56.61  ? 116  SER B CA    1 
ATOM   5671  C  C     . SER C  1 122  ? 213.631 188.203 234.413 1.00 56.61  ? 116  SER B C     1 
ATOM   5672  O  O     . SER C  1 122  ? 212.701 188.895 234.000 1.00 56.61  ? 116  SER B O     1 
ATOM   5673  C  CB    . SER C  1 122  ? 213.214 186.357 236.051 1.00 56.61  ? 116  SER B CB    1 
ATOM   5674  O  OG    . SER C  1 122  ? 211.919 186.212 235.497 1.00 56.61  ? 116  SER B OG    1 
ATOM   5675  N  N     . PHE C  1 123  ? 214.624 187.776 233.634 1.00 58.59  ? 117  PHE B N     1 
ATOM   5676  C  CA    . PHE C  1 123  ? 214.534 188.000 232.201 1.00 58.59  ? 117  PHE B CA    1 
ATOM   5677  C  C     . PHE C  1 123  ? 213.250 187.421 231.640 1.00 58.59  ? 117  PHE B C     1 
ATOM   5678  O  O     . PHE C  1 123  ? 212.697 187.955 230.674 1.00 58.59  ? 117  PHE B O     1 
ATOM   5679  C  CB    . PHE C  1 123  ? 215.735 187.404 231.481 1.00 58.59  ? 117  PHE B CB    1 
ATOM   5680  C  CG    . PHE C  1 123  ? 215.661 187.550 229.999 1.00 58.59  ? 117  PHE B CG    1 
ATOM   5681  C  CD1   . PHE C  1 123  ? 215.873 188.774 229.405 1.00 58.59  ? 117  PHE B CD1   1 
ATOM   5682  C  CD2   . PHE C  1 123  ? 215.350 186.470 229.201 1.00 58.59  ? 117  PHE B CD2   1 
ATOM   5683  C  CE1   . PHE C  1 123  ? 215.789 188.913 228.044 1.00 58.59  ? 117  PHE B CE1   1 
ATOM   5684  C  CE2   . PHE C  1 123  ? 215.269 186.607 227.839 1.00 58.59  ? 117  PHE B CE2   1 
ATOM   5685  C  CZ    . PHE C  1 123  ? 215.487 187.828 227.261 1.00 58.59  ? 117  PHE B CZ    1 
ATOM   5686  N  N     . SER C  1 124  ? 212.759 186.335 232.234 1.00 58.55  ? 118  SER B N     1 
ATOM   5687  C  CA    . SER C  1 124  ? 211.450 185.823 231.857 1.00 58.55  ? 118  SER B CA    1 
ATOM   5688  C  C     . SER C  1 124  ? 210.382 186.890 232.030 1.00 58.55  ? 118  SER B C     1 
ATOM   5689  O  O     . SER C  1 124  ? 209.479 187.020 231.194 1.00 58.55  ? 118  SER B O     1 
ATOM   5690  C  CB    . SER C  1 124  ? 211.117 184.593 232.691 1.00 58.55  ? 118  SER B CB    1 
ATOM   5691  O  OG    . SER C  1 124  ? 209.823 184.116 232.382 1.00 58.55  ? 118  SER B OG    1 
ATOM   5692  N  N     . SER C  1 125  ? 210.469 187.665 233.109 1.00 55.09  ? 119  SER B N     1 
ATOM   5693  C  CA    . SER C  1 125  ? 209.502 188.731 233.321 1.00 55.09  ? 119  SER B CA    1 
ATOM   5694  C  C     . SER C  1 125  ? 209.574 189.760 232.208 1.00 55.09  ? 119  SER B C     1 
ATOM   5695  O  O     . SER C  1 125  ? 208.545 190.141 231.644 1.00 55.09  ? 119  SER B O     1 
ATOM   5696  C  CB    . SER C  1 125  ? 209.740 189.399 234.669 1.00 55.09  ? 119  SER B CB    1 
ATOM   5697  O  OG    . SER C  1 125  ? 209.560 188.479 235.725 1.00 55.09  ? 119  SER B OG    1 
ATOM   5698  N  N     . ALA C  1 126  ? 210.778 190.224 231.884 1.00 54.30  ? 120  ALA B N     1 
ATOM   5699  C  CA    . ALA C  1 126  ? 210.911 191.216 230.827 1.00 54.30  ? 120  ALA B CA    1 
ATOM   5700  C  C     . ALA C  1 126  ? 210.439 190.668 229.496 1.00 54.30  ? 120  ALA B C     1 
ATOM   5701  O  O     . ALA C  1 126  ? 209.905 191.415 228.670 1.00 54.30  ? 120  ALA B O     1 
ATOM   5702  C  CB    . ALA C  1 126  ? 212.357 191.687 230.722 1.00 54.30  ? 120  ALA B CB    1 
ATOM   5703  N  N     . PHE C  1 127  ? 210.594 189.369 229.275 1.00 51.60  ? 121  PHE B N     1 
ATOM   5704  C  CA    . PHE C  1 127  ? 210.143 188.795 228.016 1.00 51.60  ? 121  PHE B CA    1 
ATOM   5705  C  C     . PHE C  1 127  ? 208.625 188.744 227.949 1.00 51.60  ? 121  PHE B C     1 
ATOM   5706  O  O     . PHE C  1 127  ? 208.024 189.112 226.929 1.00 51.60  ? 121  PHE B O     1 
ATOM   5707  C  CB    . PHE C  1 127  ? 210.744 187.411 227.834 1.00 51.60  ? 121  PHE B CB    1 
ATOM   5708  C  CG    . PHE C  1 127  ? 210.360 186.771 226.557 1.00 51.60  ? 121  PHE B CG    1 
ATOM   5709  C  CD1   . PHE C  1 127  ? 210.787 187.304 225.361 1.00 51.60  ? 121  PHE B CD1   1 
ATOM   5710  C  CD2   . PHE C  1 127  ? 209.604 185.624 226.543 1.00 51.60  ? 121  PHE B CD2   1 
ATOM   5711  C  CE1   . PHE C  1 127  ? 210.443 186.723 224.171 1.00 51.60  ? 121  PHE B CE1   1 
ATOM   5712  C  CE2   . PHE C  1 127  ? 209.268 185.030 225.356 1.00 51.60  ? 121  PHE B CE2   1 
ATOM   5713  C  CZ    . PHE C  1 127  ? 209.684 185.581 224.166 1.00 51.60  ? 121  PHE B CZ    1 
ATOM   5714  N  N     . LEU C  1 128  ? 207.987 188.274 229.019 1.00 53.86  ? 122  LEU B N     1 
ATOM   5715  C  CA    . LEU C  1 128  ? 206.535 188.356 229.087 1.00 53.86  ? 122  LEU B CA    1 
ATOM   5716  C  C     . LEU C  1 128  ? 206.059 189.777 228.876 1.00 53.86  ? 122  LEU B C     1 
ATOM   5717  O  O     . LEU C  1 128  ? 205.067 190.007 228.179 1.00 53.86  ? 122  LEU B O     1 
ATOM   5718  C  CB    . LEU C  1 128  ? 206.029 187.852 230.431 1.00 53.86  ? 122  LEU B CB    1 
ATOM   5719  C  CG    . LEU C  1 128  ? 206.145 186.368 230.720 1.00 53.86  ? 122  LEU B CG    1 
ATOM   5720  C  CD1   . LEU C  1 128  ? 205.681 186.103 232.130 1.00 53.86  ? 122  LEU B CD1   1 
ATOM   5721  C  CD2   . LEU C  1 128  ? 205.308 185.602 229.736 1.00 53.86  ? 122  LEU B CD2   1 
ATOM   5722  N  N     . PHE C  1 129  ? 206.750 190.742 229.472 1.00 52.19  ? 123  PHE B N     1 
ATOM   5723  C  CA    . PHE C  1 129  ? 206.353 192.131 229.313 1.00 52.19  ? 123  PHE B CA    1 
ATOM   5724  C  C     . PHE C  1 129  ? 206.462 192.572 227.865 1.00 52.19  ? 123  PHE B C     1 
ATOM   5725  O  O     . PHE C  1 129  ? 205.580 193.268 227.354 1.00 52.19  ? 123  PHE B O     1 
ATOM   5726  C  CB    . PHE C  1 129  ? 207.207 193.020 230.198 1.00 52.19  ? 123  PHE B CB    1 
ATOM   5727  C  CG    . PHE C  1 129  ? 206.882 194.457 230.067 1.00 52.19  ? 123  PHE B CG    1 
ATOM   5728  C  CD1   . PHE C  1 129  ? 205.744 194.970 230.642 1.00 52.19  ? 123  PHE B CD1   1 
ATOM   5729  C  CD2   . PHE C  1 129  ? 207.699 195.297 229.343 1.00 52.19  ? 123  PHE B CD2   1 
ATOM   5730  C  CE1   . PHE C  1 129  ? 205.433 196.295 230.514 1.00 52.19  ? 123  PHE B CE1   1 
ATOM   5731  C  CE2   . PHE C  1 129  ? 207.392 196.624 229.213 1.00 52.19  ? 123  PHE B CE2   1 
ATOM   5732  C  CZ    . PHE C  1 129  ? 206.258 197.121 229.795 1.00 52.19  ? 123  PHE B CZ    1 
ATOM   5733  N  N     . SER C  1 130  ? 207.545 192.191 227.192 1.00 51.27  ? 124  SER B N     1 
ATOM   5734  C  CA    . SER C  1 130  ? 207.698 192.577 225.798 1.00 51.27  ? 124  SER B CA    1 
ATOM   5735  C  C     . SER C  1 130  ? 206.595 191.980 224.949 1.00 51.27  ? 124  SER B C     1 
ATOM   5736  O  O     . SER C  1 130  ? 206.064 192.643 224.052 1.00 51.27  ? 124  SER B O     1 
ATOM   5737  C  CB    . SER C  1 130  ? 209.064 192.147 225.283 1.00 51.27  ? 124  SER B CB    1 
ATOM   5738  O  OG    . SER C  1 130  ? 210.079 192.839 225.980 1.00 51.27  ? 124  SER B OG    1 
ATOM   5739  N  N     . ILE C  1 131  ? 206.231 190.729 225.222 1.00 50.46  ? 125  ILE B N     1 
ATOM   5740  C  CA    . ILE C  1 131  ? 205.146 190.114 224.467 1.00 50.46  ? 125  ILE B CA    1 
ATOM   5741  C  C     . ILE C  1 131  ? 203.842 190.843 224.732 1.00 50.46  ? 125  ILE B C     1 
ATOM   5742  O  O     . ILE C  1 131  ? 203.084 191.145 223.804 1.00 50.46  ? 125  ILE B O     1 
ATOM   5743  C  CB    . ILE C  1 131  ? 205.029 188.620 224.797 1.00 50.46  ? 125  ILE B CB    1 
ATOM   5744  C  CG1   . ILE C  1 131  ? 206.262 187.869 224.309 1.00 50.46  ? 125  ILE B CG1   1 
ATOM   5745  C  CG2   . ILE C  1 131  ? 203.796 188.039 224.164 1.00 50.46  ? 125  ILE B CG2   1 
ATOM   5746  C  CD1   . ILE C  1 131  ? 206.256 186.424 224.703 1.00 50.46  ? 125  ILE B CD1   1 
ATOM   5747  N  N     . GLU C  1 132  ? 203.562 191.150 225.996 1.00 56.64  ? 126  GLU B N     1 
ATOM   5748  C  CA    . GLU C  1 132  ? 202.344 191.882 226.318 1.00 56.64  ? 126  GLU B CA    1 
ATOM   5749  C  C     . GLU C  1 132  ? 202.293 193.214 225.598 1.00 56.64  ? 126  GLU B C     1 
ATOM   5750  O  O     . GLU C  1 132  ? 201.238 193.601 225.085 1.00 56.64  ? 126  GLU B O     1 
ATOM   5751  C  CB    . GLU C  1 132  ? 202.244 192.113 227.817 1.00 56.64  ? 126  GLU B CB    1 
ATOM   5752  C  CG    . GLU C  1 132  ? 202.074 190.857 228.622 1.00 56.64  ? 126  GLU B CG    1 
ATOM   5753  C  CD    . GLU C  1 132  ? 202.030 191.150 230.095 1.00 56.64  ? 126  GLU B CD    1 
ATOM   5754  O  OE1   . GLU C  1 132  ? 202.203 192.331 230.460 1.00 56.64  ? 126  GLU B OE1   1 
ATOM   5755  O  OE2   . GLU C  1 132  ? 201.846 190.211 230.891 1.00 56.64  ? 126  GLU B OE2   1 
ATOM   5756  N  N     . VAL C  1 133  ? 203.413 193.919 225.540 1.00 46.84  ? 127  VAL B N     1 
ATOM   5757  C  CA    . VAL C  1 133  ? 203.451 195.229 224.914 1.00 46.84  ? 127  VAL B CA    1 
ATOM   5758  C  C     . VAL C  1 133  ? 203.226 195.101 223.420 1.00 46.84  ? 127  VAL B C     1 
ATOM   5759  O  O     . VAL C  1 133  ? 202.262 195.649 222.878 1.00 46.84  ? 127  VAL B O     1 
ATOM   5760  C  CB    . VAL C  1 133  ? 204.782 195.937 225.194 1.00 46.84  ? 127  VAL B CB    1 
ATOM   5761  C  CG1   . VAL C  1 133  ? 204.875 197.193 224.368 1.00 46.84  ? 127  VAL B CG1   1 
ATOM   5762  C  CG2   . VAL C  1 133  ? 204.887 196.265 226.662 1.00 46.84  ? 127  VAL B CG2   1 
ATOM   5763  N  N     . GLN C  1 134  ? 204.109 194.374 222.745 1.00 55.66  ? 128  GLN B N     1 
ATOM   5764  C  CA    . GLN C  1 134  ? 204.110 194.408 221.288 1.00 55.66  ? 128  GLN B CA    1 
ATOM   5765  C  C     . GLN C  1 134  ? 202.876 193.728 220.710 1.00 55.66  ? 128  GLN B C     1 
ATOM   5766  O  O     . GLN C  1 134  ? 202.385 194.127 219.649 1.00 55.66  ? 128  GLN B O     1 
ATOM   5767  C  CB    . GLN C  1 134  ? 205.388 193.778 220.758 1.00 55.66  ? 128  GLN B CB    1 
ATOM   5768  C  CG    . GLN C  1 134  ? 205.482 193.797 219.262 1.00 55.66  ? 128  GLN B CG    1 
ATOM   5769  C  CD    . GLN C  1 134  ? 206.849 193.416 218.776 1.00 55.66  ? 128  GLN B CD    1 
ATOM   5770  O  OE1   . GLN C  1 134  ? 207.761 193.194 219.566 1.00 55.66  ? 128  GLN B OE1   1 
ATOM   5771  N  NE2   . GLN C  1 134  ? 207.000 193.330 217.462 1.00 55.66  ? 128  GLN B NE2   1 
ATOM   5772  N  N     . VAL C  1 135  ? 202.346 192.712 221.390 1.00 50.72  ? 129  VAL B N     1 
ATOM   5773  C  CA    . VAL C  1 135  ? 201.105 192.096 220.930 1.00 50.72  ? 129  VAL B CA    1 
ATOM   5774  C  C     . VAL C  1 135  ? 199.888 192.893 221.372 1.00 50.72  ? 129  VAL B C     1 
ATOM   5775  O  O     . VAL C  1 135  ? 198.762 192.559 220.988 1.00 50.72  ? 129  VAL B O     1 
ATOM   5776  C  CB    . VAL C  1 135  ? 201.093 190.633 221.414 1.00 50.72  ? 129  VAL B CB    1 
ATOM   5777  C  CG1   . VAL C  1 135  ? 199.865 189.894 220.945 1.00 50.72  ? 129  VAL B CG1   1 
ATOM   5778  C  CG2   . VAL C  1 135  ? 202.326 189.935 220.919 1.00 50.72  ? 129  VAL B CG2   1 
ATOM   5779  N  N     . THR C  1 136  ? 200.094 193.961 222.139 1.00 52.09  ? 130  THR B N     1 
ATOM   5780  C  CA    . THR C  1 136  ? 199.026 194.858 222.583 1.00 52.09  ? 130  THR B CA    1 
ATOM   5781  C  C     . THR C  1 136  ? 198.075 194.160 223.548 1.00 52.09  ? 130  THR B C     1 
ATOM   5782  O  O     . THR C  1 136  ? 196.871 194.423 223.557 1.00 52.09  ? 130  THR B O     1 
ATOM   5783  C  CB    . THR C  1 136  ? 198.247 195.444 221.404 1.00 52.09  ? 130  THR B CB    1 
ATOM   5784  O  OG1   . THR C  1 136  ? 197.531 194.397 220.741 1.00 52.09  ? 130  THR B OG1   1 
ATOM   5785  C  CG2   . THR C  1 136  ? 199.192 196.093 220.418 1.00 52.09  ? 130  THR B CG2   1 
ATOM   5786  N  N     . ILE C  1 137  ? 198.615 193.267 224.368 1.00 50.96  ? 131  ILE B N     1 
ATOM   5787  C  CA    . ILE C  1 137  ? 197.798 192.570 225.348 1.00 50.96  ? 131  ILE B CA    1 
ATOM   5788  C  C     . ILE C  1 137  ? 197.759 193.378 226.634 1.00 50.96  ? 131  ILE B C     1 
ATOM   5789  O  O     . ILE C  1 137  ? 196.699 193.862 227.046 1.00 50.96  ? 131  ILE B O     1 
ATOM   5790  C  CB    . ILE C  1 137  ? 198.334 191.159 225.612 1.00 50.96  ? 131  ILE B CB    1 
ATOM   5791  C  CG1   . ILE C  1 137  ? 198.229 190.315 224.346 1.00 50.96  ? 131  ILE B CG1   1 
ATOM   5792  C  CG2   . ILE C  1 137  ? 197.569 190.508 226.727 1.00 50.96  ? 131  ILE B CG2   1 
ATOM   5793  C  CD1   . ILE C  1 137  ? 198.925 188.993 224.458 1.00 50.96  ? 131  ILE B CD1   1 
ATOM   5794  N  N     . GLY C  1 138  ? 198.915 193.545 227.268 1.00 56.11  ? 132  GLY B N     1 
ATOM   5795  C  CA    . GLY C  1 138  ? 199.011 194.387 228.443 1.00 56.11  ? 132  GLY B CA    1 
ATOM   5796  C  C     . GLY C  1 138  ? 198.143 193.949 229.600 1.00 56.11  ? 132  GLY B C     1 
ATOM   5797  O  O     . GLY C  1 138  ? 197.153 194.614 229.909 1.00 56.11  ? 132  GLY B O     1 
ATOM   5798  N  N     . PHE C  1 139  ? 198.481 192.827 230.230 1.00 55.15  ? 133  PHE B N     1 
ATOM   5799  C  CA    . PHE C  1 139  ? 197.688 192.339 231.350 1.00 55.15  ? 133  PHE B CA    1 
ATOM   5800  C  C     . PHE C  1 139  ? 197.596 193.370 232.462 1.00 55.15  ? 133  PHE B C     1 
ATOM   5801  O  O     . PHE C  1 139  ? 196.496 193.726 232.891 1.00 55.15  ? 133  PHE B O     1 
ATOM   5802  C  CB    . PHE C  1 139  ? 198.256 191.032 231.889 1.00 55.15  ? 133  PHE B CB    1 
ATOM   5803  C  CG    . PHE C  1 139  ? 198.042 189.871 230.978 1.00 55.15  ? 133  PHE B CG    1 
ATOM   5804  C  CD1   . PHE C  1 139  ? 196.800 189.285 230.880 1.00 55.15  ? 133  PHE B CD1   1 
ATOM   5805  C  CD2   . PHE C  1 139  ? 199.077 189.362 230.228 1.00 55.15  ? 133  PHE B CD2   1 
ATOM   5806  C  CE1   . PHE C  1 139  ? 196.595 188.223 230.046 1.00 55.15  ? 133  PHE B CE1   1 
ATOM   5807  C  CE2   . PHE C  1 139  ? 198.879 188.294 229.394 1.00 55.15  ? 133  PHE B CE2   1 
ATOM   5808  C  CZ    . PHE C  1 139  ? 197.637 187.725 229.302 1.00 55.15  ? 133  PHE B CZ    1 
ATOM   5809  N  N     . GLY C  1 140  ? 198.733 193.858 232.937 1.00 63.26  ? 134  GLY B N     1 
ATOM   5810  C  CA    . GLY C  1 140  ? 198.697 194.924 233.917 1.00 63.26  ? 134  GLY B CA    1 
ATOM   5811  C  C     . GLY C  1 140  ? 199.536 194.657 235.143 1.00 63.26  ? 134  GLY B C     1 
ATOM   5812  O  O     . GLY C  1 140  ? 199.947 195.594 235.834 1.00 63.26  ? 134  GLY B O     1 
ATOM   5813  N  N     . GLY C  1 141  ? 199.786 193.381 235.433 1.00 67.17  ? 135  GLY B N     1 
ATOM   5814  C  CA    . GLY C  1 141  ? 200.636 193.042 236.557 1.00 67.17  ? 135  GLY B CA    1 
ATOM   5815  C  C     . GLY C  1 141  ? 202.044 193.567 236.421 1.00 67.17  ? 135  GLY B C     1 
ATOM   5816  O  O     . GLY C  1 141  ? 202.723 193.773 237.433 1.00 67.17  ? 135  GLY B O     1 
ATOM   5817  N  N     . ARG C  1 142  ? 202.497 193.793 235.197 1.00 61.19  ? 136  ARG B N     1 
ATOM   5818  C  CA    . ARG C  1 142  ? 203.808 194.363 234.933 1.00 61.19  ? 136  ARG B CA    1 
ATOM   5819  C  C     . ARG C  1 142  ? 203.631 195.536 233.982 1.00 61.19  ? 136  ARG B C     1 
ATOM   5820  O  O     . ARG C  1 142  ? 203.252 195.353 232.820 1.00 61.19  ? 136  ARG B O     1 
ATOM   5821  C  CB    . ARG C  1 142  ? 204.749 193.284 234.393 1.00 61.19  ? 136  ARG B CB    1 
ATOM   5822  C  CG    . ARG C  1 142  ? 204.258 192.558 233.166 1.00 61.19  ? 136  ARG B CG    1 
ATOM   5823  C  CD    . ARG C  1 142  ? 205.120 191.350 232.890 1.00 61.19  ? 136  ARG B CD    1 
ATOM   5824  N  NE    . ARG C  1 142  ? 205.003 190.392 233.985 1.00 61.19  ? 136  ARG B NE    1 
ATOM   5825  C  CZ    . ARG C  1 142  ? 204.047 189.476 234.071 1.00 61.19  ? 136  ARG B CZ    1 
ATOM   5826  N  NH1   . ARG C  1 142  ? 203.126 189.394 233.126 1.00 61.19  ? 136  ARG B NH1   1 
ATOM   5827  N  NH2   . ARG C  1 142  ? 204.006 188.648 235.101 1.00 61.19  ? 136  ARG B NH2   1 
ATOM   5828  N  N     . MET C  1 143  ? 203.881 196.743 234.487 1.00 67.09  ? 137  MET B N     1 
ATOM   5829  C  CA    . MET C  1 143  ? 203.372 197.954 233.866 1.00 67.09  ? 137  MET B CA    1 
ATOM   5830  C  C     . MET C  1 143  ? 204.421 199.053 233.922 1.00 67.09  ? 137  MET B C     1 
ATOM   5831  O  O     . MET C  1 143  ? 205.159 199.180 234.901 1.00 67.09  ? 137  MET B O     1 
ATOM   5832  C  CB    . MET C  1 143  ? 202.092 198.408 234.571 1.00 67.09  ? 137  MET B CB    1 
ATOM   5833  C  CG    . MET C  1 143  ? 201.488 199.686 234.059 1.00 67.09  ? 137  MET B CG    1 
ATOM   5834  S  SD    . MET C  1 143  ? 199.962 200.014 234.947 1.00 67.09  ? 137  MET B SD    1 
ATOM   5835  C  CE    . MET C  1 143  ? 200.598 200.345 236.586 1.00 67.09  ? 137  MET B CE    1 
ATOM   5836  N  N     . VAL C  1 144  ? 204.472 199.853 232.858 1.00 70.21  ? 138  VAL B N     1 
ATOM   5837  C  CA    . VAL C  1 144  ? 205.437 200.942 232.784 1.00 70.21  ? 138  VAL B CA    1 
ATOM   5838  C  C     . VAL C  1 144  ? 205.070 202.017 233.794 1.00 70.21  ? 138  VAL B C     1 
ATOM   5839  O  O     . VAL C  1 144  ? 203.888 202.279 234.049 1.00 70.21  ? 138  VAL B O     1 
ATOM   5840  C  CB    . VAL C  1 144  ? 205.489 201.517 231.360 1.00 70.21  ? 138  VAL B CB    1 
ATOM   5841  C  CG1   . VAL C  1 144  ? 206.505 202.632 231.275 1.00 70.21  ? 138  VAL B CG1   1 
ATOM   5842  C  CG2   . VAL C  1 144  ? 205.812 200.437 230.372 1.00 70.21  ? 138  VAL B CG2   1 
ATOM   5843  N  N     . THR C  1 145  ? 206.083 202.641 234.381 1.00 74.89  ? 139  THR B N     1 
ATOM   5844  C  CA    . THR C  1 145  ? 205.898 203.672 235.386 1.00 74.89  ? 139  THR B CA    1 
ATOM   5845  C  C     . THR C  1 145  ? 206.636 204.926 234.945 1.00 74.89  ? 139  THR B C     1 
ATOM   5846  O  O     . THR C  1 145  ? 207.550 204.855 234.121 1.00 74.89  ? 139  THR B O     1 
ATOM   5847  C  CB    . THR C  1 145  ? 206.412 203.194 236.742 1.00 74.89  ? 139  THR B CB    1 
ATOM   5848  O  OG1   . THR C  1 145  ? 205.856 201.908 237.024 1.00 74.89  ? 139  THR B OG1   1 
ATOM   5849  C  CG2   . THR C  1 145  ? 205.983 204.140 237.850 1.00 74.89  ? 139  THR B CG2   1 
ATOM   5850  N  N     . GLU C  1 146  ? 206.239 206.074 235.491 1.00 78.05  ? 140  GLU B N     1 
ATOM   5851  C  CA    . GLU C  1 146  ? 206.882 207.341 235.175 1.00 78.05  ? 140  GLU B CA    1 
ATOM   5852  C  C     . GLU C  1 146  ? 208.315 207.422 235.671 1.00 78.05  ? 140  GLU B C     1 
ATOM   5853  O  O     . GLU C  1 146  ? 209.027 208.357 235.291 1.00 78.05  ? 140  GLU B O     1 
ATOM   5854  C  CB    . GLU C  1 146  ? 206.084 208.494 235.777 1.00 78.05  ? 140  GLU B CB    1 
ATOM   5855  C  CG    . GLU C  1 146  ? 204.694 208.636 235.218 1.00 78.05  ? 140  GLU B CG    1 
ATOM   5856  C  CD    . GLU C  1 146  ? 203.730 207.673 235.863 1.00 78.05  ? 140  GLU B CD    1 
ATOM   5857  O  OE1   . GLU C  1 146  ? 204.155 206.939 236.780 1.00 78.05  ? 140  GLU B OE1   1 
ATOM   5858  O  OE2   . GLU C  1 146  ? 202.552 207.642 235.454 1.00 78.05  ? 140  GLU B OE2   1 
ATOM   5859  N  N     . GLU C  1 147  ? 208.759 206.484 236.499 1.00 85.24  ? 141  GLU B N     1 
ATOM   5860  C  CA    . GLU C  1 147  ? 210.056 206.613 237.144 1.00 85.24  ? 141  GLU B CA    1 
ATOM   5861  C  C     . GLU C  1 147  ? 211.220 206.547 236.173 1.00 85.24  ? 141  GLU B C     1 
ATOM   5862  O  O     . GLU C  1 147  ? 212.346 206.867 236.571 1.00 85.24  ? 141  GLU B O     1 
ATOM   5863  C  CB    . GLU C  1 147  ? 210.210 205.533 238.212 1.00 85.24  ? 141  GLU B CB    1 
ATOM   5864  C  CG    . GLU C  1 147  ? 209.203 205.655 239.337 1.00 85.24  ? 141  GLU B CG    1 
ATOM   5865  C  CD    . GLU C  1 147  ? 209.367 206.933 240.123 1.00 85.24  ? 141  GLU B CD    1 
ATOM   5866  O  OE1   . GLU C  1 147  ? 210.511 207.415 240.242 1.00 85.24  ? 141  GLU B OE1   1 
ATOM   5867  O  OE2   . GLU C  1 147  ? 208.351 207.458 240.622 1.00 85.24  ? 141  GLU B OE2   1 
ATOM   5868  N  N     . CYS C  1 148  ? 210.995 206.156 234.929 1.00 72.58  ? 142  CYS B N     1 
ATOM   5869  C  CA    . CYS C  1 148  ? 212.091 206.081 233.974 1.00 72.58  ? 142  CYS B CA    1 
ATOM   5870  C  C     . CYS C  1 148  ? 211.643 206.602 232.619 1.00 72.58  ? 142  CYS B C     1 
ATOM   5871  O  O     . CYS C  1 148  ? 211.009 205.870 231.848 1.00 72.58  ? 142  CYS B O     1 
ATOM   5872  C  CB    . CYS C  1 148  ? 212.596 204.645 233.852 1.00 72.58  ? 142  CYS B CB    1 
ATOM   5873  S  SG    . CYS C  1 148  ? 213.271 204.012 235.382 1.00 72.58  ? 142  CYS B SG    1 
ATOM   5874  N  N     . PRO C  1 149  ? 211.947 207.857 232.294 1.00 59.58  ? 143  PRO B N     1 
ATOM   5875  C  CA    . PRO C  1 149  ? 211.598 208.361 230.962 1.00 59.58  ? 143  PRO B CA    1 
ATOM   5876  C  C     . PRO C  1 149  ? 212.275 207.590 229.850 1.00 59.58  ? 143  PRO B C     1 
ATOM   5877  O  O     . PRO C  1 149  ? 211.703 207.448 228.761 1.00 59.58  ? 143  PRO B O     1 
ATOM   5878  C  CB    . PRO C  1 149  ? 212.067 209.819 231.009 1.00 59.58  ? 143  PRO B CB    1 
ATOM   5879  C  CG    . PRO C  1 149  ? 213.135 209.827 232.045 1.00 59.58  ? 143  PRO B CG    1 
ATOM   5880  C  CD    . PRO C  1 149  ? 212.723 208.827 233.075 1.00 59.58  ? 143  PRO B CD    1 
ATOM   5881  N  N     . LEU C  1 150  ? 213.475 207.077 230.095 1.00 57.10  ? 144  LEU B N     1 
ATOM   5882  C  CA    . LEU C  1 150  ? 214.126 206.230 229.109 1.00 57.10  ? 144  LEU B CA    1 
ATOM   5883  C  C     . LEU C  1 150  ? 213.280 204.997 228.827 1.00 57.10  ? 144  LEU B C     1 
ATOM   5884  O  O     . LEU C  1 150  ? 213.194 204.538 227.681 1.00 57.10  ? 144  LEU B O     1 
ATOM   5885  C  CB    . LEU C  1 150  ? 215.511 205.842 229.618 1.00 57.10  ? 144  LEU B CB    1 
ATOM   5886  C  CG    . LEU C  1 150  ? 216.568 205.377 228.619 1.00 57.10  ? 144  LEU B CG    1 
ATOM   5887  C  CD1   . LEU C  1 150  ? 216.323 203.971 228.118 1.00 57.10  ? 144  LEU B CD1   1 
ATOM   5888  C  CD2   . LEU C  1 150  ? 216.618 206.360 227.473 1.00 57.10  ? 144  LEU B CD2   1 
ATOM   5889  N  N     . ALA C  1 151  ? 212.634 204.457 229.860 1.00 54.46  ? 145  ALA B N     1 
ATOM   5890  C  CA    . ALA C  1 151  ? 211.728 203.336 229.653 1.00 54.46  ? 145  ALA B CA    1 
ATOM   5891  C  C     . ALA C  1 151  ? 210.539 203.749 228.806 1.00 54.46  ? 145  ALA B C     1 
ATOM   5892  O  O     . ALA C  1 151  ? 210.032 202.959 228.006 1.00 54.46  ? 145  ALA B O     1 
ATOM   5893  C  CB    . ALA C  1 151  ? 211.267 202.781 230.997 1.00 54.46  ? 145  ALA B CB    1 
ATOM   5894  N  N     . ILE C  1 152  ? 210.086 204.990 228.957 1.00 56.83  ? 146  ILE B N     1 
ATOM   5895  C  CA    . ILE C  1 152  ? 209.008 205.480 228.111 1.00 56.83  ? 146  ILE B CA    1 
ATOM   5896  C  C     . ILE C  1 152  ? 209.460 205.531 226.663 1.00 56.83  ? 146  ILE B C     1 
ATOM   5897  O  O     . ILE C  1 152  ? 208.705 205.187 225.743 1.00 56.83  ? 146  ILE B O     1 
ATOM   5898  C  CB    . ILE C  1 152  ? 208.542 206.856 228.604 1.00 56.83  ? 146  ILE B CB    1 
ATOM   5899  C  CG1   . ILE C  1 152  ? 208.025 206.744 230.030 1.00 56.83  ? 146  ILE B CG1   1 
ATOM   5900  C  CG2   . ILE C  1 152  ? 207.465 207.393 227.707 1.00 56.83  ? 146  ILE B CG2   1 
ATOM   5901  C  CD1   . ILE C  1 152  ? 207.838 208.065 230.693 1.00 56.83  ? 146  ILE B CD1   1 
ATOM   5902  N  N     . LEU C  1 153  ? 210.697 205.967 226.438 1.00 56.32  ? 147  LEU B N     1 
ATOM   5903  C  CA    . LEU C  1 153  ? 211.247 205.935 225.090 1.00 56.32  ? 147  LEU B CA    1 
ATOM   5904  C  C     . LEU C  1 153  ? 211.256 204.521 224.538 1.00 56.32  ? 147  LEU B C     1 
ATOM   5905  O  O     . LEU C  1 153  ? 210.870 204.294 223.389 1.00 56.32  ? 147  LEU B O     1 
ATOM   5906  C  CB    . LEU C  1 153  ? 212.657 206.507 225.079 1.00 56.32  ? 147  LEU B CB    1 
ATOM   5907  C  CG    . LEU C  1 153  ? 213.260 206.432 223.684 1.00 56.32  ? 147  LEU B CG    1 
ATOM   5908  C  CD1   . LEU C  1 153  ? 212.409 207.237 222.718 1.00 56.32  ? 147  LEU B CD1   1 
ATOM   5909  C  CD2   . LEU C  1 153  ? 214.691 206.929 223.692 1.00 56.32  ? 147  LEU B CD2   1 
ATOM   5910  N  N     . ILE C  1 154  ? 211.719 203.562 225.337 1.00 52.66  ? 148  ILE B N     1 
ATOM   5911  C  CA    . ILE C  1 154  ? 211.708 202.177 224.886 1.00 52.66  ? 148  ILE B CA    1 
ATOM   5912  C  C     . ILE C  1 154  ? 210.300 201.732 224.536 1.00 52.66  ? 148  ILE B C     1 
ATOM   5913  O  O     . ILE C  1 154  ? 210.093 201.034 223.541 1.00 52.66  ? 148  ILE B O     1 
ATOM   5914  C  CB    . ILE C  1 154  ? 212.333 201.260 225.945 1.00 52.66  ? 148  ILE B CB    1 
ATOM   5915  C  CG1   . ILE C  1 154  ? 213.829 201.508 226.020 1.00 52.66  ? 148  ILE B CG1   1 
ATOM   5916  C  CG2   . ILE C  1 154  ? 212.106 199.821 225.589 1.00 52.66  ? 148  ILE B CG2   1 
ATOM   5917  C  CD1   . ILE C  1 154  ? 214.530 201.149 224.738 1.00 52.66  ? 148  ILE B CD1   1 
ATOM   5918  N  N     . LEU C  1 155  ? 209.315 202.114 225.345 1.00 52.56  ? 149  LEU B N     1 
ATOM   5919  C  CA    . LEU C  1 155  ? 207.937 201.754 225.043 1.00 52.56  ? 149  LEU B CA    1 
ATOM   5920  C  C     . LEU C  1 155  ? 207.508 202.303 223.694 1.00 52.56  ? 149  LEU B C     1 
ATOM   5921  O  O     . LEU C  1 155  ? 206.928 201.580 222.876 1.00 52.56  ? 149  LEU B O     1 
ATOM   5922  C  CB    . LEU C  1 155  ? 207.013 202.273 226.135 1.00 52.56  ? 149  LEU B CB    1 
ATOM   5923  C  CG    . LEU C  1 155  ? 205.556 201.957 225.846 1.00 52.56  ? 149  LEU B CG    1 
ATOM   5924  C  CD1   . LEU C  1 155  ? 205.377 200.466 225.776 1.00 52.56  ? 149  LEU B CD1   1 
ATOM   5925  C  CD2   . LEU C  1 155  ? 204.670 202.553 226.908 1.00 52.56  ? 149  LEU B CD2   1 
ATOM   5926  N  N     . ILE C  1 156  ? 207.767 203.588 223.457 1.00 58.29  ? 150  ILE B N     1 
ATOM   5927  C  CA    . ILE C  1 156  ? 207.400 204.197 222.184 1.00 58.29  ? 150  ILE B CA    1 
ATOM   5928  C  C     . ILE C  1 156  ? 208.076 203.465 221.039 1.00 58.29  ? 150  ILE B C     1 
ATOM   5929  O  O     . ILE C  1 156  ? 207.454 203.158 220.013 1.00 58.29  ? 150  ILE B O     1 
ATOM   5930  C  CB    . ILE C  1 156  ? 207.766 205.689 222.181 1.00 58.29  ? 150  ILE B CB    1 
ATOM   5931  C  CG1   . ILE C  1 156  ? 206.935 206.441 223.210 1.00 58.29  ? 150  ILE B CG1   1 
ATOM   5932  C  CG2   . ILE C  1 156  ? 207.563 206.278 220.811 1.00 58.29  ? 150  ILE B CG2   1 
ATOM   5933  C  CD1   . ILE C  1 156  ? 207.390 207.845 223.420 1.00 58.29  ? 150  ILE B CD1   1 
ATOM   5934  N  N     . VAL C  1 157  ? 209.363 203.176 221.203 1.00 54.86  ? 151  VAL B N     1 
ATOM   5935  C  CA    . VAL C  1 157  ? 210.118 202.500 220.161 1.00 54.86  ? 151  VAL B CA    1 
ATOM   5936  C  C     . VAL C  1 157  ? 209.507 201.147 219.859 1.00 54.86  ? 151  VAL B C     1 
ATOM   5937  O  O     . VAL C  1 157  ? 209.317 200.783 218.693 1.00 54.86  ? 151  VAL B O     1 
ATOM   5938  C  CB    . VAL C  1 157  ? 211.589 202.370 220.574 1.00 54.86  ? 151  VAL B CB    1 
ATOM   5939  C  CG1   . VAL C  1 157  ? 212.319 201.500 219.586 1.00 54.86  ? 151  VAL B CG1   1 
ATOM   5940  C  CG2   . VAL C  1 157  ? 212.222 203.732 220.638 1.00 54.86  ? 151  VAL B CG2   1 
ATOM   5941  N  N     . GLN C  1 158  ? 209.192 200.377 220.897 1.00 54.66  ? 152  GLN B N     1 
ATOM   5942  C  CA    . GLN C  1 158  ? 208.694 199.036 220.646 1.00 54.66  ? 152  GLN B CA    1 
ATOM   5943  C  C     . GLN C  1 158  ? 207.310 199.081 220.030 1.00 54.66  ? 152  GLN B C     1 
ATOM   5944  O  O     . GLN C  1 158  ? 206.980 198.247 219.188 1.00 54.66  ? 152  GLN B O     1 
ATOM   5945  C  CB    . GLN C  1 158  ? 208.685 198.199 221.920 1.00 54.66  ? 152  GLN B CB    1 
ATOM   5946  C  CG    . GLN C  1 158  ? 208.311 196.755 221.625 1.00 54.66  ? 152  GLN B CG    1 
ATOM   5947  C  CD    . GLN C  1 158  ? 208.461 195.840 222.808 1.00 54.66  ? 152  GLN B CD    1 
ATOM   5948  O  OE1   . GLN C  1 158  ? 208.791 196.275 223.907 1.00 54.66  ? 152  GLN B OE1   1 
ATOM   5949  N  NE2   . GLN C  1 158  ? 208.243 194.556 222.584 1.00 54.66  ? 152  GLN B NE2   1 
ATOM   5950  N  N     . ASN C  1 159  ? 206.497 200.067 220.401 1.00 58.30  ? 153  ASN B N     1 
ATOM   5951  C  CA    . ASN C  1 159  ? 205.180 200.162 219.787 1.00 58.30  ? 153  ASN B CA    1 
ATOM   5952  C  C     . ASN C  1 159  ? 205.284 200.511 218.314 1.00 58.30  ? 153  ASN B C     1 
ATOM   5953  O  O     . ASN C  1 159  ? 204.594 199.916 217.477 1.00 58.30  ? 153  ASN B O     1 
ATOM   5954  C  CB    . ASN C  1 159  ? 204.334 201.185 220.522 1.00 58.30  ? 153  ASN B CB    1 
ATOM   5955  C  CG    . ASN C  1 159  ? 203.873 200.681 221.855 1.00 58.30  ? 153  ASN B CG    1 
ATOM   5956  O  OD1   . ASN C  1 159  ? 203.461 199.531 221.982 1.00 58.30  ? 153  ASN B OD1   1 
ATOM   5957  N  ND2   . ASN C  1 159  ? 203.952 201.528 222.867 1.00 58.30  ? 153  ASN B ND2   1 
ATOM   5958  N  N     . ILE C  1 160  ? 206.144 201.468 217.974 1.00 68.35  ? 154  ILE B N     1 
ATOM   5959  C  CA    . ILE C  1 160  ? 206.318 201.844 216.575 1.00 68.35  ? 154  ILE B CA    1 
ATOM   5960  C  C     . ILE C  1 160  ? 206.838 200.664 215.771 1.00 68.35  ? 154  ILE B C     1 
ATOM   5961  O  O     . ILE C  1 160  ? 206.332 200.350 214.686 1.00 68.35  ? 154  ILE B O     1 
ATOM   5962  C  CB    . ILE C  1 160  ? 207.256 203.053 216.455 1.00 68.35  ? 154  ILE B CB    1 
ATOM   5963  C  CG1   . ILE C  1 160  ? 206.576 204.301 216.999 1.00 68.35  ? 154  ILE B CG1   1 
ATOM   5964  C  CG2   . ILE C  1 160  ? 207.696 203.231 215.024 1.00 68.35  ? 154  ILE B CG2   1 
ATOM   5965  C  CD1   . ILE C  1 160  ? 207.504 205.463 217.143 1.00 68.35  ? 154  ILE B CD1   1 
ATOM   5966  N  N     . VAL C  1 161  ? 207.875 200.006 216.283 1.00 66.32  ? 155  VAL B N     1 
ATOM   5967  C  CA    . VAL C  1 161  ? 208.420 198.848 215.593 1.00 66.32  ? 155  VAL B CA    1 
ATOM   5968  C  C     . VAL C  1 161  ? 207.373 197.759 215.462 1.00 66.32  ? 155  VAL B C     1 
ATOM   5969  O  O     . VAL C  1 161  ? 207.275 197.109 214.419 1.00 66.32  ? 155  VAL B O     1 
ATOM   5970  C  CB    . VAL C  1 161  ? 209.671 198.344 216.323 1.00 66.32  ? 155  VAL B CB    1 
ATOM   5971  C  CG1   . VAL C  1 161  ? 210.151 197.056 215.704 1.00 66.32  ? 155  VAL B CG1   1 
ATOM   5972  C  CG2   . VAL C  1 161  ? 210.752 199.392 216.259 1.00 66.32  ? 155  VAL B CG2   1 
ATOM   5973  N  N     . GLY C  1 162  ? 206.573 197.541 216.504 1.00 65.66  ? 156  GLY B N     1 
ATOM   5974  C  CA    . GLY C  1 162  ? 205.550 196.518 216.431 1.00 65.66  ? 156  GLY B CA    1 
ATOM   5975  C  C     . GLY C  1 162  ? 204.527 196.816 215.358 1.00 65.66  ? 156  GLY B C     1 
ATOM   5976  O  O     . GLY C  1 162  ? 204.140 195.935 214.594 1.00 65.66  ? 156  GLY B O     1 
ATOM   5977  N  N     . LEU C  1 163  ? 204.098 198.073 215.263 1.00 75.08  ? 157  LEU B N     1 
ATOM   5978  C  CA    . LEU C  1 163  ? 203.126 198.410 214.234 1.00 75.08  ? 157  LEU B CA    1 
ATOM   5979  C  C     . LEU C  1 163  ? 203.726 198.280 212.844 1.00 75.08  ? 157  LEU B C     1 
ATOM   5980  O  O     . LEU C  1 163  ? 203.078 197.757 211.930 1.00 75.08  ? 157  LEU B O     1 
ATOM   5981  C  CB    . LEU C  1 163  ? 202.578 199.812 214.460 1.00 75.08  ? 157  LEU B CB    1 
ATOM   5982  C  CG    . LEU C  1 163  ? 201.719 199.845 215.716 1.00 75.08  ? 157  LEU B CG    1 
ATOM   5983  C  CD1   . LEU C  1 163  ? 201.165 201.233 215.982 1.00 75.08  ? 157  LEU B CD1   1 
ATOM   5984  C  CD2   . LEU C  1 163  ? 200.605 198.822 215.599 1.00 75.08  ? 157  LEU B CD2   1 
ATOM   5985  N  N     . MET C  1 164  ? 204.967 198.728 212.667 1.00 81.61  ? 158  MET B N     1 
ATOM   5986  C  CA    . MET C  1 164  ? 205.603 198.623 211.359 1.00 81.61  ? 158  MET B CA    1 
ATOM   5987  C  C     . MET C  1 164  ? 205.757 197.169 210.940 1.00 81.61  ? 158  MET B C     1 
ATOM   5988  O  O     . MET C  1 164  ? 205.388 196.790 209.821 1.00 81.61  ? 158  MET B O     1 
ATOM   5989  C  CB    . MET C  1 164  ? 206.957 199.327 211.381 1.00 81.61  ? 158  MET B CB    1 
ATOM   5990  C  CG    . MET C  1 164  ? 206.874 200.845 211.467 1.00 81.61  ? 158  MET B CG    1 
ATOM   5991  S  SD    . MET C  1 164  ? 206.134 201.589 209.997 1.00 81.61  ? 158  MET B SD    1 
ATOM   5992  C  CE    . MET C  1 164  ? 204.502 202.023 210.589 1.00 81.61  ? 158  MET B CE    1 
ATOM   5993  N  N     . ILE C  1 165  ? 206.293 196.337 211.830 1.00 78.63  ? 159  ILE B N     1 
ATOM   5994  C  CA    . ILE C  1 165  ? 206.489 194.939 211.488 1.00 78.63  ? 159  ILE B CA    1 
ATOM   5995  C  C     . ILE C  1 165  ? 205.154 194.253 211.283 1.00 78.63  ? 159  ILE B C     1 
ATOM   5996  O  O     . ILE C  1 165  ? 205.024 193.393 210.408 1.00 78.63  ? 159  ILE B O     1 
ATOM   5997  C  CB    . ILE C  1 165  ? 207.332 194.231 212.562 1.00 78.63  ? 159  ILE B CB    1 
ATOM   5998  C  CG1   . ILE C  1 165  ? 207.706 192.832 212.095 1.00 78.63  ? 159  ILE B CG1   1 
ATOM   5999  C  CG2   . ILE C  1 165  ? 206.589 194.119 213.862 1.00 78.63  ? 159  ILE B CG2   1 
ATOM   6000  C  CD1   . ILE C  1 165  ? 208.729 192.177 212.965 1.00 78.63  ? 159  ILE B CD1   1 
ATOM   6001  N  N     . ASN C  1 166  ? 204.134 194.632 212.046 1.00 83.20  ? 160  ASN B N     1 
ATOM   6002  C  CA    . ASN C  1 166  ? 202.844 193.990 211.886 1.00 83.20  ? 160  ASN B CA    1 
ATOM   6003  C  C     . ASN C  1 166  ? 202.244 194.323 210.533 1.00 83.20  ? 160  ASN B C     1 
ATOM   6004  O  O     . ASN C  1 166  ? 201.730 193.439 209.841 1.00 83.20  ? 160  ASN B O     1 
ATOM   6005  C  CB    . ASN C  1 166  ? 201.918 194.417 213.020 1.00 83.20  ? 160  ASN B CB    1 
ATOM   6006  C  CG    . ASN C  1 166  ? 200.667 193.586 213.082 1.00 83.20  ? 160  ASN B CG    1 
ATOM   6007  O  OD1   . ASN C  1 166  ? 200.461 192.701 212.260 1.00 83.20  ? 160  ASN B OD1   1 
ATOM   6008  N  ND2   . ASN C  1 166  ? 199.823 193.860 214.064 1.00 83.20  ? 160  ASN B ND2   1 
ATOM   6009  N  N     . ALA C  1 167  ? 202.332 195.587 210.125 1.00 89.61  ? 161  ALA B N     1 
ATOM   6010  C  CA    . ALA C  1 167  ? 201.806 195.972 208.824 1.00 89.61  ? 161  ALA B CA    1 
ATOM   6011  C  C     . ALA C  1 167  ? 202.574 195.299 207.700 1.00 89.61  ? 161  ALA B C     1 
ATOM   6012  O  O     . ALA C  1 167  ? 201.982 194.890 206.699 1.00 89.61  ? 161  ALA B O     1 
ATOM   6013  C  CB    . ALA C  1 167  ? 201.850 197.489 208.665 1.00 89.61  ? 161  ALA B CB    1 
ATOM   6014  N  N     . ILE C  1 168  ? 203.892 195.175 207.838 1.00 93.08  ? 162  ILE B N     1 
ATOM   6015  C  CA    . ILE C  1 168  ? 204.663 194.490 206.807 1.00 93.08  ? 162  ILE B CA    1 
ATOM   6016  C  C     . ILE C  1 168  ? 204.230 193.036 206.700 1.00 93.08  ? 162  ILE B C     1 
ATOM   6017  O  O     . ILE C  1 168  ? 203.961 192.530 205.603 1.00 93.08  ? 162  ILE B O     1 
ATOM   6018  C  CB    . ILE C  1 168  ? 206.169 194.611 207.090 1.00 93.08  ? 162  ILE B CB    1 
ATOM   6019  C  CG1   . ILE C  1 168  ? 206.625 196.059 206.926 1.00 93.08  ? 162  ILE B CG1   1 
ATOM   6020  C  CG2   . ILE C  1 168  ? 206.949 193.710 206.171 1.00 93.08  ? 162  ILE B CG2   1 
ATOM   6021  C  CD1   . ILE C  1 168  ? 206.451 196.583 205.524 1.00 93.08  ? 162  ILE B CD1   1 
ATOM   6022  N  N     . MET C  1 169  ? 204.162 192.340 207.836 1.00 104.89 ? 163  MET B N     1 
ATOM   6023  C  CA    . MET C  1 169  ? 203.739 190.948 207.815 1.00 104.89 ? 163  MET B CA    1 
ATOM   6024  C  C     . MET C  1 169  ? 202.352 190.808 207.218 1.00 104.89 ? 163  MET B C     1 
ATOM   6025  O  O     . MET C  1 169  ? 202.086 189.857 206.483 1.00 104.89 ? 163  MET B O     1 
ATOM   6026  C  CB    . MET C  1 169  ? 203.742 190.369 209.224 1.00 104.89 ? 163  MET B CB    1 
ATOM   6027  C  CG    . MET C  1 169  ? 205.069 190.458 209.947 1.00 104.89 ? 163  MET B CG    1 
ATOM   6028  S  SD    . MET C  1 169  ? 206.441 189.602 209.167 1.00 104.89 ? 163  MET B SD    1 
ATOM   6029  C  CE    . MET C  1 169  ? 207.335 190.967 208.422 1.00 104.89 ? 163  MET B CE    1 
ATOM   6030  N  N     . LEU C  1 170  ? 201.463 191.756 207.505 1.00 103.82 ? 164  LEU B N     1 
ATOM   6031  C  CA    . LEU C  1 170  ? 200.085 191.616 207.057 1.00 103.82 ? 164  LEU B CA    1 
ATOM   6032  C  C     . LEU C  1 170  ? 199.955 191.931 205.574 1.00 103.82 ? 164  LEU B C     1 
ATOM   6033  O  O     . LEU C  1 170  ? 199.190 191.273 204.864 1.00 103.82 ? 164  LEU B O     1 
ATOM   6034  C  CB    . LEU C  1 170  ? 199.178 192.505 207.899 1.00 103.82 ? 164  LEU B CB    1 
ATOM   6035  C  CG    . LEU C  1 170  ? 197.674 192.291 207.785 1.00 103.82 ? 164  LEU B CG    1 
ATOM   6036  C  CD1   . LEU C  1 170  ? 197.041 192.617 209.109 1.00 103.82 ? 164  LEU B CD1   1 
ATOM   6037  C  CD2   . LEU C  1 170  ? 197.096 193.180 206.713 1.00 103.82 ? 164  LEU B CD2   1 
ATOM   6038  N  N     . GLY C  1 171  ? 200.700 192.916 205.083 1.00 99.64  ? 165  GLY B N     1 
ATOM   6039  C  CA    . GLY C  1 171  ? 200.726 193.157 203.653 1.00 99.64  ? 165  GLY B CA    1 
ATOM   6040  C  C     . GLY C  1 171  ? 201.289 191.979 202.887 1.00 99.64  ? 165  GLY B C     1 
ATOM   6041  O  O     . GLY C  1 171  ? 200.773 191.604 201.827 1.00 99.64  ? 165  GLY B O     1 
ATOM   6042  N  N     . CYS C  1 172  ? 202.350 191.368 203.419 1.00 106.40 ? 166  CYS B N     1 
ATOM   6043  C  CA    . CYS C  1 172  ? 202.905 190.186 202.774 1.00 106.40 ? 166  CYS B CA    1 
ATOM   6044  C  C     . CYS C  1 172  ? 201.912 189.034 202.789 1.00 106.40 ? 166  CYS B C     1 
ATOM   6045  O  O     . CYS C  1 172  ? 201.703 188.374 201.767 1.00 106.40 ? 166  CYS B O     1 
ATOM   6046  C  CB    . CYS C  1 172  ? 204.210 189.780 203.448 1.00 106.40 ? 166  CYS B CB    1 
ATOM   6047  S  SG    . CYS C  1 172  ? 205.584 190.902 203.146 1.00 106.40 ? 166  CYS B SG    1 
ATOM   6048  N  N     . ILE C  1 173  ? 201.296 188.769 203.942 1.00 109.30 ? 167  ILE B N     1 
ATOM   6049  C  CA    . ILE C  1 173  ? 200.319 187.687 204.024 1.00 109.30 ? 167  ILE B CA    1 
ATOM   6050  C  C     . ILE C  1 173  ? 199.158 187.950 203.080 1.00 109.30 ? 167  ILE B C     1 
ATOM   6051  O  O     . ILE C  1 173  ? 198.613 187.024 202.471 1.00 109.30 ? 167  ILE B O     1 
ATOM   6052  C  CB    . ILE C  1 173  ? 199.839 187.493 205.472 1.00 109.30 ? 167  ILE B CB    1 
ATOM   6053  C  CG1   . ILE C  1 173  ? 200.963 186.932 206.335 1.00 109.30 ? 167  ILE B CG1   1 
ATOM   6054  C  CG2   . ILE C  1 173  ? 198.665 186.542 205.513 1.00 109.30 ? 167  ILE B CG2   1 
ATOM   6055  C  CD1   . ILE C  1 173  ? 201.350 185.529 205.953 1.00 109.30 ? 167  ILE B CD1   1 
ATOM   6056  N  N     . PHE C  1 174  ? 198.764 189.212 202.930 1.00 111.14 ? 168  PHE B N     1 
ATOM   6057  C  CA    . PHE C  1 174  ? 197.703 189.508 201.982 1.00 111.14 ? 168  PHE B CA    1 
ATOM   6058  C  C     . PHE C  1 174  ? 198.136 189.178 200.565 1.00 111.14 ? 168  PHE B C     1 
ATOM   6059  O  O     . PHE C  1 174  ? 197.552 188.316 199.902 1.00 111.14 ? 168  PHE B O     1 
ATOM   6060  C  CB    . PHE C  1 174  ? 197.268 190.964 202.050 1.00 111.14 ? 168  PHE B CB    1 
ATOM   6061  C  CG    . PHE C  1 174  ? 196.156 191.267 201.099 1.00 111.14 ? 168  PHE B CG    1 
ATOM   6062  C  CD1   . PHE C  1 174  ? 194.845 191.014 201.450 1.00 111.14 ? 168  PHE B CD1   1 
ATOM   6063  C  CD2   . PHE C  1 174  ? 196.426 191.678 199.813 1.00 111.14 ? 168  PHE B CD2   1 
ATOM   6064  C  CE1   . PHE C  1 174  ? 193.832 191.245 200.556 1.00 111.14 ? 168  PHE B CE1   1 
ATOM   6065  C  CE2   . PHE C  1 174  ? 195.425 191.920 198.918 1.00 111.14 ? 168  PHE B CE2   1 
ATOM   6066  C  CZ    . PHE C  1 174  ? 194.127 191.694 199.281 1.00 111.14 ? 168  PHE B CZ    1 
ATOM   6067  N  N     . MET C  1 175  ? 199.156 189.872 200.073 1.00 111.96 ? 169  MET B N     1 
ATOM   6068  C  CA    . MET C  1 175  ? 199.529 189.637 198.688 1.00 111.96 ? 169  MET B CA    1 
ATOM   6069  C  C     . MET C  1 175  ? 199.952 188.204 198.439 1.00 111.96 ? 169  MET B C     1 
ATOM   6070  O  O     . MET C  1 175  ? 200.026 187.796 197.279 1.00 111.96 ? 169  MET B O     1 
ATOM   6071  C  CB    . MET C  1 175  ? 200.633 190.599 198.263 1.00 111.96 ? 169  MET B CB    1 
ATOM   6072  C  CG    . MET C  1 175  ? 201.927 190.457 199.023 1.00 111.96 ? 169  MET B CG    1 
ATOM   6073  S  SD    . MET C  1 175  ? 203.069 191.757 198.539 1.00 111.96 ? 169  MET B SD    1 
ATOM   6074  C  CE    . MET C  1 175  ? 202.264 193.163 199.289 1.00 111.96 ? 169  MET B CE    1 
ATOM   6075  N  N     . LYS C  1 176  ? 200.202 187.423 199.484 1.00 108.31 ? 170  LYS B N     1 
ATOM   6076  C  CA    . LYS C  1 176  ? 200.438 186.008 199.281 1.00 108.31 ? 170  LYS B CA    1 
ATOM   6077  C  C     . LYS C  1 176  ? 199.142 185.222 199.213 1.00 108.31 ? 170  LYS B C     1 
ATOM   6078  O  O     . LYS C  1 176  ? 199.017 184.320 198.384 1.00 108.31 ? 170  LYS B O     1 
ATOM   6079  C  CB    . LYS C  1 176  ? 201.315 185.443 200.397 1.00 108.31 ? 170  LYS B CB    1 
ATOM   6080  C  CG    . LYS C  1 176  ? 201.828 184.045 200.106 1.00 108.31 ? 170  LYS B CG    1 
ATOM   6081  C  CD    . LYS C  1 176  ? 202.775 183.578 201.186 1.00 108.31 ? 170  LYS B CD    1 
ATOM   6082  C  CE    . LYS C  1 176  ? 203.330 182.181 200.893 1.00 108.31 ? 170  LYS B CE    1 
ATOM   6083  N  NZ    . LYS C  1 176  ? 204.178 182.115 199.649 1.00 108.31 ? 170  LYS B NZ    1 
ATOM   6084  N  N     . THR C  1 177  ? 198.164 185.539 200.059 1.00 117.83 ? 171  THR B N     1 
ATOM   6085  C  CA    . THR C  1 177  ? 196.880 184.862 200.013 1.00 117.83 ? 171  THR B CA    1 
ATOM   6086  C  C     . THR C  1 177  ? 196.047 185.279 198.814 1.00 117.83 ? 171  THR B C     1 
ATOM   6087  O  O     . THR C  1 177  ? 195.135 184.545 198.432 1.00 117.83 ? 171  THR B O     1 
ATOM   6088  C  CB    . THR C  1 177  ? 196.088 185.103 201.308 1.00 117.83 ? 171  THR B CB    1 
ATOM   6089  O  OG1   . THR C  1 177  ? 194.929 184.262 201.323 1.00 117.83 ? 171  THR B OG1   1 
ATOM   6090  C  CG2   . THR C  1 177  ? 195.637 186.541 201.423 1.00 117.83 ? 171  THR B CG2   1 
ATOM   6091  N  N     . ALA C  1 178  ? 196.334 186.433 198.217 1.00 108.99 ? 172  ALA B N     1 
ATOM   6092  C  CA    . ALA C  1 178  ? 195.754 186.773 196.928 1.00 108.99 ? 172  ALA B CA    1 
ATOM   6093  C  C     . ALA C  1 178  ? 196.560 186.208 195.770 1.00 108.99 ? 172  ALA B C     1 
ATOM   6094  O  O     . ALA C  1 178  ? 196.461 186.726 194.652 1.00 108.99 ? 172  ALA B O     1 
ATOM   6095  C  CB    . ALA C  1 178  ? 195.637 188.290 196.777 1.00 108.99 ? 172  ALA B CB    1 
ATOM   6096  N  N     . GLN C  1 179  ? 197.366 185.178 196.014 1.00 113.44 ? 173  GLN B N     1 
ATOM   6097  C  CA    . GLN C  1 179  ? 198.240 184.646 194.983 1.00 113.44 ? 173  GLN B CA    1 
ATOM   6098  C  C     . GLN C  1 179  ? 197.437 184.057 193.834 1.00 113.44 ? 173  GLN B C     1 
ATOM   6099  O  O     . GLN C  1 179  ? 196.329 183.547 194.018 1.00 113.44 ? 173  GLN B O     1 
ATOM   6100  C  CB    . GLN C  1 179  ? 199.161 183.578 195.574 1.00 113.44 ? 173  GLN B CB    1 
ATOM   6101  C  CG    . GLN C  1 179  ? 200.209 183.049 194.627 1.00 113.44 ? 173  GLN B CG    1 
ATOM   6102  C  CD    . GLN C  1 179  ? 201.132 184.134 194.140 1.00 113.44 ? 173  GLN B CD    1 
ATOM   6103  O  OE1   . GLN C  1 179  ? 201.054 184.554 192.989 1.00 113.44 ? 173  GLN B OE1   1 
ATOM   6104  N  NE2   . GLN C  1 179  ? 202.002 184.611 195.019 1.00 113.44 ? 173  GLN B NE2   1 
ATOM   6105  N  N     . ALA C  1 180  ? 198.012 184.152 192.641 1.00 125.02 ? 174  ALA B N     1 
ATOM   6106  C  CA    . ALA C  1 180  ? 197.525 183.495 191.444 1.00 125.02 ? 174  ALA B CA    1 
ATOM   6107  C  C     . ALA C  1 180  ? 198.186 182.125 191.295 1.00 125.02 ? 174  ALA B C     1 
ATOM   6108  O  O     . ALA C  1 180  ? 198.677 181.532 192.257 1.00 125.02 ? 174  ALA B O     1 
ATOM   6109  C  CB    . ALA C  1 180  ? 197.773 184.367 190.217 1.00 125.02 ? 174  ALA B CB    1 
ATOM   6110  N  N     . HIS C  1 181  ? 198.115 181.587 190.082 1.00 133.98 ? 175  HIS B N     1 
ATOM   6111  C  CA    . HIS C  1 181  ? 198.654 180.329 189.579 1.00 133.98 ? 175  HIS B CA    1 
ATOM   6112  C  C     . HIS C  1 181  ? 198.104 179.132 190.333 1.00 133.98 ? 175  HIS B C     1 
ATOM   6113  O  O     . HIS C  1 181  ? 198.509 178.008 190.047 1.00 133.98 ? 175  HIS B O     1 
ATOM   6114  C  CB    . HIS C  1 181  ? 200.195 180.255 189.567 1.00 133.98 ? 175  HIS B CB    1 
ATOM   6115  C  CG    . HIS C  1 181  ? 200.825 180.162 190.919 1.00 133.98 ? 175  HIS B CG    1 
ATOM   6116  N  ND1   . HIS C  1 181  ? 200.884 178.983 191.630 1.00 133.98 ? 175  HIS B ND1   1 
ATOM   6117  C  CD2   . HIS C  1 181  ? 201.484 181.081 191.661 1.00 133.98 ? 175  HIS B CD2   1 
ATOM   6118  C  CE1   . HIS C  1 181  ? 201.516 179.191 192.772 1.00 133.98 ? 175  HIS B CE1   1 
ATOM   6119  N  NE2   . HIS C  1 181  ? 201.890 180.456 192.815 1.00 133.98 ? 175  HIS B NE2   1 
ATOM   6120  N  N     . ARG C  1 182  ? 197.201 179.326 191.289 1.00 124.04 ? 176  ARG B N     1 
ATOM   6121  C  CA    . ARG C  1 182  ? 196.353 178.223 191.709 1.00 124.04 ? 176  ARG B CA    1 
ATOM   6122  C  C     . ARG C  1 182  ? 195.346 177.895 190.622 1.00 124.04 ? 176  ARG B C     1 
ATOM   6123  O  O     . ARG C  1 182  ? 195.055 176.721 190.362 1.00 124.04 ? 176  ARG B O     1 
ATOM   6124  C  CB    . ARG C  1 182  ? 195.648 178.572 193.015 1.00 124.04 ? 176  ARG B CB    1 
ATOM   6125  N  N     . ARG C  1 183  ? 194.814 178.925 189.963 1.00 125.36 ? 177  ARG B N     1 
ATOM   6126  C  CA    . ARG C  1 183  ? 193.942 178.700 188.822 1.00 125.36 ? 177  ARG B CA    1 
ATOM   6127  C  C     . ARG C  1 183  ? 194.726 178.207 187.612 1.00 125.36 ? 177  ARG B C     1 
ATOM   6128  O  O     . ARG C  1 183  ? 194.240 177.350 186.865 1.00 125.36 ? 177  ARG B O     1 
ATOM   6129  C  CB    . ARG C  1 183  ? 193.193 179.983 188.474 1.00 125.36 ? 177  ARG B CB    1 
ATOM   6130  C  CG    . ARG C  1 183  ? 192.288 179.840 187.273 1.00 125.36 ? 177  ARG B CG    1 
ATOM   6131  C  CD    . ARG C  1 183  ? 191.160 178.878 187.578 1.00 125.36 ? 177  ARG B CD    1 
ATOM   6132  N  NE    . ARG C  1 183  ? 190.301 178.656 186.421 1.00 125.36 ? 177  ARG B NE    1 
ATOM   6133  C  CZ    . ARG C  1 183  ? 189.261 179.420 186.117 1.00 125.36 ? 177  ARG B CZ    1 
ATOM   6134  N  NH1   . ARG C  1 183  ? 188.961 180.455 186.885 1.00 125.36 ? 177  ARG B NH1   1 
ATOM   6135  N  NH2   . ARG C  1 183  ? 188.523 179.154 185.051 1.00 125.36 ? 177  ARG B NH2   1 
ATOM   6136  N  N     . ALA C  1 184  ? 195.944 178.718 187.414 1.00 117.84 ? 178  ALA B N     1 
ATOM   6137  C  CA    . ALA C  1 184  ? 196.745 178.367 186.246 1.00 117.84 ? 178  ALA B CA    1 
ATOM   6138  C  C     . ALA C  1 184  ? 197.068 176.884 186.171 1.00 117.84 ? 178  ALA B C     1 
ATOM   6139  O  O     . ALA C  1 184  ? 197.567 176.429 185.137 1.00 117.84 ? 178  ALA B O     1 
ATOM   6140  C  CB    . ALA C  1 184  ? 198.040 179.172 186.241 1.00 117.84 ? 178  ALA B CB    1 
ATOM   6141  N  N     . GLU C  1 185  ? 196.813 176.124 187.230 1.00 127.19 ? 179  GLU B N     1 
ATOM   6142  C  CA    . GLU C  1 185  ? 196.974 174.682 187.170 1.00 127.19 ? 179  GLU B CA    1 
ATOM   6143  C  C     . GLU C  1 185  ? 195.727 173.988 186.663 1.00 127.19 ? 179  GLU B C     1 
ATOM   6144  O  O     . GLU C  1 185  ? 195.821 172.894 186.098 1.00 127.19 ? 179  GLU B O     1 
ATOM   6145  C  CB    . GLU C  1 185  ? 197.334 174.140 188.552 1.00 127.19 ? 179  GLU B CB    1 
ATOM   6146  C  CG    . GLU C  1 185  ? 198.693 174.588 189.037 1.00 127.19 ? 179  GLU B CG    1 
ATOM   6147  C  CD    . GLU C  1 185  ? 199.816 173.978 188.230 1.00 127.19 ? 179  GLU B CD    1 
ATOM   6148  O  OE1   . GLU C  1 185  ? 199.671 172.820 187.791 1.00 127.19 ? 179  GLU B OE1   1 
ATOM   6149  O  OE2   . GLU C  1 185  ? 200.841 174.658 188.026 1.00 127.19 ? 179  GLU B OE2   1 
ATOM   6150  N  N     . THR C  1 186  ? 194.558 174.599 186.852 1.00 123.30 ? 180  THR B N     1 
ATOM   6151  C  CA    . THR C  1 186  ? 193.318 174.008 186.365 1.00 123.30 ? 180  THR B CA    1 
ATOM   6152  C  C     . THR C  1 186  ? 193.159 174.179 184.861 1.00 123.30 ? 180  THR B C     1 
ATOM   6153  O  O     . THR C  1 186  ? 192.398 173.438 184.232 1.00 123.30 ? 180  THR B O     1 
ATOM   6154  C  CB    . THR C  1 186  ? 192.126 174.628 187.087 1.00 123.30 ? 180  THR B CB    1 
ATOM   6155  O  OG1   . THR C  1 186  ? 192.055 176.021 186.762 1.00 123.30 ? 180  THR B OG1   1 
ATOM   6156  C  CG2   . THR C  1 186  ? 192.294 174.481 188.587 1.00 123.30 ? 180  THR B CG2   1 
ATOM   6157  N  N     . LEU C  1 187  ? 193.856 175.146 184.275 1.00 119.01 ? 181  LEU B N     1 
ATOM   6158  C  CA    . LEU C  1 187  ? 193.789 175.357 182.838 1.00 119.01 ? 181  LEU B CA    1 
ATOM   6159  C  C     . LEU C  1 187  ? 194.548 174.246 182.130 1.00 119.01 ? 181  LEU B C     1 
ATOM   6160  O  O     . LEU C  1 187  ? 195.775 174.305 182.013 1.00 119.01 ? 181  LEU B O     1 
ATOM   6161  C  CB    . LEU C  1 187  ? 194.363 176.725 182.479 1.00 119.01 ? 181  LEU B CB    1 
ATOM   6162  C  CG    . LEU C  1 187  ? 193.594 177.892 183.103 1.00 119.01 ? 181  LEU B CG    1 
ATOM   6163  C  CD1   . LEU C  1 187  ? 194.265 179.214 182.782 1.00 119.01 ? 181  LEU B CD1   1 
ATOM   6164  C  CD2   . LEU C  1 187  ? 192.141 177.891 182.651 1.00 119.01 ? 181  LEU B CD2   1 
ATOM   6165  N  N     . ILE C  1 188  ? 193.841 173.240 181.664 1.00 111.86 ? 182  ILE B N     1 
ATOM   6166  C  CA    . ILE C  1 188  ? 194.480 172.018 181.192 1.00 111.86 ? 182  ILE B CA    1 
ATOM   6167  C  C     . ILE C  1 188  ? 194.625 172.029 179.682 1.00 111.86 ? 182  ILE B C     1 
ATOM   6168  O  O     . ILE C  1 188  ? 193.920 172.742 178.961 1.00 111.86 ? 182  ILE B O     1 
ATOM   6169  C  CB    . ILE C  1 188  ? 193.698 170.779 181.659 1.00 111.86 ? 182  ILE B CB    1 
ATOM   6170  C  CG1   . ILE C  1 188  ? 192.261 170.849 181.151 1.00 111.86 ? 182  ILE B CG1   1 
ATOM   6171  C  CG2   . ILE C  1 188  ? 193.772 170.651 183.165 1.00 111.86 ? 182  ILE B CG2   1 
ATOM   6172  C  CD1   . ILE C  1 188  ? 191.514 169.558 181.305 1.00 111.86 ? 182  ILE B CD1   1 
ATOM   6173  N  N     . PHE C  1 189  ? 195.552 171.206 179.202 1.00 106.43 ? 183  PHE B N     1 
ATOM   6174  C  CA    . PHE C  1 189  ? 195.858 171.086 177.788 1.00 106.43 ? 183  PHE B CA    1 
ATOM   6175  C  C     . PHE C  1 189  ? 196.161 169.631 177.476 1.00 106.43 ? 183  PHE B C     1 
ATOM   6176  O  O     . PHE C  1 189  ? 196.974 169.003 178.160 1.00 106.43 ? 183  PHE B O     1 
ATOM   6177  C  CB    . PHE C  1 189  ? 197.059 171.948 177.414 1.00 106.43 ? 183  PHE B CB    1 
ATOM   6178  C  CG    . PHE C  1 189  ? 196.861 173.395 177.699 1.00 106.43 ? 183  PHE B CG    1 
ATOM   6179  C  CD1   . PHE C  1 189  ? 196.125 174.186 176.843 1.00 106.43 ? 183  PHE B CD1   1 
ATOM   6180  C  CD2   . PHE C  1 189  ? 197.398 173.961 178.836 1.00 106.43 ? 183  PHE B CD2   1 
ATOM   6181  C  CE1   . PHE C  1 189  ? 195.938 175.518 177.111 1.00 106.43 ? 183  PHE B CE1   1 
ATOM   6182  C  CE2   . PHE C  1 189  ? 197.214 175.292 179.111 1.00 106.43 ? 183  PHE B CE2   1 
ATOM   6183  C  CZ    . PHE C  1 189  ? 196.482 176.074 178.247 1.00 106.43 ? 183  PHE B CZ    1 
ATOM   6184  N  N     . SER C  1 190  ? 195.514 169.106 176.442 1.00 116.79 ? 184  SER B N     1 
ATOM   6185  C  CA    . SER C  1 190  ? 195.738 167.730 176.034 1.00 116.79 ? 184  SER B CA    1 
ATOM   6186  C  C     . SER C  1 190  ? 197.224 167.482 175.795 1.00 116.79 ? 184  SER B C     1 
ATOM   6187  O  O     . SER C  1 190  ? 197.971 168.363 175.374 1.00 116.79 ? 184  SER B O     1 
ATOM   6188  C  CB    . SER C  1 190  ? 194.940 167.415 174.773 1.00 116.79 ? 184  SER B CB    1 
ATOM   6189  O  OG    . SER C  1 190  ? 195.396 168.199 173.685 1.00 116.79 ? 184  SER B OG    1 
ATOM   6190  N  N     . LYS C  1 191  ? 197.651 166.253 176.074 1.00 110.83 ? 185  LYS B N     1 
ATOM   6191  C  CA    . LYS C  1 191  ? 199.053 165.893 175.923 1.00 110.83 ? 185  LYS B CA    1 
ATOM   6192  C  C     . LYS C  1 191  ? 199.480 165.854 174.463 1.00 110.83 ? 185  LYS B C     1 
ATOM   6193  O  O     . LYS C  1 191  ? 200.679 165.773 174.173 1.00 110.83 ? 185  LYS B O     1 
ATOM   6194  C  CB    . LYS C  1 191  ? 199.312 164.542 176.602 1.00 110.83 ? 185  LYS B CB    1 
ATOM   6195  C  CG    . LYS C  1 191  ? 200.769 164.111 176.664 1.00 110.83 ? 185  LYS B CG    1 
ATOM   6196  C  CD    . LYS C  1 191  ? 200.972 162.914 177.575 1.00 110.83 ? 185  LYS B CD    1 
ATOM   6197  C  CE    . LYS C  1 191  ? 200.434 161.650 176.942 1.00 110.83 ? 185  LYS B CE    1 
ATOM   6198  N  NZ    . LYS C  1 191  ? 200.722 160.453 177.768 1.00 110.83 ? 185  LYS B NZ    1 
ATOM   6199  N  N     . HIS C  1 192  ? 198.530 165.952 173.537 1.00 112.09 ? 186  HIS B N     1 
ATOM   6200  C  CA    . HIS C  1 192  ? 198.803 165.825 172.112 1.00 112.09 ? 186  HIS B CA    1 
ATOM   6201  C  C     . HIS C  1 192  ? 198.101 166.933 171.349 1.00 112.09 ? 186  HIS B C     1 
ATOM   6202  O  O     . HIS C  1 192  ? 197.087 167.468 171.809 1.00 112.09 ? 186  HIS B O     1 
ATOM   6203  C  CB    . HIS C  1 192  ? 198.348 164.465 171.597 1.00 112.09 ? 186  HIS B CB    1 
ATOM   6204  C  CG    . HIS C  1 192  ? 199.067 163.328 172.234 1.00 112.09 ? 186  HIS B CG    1 
ATOM   6205  N  ND1   . HIS C  1 192  ? 198.626 162.731 173.394 1.00 112.09 ? 186  HIS B ND1   1 
ATOM   6206  C  CD2   . HIS C  1 192  ? 200.211 162.693 171.892 1.00 112.09 ? 186  HIS B CD2   1 
ATOM   6207  C  CE1   . HIS C  1 192  ? 199.461 161.767 173.732 1.00 112.09 ? 186  HIS B CE1   1 
ATOM   6208  N  NE2   . HIS C  1 192  ? 200.433 161.724 172.837 1.00 112.09 ? 186  HIS B NE2   1 
ATOM   6209  N  N     . ALA C  1 193  ? 198.647 167.278 170.191 1.00 116.24 ? 187  ALA B N     1 
ATOM   6210  C  CA    . ALA C  1 193  ? 198.003 168.173 169.247 1.00 116.24 ? 187  ALA B CA    1 
ATOM   6211  C  C     . ALA C  1 193  ? 197.881 167.465 167.907 1.00 116.24 ? 187  ALA B C     1 
ATOM   6212  O  O     . ALA C  1 193  ? 198.786 166.726 167.508 1.00 116.24 ? 187  ALA B O     1 
ATOM   6213  C  CB    . ALA C  1 193  ? 198.796 169.468 169.105 1.00 116.24 ? 187  ALA B CB    1 
ATOM   6214  N  N     . VAL C  1 194  ? 196.767 167.686 167.219 1.00 117.05 ? 188  VAL B N     1 
ATOM   6215  C  CA    . VAL C  1 194  ? 196.487 166.989 165.974 1.00 117.05 ? 188  VAL B CA    1 
ATOM   6216  C  C     . VAL C  1 194  ? 196.401 168.003 164.846 1.00 117.05 ? 188  VAL B C     1 
ATOM   6217  O  O     . VAL C  1 194  ? 196.097 169.181 165.062 1.00 117.05 ? 188  VAL B O     1 
ATOM   6218  C  CB    . VAL C  1 194  ? 195.186 166.168 166.057 1.00 117.05 ? 188  VAL B CB    1 
ATOM   6219  C  CG1   . VAL C  1 194  ? 195.224 165.236 167.253 1.00 117.05 ? 188  VAL B CG1   1 
ATOM   6220  C  CG2   . VAL C  1 194  ? 193.981 167.084 166.105 1.00 117.05 ? 188  VAL B CG2   1 
ATOM   6221  N  N     . ILE C  1 195  ? 196.690 167.544 163.638 1.00 116.97 ? 189  ILE B N     1 
ATOM   6222  C  CA    . ILE C  1 195  ? 196.452 168.319 162.428 1.00 116.97 ? 189  ILE B CA    1 
ATOM   6223  C  C     . ILE C  1 195  ? 195.370 167.597 161.646 1.00 116.97 ? 189  ILE B C     1 
ATOM   6224  O  O     . ILE C  1 195  ? 195.190 166.384 161.801 1.00 116.97 ? 189  ILE B O     1 
ATOM   6225  C  CB    . ILE C  1 195  ? 197.730 168.472 161.578 1.00 116.97 ? 189  ILE B CB    1 
ATOM   6226  C  CG1   . ILE C  1 195  ? 198.919 168.873 162.435 1.00 116.97 ? 189  ILE B CG1   1 
ATOM   6227  C  CG2   . ILE C  1 195  ? 197.540 169.524 160.511 1.00 116.97 ? 189  ILE B CG2   1 
ATOM   6228  C  CD1   . ILE C  1 195  ? 199.761 167.693 162.827 1.00 116.97 ? 189  ILE B CD1   1 
ATOM   6229  N  N     . ALA C  1 196  ? 194.647 168.331 160.809 1.00 117.27 ? 190  ALA B N     1 
ATOM   6230  C  CA    . ALA C  1 196  ? 193.654 167.723 159.943 1.00 117.27 ? 190  ALA B CA    1 
ATOM   6231  C  C     . ALA C  1 196  ? 193.367 168.685 158.799 1.00 117.27 ? 190  ALA B C     1 
ATOM   6232  O  O     . ALA C  1 196  ? 194.025 169.721 158.653 1.00 117.27 ? 190  ALA B O     1 
ATOM   6233  C  CB    . ALA C  1 196  ? 192.385 167.368 160.726 1.00 117.27 ? 190  ALA B CB    1 
ATOM   6234  N  N     . LEU C  1 197  ? 192.374 168.343 157.987 1.00 118.16 ? 191  LEU B N     1 
ATOM   6235  C  CA    . LEU C  1 197  ? 191.914 169.200 156.909 1.00 118.16 ? 191  LEU B CA    1 
ATOM   6236  C  C     . LEU C  1 197  ? 190.667 169.943 157.357 1.00 118.16 ? 191  LEU B C     1 
ATOM   6237  O  O     . LEU C  1 197  ? 189.692 169.324 157.794 1.00 118.16 ? 191  LEU B O     1 
ATOM   6238  C  CB    . LEU C  1 197  ? 191.630 168.398 155.643 1.00 118.16 ? 191  LEU B CB    1 
ATOM   6239  C  CG    . LEU C  1 197  ? 192.907 167.909 154.969 1.00 118.16 ? 191  LEU B CG    1 
ATOM   6240  C  CD1   . LEU C  1 197  ? 192.602 167.018 153.774 1.00 118.16 ? 191  LEU B CD1   1 
ATOM   6241  C  CD2   . LEU C  1 197  ? 193.738 169.108 154.552 1.00 118.16 ? 191  LEU B CD2   1 
ATOM   6242  N  N     . ARG C  1 198  ? 190.717 171.266 157.272 1.00 125.80 ? 192  ARG B N     1 
ATOM   6243  C  CA    . ARG C  1 198  ? 189.559 172.108 157.511 1.00 125.80 ? 192  ARG B CA    1 
ATOM   6244  C  C     . ARG C  1 198  ? 189.494 173.139 156.401 1.00 125.80 ? 192  ARG B C     1 
ATOM   6245  O  O     . ARG C  1 198  ? 190.510 173.757 156.070 1.00 125.80 ? 192  ARG B O     1 
ATOM   6246  C  CB    . ARG C  1 198  ? 189.623 172.794 158.880 1.00 125.80 ? 192  ARG B CB    1 
ATOM   6247  C  CG    . ARG C  1 198  ? 188.486 173.772 159.110 1.00 125.80 ? 192  ARG B CG    1 
ATOM   6248  C  CD    . ARG C  1 198  ? 188.445 174.311 160.530 1.00 125.80 ? 192  ARG B CD    1 
ATOM   6249  N  NE    . ARG C  1 198  ? 187.937 173.316 161.474 1.00 125.80 ? 192  ARG B NE    1 
ATOM   6250  C  CZ    . ARG C  1 198  ? 187.918 173.478 162.791 1.00 125.80 ? 192  ARG B CZ    1 
ATOM   6251  N  NH1   . ARG C  1 198  ? 188.383 174.597 163.325 1.00 125.80 ? 192  ARG B NH1   1 
ATOM   6252  N  NH2   . ARG C  1 198  ? 187.434 172.524 163.573 1.00 125.80 ? 192  ARG B NH2   1 
ATOM   6253  N  N     . HIS C  1 199  ? 188.306 173.303 155.817 1.00 120.59 ? 193  HIS B N     1 
ATOM   6254  C  CA    . HIS C  1 199  ? 188.104 174.230 154.706 1.00 120.59 ? 193  HIS B CA    1 
ATOM   6255  C  C     . HIS C  1 199  ? 189.037 173.894 153.548 1.00 120.59 ? 193  HIS B C     1 
ATOM   6256  O  O     . HIS C  1 199  ? 189.600 174.781 152.903 1.00 120.59 ? 193  HIS B O     1 
ATOM   6257  C  CB    . HIS C  1 199  ? 188.304 175.674 155.162 1.00 120.59 ? 193  HIS B CB    1 
ATOM   6258  C  CG    . HIS C  1 199  ? 187.334 176.107 156.213 1.00 120.59 ? 193  HIS B CG    1 
ATOM   6259  N  ND1   . HIS C  1 199  ? 187.513 177.246 156.966 1.00 120.59 ? 193  HIS B ND1   1 
ATOM   6260  C  CD2   . HIS C  1 199  ? 186.173 175.557 156.632 1.00 120.59 ? 193  HIS B CD2   1 
ATOM   6261  C  CE1   . HIS C  1 199  ? 186.507 177.374 157.810 1.00 120.59 ? 193  HIS B CE1   1 
ATOM   6262  N  NE2   . HIS C  1 199  ? 185.678 176.362 157.626 1.00 120.59 ? 193  HIS B NE2   1 
ATOM   6263  N  N     . GLY C  1 200  ? 189.224 172.600 153.298 1.00 125.04 ? 194  GLY B N     1 
ATOM   6264  C  CA    . GLY C  1 200  ? 190.196 172.177 152.316 1.00 125.04 ? 194  GLY B CA    1 
ATOM   6265  C  C     . GLY C  1 200  ? 191.619 172.551 152.642 1.00 125.04 ? 194  GLY B C     1 
ATOM   6266  O  O     . GLY C  1 200  ? 192.495 172.402 151.787 1.00 125.04 ? 194  GLY B O     1 
ATOM   6267  N  N     . ARG C  1 201  ? 191.878 173.041 153.849 1.00 123.10 ? 195  ARG B N     1 
ATOM   6268  C  CA    . ARG C  1 201  ? 193.205 173.470 154.248 1.00 123.10 ? 195  ARG B CA    1 
ATOM   6269  C  C     . ARG C  1 201  ? 193.691 172.624 155.414 1.00 123.10 ? 195  ARG B C     1 
ATOM   6270  O  O     . ARG C  1 201  ? 192.911 172.126 156.228 1.00 123.10 ? 195  ARG B O     1 
ATOM   6271  C  CB    . ARG C  1 201  ? 193.214 174.954 154.621 1.00 123.10 ? 195  ARG B CB    1 
ATOM   6272  C  CG    . ARG C  1 201  ? 192.859 175.857 153.462 1.00 123.10 ? 195  ARG B CG    1 
ATOM   6273  C  CD    . ARG C  1 201  ? 193.914 175.768 152.378 1.00 123.10 ? 195  ARG B CD    1 
ATOM   6274  N  NE    . ARG C  1 201  ? 195.230 176.161 152.870 1.00 123.10 ? 195  ARG B NE    1 
ATOM   6275  C  CZ    . ARG C  1 201  ? 195.663 177.416 152.915 1.00 123.10 ? 195  ARG B CZ    1 
ATOM   6276  N  NH1   . ARG C  1 201  ? 194.884 178.402 152.498 1.00 123.10 ? 195  ARG B NH1   1 
ATOM   6277  N  NH2   . ARG C  1 201  ? 196.875 177.687 153.378 1.00 123.10 ? 195  ARG B NH2   1 
ATOM   6278  N  N     . LEU C  1 202  ? 195.007 172.479 155.478 1.00 114.97 ? 196  LEU B N     1 
ATOM   6279  C  CA    . LEU C  1 202  ? 195.669 171.617 156.446 1.00 114.97 ? 196  LEU B CA    1 
ATOM   6280  C  C     . LEU C  1 202  ? 196.130 172.466 157.621 1.00 114.97 ? 196  LEU B C     1 
ATOM   6281  O  O     . LEU C  1 202  ? 197.161 173.141 157.536 1.00 114.97 ? 196  LEU B O     1 
ATOM   6282  C  CB    . LEU C  1 202  ? 196.845 170.899 155.790 1.00 114.97 ? 196  LEU B CB    1 
ATOM   6283  C  CG    . LEU C  1 202  ? 197.630 169.898 156.621 1.00 114.97 ? 196  LEU B CG    1 
ATOM   6284  C  CD1   . LEU C  1 202  ? 196.718 168.781 157.082 1.00 114.97 ? 196  LEU B CD1   1 
ATOM   6285  C  CD2   . LEU C  1 202  ? 198.768 169.353 155.788 1.00 114.97 ? 196  LEU B CD2   1 
ATOM   6286  N  N     . CYS C  1 203  ? 195.369 172.432 158.711 1.00 118.32 ? 197  CYS B N     1 
ATOM   6287  C  CA    . CYS C  1 203  ? 195.555 173.346 159.828 1.00 118.32 ? 197  CYS B CA    1 
ATOM   6288  C  C     . CYS C  1 203  ? 195.934 172.575 161.084 1.00 118.32 ? 197  CYS B C     1 
ATOM   6289  O  O     . CYS C  1 203  ? 195.327 171.548 161.399 1.00 118.32 ? 197  CYS B O     1 
ATOM   6290  C  CB    . CYS C  1 203  ? 194.288 174.171 160.068 1.00 118.32 ? 197  CYS B CB    1 
ATOM   6291  S  SG    . CYS C  1 203  ? 192.821 173.208 160.491 1.00 118.32 ? 197  CYS B SG    1 
ATOM   6292  N  N     . PHE C  1 204  ? 196.939 173.080 161.791 1.00 113.61 ? 198  PHE B N     1 
ATOM   6293  C  CA    . PHE C  1 204  ? 197.364 172.541 163.076 1.00 113.61 ? 198  PHE B CA    1 
ATOM   6294  C  C     . PHE C  1 204  ? 196.377 172.938 164.164 1.00 113.61 ? 198  PHE B C     1 
ATOM   6295  O  O     . PHE C  1 204  ? 195.961 174.095 164.236 1.00 113.61 ? 198  PHE B O     1 
ATOM   6296  C  CB    . PHE C  1 204  ? 198.755 173.061 163.418 1.00 113.61 ? 198  PHE B CB    1 
ATOM   6297  C  CG    . PHE C  1 204  ? 199.172 172.782 164.818 1.00 113.61 ? 198  PHE B CG    1 
ATOM   6298  C  CD1   . PHE C  1 204  ? 199.580 171.518 165.197 1.00 113.61 ? 198  PHE B CD1   1 
ATOM   6299  C  CD2   . PHE C  1 204  ? 199.151 173.786 165.765 1.00 113.61 ? 198  PHE B CD2   1 
ATOM   6300  C  CE1   . PHE C  1 204  ? 199.967 171.268 166.496 1.00 113.61 ? 198  PHE B CE1   1 
ATOM   6301  C  CE2   . PHE C  1 204  ? 199.536 173.540 167.065 1.00 113.61 ? 198  PHE B CE2   1 
ATOM   6302  C  CZ    . PHE C  1 204  ? 199.946 172.281 167.430 1.00 113.61 ? 198  PHE B CZ    1 
ATOM   6303  N  N     . MET C  1 205  ? 196.022 171.983 165.022 1.00 112.63 ? 199  MET B N     1 
ATOM   6304  C  CA    . MET C  1 205  ? 194.990 172.192 166.026 1.00 112.63 ? 199  MET B CA    1 
ATOM   6305  C  C     . MET C  1 205  ? 195.476 171.720 167.385 1.00 112.63 ? 199  MET B C     1 
ATOM   6306  O  O     . MET C  1 205  ? 196.494 171.033 167.485 1.00 112.63 ? 199  MET B O     1 
ATOM   6307  C  CB    . MET C  1 205  ? 193.704 171.438 165.673 1.00 112.63 ? 199  MET B CB    1 
ATOM   6308  C  CG    . MET C  1 205  ? 193.077 171.845 164.358 1.00 112.63 ? 199  MET B CG    1 
ATOM   6309  S  SD    . MET C  1 205  ? 191.487 171.067 164.062 1.00 112.63 ? 199  MET B SD    1 
ATOM   6310  C  CE    . MET C  1 205  ? 191.999 169.398 163.686 1.00 112.63 ? 199  MET B CE    1 
ATOM   6311  N  N     . LEU C  1 206  ? 194.749 172.114 168.429 1.00 110.66 ? 200  LEU B N     1 
ATOM   6312  C  CA    . LEU C  1 206  ? 194.857 171.516 169.754 1.00 110.66 ? 200  LEU B CA    1 
ATOM   6313  C  C     . LEU C  1 206  ? 193.653 171.945 170.578 1.00 110.66 ? 200  LEU B C     1 
ATOM   6314  O  O     . LEU C  1 206  ? 193.110 173.034 170.395 1.00 110.66 ? 200  LEU B O     1 
ATOM   6315  C  CB    . LEU C  1 206  ? 196.141 171.910 170.497 1.00 110.66 ? 200  LEU B CB    1 
ATOM   6316  C  CG    . LEU C  1 206  ? 196.139 173.311 171.107 1.00 110.66 ? 200  LEU B CG    1 
ATOM   6317  C  CD1   . LEU C  1 206  ? 197.140 173.386 172.228 1.00 110.66 ? 200  LEU B CD1   1 
ATOM   6318  C  CD2   . LEU C  1 206  ? 196.468 174.339 170.053 1.00 110.66 ? 200  LEU B CD2   1 
ATOM   6319  N  N     . ARG C  1 207  ? 193.249 171.085 171.503 1.00 108.42 ? 201  ARG B N     1 
ATOM   6320  C  CA    . ARG C  1 207  ? 192.126 171.366 172.382 1.00 108.42 ? 201  ARG B CA    1 
ATOM   6321  C  C     . ARG C  1 207  ? 192.625 172.037 173.652 1.00 108.42 ? 201  ARG B C     1 
ATOM   6322  O  O     . ARG C  1 207  ? 193.664 171.659 174.201 1.00 108.42 ? 201  ARG B O     1 
ATOM   6323  C  CB    . ARG C  1 207  ? 191.356 170.087 172.723 1.00 108.42 ? 201  ARG B CB    1 
ATOM   6324  C  CG    . ARG C  1 207  ? 190.145 170.283 173.633 1.00 108.42 ? 201  ARG B CG    1 
ATOM   6325  C  CD    . ARG C  1 207  ? 189.375 168.981 173.809 1.00 108.42 ? 201  ARG B CD    1 
ATOM   6326  N  NE    . ARG C  1 207  ? 188.615 168.617 172.615 1.00 108.42 ? 201  ARG B NE    1 
ATOM   6327  C  CZ    . ARG C  1 207  ? 188.094 167.415 172.394 1.00 108.42 ? 201  ARG B CZ    1 
ATOM   6328  N  NH1   . ARG C  1 207  ? 188.271 166.442 173.272 1.00 108.42 ? 201  ARG B NH1   1 
ATOM   6329  N  NH2   . ARG C  1 207  ? 187.409 167.178 171.284 1.00 108.42 ? 201  ARG B NH2   1 
ATOM   6330  N  N     . VAL C  1 208  ? 191.876 173.038 174.107 1.00 105.88 ? 202  VAL B N     1 
ATOM   6331  C  CA    . VAL C  1 208  ? 192.160 173.756 175.341 1.00 105.88 ? 202  VAL B CA    1 
ATOM   6332  C  C     . VAL C  1 208  ? 191.171 173.269 176.383 1.00 105.88 ? 202  VAL B C     1 
ATOM   6333  O  O     . VAL C  1 208  ? 190.094 172.772 176.036 1.00 105.88 ? 202  VAL B O     1 
ATOM   6334  C  CB    . VAL C  1 208  ? 192.041 175.281 175.148 1.00 105.88 ? 202  VAL B CB    1 
ATOM   6335  C  CG1   . VAL C  1 208  ? 190.603 175.662 174.897 1.00 105.88 ? 202  VAL B CG1   1 
ATOM   6336  C  CG2   . VAL C  1 208  ? 192.583 176.030 176.348 1.00 105.88 ? 202  VAL B CG2   1 
ATOM   6337  N  N     . GLY C  1 209  ? 191.530 173.395 177.654 1.00 112.51 ? 203  GLY B N     1 
ATOM   6338  C  CA    . GLY C  1 209  ? 190.628 172.961 178.701 1.00 112.51 ? 203  GLY B CA    1 
ATOM   6339  C  C     . GLY C  1 209  ? 190.706 173.836 179.927 1.00 112.51 ? 203  GLY B C     1 
ATOM   6340  O  O     . GLY C  1 209  ? 191.790 174.149 180.429 1.00 112.51 ? 203  GLY B O     1 
ATOM   6341  N  N     . ASP C  1 210  ? 189.530 174.227 180.408 1.00 122.52 ? 204  ASP B N     1 
ATOM   6342  C  CA    . ASP C  1 210  ? 189.375 174.886 181.694 1.00 122.52 ? 204  ASP B CA    1 
ATOM   6343  C  C     . ASP C  1 210  ? 188.481 174.038 182.583 1.00 122.52 ? 204  ASP B C     1 
ATOM   6344  O  O     . ASP C  1 210  ? 187.367 173.678 182.192 1.00 122.52 ? 204  ASP B O     1 
ATOM   6345  C  CB    . ASP C  1 210  ? 188.768 176.280 181.553 1.00 122.52 ? 204  ASP B CB    1 
ATOM   6346  C  CG    . ASP C  1 210  ? 188.801 177.059 182.849 1.00 122.52 ? 204  ASP B CG    1 
ATOM   6347  O  OD1   . ASP C  1 210  ? 189.341 176.531 183.843 1.00 122.52 ? 204  ASP B OD1   1 
ATOM   6348  O  OD2   . ASP C  1 210  ? 188.280 178.194 182.887 1.00 122.52 ? 204  ASP B OD2   1 
ATOM   6349  N  N     . LEU C  1 211  ? 188.966 173.730 183.783 1.00 125.57 ? 205  LEU B N     1 
ATOM   6350  C  CA    . LEU C  1 211  ? 188.259 172.843 184.692 1.00 125.57 ? 205  LEU B CA    1 
ATOM   6351  C  C     . LEU C  1 211  ? 187.438 173.569 185.743 1.00 125.57 ? 205  LEU B C     1 
ATOM   6352  O  O     . LEU C  1 211  ? 186.486 172.985 186.266 1.00 125.57 ? 205  LEU B O     1 
ATOM   6353  C  CB    . LEU C  1 211  ? 189.245 171.910 185.391 1.00 125.57 ? 205  LEU B CB    1 
ATOM   6354  C  CG    . LEU C  1 211  ? 189.951 170.926 184.472 1.00 125.57 ? 205  LEU B CG    1 
ATOM   6355  C  CD1   . LEU C  1 211  ? 190.944 170.117 185.265 1.00 125.57 ? 205  LEU B CD1   1 
ATOM   6356  C  CD2   . LEU C  1 211  ? 188.938 170.032 183.819 1.00 125.57 ? 205  LEU B CD2   1 
ATOM   6357  N  N     . ARG C  1 212  ? 187.772 174.809 186.067 1.00 127.07 ? 206  ARG B N     1 
ATOM   6358  C  CA    . ARG C  1 212  ? 187.027 175.567 187.057 1.00 127.07 ? 206  ARG B CA    1 
ATOM   6359  C  C     . ARG C  1 212  ? 185.817 176.221 186.410 1.00 127.07 ? 206  ARG B C     1 
ATOM   6360  O  O     . ARG C  1 212  ? 185.874 176.682 185.268 1.00 127.07 ? 206  ARG B O     1 
ATOM   6361  C  CB    . ARG C  1 212  ? 187.896 176.639 187.708 1.00 127.07 ? 206  ARG B CB    1 
ATOM   6362  C  CG    . ARG C  1 212  ? 189.042 176.089 188.513 1.00 127.07 ? 206  ARG B CG    1 
ATOM   6363  C  CD    . ARG C  1 212  ? 188.522 175.372 189.742 1.00 127.07 ? 206  ARG B CD    1 
ATOM   6364  N  NE    . ARG C  1 212  ? 189.606 174.853 190.567 1.00 127.07 ? 206  ARG B NE    1 
ATOM   6365  C  CZ    . ARG C  1 212  ? 190.179 175.534 191.553 1.00 127.07 ? 206  ARG B CZ    1 
ATOM   6366  N  NH1   . ARG C  1 212  ? 189.767 176.759 191.838 1.00 127.07 ? 206  ARG B NH1   1 
ATOM   6367  N  NH2   . ARG C  1 212  ? 191.162 174.988 192.254 1.00 127.07 ? 206  ARG B NH2   1 
ATOM   6368  N  N     . LYS C  1 213  ? 184.712 176.243 187.148 1.00 129.46 ? 207  LYS B N     1 
ATOM   6369  C  CA    . LYS C  1 213  ? 183.563 177.018 186.710 1.00 129.46 ? 207  LYS B CA    1 
ATOM   6370  C  C     . LYS C  1 213  ? 183.826 178.510 186.786 1.00 129.46 ? 207  LYS B C     1 
ATOM   6371  O  O     . LYS C  1 213  ? 183.170 179.278 186.075 1.00 129.46 ? 207  LYS B O     1 
ATOM   6372  C  CB    . LYS C  1 213  ? 182.334 176.665 187.550 1.00 129.46 ? 207  LYS B CB    1 
ATOM   6373  N  N     . SER C  1 214  ? 184.769 178.929 187.624 1.00 135.32 ? 208  SER B N     1 
ATOM   6374  C  CA    . SER C  1 214  ? 185.191 180.320 187.658 1.00 135.32 ? 208  SER B CA    1 
ATOM   6375  C  C     . SER C  1 214  ? 185.756 180.719 186.305 1.00 135.32 ? 208  SER B C     1 
ATOM   6376  O  O     . SER C  1 214  ? 186.431 179.932 185.638 1.00 135.32 ? 208  SER B O     1 
ATOM   6377  C  CB    . SER C  1 214  ? 186.229 180.527 188.756 1.00 135.32 ? 208  SER B CB    1 
ATOM   6378  O  OG    . SER C  1 214  ? 187.396 179.774 188.487 1.00 135.32 ? 208  SER B OG    1 
ATOM   6379  N  N     . MET C  1 215  ? 185.458 181.940 185.887 1.00 129.68 ? 209  MET B N     1 
ATOM   6380  C  CA    . MET C  1 215  ? 185.700 182.307 184.505 1.00 129.68 ? 209  MET B CA    1 
ATOM   6381  C  C     . MET C  1 215  ? 186.977 183.123 184.372 1.00 129.68 ? 209  MET B C     1 
ATOM   6382  O  O     . MET C  1 215  ? 187.336 183.912 185.246 1.00 129.68 ? 209  MET B O     1 
ATOM   6383  C  CB    . MET C  1 215  ? 184.506 183.081 183.953 1.00 129.68 ? 209  MET B CB    1 
ATOM   6384  C  CG    . MET C  1 215  ? 184.530 183.261 182.457 1.00 129.68 ? 209  MET B CG    1 
ATOM   6385  S  SD    . MET C  1 215  ? 184.633 181.638 181.696 1.00 129.68 ? 209  MET B SD    1 
ATOM   6386  C  CE    . MET C  1 215  ? 183.094 180.926 182.261 1.00 129.68 ? 209  MET B CE    1 
ATOM   6387  N  N     . ILE C  1 216  ? 187.668 182.915 183.268 1.00 113.16 ? 210  ILE B N     1 
ATOM   6388  C  CA    . ILE C  1 216  ? 188.832 183.709 182.911 1.00 113.16 ? 210  ILE B CA    1 
ATOM   6389  C  C     . ILE C  1 216  ? 188.366 184.807 181.973 1.00 113.16 ? 210  ILE B C     1 
ATOM   6390  O  O     . ILE C  1 216  ? 187.498 184.585 181.121 1.00 113.16 ? 210  ILE B O     1 
ATOM   6391  C  CB    . ILE C  1 216  ? 189.922 182.834 182.269 1.00 113.16 ? 210  ILE B CB    1 
ATOM   6392  C  CG1   . ILE C  1 216  ? 191.238 183.605 182.150 1.00 113.16 ? 210  ILE B CG1   1 
ATOM   6393  C  CG2   . ILE C  1 216  ? 189.457 182.284 180.932 1.00 113.16 ? 210  ILE B CG2   1 
ATOM   6394  C  CD1   . ILE C  1 216  ? 191.902 183.864 183.477 1.00 113.16 ? 210  ILE B CD1   1 
ATOM   6395  N  N     . ILE C  1 217  ? 188.909 186.007 182.146 1.00 105.15 ? 211  ILE B N     1 
ATOM   6396  C  CA    . ILE C  1 217  ? 188.485 187.172 181.382 1.00 105.15 ? 211  ILE B CA    1 
ATOM   6397  C  C     . ILE C  1 217  ? 189.583 187.523 180.394 1.00 105.15 ? 211  ILE B C     1 
ATOM   6398  O  O     . ILE C  1 217  ? 190.770 187.448 180.725 1.00 105.15 ? 211  ILE B O     1 
ATOM   6399  C  CB    . ILE C  1 217  ? 188.155 188.362 182.298 1.00 105.15 ? 211  ILE B CB    1 
ATOM   6400  C  CG1   . ILE C  1 217  ? 186.902 188.075 183.121 1.00 105.15 ? 211  ILE B CG1   1 
ATOM   6401  C  CG2   . ILE C  1 217  ? 187.940 189.616 181.488 1.00 105.15 ? 211  ILE B CG2   1 
ATOM   6402  C  CD1   . ILE C  1 217  ? 187.172 187.433 184.445 1.00 105.15 ? 211  ILE B CD1   1 
ATOM   6403  N  N     . SER C  1 218  ? 189.182 187.890 179.177 1.00 99.64  ? 212  SER B N     1 
ATOM   6404  C  CA    . SER C  1 218  ? 190.112 188.283 178.124 1.00 99.64  ? 212  SER B CA    1 
ATOM   6405  C  C     . SER C  1 218  ? 191.128 187.181 177.850 1.00 99.64  ? 212  SER B C     1 
ATOM   6406  O  O     . SER C  1 218  ? 192.298 187.445 177.570 1.00 99.64  ? 212  SER B O     1 
ATOM   6407  C  CB    . SER C  1 218  ? 190.812 189.596 178.465 1.00 99.64  ? 212  SER B CB    1 
ATOM   6408  O  OG    . SER C  1 218  ? 191.755 189.931 177.465 1.00 99.64  ? 212  SER B OG    1 
ATOM   6409  N  N     . ALA C  1 219  ? 190.673 185.935 177.945 1.00 102.66 ? 213  ALA B N     1 
ATOM   6410  C  CA    . ALA C  1 219  ? 191.516 184.786 177.655 1.00 102.66 ? 213  ALA B CA    1 
ATOM   6411  C  C     . ALA C  1 219  ? 192.113 184.913 176.263 1.00 102.66 ? 213  ALA B C     1 
ATOM   6412  O  O     . ALA C  1 219  ? 191.390 184.903 175.263 1.00 102.66 ? 213  ALA B O     1 
ATOM   6413  C  CB    . ALA C  1 219  ? 190.715 183.492 177.779 1.00 102.66 ? 213  ALA B CB    1 
ATOM   6414  N  N     . THR C  1 220  ? 193.434 185.034 176.196 1.00 101.19 ? 214  THR B N     1 
ATOM   6415  C  CA    . THR C  1 220  ? 194.138 185.340 174.963 1.00 101.19 ? 214  THR B CA    1 
ATOM   6416  C  C     . THR C  1 220  ? 195.167 184.256 174.685 1.00 101.19 ? 214  THR B C     1 
ATOM   6417  O  O     . THR C  1 220  ? 195.845 183.788 175.605 1.00 101.19 ? 214  THR B O     1 
ATOM   6418  C  CB    . THR C  1 220  ? 194.802 186.707 175.062 1.00 101.19 ? 214  THR B CB    1 
ATOM   6419  O  OG1   . THR C  1 220  ? 193.803 187.682 175.372 1.00 101.19 ? 214  THR B OG1   1 
ATOM   6420  C  CG2   . THR C  1 220  ? 195.450 187.072 173.753 1.00 101.19 ? 214  THR B CG2   1 
ATOM   6421  N  N     . ILE C  1 221  ? 195.272 183.856 173.422 1.00 95.22  ? 215  ILE B N     1 
ATOM   6422  C  CA    . ILE C  1 221  ? 196.129 182.753 173.003 1.00 95.22  ? 215  ILE B CA    1 
ATOM   6423  C  C     . ILE C  1 221  ? 197.304 183.308 172.223 1.00 95.22  ? 215  ILE B C     1 
ATOM   6424  O  O     . ILE C  1 221  ? 197.124 184.120 171.309 1.00 95.22  ? 215  ILE B O     1 
ATOM   6425  C  CB    . ILE C  1 221  ? 195.351 181.744 172.144 1.00 95.22  ? 215  ILE B CB    1 
ATOM   6426  C  CG1   . ILE C  1 221  ? 194.249 181.080 172.964 1.00 95.22  ? 215  ILE B CG1   1 
ATOM   6427  C  CG2   . ILE C  1 221  ? 196.291 180.711 171.552 1.00 95.22  ? 215  ILE B CG2   1 
ATOM   6428  C  CD1   . ILE C  1 221  ? 194.780 180.244 174.091 1.00 95.22  ? 215  ILE B CD1   1 
ATOM   6429  N  N     . HIS C  1 222  ? 198.501 182.856 172.558 1.00 94.69  ? 216  HIS B N     1 
ATOM   6430  C  CA    . HIS C  1 222  ? 199.687 183.159 171.767 1.00 94.69  ? 216  HIS B CA    1 
ATOM   6431  C  C     . HIS C  1 222  ? 200.417 181.856 171.492 1.00 94.69  ? 216  HIS B C     1 
ATOM   6432  O  O     . HIS C  1 222  ? 201.349 181.491 172.215 1.00 94.69  ? 216  HIS B O     1 
ATOM   6433  C  CB    . HIS C  1 222  ? 200.583 184.154 172.479 1.00 94.69  ? 216  HIS B CB    1 
ATOM   6434  C  CG    . HIS C  1 222  ? 199.985 185.515 172.589 1.00 94.69  ? 216  HIS B CG    1 
ATOM   6435  N  ND1   . HIS C  1 222  ? 199.142 185.876 173.615 1.00 94.69  ? 216  HIS B ND1   1 
ATOM   6436  C  CD2   . HIS C  1 222  ? 200.104 186.607 171.797 1.00 94.69  ? 216  HIS B CD2   1 
ATOM   6437  C  CE1   . HIS C  1 222  ? 198.769 187.132 173.454 1.00 94.69  ? 216  HIS B CE1   1 
ATOM   6438  N  NE2   . HIS C  1 222  ? 199.337 187.598 172.358 1.00 94.69  ? 216  HIS B NE2   1 
ATOM   6439  N  N     . MET C  1 223  ? 199.998 181.157 170.448 1.00 101.75 ? 217  MET B N     1 
ATOM   6440  C  CA    . MET C  1 223  ? 200.775 180.035 169.962 1.00 101.75 ? 217  MET B CA    1 
ATOM   6441  C  C     . MET C  1 223  ? 202.065 180.572 169.368 1.00 101.75 ? 217  MET B C     1 
ATOM   6442  O  O     . MET C  1 223  ? 202.069 181.596 168.681 1.00 101.75 ? 217  MET B O     1 
ATOM   6443  C  CB    . MET C  1 223  ? 199.985 179.243 168.925 1.00 101.75 ? 217  MET B CB    1 
ATOM   6444  C  CG    . MET C  1 223  ? 198.724 178.614 169.482 1.00 101.75 ? 217  MET B CG    1 
ATOM   6445  S  SD    . MET C  1 223  ? 197.906 177.525 168.306 1.00 101.75 ? 217  MET B SD    1 
ATOM   6446  C  CE    . MET C  1 223  ? 197.235 178.711 167.158 1.00 101.75 ? 217  MET B CE    1 
ATOM   6447  N  N     . GLN C  1 224  ? 203.170 179.889 169.644 1.00 105.51 ? 218  GLN B N     1 
ATOM   6448  C  CA    . GLN C  1 224  ? 204.466 180.436 169.269 1.00 105.51 ? 218  GLN B CA    1 
ATOM   6449  C  C     . GLN C  1 224  ? 205.411 179.270 168.998 1.00 105.51 ? 218  GLN B C     1 
ATOM   6450  O  O     . GLN C  1 224  ? 205.771 178.537 169.920 1.00 105.51 ? 218  GLN B O     1 
ATOM   6451  C  CB    . GLN C  1 224  ? 204.986 181.344 170.361 1.00 105.51 ? 218  GLN B CB    1 
ATOM   6452  C  CG    . GLN C  1 224  ? 206.261 182.063 170.042 1.00 105.51 ? 218  GLN B CG    1 
ATOM   6453  C  CD    . GLN C  1 224  ? 206.612 183.044 171.132 1.00 105.51 ? 218  GLN B CD    1 
ATOM   6454  O  OE1   . GLN C  1 224  ? 205.906 183.140 172.134 1.00 105.51 ? 218  GLN B OE1   1 
ATOM   6455  N  NE2   . GLN C  1 224  ? 207.687 183.791 170.943 1.00 105.51 ? 218  GLN B NE2   1 
ATOM   6456  N  N     . VAL C  1 225  ? 205.791 179.109 167.738 1.00 103.81 ? 219  VAL B N     1 
ATOM   6457  C  CA    . VAL C  1 225  ? 206.683 178.028 167.343 1.00 103.81 ? 219  VAL B CA    1 
ATOM   6458  C  C     . VAL C  1 225  ? 208.121 178.447 167.600 1.00 103.81 ? 219  VAL B C     1 
ATOM   6459  O  O     . VAL C  1 225  ? 208.510 179.597 167.361 1.00 103.81 ? 219  VAL B O     1 
ATOM   6460  C  CB    . VAL C  1 225  ? 206.457 177.651 165.870 1.00 103.81 ? 219  VAL B CB    1 
ATOM   6461  C  CG1   . VAL C  1 225  ? 206.732 178.835 164.966 1.00 103.81 ? 219  VAL B CG1   1 
ATOM   6462  C  CG2   . VAL C  1 225  ? 207.338 176.479 165.489 1.00 103.81 ? 219  VAL B CG2   1 
ATOM   6463  N  N     . VAL C  1 226  ? 208.916 177.517 168.116 1.00 105.94 ? 220  VAL B N     1 
ATOM   6464  C  CA    . VAL C  1 226  ? 210.298 177.788 168.476 1.00 105.94 ? 220  VAL B CA    1 
ATOM   6465  C  C     . VAL C  1 226  ? 211.185 176.692 167.914 1.00 105.94 ? 220  VAL B C     1 
ATOM   6466  O  O     . VAL C  1 226  ? 210.852 175.504 167.982 1.00 105.94 ? 220  VAL B O     1 
ATOM   6467  C  CB    . VAL C  1 226  ? 210.477 177.911 170.000 1.00 105.94 ? 220  VAL B CB    1 
ATOM   6468  C  CG1   . VAL C  1 226  ? 209.725 179.119 170.511 1.00 105.94 ? 220  VAL B CG1   1 
ATOM   6469  C  CG2   . VAL C  1 226  ? 209.992 176.660 170.697 1.00 105.94 ? 220  VAL B CG2   1 
ATOM   6470  N  N     . ARG C  1 227  ? 212.310 177.099 167.343 1.00 107.07 ? 221  ARG B N     1 
ATOM   6471  C  CA    . ARG C  1 227  ? 213.311 176.160 166.869 1.00 107.07 ? 221  ARG B CA    1 
ATOM   6472  C  C     . ARG C  1 227  ? 214.604 176.928 166.671 1.00 107.07 ? 221  ARG B C     1 
ATOM   6473  O  O     . ARG C  1 227  ? 214.666 178.143 166.865 1.00 107.07 ? 221  ARG B O     1 
ATOM   6474  C  CB    . ARG C  1 227  ? 212.899 175.479 165.565 1.00 107.07 ? 221  ARG B CB    1 
ATOM   6475  C  CG    . ARG C  1 227  ? 213.074 176.369 164.358 1.00 107.07 ? 221  ARG B CG    1 
ATOM   6476  C  CD    . ARG C  1 227  ? 212.686 175.681 163.068 1.00 107.07 ? 221  ARG B CD    1 
ATOM   6477  N  NE    . ARG C  1 227  ? 211.241 175.547 162.916 1.00 107.07 ? 221  ARG B NE    1 
ATOM   6478  C  CZ    . ARG C  1 227  ? 210.663 174.893 161.918 1.00 107.07 ? 221  ARG B CZ    1 
ATOM   6479  N  NH1   . ARG C  1 227  ? 211.410 174.315 160.988 1.00 107.07 ? 221  ARG B NH1   1 
ATOM   6480  N  NH2   . ARG C  1 227  ? 209.343 174.820 161.844 1.00 107.07 ? 221  ARG B NH2   1 
ATOM   6481  N  N     . LYS C  1 228  ? 215.634 176.202 166.266 1.00 120.75 ? 222  LYS B N     1 
ATOM   6482  C  CA    . LYS C  1 228  ? 216.927 176.784 165.937 1.00 120.75 ? 222  LYS B CA    1 
ATOM   6483  C  C     . LYS C  1 228  ? 216.919 177.064 164.443 1.00 120.75 ? 222  LYS B C     1 
ATOM   6484  O  O     . LYS C  1 228  ? 217.388 176.249 163.645 1.00 120.75 ? 222  LYS B O     1 
ATOM   6485  C  CB    . LYS C  1 228  ? 218.050 175.836 166.336 1.00 120.75 ? 222  LYS B CB    1 
ATOM   6486  C  CG    . LYS C  1 228  ? 219.437 176.397 166.176 1.00 120.75 ? 222  LYS B CG    1 
ATOM   6487  C  CD    . LYS C  1 228  ? 220.469 175.398 166.664 1.00 120.75 ? 222  LYS B CD    1 
ATOM   6488  C  CE    . LYS C  1 228  ? 221.888 175.908 166.475 1.00 120.75 ? 222  LYS B CE    1 
ATOM   6489  N  NZ    . LYS C  1 228  ? 222.887 174.914 166.960 1.00 120.75 ? 222  LYS B NZ    1 
ATOM   6490  N  N     . THR C  1 229  ? 216.378 178.213 164.059 1.00 112.78 ? 223  THR B N     1 
ATOM   6491  C  CA    . THR C  1 229  ? 216.249 178.554 162.653 1.00 112.78 ? 223  THR B CA    1 
ATOM   6492  C  C     . THR C  1 229  ? 217.283 179.597 162.259 1.00 112.78 ? 223  THR B C     1 
ATOM   6493  O  O     . THR C  1 229  ? 217.993 180.161 163.095 1.00 112.78 ? 223  THR B O     1 
ATOM   6494  C  CB    . THR C  1 229  ? 214.846 179.065 162.336 1.00 112.78 ? 223  THR B CB    1 
ATOM   6495  O  OG1   . THR C  1 229  ? 214.687 179.148 160.918 1.00 112.78 ? 223  THR B OG1   1 
ATOM   6496  C  CG2   . THR C  1 229  ? 214.665 180.437 162.917 1.00 112.78 ? 223  THR B CG2   1 
ATOM   6497  N  N     . THR C  1 230  ? 217.344 179.867 160.958 1.00 118.29 ? 224  THR B N     1 
ATOM   6498  C  CA    . THR C  1 230  ? 218.433 180.632 160.376 1.00 118.29 ? 224  THR B CA    1 
ATOM   6499  C  C     . THR C  1 230  ? 217.903 181.585 159.315 1.00 118.29 ? 224  THR B C     1 
ATOM   6500  O  O     . THR C  1 230  ? 217.034 181.217 158.520 1.00 118.29 ? 224  THR B O     1 
ATOM   6501  C  CB    . THR C  1 230  ? 219.470 179.693 159.768 1.00 118.29 ? 224  THR B CB    1 
ATOM   6502  O  OG1   . THR C  1 230  ? 219.927 178.782 160.776 1.00 118.29 ? 224  THR B OG1   1 
ATOM   6503  C  CG2   . THR C  1 230  ? 220.652 180.473 159.239 1.00 118.29 ? 224  THR B CG2   1 
ATOM   6504  N  N     . SER C  1 231  ? 218.425 182.809 159.315 1.00 119.32 ? 225  SER B N     1 
ATOM   6505  C  CA    . SER C  1 231  ? 218.136 183.760 158.260 1.00 119.32 ? 225  SER B CA    1 
ATOM   6506  C  C     . SER C  1 231  ? 218.833 183.329 156.973 1.00 119.32 ? 225  SER B C     1 
ATOM   6507  O  O     . SER C  1 231  ? 219.753 182.510 157.000 1.00 119.32 ? 225  SER B O     1 
ATOM   6508  C  CB    . SER C  1 231  ? 218.608 185.154 158.661 1.00 119.32 ? 225  SER B CB    1 
ATOM   6509  O  OG    . SER C  1 231  ? 220.022 185.210 158.691 1.00 119.32 ? 225  SER B OG    1 
ATOM   6510  N  N     . PRO C  1 232  ? 218.414 183.866 155.825 1.00 124.79 ? 226  PRO B N     1 
ATOM   6511  C  CA    . PRO C  1 232  ? 219.170 183.595 154.595 1.00 124.79 ? 226  PRO B CA    1 
ATOM   6512  C  C     . PRO C  1 232  ? 220.610 184.051 154.682 1.00 124.79 ? 226  PRO B C     1 
ATOM   6513  O  O     . PRO C  1 232  ? 221.499 183.371 154.159 1.00 124.79 ? 226  PRO B O     1 
ATOM   6514  C  CB    . PRO C  1 232  ? 218.399 184.380 153.524 1.00 124.79 ? 226  PRO B CB    1 
ATOM   6515  C  CG    . PRO C  1 232  ? 217.032 184.552 154.086 1.00 124.79 ? 226  PRO B CG    1 
ATOM   6516  C  CD    . PRO C  1 232  ? 217.228 184.699 155.564 1.00 124.79 ? 226  PRO B CD    1 
ATOM   6517  N  N     . GLU C  1 233  ? 220.869 185.174 155.346 1.00 119.26 ? 227  GLU B N     1 
ATOM   6518  C  CA    . GLU C  1 233  ? 222.224 185.697 155.447 1.00 119.26 ? 227  GLU B CA    1 
ATOM   6519  C  C     . GLU C  1 233  ? 223.111 184.770 156.263 1.00 119.26 ? 227  GLU B C     1 
ATOM   6520  O  O     . GLU C  1 233  ? 224.339 184.809 156.139 1.00 119.26 ? 227  GLU B O     1 
ATOM   6521  C  CB    . GLU C  1 233  ? 222.188 187.098 156.051 1.00 119.26 ? 227  GLU B CB    1 
ATOM   6522  C  CG    . GLU C  1 233  ? 221.519 188.119 155.151 1.00 119.26 ? 227  GLU B CG    1 
ATOM   6523  C  CD    . GLU C  1 233  ? 220.005 188.039 155.206 1.00 119.26 ? 227  GLU B CD    1 
ATOM   6524  O  OE1   . GLU C  1 233  ? 219.476 187.211 155.974 1.00 119.26 ? 227  GLU B OE1   1 
ATOM   6525  O  OE2   . GLU C  1 233  ? 219.341 188.803 154.479 1.00 119.26 ? 227  GLU B OE2   1 
ATOM   6526  N  N     . GLY C  1 234  ? 222.510 183.942 157.108 1.00 116.80 ? 228  GLY B N     1 
ATOM   6527  C  CA    . GLY C  1 234  ? 223.269 182.893 157.747 1.00 116.80 ? 228  GLY B CA    1 
ATOM   6528  C  C     . GLY C  1 234  ? 223.171 182.816 159.254 1.00 116.80 ? 228  GLY B C     1 
ATOM   6529  O  O     . GLY C  1 234  ? 223.461 181.763 159.828 1.00 116.80 ? 228  GLY B O     1 
ATOM   6530  N  N     . GLU C  1 235  ? 222.785 183.899 159.920 1.00 113.62 ? 229  GLU B N     1 
ATOM   6531  C  CA    . GLU C  1 235  ? 222.756 183.878 161.373 1.00 113.62 ? 229  GLU B CA    1 
ATOM   6532  C  C     . GLU C  1 235  ? 221.700 182.908 161.878 1.00 113.62 ? 229  GLU B C     1 
ATOM   6533  O  O     . GLU C  1 235  ? 220.559 182.897 161.410 1.00 113.62 ? 229  GLU B O     1 
ATOM   6534  C  CB    . GLU C  1 235  ? 222.506 185.268 161.953 1.00 113.62 ? 229  GLU B CB    1 
ATOM   6535  C  CG    . GLU C  1 235  ? 221.224 185.917 161.522 1.00 113.62 ? 229  GLU B CG    1 
ATOM   6536  C  CD    . GLU C  1 235  ? 220.981 187.210 162.256 1.00 113.62 ? 229  GLU B CD    1 
ATOM   6537  O  OE1   . GLU C  1 235  ? 221.757 187.516 163.184 1.00 113.62 ? 229  GLU B OE1   1 
ATOM   6538  O  OE2   . GLU C  1 235  ? 220.027 187.930 161.894 1.00 113.62 ? 229  GLU B OE2   1 
ATOM   6539  N  N     . VAL C  1 236  ? 222.102 182.078 162.828 1.00 108.07 ? 230  VAL B N     1 
ATOM   6540  C  CA    . VAL C  1 236  ? 221.223 181.120 163.478 1.00 108.07 ? 230  VAL B CA    1 
ATOM   6541  C  C     . VAL C  1 236  ? 221.106 181.510 164.942 1.00 108.07 ? 230  VAL B C     1 
ATOM   6542  O  O     . VAL C  1 236  ? 222.076 181.971 165.553 1.00 108.07 ? 230  VAL B O     1 
ATOM   6543  C  CB    . VAL C  1 236  ? 221.744 179.674 163.325 1.00 108.07 ? 230  VAL B CB    1 
ATOM   6544  C  CG1   . VAL C  1 236  ? 223.086 179.504 164.019 1.00 108.07 ? 230  VAL B CG1   1 
ATOM   6545  C  CG2   . VAL C  1 236  ? 220.743 178.694 163.876 1.00 108.07 ? 230  VAL B CG2   1 
ATOM   6546  N  N     . VAL C  1 237  ? 219.910 181.357 165.494 1.00 112.39 ? 231  VAL B N     1 
ATOM   6547  C  CA    . VAL C  1 237  ? 219.712 181.606 166.915 1.00 112.39 ? 231  VAL B CA    1 
ATOM   6548  C  C     . VAL C  1 237  ? 219.095 180.357 167.528 1.00 112.39 ? 231  VAL B C     1 
ATOM   6549  O  O     . VAL C  1 237  ? 218.180 179.762 166.942 1.00 112.39 ? 231  VAL B O     1 
ATOM   6550  C  CB    . VAL C  1 237  ? 218.866 182.865 167.146 1.00 112.39 ? 231  VAL B CB    1 
ATOM   6551  C  CG1   . VAL C  1 237  ? 219.639 184.083 166.687 1.00 112.39 ? 231  VAL B CG1   1 
ATOM   6552  C  CG2   . VAL C  1 237  ? 217.575 182.774 166.379 1.00 112.39 ? 231  VAL B CG2   1 
ATOM   6553  N  N     . PRO C  1 238  ? 219.591 179.906 168.676 1.00 119.52 ? 232  PRO B N     1 
ATOM   6554  C  CA    . PRO C  1 238  ? 219.201 178.588 169.192 1.00 119.52 ? 232  PRO B CA    1 
ATOM   6555  C  C     . PRO C  1 238  ? 217.712 178.458 169.434 1.00 119.52 ? 232  PRO B C     1 
ATOM   6556  O  O     . PRO C  1 238  ? 217.054 177.593 168.857 1.00 119.52 ? 232  PRO B O     1 
ATOM   6557  C  CB    . PRO C  1 238  ? 219.985 178.486 170.505 1.00 119.52 ? 232  PRO B CB    1 
ATOM   6558  C  CG    . PRO C  1 238  ? 221.119 179.438 170.346 1.00 119.52 ? 232  PRO B CG    1 
ATOM   6559  C  CD    . PRO C  1 238  ? 220.575 180.573 169.542 1.00 119.52 ? 232  PRO B CD    1 
ATOM   6560  N  N     . LEU C  1 239  ? 217.171 179.306 170.302 1.00 117.00 ? 233  LEU B N     1 
ATOM   6561  C  CA    . LEU C  1 239  ? 215.733 179.312 170.564 1.00 117.00 ? 233  LEU B CA    1 
ATOM   6562  C  C     . LEU C  1 239  ? 215.102 180.508 169.859 1.00 117.00 ? 233  LEU B C     1 
ATOM   6563  O  O     . LEU C  1 239  ? 214.786 181.537 170.458 1.00 117.00 ? 233  LEU B O     1 
ATOM   6564  C  CB    . LEU C  1 239  ? 215.467 179.328 172.062 1.00 117.00 ? 233  LEU B CB    1 
ATOM   6565  C  CG    . LEU C  1 239  ? 215.861 178.035 172.776 1.00 117.00 ? 233  LEU B CG    1 
ATOM   6566  C  CD1   . LEU C  1 239  ? 215.798 178.198 174.277 1.00 117.00 ? 233  LEU B CD1   1 
ATOM   6567  C  CD2   . LEU C  1 239  ? 214.960 176.902 172.327 1.00 117.00 ? 233  LEU B CD2   1 
ATOM   6568  N  N     . HIS C  1 240  ? 214.931 180.366 168.549 1.00 105.37 ? 234  HIS B N     1 
ATOM   6569  C  CA    . HIS C  1 240  ? 214.197 181.375 167.805 1.00 105.37 ? 234  HIS B CA    1 
ATOM   6570  C  C     . HIS C  1 240  ? 212.710 181.198 168.055 1.00 105.37 ? 234  HIS B C     1 
ATOM   6571  O  O     . HIS C  1 240  ? 212.241 180.086 168.308 1.00 105.37 ? 234  HIS B O     1 
ATOM   6572  C  CB    . HIS C  1 240  ? 214.476 181.294 166.315 1.00 105.37 ? 234  HIS B CB    1 
ATOM   6573  C  CG    . HIS C  1 240  ? 213.800 182.381 165.546 1.00 105.37 ? 234  HIS B CG    1 
ATOM   6574  N  ND1   . HIS C  1 240  ? 214.247 183.683 165.558 1.00 105.37 ? 234  HIS B ND1   1 
ATOM   6575  C  CD2   . HIS C  1 240  ? 212.680 182.372 164.788 1.00 105.37 ? 234  HIS B CD2   1 
ATOM   6576  C  CE1   . HIS C  1 240  ? 213.450 184.426 164.812 1.00 105.37 ? 234  HIS B CE1   1 
ATOM   6577  N  NE2   . HIS C  1 240  ? 212.491 183.655 164.333 1.00 105.37 ? 234  HIS B NE2   1 
ATOM   6578  N  N     . GLN C  1 241  ? 211.968 182.295 167.975 1.00 111.15 ? 235  GLN B N     1 
ATOM   6579  C  CA    . GLN C  1 241  ? 210.581 182.337 168.402 1.00 111.15 ? 235  GLN B CA    1 
ATOM   6580  C  C     . GLN C  1 241  ? 209.758 183.089 167.371 1.00 111.15 ? 235  GLN B C     1 
ATOM   6581  O  O     . GLN C  1 241  ? 210.028 184.262 167.095 1.00 111.15 ? 235  GLN B O     1 
ATOM   6582  C  CB    . GLN C  1 241  ? 210.478 183.019 169.763 1.00 111.15 ? 235  GLN B CB    1 
ATOM   6583  C  CG    . GLN C  1 241  ? 211.250 182.319 170.858 1.00 111.15 ? 235  GLN B CG    1 
ATOM   6584  C  CD    . GLN C  1 241  ? 211.211 183.076 172.162 1.00 111.15 ? 235  GLN B CD    1 
ATOM   6585  O  OE1   . GLN C  1 241  ? 210.638 184.160 172.243 1.00 111.15 ? 235  GLN B OE1   1 
ATOM   6586  N  NE2   . GLN C  1 241  ? 211.833 182.517 173.190 1.00 111.15 ? 235  GLN B NE2   1 
ATOM   6587  N  N     . VAL C  1 242  ? 208.758 182.422 166.803 1.00 97.11  ? 236  VAL B N     1 
ATOM   6588  C  CA    . VAL C  1 242  ? 207.878 183.036 165.818 1.00 97.11  ? 236  VAL B CA    1 
ATOM   6589  C  C     . VAL C  1 242  ? 206.452 182.915 166.314 1.00 97.11  ? 236  VAL B C     1 
ATOM   6590  O  O     . VAL C  1 242  ? 205.949 181.802 166.509 1.00 97.11  ? 236  VAL B O     1 
ATOM   6591  C  CB    . VAL C  1 242  ? 208.013 182.395 164.433 1.00 97.11  ? 236  VAL B CB    1 
ATOM   6592  C  CG1   . VAL C  1 242  ? 207.010 183.017 163.490 1.00 97.11  ? 236  VAL B CG1   1 
ATOM   6593  C  CG2   . VAL C  1 242  ? 209.410 182.578 163.912 1.00 97.11  ? 236  VAL B CG2   1 
ATOM   6594  N  N     . ASP C  1 243  ? 205.800 184.052 166.513 1.00 103.50 ? 237  ASP B N     1 
ATOM   6595  C  CA    . ASP C  1 243  ? 204.417 184.061 166.970 1.00 103.50 ? 237  ASP B CA    1 
ATOM   6596  C  C     . ASP C  1 243  ? 203.519 183.567 165.846 1.00 103.50 ? 237  ASP B C     1 
ATOM   6597  O  O     . ASP C  1 243  ? 203.249 184.296 164.888 1.00 103.50 ? 237  ASP B O     1 
ATOM   6598  C  CB    . ASP C  1 243  ? 204.028 185.465 167.414 1.00 103.50 ? 237  ASP B CB    1 
ATOM   6599  C  CG    . ASP C  1 243  ? 204.758 185.894 168.664 1.00 103.50 ? 237  ASP B CG    1 
ATOM   6600  O  OD1   . ASP C  1 243  ? 205.094 185.018 169.483 1.00 103.50 ? 237  ASP B OD1   1 
ATOM   6601  O  OD2   . ASP C  1 243  ? 205.002 187.106 168.830 1.00 103.50 ? 237  ASP B OD2   1 
ATOM   6602  N  N     . ILE C  1 244  ? 203.066 182.326 165.954 1.00 101.61 ? 238  ILE B N     1 
ATOM   6603  C  CA    . ILE C  1 244  ? 202.203 181.749 164.932 1.00 101.61 ? 238  ILE B CA    1 
ATOM   6604  C  C     . ILE C  1 244  ? 200.761 182.121 165.253 1.00 101.61 ? 238  ILE B C     1 
ATOM   6605  O  O     . ILE C  1 244  ? 200.256 181.802 166.339 1.00 101.61 ? 238  ILE B O     1 
ATOM   6606  C  CB    . ILE C  1 244  ? 202.426 180.233 164.820 1.00 101.61 ? 238  ILE B CB    1 
ATOM   6607  C  CG1   . ILE C  1 244  ? 201.585 179.640 163.695 1.00 101.61 ? 238  ILE B CG1   1 
ATOM   6608  C  CG2   . ILE C  1 244  ? 202.201 179.524 166.145 1.00 101.61 ? 238  ILE B CG2   1 
ATOM   6609  C  CD1   . ILE C  1 244  ? 202.009 178.252 163.322 1.00 101.61 ? 238  ILE B CD1   1 
ATOM   6610  N  N     . PRO C  1 245  ? 200.073 182.816 164.353 1.00 95.92  ? 239  PRO B N     1 
ATOM   6611  C  CA    . PRO C  1 245  ? 198.766 183.386 164.702 1.00 95.92  ? 239  PRO B CA    1 
ATOM   6612  C  C     . PRO C  1 245  ? 197.665 182.345 164.700 1.00 95.92  ? 239  PRO B C     1 
ATOM   6613  O  O     . PRO C  1 245  ? 197.574 181.510 163.799 1.00 95.92  ? 239  PRO B O     1 
ATOM   6614  C  CB    . PRO C  1 245  ? 198.539 184.432 163.606 1.00 95.92  ? 239  PRO B CB    1 
ATOM   6615  C  CG    . PRO C  1 245  ? 199.307 183.916 162.448 1.00 95.92  ? 239  PRO B CG    1 
ATOM   6616  C  CD    . PRO C  1 245  ? 200.521 183.234 163.016 1.00 95.92  ? 239  PRO B CD    1 
ATOM   6617  N  N     . MET C  1 246  ? 196.812 182.413 165.717 1.00 102.58 ? 240  MET B N     1 
ATOM   6618  C  CA    . MET C  1 246  ? 195.644 181.552 165.750 1.00 102.58 ? 240  MET B CA    1 
ATOM   6619  C  C     . MET C  1 246  ? 194.622 182.028 164.731 1.00 102.58 ? 240  MET B C     1 
ATOM   6620  O  O     . MET C  1 246  ? 194.465 183.226 164.485 1.00 102.58 ? 240  MET B O     1 
ATOM   6621  C  CB    . MET C  1 246  ? 195.009 181.526 167.139 1.00 102.58 ? 240  MET B CB    1 
ATOM   6622  C  CG    . MET C  1 246  ? 194.385 182.837 167.568 1.00 102.58 ? 240  MET B CG    1 
ATOM   6623  S  SD    . MET C  1 246  ? 193.541 182.709 169.153 1.00 102.58 ? 240  MET B SD    1 
ATOM   6624  C  CE    . MET C  1 246  ? 192.099 181.767 168.683 1.00 102.58 ? 240  MET B CE    1 
ATOM   6625  N  N     . GLU C  1 247  ? 193.926 181.073 164.131 1.00 111.49 ? 241  GLU B N     1 
ATOM   6626  C  CA    . GLU C  1 247  ? 192.887 181.405 163.170 1.00 111.49 ? 241  GLU B CA    1 
ATOM   6627  C  C     . GLU C  1 247  ? 191.627 181.820 163.912 1.00 111.49 ? 241  GLU B C     1 
ATOM   6628  O  O     . GLU C  1 247  ? 190.910 180.976 164.459 1.00 111.49 ? 241  GLU B O     1 
ATOM   6629  C  CB    . GLU C  1 247  ? 192.611 180.221 162.254 1.00 111.49 ? 241  GLU B CB    1 
ATOM   6630  C  CG    . GLU C  1 247  ? 191.532 180.507 161.236 1.00 111.49 ? 241  GLU B CG    1 
ATOM   6631  C  CD    . GLU C  1 247  ? 191.934 181.588 160.259 1.00 111.49 ? 241  GLU B CD    1 
ATOM   6632  O  OE1   . GLU C  1 247  ? 193.150 181.753 160.014 1.00 111.49 ? 241  GLU B OE1   1 
ATOM   6633  O  OE2   . GLU C  1 247  ? 191.035 182.280 159.736 1.00 111.49 ? 241  GLU B OE2   1 
ATOM   6634  N  N     . ASN C  1 248  ? 191.357 183.119 163.928 1.00 114.80 ? 242  ASN B N     1 
ATOM   6635  C  CA    . ASN C  1 248  ? 190.178 183.650 164.588 1.00 114.80 ? 242  ASN B CA    1 
ATOM   6636  C  C     . ASN C  1 248  ? 189.383 184.472 163.588 1.00 114.80 ? 242  ASN B C     1 
ATOM   6637  O  O     . ASN C  1 248  ? 189.942 185.244 162.808 1.00 114.80 ? 242  ASN B O     1 
ATOM   6638  C  CB    . ASN C  1 248  ? 190.546 184.504 165.802 1.00 114.80 ? 242  ASN B CB    1 
ATOM   6639  C  CG    . ASN C  1 248  ? 189.343 184.859 166.639 1.00 114.80 ? 242  ASN B CG    1 
ATOM   6640  O  OD1   . ASN C  1 248  ? 188.218 184.490 166.309 1.00 114.80 ? 242  ASN B OD1   1 
ATOM   6641  N  ND2   . ASN C  1 248  ? 189.571 185.576 167.732 1.00 114.80 ? 242  ASN B ND2   1 
ATOM   6642  N  N     . GLY C  1 249  ? 188.060 184.294 163.624 1.00 111.87 ? 243  GLY B N     1 
ATOM   6643  C  CA    . GLY C  1 249  ? 187.202 184.963 162.664 1.00 111.87 ? 243  GLY B CA    1 
ATOM   6644  C  C     . GLY C  1 249  ? 187.430 186.457 162.611 1.00 111.87 ? 243  GLY B C     1 
ATOM   6645  O  O     . GLY C  1 249  ? 187.345 187.066 161.542 1.00 111.87 ? 243  GLY B O     1 
ATOM   6646  N  N     . VAL C  1 250  ? 187.732 187.066 163.749 1.00 109.68 ? 244  VAL B N     1 
ATOM   6647  C  CA    . VAL C  1 250  ? 188.143 188.463 163.773 1.00 109.68 ? 244  VAL B CA    1 
ATOM   6648  C  C     . VAL C  1 250  ? 189.594 188.605 163.349 1.00 109.68 ? 244  VAL B C     1 
ATOM   6649  O  O     . VAL C  1 250  ? 189.967 189.559 162.664 1.00 109.68 ? 244  VAL B O     1 
ATOM   6650  C  CB    . VAL C  1 250  ? 187.908 189.050 165.181 1.00 109.68 ? 244  VAL B CB    1 
ATOM   6651  C  CG1   . VAL C  1 250  ? 188.420 190.477 165.258 1.00 109.68 ? 244  VAL B CG1   1 
ATOM   6652  C  CG2   . VAL C  1 250  ? 186.438 188.985 165.542 1.00 109.68 ? 244  VAL B CG2   1 
ATOM   6653  N  N     . GLY C  1 251  ? 190.419 187.640 163.733 1.00 107.79 ? 245  GLY B N     1 
ATOM   6654  C  CA    . GLY C  1 251  ? 191.853 187.724 163.565 1.00 107.79 ? 245  GLY B CA    1 
ATOM   6655  C  C     . GLY C  1 251  ? 192.598 187.954 164.854 1.00 107.79 ? 245  GLY B C     1 
ATOM   6656  O  O     . GLY C  1 251  ? 193.812 187.709 164.905 1.00 107.79 ? 245  GLY B O     1 
ATOM   6657  N  N     . GLY C  1 252  ? 191.921 188.404 165.906 1.00 111.23 ? 246  GLY B N     1 
ATOM   6658  C  CA    . GLY C  1 252  ? 192.571 188.647 167.174 1.00 111.23 ? 246  GLY B CA    1 
ATOM   6659  C  C     . GLY C  1 252  ? 192.927 187.365 167.892 1.00 111.23 ? 246  GLY B C     1 
ATOM   6660  O  O     . GLY C  1 252  ? 192.768 186.274 167.338 1.00 111.23 ? 246  GLY B O     1 
ATOM   6661  N  N     . ASN C  1 253  ? 193.389 187.482 169.134 1.00 103.72 ? 247  ASN B N     1 
ATOM   6662  C  CA    . ASN C  1 253  ? 193.879 186.317 169.856 1.00 103.72 ? 247  ASN B CA    1 
ATOM   6663  C  C     . ASN C  1 253  ? 193.076 186.015 171.112 1.00 103.72 ? 247  ASN B C     1 
ATOM   6664  O  O     . ASN C  1 253  ? 193.444 185.096 171.853 1.00 103.72 ? 247  ASN B O     1 
ATOM   6665  C  CB    . ASN C  1 253  ? 195.352 186.506 170.213 1.00 103.72 ? 247  ASN B CB    1 
ATOM   6666  C  CG    . ASN C  1 253  ? 196.253 186.479 168.994 1.00 103.72 ? 247  ASN B CG    1 
ATOM   6667  O  OD1   . ASN C  1 253  ? 196.821 187.497 168.604 1.00 103.72 ? 247  ASN B OD1   1 
ATOM   6668  N  ND2   . ASN C  1 253  ? 196.407 185.304 168.401 1.00 103.72 ? 247  ASN B ND2   1 
ATOM   6669  N  N     . SER C  1 254  ? 192.000 186.744 171.372 1.00 102.45 ? 248  SER B N     1 
ATOM   6670  C  CA    . SER C  1 254  ? 191.147 186.473 172.515 1.00 102.45 ? 248  SER B CA    1 
ATOM   6671  C  C     . SER C  1 254  ? 190.201 185.328 172.200 1.00 102.45 ? 248  SER B C     1 
ATOM   6672  O  O     . SER C  1 254  ? 189.797 185.140 171.049 1.00 102.45 ? 248  SER B O     1 
ATOM   6673  C  CB    . SER C  1 254  ? 190.341 187.712 172.898 1.00 102.45 ? 248  SER B CB    1 
ATOM   6674  O  OG    . SER C  1 254  ? 191.192 188.759 173.326 1.00 102.45 ? 248  SER B OG    1 
ATOM   6675  N  N     . ILE C  1 255  ? 189.854 184.557 173.227 1.00 101.57 ? 249  ILE B N     1 
ATOM   6676  C  CA    . ILE C  1 255  ? 188.850 183.518 173.127 1.00 101.57 ? 249  ILE B CA    1 
ATOM   6677  C  C     . ILE C  1 255  ? 187.853 183.701 174.267 1.00 101.57 ? 249  ILE B C     1 
ATOM   6678  O  O     . ILE C  1 255  ? 187.997 184.584 175.109 1.00 101.57 ? 249  ILE B O     1 
ATOM   6679  C  CB    . ILE C  1 255  ? 189.454 182.103 173.172 1.00 101.57 ? 249  ILE B CB    1 
ATOM   6680  C  CG1   . ILE C  1 255  ? 190.001 181.824 174.564 1.00 101.57 ? 249  ILE B CG1   1 
ATOM   6681  C  CG2   . ILE C  1 255  ? 190.560 181.966 172.154 1.00 101.57 ? 249  ILE B CG2   1 
ATOM   6682  C  CD1   . ILE C  1 255  ? 190.292 180.374 174.813 1.00 101.57 ? 249  ILE B CD1   1 
ATOM   6683  N  N     . PHE C  1 256  ? 186.840 182.841 174.284 1.00 107.97 ? 250  PHE B N     1 
ATOM   6684  C  CA    . PHE C  1 256  ? 185.845 182.799 175.359 1.00 107.97 ? 250  PHE B CA    1 
ATOM   6685  C  C     . PHE C  1 256  ? 185.680 181.330 175.736 1.00 107.97 ? 250  PHE B C     1 
ATOM   6686  O  O     . PHE C  1 256  ? 184.838 180.623 175.176 1.00 107.97 ? 250  PHE B O     1 
ATOM   6687  C  CB    . PHE C  1 256  ? 184.533 183.427 174.922 1.00 107.97 ? 250  PHE B CB    1 
ATOM   6688  C  CG    . PHE C  1 256  ? 183.444 183.333 175.944 1.00 107.97 ? 250  PHE B CG    1 
ATOM   6689  C  CD1   . PHE C  1 256  ? 183.466 184.119 177.078 1.00 107.97 ? 250  PHE B CD1   1 
ATOM   6690  C  CD2   . PHE C  1 256  ? 182.384 182.470 175.758 1.00 107.97 ? 250  PHE B CD2   1 
ATOM   6691  C  CE1   . PHE C  1 256  ? 182.454 184.032 178.013 1.00 107.97 ? 250  PHE B CE1   1 
ATOM   6692  C  CE2   . PHE C  1 256  ? 181.375 182.385 176.686 1.00 107.97 ? 250  PHE B CE2   1 
ATOM   6693  C  CZ    . PHE C  1 256  ? 181.411 183.166 177.816 1.00 107.97 ? 250  PHE B CZ    1 
ATOM   6694  N  N     . LEU C  1 257  ? 186.493 180.878 176.684 1.00 126.02 ? 251  LEU B N     1 
ATOM   6695  C  CA    . LEU C  1 257  ? 186.557 179.467 177.040 1.00 126.02 ? 251  LEU B CA    1 
ATOM   6696  C  C     . LEU C  1 257  ? 185.584 179.170 178.172 1.00 126.02 ? 251  LEU B C     1 
ATOM   6697  O  O     . LEU C  1 257  ? 185.828 179.532 179.327 1.00 126.02 ? 251  LEU B O     1 
ATOM   6698  C  CB    . LEU C  1 257  ? 187.973 179.071 177.436 1.00 126.02 ? 251  LEU B CB    1 
ATOM   6699  C  CG    . LEU C  1 257  ? 188.073 177.602 177.836 1.00 126.02 ? 251  LEU B CG    1 
ATOM   6700  C  CD1   . LEU C  1 257  ? 187.606 176.724 176.702 1.00 126.02 ? 251  LEU B CD1   1 
ATOM   6701  C  CD2   . LEU C  1 257  ? 189.500 177.266 178.194 1.00 126.02 ? 251  LEU B CD2   1 
ATOM   6702  N  N     . VAL C  1 258  ? 184.489 178.499 177.840 1.00 131.60 ? 252  VAL B N     1 
ATOM   6703  C  CA    . VAL C  1 258  ? 183.608 177.941 178.853 1.00 131.60 ? 252  VAL B CA    1 
ATOM   6704  C  C     . VAL C  1 258  ? 183.648 176.431 178.694 1.00 131.60 ? 252  VAL B C     1 
ATOM   6705  O  O     . VAL C  1 258  ? 184.068 175.710 179.606 1.00 131.60 ? 252  VAL B O     1 
ATOM   6706  C  CB    . VAL C  1 258  ? 182.182 178.497 178.729 1.00 131.60 ? 252  VAL B CB    1 
ATOM   6707  C  CG1   . VAL C  1 258  ? 181.252 177.788 179.690 1.00 131.60 ? 252  VAL B CG1   1 
ATOM   6708  C  CG2   . VAL C  1 258  ? 182.195 179.977 179.010 1.00 131.60 ? 252  VAL B CG2   1 
ATOM   6709  N  N     . ALA C  1 259  ? 183.243 175.956 177.548 1.00 126.27 ? 253  ALA B N     1 
ATOM   6710  C  CA    . ALA C  1 259  ? 183.459 174.546 177.290 1.00 126.27 ? 253  ALA B CA    1 
ATOM   6711  C  C     . ALA C  1 259  ? 184.811 174.339 176.621 1.00 126.27 ? 253  ALA B C     1 
ATOM   6712  O  O     . ALA C  1 259  ? 185.138 175.024 175.647 1.00 126.27 ? 253  ALA B O     1 
ATOM   6713  C  CB    . ALA C  1 259  ? 182.356 173.980 176.392 1.00 126.27 ? 253  ALA B CB    1 
ATOM   6714  N  N     . PRO C  1 260  ? 185.602 173.400 177.126 1.00 119.20 ? 254  PRO B N     1 
ATOM   6715  C  CA    . PRO C  1 260  ? 186.961 173.205 176.602 1.00 119.20 ? 254  PRO B CA    1 
ATOM   6716  C  C     . PRO C  1 260  ? 186.989 172.964 175.103 1.00 119.20 ? 254  PRO B C     1 
ATOM   6717  O  O     . PRO C  1 260  ? 186.530 171.932 174.608 1.00 119.20 ? 254  PRO B O     1 
ATOM   6718  C  CB    . PRO C  1 260  ? 187.466 171.990 177.387 1.00 119.20 ? 254  PRO B CB    1 
ATOM   6719  C  CG    . PRO C  1 260  ? 186.247 171.308 177.879 1.00 119.20 ? 254  PRO B CG    1 
ATOM   6720  C  CD    . PRO C  1 260  ? 185.255 172.399 178.140 1.00 119.20 ? 254  PRO B CD    1 
ATOM   6721  N  N     . LEU C  1 261  ? 187.554 173.925 174.379 1.00 106.43 ? 255  LEU B N     1 
ATOM   6722  C  CA    . LEU C  1 261  ? 187.463 173.977 172.932 1.00 106.43 ? 255  LEU B CA    1 
ATOM   6723  C  C     . LEU C  1 261  ? 188.814 173.658 172.293 1.00 106.43 ? 255  LEU B C     1 
ATOM   6724  O  O     . LEU C  1 261  ? 189.781 173.296 172.963 1.00 106.43 ? 255  LEU B O     1 
ATOM   6725  C  CB    . LEU C  1 261  ? 186.932 175.344 172.508 1.00 106.43 ? 255  LEU B CB    1 
ATOM   6726  C  CG    . LEU C  1 261  ? 187.704 176.574 172.993 1.00 106.43 ? 255  LEU B CG    1 
ATOM   6727  C  CD1   . LEU C  1 261  ? 188.806 176.959 172.025 1.00 106.43 ? 255  LEU B CD1   1 
ATOM   6728  C  CD2   . LEU C  1 261  ? 186.766 177.742 173.242 1.00 106.43 ? 255  LEU B CD2   1 
ATOM   6729  N  N     . ILE C  1 262  ? 188.877 173.794 170.973 1.00 103.76 ? 256  ILE B N     1 
ATOM   6730  C  CA    . ILE C  1 262  ? 190.074 173.490 170.198 1.00 103.76 ? 256  ILE B CA    1 
ATOM   6731  C  C     . ILE C  1 262  ? 190.672 174.794 169.691 1.00 103.76 ? 256  ILE B C     1 
ATOM   6732  O  O     . ILE C  1 262  ? 189.976 175.608 169.072 1.00 103.76 ? 256  ILE B O     1 
ATOM   6733  C  CB    . ILE C  1 262  ? 189.783 172.536 169.033 1.00 103.76 ? 256  ILE B CB    1 
ATOM   6734  C  CG1   . ILE C  1 262  ? 189.444 171.141 169.559 1.00 103.76 ? 256  ILE B CG1   1 
ATOM   6735  C  CG2   . ILE C  1 262  ? 190.957 172.484 168.074 1.00 103.76 ? 256  ILE B CG2   1 
ATOM   6736  C  CD1   . ILE C  1 262  ? 188.960 170.188 168.493 1.00 103.76 ? 256  ILE B CD1   1 
ATOM   6737  N  N     . ILE C  1 263  ? 191.963 174.996 169.959 1.00 109.63 ? 257  ILE B N     1 
ATOM   6738  C  CA    . ILE C  1 263  ? 192.708 176.082 169.336 1.00 109.63 ? 257  ILE B CA    1 
ATOM   6739  C  C     . ILE C  1 263  ? 193.419 175.548 168.104 1.00 109.63 ? 257  ILE B C     1 
ATOM   6740  O  O     . ILE C  1 263  ? 193.935 174.423 168.104 1.00 109.63 ? 257  ILE B O     1 
ATOM   6741  C  CB    . ILE C  1 263  ? 193.707 176.685 170.335 1.00 109.63 ? 257  ILE B CB    1 
ATOM   6742  C  CG1   . ILE C  1 263  ? 192.961 177.256 171.531 1.00 109.63 ? 257  ILE B CG1   1 
ATOM   6743  C  CG2   . ILE C  1 263  ? 194.536 177.763 169.675 1.00 109.63 ? 257  ILE B CG2   1 
ATOM   6744  C  CD1   . ILE C  1 263  ? 192.010 178.365 171.154 1.00 109.63 ? 257  ILE B CD1   1 
ATOM   6745  N  N     . TYR C  1 264  ? 193.452 176.346 167.040 1.00 107.11 ? 258  TYR B N     1 
ATOM   6746  C  CA    . TYR C  1 264  ? 194.023 175.842 165.806 1.00 107.11 ? 258  TYR B CA    1 
ATOM   6747  C  C     . TYR C  1 264  ? 194.647 176.960 164.992 1.00 107.11 ? 258  TYR B C     1 
ATOM   6748  O  O     . TYR C  1 264  ? 194.169 178.095 164.988 1.00 107.11 ? 258  TYR B O     1 
ATOM   6749  C  CB    . TYR C  1 264  ? 192.974 175.121 164.965 1.00 107.11 ? 258  TYR B CB    1 
ATOM   6750  C  CG    . TYR C  1 264  ? 191.888 175.994 164.391 1.00 107.11 ? 258  TYR B CG    1 
ATOM   6751  C  CD1   . TYR C  1 264  ? 190.750 176.289 165.122 1.00 107.11 ? 258  TYR B CD1   1 
ATOM   6752  C  CD2   . TYR C  1 264  ? 191.980 176.482 163.098 1.00 107.11 ? 258  TYR B CD2   1 
ATOM   6753  C  CE1   . TYR C  1 264  ? 189.748 177.072 164.592 1.00 107.11 ? 258  TYR B CE1   1 
ATOM   6754  C  CE2   . TYR C  1 264  ? 190.981 177.258 162.557 1.00 107.11 ? 258  TYR B CE2   1 
ATOM   6755  C  CZ    . TYR C  1 264  ? 189.867 177.551 163.306 1.00 107.11 ? 258  TYR B CZ    1 
ATOM   6756  O  OH    . TYR C  1 264  ? 188.870 178.331 162.770 1.00 107.11 ? 258  TYR B OH    1 
ATOM   6757  N  N     . HIS C  1 265  ? 195.716 176.608 164.286 1.00 103.64 ? 259  HIS B N     1 
ATOM   6758  C  CA    . HIS C  1 265  ? 196.356 177.488 163.327 1.00 103.64 ? 259  HIS B CA    1 
ATOM   6759  C  C     . HIS C  1 265  ? 196.212 176.934 161.921 1.00 103.64 ? 259  HIS B C     1 
ATOM   6760  O  O     . HIS C  1 265  ? 196.478 175.753 161.678 1.00 103.64 ? 259  HIS B O     1 
ATOM   6761  C  CB    . HIS C  1 265  ? 197.831 177.669 163.623 1.00 103.64 ? 259  HIS B CB    1 
ATOM   6762  C  CG    . HIS C  1 265  ? 198.545 178.442 162.566 1.00 103.64 ? 259  HIS B CG    1 
ATOM   6763  N  ND1   . HIS C  1 265  ? 198.443 179.810 162.448 1.00 103.64 ? 259  HIS B ND1   1 
ATOM   6764  C  CD2   . HIS C  1 265  ? 199.320 178.033 161.535 1.00 103.64 ? 259  HIS B CD2   1 
ATOM   6765  C  CE1   . HIS C  1 265  ? 199.154 180.214 161.412 1.00 103.64 ? 259  HIS B CE1   1 
ATOM   6766  N  NE2   . HIS C  1 265  ? 199.700 179.155 160.844 1.00 103.64 ? 259  HIS B NE2   1 
ATOM   6767  N  N     . VAL C  1 266  ? 195.816 177.798 160.994 1.00 106.43 ? 260  VAL B N     1 
ATOM   6768  C  CA    . VAL C  1 266  ? 195.766 177.458 159.578 1.00 106.43 ? 260  VAL B CA    1 
ATOM   6769  C  C     . VAL C  1 266  ? 197.158 177.684 159.005 1.00 106.43 ? 260  VAL B C     1 
ATOM   6770  O  O     . VAL C  1 266  ? 197.707 178.783 159.104 1.00 106.43 ? 260  VAL B O     1 
ATOM   6771  C  CB    . VAL C  1 266  ? 194.717 178.291 158.837 1.00 106.43 ? 260  VAL B CB    1 
ATOM   6772  C  CG1   . VAL C  1 266  ? 194.760 177.991 157.350 1.00 106.43 ? 260  VAL B CG1   1 
ATOM   6773  C  CG2   . VAL C  1 266  ? 193.341 178.006 159.396 1.00 106.43 ? 260  VAL B CG2   1 
ATOM   6774  N  N     . ILE C  1 267  ? 197.725 176.647 158.396 1.00 109.42 ? 261  ILE B N     1 
ATOM   6775  C  CA    . ILE C  1 267  ? 199.106 176.695 157.933 1.00 109.42 ? 261  ILE B CA    1 
ATOM   6776  C  C     . ILE C  1 267  ? 199.179 177.341 156.557 1.00 109.42 ? 261  ILE B C     1 
ATOM   6777  O  O     . ILE C  1 267  ? 198.921 176.688 155.541 1.00 109.42 ? 261  ILE B O     1 
ATOM   6778  C  CB    . ILE C  1 267  ? 199.713 175.285 157.909 1.00 109.42 ? 261  ILE B CB    1 
ATOM   6779  C  CG1   . ILE C  1 267  ? 199.587 174.649 159.288 1.00 109.42 ? 261  ILE B CG1   1 
ATOM   6780  C  CG2   . ILE C  1 267  ? 201.169 175.350 157.511 1.00 109.42 ? 261  ILE B CG2   1 
ATOM   6781  C  CD1   . ILE C  1 267  ? 199.847 173.170 159.290 1.00 109.42 ? 261  ILE B CD1   1 
ATOM   6782  N  N     . ASP C  1 268  ? 199.547 178.614 156.513 1.00 120.82 ? 262  ASP B N     1 
ATOM   6783  C  CA    . ASP C  1 268  ? 199.633 179.371 155.274 1.00 120.82 ? 262  ASP B CA    1 
ATOM   6784  C  C     . ASP C  1 268  ? 201.089 179.501 154.840 1.00 120.82 ? 262  ASP B C     1 
ATOM   6785  O  O     . ASP C  1 268  ? 202.021 179.223 155.599 1.00 120.82 ? 262  ASP B O     1 
ATOM   6786  C  CB    . ASP C  1 268  ? 198.988 180.750 155.440 1.00 120.82 ? 262  ASP B CB    1 
ATOM   6787  N  N     . ALA C  1 269  ? 201.278 179.946 153.595 1.00 113.66 ? 263  ALA B N     1 
ATOM   6788  C  CA    . ALA C  1 269  ? 202.627 180.091 153.059 1.00 113.66 ? 263  ALA B CA    1 
ATOM   6789  C  C     . ALA C  1 269  ? 203.457 181.073 153.873 1.00 113.66 ? 263  ALA B C     1 
ATOM   6790  O  O     . ALA C  1 269  ? 204.684 181.105 153.740 1.00 113.66 ? 263  ALA B O     1 
ATOM   6791  C  CB    . ALA C  1 269  ? 202.564 180.528 151.597 1.00 113.66 ? 263  ALA B CB    1 
ATOM   6792  N  N     . ASN C  1 270  ? 202.811 181.890 154.704 1.00 117.60 ? 264  ASN B N     1 
ATOM   6793  C  CA    . ASN C  1 270  ? 203.529 182.739 155.643 1.00 117.60 ? 264  ASN B CA    1 
ATOM   6794  C  C     . ASN C  1 270  ? 203.816 182.042 156.962 1.00 117.60 ? 264  ASN B C     1 
ATOM   6795  O  O     . ASN C  1 270  ? 204.717 182.476 157.688 1.00 117.60 ? 264  ASN B O     1 
ATOM   6796  C  CB    . ASN C  1 270  ? 202.741 184.020 155.907 1.00 117.60 ? 264  ASN B CB    1 
ATOM   6797  C  CG    . ASN C  1 270  ? 202.642 184.903 154.684 1.00 117.60 ? 264  ASN B CG    1 
ATOM   6798  O  OD1   . ASN C  1 270  ? 201.565 185.084 154.122 1.00 117.60 ? 264  ASN B OD1   1 
ATOM   6799  N  ND2   . ASN C  1 270  ? 203.770 185.472 154.272 1.00 117.60 ? 264  ASN B ND2   1 
ATOM   6800  N  N     . SER C  1 271  ? 203.084 180.992 157.289 1.00 113.86 ? 265  SER B N     1 
ATOM   6801  C  CA    . SER C  1 271  ? 203.398 180.264 158.506 1.00 113.86 ? 265  SER B CA    1 
ATOM   6802  C  C     . SER C  1 271  ? 204.709 179.505 158.338 1.00 113.86 ? 265  SER B C     1 
ATOM   6803  O  O     . SER C  1 271  ? 204.956 178.924 157.280 1.00 113.86 ? 265  SER B O     1 
ATOM   6804  C  CB    . SER C  1 271  ? 202.285 179.282 158.847 1.00 113.86 ? 265  SER B CB    1 
ATOM   6805  O  OG    . SER C  1 271  ? 202.635 178.517 159.984 1.00 113.86 ? 265  SER B OG    1 
ATOM   6806  N  N     . PRO C  1 272  ? 205.568 179.503 159.356 1.00 102.12 ? 266  PRO B N     1 
ATOM   6807  C  CA    . PRO C  1 272  ? 206.805 178.719 159.254 1.00 102.12 ? 266  PRO B CA    1 
ATOM   6808  C  C     . PRO C  1 272  ? 206.545 177.239 159.088 1.00 102.12 ? 266  PRO B C     1 
ATOM   6809  O  O     . PRO C  1 272  ? 207.377 176.529 158.509 1.00 102.12 ? 266  PRO B O     1 
ATOM   6810  C  CB    . PRO C  1 272  ? 207.520 179.019 160.576 1.00 102.12 ? 266  PRO B CB    1 
ATOM   6811  C  CG    . PRO C  1 272  ? 206.939 180.307 161.036 1.00 102.12 ? 266  PRO B CG    1 
ATOM   6812  C  CD    . PRO C  1 272  ? 205.507 180.277 160.604 1.00 102.12 ? 266  PRO B CD    1 
ATOM   6813  N  N     . LEU C  1 273  ? 205.406 176.753 159.569 1.00 109.30 ? 267  LEU B N     1 
ATOM   6814  C  CA    . LEU C  1 273  ? 205.026 175.356 159.446 1.00 109.30 ? 267  LEU B CA    1 
ATOM   6815  C  C     . LEU C  1 273  ? 204.588 174.990 158.042 1.00 109.30 ? 267  LEU B C     1 
ATOM   6816  O  O     . LEU C  1 273  ? 204.123 173.868 157.815 1.00 109.30 ? 267  LEU B O     1 
ATOM   6817  C  CB    . LEU C  1 273  ? 203.908 175.030 160.433 1.00 109.30 ? 267  LEU B CB    1 
ATOM   6818  C  CG    . LEU C  1 273  ? 204.305 174.804 161.887 1.00 109.30 ? 267  LEU B CG    1 
ATOM   6819  C  CD1   . LEU C  1 273  ? 204.735 176.101 162.547 1.00 109.30 ? 267  LEU B CD1   1 
ATOM   6820  C  CD2   . LEU C  1 273  ? 203.149 174.178 162.647 1.00 109.30 ? 267  LEU B CD2   1 
ATOM   6821  N  N     . TYR C  1 274  ? 204.716 175.912 157.094 1.00 118.99 ? 268  TYR B N     1 
ATOM   6822  C  CA    . TYR C  1 274  ? 204.308 175.631 155.730 1.00 118.99 ? 268  TYR B CA    1 
ATOM   6823  C  C     . TYR C  1 274  ? 205.299 174.736 155.002 1.00 118.99 ? 268  TYR B C     1 
ATOM   6824  O  O     . TYR C  1 274  ? 204.994 174.265 153.901 1.00 118.99 ? 268  TYR B O     1 
ATOM   6825  C  CB    . TYR C  1 274  ? 204.111 176.948 154.987 1.00 118.99 ? 268  TYR B CB    1 
ATOM   6826  C  CG    . TYR C  1 274  ? 203.505 176.805 153.624 1.00 118.99 ? 268  TYR B CG    1 
ATOM   6827  C  CD1   . TYR C  1 274  ? 202.160 176.524 153.473 1.00 118.99 ? 268  TYR B CD1   1 
ATOM   6828  C  CD2   . TYR C  1 274  ? 204.277 176.961 152.487 1.00 118.99 ? 268  TYR B CD2   1 
ATOM   6829  C  CE1   . TYR C  1 274  ? 201.603 176.391 152.232 1.00 118.99 ? 268  TYR B CE1   1 
ATOM   6830  C  CE2   . TYR C  1 274  ? 203.731 176.835 151.241 1.00 118.99 ? 268  TYR B CE2   1 
ATOM   6831  C  CZ    . TYR C  1 274  ? 202.396 176.548 151.118 1.00 118.99 ? 268  TYR B CZ    1 
ATOM   6832  O  OH    . TYR C  1 274  ? 201.861 176.423 149.863 1.00 118.99 ? 268  TYR B OH    1 
ATOM   6833  N  N     . ASP C  1 275  ? 206.470 174.486 155.587 1.00 123.84 ? 269  ASP B N     1 
ATOM   6834  C  CA    . ASP C  1 275  ? 207.411 173.505 155.065 1.00 123.84 ? 269  ASP B CA    1 
ATOM   6835  C  C     . ASP C  1 275  ? 207.356 172.196 155.843 1.00 123.84 ? 269  ASP B C     1 
ATOM   6836  O  O     . ASP C  1 275  ? 208.110 171.265 155.543 1.00 123.84 ? 269  ASP B O     1 
ATOM   6837  C  CB    . ASP C  1 275  ? 208.833 174.064 155.077 1.00 123.84 ? 269  ASP B CB    1 
ATOM   6838  C  CG    . ASP C  1 275  ? 209.046 175.131 154.029 1.00 123.84 ? 269  ASP B CG    1 
ATOM   6839  O  OD1   . ASP C  1 275  ? 208.361 175.084 152.986 1.00 123.84 ? 269  ASP B OD1   1 
ATOM   6840  O  OD2   . ASP C  1 275  ? 209.903 176.011 154.242 1.00 123.84 ? 269  ASP B OD2   1 
ATOM   6841  N  N     . LEU C  1 276  ? 206.474 172.106 156.830 1.00 125.18 ? 270  LEU B N     1 
ATOM   6842  C  CA    . LEU C  1 276  ? 206.351 170.897 157.626 1.00 125.18 ? 270  LEU B CA    1 
ATOM   6843  C  C     . LEU C  1 276  ? 205.671 169.797 156.822 1.00 125.18 ? 270  LEU B C     1 
ATOM   6844  O  O     . LEU C  1 276  ? 204.820 170.061 155.970 1.00 125.18 ? 270  LEU B O     1 
ATOM   6845  C  CB    . LEU C  1 276  ? 205.566 171.182 158.906 1.00 125.18 ? 270  LEU B CB    1 
ATOM   6846  C  CG    . LEU C  1 276  ? 205.480 170.087 159.969 1.00 125.18 ? 270  LEU B CG    1 
ATOM   6847  C  CD1   . LEU C  1 276  ? 205.393 170.727 161.333 1.00 125.18 ? 270  LEU B CD1   1 
ATOM   6848  C  CD2   . LEU C  1 276  ? 204.277 169.181 159.746 1.00 125.18 ? 270  LEU B CD2   1 
ATOM   6849  N  N     . ALA C  1 277  ? 206.061 168.561 157.100 1.00 120.82 ? 271  ALA B N     1 
ATOM   6850  C  CA    . ALA C  1 277  ? 205.506 167.369 156.484 1.00 120.82 ? 271  ALA B CA    1 
ATOM   6851  C  C     . ALA C  1 277  ? 205.289 166.338 157.576 1.00 120.82 ? 271  ALA B C     1 
ATOM   6852  O  O     . ALA C  1 277  ? 205.930 166.403 158.630 1.00 120.82 ? 271  ALA B O     1 
ATOM   6853  C  CB    . ALA C  1 277  ? 206.445 166.797 155.414 1.00 120.82 ? 271  ALA B CB    1 
ATOM   6854  N  N     . PRO C  1 278  ? 204.400 165.377 157.361 1.00 117.26 ? 272  PRO B N     1 
ATOM   6855  C  CA    . PRO C  1 278  ? 204.345 164.229 158.263 1.00 117.26 ? 272  PRO B CA    1 
ATOM   6856  C  C     . PRO C  1 278  ? 205.661 163.479 158.216 1.00 117.26 ? 272  PRO B C     1 
ATOM   6857  O  O     . PRO C  1 278  ? 206.439 163.590 157.267 1.00 117.26 ? 272  PRO B O     1 
ATOM   6858  C  CB    . PRO C  1 278  ? 203.200 163.384 157.712 1.00 117.26 ? 272  PRO B CB    1 
ATOM   6859  C  CG    . PRO C  1 278  ? 203.136 163.747 156.295 1.00 117.26 ? 272  PRO B CG    1 
ATOM   6860  C  CD    . PRO C  1 278  ? 203.504 165.199 156.210 1.00 117.26 ? 272  PRO B CD    1 
ATOM   6861  N  N     . SER C  1 279  ? 205.932 162.758 159.300 1.00 140.45 ? 273  SER B N     1 
ATOM   6862  C  CA    . SER C  1 279  ? 207.117 161.919 159.437 1.00 140.45 ? 273  SER B CA    1 
ATOM   6863  C  C     . SER C  1 279  ? 208.363 162.786 159.556 1.00 140.45 ? 273  SER B C     1 
ATOM   6864  O  O     . SER C  1 279  ? 209.456 162.282 159.834 1.00 140.45 ? 273  SER B O     1 
ATOM   6865  C  CB    . SER C  1 279  ? 207.249 160.937 158.266 1.00 140.45 ? 273  SER B CB    1 
ATOM   6866  O  OG    . SER C  1 279  ? 207.548 161.617 157.059 1.00 140.45 ? 273  SER B OG    1 
ATOM   6867  N  N     . ASP C  1 280  ? 208.206 164.093 159.352 1.00 129.97 ? 274  ASP B N     1 
ATOM   6868  C  CA    . ASP C  1 280  ? 209.244 165.028 159.753 1.00 129.97 ? 274  ASP B CA    1 
ATOM   6869  C  C     . ASP C  1 280  ? 209.157 165.283 161.247 1.00 129.97 ? 274  ASP B C     1 
ATOM   6870  O  O     . ASP C  1 280  ? 210.177 165.506 161.906 1.00 129.97 ? 274  ASP B O     1 
ATOM   6871  C  CB    . ASP C  1 280  ? 209.105 166.331 158.960 1.00 129.97 ? 274  ASP B CB    1 
ATOM   6872  C  CG    . ASP C  1 280  ? 210.321 167.232 159.087 1.00 129.97 ? 274  ASP B CG    1 
ATOM   6873  O  OD1   . ASP C  1 280  ? 211.276 166.859 159.797 1.00 129.97 ? 274  ASP B OD1   1 
ATOM   6874  O  OD2   . ASP C  1 280  ? 210.320 168.317 158.468 1.00 129.97 ? 274  ASP B OD2   1 
ATOM   6875  N  N     . LEU C  1 281  ? 207.949 165.221 161.796 1.00 122.26 ? 275  LEU B N     1 
ATOM   6876  C  CA    . LEU C  1 281  ? 207.744 165.346 163.228 1.00 122.26 ? 275  LEU B CA    1 
ATOM   6877  C  C     . LEU C  1 281  ? 208.220 164.082 163.931 1.00 122.26 ? 275  LEU B C     1 
ATOM   6878  O  O     . LEU C  1 281  ? 207.923 162.967 163.494 1.00 122.26 ? 275  LEU B O     1 
ATOM   6879  C  CB    . LEU C  1 281  ? 206.268 165.620 163.526 1.00 122.26 ? 275  LEU B CB    1 
ATOM   6880  C  CG    . LEU C  1 281  ? 205.192 164.634 163.057 1.00 122.26 ? 275  LEU B CG    1 
ATOM   6881  C  CD1   . LEU C  1 281  ? 204.901 163.556 164.091 1.00 122.26 ? 275  LEU B CD1   1 
ATOM   6882  C  CD2   . LEU C  1 281  ? 203.921 165.376 162.681 1.00 122.26 ? 275  LEU B CD2   1 
ATOM   6883  N  N     . HIS C  1 282  ? 208.981 164.267 165.004 1.00 139.11 ? 276  HIS B N     1 
ATOM   6884  C  CA    . HIS C  1 282  ? 209.497 163.190 165.839 1.00 139.11 ? 276  HIS B CA    1 
ATOM   6885  C  C     . HIS C  1 282  ? 210.253 163.828 166.994 1.00 139.11 ? 276  HIS B C     1 
ATOM   6886  O  O     . HIS C  1 282  ? 210.673 164.987 166.923 1.00 139.11 ? 276  HIS B O     1 
ATOM   6887  C  CB    . HIS C  1 282  ? 210.392 162.229 165.052 1.00 139.11 ? 276  HIS B CB    1 
ATOM   6888  C  CG    . HIS C  1 282  ? 211.570 162.885 164.405 1.00 139.11 ? 276  HIS B CG    1 
ATOM   6889  N  ND1   . HIS C  1 282  ? 211.491 163.516 163.183 1.00 139.11 ? 276  HIS B ND1   1 
ATOM   6890  C  CD2   . HIS C  1 282  ? 212.857 163.004 164.808 1.00 139.11 ? 276  HIS B CD2   1 
ATOM   6891  C  CE1   . HIS C  1 282  ? 212.679 163.986 162.856 1.00 139.11 ? 276  HIS B CE1   1 
ATOM   6892  N  NE2   . HIS C  1 282  ? 213.525 163.699 163.829 1.00 139.11 ? 276  HIS B NE2   1 
ATOM   6893  N  N     . HIS C  1 283  ? 210.439 163.051 168.062 1.00 146.71 ? 277  HIS B N     1 
ATOM   6894  C  CA    . HIS C  1 283  ? 211.036 163.613 169.268 1.00 146.71 ? 277  HIS B CA    1 
ATOM   6895  C  C     . HIS C  1 283  ? 212.500 163.988 169.082 1.00 146.71 ? 277  HIS B C     1 
ATOM   6896  O  O     . HIS C  1 283  ? 213.130 164.459 170.032 1.00 146.71 ? 277  HIS B O     1 
ATOM   6897  C  CB    . HIS C  1 283  ? 210.908 162.644 170.443 1.00 146.71 ? 277  HIS B CB    1 
ATOM   6898  C  CG    . HIS C  1 283  ? 211.307 163.244 171.757 1.00 146.71 ? 277  HIS B CG    1 
ATOM   6899  N  ND1   . HIS C  1 283  ? 212.618 163.306 172.175 1.00 146.71 ? 277  HIS B ND1   1 
ATOM   6900  C  CD2   . HIS C  1 283  ? 210.574 163.825 172.735 1.00 146.71 ? 277  HIS B CD2   1 
ATOM   6901  C  CE1   . HIS C  1 283  ? 212.676 163.893 173.356 1.00 146.71 ? 277  HIS B CE1   1 
ATOM   6902  N  NE2   . HIS C  1 283  ? 211.448 164.215 173.719 1.00 146.71 ? 277  HIS B NE2   1 
ATOM   6903  N  N     . HIS C  1 284  ? 213.068 163.781 167.903 1.00 149.17 ? 278  HIS B N     1 
ATOM   6904  C  CA    . HIS C  1 284  ? 214.437 164.194 167.630 1.00 149.17 ? 278  HIS B CA    1 
ATOM   6905  C  C     . HIS C  1 284  ? 214.487 165.224 166.510 1.00 149.17 ? 278  HIS B C     1 
ATOM   6906  O  O     . HIS C  1 284  ? 215.547 165.526 165.957 1.00 149.17 ? 278  HIS B O     1 
ATOM   6907  C  CB    . HIS C  1 284  ? 215.302 162.980 167.324 1.00 149.17 ? 278  HIS B CB    1 
ATOM   6908  C  CG    . HIS C  1 284  ? 215.510 162.094 168.511 1.00 149.17 ? 278  HIS B CG    1 
ATOM   6909  N  ND1   . HIS C  1 284  ? 216.071 160.839 168.420 1.00 149.17 ? 278  HIS B ND1   1 
ATOM   6910  C  CD2   . HIS C  1 284  ? 215.235 162.289 169.822 1.00 149.17 ? 278  HIS B CD2   1 
ATOM   6911  C  CE1   . HIS C  1 284  ? 216.127 160.297 169.623 1.00 149.17 ? 278  HIS B CE1   1 
ATOM   6912  N  NE2   . HIS C  1 284  ? 215.628 161.158 170.491 1.00 149.17 ? 278  HIS B NE2   1 
ATOM   6913  N  N     . GLN C  1 285  ? 213.330 165.784 166.177 1.00 136.17 ? 279  GLN B N     1 
ATOM   6914  C  CA    . GLN C  1 285  ? 213.217 166.869 165.214 1.00 136.17 ? 279  GLN B CA    1 
ATOM   6915  C  C     . GLN C  1 285  ? 213.177 168.176 165.982 1.00 136.17 ? 279  GLN B C     1 
ATOM   6916  O  O     . GLN C  1 285  ? 212.296 168.373 166.831 1.00 136.17 ? 279  GLN B O     1 
ATOM   6917  C  CB    . GLN C  1 285  ? 211.963 166.730 164.358 1.00 136.17 ? 279  GLN B CB    1 
ATOM   6918  C  CG    . GLN C  1 285  ? 211.881 167.769 163.265 1.00 136.17 ? 279  GLN B CG    1 
ATOM   6919  C  CD    . GLN C  1 285  ? 213.019 167.640 162.280 1.00 136.17 ? 279  GLN B CD    1 
ATOM   6920  O  OE1   . GLN C  1 285  ? 213.979 168.407 162.320 1.00 136.17 ? 279  GLN B OE1   1 
ATOM   6921  N  NE2   . GLN C  1 285  ? 212.918 166.664 161.386 1.00 136.17 ? 279  GLN B NE2   1 
ATOM   6922  N  N     . ASP C  1 286  ? 214.112 169.074 165.678 1.00 135.78 ? 280  ASP B N     1 
ATOM   6923  C  CA    . ASP C  1 286  ? 214.145 170.338 166.397 1.00 135.78 ? 280  ASP B CA    1 
ATOM   6924  C  C     . ASP C  1 286  ? 212.898 171.123 166.024 1.00 135.78 ? 280  ASP B C     1 
ATOM   6925  O  O     . ASP C  1 286  ? 212.792 171.673 164.918 1.00 135.78 ? 280  ASP B O     1 
ATOM   6926  C  CB    . ASP C  1 286  ? 215.403 171.133 166.070 1.00 135.78 ? 280  ASP B CB    1 
ATOM   6927  C  CG    . ASP C  1 286  ? 215.481 172.433 166.832 1.00 135.78 ? 280  ASP B CG    1 
ATOM   6928  O  OD1   . ASP C  1 286  ? 215.673 172.394 168.062 1.00 135.78 ? 280  ASP B OD1   1 
ATOM   6929  O  OD2   . ASP C  1 286  ? 215.347 173.502 166.196 1.00 135.78 ? 280  ASP B OD2   1 
ATOM   6930  N  N     . LEU C  1 287  ? 211.937 171.156 166.942 1.00 122.62 ? 281  LEU B N     1 
ATOM   6931  C  CA    . LEU C  1 287  ? 210.637 171.737 166.663 1.00 122.62 ? 281  LEU B CA    1 
ATOM   6932  C  C     . LEU C  1 287  ? 209.846 171.789 167.956 1.00 122.62 ? 281  LEU B C     1 
ATOM   6933  O  O     . LEU C  1 287  ? 209.891 170.847 168.749 1.00 122.62 ? 281  LEU B O     1 
ATOM   6934  C  CB    . LEU C  1 287  ? 209.879 170.912 165.621 1.00 122.62 ? 281  LEU B CB    1 
ATOM   6935  C  CG    . LEU C  1 287  ? 208.536 171.495 165.212 1.00 122.62 ? 281  LEU B CG    1 
ATOM   6936  C  CD1   . LEU C  1 287  ? 208.785 172.821 164.527 1.00 122.62 ? 281  LEU B CD1   1 
ATOM   6937  C  CD2   . LEU C  1 287  ? 207.779 170.530 164.311 1.00 122.62 ? 281  LEU B CD2   1 
ATOM   6938  N  N     . GLU C  1 288  ? 209.116 172.880 168.145 1.00 116.39 ? 282  GLU B N     1 
ATOM   6939  C  CA    . GLU C  1 288  ? 208.303 173.064 169.332 1.00 116.39 ? 282  GLU B CA    1 
ATOM   6940  C  C     . GLU C  1 288  ? 207.447 174.302 169.136 1.00 116.39 ? 282  GLU B C     1 
ATOM   6941  O  O     . GLU C  1 288  ? 207.893 175.306 168.575 1.00 116.39 ? 282  GLU B O     1 
ATOM   6942  C  CB    . GLU C  1 288  ? 209.165 173.203 170.586 1.00 116.39 ? 282  GLU B CB    1 
ATOM   6943  C  CG    . GLU C  1 288  ? 208.383 173.301 171.874 1.00 116.39 ? 282  GLU B CG    1 
ATOM   6944  C  CD    . GLU C  1 288  ? 209.294 173.369 173.081 1.00 116.39 ? 282  GLU B CD    1 
ATOM   6945  O  OE1   . GLU C  1 288  ? 210.526 173.335 172.889 1.00 116.39 ? 282  GLU B OE1   1 
ATOM   6946  O  OE2   . GLU C  1 288  ? 208.789 173.462 174.216 1.00 116.39 ? 282  GLU B OE2   1 
ATOM   6947  N  N     . ILE C  1 289  ? 206.206 174.218 169.605 1.00 116.70 ? 283  ILE B N     1 
ATOM   6948  C  CA    . ILE C  1 289  ? 205.252 175.308 169.449 1.00 116.70 ? 283  ILE B CA    1 
ATOM   6949  C  C     . ILE C  1 289  ? 204.751 175.694 170.831 1.00 116.70 ? 283  ILE B C     1 
ATOM   6950  O  O     . ILE C  1 289  ? 204.033 174.919 171.471 1.00 116.70 ? 283  ILE B O     1 
ATOM   6951  C  CB    . ILE C  1 289  ? 204.076 174.917 168.547 1.00 116.70 ? 283  ILE B CB    1 
ATOM   6952  C  CG1   . ILE C  1 289  ? 204.585 174.497 167.176 1.00 116.70 ? 283  ILE B CG1   1 
ATOM   6953  C  CG2   . ILE C  1 289  ? 203.121 176.085 168.410 1.00 116.70 ? 283  ILE B CG2   1 
ATOM   6954  C  CD1   . ILE C  1 289  ? 203.532 173.833 166.323 1.00 116.70 ? 283  ILE B CD1   1 
ATOM   6955  N  N     . ILE C  1 290  ? 205.101 176.885 171.277 1.00 105.20 ? 284  ILE B N     1 
ATOM   6956  C  CA    . ILE C  1 290  ? 204.838 177.319 172.640 1.00 105.20 ? 284  ILE B CA    1 
ATOM   6957  C  C     . ILE C  1 290  ? 203.449 177.923 172.692 1.00 105.20 ? 284  ILE B C     1 
ATOM   6958  O  O     . ILE C  1 290  ? 203.121 178.821 171.910 1.00 105.20 ? 284  ILE B O     1 
ATOM   6959  C  CB    . ILE C  1 290  ? 205.903 178.328 173.102 1.00 105.20 ? 284  ILE B CB    1 
ATOM   6960  C  CG1   . ILE C  1 290  ? 207.292 177.775 172.817 1.00 105.20 ? 284  ILE B CG1   1 
ATOM   6961  C  CG2   . ILE C  1 290  ? 205.770 178.596 174.580 1.00 105.20 ? 284  ILE B CG2   1 
ATOM   6962  C  CD1   . ILE C  1 290  ? 207.567 176.468 173.493 1.00 105.20 ? 284  ILE B CD1   1 
ATOM   6963  N  N     . VAL C  1 291  ? 202.629 177.438 173.619 1.00 102.88 ? 285  VAL B N     1 
ATOM   6964  C  CA    . VAL C  1 291  ? 201.236 177.851 173.717 1.00 102.88 ? 285  VAL B CA    1 
ATOM   6965  C  C     . VAL C  1 291  ? 201.056 178.639 175.003 1.00 102.88 ? 285  VAL B C     1 
ATOM   6966  O  O     . VAL C  1 291  ? 201.330 178.129 176.094 1.00 102.88 ? 285  VAL B O     1 
ATOM   6967  C  CB    . VAL C  1 291  ? 200.279 176.647 173.677 1.00 102.88 ? 285  VAL B CB    1 
ATOM   6968  C  CG1   . VAL C  1 291  ? 198.846 177.108 173.795 1.00 102.88 ? 285  VAL B CG1   1 
ATOM   6969  C  CG2   . VAL C  1 291  ? 200.491 175.864 172.404 1.00 102.88 ? 285  VAL B CG2   1 
ATOM   6970  N  N     . ILE C  1 292  ? 200.585 179.874 174.871 1.00 91.79  ? 286  ILE B N     1 
ATOM   6971  C  CA    . ILE C  1 292  ? 200.447 180.808 175.980 1.00 91.79  ? 286  ILE B CA    1 
ATOM   6972  C  C     . ILE C  1 292  ? 198.981 181.172 176.148 1.00 91.79  ? 286  ILE B C     1 
ATOM   6973  O  O     . ILE C  1 292  ? 198.293 181.497 175.175 1.00 91.79  ? 286  ILE B O     1 
ATOM   6974  C  CB    . ILE C  1 292  ? 201.302 182.069 175.754 1.00 91.79  ? 286  ILE B CB    1 
ATOM   6975  C  CG1   . ILE C  1 292  ? 202.779 181.761 175.993 1.00 91.79  ? 286  ILE B CG1   1 
ATOM   6976  C  CG2   . ILE C  1 292  ? 200.806 183.221 176.590 1.00 91.79  ? 286  ILE B CG2   1 
ATOM   6977  C  CD1   . ILE C  1 292  ? 203.515 181.333 174.761 1.00 91.79  ? 286  ILE B CD1   1 
ATOM   6978  N  N     . LEU C  1 293  ? 198.511 181.119 177.389 1.00 98.56  ? 287  LEU B N     1 
ATOM   6979  C  CA    . LEU C  1 293  ? 197.141 181.467 177.743 1.00 98.56  ? 287  LEU B CA    1 
ATOM   6980  C  C     . LEU C  1 293  ? 197.192 182.526 178.833 1.00 98.56  ? 287  LEU B C     1 
ATOM   6981  O  O     . LEU C  1 293  ? 197.755 182.288 179.906 1.00 98.56  ? 287  LEU B O     1 
ATOM   6982  C  CB    . LEU C  1 293  ? 196.369 180.241 178.211 1.00 98.56  ? 287  LEU B CB    1 
ATOM   6983  C  CG    . LEU C  1 293  ? 194.938 180.495 178.663 1.00 98.56  ? 287  LEU B CG    1 
ATOM   6984  C  CD1   . LEU C  1 293  ? 194.117 181.057 177.531 1.00 98.56  ? 287  LEU B CD1   1 
ATOM   6985  C  CD2   . LEU C  1 293  ? 194.338 179.204 179.167 1.00 98.56  ? 287  LEU B CD2   1 
ATOM   6986  N  N     . GLU C  1 294  ? 196.610 183.689 178.563 1.00 110.75 ? 288  GLU B N     1 
ATOM   6987  C  CA    . GLU C  1 294  ? 196.699 184.836 179.455 1.00 110.75 ? 288  GLU B CA    1 
ATOM   6988  C  C     . GLU C  1 294  ? 195.325 185.467 179.606 1.00 110.75 ? 288  GLU B C     1 
ATOM   6989  O  O     . GLU C  1 294  ? 194.672 185.790 178.608 1.00 110.75 ? 288  GLU B O     1 
ATOM   6990  C  CB    . GLU C  1 294  ? 197.706 185.849 178.922 1.00 110.75 ? 288  GLU B CB    1 
ATOM   6991  C  CG    . GLU C  1 294  ? 199.119 185.312 178.916 1.00 110.75 ? 288  GLU B CG    1 
ATOM   6992  C  CD    . GLU C  1 294  ? 200.116 186.283 178.331 1.00 110.75 ? 288  GLU B CD    1 
ATOM   6993  O  OE1   . GLU C  1 294  ? 199.696 187.353 177.847 1.00 110.75 ? 288  GLU B OE1   1 
ATOM   6994  O  OE2   . GLU C  1 294  ? 201.325 185.968 178.342 1.00 110.75 ? 288  GLU B OE2   1 
ATOM   6995  N  N     . GLY C  1 295  ? 194.892 185.638 180.846 1.00 108.29 ? 289  GLY B N     1 
ATOM   6996  C  CA    . GLY C  1 295  ? 193.601 186.234 181.122 1.00 108.29 ? 289  GLY B CA    1 
ATOM   6997  C  C     . GLY C  1 295  ? 193.517 186.685 182.562 1.00 108.29 ? 289  GLY B C     1 
ATOM   6998  O  O     . GLY C  1 295  ? 194.459 186.535 183.337 1.00 108.29 ? 289  GLY B O     1 
ATOM   6999  N  N     . VAL C  1 296  ? 192.367 187.232 182.914 1.00 111.83 ? 290  VAL B N     1 
ATOM   7000  C  CA    . VAL C  1 296  ? 192.144 187.767 184.249 1.00 111.83 ? 290  VAL B CA    1 
ATOM   7001  C  C     . VAL C  1 296  ? 191.270 186.806 185.038 1.00 111.83 ? 290  VAL B C     1 
ATOM   7002  O  O     . VAL C  1 296  ? 190.222 186.365 184.554 1.00 111.83 ? 290  VAL B O     1 
ATOM   7003  C  CB    . VAL C  1 296  ? 191.503 189.159 184.177 1.00 111.83 ? 290  VAL B CB    1 
ATOM   7004  C  CG1   . VAL C  1 296  ? 191.104 189.626 185.560 1.00 111.83 ? 290  VAL B CG1   1 
ATOM   7005  C  CG2   . VAL C  1 296  ? 192.465 190.144 183.540 1.00 111.83 ? 290  VAL B CG2   1 
ATOM   7006  N  N     . VAL C  1 297  ? 191.699 186.484 186.258 1.00 114.35 ? 291  VAL B N     1 
ATOM   7007  C  CA    . VAL C  1 297  ? 190.880 185.675 187.144 1.00 114.35 ? 291  VAL B CA    1 
ATOM   7008  C  C     . VAL C  1 297  ? 189.612 186.440 187.495 1.00 114.35 ? 291  VAL B C     1 
ATOM   7009  O  O     . VAL C  1 297  ? 189.623 187.663 187.669 1.00 114.35 ? 291  VAL B O     1 
ATOM   7010  C  CB    . VAL C  1 297  ? 191.669 185.293 188.409 1.00 114.35 ? 291  VAL B CB    1 
ATOM   7011  C  CG1   . VAL C  1 297  ? 190.806 184.491 189.365 1.00 114.35 ? 291  VAL B CG1   1 
ATOM   7012  C  CG2   . VAL C  1 297  ? 192.911 184.519 188.029 1.00 114.35 ? 291  VAL B CG2   1 
ATOM   7013  N  N     . GLU C  1 298  ? 188.502 185.712 187.586 1.00 125.04 ? 292  GLU B N     1 
ATOM   7014  C  CA    . GLU C  1 298  ? 187.215 186.356 187.813 1.00 125.04 ? 292  GLU B CA    1 
ATOM   7015  C  C     . GLU C  1 298  ? 187.138 186.971 189.202 1.00 125.04 ? 292  GLU B C     1 
ATOM   7016  O  O     . GLU C  1 298  ? 186.843 188.161 189.345 1.00 125.04 ? 292  GLU B O     1 
ATOM   7017  C  CB    . GLU C  1 298  ? 186.092 185.347 187.606 1.00 125.04 ? 292  GLU B CB    1 
ATOM   7018  C  CG    . GLU C  1 298  ? 184.705 185.934 187.647 1.00 125.04 ? 292  GLU B CG    1 
ATOM   7019  C  CD    . GLU C  1 298  ? 183.643 184.898 187.343 1.00 125.04 ? 292  GLU B CD    1 
ATOM   7020  O  OE1   . GLU C  1 298  ? 184.002 183.717 187.148 1.00 125.04 ? 292  GLU B OE1   1 
ATOM   7021  O  OE2   . GLU C  1 298  ? 182.452 185.267 187.288 1.00 125.04 ? 292  GLU B OE2   1 
ATOM   7022  N  N     . THR C  1 299  ? 187.406 186.178 190.235 1.00 127.15 ? 293  THR B N     1 
ATOM   7023  C  CA    . THR C  1 299  ? 187.320 186.671 191.601 1.00 127.15 ? 293  THR B CA    1 
ATOM   7024  C  C     . THR C  1 299  ? 188.399 187.691 191.923 1.00 127.15 ? 293  THR B C     1 
ATOM   7025  O  O     . THR C  1 299  ? 188.096 188.752 192.476 1.00 127.15 ? 293  THR B O     1 
ATOM   7026  C  CB    . THR C  1 299  ? 187.428 185.505 192.582 1.00 127.15 ? 293  THR B CB    1 
ATOM   7027  O  OG1   . THR C  1 299  ? 188.723 184.903 192.461 1.00 127.15 ? 293  THR B OG1   1 
ATOM   7028  C  CG2   . THR C  1 299  ? 186.385 184.470 192.260 1.00 127.15 ? 293  THR B CG2   1 
ATOM   7029  N  N     . THR C  1 300  ? 189.643 187.395 191.581 1.00 126.70 ? 294  THR B N     1 
ATOM   7030  C  CA    . THR C  1 300  ? 190.750 188.306 191.788 1.00 126.70 ? 294  THR B CA    1 
ATOM   7031  C  C     . THR C  1 300  ? 191.096 188.967 190.465 1.00 126.70 ? 294  THR B C     1 
ATOM   7032  O  O     . THR C  1 300  ? 191.512 188.303 189.513 1.00 126.70 ? 294  THR B O     1 
ATOM   7033  C  CB    . THR C  1 300  ? 191.975 187.574 192.336 1.00 126.70 ? 294  THR B CB    1 
ATOM   7034  O  OG1   . THR C  1 300  ? 192.452 186.648 191.353 1.00 126.70 ? 294  THR B OG1   1 
ATOM   7035  C  CG2   . THR C  1 300  ? 191.604 186.810 193.585 1.00 126.70 ? 294  THR B CG2   1 
ATOM   7036  N  N     . GLY C  1 301  ? 190.941 190.289 190.418 1.00 128.11 ? 295  GLY B N     1 
ATOM   7037  C  CA    . GLY C  1 301  ? 191.154 191.019 189.181 1.00 128.11 ? 295  GLY B CA    1 
ATOM   7038  C  C     . GLY C  1 301  ? 192.546 190.896 188.601 1.00 128.11 ? 295  GLY B C     1 
ATOM   7039  O  O     . GLY C  1 301  ? 192.826 191.523 187.574 1.00 128.11 ? 295  GLY B O     1 
ATOM   7040  N  N     . ILE C  1 302  ? 193.419 190.118 189.231 1.00 122.25 ? 296  ILE B N     1 
ATOM   7041  C  CA    . ILE C  1 302  ? 194.789 189.951 188.771 1.00 122.25 ? 296  ILE B CA    1 
ATOM   7042  C  C     . ILE C  1 302  ? 194.819 189.010 187.576 1.00 122.25 ? 296  ILE B C     1 
ATOM   7043  O  O     . ILE C  1 302  ? 193.828 188.342 187.266 1.00 122.25 ? 296  ILE B O     1 
ATOM   7044  C  CB    . ILE C  1 302  ? 195.683 189.439 189.908 1.00 122.25 ? 296  ILE B CB    1 
ATOM   7045  C  CG1   . ILE C  1 302  ? 195.173 188.094 190.412 1.00 122.25 ? 296  ILE B CG1   1 
ATOM   7046  C  CG2   . ILE C  1 302  ? 195.704 190.442 191.039 1.00 122.25 ? 296  ILE B CG2   1 
ATOM   7047  C  CD1   . ILE C  1 302  ? 196.108 187.433 191.388 1.00 122.25 ? 296  ILE B CD1   1 
ATOM   7048  N  N     . THR C  1 303  ? 195.961 188.958 186.898 1.00 111.58 ? 297  THR B N     1 
ATOM   7049  C  CA    . THR C  1 303  ? 196.126 188.207 185.662 1.00 111.58 ? 297  THR B CA    1 
ATOM   7050  C  C     . THR C  1 303  ? 196.981 186.986 185.942 1.00 111.58 ? 297  THR B C     1 
ATOM   7051  O  O     . THR C  1 303  ? 197.907 187.045 186.757 1.00 111.58 ? 297  THR B O     1 
ATOM   7052  C  CB    . THR C  1 303  ? 196.766 189.079 184.585 1.00 111.58 ? 297  THR B CB    1 
ATOM   7053  O  OG1   . THR C  1 303  ? 195.892 190.171 184.279 1.00 111.58 ? 297  THR B OG1   1 
ATOM   7054  C  CG2   . THR C  1 303  ? 197.040 188.287 183.326 1.00 111.58 ? 297  THR B CG2   1 
ATOM   7055  N  N     . THR C  1 304  ? 196.659 185.881 185.288 1.00 104.63 ? 298  THR B N     1 
ATOM   7056  C  CA    . THR C  1 304  ? 197.476 184.684 185.348 1.00 104.63 ? 298  THR B CA    1 
ATOM   7057  C  C     . THR C  1 304  ? 197.828 184.207 183.947 1.00 104.63 ? 298  THR B C     1 
ATOM   7058  O  O     . THR C  1 304  ? 197.194 184.577 182.956 1.00 104.63 ? 298  THR B O     1 
ATOM   7059  C  CB    . THR C  1 304  ? 196.758 183.572 186.107 1.00 104.63 ? 298  THR B CB    1 
ATOM   7060  O  OG1   . THR C  1 304  ? 197.642 182.455 186.255 1.00 104.63 ? 298  THR B OG1   1 
ATOM   7061  C  CG2   . THR C  1 304  ? 195.512 183.144 185.352 1.00 104.63 ? 298  THR B CG2   1 
ATOM   7062  N  N     . GLN C  1 305  ? 198.857 183.368 183.881 1.00 103.55 ? 299  GLN B N     1 
ATOM   7063  C  CA    . GLN C  1 305  ? 199.317 182.797 182.623 1.00 103.55 ? 299  GLN B CA    1 
ATOM   7064  C  C     . GLN C  1 305  ? 199.611 181.325 182.830 1.00 103.55 ? 299  GLN B C     1 
ATOM   7065  O  O     . GLN C  1 305  ? 200.320 180.958 183.772 1.00 103.55 ? 299  GLN B O     1 
ATOM   7066  C  CB    . GLN C  1 305  ? 200.568 183.504 182.110 1.00 103.55 ? 299  GLN B CB    1 
ATOM   7067  C  CG    . GLN C  1 305  ? 201.066 182.928 180.811 1.00 103.55 ? 299  GLN B CG    1 
ATOM   7068  C  CD    . GLN C  1 305  ? 202.313 183.606 180.315 1.00 103.55 ? 299  GLN B CD    1 
ATOM   7069  O  OE1   . GLN C  1 305  ? 202.836 184.513 180.961 1.00 103.55 ? 299  GLN B OE1   1 
ATOM   7070  N  NE2   . GLN C  1 305  ? 202.805 183.171 179.166 1.00 103.55 ? 299  GLN B NE2   1 
ATOM   7071  N  N     . ALA C  1 306  ? 199.075 180.487 181.953 1.00 104.27 ? 300  ALA B N     1 
ATOM   7072  C  CA    . ALA C  1 306  ? 199.446 179.084 181.882 1.00 104.27 ? 300  ALA B CA    1 
ATOM   7073  C  C     . ALA C  1 306  ? 200.277 178.868 180.627 1.00 104.27 ? 300  ALA B C     1 
ATOM   7074  O  O     . ALA C  1 306  ? 200.095 179.570 179.627 1.00 104.27 ? 300  ALA B O     1 
ATOM   7075  C  CB    . ALA C  1 306  ? 198.212 178.185 181.873 1.00 104.27 ? 300  ALA B CB    1 
ATOM   7076  N  N     . ARG C  1 307  ? 201.198 177.921 180.685 1.00 105.77 ? 301  ARG B N     1 
ATOM   7077  C  CA    . ARG C  1 307  ? 202.023 177.576 179.544 1.00 105.77 ? 301  ARG B CA    1 
ATOM   7078  C  C     . ARG C  1 307  ? 201.953 176.082 179.287 1.00 105.77 ? 301  ARG B C     1 
ATOM   7079  O  O     . ARG C  1 307  ? 201.908 175.273 180.216 1.00 105.77 ? 301  ARG B O     1 
ATOM   7080  C  CB    . ARG C  1 307  ? 203.483 177.984 179.754 1.00 105.77 ? 301  ARG B CB    1 
ATOM   7081  C  CG    . ARG C  1 307  ? 203.766 179.431 179.449 1.00 105.77 ? 301  ARG B CG    1 
ATOM   7082  C  CD    . ARG C  1 307  ? 203.361 180.313 180.609 1.00 105.77 ? 301  ARG B CD    1 
ATOM   7083  N  NE    . ARG C  1 307  ? 204.152 180.049 181.799 1.00 105.77 ? 301  ARG B NE    1 
ATOM   7084  C  CZ    . ARG C  1 307  ? 203.844 180.496 183.010 1.00 105.77 ? 301  ARG B CZ    1 
ATOM   7085  N  NH1   . ARG C  1 307  ? 202.754 181.230 183.184 1.00 105.77 ? 301  ARG B NH1   1 
ATOM   7086  N  NH2   . ARG C  1 307  ? 204.623 180.210 184.042 1.00 105.77 ? 301  ARG B NH2   1 
ATOM   7087  N  N     . THR C  1 308  ? 201.940 175.727 178.010 1.00 107.69 ? 302  THR B N     1 
ATOM   7088  C  CA    . THR C  1 308  ? 202.116 174.348 177.596 1.00 107.69 ? 302  THR B CA    1 
ATOM   7089  C  C     . THR C  1 308  ? 202.856 174.361 176.276 1.00 107.69 ? 302  THR B C     1 
ATOM   7090  O  O     . THR C  1 308  ? 202.819 175.339 175.526 1.00 107.69 ? 302  THR B O     1 
ATOM   7091  C  CB    . THR C  1 308  ? 200.784 173.610 177.472 1.00 107.69 ? 302  THR B CB    1 
ATOM   7092  O  OG1   . THR C  1 308  ? 201.035 172.226 177.203 1.00 107.69 ? 302  THR B OG1   1 
ATOM   7093  C  CG2   . THR C  1 308  ? 199.963 174.193 176.348 1.00 107.69 ? 302  THR B CG2   1 
ATOM   7094  N  N     . SER C  1 309  ? 203.540 173.262 175.993 1.00 116.02 ? 303  SER B N     1 
ATOM   7095  C  CA    . SER C  1 309  ? 204.358 173.207 174.797 1.00 116.02 ? 303  SER B CA    1 
ATOM   7096  C  C     . SER C  1 309  ? 204.156 171.866 174.122 1.00 116.02 ? 303  SER B C     1 
ATOM   7097  O  O     . SER C  1 309  ? 203.751 170.884 174.747 1.00 116.02 ? 303  SER B O     1 
ATOM   7098  C  CB    . SER C  1 309  ? 205.834 173.444 175.119 1.00 116.02 ? 303  SER B CB    1 
ATOM   7099  O  OG    . SER C  1 309  ? 206.340 172.419 175.952 1.00 116.02 ? 303  SER B OG    1 
ATOM   7100  N  N     . TYR C  1 310  ? 204.447 171.838 172.829 1.00 112.58 ? 304  TYR B N     1 
ATOM   7101  C  CA    . TYR C  1 310  ? 204.339 170.611 172.053 1.00 112.58 ? 304  TYR B CA    1 
ATOM   7102  C  C     . TYR C  1 310  ? 205.543 170.559 171.131 1.00 112.58 ? 304  TYR B C     1 
ATOM   7103  O  O     . TYR C  1 310  ? 205.705 171.434 170.277 1.00 112.58 ? 304  TYR B O     1 
ATOM   7104  C  CB    . TYR C  1 310  ? 203.042 170.564 171.258 1.00 112.58 ? 304  TYR B CB    1 
ATOM   7105  C  CG    . TYR C  1 310  ? 201.813 170.463 172.113 1.00 112.58 ? 304  TYR B CG    1 
ATOM   7106  C  CD1   . TYR C  1 310  ? 201.437 169.257 172.676 1.00 112.58 ? 304  TYR B CD1   1 
ATOM   7107  C  CD2   . TYR C  1 310  ? 201.023 171.571 172.355 1.00 112.58 ? 304  TYR B CD2   1 
ATOM   7108  C  CE1   . TYR C  1 310  ? 200.315 169.159 173.459 1.00 112.58 ? 304  TYR B CE1   1 
ATOM   7109  C  CE2   . TYR C  1 310  ? 199.900 171.482 173.135 1.00 112.58 ? 304  TYR B CE2   1 
ATOM   7110  C  CZ    . TYR C  1 310  ? 199.550 170.277 173.685 1.00 112.58 ? 304  TYR B CZ    1 
ATOM   7111  O  OH    . TYR C  1 310  ? 198.425 170.187 174.467 1.00 112.58 ? 304  TYR B OH    1 
ATOM   7112  N  N     . LEU C  1 311  ? 206.389 169.557 171.316 1.00 120.86 ? 305  LEU B N     1 
ATOM   7113  C  CA    . LEU C  1 311  ? 207.459 169.330 170.364 1.00 120.86 ? 305  LEU B CA    1 
ATOM   7114  C  C     . LEU C  1 311  ? 206.930 168.383 169.290 1.00 120.86 ? 305  LEU B C     1 
ATOM   7115  O  O     . LEU C  1 311  ? 205.744 168.046 169.263 1.00 120.86 ? 305  LEU B O     1 
ATOM   7116  C  CB    . LEU C  1 311  ? 208.718 168.846 171.081 1.00 120.86 ? 305  LEU B CB    1 
ATOM   7117  C  CG    . LEU C  1 311  ? 208.774 167.518 171.826 1.00 120.86 ? 305  LEU B CG    1 
ATOM   7118  C  CD1   . LEU C  1 311  ? 209.238 166.417 170.896 1.00 120.86 ? 305  LEU B CD1   1 
ATOM   7119  C  CD2   . LEU C  1 311  ? 209.702 167.633 173.015 1.00 120.86 ? 305  LEU B CD2   1 
ATOM   7120  N  N     . ALA C  1 312  ? 207.809 167.942 168.393 1.00 125.32 ? 306  ALA B N     1 
ATOM   7121  C  CA    . ALA C  1 312  ? 207.355 167.417 167.112 1.00 125.32 ? 306  ALA B CA    1 
ATOM   7122  C  C     . ALA C  1 312  ? 206.507 166.160 167.268 1.00 125.32 ? 306  ALA B C     1 
ATOM   7123  O  O     . ALA C  1 312  ? 205.496 166.000 166.576 1.00 125.32 ? 306  ALA B O     1 
ATOM   7124  C  CB    . ALA C  1 312  ? 208.559 167.160 166.212 1.00 125.32 ? 306  ALA B CB    1 
ATOM   7125  N  N     . ASP C  1 313  ? 206.883 165.265 168.182 1.00 133.46 ? 307  ASP B N     1 
ATOM   7126  C  CA    . ASP C  1 313  ? 206.203 163.975 168.255 1.00 133.46 ? 307  ASP B CA    1 
ATOM   7127  C  C     . ASP C  1 313  ? 204.803 164.110 168.842 1.00 133.46 ? 307  ASP B C     1 
ATOM   7128  O  O     . ASP C  1 313  ? 203.856 163.484 168.353 1.00 133.46 ? 307  ASP B O     1 
ATOM   7129  C  CB    . ASP C  1 313  ? 207.043 162.983 169.061 1.00 133.46 ? 307  ASP B CB    1 
ATOM   7130  C  CG    . ASP C  1 313  ? 207.234 163.411 170.506 1.00 133.46 ? 307  ASP B CG    1 
ATOM   7131  O  OD1   . ASP C  1 313  ? 206.757 164.500 170.887 1.00 133.46 ? 307  ASP B OD1   1 
ATOM   7132  O  OD2   . ASP C  1 313  ? 207.862 162.650 171.269 1.00 133.46 ? 307  ASP B OD2   1 
ATOM   7133  N  N     . GLU C  1 314  ? 204.657 164.921 169.894 1.00 123.68 ? 308  GLU B N     1 
ATOM   7134  C  CA    . GLU C  1 314  ? 203.354 165.148 170.510 1.00 123.68 ? 308  GLU B CA    1 
ATOM   7135  C  C     . GLU C  1 314  ? 202.353 165.725 169.527 1.00 123.68 ? 308  GLU B C     1 
ATOM   7136  O  O     . GLU C  1 314  ? 201.146 165.655 169.771 1.00 123.68 ? 308  GLU B O     1 
ATOM   7137  C  CB    . GLU C  1 314  ? 203.486 166.086 171.707 1.00 123.68 ? 308  GLU B CB    1 
ATOM   7138  C  CG    . GLU C  1 314  ? 204.258 165.504 172.870 1.00 123.68 ? 308  GLU B CG    1 
ATOM   7139  C  CD    . GLU C  1 314  ? 204.389 166.477 174.015 1.00 123.68 ? 308  GLU B CD    1 
ATOM   7140  O  OE1   . GLU C  1 314  ? 203.995 167.648 173.847 1.00 123.68 ? 308  GLU B OE1   1 
ATOM   7141  O  OE2   . GLU C  1 314  ? 204.879 166.071 175.087 1.00 123.68 ? 308  GLU B OE2   1 
ATOM   7142  N  N     . ILE C  1 315  ? 202.834 166.298 168.430 1.00 120.86 ? 309  ILE B N     1 
ATOM   7143  C  CA    . ILE C  1 315  ? 201.977 166.834 167.387 1.00 120.86 ? 309  ILE B CA    1 
ATOM   7144  C  C     . ILE C  1 315  ? 201.554 165.653 166.524 1.00 120.86 ? 309  ILE B C     1 
ATOM   7145  O  O     . ILE C  1 315  ? 202.220 165.308 165.549 1.00 120.86 ? 309  ILE B O     1 
ATOM   7146  C  CB    . ILE C  1 315  ? 202.700 167.900 166.568 1.00 120.86 ? 309  ILE B CB    1 
ATOM   7147  C  CG1   . ILE C  1 315  ? 203.178 169.023 167.478 1.00 120.86 ? 309  ILE B CG1   1 
ATOM   7148  C  CG2   . ILE C  1 315  ? 201.774 168.460 165.538 1.00 120.86 ? 309  ILE B CG2   1 
ATOM   7149  C  CD1   . ILE C  1 315  ? 204.163 169.955 166.817 1.00 120.86 ? 309  ILE B CD1   1 
ATOM   7150  N  N     . LEU C  1 316  ? 200.442 165.026 166.888 1.00 118.93 ? 310  LEU B N     1 
ATOM   7151  C  CA    . LEU C  1 316  ? 199.971 163.888 166.122 1.00 118.93 ? 310  LEU B CA    1 
ATOM   7152  C  C     . LEU C  1 316  ? 199.507 164.342 164.742 1.00 118.93 ? 310  LEU B C     1 
ATOM   7153  O  O     . LEU C  1 316  ? 198.745 165.298 164.597 1.00 118.93 ? 310  LEU B O     1 
ATOM   7154  C  CB    . LEU C  1 316  ? 198.834 163.177 166.856 1.00 118.93 ? 310  LEU B CB    1 
ATOM   7155  C  CG    . LEU C  1 316  ? 199.231 162.562 168.196 1.00 118.93 ? 310  LEU B CG    1 
ATOM   7156  C  CD1   . LEU C  1 316  ? 198.024 161.984 168.921 1.00 118.93 ? 310  LEU B CD1   1 
ATOM   7157  C  CD2   . LEU C  1 316  ? 200.301 161.505 168.000 1.00 118.93 ? 310  LEU B CD2   1 
ATOM   7158  N  N     . TRP C  1 317  ? 199.965 163.627 163.723 1.00 108.72 ? 311  TRP B N     1 
ATOM   7159  C  CA    . TRP C  1 317  ? 199.662 163.961 162.342 1.00 108.72 ? 311  TRP B CA    1 
ATOM   7160  C  C     . TRP C  1 317  ? 198.398 163.239 161.906 1.00 108.72 ? 311  TRP B C     1 
ATOM   7161  O  O     . TRP C  1 317  ? 198.266 162.028 162.094 1.00 108.72 ? 311  TRP B O     1 
ATOM   7162  C  CB    . TRP C  1 317  ? 200.808 163.581 161.414 1.00 108.72 ? 311  TRP B CB    1 
ATOM   7163  C  CG    . TRP C  1 317  ? 200.536 163.926 159.990 1.00 108.72 ? 311  TRP B CG    1 
ATOM   7164  C  CD1   . TRP C  1 317  ? 200.052 163.094 159.030 1.00 108.72 ? 311  TRP B CD1   1 
ATOM   7165  C  CD2   . TRP C  1 317  ? 200.750 165.190 159.354 1.00 108.72 ? 311  TRP B CD2   1 
ATOM   7166  N  NE1   . TRP C  1 317  ? 199.942 163.760 157.839 1.00 108.72 ? 311  TRP B NE1   1 
ATOM   7167  C  CE2   . TRP C  1 317  ? 200.360 165.052 158.011 1.00 108.72 ? 311  TRP B CE2   1 
ATOM   7168  C  CE3   . TRP C  1 317  ? 201.227 166.427 159.792 1.00 108.72 ? 311  TRP B CE3   1 
ATOM   7169  C  CZ2   . TRP C  1 317  ? 200.433 166.099 157.099 1.00 108.72 ? 311  TRP B CZ2   1 
ATOM   7170  C  CZ3   . TRP C  1 317  ? 201.300 167.466 158.884 1.00 108.72 ? 311  TRP B CZ3   1 
ATOM   7171  C  CH2   . TRP C  1 317  ? 200.909 167.293 157.554 1.00 108.72 ? 311  TRP B CH2   1 
ATOM   7172  N  N     . GLY C  1 318  ? 197.472 163.989 161.322 1.00 104.69 ? 312  GLY B N     1 
ATOM   7173  C  CA    . GLY C  1 318  ? 196.283 163.382 160.754 1.00 104.69 ? 312  GLY B CA    1 
ATOM   7174  C  C     . GLY C  1 318  ? 195.340 162.769 161.763 1.00 104.69 ? 312  GLY B C     1 
ATOM   7175  O  O     . GLY C  1 318  ? 195.085 161.561 161.712 1.00 104.69 ? 312  GLY B O     1 
ATOM   7176  N  N     . GLN C  1 319  ? 194.823 163.569 162.688 1.00 107.96 ? 313  GLN B N     1 
ATOM   7177  C  CA    . GLN C  1 319  ? 193.782 163.125 163.599 1.00 107.96 ? 313  GLN B CA    1 
ATOM   7178  C  C     . GLN C  1 319  ? 192.817 164.269 163.855 1.00 107.96 ? 313  GLN B C     1 
ATOM   7179  O  O     . GLN C  1 319  ? 193.025 165.399 163.411 1.00 107.96 ? 313  GLN B O     1 
ATOM   7180  C  CB    . GLN C  1 319  ? 194.346 162.629 164.933 1.00 107.96 ? 313  GLN B CB    1 
ATOM   7181  C  CG    . GLN C  1 319  ? 195.120 161.342 164.847 1.00 107.96 ? 313  GLN B CG    1 
ATOM   7182  C  CD    . GLN C  1 319  ? 195.641 160.914 166.191 1.00 107.96 ? 313  GLN B CD    1 
ATOM   7183  O  OE1   . GLN C  1 319  ? 195.440 161.604 167.187 1.00 107.96 ? 313  GLN B OE1   1 
ATOM   7184  N  NE2   . GLN C  1 319  ? 196.329 159.782 166.231 1.00 107.96 ? 313  GLN B NE2   1 
ATOM   7185  N  N     . ARG C  1 320  ? 191.749 163.959 164.585 1.00 111.63 ? 314  ARG B N     1 
ATOM   7186  C  CA    . ARG C  1 320  ? 190.784 164.960 165.006 1.00 111.63 ? 314  ARG B CA    1 
ATOM   7187  C  C     . ARG C  1 320  ? 190.337 164.645 166.424 1.00 111.63 ? 314  ARG B C     1 
ATOM   7188  O  O     . ARG C  1 320  ? 189.987 163.504 166.731 1.00 111.63 ? 314  ARG B O     1 
ATOM   7189  C  CB    . ARG C  1 320  ? 189.575 165.018 164.050 1.00 111.63 ? 314  ARG B CB    1 
ATOM   7190  C  CG    . ARG C  1 320  ? 189.913 165.580 162.663 1.00 111.63 ? 314  ARG B CG    1 
ATOM   7191  C  CD    . ARG C  1 320  ? 188.723 165.659 161.698 1.00 111.63 ? 314  ARG B CD    1 
ATOM   7192  N  NE    . ARG C  1 320  ? 188.278 164.362 161.191 1.00 111.63 ? 314  ARG B NE    1 
ATOM   7193  C  CZ    . ARG C  1 320  ? 187.236 164.197 160.382 1.00 111.63 ? 314  ARG B CZ    1 
ATOM   7194  N  NH1   . ARG C  1 320  ? 186.535 165.246 159.977 1.00 111.63 ? 314  ARG B NH1   1 
ATOM   7195  N  NH2   . ARG C  1 320  ? 186.902 162.987 159.964 1.00 111.63 ? 314  ARG B NH2   1 
ATOM   7196  N  N     . PHE C  1 321  ? 190.382 165.652 167.291 1.00 112.14 ? 315  PHE B N     1 
ATOM   7197  C  CA    . PHE C  1 321  ? 189.860 165.491 168.640 1.00 112.14 ? 315  PHE B CA    1 
ATOM   7198  C  C     . PHE C  1 321  ? 188.370 165.182 168.588 1.00 112.14 ? 315  PHE B C     1 
ATOM   7199  O  O     . PHE C  1 321  ? 187.583 165.931 168.005 1.00 112.14 ? 315  PHE B O     1 
ATOM   7200  C  CB    . PHE C  1 321  ? 190.104 166.754 169.469 1.00 112.14 ? 315  PHE B CB    1 
ATOM   7201  C  CG    . PHE C  1 321  ? 191.543 166.980 169.832 1.00 112.14 ? 315  PHE B CG    1 
ATOM   7202  C  CD1   . PHE C  1 321  ? 192.111 166.324 170.906 1.00 112.14 ? 315  PHE B CD1   1 
ATOM   7203  C  CD2   . PHE C  1 321  ? 192.329 167.854 169.103 1.00 112.14 ? 315  PHE B CD2   1 
ATOM   7204  C  CE1   . PHE C  1 321  ? 193.436 166.529 171.243 1.00 112.14 ? 315  PHE B CE1   1 
ATOM   7205  C  CE2   . PHE C  1 321  ? 193.654 168.062 169.438 1.00 112.14 ? 315  PHE B CE2   1 
ATOM   7206  C  CZ    . PHE C  1 321  ? 194.204 167.399 170.509 1.00 112.14 ? 315  PHE B CZ    1 
ATOM   7207  N  N     . VAL C  1 322  ? 187.989 164.069 169.199 1.00 108.06 ? 316  VAL B N     1 
ATOM   7208  C  CA    . VAL C  1 322  ? 186.586 163.647 169.189 1.00 108.06 ? 316  VAL B CA    1 
ATOM   7209  C  C     . VAL C  1 322  ? 185.773 164.634 170.019 1.00 108.06 ? 316  VAL B C     1 
ATOM   7210  O  O     . VAL C  1 322  ? 186.237 165.061 171.091 1.00 108.06 ? 316  VAL B O     1 
ATOM   7211  C  CB    . VAL C  1 322  ? 186.449 162.231 169.731 1.00 108.06 ? 316  VAL B CB    1 
ATOM   7212  N  N     . PRO C  1 323  ? 184.591 165.030 169.568 1.00 110.43 ? 317  PRO B N     1 
ATOM   7213  C  CA    . PRO C  1 323  ? 183.798 165.996 170.332 1.00 110.43 ? 317  PRO B CA    1 
ATOM   7214  C  C     . PRO C  1 323  ? 183.377 165.447 171.684 1.00 110.43 ? 317  PRO B C     1 
ATOM   7215  O  O     . PRO C  1 323  ? 182.576 164.511 171.764 1.00 110.43 ? 317  PRO B O     1 
ATOM   7216  C  CB    . PRO C  1 323  ? 182.585 166.247 169.428 1.00 110.43 ? 317  PRO B CB    1 
ATOM   7217  C  CG    . PRO C  1 323  ? 183.060 165.902 168.067 1.00 110.43 ? 317  PRO B CG    1 
ATOM   7218  C  CD    . PRO C  1 323  ? 183.998 164.750 168.254 1.00 110.43 ? 317  PRO B CD    1 
ATOM   7219  N  N     . ILE C  1 324  ? 183.916 166.040 172.754 1.00 114.94 ? 318  ILE B N     1 
ATOM   7220  C  CA    . ILE C  1 324  ? 183.602 165.617 174.116 1.00 114.94 ? 318  ILE B CA    1 
ATOM   7221  C  C     . ILE C  1 324  ? 182.395 166.344 174.691 1.00 114.94 ? 318  ILE B C     1 
ATOM   7222  O  O     . ILE C  1 324  ? 182.158 166.273 175.903 1.00 114.94 ? 318  ILE B O     1 
ATOM   7223  C  CB    . ILE C  1 324  ? 184.825 165.811 175.037 1.00 114.94 ? 318  ILE B CB    1 
ATOM   7224  C  CG1   . ILE C  1 324  ? 185.353 167.238 174.929 1.00 114.94 ? 318  ILE B CG1   1 
ATOM   7225  C  CG2   . ILE C  1 324  ? 185.914 164.794 174.735 1.00 114.94 ? 318  ILE B CG2   1 
ATOM   7226  C  CD1   . ILE C  1 324  ? 186.420 167.553 175.935 1.00 114.94 ? 318  ILE B CD1   1 
ATOM   7227  N  N     . VAL C  1 325  ? 181.631 167.048 173.863 1.00 116.66 ? 319  VAL B N     1 
ATOM   7228  C  CA    . VAL C  1 325  ? 180.437 167.750 174.312 1.00 116.66 ? 319  VAL B CA    1 
ATOM   7229  C  C     . VAL C  1 325  ? 179.219 167.045 173.737 1.00 116.66 ? 319  VAL B C     1 
ATOM   7230  O  O     . VAL C  1 325  ? 179.261 166.530 172.613 1.00 116.66 ? 319  VAL B O     1 
ATOM   7231  C  CB    . VAL C  1 325  ? 180.475 169.223 173.883 1.00 116.66 ? 319  VAL B CB    1 
ATOM   7232  C  CG1   . VAL C  1 325  ? 179.248 169.958 174.394 1.00 116.66 ? 319  VAL B CG1   1 
ATOM   7233  C  CG2   . VAL C  1 325  ? 181.748 169.879 174.364 1.00 116.66 ? 319  VAL B CG2   1 
ATOM   7234  N  N     . ALA C  1 326  ? 178.145 166.992 174.512 1.00 128.93 ? 320  ALA B N     1 
ATOM   7235  C  CA    . ALA C  1 326  ? 176.876 166.474 174.033 1.00 128.93 ? 320  ALA B CA    1 
ATOM   7236  C  C     . ALA C  1 326  ? 175.748 167.260 174.679 1.00 128.93 ? 320  ALA B C     1 
ATOM   7237  O  O     . ALA C  1 326  ? 175.877 167.751 175.801 1.00 128.93 ? 320  ALA B O     1 
ATOM   7238  C  CB    . ALA C  1 326  ? 176.728 164.975 174.329 1.00 128.93 ? 320  ALA B CB    1 
ATOM   7239  N  N     . GLU C  1 327  ? 174.642 167.391 173.958 1.00 153.64 ? 321  GLU B N     1 
ATOM   7240  C  CA    . GLU C  1 327  ? 173.482 168.109 174.476 1.00 153.64 ? 321  GLU B CA    1 
ATOM   7241  C  C     . GLU C  1 327  ? 172.882 167.248 175.578 1.00 153.64 ? 321  GLU B C     1 
ATOM   7242  O  O     . GLU C  1 327  ? 172.197 166.259 175.306 1.00 153.64 ? 321  GLU B O     1 
ATOM   7243  C  CB    . GLU C  1 327  ? 172.473 168.395 173.369 1.00 153.64 ? 321  GLU B CB    1 
ATOM   7244  C  CG    . GLU C  1 327  ? 171.421 169.434 173.730 1.00 153.64 ? 321  GLU B CG    1 
ATOM   7245  C  CD    . GLU C  1 327  ? 170.267 168.862 174.525 1.00 153.64 ? 321  GLU B CD    1 
ATOM   7246  O  OE1   . GLU C  1 327  ? 169.974 167.659 174.370 1.00 153.64 ? 321  GLU B OE1   1 
ATOM   7247  O  OE2   . GLU C  1 327  ? 169.652 169.613 175.309 1.00 153.64 ? 321  GLU B OE2   1 
ATOM   7248  N  N     . GLU C  1 328  ? 173.159 167.608 176.824 1.00 166.36 ? 322  GLU B N     1 
ATOM   7249  C  CA    . GLU C  1 328  ? 172.621 166.881 177.960 1.00 166.36 ? 322  GLU B CA    1 
ATOM   7250  C  C     . GLU C  1 328  ? 171.119 167.097 178.058 1.00 166.36 ? 322  GLU B C     1 
ATOM   7251  O  O     . GLU C  1 328  ? 170.518 167.847 177.288 1.00 166.36 ? 322  GLU B O     1 
ATOM   7252  C  CB    . GLU C  1 328  ? 173.304 167.319 179.256 1.00 166.36 ? 322  GLU B CB    1 
ATOM   7253  N  N     . ASP C  1 329  ? 170.507 166.434 179.033 1.00 178.33 ? 323  ASP B N     1 
ATOM   7254  C  CA    . ASP C  1 329  ? 169.091 166.665 179.258 1.00 178.33 ? 323  ASP B CA    1 
ATOM   7255  C  C     . ASP C  1 329  ? 168.913 168.097 179.739 1.00 178.33 ? 323  ASP B C     1 
ATOM   7256  O  O     . ASP C  1 329  ? 169.197 168.409 180.899 1.00 178.33 ? 323  ASP B O     1 
ATOM   7257  C  CB    . ASP C  1 329  ? 168.532 165.667 180.275 1.00 178.33 ? 323  ASP B CB    1 
ATOM   7258  N  N     . GLY C  1 330  ? 168.451 168.971 178.850 1.00 174.20 ? 324  GLY B N     1 
ATOM   7259  C  CA    . GLY C  1 330  ? 168.337 170.376 179.185 1.00 174.20 ? 324  GLY B CA    1 
ATOM   7260  C  C     . GLY C  1 330  ? 169.636 171.008 179.625 1.00 174.20 ? 324  GLY B C     1 
ATOM   7261  O  O     . GLY C  1 330  ? 169.633 171.859 180.520 1.00 174.20 ? 324  GLY B O     1 
ATOM   7262  N  N     . ARG C  1 331  ? 170.749 170.617 179.016 1.00 151.64 ? 325  ARG B N     1 
ATOM   7263  C  CA    . ARG C  1 331  ? 172.064 171.071 179.443 1.00 151.64 ? 325  ARG B CA    1 
ATOM   7264  C  C     . ARG C  1 331  ? 173.059 170.711 178.351 1.00 151.64 ? 325  ARG B C     1 
ATOM   7265  O  O     . ARG C  1 331  ? 172.751 169.960 177.423 1.00 151.64 ? 325  ARG B O     1 
ATOM   7266  C  CB    . ARG C  1 331  ? 172.447 170.441 180.784 1.00 151.64 ? 325  ARG B CB    1 
ATOM   7267  C  CG    . ARG C  1 331  ? 173.692 170.992 181.437 1.00 151.64 ? 325  ARG B CG    1 
ATOM   7268  C  CD    . ARG C  1 331  ? 173.966 170.252 182.726 1.00 151.64 ? 325  ARG B CD    1 
ATOM   7269  N  NE    . ARG C  1 331  ? 172.875 170.419 183.680 1.00 151.64 ? 325  ARG B NE    1 
ATOM   7270  C  CZ    . ARG C  1 331  ? 172.729 171.479 184.468 1.00 151.64 ? 325  ARG B CZ    1 
ATOM   7271  N  NH1   . ARG C  1 331  ? 173.604 172.474 184.411 1.00 151.64 ? 325  ARG B NH1   1 
ATOM   7272  N  NH2   . ARG C  1 331  ? 171.704 171.549 185.305 1.00 151.64 ? 325  ARG B NH2   1 
ATOM   7273  N  N     . TYR C  1 332  ? 174.252 171.269 178.463 1.00 133.24 ? 326  TYR B N     1 
ATOM   7274  C  CA    . TYR C  1 332  ? 175.355 170.956 177.570 1.00 133.24 ? 326  TYR B CA    1 
ATOM   7275  C  C     . TYR C  1 332  ? 176.342 170.104 178.354 1.00 133.24 ? 326  TYR B C     1 
ATOM   7276  O  O     . TYR C  1 332  ? 176.883 170.539 179.375 1.00 133.24 ? 326  TYR B O     1 
ATOM   7277  C  CB    . TYR C  1 332  ? 175.993 172.231 177.035 1.00 133.24 ? 326  TYR B CB    1 
ATOM   7278  C  CG    . TYR C  1 332  ? 175.069 173.011 176.132 1.00 133.24 ? 326  TYR B CG    1 
ATOM   7279  C  CD1   . TYR C  1 332  ? 174.907 172.655 174.805 1.00 133.24 ? 326  TYR B CD1   1 
ATOM   7280  C  CD2   . TYR C  1 332  ? 174.347 174.093 176.611 1.00 133.24 ? 326  TYR B CD2   1 
ATOM   7281  C  CE1   . TYR C  1 332  ? 174.063 173.361 173.975 1.00 133.24 ? 326  TYR B CE1   1 
ATOM   7282  C  CE2   . TYR C  1 332  ? 173.500 174.804 175.789 1.00 133.24 ? 326  TYR B CE2   1 
ATOM   7283  C  CZ    . TYR C  1 332  ? 173.364 174.436 174.472 1.00 133.24 ? 326  TYR B CZ    1 
ATOM   7284  O  OH    . TYR C  1 332  ? 172.522 175.139 173.646 1.00 133.24 ? 326  TYR B OH    1 
ATOM   7285  N  N     . SER C  1 333  ? 176.544 168.877 177.898 1.00 133.72 ? 327  SER B N     1 
ATOM   7286  C  CA    . SER C  1 333  ? 177.324 167.894 178.627 1.00 133.72 ? 327  SER B CA    1 
ATOM   7287  C  C     . SER C  1 333  ? 178.733 167.859 178.068 1.00 133.72 ? 327  SER B C     1 
ATOM   7288  O  O     . SER C  1 333  ? 178.972 167.248 177.022 1.00 133.72 ? 327  SER B O     1 
ATOM   7289  C  CB    . SER C  1 333  ? 176.676 166.515 178.525 1.00 133.72 ? 327  SER B CB    1 
ATOM   7290  O  OG    . SER C  1 333  ? 176.648 166.071 177.187 1.00 133.72 ? 327  SER B OG    1 
ATOM   7291  N  N     . VAL C  1 334  ? 179.661 168.499 178.757 1.00 120.49 ? 328  VAL B N     1 
ATOM   7292  C  CA    . VAL C  1 334  ? 181.059 168.406 178.378 1.00 120.49 ? 328  VAL B CA    1 
ATOM   7293  C  C     . VAL C  1 334  ? 181.610 167.169 179.054 1.00 120.49 ? 328  VAL B C     1 
ATOM   7294  O  O     . VAL C  1 334  ? 181.946 167.192 180.239 1.00 120.49 ? 328  VAL B O     1 
ATOM   7295  C  CB    . VAL C  1 334  ? 181.850 169.654 178.762 1.00 120.49 ? 328  VAL B CB    1 
ATOM   7296  C  CG1   . VAL C  1 334  ? 183.302 169.439 178.401 1.00 120.49 ? 328  VAL B CG1   1 
ATOM   7297  C  CG2   . VAL C  1 334  ? 181.297 170.847 178.032 1.00 120.49 ? 328  VAL B CG2   1 
ATOM   7298  N  N     . ASP C  1 335  ? 181.699 166.082 178.307 1.00 125.38 ? 329  ASP B N     1 
ATOM   7299  C  CA    . ASP C  1 335  ? 182.288 164.866 178.843 1.00 125.38 ? 329  ASP B CA    1 
ATOM   7300  C  C     . ASP C  1 335  ? 183.777 165.129 178.971 1.00 125.38 ? 329  ASP B C     1 
ATOM   7301  O  O     . ASP C  1 335  ? 184.537 164.968 178.016 1.00 125.38 ? 329  ASP B O     1 
ATOM   7302  C  CB    . ASP C  1 335  ? 181.997 163.684 177.932 1.00 125.38 ? 329  ASP B CB    1 
ATOM   7303  C  CG    . ASP C  1 335  ? 182.438 162.375 178.525 1.00 125.38 ? 329  ASP B CG    1 
ATOM   7304  O  OD1   . ASP C  1 335  ? 183.011 162.385 179.634 1.00 125.38 ? 329  ASP B OD1   1 
ATOM   7305  O  OD2   . ASP C  1 335  ? 182.220 161.333 177.878 1.00 125.38 ? 329  ASP B OD2   1 
ATOM   7306  N  N     . TYR C  1 336  ? 184.186 165.574 180.152 1.00 123.29 ? 330  TYR B N     1 
ATOM   7307  C  CA    . TYR C  1 336  ? 185.590 165.812 180.432 1.00 123.29 ? 330  TYR B CA    1 
ATOM   7308  C  C     . TYR C  1 336  ? 186.423 164.547 180.393 1.00 123.29 ? 330  TYR B C     1 
ATOM   7309  O  O     . TYR C  1 336  ? 187.630 164.630 180.151 1.00 123.29 ? 330  TYR B O     1 
ATOM   7310  C  CB    . TYR C  1 336  ? 185.733 166.506 181.783 1.00 123.29 ? 330  TYR B CB    1 
ATOM   7311  C  CG    . TYR C  1 336  ? 185.607 168.000 181.677 1.00 123.29 ? 330  TYR B CG    1 
ATOM   7312  C  CD1   . TYR C  1 336  ? 186.729 168.778 181.443 1.00 123.29 ? 330  TYR B CD1   1 
ATOM   7313  C  CD2   . TYR C  1 336  ? 184.372 168.630 181.751 1.00 123.29 ? 330  TYR B CD2   1 
ATOM   7314  C  CE1   . TYR C  1 336  ? 186.637 170.136 181.331 1.00 123.29 ? 330  TYR B CE1   1 
ATOM   7315  C  CE2   . TYR C  1 336  ? 184.267 169.998 181.631 1.00 123.29 ? 330  TYR B CE2   1 
ATOM   7316  C  CZ    . TYR C  1 336  ? 185.409 170.754 181.424 1.00 123.29 ? 330  TYR B CZ    1 
ATOM   7317  O  OH    . TYR C  1 336  ? 185.325 172.117 181.311 1.00 123.29 ? 330  TYR B OH    1 
ATOM   7318  N  N     . SER C  1 337  ? 185.821 163.387 180.619 1.00 119.67 ? 331  SER B N     1 
ATOM   7319  C  CA    . SER C  1 337  ? 186.510 162.152 180.308 1.00 119.67 ? 331  SER B CA    1 
ATOM   7320  C  C     . SER C  1 337  ? 186.836 162.121 178.819 1.00 119.67 ? 331  SER B C     1 
ATOM   7321  O  O     . SER C  1 337  ? 186.324 162.922 178.031 1.00 119.67 ? 331  SER B O     1 
ATOM   7322  C  CB    . SER C  1 337  ? 185.651 160.952 180.680 1.00 119.67 ? 331  SER B CB    1 
ATOM   7323  O  OG    . SER C  1 337  ? 184.523 160.884 179.834 1.00 119.67 ? 331  SER B OG    1 
ATOM   7324  N  N     . LYS C  1 338  ? 187.707 161.185 178.439 1.00 123.86 ? 332  LYS B N     1 
ATOM   7325  C  CA    . LYS C  1 338  ? 188.270 161.087 177.091 1.00 123.86 ? 332  LYS B CA    1 
ATOM   7326  C  C     . LYS C  1 338  ? 188.636 162.454 176.529 1.00 123.86 ? 332  LYS B C     1 
ATOM   7327  O  O     . LYS C  1 338  ? 188.514 162.694 175.326 1.00 123.86 ? 332  LYS B O     1 
ATOM   7328  C  CB    . LYS C  1 338  ? 187.319 160.352 176.127 1.00 123.86 ? 332  LYS B CB    1 
ATOM   7329  C  CG    . LYS C  1 338  ? 186.031 161.091 175.731 1.00 123.86 ? 332  LYS B CG    1 
ATOM   7330  C  CD    . LYS C  1 338  ? 185.238 160.306 174.689 1.00 123.86 ? 332  LYS B CD    1 
ATOM   7331  C  CE    . LYS C  1 338  ? 183.922 160.987 174.331 1.00 123.86 ? 332  LYS B CE    1 
ATOM   7332  N  NZ    . LYS C  1 338  ? 184.115 162.293 173.646 1.00 123.86 ? 332  LYS B NZ    1 
ATOM   7333  N  N     . PHE C  1 339  ? 189.116 163.336 177.398 1.00 117.79 ? 333  PHE B N     1 
ATOM   7334  C  CA    . PHE C  1 339  ? 189.315 164.742 177.080 1.00 117.79 ? 333  PHE B CA    1 
ATOM   7335  C  C     . PHE C  1 339  ? 190.162 164.950 175.833 1.00 117.79 ? 333  PHE B C     1 
ATOM   7336  O  O     . PHE C  1 339  ? 189.731 165.611 174.885 1.00 117.79 ? 333  PHE B O     1 
ATOM   7337  C  CB    . PHE C  1 339  ? 189.965 165.449 178.269 1.00 117.79 ? 333  PHE B CB    1 
ATOM   7338  C  CG    . PHE C  1 339  ? 190.213 166.911 178.045 1.00 117.79 ? 333  PHE B CG    1 
ATOM   7339  C  CD1   . PHE C  1 339  ? 189.177 167.820 178.110 1.00 117.79 ? 333  PHE B CD1   1 
ATOM   7340  C  CD2   . PHE C  1 339  ? 191.489 167.375 177.784 1.00 117.79 ? 333  PHE B CD2   1 
ATOM   7341  C  CE1   . PHE C  1 339  ? 189.409 169.163 177.913 1.00 117.79 ? 333  PHE B CE1   1 
ATOM   7342  C  CE2   . PHE C  1 339  ? 191.723 168.717 177.584 1.00 117.79 ? 333  PHE B CE2   1 
ATOM   7343  C  CZ    . PHE C  1 339  ? 190.681 169.610 177.648 1.00 117.79 ? 333  PHE B CZ    1 
ATOM   7344  N  N     . GLY C  1 340  ? 191.372 164.405 175.835 1.00 114.60 ? 334  GLY B N     1 
ATOM   7345  C  CA    . GLY C  1 340  ? 192.268 164.575 174.713 1.00 114.60 ? 334  GLY B CA    1 
ATOM   7346  C  C     . GLY C  1 340  ? 192.236 163.401 173.760 1.00 114.60 ? 334  GLY B C     1 
ATOM   7347  O  O     . GLY C  1 340  ? 193.039 163.339 172.827 1.00 114.60 ? 334  GLY B O     1 
ATOM   7348  N  N     . ASN C  1 341  ? 191.325 162.457 173.991 1.00 120.65 ? 335  ASN B N     1 
ATOM   7349  C  CA    . ASN C  1 341  ? 191.192 161.321 173.091 1.00 120.65 ? 335  ASN B CA    1 
ATOM   7350  C  C     . ASN C  1 341  ? 190.800 161.790 171.701 1.00 120.65 ? 335  ASN B C     1 
ATOM   7351  O  O     . ASN C  1 341  ? 189.853 162.560 171.534 1.00 120.65 ? 335  ASN B O     1 
ATOM   7352  C  CB    . ASN C  1 341  ? 190.177 160.308 173.620 1.00 120.65 ? 335  ASN B CB    1 
ATOM   7353  C  CG    . ASN C  1 341  ? 190.765 159.401 174.683 1.00 120.65 ? 335  ASN B CG    1 
ATOM   7354  O  OD1   . ASN C  1 341  ? 190.365 159.431 175.843 1.00 120.65 ? 335  ASN B OD1   1 
ATOM   7355  N  ND2   . ASN C  1 341  ? 191.722 158.576 174.283 1.00 120.65 ? 335  ASN B ND2   1 
ATOM   7356  N  N     . THR C  1 342  ? 191.542 161.317 170.709 1.00 118.20 ? 336  THR B N     1 
ATOM   7357  C  CA    . THR C  1 342  ? 191.418 161.713 169.317 1.00 118.20 ? 336  THR B CA    1 
ATOM   7358  C  C     . THR C  1 342  ? 190.927 160.544 168.475 1.00 118.20 ? 336  THR B C     1 
ATOM   7359  O  O     . THR C  1 342  ? 190.564 159.482 168.985 1.00 118.20 ? 336  THR B O     1 
ATOM   7360  C  CB    . THR C  1 342  ? 192.757 162.213 168.779 1.00 118.20 ? 336  THR B CB    1 
ATOM   7361  O  OG1   . THR C  1 342  ? 193.706 161.143 168.805 1.00 118.20 ? 336  THR B OG1   1 
ATOM   7362  C  CG2   . THR C  1 342  ? 193.275 163.335 169.639 1.00 118.20 ? 336  THR B CG2   1 
ATOM   7363  N  N     . ILE C  1 343  ? 190.913 160.762 167.164 1.00 122.92 ? 337  ILE B N     1 
ATOM   7364  C  CA    . ILE C  1 343  ? 190.604 159.725 166.188 1.00 122.92 ? 337  ILE B CA    1 
ATOM   7365  C  C     . ILE C  1 343  ? 191.489 159.926 164.964 1.00 122.92 ? 337  ILE B C     1 
ATOM   7366  O  O     . ILE C  1 343  ? 191.693 161.057 164.511 1.00 122.92 ? 337  ILE B O     1 
ATOM   7367  C  CB    . ILE C  1 343  ? 189.105 159.730 165.810 1.00 122.92 ? 337  ILE B CB    1 
ATOM   7368  C  CG1   . ILE C  1 343  ? 188.772 158.561 164.875 1.00 122.92 ? 337  ILE B CG1   1 
ATOM   7369  C  CG2   . ILE C  1 343  ? 188.673 161.080 165.238 1.00 122.92 ? 337  ILE B CG2   1 
ATOM   7370  C  CD1   . ILE C  1 343  ? 188.947 157.195 165.506 1.00 122.92 ? 337  ILE B CD1   1 
ATOM   7371  N  N     . LYS C  1 344  ? 192.027 158.828 164.437 1.00 114.42 ? 338  LYS B N     1 
ATOM   7372  C  CA    . LYS C  1 344  ? 192.947 158.915 163.311 1.00 114.42 ? 338  LYS B CA    1 
ATOM   7373  C  C     . LYS C  1 344  ? 192.194 159.113 162.002 1.00 114.42 ? 338  LYS B C     1 
ATOM   7374  O  O     . LYS C  1 344  ? 191.164 158.476 161.765 1.00 114.42 ? 338  LYS B O     1 
ATOM   7375  C  CB    . LYS C  1 344  ? 193.811 157.661 163.227 1.00 114.42 ? 338  LYS B CB    1 
ATOM   7376  C  CG    . LYS C  1 344  ? 194.812 157.518 164.352 1.00 114.42 ? 338  LYS B CG    1 
ATOM   7377  C  CD    . LYS C  1 344  ? 195.665 156.285 164.147 1.00 114.42 ? 338  LYS B CD    1 
ATOM   7378  C  CE    . LYS C  1 344  ? 196.761 156.188 165.189 1.00 114.42 ? 338  LYS B CE    1 
ATOM   7379  N  NZ    . LYS C  1 344  ? 196.216 155.952 166.552 1.00 114.42 ? 338  LYS B NZ    1 
ATOM   7380  N  N     . VAL C  1 345  ? 192.715 159.996 161.154 1.00 118.91 ? 339  VAL B N     1 
ATOM   7381  C  CA    . VAL C  1 345  ? 192.176 160.244 159.818 1.00 118.91 ? 339  VAL B CA    1 
ATOM   7382  C  C     . VAL C  1 345  ? 193.339 160.424 158.848 1.00 118.91 ? 339  VAL B C     1 
ATOM   7383  O  O     . VAL C  1 345  ? 194.265 161.196 159.134 1.00 118.91 ? 339  VAL B O     1 
ATOM   7384  C  CB    . VAL C  1 345  ? 191.257 161.475 159.798 1.00 118.91 ? 339  VAL B CB    1 
ATOM   7385  C  CG1   . VAL C  1 345  ? 190.809 161.769 158.382 1.00 118.91 ? 339  VAL B CG1   1 
ATOM   7386  C  CG2   . VAL C  1 345  ? 190.052 161.279 160.707 1.00 118.91 ? 339  VAL B CG2   1 
ATOM   7387  N  N     . PRO C  1 346  ? 193.342 159.745 157.700 1.00 126.59 ? 340  PRO B N     1 
ATOM   7388  C  CA    . PRO C  1 346  ? 194.410 159.967 156.716 1.00 126.59 ? 340  PRO B CA    1 
ATOM   7389  C  C     . PRO C  1 346  ? 194.367 161.374 156.139 1.00 126.59 ? 340  PRO B C     1 
ATOM   7390  O  O     . PRO C  1 346  ? 193.486 162.176 156.456 1.00 126.59 ? 340  PRO B O     1 
ATOM   7391  C  CB    . PRO C  1 346  ? 194.125 158.915 155.640 1.00 126.59 ? 340  PRO B CB    1 
ATOM   7392  C  CG    . PRO C  1 346  ? 193.343 157.868 156.340 1.00 126.59 ? 340  PRO B CG    1 
ATOM   7393  C  CD    . PRO C  1 346  ? 192.495 158.603 157.331 1.00 126.59 ? 340  PRO B CD    1 
ATOM   7394  N  N     . THR C  1 347  ? 195.332 161.657 155.265 1.00 123.11 ? 341  THR B N     1 
ATOM   7395  C  CA    . THR C  1 347  ? 195.550 162.992 154.721 1.00 123.11 ? 341  THR B CA    1 
ATOM   7396  C  C     . THR C  1 347  ? 196.663 162.912 153.691 1.00 123.11 ? 341  THR B C     1 
ATOM   7397  O  O     . THR C  1 347  ? 197.460 161.970 153.725 1.00 123.11 ? 341  THR B O     1 
ATOM   7398  C  CB    . THR C  1 347  ? 195.918 163.981 155.837 1.00 123.11 ? 341  THR B CB    1 
ATOM   7399  O  OG1   . THR C  1 347  ? 196.156 165.283 155.291 1.00 123.11 ? 341  THR B OG1   1 
ATOM   7400  C  CG2   . THR C  1 347  ? 197.138 163.512 156.577 1.00 123.11 ? 341  THR B CG2   1 
ATOM   7401  N  N     . PRO C  1 348  ? 196.731 163.856 152.752 1.00 122.53 ? 342  PRO B N     1 
ATOM   7402  C  CA    . PRO C  1 348  ? 197.914 163.941 151.887 1.00 122.53 ? 342  PRO B CA    1 
ATOM   7403  C  C     . PRO C  1 348  ? 199.176 164.109 152.716 1.00 122.53 ? 342  PRO B C     1 
ATOM   7404  O  O     . PRO C  1 348  ? 199.340 165.090 153.446 1.00 122.53 ? 342  PRO B O     1 
ATOM   7405  C  CB    . PRO C  1 348  ? 197.632 165.173 151.019 1.00 122.53 ? 342  PRO B CB    1 
ATOM   7406  C  CG    . PRO C  1 348  ? 196.150 165.251 150.974 1.00 122.53 ? 342  PRO B CG    1 
ATOM   7407  C  CD    . PRO C  1 348  ? 195.675 164.794 152.327 1.00 122.53 ? 342  PRO B CD    1 
ATOM   7408  N  N     . LEU C  1 349  ? 200.073 163.136 152.592 1.00 119.34 ? 343  LEU B N     1 
ATOM   7409  C  CA    . LEU C  1 349  ? 201.217 163.013 153.491 1.00 119.34 ? 343  LEU B CA    1 
ATOM   7410  C  C     . LEU C  1 349  ? 202.417 163.788 152.952 1.00 119.34 ? 343  LEU B C     1 
ATOM   7411  O  O     . LEU C  1 349  ? 203.527 163.275 152.822 1.00 119.34 ? 343  LEU B O     1 
ATOM   7412  C  CB    . LEU C  1 349  ? 201.562 161.547 153.693 1.00 119.34 ? 343  LEU B CB    1 
ATOM   7413  C  CG    . LEU C  1 349  ? 200.408 160.770 154.305 1.00 119.34 ? 343  LEU B CG    1 
ATOM   7414  C  CD1   . LEU C  1 349  ? 200.785 159.313 154.438 1.00 119.34 ? 343  LEU B CD1   1 
ATOM   7415  C  CD2   . LEU C  1 349  ? 200.030 161.374 155.639 1.00 119.34 ? 343  LEU B CD2   1 
ATOM   7416  N  N     . CYS C  1 350  ? 202.173 165.058 152.650 1.00 126.08 ? 344  CYS B N     1 
ATOM   7417  C  CA    . CYS C  1 350  ? 203.212 165.914 152.108 1.00 126.08 ? 344  CYS B CA    1 
ATOM   7418  C  C     . CYS C  1 350  ? 203.053 167.305 152.700 1.00 126.08 ? 344  CYS B C     1 
ATOM   7419  O  O     . CYS C  1 350  ? 202.099 167.592 153.426 1.00 126.08 ? 344  CYS B O     1 
ATOM   7420  C  CB    . CYS C  1 350  ? 203.163 165.948 150.581 1.00 126.08 ? 344  CYS B CB    1 
ATOM   7421  S  SG    . CYS C  1 350  ? 201.682 166.682 149.883 1.00 126.08 ? 344  CYS B SG    1 
ATOM   7422  N  N     . THR C  1 351  ? 204.016 168.168 152.398 1.00 135.36 ? 345  THR B N     1 
ATOM   7423  C  CA    . THR C  1 351  ? 204.011 169.498 152.981 1.00 135.36 ? 345  THR B CA    1 
ATOM   7424  C  C     . THR C  1 351  ? 202.841 170.313 152.454 1.00 135.36 ? 345  THR B C     1 
ATOM   7425  O  O     . THR C  1 351  ? 202.373 170.114 151.330 1.00 135.36 ? 345  THR B O     1 
ATOM   7426  C  CB    . THR C  1 351  ? 205.314 170.235 152.676 1.00 135.36 ? 345  THR B CB    1 
ATOM   7427  O  OG1   . THR C  1 351  ? 205.461 170.375 151.257 1.00 135.36 ? 345  THR B OG1   1 
ATOM   7428  C  CG2   . THR C  1 351  ? 206.507 169.489 153.230 1.00 135.36 ? 345  THR B CG2   1 
ATOM   7429  N  N     . ALA C  1 352  ? 202.375 171.248 153.281 1.00 133.42 ? 346  ALA B N     1 
ATOM   7430  C  CA    . ALA C  1 352  ? 201.432 172.241 152.788 1.00 133.42 ? 346  ALA B CA    1 
ATOM   7431  C  C     . ALA C  1 352  ? 201.985 172.947 151.559 1.00 133.42 ? 346  ALA B C     1 
ATOM   7432  O  O     . ALA C  1 352  ? 201.220 173.384 150.691 1.00 133.42 ? 346  ALA B O     1 
ATOM   7433  C  CB    . ALA C  1 352  ? 201.106 173.244 153.892 1.00 133.42 ? 346  ALA B CB    1 
ATOM   7434  N  N     . ARG C  1 353  ? 203.311 173.052 151.462 1.00 134.61 ? 347  ARG B N     1 
ATOM   7435  C  CA    . ARG C  1 353  ? 203.936 173.476 150.216 1.00 134.61 ? 347  ARG B CA    1 
ATOM   7436  C  C     . ARG C  1 353  ? 203.533 172.570 149.066 1.00 134.61 ? 347  ARG B C     1 
ATOM   7437  O  O     . ARG C  1 353  ? 202.928 173.023 148.090 1.00 134.61 ? 347  ARG B O     1 
ATOM   7438  C  CB    . ARG C  1 353  ? 205.452 173.498 150.370 1.00 134.61 ? 347  ARG B CB    1 
ATOM   7439  C  CG    . ARG C  1 353  ? 206.163 173.975 149.126 1.00 134.61 ? 347  ARG B CG    1 
ATOM   7440  C  CD    . ARG C  1 353  ? 207.624 174.188 149.406 1.00 134.61 ? 347  ARG B CD    1 
ATOM   7441  N  NE    . ARG C  1 353  ? 207.769 175.195 150.449 1.00 134.61 ? 347  ARG B NE    1 
ATOM   7442  C  CZ    . ARG C  1 353  ? 207.642 176.502 150.244 1.00 134.61 ? 347  ARG B CZ    1 
ATOM   7443  N  NH1   . ARG C  1 353  ? 207.356 176.963 149.035 1.00 134.61 ? 347  ARG B NH1   1 
ATOM   7444  N  NH2   . ARG C  1 353  ? 207.788 177.348 151.254 1.00 134.61 ? 347  ARG B NH2   1 
ATOM   7445  N  N     . GLN C  1 354  ? 203.864 171.282 149.159 1.00 143.31 ? 348  GLN B N     1 
ATOM   7446  C  CA    . GLN C  1 354  ? 203.454 170.341 148.126 1.00 143.31 ? 348  GLN B CA    1 
ATOM   7447  C  C     . GLN C  1 354  ? 201.942 170.199 148.046 1.00 143.31 ? 348  GLN B C     1 
ATOM   7448  O  O     . GLN C  1 354  ? 201.427 169.870 146.974 1.00 143.31 ? 348  GLN B O     1 
ATOM   7449  C  CB    . GLN C  1 354  ? 204.098 168.975 148.368 1.00 143.31 ? 348  GLN B CB    1 
ATOM   7450  C  CG    . GLN C  1 354  ? 205.615 169.012 148.304 1.00 143.31 ? 348  GLN B CG    1 
ATOM   7451  C  CD    . GLN C  1 354  ? 206.254 167.671 148.592 1.00 143.31 ? 348  GLN B CD    1 
ATOM   7452  O  OE1   . GLN C  1 354  ? 205.568 166.677 148.808 1.00 143.31 ? 348  GLN B OE1   1 
ATOM   7453  N  NE2   . GLN C  1 354  ? 207.581 167.646 148.630 1.00 143.31 ? 348  GLN B NE2   1 
ATOM   7454  N  N     . LEU C  1 355  ? 201.218 170.453 149.140 1.00 145.64 ? 349  LEU B N     1 
ATOM   7455  C  CA    . LEU C  1 355  ? 199.767 170.558 149.036 1.00 145.64 ? 349  LEU B CA    1 
ATOM   7456  C  C     . LEU C  1 355  ? 199.363 171.617 148.024 1.00 145.64 ? 349  LEU B C     1 
ATOM   7457  O  O     . LEU C  1 355  ? 198.604 171.333 147.096 1.00 145.64 ? 349  LEU B O     1 
ATOM   7458  C  CB    . LEU C  1 355  ? 199.136 170.873 150.389 1.00 145.64 ? 349  LEU B CB    1 
ATOM   7459  C  CG    . LEU C  1 355  ? 198.593 169.725 151.230 1.00 145.64 ? 349  LEU B CG    1 
ATOM   7460  C  CD1   . LEU C  1 355  ? 197.492 169.055 150.438 1.00 145.64 ? 349  LEU B CD1   1 
ATOM   7461  C  CD2   . LEU C  1 355  ? 199.672 168.745 151.616 1.00 145.64 ? 349  LEU B CD2   1 
ATOM   7462  N  N     . ASP C  1 356  ? 199.843 172.850 148.196 1.00 149.20 ? 350  ASP B N     1 
ATOM   7463  C  CA    . ASP C  1 356  ? 199.487 173.894 147.244 1.00 149.20 ? 350  ASP B CA    1 
ATOM   7464  C  C     . ASP C  1 356  ? 200.064 173.622 145.867 1.00 149.20 ? 350  ASP B C     1 
ATOM   7465  O  O     . ASP C  1 356  ? 199.458 174.009 144.865 1.00 149.20 ? 350  ASP B O     1 
ATOM   7466  C  CB    . ASP C  1 356  ? 199.948 175.261 147.744 1.00 149.20 ? 350  ASP B CB    1 
ATOM   7467  C  CG    . ASP C  1 356  ? 199.132 175.750 148.920 1.00 149.20 ? 350  ASP B CG    1 
ATOM   7468  O  OD1   . ASP C  1 356  ? 197.962 175.334 149.033 1.00 149.20 ? 350  ASP B OD1   1 
ATOM   7469  O  OD2   . ASP C  1 356  ? 199.649 176.555 149.723 1.00 149.20 ? 350  ASP B OD2   1 
ATOM   7470  N  N     . GLU C  1 357  ? 201.203 172.938 145.796 1.00 156.59 ? 351  GLU B N     1 
ATOM   7471  C  CA    . GLU C  1 357  ? 201.762 172.554 144.503 1.00 156.59 ? 351  GLU B CA    1 
ATOM   7472  C  C     . GLU C  1 357  ? 200.803 171.655 143.737 1.00 156.59 ? 351  GLU B C     1 
ATOM   7473  O  O     . GLU C  1 357  ? 200.381 171.983 142.619 1.00 156.59 ? 351  GLU B O     1 
ATOM   7474  C  CB    . GLU C  1 357  ? 203.100 171.851 144.706 1.00 156.59 ? 351  GLU B CB    1 
ATOM   7475  C  CG    . GLU C  1 357  ? 204.196 172.754 145.216 1.00 156.59 ? 351  GLU B CG    1 
ATOM   7476  C  CD    . GLU C  1 357  ? 205.485 172.007 145.444 1.00 156.59 ? 351  GLU B CD    1 
ATOM   7477  O  OE1   . GLU C  1 357  ? 205.470 170.764 145.348 1.00 156.59 ? 351  GLU B OE1   1 
ATOM   7478  O  OE2   . GLU C  1 357  ? 206.513 172.663 145.707 1.00 156.59 ? 351  GLU B OE2   1 
ATOM   7479  N  N     . ASP C  1 358  ? 200.445 170.514 144.327 1.00 173.40 ? 352  ASP B N     1 
ATOM   7480  C  CA    . ASP C  1 358  ? 199.539 169.582 143.669 1.00 173.40 ? 352  ASP B CA    1 
ATOM   7481  C  C     . ASP C  1 358  ? 198.153 170.190 143.482 1.00 173.40 ? 352  ASP B C     1 
ATOM   7482  O  O     . ASP C  1 358  ? 197.470 169.895 142.498 1.00 173.40 ? 352  ASP B O     1 
ATOM   7483  C  CB    . ASP C  1 358  ? 199.458 168.284 144.468 1.00 173.40 ? 352  ASP B CB    1 
ATOM   7484  N  N     . HIS C  1 359  ? 197.732 171.063 144.399 1.00 191.51 ? 353  HIS B N     1 
ATOM   7485  C  CA    . HIS C  1 359  ? 196.426 171.696 144.274 1.00 191.51 ? 353  HIS B CA    1 
ATOM   7486  C  C     . HIS C  1 359  ? 196.390 172.657 143.096 1.00 191.51 ? 353  HIS B C     1 
ATOM   7487  O  O     . HIS C  1 359  ? 195.414 172.683 142.340 1.00 191.51 ? 353  HIS B O     1 
ATOM   7488  C  CB    . HIS C  1 359  ? 196.073 172.425 145.570 1.00 191.51 ? 353  HIS B CB    1 
ATOM   7489  N  N     . SER C  1 360  ? 197.442 173.458 142.925 1.00 198.68 ? 354  SER B N     1 
ATOM   7490  C  CA    . SER C  1 360  ? 197.524 174.330 141.763 1.00 198.68 ? 354  SER B CA    1 
ATOM   7491  C  C     . SER C  1 360  ? 197.627 173.514 140.482 1.00 198.68 ? 354  SER B C     1 
ATOM   7492  O  O     . SER C  1 360  ? 197.035 173.876 139.460 1.00 198.68 ? 354  SER B O     1 
ATOM   7493  C  CB    . SER C  1 360  ? 198.717 175.274 141.905 1.00 198.68 ? 354  SER B CB    1 
ATOM   7494  N  N     . LEU C  1 361  ? 198.360 172.399 140.524 1.00 212.04 ? 355  LEU B N     1 
ATOM   7495  C  CA    . LEU C  1 361  ? 198.454 171.544 139.346 1.00 212.04 ? 355  LEU B CA    1 
ATOM   7496  C  C     . LEU C  1 361  ? 197.107 170.924 138.993 1.00 212.04 ? 355  LEU B C     1 
ATOM   7497  O  O     . LEU C  1 361  ? 196.820 170.701 137.812 1.00 212.04 ? 355  LEU B O     1 
ATOM   7498  C  CB    . LEU C  1 361  ? 199.501 170.454 139.568 1.00 212.04 ? 355  LEU B CB    1 
ATOM   7499  N  N     . LEU C  1 362  ? 196.274 170.638 139.994 1.00 231.59 ? 356  LEU B N     1 
ATOM   7500  C  CA    . LEU C  1 362  ? 194.978 170.020 139.733 1.00 231.59 ? 356  LEU B CA    1 
ATOM   7501  C  C     . LEU C  1 362  ? 193.904 171.050 139.400 1.00 231.59 ? 356  LEU B C     1 
ATOM   7502  O  O     . LEU C  1 362  ? 192.909 170.710 138.750 1.00 231.59 ? 356  LEU B O     1 
ATOM   7503  C  CB    . LEU C  1 362  ? 194.544 169.181 140.935 1.00 231.59 ? 356  LEU B CB    1 
ATOM   7504  N  N     . GLU C  1 363  ? 194.078 172.299 139.837 1.00 242.68 ? 357  GLU B N     1 
ATOM   7505  C  CA    . GLU C  1 363  ? 193.105 173.345 139.549 1.00 242.68 ? 357  GLU B CA    1 
ATOM   7506  C  C     . GLU C  1 363  ? 193.372 174.056 138.229 1.00 242.68 ? 357  GLU B C     1 
ATOM   7507  O  O     . GLU C  1 363  ? 192.417 174.440 137.546 1.00 242.68 ? 357  GLU B O     1 
ATOM   7508  C  CB    . GLU C  1 363  ? 193.081 174.370 140.686 1.00 242.68 ? 357  GLU B CB    1 
ATOM   7509  N  N     . ALA C  1 364  ? 194.641 174.243 137.855 1.00 247.58 ? 358  ALA B N     1 
ATOM   7510  C  CA    . ALA C  1 364  ? 194.964 174.833 136.564 1.00 247.58 ? 358  ALA B CA    1 
ATOM   7511  C  C     . ALA C  1 364  ? 194.939 173.814 135.432 1.00 247.58 ? 358  ALA B C     1 
ATOM   7512  O  O     . ALA C  1 364  ? 195.354 174.138 134.314 1.00 247.58 ? 358  ALA B O     1 
ATOM   7513  C  CB    . ALA C  1 364  ? 196.337 175.507 136.617 1.00 247.58 ? 358  ALA B CB    1 
ATOM   7514  N  N     . LEU C  1 365  ? 194.476 172.594 135.698 1.00 251.04 ? 359  LEU B N     1 
ATOM   7515  C  CA    . LEU C  1 365  ? 194.393 171.559 134.678 1.00 251.04 ? 359  LEU B CA    1 
ATOM   7516  C  C     . LEU C  1 365  ? 193.207 171.792 133.745 1.00 251.04 ? 359  LEU B C     1 
ATOM   7517  O  O     . LEU C  1 365  ? 192.052 171.721 134.166 1.00 251.04 ? 359  LEU B O     1 
ATOM   7518  C  CB    . LEU C  1 365  ? 194.286 170.178 135.327 1.00 251.04 ? 359  LEU B CB    1 
ATOM   7519  N  N     . ARG D  1 38   ? 167.844 170.878 174.070 1.00 150.11 ? 32   ARG C N     1 
ATOM   7520  C  CA    . ARG D  1 38   ? 168.147 172.221 173.591 1.00 150.11 ? 32   ARG C CA    1 
ATOM   7521  C  C     . ARG D  1 38   ? 168.233 173.225 174.739 1.00 150.11 ? 32   ARG C C     1 
ATOM   7522  O  O     . ARG D  1 38   ? 167.261 173.918 175.041 1.00 150.11 ? 32   ARG C O     1 
ATOM   7523  C  CB    . ARG D  1 38   ? 167.097 172.675 172.583 1.00 150.11 ? 32   ARG C CB    1 
ATOM   7524  C  CG    . ARG D  1 38   ? 167.386 174.025 171.967 1.00 150.11 ? 32   ARG C CG    1 
ATOM   7525  C  CD    . ARG D  1 38   ? 166.329 174.370 170.952 1.00 150.11 ? 32   ARG C CD    1 
ATOM   7526  N  NE    . ARG D  1 38   ? 166.477 175.729 170.440 1.00 150.11 ? 32   ARG C NE    1 
ATOM   7527  C  CZ    . ARG D  1 38   ? 167.228 176.055 169.396 1.00 150.11 ? 32   ARG C CZ    1 
ATOM   7528  N  NH1   . ARG D  1 38   ? 167.901 175.116 168.751 1.00 150.11 ? 32   ARG C NH1   1 
ATOM   7529  N  NH2   . ARG D  1 38   ? 167.299 177.315 168.994 1.00 150.11 ? 32   ARG C NH2   1 
ATOM   7530  N  N     . ALA D  1 39   ? 169.396 173.287 175.388 1.00 146.22 ? 33   ALA C N     1 
ATOM   7531  C  CA    . ALA D  1 39   ? 169.620 174.234 176.473 1.00 146.22 ? 33   ALA C CA    1 
ATOM   7532  C  C     . ALA D  1 39   ? 170.198 175.536 175.938 1.00 146.22 ? 33   ALA C C     1 
ATOM   7533  O  O     . ALA D  1 39   ? 170.666 175.583 174.797 1.00 146.22 ? 33   ALA C O     1 
ATOM   7534  C  CB    . ALA D  1 39   ? 170.552 173.624 177.522 1.00 146.22 ? 33   ALA C CB    1 
ATOM   7535  N  N     . ARG D  1 40   ? 170.164 176.600 176.739 1.00 123.62 ? 34   ARG C N     1 
ATOM   7536  C  CA    . ARG D  1 40   ? 170.894 177.821 176.434 1.00 123.62 ? 34   ARG C CA    1 
ATOM   7537  C  C     . ARG D  1 40   ? 172.338 177.657 176.874 1.00 123.62 ? 34   ARG C C     1 
ATOM   7538  O  O     . ARG D  1 40   ? 172.606 177.217 177.995 1.00 123.62 ? 34   ARG C O     1 
ATOM   7539  C  CB    . ARG D  1 40   ? 170.313 179.043 177.130 1.00 123.62 ? 34   ARG C CB    1 
ATOM   7540  C  CG    . ARG D  1 40   ? 168.945 179.444 176.667 1.00 123.62 ? 34   ARG C CG    1 
ATOM   7541  C  CD    . ARG D  1 40   ? 168.550 180.733 177.349 1.00 123.62 ? 34   ARG C CD    1 
ATOM   7542  N  NE    . ARG D  1 40   ? 169.453 181.800 176.932 1.00 123.62 ? 34   ARG C NE    1 
ATOM   7543  C  CZ    . ARG D  1 40   ? 169.254 182.572 175.870 1.00 123.62 ? 34   ARG C CZ    1 
ATOM   7544  N  NH1   . ARG D  1 40   ? 168.171 182.418 175.127 1.00 123.62 ? 34   ARG C NH1   1 
ATOM   7545  N  NH2   . ARG D  1 40   ? 170.132 183.509 175.559 1.00 123.62 ? 34   ARG C NH2   1 
ATOM   7546  N  N     . PHE D  1 41   ? 173.264 178.013 175.986 1.00 122.82 ? 35   PHE C N     1 
ATOM   7547  C  CA    . PHE D  1 41   ? 174.675 177.989 176.349 1.00 122.82 ? 35   PHE C CA    1 
ATOM   7548  C  C     . PHE D  1 41   ? 174.933 178.850 177.577 1.00 122.82 ? 35   PHE C C     1 
ATOM   7549  O  O     . PHE D  1 41   ? 175.385 178.350 178.614 1.00 122.82 ? 35   PHE C O     1 
ATOM   7550  C  CB    . PHE D  1 41   ? 175.512 178.467 175.171 1.00 122.82 ? 35   PHE C CB    1 
ATOM   7551  C  CG    . PHE D  1 41   ? 176.981 178.420 175.416 1.00 122.82 ? 35   PHE C CG    1 
ATOM   7552  C  CD1   . PHE D  1 41   ? 177.669 177.231 175.332 1.00 122.82 ? 35   PHE C CD1   1 
ATOM   7553  C  CD2   . PHE D  1 41   ? 177.674 179.566 175.732 1.00 122.82 ? 35   PHE C CD2   1 
ATOM   7554  C  CE1   . PHE D  1 41   ? 179.026 177.188 175.556 1.00 122.82 ? 35   PHE C CE1   1 
ATOM   7555  C  CE2   . PHE D  1 41   ? 179.030 179.531 175.963 1.00 122.82 ? 35   PHE C CE2   1 
ATOM   7556  C  CZ    . PHE D  1 41   ? 179.707 178.341 175.875 1.00 122.82 ? 35   PHE C CZ    1 
ATOM   7557  N  N     . VAL D  1 42   ? 174.627 180.140 177.488 1.00 116.36 ? 36   VAL C N     1 
ATOM   7558  C  CA    . VAL D  1 42   ? 174.699 181.048 178.622 1.00 116.36 ? 36   VAL C CA    1 
ATOM   7559  C  C     . VAL D  1 42   ? 173.308 181.599 178.873 1.00 116.36 ? 36   VAL C C     1 
ATOM   7560  O  O     . VAL D  1 42   ? 172.605 181.974 177.928 1.00 116.36 ? 36   VAL C O     1 
ATOM   7561  C  CB    . VAL D  1 42   ? 175.703 182.191 178.385 1.00 116.36 ? 36   VAL C CB    1 
ATOM   7562  C  CG1   . VAL D  1 42   ? 175.600 183.218 179.485 1.00 116.36 ? 36   VAL C CG1   1 
ATOM   7563  C  CG2   . VAL D  1 42   ? 177.104 181.640 178.341 1.00 116.36 ? 36   VAL C CG2   1 
ATOM   7564  N  N     . SER D  1 43   ? 172.903 181.626 180.138 1.00 121.81 ? 37   SER C N     1 
ATOM   7565  C  CA    . SER D  1 43   ? 171.601 182.155 180.498 1.00 121.81 ? 37   SER C CA    1 
ATOM   7566  C  C     . SER D  1 43   ? 171.507 183.627 180.112 1.00 121.81 ? 37   SER C C     1 
ATOM   7567  O  O     . SER D  1 43   ? 172.510 184.323 179.949 1.00 121.81 ? 37   SER C O     1 
ATOM   7568  C  CB    . SER D  1 43   ? 171.356 181.979 181.992 1.00 121.81 ? 37   SER C CB    1 
ATOM   7569  O  OG    . SER D  1 43   ? 170.131 182.575 182.373 1.00 121.81 ? 37   SER C OG    1 
ATOM   7570  N  N     . LYS D  1 44   ? 170.269 184.118 180.004 1.00 120.67 ? 38   LYS C N     1 
ATOM   7571  C  CA    . LYS D  1 44   ? 170.050 185.538 179.751 1.00 120.67 ? 38   LYS C CA    1 
ATOM   7572  C  C     . LYS D  1 44   ? 170.615 186.421 180.853 1.00 120.67 ? 38   LYS C C     1 
ATOM   7573  O  O     . LYS D  1 44   ? 170.475 187.645 180.777 1.00 120.67 ? 38   LYS C O     1 
ATOM   7574  C  CB    . LYS D  1 44   ? 168.556 185.833 179.580 1.00 120.67 ? 38   LYS C CB    1 
ATOM   7575  C  CG    . LYS D  1 44   ? 167.926 185.226 178.328 1.00 120.67 ? 38   LYS C CG    1 
ATOM   7576  C  CD    . LYS D  1 44   ? 168.551 185.795 177.055 1.00 120.67 ? 38   LYS C CD    1 
ATOM   7577  C  CE    . LYS D  1 44   ? 168.187 187.257 176.815 1.00 120.67 ? 38   LYS C CE    1 
ATOM   7578  N  NZ    . LYS D  1 44   ? 166.762 187.433 176.439 1.00 120.67 ? 38   LYS C NZ    1 
ATOM   7579  N  N     . LYS D  1 45   ? 171.232 185.836 181.878 1.00 120.76 ? 39   LYS C N     1 
ATOM   7580  C  CA    . LYS D  1 45   ? 171.838 186.590 182.963 1.00 120.76 ? 39   LYS C CA    1 
ATOM   7581  C  C     . LYS D  1 45   ? 173.280 186.180 183.232 1.00 120.76 ? 39   LYS C C     1 
ATOM   7582  O  O     . LYS D  1 45   ? 173.788 186.423 184.330 1.00 120.76 ? 39   LYS C O     1 
ATOM   7583  C  CB    . LYS D  1 45   ? 170.999 186.445 184.230 1.00 120.76 ? 39   LYS C CB    1 
ATOM   7584  C  CG    . LYS D  1 45   ? 169.591 186.977 184.061 1.00 120.76 ? 39   LYS C CG    1 
ATOM   7585  C  CD    . LYS D  1 45   ? 169.626 188.476 183.803 1.00 120.76 ? 39   LYS C CD    1 
ATOM   7586  C  CE    . LYS D  1 45   ? 168.235 189.084 183.740 1.00 120.76 ? 39   LYS C CE    1 
ATOM   7587  N  NZ    . LYS D  1 45   ? 167.512 188.701 182.502 1.00 120.76 ? 39   LYS C NZ    1 
ATOM   7588  N  N     . GLY D  1 46   ? 173.949 185.559 182.267 1.00 122.34 ? 40   GLY C N     1 
ATOM   7589  C  CA    . GLY D  1 46   ? 175.363 185.287 182.387 1.00 122.34 ? 40   GLY C CA    1 
ATOM   7590  C  C     . GLY D  1 46   ? 175.725 183.944 182.976 1.00 122.34 ? 40   GLY C C     1 
ATOM   7591  O  O     . GLY D  1 46   ? 176.914 183.688 183.191 1.00 122.34 ? 40   GLY C O     1 
ATOM   7592  N  N     . ASN D  1 47   ? 174.752 183.082 183.246 1.00 122.02 ? 41   ASN C N     1 
ATOM   7593  C  CA    . ASN D  1 47   ? 175.060 181.784 183.823 1.00 122.02 ? 41   ASN C CA    1 
ATOM   7594  C  C     . ASN D  1 47   ? 175.524 180.815 182.747 1.00 122.02 ? 41   ASN C C     1 
ATOM   7595  O  O     . ASN D  1 47   ? 174.788 180.508 181.805 1.00 122.02 ? 41   ASN C O     1 
ATOM   7596  C  CB    . ASN D  1 47   ? 173.838 181.218 184.538 1.00 122.02 ? 41   ASN C CB    1 
ATOM   7597  C  CG    . ASN D  1 47   ? 173.376 182.097 185.670 1.00 122.02 ? 41   ASN C CG    1 
ATOM   7598  O  OD1   . ASN D  1 47   ? 172.279 182.649 185.632 1.00 122.02 ? 41   ASN C OD1   1 
ATOM   7599  N  ND2   . ASN D  1 47   ? 174.218 182.246 186.683 1.00 122.02 ? 41   ASN C ND2   1 
ATOM   7600  N  N     . CYS D  1 48   ? 176.743 180.316 182.904 1.00 122.41 ? 42   CYS C N     1 
ATOM   7601  C  CA    . CYS D  1 48   ? 177.313 179.351 181.979 1.00 122.41 ? 42   CYS C CA    1 
ATOM   7602  C  C     . CYS D  1 48   ? 176.655 178.005 182.237 1.00 122.41 ? 42   CYS C C     1 
ATOM   7603  O  O     . CYS D  1 48   ? 177.091 177.253 183.115 1.00 122.41 ? 42   CYS C O     1 
ATOM   7604  C  CB    . CYS D  1 48   ? 178.826 179.264 182.152 1.00 122.41 ? 42   CYS C CB    1 
ATOM   7605  S  SG    . CYS D  1 48   ? 179.666 180.817 181.780 1.00 122.41 ? 42   CYS C SG    1 
ATOM   7606  N  N     . ASN D  1 49   ? 175.618 177.704 181.464 1.00 131.22 ? 43   ASN C N     1 
ATOM   7607  C  CA    . ASN D  1 49   ? 174.729 176.579 181.743 1.00 131.22 ? 43   ASN C CA    1 
ATOM   7608  C  C     . ASN D  1 49   ? 175.299 175.267 181.224 1.00 131.22 ? 43   ASN C C     1 
ATOM   7609  O  O     . ASN D  1 49   ? 174.705 174.595 180.387 1.00 131.22 ? 43   ASN C O     1 
ATOM   7610  C  CB    . ASN D  1 49   ? 173.359 176.858 181.141 1.00 131.22 ? 43   ASN C CB    1 
ATOM   7611  C  CG    . ASN D  1 49   ? 172.705 178.081 181.743 1.00 131.22 ? 43   ASN C CG    1 
ATOM   7612  O  OD1   . ASN D  1 49   ? 172.798 178.325 182.943 1.00 131.22 ? 43   ASN C OD1   1 
ATOM   7613  N  ND2   . ASN D  1 49   ? 172.036 178.862 180.901 1.00 131.22 ? 43   ASN C ND2   1 
ATOM   7614  N  N     . VAL D  1 50   ? 176.475 174.903 181.720 1.00 128.91 ? 44   VAL C N     1 
ATOM   7615  C  CA    . VAL D  1 50   ? 177.200 173.721 181.276 1.00 128.91 ? 44   VAL C CA    1 
ATOM   7616  C  C     . VAL D  1 50   ? 177.787 173.060 182.517 1.00 128.91 ? 44   VAL C C     1 
ATOM   7617  O  O     . VAL D  1 50   ? 178.442 173.725 183.327 1.00 128.91 ? 44   VAL C O     1 
ATOM   7618  C  CB    . VAL D  1 50   ? 178.304 174.058 180.271 1.00 128.91 ? 44   VAL C CB    1 
ATOM   7619  C  CG1   . VAL D  1 50   ? 179.065 172.806 179.926 1.00 128.91 ? 44   VAL C CG1   1 
ATOM   7620  C  CG2   . VAL D  1 50   ? 177.726 174.699 179.018 1.00 128.91 ? 44   VAL C CG2   1 
ATOM   7621  N  N     . ALA D  1 51   ? 177.553 171.760 182.677 1.00 124.90 ? 45   ALA C N     1 
ATOM   7622  C  CA    . ALA D  1 51   ? 178.175 171.019 183.763 1.00 124.90 ? 45   ALA C CA    1 
ATOM   7623  C  C     . ALA D  1 51   ? 179.412 170.280 183.276 1.00 124.90 ? 45   ALA C C     1 
ATOM   7624  O  O     . ALA D  1 51   ? 179.543 169.955 182.092 1.00 124.90 ? 45   ALA C O     1 
ATOM   7625  C  CB    . ALA D  1 51   ? 177.190 170.036 184.386 1.00 124.90 ? 45   ALA C CB    1 
ATOM   7626  N  N     . HIS D  1 52   ? 180.319 170.012 184.210 1.00 127.84 ? 46   HIS C N     1 
ATOM   7627  C  CA    . HIS D  1 52   ? 181.604 169.411 183.894 1.00 127.84 ? 46   HIS C CA    1 
ATOM   7628  C  C     . HIS D  1 52   ? 181.526 167.895 183.861 1.00 127.84 ? 46   HIS C C     1 
ATOM   7629  O  O     . HIS D  1 52   ? 181.946 167.294 182.878 1.00 127.84 ? 46   HIS C O     1 
ATOM   7630  C  CB    . HIS D  1 52   ? 182.663 169.876 184.892 1.00 127.84 ? 46   HIS C CB    1 
ATOM   7631  C  CG    . HIS D  1 52   ? 182.944 171.345 184.840 1.00 127.84 ? 46   HIS C CG    1 
ATOM   7632  N  ND1   . HIS D  1 52   ? 182.215 172.270 185.556 1.00 127.84 ? 46   HIS C ND1   1 
ATOM   7633  C  CD2   . HIS D  1 52   ? 183.898 172.042 184.182 1.00 127.84 ? 46   HIS C CD2   1 
ATOM   7634  C  CE1   . HIS D  1 52   ? 182.699 173.477 185.325 1.00 127.84 ? 46   HIS C CE1   1 
ATOM   7635  N  NE2   . HIS D  1 52   ? 183.721 173.367 184.494 1.00 127.84 ? 46   HIS C NE2   1 
ATOM   7636  N  N     . LYS D  1 53   ? 181.007 167.261 184.910 1.00 124.69 ? 47   LYS C N     1 
ATOM   7637  C  CA    . LYS D  1 53   ? 180.757 165.824 184.829 1.00 124.69 ? 47   LYS C CA    1 
ATOM   7638  C  C     . LYS D  1 53   ? 182.015 165.000 184.558 1.00 124.69 ? 47   LYS C C     1 
ATOM   7639  O  O     . LYS D  1 53   ? 182.327 164.702 183.400 1.00 124.69 ? 47   LYS C O     1 
ATOM   7640  C  CB    . LYS D  1 53   ? 179.679 165.509 183.795 1.00 124.69 ? 47   LYS C CB    1 
ATOM   7641  C  CG    . LYS D  1 53   ? 178.308 165.994 184.229 1.00 124.69 ? 47   LYS C CG    1 
ATOM   7642  C  CD    . LYS D  1 53   ? 177.250 165.529 183.264 1.00 124.69 ? 47   LYS C CD    1 
ATOM   7643  C  CE    . LYS D  1 53   ? 177.355 166.298 181.984 1.00 124.69 ? 47   LYS C CE    1 
ATOM   7644  N  NZ    . LYS D  1 53   ? 176.941 167.716 182.148 1.00 124.69 ? 47   LYS C NZ    1 
ATOM   7645  N  N     . ASN D  1 54   ? 182.769 164.701 185.626 1.00 131.56 ? 48   ASN C N     1 
ATOM   7646  C  CA    . ASN D  1 54   ? 183.914 163.780 185.609 1.00 131.56 ? 48   ASN C CA    1 
ATOM   7647  C  C     . ASN D  1 54   ? 185.223 164.428 185.163 1.00 131.56 ? 48   ASN C C     1 
ATOM   7648  O  O     . ASN D  1 54   ? 185.903 163.923 184.268 1.00 131.56 ? 48   ASN C O     1 
ATOM   7649  C  CB    . ASN D  1 54   ? 183.623 162.565 184.724 1.00 131.56 ? 48   ASN C CB    1 
ATOM   7650  C  CG    . ASN D  1 54   ? 182.353 161.858 185.116 1.00 131.56 ? 48   ASN C CG    1 
ATOM   7651  O  OD1   . ASN D  1 54   ? 182.061 161.683 186.297 1.00 131.56 ? 48   ASN C OD1   1 
ATOM   7652  N  ND2   . ASN D  1 54   ? 181.563 161.473 184.117 1.00 131.56 ? 48   ASN C ND2   1 
ATOM   7653  N  N     . ILE D  1 55   ? 185.590 165.541 185.795 1.00 123.53 ? 49   ILE C N     1 
ATOM   7654  C  CA    . ILE D  1 55   ? 186.980 165.991 185.802 1.00 123.53 ? 49   ILE C CA    1 
ATOM   7655  C  C     . ILE D  1 55   ? 187.837 164.818 186.269 1.00 123.53 ? 49   ILE C C     1 
ATOM   7656  O  O     . ILE D  1 55   ? 187.473 164.112 187.211 1.00 123.53 ? 49   ILE C O     1 
ATOM   7657  C  CB    . ILE D  1 55   ? 187.186 167.202 186.720 1.00 123.53 ? 49   ILE C CB    1 
ATOM   7658  C  CG1   . ILE D  1 55   ? 186.355 168.406 186.277 1.00 123.53 ? 49   ILE C CG1   1 
ATOM   7659  C  CG2   . ILE D  1 55   ? 188.658 167.557 186.806 1.00 123.53 ? 49   ILE C CG2   1 
ATOM   7660  C  CD1   . ILE D  1 55   ? 185.056 168.543 187.027 1.00 123.53 ? 49   ILE C CD1   1 
ATOM   7661  N  N     . ARG D  1 56   ? 188.980 164.611 185.618 1.00 122.85 ? 50   ARG C N     1 
ATOM   7662  C  CA    . ARG D  1 56   ? 189.892 163.539 186.002 1.00 122.85 ? 50   ARG C CA    1 
ATOM   7663  C  C     . ARG D  1 56   ? 190.455 163.732 187.403 1.00 122.85 ? 50   ARG C C     1 
ATOM   7664  O  O     . ARG D  1 56   ? 190.198 162.937 188.312 1.00 122.85 ? 50   ARG C O     1 
ATOM   7665  C  CB    . ARG D  1 56   ? 191.033 163.474 184.992 1.00 122.85 ? 50   ARG C CB    1 
ATOM   7666  C  CG    . ARG D  1 56   ? 191.974 162.311 185.090 1.00 122.85 ? 50   ARG C CG    1 
ATOM   7667  C  CD    . ARG D  1 56   ? 192.941 162.430 183.934 1.00 122.85 ? 50   ARG C CD    1 
ATOM   7668  N  NE    . ARG D  1 56   ? 193.891 161.333 183.852 1.00 122.85 ? 50   ARG C NE    1 
ATOM   7669  C  CZ    . ARG D  1 56   ? 194.823 161.245 182.913 1.00 122.85 ? 50   ARG C CZ    1 
ATOM   7670  N  NH1   . ARG D  1 56   ? 194.926 162.193 181.995 1.00 122.85 ? 50   ARG C NH1   1 
ATOM   7671  N  NH2   . ARG D  1 56   ? 195.656 160.215 182.889 1.00 122.85 ? 50   ARG C NH2   1 
ATOM   7672  N  N     . GLU D  1 57   ? 191.216 164.805 187.587 1.00 123.99 ? 51   GLU C N     1 
ATOM   7673  C  CA    . GLU D  1 57   ? 192.127 164.917 188.716 1.00 123.99 ? 51   GLU C CA    1 
ATOM   7674  C  C     . GLU D  1 57   ? 191.422 165.508 189.935 1.00 123.99 ? 51   GLU C C     1 
ATOM   7675  O  O     . GLU D  1 57   ? 190.207 165.719 189.950 1.00 123.99 ? 51   GLU C O     1 
ATOM   7676  C  CB    . GLU D  1 57   ? 193.344 165.746 188.316 1.00 123.99 ? 51   GLU C CB    1 
ATOM   7677  C  CG    . GLU D  1 57   ? 194.144 165.132 187.193 1.00 123.99 ? 51   GLU C CG    1 
ATOM   7678  C  CD    . GLU D  1 57   ? 194.751 163.803 187.578 1.00 123.99 ? 51   GLU C CD    1 
ATOM   7679  O  OE1   . GLU D  1 57   ? 195.080 163.624 188.768 1.00 123.99 ? 51   GLU C OE1   1 
ATOM   7680  O  OE2   . GLU D  1 57   ? 194.900 162.936 186.691 1.00 123.99 ? 51   GLU C OE2   1 
ATOM   7681  N  N     . GLN D  1 58   ? 192.200 165.764 190.979 1.00 129.41 ? 52   GLN C N     1 
ATOM   7682  C  CA    . GLN D  1 58   ? 191.728 166.397 192.199 1.00 129.41 ? 52   GLN C CA    1 
ATOM   7683  C  C     . GLN D  1 58   ? 191.923 167.910 192.083 1.00 129.41 ? 52   GLN C C     1 
ATOM   7684  O  O     . GLN D  1 58   ? 192.223 168.424 191.002 1.00 129.41 ? 52   GLN C O     1 
ATOM   7685  C  CB    . GLN D  1 58   ? 192.456 165.798 193.403 1.00 129.41 ? 52   GLN C CB    1 
ATOM   7686  N  N     . GLY D  1 59   ? 191.766 168.631 193.179 1.00 154.91 ? 53   GLY C N     1 
ATOM   7687  C  CA    . GLY D  1 59   ? 191.872 170.084 193.162 1.00 154.91 ? 53   GLY C CA    1 
ATOM   7688  C  C     . GLY D  1 59   ? 193.266 170.555 193.495 1.00 154.91 ? 53   GLY C C     1 
ATOM   7689  O  O     . GLY D  1 59   ? 194.242 169.820 193.333 1.00 154.91 ? 53   GLY C O     1 
ATOM   7690  N  N     . ARG D  1 60   ? 193.360 171.804 193.956 1.00 164.27 ? 54   ARG C N     1 
ATOM   7691  C  CA    . ARG D  1 60   ? 194.634 172.396 194.356 1.00 164.27 ? 54   ARG C CA    1 
ATOM   7692  C  C     . ARG D  1 60   ? 194.953 171.940 195.775 1.00 164.27 ? 54   ARG C C     1 
ATOM   7693  O  O     . ARG D  1 60   ? 194.078 171.939 196.645 1.00 164.27 ? 54   ARG C O     1 
ATOM   7694  C  CB    . ARG D  1 60   ? 194.584 173.918 194.260 1.00 164.27 ? 54   ARG C CB    1 
ATOM   7695  N  N     . PHE D  1 61   ? 196.207 171.547 195.999 1.00 164.42 ? 55   PHE C N     1 
ATOM   7696  C  CA    . PHE D  1 61   ? 196.639 170.928 197.247 1.00 164.42 ? 55   PHE C CA    1 
ATOM   7697  C  C     . PHE D  1 61   ? 196.170 171.695 198.481 1.00 164.42 ? 55   PHE C C     1 
ATOM   7698  O  O     . PHE D  1 61   ? 195.362 171.177 199.259 1.00 164.42 ? 55   PHE C O     1 
ATOM   7699  C  CB    . PHE D  1 61   ? 198.168 170.763 197.231 1.00 164.42 ? 55   PHE C CB    1 
ATOM   7700  C  CG    . PHE D  1 61   ? 198.930 172.053 197.048 1.00 164.42 ? 55   PHE C CG    1 
ATOM   7701  C  CD1   . PHE D  1 61   ? 199.098 172.601 195.787 1.00 164.42 ? 55   PHE C CD1   1 
ATOM   7702  C  CD2   . PHE D  1 61   ? 199.520 172.688 198.130 1.00 164.42 ? 55   PHE C CD2   1 
ATOM   7703  C  CE1   . PHE D  1 61   ? 199.793 173.776 195.611 1.00 164.42 ? 55   PHE C CE1   1 
ATOM   7704  C  CE2   . PHE D  1 61   ? 200.218 173.864 197.955 1.00 164.42 ? 55   PHE C CE2   1 
ATOM   7705  C  CZ    . PHE D  1 61   ? 200.359 174.405 196.695 1.00 164.42 ? 55   PHE C CZ    1 
ATOM   7706  N  N     . LEU D  1 62   ? 196.636 172.931 198.664 1.00 160.55 ? 56   LEU C N     1 
ATOM   7707  C  CA    . LEU D  1 62   ? 196.204 173.785 199.763 1.00 160.55 ? 56   LEU C CA    1 
ATOM   7708  C  C     . LEU D  1 62   ? 196.078 175.247 199.357 1.00 160.55 ? 56   LEU C C     1 
ATOM   7709  O  O     . LEU D  1 62   ? 196.167 176.126 200.216 1.00 160.55 ? 56   LEU C O     1 
ATOM   7710  C  CB    . LEU D  1 62   ? 197.154 173.670 200.957 1.00 160.55 ? 56   LEU C CB    1 
ATOM   7711  C  CG    . LEU D  1 62   ? 196.993 172.499 201.931 1.00 160.55 ? 56   LEU C CG    1 
ATOM   7712  C  CD1   . LEU D  1 62   ? 197.605 171.211 201.402 1.00 160.55 ? 56   LEU C CD1   1 
ATOM   7713  C  CD2   . LEU D  1 62   ? 197.564 172.853 203.299 1.00 160.55 ? 56   LEU C CD2   1 
ATOM   7714  N  N     . GLN D  1 63   ? 195.897 175.530 198.069 1.00 154.61 ? 57   GLN C N     1 
ATOM   7715  C  CA    . GLN D  1 63   ? 195.673 176.894 197.605 1.00 154.61 ? 57   GLN C CA    1 
ATOM   7716  C  C     . GLN D  1 63   ? 194.230 177.120 197.181 1.00 154.61 ? 57   GLN C C     1 
ATOM   7717  O  O     . GLN D  1 63   ? 193.715 178.236 197.295 1.00 154.61 ? 57   GLN C O     1 
ATOM   7718  C  CB    . GLN D  1 63   ? 196.618 177.226 196.445 1.00 154.61 ? 57   GLN C CB    1 
ATOM   7719  N  N     . ASP D  1 64   ? 193.569 176.070 196.698 1.00 152.95 ? 58   ASP C N     1 
ATOM   7720  C  CA    . ASP D  1 64   ? 192.155 176.131 196.359 1.00 152.95 ? 58   ASP C CA    1 
ATOM   7721  C  C     . ASP D  1 64   ? 191.337 176.633 197.540 1.00 152.95 ? 58   ASP C C     1 
ATOM   7722  O  O     . ASP D  1 64   ? 190.213 177.107 197.365 1.00 152.95 ? 58   ASP C O     1 
ATOM   7723  C  CB    . ASP D  1 64   ? 191.644 174.760 195.903 1.00 152.95 ? 58   ASP C CB    1 
ATOM   7724  C  CG    . ASP D  1 64   ? 191.803 173.682 196.968 1.00 152.95 ? 58   ASP C CG    1 
ATOM   7725  O  OD1   . ASP D  1 64   ? 192.370 173.961 198.047 1.00 152.95 ? 58   ASP C OD1   1 
ATOM   7726  O  OD2   . ASP D  1 64   ? 191.363 172.543 196.723 1.00 152.95 ? 58   ASP C OD2   1 
ATOM   7727  N  N     . VAL D  1 65   ? 191.889 176.521 198.747 1.00 146.95 ? 59   VAL C N     1 
ATOM   7728  C  CA    . VAL D  1 65   ? 191.185 177.010 199.925 1.00 146.95 ? 59   VAL C CA    1 
ATOM   7729  C  C     . VAL D  1 65   ? 190.885 178.497 199.782 1.00 146.95 ? 59   VAL C C     1 
ATOM   7730  O  O     . VAL D  1 65   ? 189.744 178.934 199.960 1.00 146.95 ? 59   VAL C O     1 
ATOM   7731  C  CB    . VAL D  1 65   ? 191.991 176.698 201.196 1.00 146.95 ? 59   VAL C CB    1 
ATOM   7732  C  CG1   . VAL D  1 65   ? 192.067 175.201 201.402 1.00 146.95 ? 59   VAL C CG1   1 
ATOM   7733  C  CG2   . VAL D  1 65   ? 193.388 177.260 201.097 1.00 146.95 ? 59   VAL C CG2   1 
ATOM   7734  N  N     . PHE D  1 66   ? 191.881 179.284 199.381 1.00 138.26 ? 60   PHE C N     1 
ATOM   7735  C  CA    . PHE D  1 66   ? 191.689 180.727 199.300 1.00 138.26 ? 60   PHE C CA    1 
ATOM   7736  C  C     . PHE D  1 66   ? 190.738 181.100 198.172 1.00 138.26 ? 60   PHE C C     1 
ATOM   7737  O  O     . PHE D  1 66   ? 189.803 181.881 198.376 1.00 138.26 ? 60   PHE C O     1 
ATOM   7738  C  CB    . PHE D  1 66   ? 193.040 181.414 199.129 1.00 138.26 ? 60   PHE C CB    1 
ATOM   7739  C  CG    . PHE D  1 66   ? 193.910 181.320 200.345 1.00 138.26 ? 60   PHE C CG    1 
ATOM   7740  C  CD1   . PHE D  1 66   ? 193.350 181.076 201.583 1.00 138.26 ? 60   PHE C CD1   1 
ATOM   7741  C  CD2   . PHE D  1 66   ? 195.285 181.426 200.246 1.00 138.26 ? 60   PHE C CD2   1 
ATOM   7742  C  CE1   . PHE D  1 66   ? 194.138 180.973 202.704 1.00 138.26 ? 60   PHE C CE1   1 
ATOM   7743  C  CE2   . PHE D  1 66   ? 196.080 181.319 201.368 1.00 138.26 ? 60   PHE C CE2   1 
ATOM   7744  C  CZ    . PHE D  1 66   ? 195.506 181.094 202.599 1.00 138.26 ? 60   PHE C CZ    1 
ATOM   7745  N  N     . THR D  1 67   ? 190.958 180.550 196.979 1.00 148.34 ? 61   THR C N     1 
ATOM   7746  C  CA    . THR D  1 67   ? 190.086 180.853 195.850 1.00 148.34 ? 61   THR C CA    1 
ATOM   7747  C  C     . THR D  1 67   ? 188.646 180.443 196.133 1.00 148.34 ? 61   THR C C     1 
ATOM   7748  O  O     . THR D  1 67   ? 187.717 181.242 195.971 1.00 148.34 ? 61   THR C O     1 
ATOM   7749  C  CB    . THR D  1 67   ? 190.612 180.164 194.591 1.00 148.34 ? 61   THR C CB    1 
ATOM   7750  O  OG1   . THR D  1 67   ? 190.746 178.758 194.834 1.00 148.34 ? 61   THR C OG1   1 
ATOM   7751  C  CG2   . THR D  1 67   ? 191.961 180.741 194.192 1.00 148.34 ? 61   THR C CG2   1 
ATOM   7752  N  N     . THR D  1 68   ? 188.442 179.193 196.554 1.00 142.40 ? 62   THR C N     1 
ATOM   7753  C  CA    . THR D  1 68   ? 187.102 178.727 196.899 1.00 142.40 ? 62   THR C CA    1 
ATOM   7754  C  C     . THR D  1 68   ? 186.536 179.501 198.078 1.00 142.40 ? 62   THR C C     1 
ATOM   7755  O  O     . THR D  1 68   ? 185.320 179.527 198.289 1.00 142.40 ? 62   THR C O     1 
ATOM   7756  C  CB    . THR D  1 68   ? 187.135 177.230 197.210 1.00 142.40 ? 62   THR C CB    1 
ATOM   7757  O  OG1   . THR D  1 68   ? 188.082 176.982 198.255 1.00 142.40 ? 62   THR C OG1   1 
ATOM   7758  C  CG2   . THR D  1 68   ? 187.516 176.429 195.972 1.00 142.40 ? 62   THR C CG2   1 
ATOM   7759  N  N     . LEU D  1 69   ? 187.407 180.145 198.850 1.00 127.30 ? 63   LEU C N     1 
ATOM   7760  C  CA    . LEU D  1 69   ? 186.947 180.915 199.992 1.00 127.30 ? 63   LEU C CA    1 
ATOM   7761  C  C     . LEU D  1 69   ? 186.411 182.269 199.546 1.00 127.30 ? 63   LEU C C     1 
ATOM   7762  O  O     . LEU D  1 69   ? 185.385 182.740 200.046 1.00 127.30 ? 63   LEU C O     1 
ATOM   7763  C  CB    . LEU D  1 69   ? 188.106 181.060 200.976 1.00 127.30 ? 63   LEU C CB    1 
ATOM   7764  C  CG    . LEU D  1 69   ? 187.848 181.475 202.418 1.00 127.30 ? 63   LEU C CG    1 
ATOM   7765  C  CD1   . LEU D  1 69   ? 187.594 182.962 202.526 1.00 127.30 ? 63   LEU C CD1   1 
ATOM   7766  C  CD2   . LEU D  1 69   ? 186.678 180.681 202.969 1.00 127.30 ? 63   LEU C CD2   1 
ATOM   7767  N  N     . VAL D  1 70   ? 187.089 182.899 198.585 1.00 129.23 ? 64   VAL C N     1 
ATOM   7768  C  CA    . VAL D  1 70   ? 186.718 184.254 198.184 1.00 129.23 ? 64   VAL C CA    1 
ATOM   7769  C  C     . VAL D  1 70   ? 185.288 184.291 197.668 1.00 129.23 ? 64   VAL C C     1 
ATOM   7770  O  O     . VAL D  1 70   ? 184.398 184.879 198.294 1.00 129.23 ? 64   VAL C O     1 
ATOM   7771  C  CB    . VAL D  1 70   ? 187.699 184.789 197.127 1.00 129.23 ? 64   VAL C CB    1 
ATOM   7772  C  CG1   . VAL D  1 70   ? 187.277 186.178 196.673 1.00 129.23 ? 64   VAL C CG1   1 
ATOM   7773  C  CG2   . VAL D  1 70   ? 189.100 184.806 197.674 1.00 129.23 ? 64   VAL C CG2   1 
ATOM   7774  N  N     . ASP D  1 71   ? 185.037 183.641 196.534 1.00 137.55 ? 65   ASP C N     1 
ATOM   7775  C  CA    . ASP D  1 71   ? 183.721 183.647 195.917 1.00 137.55 ? 65   ASP C CA    1 
ATOM   7776  C  C     . ASP D  1 71   ? 182.876 182.590 196.596 1.00 137.55 ? 65   ASP C C     1 
ATOM   7777  O  O     . ASP D  1 71   ? 183.045 181.394 196.338 1.00 137.55 ? 65   ASP C O     1 
ATOM   7778  C  CB    . ASP D  1 71   ? 183.785 183.378 194.417 1.00 137.55 ? 65   ASP C CB    1 
ATOM   7779  C  CG    . ASP D  1 71   ? 182.444 183.584 193.731 1.00 137.55 ? 65   ASP C CG    1 
ATOM   7780  O  OD1   . ASP D  1 71   ? 182.055 184.750 193.515 1.00 137.55 ? 65   ASP C OD1   1 
ATOM   7781  O  OD2   . ASP D  1 71   ? 181.775 182.579 193.419 1.00 137.55 ? 65   ASP C OD2   1 
ATOM   7782  N  N     . LEU D  1 72   ? 181.970 183.033 197.457 1.00 110.55 ? 66   LEU C N     1 
ATOM   7783  C  CA    . LEU D  1 72   ? 181.207 182.123 198.289 1.00 110.55 ? 66   LEU C CA    1 
ATOM   7784  C  C     . LEU D  1 72   ? 180.177 182.960 199.026 1.00 110.55 ? 66   LEU C C     1 
ATOM   7785  O  O     . LEU D  1 72   ? 180.388 184.150 199.272 1.00 110.55 ? 66   LEU C O     1 
ATOM   7786  C  CB    . LEU D  1 72   ? 182.123 181.370 199.258 1.00 110.55 ? 66   LEU C CB    1 
ATOM   7787  C  CG    . LEU D  1 72   ? 181.577 180.176 200.022 1.00 110.55 ? 66   LEU C CG    1 
ATOM   7788  C  CD1   . LEU D  1 72   ? 182.690 179.187 200.281 1.00 110.55 ? 66   LEU C CD1   1 
ATOM   7789  C  CD2   . LEU D  1 72   ? 181.015 180.644 201.321 1.00 110.55 ? 66   LEU C CD2   1 
ATOM   7790  N  N     . LYS D  1 73   ? 179.060 182.331 199.366 1.00 107.19 ? 67   LYS C N     1 
ATOM   7791  C  CA    . LYS D  1 73   ? 177.967 183.072 199.973 1.00 107.19 ? 67   LYS C CA    1 
ATOM   7792  C  C     . LYS D  1 73   ? 178.412 183.680 201.304 1.00 107.19 ? 67   LYS C C     1 
ATOM   7793  O  O     . LYS D  1 73   ? 179.132 183.054 202.089 1.00 107.19 ? 67   LYS C O     1 
ATOM   7794  C  CB    . LYS D  1 73   ? 176.756 182.156 200.160 1.00 107.19 ? 67   LYS C CB    1 
ATOM   7795  C  CG    . LYS D  1 73   ? 175.487 182.879 200.564 1.00 107.19 ? 67   LYS C CG    1 
ATOM   7796  C  CD    . LYS D  1 73   ? 174.312 181.927 200.721 1.00 107.19 ? 67   LYS C CD    1 
ATOM   7797  C  CE    . LYS D  1 73   ? 173.067 182.672 201.188 1.00 107.19 ? 67   LYS C CE    1 
ATOM   7798  N  NZ    . LYS D  1 73   ? 171.912 181.766 201.436 1.00 107.19 ? 67   LYS C NZ    1 
ATOM   7799  N  N     . TRP D  1 74   ? 177.995 184.931 201.536 1.00 96.58  ? 68   TRP C N     1 
ATOM   7800  C  CA    . TRP D  1 74   ? 178.452 185.676 202.709 1.00 96.58  ? 68   TRP C CA    1 
ATOM   7801  C  C     . TRP D  1 74   ? 178.228 184.940 204.020 1.00 96.58  ? 68   TRP C C     1 
ATOM   7802  O  O     . TRP D  1 74   ? 179.193 184.778 204.782 1.00 96.58  ? 68   TRP C O     1 
ATOM   7803  C  CB    . TRP D  1 74   ? 177.796 187.059 202.723 1.00 96.58  ? 68   TRP C CB    1 
ATOM   7804  C  CG    . TRP D  1 74   ? 178.372 187.964 201.708 1.00 96.58  ? 68   TRP C CG    1 
ATOM   7805  C  CD1   . TRP D  1 74   ? 177.883 188.218 200.462 1.00 96.58  ? 68   TRP C CD1   1 
ATOM   7806  C  CD2   . TRP D  1 74   ? 179.567 188.733 201.839 1.00 96.58  ? 68   TRP C CD2   1 
ATOM   7807  N  NE1   . TRP D  1 74   ? 178.703 189.103 199.808 1.00 96.58  ? 68   TRP C NE1   1 
ATOM   7808  C  CE2   . TRP D  1 74   ? 179.745 189.434 200.633 1.00 96.58  ? 68   TRP C CE2   1 
ATOM   7809  C  CE3   . TRP D  1 74   ? 180.507 188.896 202.862 1.00 96.58  ? 68   TRP C CE3   1 
ATOM   7810  C  CZ2   . TRP D  1 74   ? 180.823 190.288 200.420 1.00 96.58  ? 68   TRP C CZ2   1 
ATOM   7811  C  CZ3   . TRP D  1 74   ? 181.575 189.744 202.647 1.00 96.58  ? 68   TRP C CZ3   1 
ATOM   7812  C  CH2   . TRP D  1 74   ? 181.725 190.430 201.439 1.00 96.58  ? 68   TRP C CH2   1 
ATOM   7813  N  N     . PRO D  1 75   ? 177.014 184.501 204.360 1.00 106.67 ? 69   PRO C N     1 
ATOM   7814  C  CA    . PRO D  1 75   ? 176.835 183.843 205.661 1.00 106.67 ? 69   PRO C CA    1 
ATOM   7815  C  C     . PRO D  1 75   ? 177.705 182.619 205.836 1.00 106.67 ? 69   PRO C C     1 
ATOM   7816  O  O     . PRO D  1 75   ? 178.205 182.394 206.942 1.00 106.67 ? 69   PRO C O     1 
ATOM   7817  C  CB    . PRO D  1 75   ? 175.342 183.488 205.674 1.00 106.67 ? 69   PRO C CB    1 
ATOM   7818  C  CG    . PRO D  1 75   ? 174.946 183.461 204.245 1.00 106.67 ? 69   PRO C CG    1 
ATOM   7819  C  CD    . PRO D  1 75   ? 175.760 184.515 203.591 1.00 106.67 ? 69   PRO C CD    1 
ATOM   7820  N  N     . HIS D  1 76   ? 177.927 181.835 204.783 1.00 114.14 ? 70   HIS C N     1 
ATOM   7821  C  CA    . HIS D  1 76   ? 178.796 180.674 204.921 1.00 114.14 ? 70   HIS C CA    1 
ATOM   7822  C  C     . HIS D  1 76   ? 180.224 181.093 205.257 1.00 114.14 ? 70   HIS C C     1 
ATOM   7823  O  O     . HIS D  1 76   ? 180.849 180.514 206.152 1.00 114.14 ? 70   HIS C O     1 
ATOM   7824  C  CB    . HIS D  1 76   ? 178.773 179.835 203.647 1.00 114.14 ? 70   HIS C CB    1 
ATOM   7825  C  CG    . HIS D  1 76   ? 177.437 179.245 203.326 1.00 114.14 ? 70   HIS C CG    1 
ATOM   7826  N  ND1   . HIS D  1 76   ? 176.515 179.881 202.522 1.00 114.14 ? 70   HIS C ND1   1 
ATOM   7827  C  CD2   . HIS D  1 76   ? 176.868 178.072 203.691 1.00 114.14 ? 70   HIS C CD2   1 
ATOM   7828  C  CE1   . HIS D  1 76   ? 175.436 179.129 202.410 1.00 114.14 ? 70   HIS C CE1   1 
ATOM   7829  N  NE2   . HIS D  1 76   ? 175.622 178.026 203.111 1.00 114.14 ? 70   HIS C NE2   1 
ATOM   7830  N  N     . THR D  1 77   ? 180.751 182.101 204.561 1.00 111.90 ? 71   THR C N     1 
ATOM   7831  C  CA    . THR D  1 77   ? 182.100 182.583 204.848 1.00 111.90 ? 71   THR C CA    1 
ATOM   7832  C  C     . THR D  1 77   ? 182.201 183.135 206.264 1.00 111.90 ? 71   THR C C     1 
ATOM   7833  O  O     . THR D  1 77   ? 183.145 182.817 207.004 1.00 111.90 ? 71   THR C O     1 
ATOM   7834  C  CB    . THR D  1 77   ? 182.490 183.658 203.836 1.00 111.90 ? 71   THR C CB    1 
ATOM   7835  O  OG1   . THR D  1 77   ? 182.458 183.107 202.516 1.00 111.90 ? 71   THR C OG1   1 
ATOM   7836  C  CG2   . THR D  1 77   ? 183.881 184.195 204.127 1.00 111.90 ? 71   THR C CG2   1 
ATOM   7837  N  N     . LEU D  1 78   ? 181.258 184.002 206.632 1.00 106.16 ? 72   LEU C N     1 
ATOM   7838  C  CA    . LEU D  1 78   ? 181.142 184.473 208.005 1.00 106.16 ? 72   LEU C CA    1 
ATOM   7839  C  C     . LEU D  1 78   ? 181.232 183.324 208.991 1.00 106.16 ? 72   LEU C C     1 
ATOM   7840  O  O     . LEU D  1 78   ? 182.053 183.353 209.913 1.00 106.16 ? 72   LEU C O     1 
ATOM   7841  C  CB    . LEU D  1 78   ? 179.816 185.216 208.173 1.00 106.16 ? 72   LEU C CB    1 
ATOM   7842  C  CG    . LEU D  1 78   ? 179.404 185.795 209.526 1.00 106.16 ? 72   LEU C CG    1 
ATOM   7843  C  CD1   . LEU D  1 78   ? 178.753 184.756 210.442 1.00 106.16 ? 72   LEU C CD1   1 
ATOM   7844  C  CD2   . LEU D  1 78   ? 180.600 186.427 210.204 1.00 106.16 ? 72   LEU C CD2   1 
ATOM   7845  N  N     . LEU D  1 79   ? 180.369 182.325 208.830 1.00 107.60 ? 73   LEU C N     1 
ATOM   7846  C  CA    . LEU D  1 79   ? 180.335 181.207 209.760 1.00 107.60 ? 73   LEU C CA    1 
ATOM   7847  C  C     . LEU D  1 79   ? 181.679 180.507 209.813 1.00 107.60 ? 73   LEU C C     1 
ATOM   7848  O  O     . LEU D  1 79   ? 182.138 180.113 210.888 1.00 107.60 ? 73   LEU C O     1 
ATOM   7849  C  CB    . LEU D  1 79   ? 179.234 180.235 209.349 1.00 107.60 ? 73   LEU C CB    1 
ATOM   7850  C  CG    . LEU D  1 79   ? 178.910 179.068 210.277 1.00 107.60 ? 73   LEU C CG    1 
ATOM   7851  C  CD1   . LEU D  1 79   ? 177.446 178.702 210.134 1.00 107.60 ? 73   LEU C CD1   1 
ATOM   7852  C  CD2   . LEU D  1 79   ? 179.784 177.861 209.967 1.00 107.60 ? 73   LEU C CD2   1 
ATOM   7853  N  N     . ILE D  1 80   ? 182.320 180.333 208.659 1.00 107.14 ? 74   ILE C N     1 
ATOM   7854  C  CA    . ILE D  1 80   ? 183.609 179.657 208.640 1.00 107.14 ? 74   ILE C CA    1 
ATOM   7855  C  C     . ILE D  1 80   ? 184.624 180.421 209.474 1.00 107.14 ? 74   ILE C C     1 
ATOM   7856  O  O     . ILE D  1 80   ? 185.365 179.834 210.270 1.00 107.14 ? 74   ILE C O     1 
ATOM   7857  C  CB    . ILE D  1 80   ? 184.088 179.470 207.194 1.00 107.14 ? 74   ILE C CB    1 
ATOM   7858  C  CG1   . ILE D  1 80   ? 183.153 178.508 206.457 1.00 107.14 ? 74   ILE C CG1   1 
ATOM   7859  C  CG2   . ILE D  1 80   ? 185.515 178.965 207.172 1.00 107.14 ? 74   ILE C CG2   1 
ATOM   7860  C  CD1   . ILE D  1 80   ? 183.334 178.485 204.954 1.00 107.14 ? 74   ILE C CD1   1 
ATOM   7861  N  N     . PHE D  1 81   ? 184.654 181.745 209.335 1.00 105.93 ? 75   PHE C N     1 
ATOM   7862  C  CA    . PHE D  1 81   ? 185.641 182.512 210.086 1.00 105.93 ? 75   PHE C CA    1 
ATOM   7863  C  C     . PHE D  1 81   ? 185.331 182.494 211.575 1.00 105.93 ? 75   PHE C C     1 
ATOM   7864  O  O     . PHE D  1 81   ? 186.228 182.307 212.408 1.00 105.93 ? 75   PHE C O     1 
ATOM   7865  C  CB    . PHE D  1 81   ? 185.707 183.943 209.580 1.00 105.93 ? 75   PHE C CB    1 
ATOM   7866  C  CG    . PHE D  1 81   ? 186.308 184.075 208.223 1.00 105.93 ? 75   PHE C CG    1 
ATOM   7867  C  CD1   . PHE D  1 81   ? 186.843 182.983 207.572 1.00 105.93 ? 75   PHE C CD1   1 
ATOM   7868  C  CD2   . PHE D  1 81   ? 186.390 185.309 207.616 1.00 105.93 ? 75   PHE C CD2   1 
ATOM   7869  C  CE1   . PHE D  1 81   ? 187.411 183.116 206.322 1.00 105.93 ? 75   PHE C CE1   1 
ATOM   7870  C  CE2   . PHE D  1 81   ? 186.959 185.444 206.369 1.00 105.93 ? 75   PHE C CE2   1 
ATOM   7871  C  CZ    . PHE D  1 81   ? 187.467 184.350 205.723 1.00 105.93 ? 75   PHE C CZ    1 
ATOM   7872  N  N     . THR D  1 82   ? 184.065 182.712 211.925 1.00 104.31 ? 76   THR C N     1 
ATOM   7873  C  CA    . THR D  1 82   ? 183.652 182.630 213.319 1.00 104.31 ? 76   THR C CA    1 
ATOM   7874  C  C     . THR D  1 82   ? 184.060 181.305 213.931 1.00 104.31 ? 76   THR C C     1 
ATOM   7875  O  O     . THR D  1 82   ? 184.593 181.259 215.043 1.00 104.31 ? 76   THR C O     1 
ATOM   7876  C  CB    . THR D  1 82   ? 182.142 182.792 213.423 1.00 104.31 ? 76   THR C CB    1 
ATOM   7877  O  OG1   . THR D  1 82   ? 181.508 181.728 212.708 1.00 104.31 ? 76   THR C OG1   1 
ATOM   7878  C  CG2   . THR D  1 82   ? 181.710 184.105 212.825 1.00 104.31 ? 76   THR C CG2   1 
ATOM   7879  N  N     . MET D  1 83   ? 183.812 180.210 213.224 1.00 104.02 ? 77   MET C N     1 
ATOM   7880  C  CA    . MET D  1 83   ? 184.076 178.912 213.812 1.00 104.02 ? 77   MET C CA    1 
ATOM   7881  C  C     . MET D  1 83   ? 185.572 178.642 213.858 1.00 104.02 ? 77   MET C C     1 
ATOM   7882  O  O     . MET D  1 83   ? 186.046 177.948 214.761 1.00 104.02 ? 77   MET C O     1 
ATOM   7883  C  CB    . MET D  1 83   ? 183.309 177.833 213.043 1.00 104.02 ? 77   MET C CB    1 
ATOM   7884  C  CG    . MET D  1 83   ? 183.131 176.545 213.822 1.00 104.02 ? 77   MET C CG    1 
ATOM   7885  S  SD    . MET D  1 83   ? 181.996 175.370 213.061 1.00 104.02 ? 77   MET C SD    1 
ATOM   7886  C  CE    . MET D  1 83   ? 182.022 174.063 214.285 1.00 104.02 ? 77   MET C CE    1 
ATOM   7887  N  N     . SER D  1 84   ? 186.336 179.232 212.935 1.00 91.75  ? 78   SER C N     1 
ATOM   7888  C  CA    . SER D  1 84   ? 187.789 179.193 213.052 1.00 91.75  ? 78   SER C CA    1 
ATOM   7889  C  C     . SER D  1 84   ? 188.253 179.871 214.333 1.00 91.75  ? 78   SER C C     1 
ATOM   7890  O  O     . SER D  1 84   ? 189.112 179.346 215.049 1.00 91.75  ? 78   SER C O     1 
ATOM   7891  C  CB    . SER D  1 84   ? 188.432 179.859 211.841 1.00 91.75  ? 78   SER C CB    1 
ATOM   7892  O  OG    . SER D  1 84   ? 188.143 181.245 211.821 1.00 91.75  ? 78   SER C OG    1 
ATOM   7893  N  N     . PHE D  1 85   ? 187.703 181.045 214.631 1.00 74.59  ? 79   PHE C N     1 
ATOM   7894  C  CA    . PHE D  1 85   ? 188.063 181.717 215.875 1.00 74.59  ? 79   PHE C CA    1 
ATOM   7895  C  C     . PHE D  1 85   ? 187.648 180.898 217.088 1.00 74.59  ? 79   PHE C C     1 
ATOM   7896  O  O     . PHE D  1 85   ? 188.399 180.801 218.062 1.00 74.59  ? 79   PHE C O     1 
ATOM   7897  C  CB    . PHE D  1 85   ? 187.440 183.107 215.918 1.00 74.59  ? 79   PHE C CB    1 
ATOM   7898  C  CG    . PHE D  1 85   ? 188.177 184.118 215.098 1.00 74.59  ? 79   PHE C CG    1 
ATOM   7899  C  CD1   . PHE D  1 85   ? 189.510 183.940 214.807 1.00 74.59  ? 79   PHE C CD1   1 
ATOM   7900  C  CD2   . PHE D  1 85   ? 187.530 185.223 214.590 1.00 74.59  ? 79   PHE C CD2   1 
ATOM   7901  C  CE1   . PHE D  1 85   ? 190.194 184.863 214.050 1.00 74.59  ? 79   PHE C CE1   1 
ATOM   7902  C  CE2   . PHE D  1 85   ? 188.207 186.146 213.826 1.00 74.59  ? 79   PHE C CE2   1 
ATOM   7903  C  CZ    . PHE D  1 85   ? 189.542 185.967 213.556 1.00 74.59  ? 79   PHE C CZ    1 
ATOM   7904  N  N     . LEU D  1 86   ? 186.461 180.297 217.045 1.00 82.86  ? 80   LEU C N     1 
ATOM   7905  C  CA    . LEU D  1 86   ? 186.030 179.464 218.163 1.00 82.86  ? 80   LEU C CA    1 
ATOM   7906  C  C     . LEU D  1 86   ? 186.976 178.300 218.385 1.00 82.86  ? 80   LEU C C     1 
ATOM   7907  O  O     . LEU D  1 86   ? 187.354 178.011 219.525 1.00 82.86  ? 80   LEU C O     1 
ATOM   7908  C  CB    . LEU D  1 86   ? 184.613 178.945 217.940 1.00 82.86  ? 80   LEU C CB    1 
ATOM   7909  C  CG    . LEU D  1 86   ? 183.524 179.781 218.591 1.00 82.86  ? 80   LEU C CG    1 
ATOM   7910  C  CD1   . LEU D  1 86   ? 183.714 179.696 220.084 1.00 82.86  ? 80   LEU C CD1   1 
ATOM   7911  C  CD2   . LEU D  1 86   ? 183.600 181.214 218.127 1.00 82.86  ? 80   LEU C CD2   1 
ATOM   7912  N  N     . CYS D  1 87   ? 187.347 177.597 217.320 1.00 93.42  ? 81   CYS C N     1 
ATOM   7913  C  CA    . CYS D  1 87   ? 188.201 176.435 217.509 1.00 93.42  ? 81   CYS C CA    1 
ATOM   7914  C  C     . CYS D  1 87   ? 189.588 176.858 217.965 1.00 93.42  ? 81   CYS C C     1 
ATOM   7915  O  O     . CYS D  1 87   ? 190.184 176.212 218.833 1.00 93.42  ? 81   CYS C O     1 
ATOM   7916  C  CB    . CYS D  1 87   ? 188.261 175.600 216.229 1.00 93.42  ? 81   CYS C CB    1 
ATOM   7917  S  SG    . CYS D  1 87   ? 189.086 176.353 214.828 1.00 93.42  ? 81   CYS C SG    1 
ATOM   7918  N  N     . SER D  1 88   ? 190.103 177.963 217.426 1.00 78.13  ? 82   SER C N     1 
ATOM   7919  C  CA    . SER D  1 88   ? 191.394 178.457 217.882 1.00 78.13  ? 82   SER C CA    1 
ATOM   7920  C  C     . SER D  1 88   ? 191.357 178.845 219.352 1.00 78.13  ? 82   SER C C     1 
ATOM   7921  O  O     . SER D  1 88   ? 192.325 178.609 220.079 1.00 78.13  ? 82   SER C O     1 
ATOM   7922  C  CB    . SER D  1 88   ? 191.824 179.647 217.033 1.00 78.13  ? 82   SER C CB    1 
ATOM   7923  O  OG    . SER D  1 88   ? 193.044 180.173 217.510 1.00 78.13  ? 82   SER C OG    1 
ATOM   7924  N  N     . TRP D  1 89   ? 190.253 179.428 219.809 1.00 66.04  ? 83   TRP C N     1 
ATOM   7925  C  CA    . TRP D  1 89   ? 190.157 179.794 221.213 1.00 66.04  ? 83   TRP C CA    1 
ATOM   7926  C  C     . TRP D  1 89   ? 190.053 178.560 222.090 1.00 66.04  ? 83   TRP C C     1 
ATOM   7927  O  O     . TRP D  1 89   ? 190.811 178.421 223.053 1.00 66.04  ? 83   TRP C O     1 
ATOM   7928  C  CB    . TRP D  1 89   ? 188.962 180.718 221.430 1.00 66.04  ? 83   TRP C CB    1 
ATOM   7929  C  CG    . TRP D  1 89   ? 189.142 182.010 220.738 1.00 66.04  ? 83   TRP C CG    1 
ATOM   7930  C  CD1   . TRP D  1 89   ? 190.288 182.479 220.187 1.00 66.04  ? 83   TRP C CD1   1 
ATOM   7931  C  CD2   . TRP D  1 89   ? 188.138 182.989 220.464 1.00 66.04  ? 83   TRP C CD2   1 
ATOM   7932  N  NE1   . TRP D  1 89   ? 190.075 183.701 219.609 1.00 66.04  ? 83   TRP C NE1   1 
ATOM   7933  C  CE2   . TRP D  1 89   ? 188.758 184.035 219.765 1.00 66.04  ? 83   TRP C CE2   1 
ATOM   7934  C  CE3   . TRP D  1 89   ? 186.779 183.091 220.752 1.00 66.04  ? 83   TRP C CE3   1 
ATOM   7935  C  CZ2   . TRP D  1 89   ? 188.068 185.160 219.348 1.00 66.04  ? 83   TRP C CZ2   1 
ATOM   7936  C  CZ3   . TRP D  1 89   ? 186.098 184.212 220.340 1.00 66.04  ? 83   TRP C CZ3   1 
ATOM   7937  C  CH2   . TRP D  1 89   ? 186.742 185.231 219.648 1.00 66.04  ? 83   TRP C CH2   1 
ATOM   7938  N  N     . LEU D  1 90   ? 189.148 177.648 221.756 1.00 69.68  ? 84   LEU C N     1 
ATOM   7939  C  CA    . LEU D  1 90   ? 188.947 176.456 222.567 1.00 69.68  ? 84   LEU C CA    1 
ATOM   7940  C  C     . LEU D  1 90   ? 190.179 175.568 222.625 1.00 69.68  ? 84   LEU C C     1 
ATOM   7941  O  O     . LEU D  1 90   ? 190.443 174.963 223.667 1.00 69.68  ? 84   LEU C O     1 
ATOM   7942  C  CB    . LEU D  1 90   ? 187.764 175.653 222.035 1.00 69.68  ? 84   LEU C CB    1 
ATOM   7943  C  CG    . LEU D  1 90   ? 186.377 176.198 222.338 1.00 69.68  ? 84   LEU C CG    1 
ATOM   7944  C  CD1   . LEU D  1 90   ? 185.339 175.482 221.512 1.00 69.68  ? 84   LEU C CD1   1 
ATOM   7945  C  CD2   . LEU D  1 90   ? 186.119 175.960 223.801 1.00 69.68  ? 84   LEU C CD2   1 
ATOM   7946  N  N     . LEU D  1 91   ? 190.935 175.454 221.535 1.00 66.84  ? 85   LEU C N     1 
ATOM   7947  C  CA    . LEU D  1 91   ? 192.096 174.577 221.553 1.00 66.84  ? 85   LEU C CA    1 
ATOM   7948  C  C     . LEU D  1 91   ? 193.099 175.051 222.595 1.00 66.84  ? 85   LEU C C     1 
ATOM   7949  O  O     . LEU D  1 91   ? 193.489 174.303 223.500 1.00 66.84  ? 85   LEU C O     1 
ATOM   7950  C  CB    . LEU D  1 91   ? 192.714 174.522 220.156 1.00 66.84  ? 85   LEU C CB    1 
ATOM   7951  C  CG    . LEU D  1 91   ? 193.790 173.490 219.834 1.00 66.84  ? 85   LEU C CG    1 
ATOM   7952  C  CD1   . LEU D  1 91   ? 193.695 173.114 218.373 1.00 66.84  ? 85   LEU C CD1   1 
ATOM   7953  C  CD2   . LEU D  1 91   ? 195.166 174.043 220.131 1.00 66.84  ? 85   LEU C CD2   1 
ATOM   7954  N  N     . PHE D  1 92   ? 193.500 176.314 222.511 1.00 59.62  ? 86   PHE C N     1 
ATOM   7955  C  CA    . PHE D  1 92   ? 194.403 176.835 223.522 1.00 59.62  ? 86   PHE C CA    1 
ATOM   7956  C  C     . PHE D  1 92   ? 193.745 176.927 224.884 1.00 59.62  ? 86   PHE C C     1 
ATOM   7957  O  O     . PHE D  1 92   ? 194.448 176.931 225.893 1.00 59.62  ? 86   PHE C O     1 
ATOM   7958  C  CB    . PHE D  1 92   ? 194.932 178.196 223.100 1.00 59.62  ? 86   PHE C CB    1 
ATOM   7959  C  CG    . PHE D  1 92   ? 195.827 178.146 221.911 1.00 59.62  ? 86   PHE C CG    1 
ATOM   7960  C  CD1   . PHE D  1 92   ? 197.138 177.753 222.039 1.00 59.62  ? 86   PHE C CD1   1 
ATOM   7961  C  CD2   . PHE D  1 92   ? 195.356 178.488 220.662 1.00 59.62  ? 86   PHE C CD2   1 
ATOM   7962  C  CE1   . PHE D  1 92   ? 197.964 177.702 220.948 1.00 59.62  ? 86   PHE C CE1   1 
ATOM   7963  C  CE2   . PHE D  1 92   ? 196.180 178.439 219.568 1.00 59.62  ? 86   PHE C CE2   1 
ATOM   7964  C  CZ    . PHE D  1 92   ? 197.485 178.046 219.711 1.00 59.62  ? 86   PHE C CZ    1 
ATOM   7965  N  N     . ALA D  1 93   ? 192.418 177.002 224.948 1.00 60.72  ? 87   ALA C N     1 
ATOM   7966  C  CA    . ALA D  1 93   ? 191.755 176.957 226.244 1.00 60.72  ? 87   ALA C CA    1 
ATOM   7967  C  C     . ALA D  1 93   ? 192.006 175.624 226.919 1.00 60.72  ? 87   ALA C C     1 
ATOM   7968  O  O     . ALA D  1 93   ? 192.385 175.561 228.094 1.00 60.72  ? 87   ALA C O     1 
ATOM   7969  C  CB    . ALA D  1 93   ? 190.258 177.203 226.076 1.00 60.72  ? 87   ALA C CB    1 
ATOM   7970  N  N     . MET D  1 94   ? 191.787 174.542 226.179 1.00 68.14  ? 88   MET C N     1 
ATOM   7971  C  CA    . MET D  1 94   ? 192.142 173.224 226.673 1.00 68.14  ? 88   MET C CA    1 
ATOM   7972  C  C     . MET D  1 94   ? 193.610 173.169 227.050 1.00 68.14  ? 88   MET C C     1 
ATOM   7973  O  O     . MET D  1 94   ? 193.966 172.581 228.075 1.00 68.14  ? 88   MET C O     1 
ATOM   7974  C  CB    . MET D  1 94   ? 191.814 172.169 225.622 1.00 68.14  ? 88   MET C CB    1 
ATOM   7975  C  CG    . MET D  1 94   ? 192.044 170.742 226.076 1.00 68.14  ? 88   MET C CG    1 
ATOM   7976  S  SD    . MET D  1 94   ? 191.009 170.303 227.484 1.00 68.14  ? 88   MET C SD    1 
ATOM   7977  C  CE    . MET D  1 94   ? 189.391 170.252 226.725 1.00 68.14  ? 88   MET C CE    1 
ATOM   7978  N  N     . ALA D  1 95   ? 194.470 173.800 226.251 1.00 57.02  ? 89   ALA C N     1 
ATOM   7979  C  CA    . ALA D  1 95   ? 195.899 173.798 226.552 1.00 57.02  ? 89   ALA C CA    1 
ATOM   7980  C  C     . ALA D  1 95   ? 196.179 174.439 227.906 1.00 57.02  ? 89   ALA C C     1 
ATOM   7981  O  O     . ALA D  1 95   ? 196.829 173.840 228.768 1.00 57.02  ? 89   ALA C O     1 
ATOM   7982  C  CB    . ALA D  1 95   ? 196.668 174.519 225.448 1.00 57.02  ? 89   ALA C CB    1 
ATOM   7983  N  N     . TRP D  1 96   ? 195.704 175.667 228.106 1.00 54.73  ? 90   TRP C N     1 
ATOM   7984  C  CA    . TRP D  1 96   ? 195.966 176.359 229.361 1.00 54.73  ? 90   TRP C CA    1 
ATOM   7985  C  C     . TRP D  1 96   ? 195.375 175.604 230.538 1.00 54.73  ? 90   TRP C C     1 
ATOM   7986  O  O     . TRP D  1 96   ? 196.009 175.488 231.592 1.00 54.73  ? 90   TRP C O     1 
ATOM   7987  C  CB    . TRP D  1 96   ? 195.406 177.778 229.332 1.00 54.73  ? 90   TRP C CB    1 
ATOM   7988  C  CG    . TRP D  1 96   ? 196.097 178.697 228.403 1.00 54.73  ? 90   TRP C CG    1 
ATOM   7989  C  CD1   . TRP D  1 96   ? 195.600 179.225 227.258 1.00 54.73  ? 90   TRP C CD1   1 
ATOM   7990  C  CD2   . TRP D  1 96   ? 197.437 179.169 228.515 1.00 54.73  ? 90   TRP C CD2   1 
ATOM   7991  N  NE1   . TRP D  1 96   ? 196.539 180.024 226.657 1.00 54.73  ? 90   TRP C NE1   1 
ATOM   7992  C  CE2   . TRP D  1 96   ? 197.681 179.998 227.411 1.00 54.73  ? 90   TRP C CE2   1 
ATOM   7993  C  CE3   . TRP D  1 96   ? 198.454 178.974 229.448 1.00 54.73  ? 90   TRP C CE3   1 
ATOM   7994  C  CZ2   . TRP D  1 96   ? 198.892 180.637 227.216 1.00 54.73  ? 90   TRP C CZ2   1 
ATOM   7995  C  CZ3   . TRP D  1 96   ? 199.657 179.603 229.251 1.00 54.73  ? 90   TRP C CZ3   1 
ATOM   7996  C  CH2   . TRP D  1 96   ? 199.870 180.424 228.144 1.00 54.73  ? 90   TRP C CH2   1 
ATOM   7997  N  N     . TRP D  1 97   ? 194.145 175.117 230.390 1.00 58.05  ? 91   TRP C N     1 
ATOM   7998  C  CA    . TRP D  1 97   ? 193.523 174.368 231.470 1.00 58.05  ? 91   TRP C CA    1 
ATOM   7999  C  C     . TRP D  1 97   ? 194.350 173.150 231.830 1.00 58.05  ? 91   TRP C C     1 
ATOM   8000  O  O     . TRP D  1 97   ? 194.611 172.887 233.009 1.00 58.05  ? 91   TRP C O     1 
ATOM   8001  C  CB    . TRP D  1 97   ? 192.117 173.954 231.059 1.00 58.05  ? 91   TRP C CB    1 
ATOM   8002  C  CG    . TRP D  1 97   ? 191.444 173.129 232.066 1.00 58.05  ? 91   TRP C CG    1 
ATOM   8003  C  CD1   . TRP D  1 97   ? 191.062 173.508 233.311 1.00 58.05  ? 91   TRP C CD1   1 
ATOM   8004  C  CD2   . TRP D  1 97   ? 191.069 171.765 231.924 1.00 58.05  ? 91   TRP C CD2   1 
ATOM   8005  N  NE1   . TRP D  1 97   ? 190.461 172.458 233.959 1.00 58.05  ? 91   TRP C NE1   1 
ATOM   8006  C  CE2   . TRP D  1 97   ? 190.455 171.375 233.122 1.00 58.05  ? 91   TRP C CE2   1 
ATOM   8007  C  CE3   . TRP D  1 97   ? 191.189 170.832 230.896 1.00 58.05  ? 91   TRP C CE3   1 
ATOM   8008  C  CZ2   . TRP D  1 97   ? 189.964 170.096 233.319 1.00 58.05  ? 91   TRP C CZ2   1 
ATOM   8009  C  CZ3   . TRP D  1 97   ? 190.705 169.569 231.092 1.00 58.05  ? 91   TRP C CZ3   1 
ATOM   8010  C  CH2   . TRP D  1 97   ? 190.100 169.208 232.292 1.00 58.05  ? 91   TRP C CH2   1 
ATOM   8011  N  N     . LEU D  1 98   ? 194.782 172.403 230.819 1.00 57.09  ? 92   LEU C N     1 
ATOM   8012  C  CA    . LEU D  1 98   ? 195.600 171.229 231.055 1.00 57.09  ? 92   LEU C CA    1 
ATOM   8013  C  C     . LEU D  1 98   ? 196.901 171.598 231.743 1.00 57.09  ? 92   LEU C C     1 
ATOM   8014  O  O     . LEU D  1 98   ? 197.378 170.867 232.612 1.00 57.09  ? 92   LEU C O     1 
ATOM   8015  C  CB    . LEU D  1 98   ? 195.874 170.533 229.730 1.00 57.09  ? 92   LEU C CB    1 
ATOM   8016  C  CG    . LEU D  1 98   ? 196.645 169.230 229.819 1.00 57.09  ? 92   LEU C CG    1 
ATOM   8017  C  CD1   . LEU D  1 98   ? 195.812 168.211 230.565 1.00 57.09  ? 92   LEU C CD1   1 
ATOM   8018  C  CD2   . LEU D  1 98   ? 196.997 168.743 228.431 1.00 57.09  ? 92   LEU C CD2   1 
ATOM   8019  N  N     . ILE D  1 99   ? 197.497 172.725 231.365 1.00 55.30  ? 93   ILE C N     1 
ATOM   8020  C  CA    . ILE D  1 99   ? 198.746 173.130 231.994 1.00 55.30  ? 93   ILE C CA    1 
ATOM   8021  C  C     . ILE D  1 99   ? 198.528 173.452 233.458 1.00 55.30  ? 93   ILE C C     1 
ATOM   8022  O  O     . ILE D  1 99   ? 199.299 173.023 234.321 1.00 55.30  ? 93   ILE C O     1 
ATOM   8023  C  CB    . ILE D  1 99   ? 199.365 174.321 231.251 1.00 55.30  ? 93   ILE C CB    1 
ATOM   8024  C  CG1   . ILE D  1 99   ? 199.723 173.914 229.829 1.00 55.30  ? 93   ILE C CG1   1 
ATOM   8025  C  CG2   . ILE D  1 99   ? 200.580 174.828 232.001 1.00 55.30  ? 93   ILE C CG2   1 
ATOM   8026  C  CD1   . ILE D  1 99   ? 200.670 172.748 229.770 1.00 55.30  ? 93   ILE C CD1   1 
ATOM   8027  N  N     . ALA D  1 100  ? 197.491 174.228 233.762 1.00 59.16  ? 94   ALA C N     1 
ATOM   8028  C  CA    . ALA D  1 100  ? 197.195 174.523 235.156 1.00 59.16  ? 94   ALA C CA    1 
ATOM   8029  C  C     . ALA D  1 100  ? 196.947 173.252 235.937 1.00 59.16  ? 94   ALA C C     1 
ATOM   8030  O  O     . ALA D  1 100  ? 197.320 173.155 237.111 1.00 59.16  ? 94   ALA C O     1 
ATOM   8031  C  CB    . ALA D  1 100  ? 195.983 175.435 235.261 1.00 59.16  ? 94   ALA C CB    1 
ATOM   8032  N  N     . PHE D  1 101  ? 196.328 172.267 235.304 1.00 62.85  ? 95   PHE C N     1 
ATOM   8033  C  CA    . PHE D  1 101  ? 196.033 171.047 236.027 1.00 62.85  ? 95   PHE C CA    1 
ATOM   8034  C  C     . PHE D  1 101  ? 197.263 170.176 236.207 1.00 62.85  ? 95   PHE C C     1 
ATOM   8035  O  O     . PHE D  1 101  ? 197.369 169.476 237.218 1.00 62.85  ? 95   PHE C O     1 
ATOM   8036  C  CB    . PHE D  1 101  ? 194.936 170.285 235.308 1.00 62.85  ? 95   PHE C CB    1 
ATOM   8037  C  CG    . PHE D  1 101  ? 194.449 169.107 236.059 1.00 62.85  ? 95   PHE C CG    1 
ATOM   8038  C  CD1   . PHE D  1 101  ? 193.762 169.276 237.236 1.00 62.85  ? 95   PHE C CD1   1 
ATOM   8039  C  CD2   . PHE D  1 101  ? 194.645 167.835 235.583 1.00 62.85  ? 95   PHE C CD2   1 
ATOM   8040  C  CE1   . PHE D  1 101  ? 193.307 168.202 237.933 1.00 62.85  ? 95   PHE C CE1   1 
ATOM   8041  C  CE2   . PHE D  1 101  ? 194.184 166.758 236.282 1.00 62.85  ? 95   PHE C CE2   1 
ATOM   8042  C  CZ    . PHE D  1 101  ? 193.513 166.939 237.456 1.00 62.85  ? 95   PHE C CZ    1 
ATOM   8043  N  N     . ALA D  1 102  ? 198.193 170.211 235.261 1.00 62.07  ? 96   ALA C N     1 
ATOM   8044  C  CA    . ALA D  1 102  ? 199.426 169.448 235.393 1.00 62.07  ? 96   ALA C CA    1 
ATOM   8045  C  C     . ALA D  1 102  ? 200.357 170.090 236.404 1.00 62.07  ? 96   ALA C C     1 
ATOM   8046  O  O     . ALA D  1 102  ? 201.097 169.393 237.106 1.00 62.07  ? 96   ALA C O     1 
ATOM   8047  C  CB    . ALA D  1 102  ? 200.119 169.329 234.039 1.00 62.07  ? 96   ALA C CB    1 
ATOM   8048  N  N     . HIS D  1 103  ? 200.328 171.417 236.491 1.00 66.38  ? 97   HIS C N     1 
ATOM   8049  C  CA    . HIS D  1 103  ? 201.103 172.121 237.497 1.00 66.38  ? 97   HIS C CA    1 
ATOM   8050  C  C     . HIS D  1 103  ? 200.593 171.857 238.904 1.00 66.38  ? 97   HIS C C     1 
ATOM   8051  O  O     . HIS D  1 103  ? 201.213 172.307 239.872 1.00 66.38  ? 97   HIS C O     1 
ATOM   8052  C  CB    . HIS D  1 103  ? 201.081 173.614 237.198 1.00 66.38  ? 97   HIS C CB    1 
ATOM   8053  C  CG    . HIS D  1 103  ? 201.905 174.432 238.137 1.00 66.38  ? 97   HIS C CG    1 
ATOM   8054  N  ND1   . HIS D  1 103  ? 201.394 174.959 239.302 1.00 66.38  ? 97   HIS C ND1   1 
ATOM   8055  C  CD2   . HIS D  1 103  ? 203.206 174.794 238.097 1.00 66.38  ? 97   HIS C CD2   1 
ATOM   8056  C  CE1   . HIS D  1 103  ? 202.343 175.626 239.931 1.00 66.38  ? 97   HIS C CE1   1 
ATOM   8057  N  NE2   . HIS D  1 103  ? 203.453 175.541 239.222 1.00 66.38  ? 97   HIS C NE2   1 
ATOM   8058  N  N     . GLY D  1 104  ? 199.496 171.123 239.039 1.00 72.27  ? 98   GLY C N     1 
ATOM   8059  C  CA    . GLY D  1 104  ? 198.908 170.914 240.340 1.00 72.27  ? 98   GLY C CA    1 
ATOM   8060  C  C     . GLY D  1 104  ? 198.455 172.239 240.889 1.00 72.27  ? 98   GLY C C     1 
ATOM   8061  O  O     . GLY D  1 104  ? 198.815 172.621 242.003 1.00 72.27  ? 98   GLY C O     1 
ATOM   8062  N  N     . ASP D  1 105  ? 197.677 172.964 240.094 1.00 76.36  ? 99   ASP C N     1 
ATOM   8063  C  CA    . ASP D  1 105  ? 197.286 174.313 240.451 1.00 76.36  ? 99   ASP C CA    1 
ATOM   8064  C  C     . ASP D  1 105  ? 195.792 174.481 240.668 1.00 76.36  ? 99   ASP C C     1 
ATOM   8065  O  O     . ASP D  1 105  ? 195.369 175.560 241.093 1.00 76.36  ? 99   ASP C O     1 
ATOM   8066  C  CB    . ASP D  1 105  ? 197.762 175.300 239.375 1.00 76.36  ? 99   ASP C CB    1 
ATOM   8067  C  CG    . ASP D  1 105  ? 197.647 176.729 239.819 1.00 76.36  ? 99   ASP C CG    1 
ATOM   8068  O  OD1   . ASP D  1 105  ? 198.426 177.129 240.708 1.00 76.36  ? 99   ASP C OD1   1 
ATOM   8069  O  OD2   . ASP D  1 105  ? 196.781 177.453 239.288 1.00 76.36  ? 99   ASP C OD2   1 
ATOM   8070  N  N     . LEU D  1 106  ? 194.985 173.460 240.403 1.00 78.29  ? 100  LEU C N     1 
ATOM   8071  C  CA    . LEU D  1 106  ? 193.552 173.574 240.633 1.00 78.29  ? 100  LEU C CA    1 
ATOM   8072  C  C     . LEU D  1 106  ? 193.175 173.143 242.041 1.00 78.29  ? 100  LEU C C     1 
ATOM   8073  O  O     . LEU D  1 106  ? 192.279 173.725 242.659 1.00 78.29  ? 100  LEU C O     1 
ATOM   8074  C  CB    . LEU D  1 106  ? 192.787 172.751 239.601 1.00 78.29  ? 100  LEU C CB    1 
ATOM   8075  C  CG    . LEU D  1 106  ? 192.878 173.350 238.205 1.00 78.29  ? 100  LEU C CG    1 
ATOM   8076  C  CD1   . LEU D  1 106  ? 192.248 172.443 237.174 1.00 78.29  ? 100  LEU C CD1   1 
ATOM   8077  C  CD2   . LEU D  1 106  ? 192.191 174.692 238.223 1.00 78.29  ? 100  LEU C CD2   1 
ATOM   8078  N  N     . ALA D  1 107  ? 193.841 172.124 242.551 1.00 88.23  ? 101  ALA C N     1 
ATOM   8079  C  CA    . ALA D  1 107  ? 193.488 171.576 243.852 1.00 88.23  ? 101  ALA C CA    1 
ATOM   8080  C  C     . ALA D  1 107  ? 193.975 172.417 245.030 1.00 88.23  ? 101  ALA C C     1 
ATOM   8081  O  O     . ALA D  1 107  ? 193.161 172.806 245.877 1.00 88.23  ? 101  ALA C O     1 
ATOM   8082  C  CB    . ALA D  1 107  ? 194.035 170.156 243.993 1.00 88.23  ? 101  ALA C CB    1 
ATOM   8083  N  N     . PRO D  1 108  ? 195.283 172.719 245.134 1.00 91.64  ? 102  PRO C N     1 
ATOM   8084  C  CA    . PRO D  1 108  ? 195.826 173.122 246.439 1.00 91.64  ? 102  PRO C CA    1 
ATOM   8085  C  C     . PRO D  1 108  ? 195.271 174.430 246.974 1.00 91.64  ? 102  PRO C C     1 
ATOM   8086  O  O     . PRO D  1 108  ? 194.687 174.452 248.063 1.00 91.64  ? 102  PRO C O     1 
ATOM   8087  C  CB    . PRO D  1 108  ? 197.331 173.231 246.168 1.00 91.64  ? 102  PRO C CB    1 
ATOM   8088  C  CG    . PRO D  1 108  ? 197.427 173.551 244.733 1.00 91.64  ? 102  PRO C CG    1 
ATOM   8089  C  CD    . PRO D  1 108  ? 196.298 172.826 244.069 1.00 91.64  ? 102  PRO C CD    1 
ATOM   8090  N  N     . SER D  1 109  ? 195.437 175.516 246.220 1.00 92.69  ? 103  SER C N     1 
ATOM   8091  C  CA    . SER D  1 109  ? 195.148 176.866 246.706 1.00 92.69  ? 103  SER C CA    1 
ATOM   8092  C  C     . SER D  1 109  ? 195.812 177.107 248.060 1.00 92.69  ? 103  SER C C     1 
ATOM   8093  O  O     . SER D  1 109  ? 195.317 177.865 248.896 1.00 92.69  ? 103  SER C O     1 
ATOM   8094  C  CB    . SER D  1 109  ? 193.641 177.114 246.778 1.00 92.69  ? 103  SER C CB    1 
ATOM   8095  O  OG    . SER D  1 109  ? 193.032 176.283 247.748 1.00 92.69  ? 103  SER C OG    1 
ATOM   8096  N  N     . GLU D  1 110  ? 196.957 176.451 248.272 1.00 92.49  ? 104  GLU C N     1 
ATOM   8097  C  CA    . GLU D  1 110  ? 197.621 176.498 249.569 1.00 92.49  ? 104  GLU C CA    1 
ATOM   8098  C  C     . GLU D  1 110  ? 198.179 177.881 249.869 1.00 92.49  ? 104  GLU C C     1 
ATOM   8099  O  O     . GLU D  1 110  ? 198.456 178.194 251.032 1.00 92.49  ? 104  GLU C O     1 
ATOM   8100  C  CB    . GLU D  1 110  ? 198.738 175.455 249.621 1.00 92.49  ? 104  GLU C CB    1 
ATOM   8101  N  N     . GLY D  1 111  ? 198.355 178.711 248.846 1.00 94.04  ? 105  GLY C N     1 
ATOM   8102  C  CA    . GLY D  1 111  ? 198.870 180.050 249.038 1.00 94.04  ? 105  GLY C CA    1 
ATOM   8103  C  C     . GLY D  1 111  ? 200.343 180.165 248.709 1.00 94.04  ? 105  GLY C C     1 
ATOM   8104  O  O     . GLY D  1 111  ? 200.808 181.218 248.265 1.00 94.04  ? 105  GLY C O     1 
ATOM   8105  N  N     . THR D  1 112  ? 201.088 179.080 248.920 1.00 91.18  ? 106  THR C N     1 
ATOM   8106  C  CA    . THR D  1 112  ? 202.525 179.114 248.680 1.00 91.18  ? 106  THR C CA    1 
ATOM   8107  C  C     . THR D  1 112  ? 202.853 178.998 247.195 1.00 91.18  ? 106  THR C C     1 
ATOM   8108  O  O     . THR D  1 112  ? 203.411 179.931 246.606 1.00 91.18  ? 106  THR C O     1 
ATOM   8109  C  CB    . THR D  1 112  ? 203.213 177.993 249.460 1.00 91.18  ? 106  THR C CB    1 
ATOM   8110  N  N     . ALA D  1 113  ? 202.506 177.872 246.574 1.00 80.56  ? 107  ALA C N     1 
ATOM   8111  C  CA    . ALA D  1 113  ? 202.883 177.624 245.190 1.00 80.56  ? 107  ALA C CA    1 
ATOM   8112  C  C     . ALA D  1 113  ? 202.139 178.571 244.259 1.00 80.56  ? 107  ALA C C     1 
ATOM   8113  O  O     . ALA D  1 113  ? 200.909 178.671 244.311 1.00 80.56  ? 107  ALA C O     1 
ATOM   8114  C  CB    . ALA D  1 113  ? 202.593 176.173 244.812 1.00 80.56  ? 107  ALA C CB    1 
ATOM   8115  N  N     . GLU D  1 114  ? 202.883 179.248 243.414 1.00 73.19  ? 108  GLU C N     1 
ATOM   8116  C  CA    . GLU D  1 114  ? 202.330 180.230 242.494 1.00 73.19  ? 108  GLU C CA    1 
ATOM   8117  C  C     . GLU D  1 114  ? 201.941 179.548 241.193 1.00 73.19  ? 108  GLU C C     1 
ATOM   8118  O  O     . GLU D  1 114  ? 202.657 178.651 240.735 1.00 73.19  ? 108  GLU C O     1 
ATOM   8119  C  CB    . GLU D  1 114  ? 203.338 181.326 242.215 1.00 73.19  ? 108  GLU C CB    1 
ATOM   8120  C  CG    . GLU D  1 114  ? 203.727 182.103 243.449 1.00 73.19  ? 108  GLU C CG    1 
ATOM   8121  C  CD    . GLU D  1 114  ? 204.746 181.364 244.280 1.00 73.19  ? 108  GLU C CD    1 
ATOM   8122  O  OE1   . GLU D  1 114  ? 205.170 180.270 243.858 1.00 73.19  ? 108  GLU C OE1   1 
ATOM   8123  O  OE2   . GLU D  1 114  ? 205.119 181.865 245.358 1.00 73.19  ? 108  GLU C OE2   1 
ATOM   8124  N  N     . PRO D  1 115  ? 200.844 179.939 240.579 1.00 70.83  ? 109  PRO C N     1 
ATOM   8125  C  CA    . PRO D  1 115  ? 200.364 179.220 239.395 1.00 70.83  ? 109  PRO C CA    1 
ATOM   8126  C  C     . PRO D  1 115  ? 201.220 179.457 238.169 1.00 70.83  ? 109  PRO C C     1 
ATOM   8127  O  O     . PRO D  1 115  ? 202.020 180.395 238.132 1.00 70.83  ? 109  PRO C O     1 
ATOM   8128  C  CB    . PRO D  1 115  ? 198.959 179.792 239.199 1.00 70.83  ? 109  PRO C CB    1 
ATOM   8129  C  CG    . PRO D  1 115  ? 199.038 181.155 239.767 1.00 70.83  ? 109  PRO C CG    1 
ATOM   8130  C  CD    . PRO D  1 115  ? 199.974 181.071 240.933 1.00 70.83  ? 109  PRO C CD    1 
ATOM   8131  N  N     . CYS D  1 116  ? 201.063 178.599 237.159 1.00 78.26  ? 110  CYS C N     1 
ATOM   8132  C  CA    . CYS D  1 116  ? 201.555 178.951 235.835 1.00 78.26  ? 110  CYS C CA    1 
ATOM   8133  C  C     . CYS D  1 116  ? 200.916 180.246 235.366 1.00 78.26  ? 110  CYS C C     1 
ATOM   8134  O  O     . CYS D  1 116  ? 201.601 181.144 234.860 1.00 78.26  ? 110  CYS C O     1 
ATOM   8135  C  CB    . CYS D  1 116  ? 201.254 177.837 234.835 1.00 78.26  ? 110  CYS C CB    1 
ATOM   8136  S  SG    . CYS D  1 116  ? 202.024 176.234 235.149 1.00 78.26  ? 110  CYS C SG    1 
ATOM   8137  N  N     . VAL D  1 117  ? 199.607 180.360 235.544 1.00 66.75  ? 111  VAL C N     1 
ATOM   8138  C  CA    . VAL D  1 117  ? 198.845 181.543 235.179 1.00 66.75  ? 111  VAL C CA    1 
ATOM   8139  C  C     . VAL D  1 117  ? 197.933 181.891 236.343 1.00 66.75  ? 111  VAL C C     1 
ATOM   8140  O  O     . VAL D  1 117  ? 197.295 181.013 236.932 1.00 66.75  ? 111  VAL C O     1 
ATOM   8141  C  CB    . VAL D  1 117  ? 198.045 181.319 233.881 1.00 66.75  ? 111  VAL C CB    1 
ATOM   8142  C  CG1   . VAL D  1 117  ? 197.121 180.133 234.030 1.00 66.75  ? 111  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL D  1 117  ? 197.257 182.558 233.522 1.00 66.75  ? 111  VAL C CG2   1 
ATOM   8144  N  N     . THR D  1 118  ? 197.886 183.171 236.686 1.00 63.42  ? 112  THR C N     1 
ATOM   8145  C  CA    . THR D  1 118  ? 197.195 183.605 237.889 1.00 63.42  ? 112  THR C CA    1 
ATOM   8146  C  C     . THR D  1 118  ? 195.703 183.335 237.804 1.00 63.42  ? 112  THR C C     1 
ATOM   8147  O  O     . THR D  1 118  ? 195.068 183.576 236.775 1.00 63.42  ? 112  THR C O     1 
ATOM   8148  C  CB    . THR D  1 118  ? 197.423 185.095 238.125 1.00 63.42  ? 112  THR C CB    1 
ATOM   8149  O  OG1   . THR D  1 118  ? 196.938 185.832 237.000 1.00 63.42  ? 112  THR C OG1   1 
ATOM   8150  C  CG2   . THR D  1 118  ? 198.892 185.378 238.315 1.00 63.42  ? 112  THR C CG2   1 
ATOM   8151  N  N     . SER D  1 119  ? 195.155 182.818 238.902 1.00 61.35  ? 113  SER C N     1 
ATOM   8152  C  CA    . SER D  1 119  ? 193.723 182.834 239.185 1.00 61.35  ? 113  SER C CA    1 
ATOM   8153  C  C     . SER D  1 119  ? 192.913 182.204 238.050 1.00 61.35  ? 113  SER C C     1 
ATOM   8154  O  O     . SER D  1 119  ? 192.109 182.853 237.387 1.00 61.35  ? 113  SER C O     1 
ATOM   8155  C  CB    . SER D  1 119  ? 193.247 184.265 239.447 1.00 61.35  ? 113  SER C CB    1 
ATOM   8156  O  OG    . SER D  1 119  ? 193.323 185.041 238.266 1.00 61.35  ? 113  SER C OG    1 
ATOM   8157  N  N     . ILE D  1 120  ? 193.145 180.914 237.842 1.00 56.93  ? 114  ILE C N     1 
ATOM   8158  C  CA    . ILE D  1 120  ? 192.222 180.121 237.044 1.00 56.93  ? 114  ILE C CA    1 
ATOM   8159  C  C     . ILE D  1 120  ? 191.855 178.881 237.838 1.00 56.93  ? 114  ILE C C     1 
ATOM   8160  O  O     . ILE D  1 120  ? 192.709 178.223 238.437 1.00 56.93  ? 114  ILE C O     1 
ATOM   8161  C  CB    . ILE D  1 120  ? 192.765 179.740 235.650 1.00 56.93  ? 114  ILE C CB    1 
ATOM   8162  C  CG1   . ILE D  1 120  ? 193.886 178.729 235.733 1.00 56.93  ? 114  ILE C CG1   1 
ATOM   8163  C  CG2   . ILE D  1 120  ? 193.267 180.957 234.919 1.00 56.93  ? 114  ILE C CG2   1 
ATOM   8164  C  CD1   . ILE D  1 120  ? 194.166 178.161 234.394 1.00 56.93  ? 114  ILE C CD1   1 
ATOM   8165  N  N     . HIS D  1 121  ? 190.563 178.579 237.857 1.00 57.84  ? 115  HIS C N     1 
ATOM   8166  C  CA    . HIS D  1 121  ? 190.059 177.520 238.713 1.00 57.84  ? 115  HIS C CA    1 
ATOM   8167  C  C     . HIS D  1 121  ? 189.098 176.612 237.972 1.00 57.84  ? 115  HIS C C     1 
ATOM   8168  O  O     . HIS D  1 121  ? 188.733 175.557 238.500 1.00 57.84  ? 115  HIS C O     1 
ATOM   8169  C  CB    . HIS D  1 121  ? 189.379 178.131 239.930 1.00 57.84  ? 115  HIS C CB    1 
ATOM   8170  C  CG    . HIS D  1 121  ? 190.254 179.085 240.674 1.00 57.84  ? 115  HIS C CG    1 
ATOM   8171  N  ND1   . HIS D  1 121  ? 190.273 180.434 240.402 1.00 57.84  ? 115  HIS C ND1   1 
ATOM   8172  C  CD2   . HIS D  1 121  ? 191.179 178.881 241.639 1.00 57.84  ? 115  HIS C CD2   1 
ATOM   8173  C  CE1   . HIS D  1 121  ? 191.152 181.025 241.190 1.00 57.84  ? 115  HIS C CE1   1 
ATOM   8174  N  NE2   . HIS D  1 121  ? 191.718 180.105 241.950 1.00 57.84  ? 115  HIS C NE2   1 
ATOM   8175  N  N     . SER D  1 122  ? 188.690 176.981 236.768 1.00 57.94  ? 116  SER C N     1 
ATOM   8176  C  CA    . SER D  1 122  ? 187.750 176.188 236.001 1.00 57.94  ? 116  SER C CA    1 
ATOM   8177  C  C     . SER D  1 122  ? 188.164 176.268 234.546 1.00 57.94  ? 116  SER C C     1 
ATOM   8178  O  O     . SER D  1 122  ? 188.857 177.197 234.131 1.00 57.94  ? 116  SER C O     1 
ATOM   8179  C  CB    . SER D  1 122  ? 186.318 176.690 236.183 1.00 57.94  ? 116  SER C CB    1 
ATOM   8180  O  OG    . SER D  1 122  ? 186.174 177.984 235.625 1.00 57.94  ? 116  SER C OG    1 
ATOM   8181  N  N     . PHE D  1 123  ? 187.736 175.275 233.768 1.00 56.27  ? 117  PHE C N     1 
ATOM   8182  C  CA    . PHE D  1 123  ? 187.962 175.361 232.336 1.00 56.27  ? 117  PHE C CA    1 
ATOM   8183  C  C     . PHE D  1 123  ? 187.383 176.645 231.772 1.00 56.27  ? 117  PHE C C     1 
ATOM   8184  O  O     . PHE D  1 123  ? 187.918 177.194 230.806 1.00 56.27  ? 117  PHE C O     1 
ATOM   8185  C  CB    . PHE D  1 123  ? 187.364 174.159 231.618 1.00 56.27  ? 117  PHE C CB    1 
ATOM   8186  C  CG    . PHE D  1 123  ? 187.511 174.230 230.135 1.00 56.27  ? 117  PHE C CG    1 
ATOM   8187  C  CD1   . PHE D  1 123  ? 188.735 174.016 229.542 1.00 56.27  ? 117  PHE C CD1   1 
ATOM   8188  C  CD2   . PHE D  1 123  ? 186.431 174.540 229.337 1.00 56.27  ? 117  PHE C CD2   1 
ATOM   8189  C  CE1   . PHE D  1 123  ? 188.874 174.097 228.181 1.00 56.27  ? 117  PHE C CE1   1 
ATOM   8190  C  CE2   . PHE D  1 123  ? 186.568 174.618 227.976 1.00 56.27  ? 117  PHE C CE2   1 
ATOM   8191  C  CZ    . PHE D  1 123  ? 187.791 174.399 227.398 1.00 56.27  ? 117  PHE C CZ    1 
ATOM   8192  N  N     . SER D  1 124  ? 186.297 177.137 232.364 1.00 60.41  ? 118  SER C N     1 
ATOM   8193  C  CA    . SER D  1 124  ? 185.787 178.446 231.985 1.00 60.41  ? 118  SER C CA    1 
ATOM   8194  C  C     . SER D  1 124  ? 186.853 179.514 232.155 1.00 60.41  ? 118  SER C C     1 
ATOM   8195  O  O     . SER D  1 124  ? 186.985 180.415 231.319 1.00 60.41  ? 118  SER C O     1 
ATOM   8196  C  CB    . SER D  1 124  ? 184.556 178.782 232.817 1.00 60.41  ? 118  SER C CB    1 
ATOM   8197  O  OG    . SER D  1 124  ? 184.080 180.073 232.506 1.00 60.41  ? 118  SER C OG    1 
ATOM   8198  N  N     . SER D  1 125  ? 187.629 179.428 233.235 1.00 59.10  ? 119  SER C N     1 
ATOM   8199  C  CA    . SER D  1 125  ? 188.696 180.396 233.445 1.00 59.10  ? 119  SER C CA    1 
ATOM   8200  C  C     . SER D  1 125  ? 189.724 180.320 232.333 1.00 59.10  ? 119  SER C C     1 
ATOM   8201  O  O     . SER D  1 125  ? 190.106 181.349 231.768 1.00 59.10  ? 119  SER C O     1 
ATOM   8202  C  CB    . SER D  1 125  ? 189.362 180.159 234.794 1.00 59.10  ? 119  SER C CB    1 
ATOM   8203  O  OG    . SER D  1 125  ? 188.442 180.341 235.850 1.00 59.10  ? 119  SER C OG    1 
ATOM   8204  N  N     . ALA D  1 126  ? 190.187 179.115 232.011 1.00 55.61  ? 120  ALA C N     1 
ATOM   8205  C  CA    . ALA D  1 126  ? 191.179 178.979 230.956 1.00 55.61  ? 120  ALA C CA    1 
ATOM   8206  C  C     . ALA D  1 126  ? 190.632 179.450 229.622 1.00 55.61  ? 120  ALA C C     1 
ATOM   8207  O  O     . ALA D  1 126  ? 191.379 179.982 228.796 1.00 55.61  ? 120  ALA C O     1 
ATOM   8208  C  CB    . ALA D  1 126  ? 191.648 177.533 230.854 1.00 55.61  ? 120  ALA C CB    1 
ATOM   8209  N  N     . PHE D  1 127  ? 189.333 179.295 229.403 1.00 55.59  ? 121  PHE C N     1 
ATOM   8210  C  CA    . PHE D  1 127  ? 188.759 179.743 228.143 1.00 55.59  ? 121  PHE C CA    1 
ATOM   8211  C  C     . PHE D  1 127  ? 188.710 181.262 228.072 1.00 55.59  ? 121  PHE C C     1 
ATOM   8212  O  O     . PHE D  1 127  ? 189.077 181.860 227.051 1.00 55.59  ? 121  PHE C O     1 
ATOM   8213  C  CB    . PHE D  1 127  ? 187.376 179.143 227.961 1.00 55.59  ? 121  PHE C CB    1 
ATOM   8214  C  CG    . PHE D  1 127  ? 186.736 179.523 226.682 1.00 55.59  ? 121  PHE C CG    1 
ATOM   8215  C  CD1   . PHE D  1 127  ? 187.269 179.095 225.488 1.00 55.59  ? 121  PHE C CD1   1 
ATOM   8216  C  CD2   . PHE D  1 127  ? 185.589 180.281 226.667 1.00 55.59  ? 121  PHE C CD2   1 
ATOM   8217  C  CE1   . PHE D  1 127  ? 186.688 179.436 224.297 1.00 55.59  ? 121  PHE C CE1   1 
ATOM   8218  C  CE2   . PHE D  1 127  ? 184.995 180.615 225.479 1.00 55.59  ? 121  PHE C CE2   1 
ATOM   8219  C  CZ    . PHE D  1 127  ? 185.546 180.196 224.290 1.00 55.59  ? 121  PHE C CZ    1 
ATOM   8220  N  N     . LEU D  1 128  ? 188.239 181.903 229.140 1.00 55.80  ? 122  LEU C N     1 
ATOM   8221  C  CA    . LEU D  1 128  ? 188.323 183.353 229.205 1.00 55.80  ? 122  LEU C CA    1 
ATOM   8222  C  C     . LEU D  1 128  ? 189.745 183.828 228.994 1.00 55.80  ? 122  LEU C C     1 
ATOM   8223  O  O     . LEU D  1 128  ? 189.974 184.818 228.294 1.00 55.80  ? 122  LEU C O     1 
ATOM   8224  C  CB    . LEU D  1 128  ? 187.818 183.862 230.548 1.00 55.80  ? 122  LEU C CB    1 
ATOM   8225  C  CG    . LEU D  1 128  ? 186.334 183.747 230.837 1.00 55.80  ? 122  LEU C CG    1 
ATOM   8226  C  CD1   . LEU D  1 128  ? 186.068 184.214 232.246 1.00 55.80  ? 122  LEU C CD1   1 
ATOM   8227  C  CD2   . LEU D  1 128  ? 185.569 184.585 229.851 1.00 55.80  ? 122  LEU C CD2   1 
ATOM   8228  N  N     . PHE D  1 129  ? 190.708 183.137 229.591 1.00 53.18  ? 123  PHE C N     1 
ATOM   8229  C  CA    . PHE D  1 129  ? 192.096 183.533 229.432 1.00 53.18  ? 123  PHE C CA    1 
ATOM   8230  C  C     . PHE D  1 129  ? 192.538 183.420 227.984 1.00 53.18  ? 123  PHE C C     1 
ATOM   8231  O  O     . PHE D  1 129  ? 193.235 184.302 227.472 1.00 53.18  ? 123  PHE C O     1 
ATOM   8232  C  CB    . PHE D  1 129  ? 192.986 182.682 230.320 1.00 53.18  ? 123  PHE C CB    1 
ATOM   8233  C  CG    . PHE D  1 129  ? 194.423 183.005 230.186 1.00 53.18  ? 123  PHE C CG    1 
ATOM   8234  C  CD1   . PHE D  1 129  ? 194.937 184.144 230.761 1.00 53.18  ? 123  PHE C CD1   1 
ATOM   8235  C  CD2   . PHE D  1 129  ? 195.262 182.186 229.466 1.00 53.18  ? 123  PHE C CD2   1 
ATOM   8236  C  CE1   . PHE D  1 129  ? 196.261 184.453 230.631 1.00 53.18  ? 123  PHE C CE1   1 
ATOM   8237  C  CE2   . PHE D  1 129  ? 196.589 182.492 229.334 1.00 53.18  ? 123  PHE C CE2   1 
ATOM   8238  C  CZ    . PHE D  1 129  ? 197.088 183.628 229.916 1.00 53.18  ? 123  PHE C CZ    1 
ATOM   8239  N  N     . SER D  1 130  ? 192.157 182.338 227.313 1.00 56.16  ? 124  SER C N     1 
ATOM   8240  C  CA    . SER D  1 130  ? 192.545 182.180 225.920 1.00 56.16  ? 124  SER C CA    1 
ATOM   8241  C  C     . SER D  1 130  ? 191.947 183.282 225.068 1.00 56.16  ? 124  SER C C     1 
ATOM   8242  O  O     . SER D  1 130  ? 192.611 183.813 224.170 1.00 56.16  ? 124  SER C O     1 
ATOM   8243  C  CB    . SER D  1 130  ? 192.112 180.814 225.407 1.00 56.16  ? 124  SER C CB    1 
ATOM   8244  O  OG    . SER D  1 130  ? 192.804 179.801 226.107 1.00 56.16  ? 124  SER C OG    1 
ATOM   8245  N  N     . ILE D  1 131  ? 190.697 183.647 225.340 1.00 55.38  ? 125  ILE C N     1 
ATOM   8246  C  CA    . ILE D  1 131  ? 190.083 184.732 224.583 1.00 55.38  ? 125  ILE C CA    1 
ATOM   8247  C  C     . ILE D  1 131  ? 190.811 186.037 224.846 1.00 55.38  ? 125  ILE C C     1 
ATOM   8248  O  O     . ILE D  1 131  ? 191.114 186.792 223.916 1.00 55.38  ? 125  ILE C O     1 
ATOM   8249  C  CB    . ILE D  1 131  ? 188.587 184.850 224.912 1.00 55.38  ? 125  ILE C CB    1 
ATOM   8250  C  CG1   . ILE D  1 131  ? 187.837 183.618 224.427 1.00 55.38  ? 125  ILE C CG1   1 
ATOM   8251  C  CG2   . ILE D  1 131  ? 188.008 186.083 224.278 1.00 55.38  ? 125  ILE C CG2   1 
ATOM   8252  C  CD1   . ILE D  1 131  ? 186.391 183.625 224.821 1.00 55.38  ? 125  ILE C CD1   1 
ATOM   8253  N  N     . GLU D  1 132  ? 191.119 186.319 226.110 1.00 62.55  ? 126  GLU C N     1 
ATOM   8254  C  CA    . GLU D  1 132  ? 191.851 187.535 226.428 1.00 62.55  ? 126  GLU C CA    1 
ATOM   8255  C  C     . GLU D  1 132  ? 193.184 187.585 225.709 1.00 62.55  ? 126  GLU C C     1 
ATOM   8256  O  O     . GLU D  1 132  ? 193.570 188.638 225.194 1.00 62.55  ? 126  GLU C O     1 
ATOM   8257  C  CB    . GLU D  1 132  ? 192.083 187.639 227.927 1.00 62.55  ? 126  GLU C CB    1 
ATOM   8258  C  CG    . GLU D  1 132  ? 190.827 187.813 228.732 1.00 62.55  ? 126  GLU C CG    1 
ATOM   8259  C  CD    . GLU D  1 132  ? 191.120 187.860 230.205 1.00 62.55  ? 126  GLU C CD    1 
ATOM   8260  O  OE1   . GLU D  1 132  ? 192.299 187.686 230.570 1.00 62.55  ? 126  GLU C OE1   1 
ATOM   8261  O  OE2   . GLU D  1 132  ? 190.179 188.046 231.000 1.00 62.55  ? 126  GLU C OE2   1 
ATOM   8262  N  N     . VAL D  1 133  ? 193.888 186.464 225.652 1.00 48.43  ? 127  VAL C N     1 
ATOM   8263  C  CA    . VAL D  1 133  ? 195.198 186.425 225.028 1.00 48.43  ? 127  VAL C CA    1 
ATOM   8264  C  C     . VAL D  1 133  ? 195.072 186.646 223.533 1.00 48.43  ? 127  VAL C C     1 
ATOM   8265  O  O     . VAL D  1 133  ? 195.618 187.608 222.989 1.00 48.43  ? 127  VAL C O     1 
ATOM   8266  C  CB    . VAL D  1 133  ? 195.905 185.094 225.311 1.00 48.43  ? 127  VAL C CB    1 
ATOM   8267  C  CG1   . VAL D  1 133  ? 197.162 185.000 224.486 1.00 48.43  ? 127  VAL C CG1   1 
ATOM   8268  C  CG2   . VAL D  1 133  ? 196.233 184.991 226.778 1.00 48.43  ? 127  VAL C CG2   1 
ATOM   8269  N  N     . GLN D  1 134  ? 194.343 185.762 222.859 1.00 57.50  ? 128  GLN C N     1 
ATOM   8270  C  CA    . GLN D  1 134  ? 194.378 185.760 221.403 1.00 57.50  ? 128  GLN C CA    1 
ATOM   8271  C  C     . GLN D  1 134  ? 193.700 186.994 220.822 1.00 57.50  ? 128  GLN C C     1 
ATOM   8272  O  O     . GLN D  1 134  ? 194.099 187.482 219.760 1.00 57.50  ? 128  GLN C O     1 
ATOM   8273  C  CB    . GLN D  1 134  ? 193.747 184.479 220.875 1.00 57.50  ? 128  GLN C CB    1 
ATOM   8274  C  CG    . GLN D  1 134  ? 193.766 184.382 219.380 1.00 57.50  ? 128  GLN C CG    1 
ATOM   8275  C  CD    . GLN D  1 134  ? 193.385 183.016 218.896 1.00 57.50  ? 128  GLN C CD    1 
ATOM   8276  O  OE1   . GLN D  1 134  ? 193.161 182.105 219.687 1.00 57.50  ? 128  GLN C OE1   1 
ATOM   8277  N  NE2   . GLN D  1 134  ? 193.299 182.860 217.583 1.00 57.50  ? 128  GLN C NE2   1 
ATOM   8278  N  N     . VAL D  1 135  ? 192.684 187.524 221.501 1.00 51.82  ? 129  VAL C N     1 
ATOM   8279  C  CA    . VAL D  1 135  ? 192.066 188.764 221.038 1.00 51.82  ? 129  VAL C CA    1 
ATOM   8280  C  C     . VAL D  1 135  ? 192.864 189.981 221.477 1.00 51.82  ? 129  VAL C C     1 
ATOM   8281  O  O     . VAL D  1 135  ? 192.532 191.108 221.091 1.00 51.82  ? 129  VAL C O     1 
ATOM   8282  C  CB    . VAL D  1 135  ? 190.604 188.778 221.521 1.00 51.82  ? 129  VAL C CB    1 
ATOM   8283  C  CG1   . VAL D  1 135  ? 189.866 190.006 221.050 1.00 51.82  ? 129  VAL C CG1   1 
ATOM   8284  C  CG2   . VAL D  1 135  ? 189.905 187.546 221.030 1.00 51.82  ? 129  VAL C CG2   1 
ATOM   8285  N  N     . THR D  1 136  ? 193.933 189.776 222.247 1.00 53.02  ? 130  THR C N     1 
ATOM   8286  C  CA    . THR D  1 136  ? 194.830 190.845 222.687 1.00 53.02  ? 130  THR C CA    1 
ATOM   8287  C  C     . THR D  1 136  ? 194.133 191.799 223.649 1.00 53.02  ? 130  THR C C     1 
ATOM   8288  O  O     . THR D  1 136  ? 194.397 193.002 223.657 1.00 53.02  ? 130  THR C O     1 
ATOM   8289  C  CB    . THR D  1 136  ? 195.416 191.622 221.507 1.00 53.02  ? 130  THR C CB    1 
ATOM   8290  O  OG1   . THR D  1 136  ? 194.371 192.337 220.844 1.00 53.02  ? 130  THR C OG1   1 
ATOM   8291  C  CG2   . THR D  1 136  ? 196.065 190.673 220.523 1.00 53.02  ? 130  THR C CG2   1 
ATOM   8292  N  N     . ILE D  1 137  ? 193.238 191.260 224.472 1.00 52.16  ? 131  ILE C N     1 
ATOM   8293  C  CA    . ILE D  1 137  ? 192.542 192.081 225.451 1.00 52.16  ? 131  ILE C CA    1 
ATOM   8294  C  C     . ILE D  1 137  ? 193.350 192.121 226.737 1.00 52.16  ? 131  ILE C C     1 
ATOM   8295  O  O     . ILE D  1 137  ? 193.834 193.182 227.145 1.00 52.16  ? 131  ILE C O     1 
ATOM   8296  C  CB    . ILE D  1 137  ? 191.130 191.546 225.714 1.00 52.16  ? 131  ILE C CB    1 
ATOM   8297  C  CG1   . ILE D  1 137  ? 190.288 191.649 224.447 1.00 52.16  ? 131  ILE C CG1   1 
ATOM   8298  C  CG2   . ILE D  1 137  ? 190.480 192.312 226.828 1.00 52.16  ? 131  ILE C CG2   1 
ATOM   8299  C  CD1   . ILE D  1 137  ? 188.965 190.953 224.560 1.00 52.16  ? 131  ILE C CD1   1 
ATOM   8300  N  N     . GLY D  1 138  ? 193.517 190.966 227.371 1.00 57.88  ? 132  GLY C N     1 
ATOM   8301  C  CA    . GLY D  1 138  ? 194.358 190.873 228.546 1.00 57.88  ? 132  GLY C CA    1 
ATOM   8302  C  C     . GLY D  1 138  ? 193.922 191.743 229.703 1.00 57.88  ? 132  GLY C C     1 
ATOM   8303  O  O     . GLY D  1 138  ? 194.587 192.734 230.010 1.00 57.88  ? 132  GLY C O     1 
ATOM   8304  N  N     . PHE D  1 139  ? 192.798 191.407 230.334 1.00 55.39  ? 133  PHE C N     1 
ATOM   8305  C  CA    . PHE D  1 139  ? 192.310 192.203 231.451 1.00 55.39  ? 133  PHE C CA    1 
ATOM   8306  C  C     . PHE D  1 139  ? 193.341 192.296 232.563 1.00 55.39  ? 133  PHE C C     1 
ATOM   8307  O  O     . PHE D  1 139  ? 193.697 193.398 232.990 1.00 55.39  ? 133  PHE C O     1 
ATOM   8308  C  CB    . PHE D  1 139  ? 191.003 191.636 231.990 1.00 55.39  ? 133  PHE C CB    1 
ATOM   8309  C  CG    . PHE D  1 139  ? 189.842 191.849 231.080 1.00 55.39  ? 133  PHE C CG    1 
ATOM   8310  C  CD1   . PHE D  1 139  ? 189.256 193.092 230.978 1.00 55.39  ? 133  PHE C CD1   1 
ATOM   8311  C  CD2   . PHE D  1 139  ? 189.332 190.814 230.331 1.00 55.39  ? 133  PHE C CD2   1 
ATOM   8312  C  CE1   . PHE D  1 139  ? 188.196 193.297 230.144 1.00 55.39  ? 133  PHE C CE1   1 
ATOM   8313  C  CE2   . PHE D  1 139  ? 188.266 191.011 229.497 1.00 55.39  ? 133  PHE C CE2   1 
ATOM   8314  C  CZ    . PHE D  1 139  ? 187.696 192.253 229.401 1.00 55.39  ? 133  PHE C CZ    1 
ATOM   8315  N  N     . GLY D  1 140  ? 193.828 191.159 233.041 1.00 60.49  ? 134  GLY C N     1 
ATOM   8316  C  CA    . GLY D  1 140  ? 194.893 191.197 234.020 1.00 60.49  ? 134  GLY C CA    1 
ATOM   8317  C  C     . GLY D  1 140  ? 194.627 190.362 235.248 1.00 60.49  ? 134  GLY C C     1 
ATOM   8318  O  O     . GLY D  1 140  ? 195.562 189.952 235.940 1.00 60.49  ? 134  GLY C O     1 
ATOM   8319  N  N     . GLY D  1 141  ? 193.350 190.112 235.539 1.00 62.13  ? 135  GLY C N     1 
ATOM   8320  C  CA    . GLY D  1 141  ? 193.009 189.265 236.665 1.00 62.13  ? 135  GLY C CA    1 
ATOM   8321  C  C     . GLY D  1 141  ? 193.534 187.856 236.533 1.00 62.13  ? 135  GLY C C     1 
ATOM   8322  O  O     . GLY D  1 141  ? 193.740 187.179 237.544 1.00 62.13  ? 135  GLY C O     1 
ATOM   8323  N  N     . ARG D  1 142  ? 193.760 187.400 235.308 1.00 58.05  ? 136  ARG C N     1 
ATOM   8324  C  CA    . ARG D  1 142  ? 194.330 186.089 235.047 1.00 58.05  ? 136  ARG C CA    1 
ATOM   8325  C  C     . ARG D  1 142  ? 195.503 186.263 234.095 1.00 58.05  ? 136  ARG C C     1 
ATOM   8326  O  O     . ARG D  1 142  ? 195.322 186.640 232.933 1.00 58.05  ? 136  ARG C O     1 
ATOM   8327  C  CB    . ARG D  1 142  ? 193.250 185.148 234.509 1.00 58.05  ? 136  ARG C CB    1 
ATOM   8328  C  CG    . ARG D  1 142  ? 192.525 185.635 233.281 1.00 58.05  ? 136  ARG C CG    1 
ATOM   8329  C  CD    . ARG D  1 142  ? 191.316 184.774 233.006 1.00 58.05  ? 136  ARG C CD    1 
ATOM   8330  N  NE    . ARG D  1 142  ? 190.359 184.894 234.101 1.00 58.05  ? 136  ARG C NE    1 
ATOM   8331  C  CZ    . ARG D  1 142  ? 189.442 185.850 234.184 1.00 58.05  ? 136  ARG C CZ    1 
ATOM   8332  N  NH1   . ARG D  1 142  ? 189.362 186.771 233.239 1.00 58.05  ? 136  ARG C NH1   1 
ATOM   8333  N  NH2   . ARG D  1 142  ? 188.613 185.895 235.214 1.00 58.05  ? 136  ARG C NH2   1 
ATOM   8334  N  N     . MET D  1 143  ? 196.710 186.013 234.601 1.00 64.75  ? 137  MET C N     1 
ATOM   8335  C  CA    . MET D  1 143  ? 197.922 186.522 233.981 1.00 64.75  ? 137  MET C CA    1 
ATOM   8336  C  C     . MET D  1 143  ? 199.020 185.471 234.037 1.00 64.75  ? 137  MET C C     1 
ATOM   8337  O  O     . MET D  1 143  ? 199.146 184.735 235.020 1.00 64.75  ? 137  MET C O     1 
ATOM   8338  C  CB    . MET D  1 143  ? 198.376 187.803 234.683 1.00 64.75  ? 137  MET C CB    1 
ATOM   8339  C  CG    . MET D  1 143  ? 199.655 188.404 234.170 1.00 64.75  ? 137  MET C CG    1 
ATOM   8340  S  SD    . MET D  1 143  ? 199.984 189.931 235.054 1.00 64.75  ? 137  MET C SD    1 
ATOM   8341  C  CE    . MET D  1 143  ? 200.313 189.298 236.695 1.00 64.75  ? 137  MET C CE    1 
ATOM   8342  N  N     . VAL D  1 144  ? 199.820 185.417 232.974 1.00 66.39  ? 138  VAL C N     1 
ATOM   8343  C  CA    . VAL D  1 144  ? 200.909 184.451 232.903 1.00 66.39  ? 138  VAL C CA    1 
ATOM   8344  C  C     . VAL D  1 144  ? 201.984 184.820 233.912 1.00 66.39  ? 138  VAL C C     1 
ATOM   8345  O  O     . VAL D  1 144  ? 202.246 186.002 234.163 1.00 66.39  ? 138  VAL C O     1 
ATOM   8346  C  CB    . VAL D  1 144  ? 201.484 184.397 231.479 1.00 66.39  ? 138  VAL C CB    1 
ATOM   8347  C  CG1   . VAL D  1 144  ? 202.598 183.379 231.397 1.00 66.39  ? 138  VAL C CG1   1 
ATOM   8348  C  CG2   . VAL D  1 144  ? 200.404 184.072 230.492 1.00 66.39  ? 138  VAL C CG2   1 
ATOM   8349  N  N     . THR D  1 145  ? 202.607 183.807 234.502 1.00 68.06  ? 139  THR C N     1 
ATOM   8350  C  CA    . THR D  1 145  ? 203.638 183.995 235.506 1.00 68.06  ? 139  THR C CA    1 
ATOM   8351  C  C     . THR D  1 145  ? 204.891 183.254 235.068 1.00 68.06  ? 139  THR C C     1 
ATOM   8352  O  O     . THR D  1 145  ? 204.819 182.339 234.244 1.00 68.06  ? 139  THR C O     1 
ATOM   8353  C  CB    . THR D  1 145  ? 203.158 183.482 236.864 1.00 68.06  ? 139  THR C CB    1 
ATOM   8354  O  OG1   . THR D  1 145  ? 201.872 184.041 237.143 1.00 68.06  ? 139  THR C OG1   1 
ATOM   8355  C  CG2   . THR D  1 145  ? 204.105 183.914 237.971 1.00 68.06  ? 139  THR C CG2   1 
ATOM   8356  N  N     . GLU D  1 146  ? 206.039 183.653 235.612 1.00 64.17  ? 140  GLU C N     1 
ATOM   8357  C  CA    . GLU D  1 146  ? 207.307 183.007 235.298 1.00 64.17  ? 140  GLU C CA    1 
ATOM   8358  C  C     . GLU D  1 146  ? 207.387 181.576 235.797 1.00 64.17  ? 140  GLU C C     1 
ATOM   8359  O  O     . GLU D  1 146  ? 208.320 180.862 235.417 1.00 64.17  ? 140  GLU C O     1 
ATOM   8360  C  CB    . GLU D  1 146  ? 208.460 183.806 235.899 1.00 64.17  ? 140  GLU C CB    1 
ATOM   8361  C  CG    . GLU D  1 146  ? 208.603 185.196 235.337 1.00 64.17  ? 140  GLU C CG    1 
ATOM   8362  C  CD    . GLU D  1 146  ? 207.639 186.162 235.979 1.00 64.17  ? 140  GLU C CD    1 
ATOM   8363  O  OE1   . GLU D  1 146  ? 206.906 185.738 236.897 1.00 64.17  ? 140  GLU C OE1   1 
ATOM   8364  O  OE2   . GLU D  1 146  ? 207.609 187.337 235.568 1.00 64.17  ? 140  GLU C OE2   1 
ATOM   8365  N  N     . GLU D  1 147  ? 206.447 181.135 236.626 1.00 71.01  ? 141  GLU C N     1 
ATOM   8366  C  CA    . GLU D  1 147  ? 206.576 179.837 237.274 1.00 71.01  ? 141  GLU C CA    1 
ATOM   8367  C  C     . GLU D  1 147  ? 206.510 178.671 236.306 1.00 71.01  ? 141  GLU C C     1 
ATOM   8368  O  O     . GLU D  1 147  ? 206.829 177.548 236.706 1.00 71.01  ? 141  GLU C O     1 
ATOM   8369  C  CB    . GLU D  1 147  ? 205.495 179.687 238.341 1.00 71.01  ? 141  GLU C CB    1 
ATOM   8370  C  CG    . GLU D  1 147  ? 205.617 180.695 239.464 1.00 71.01  ? 141  GLU C CG    1 
ATOM   8371  C  CD    . GLU D  1 147  ? 206.895 180.532 240.252 1.00 71.01  ? 141  GLU C CD    1 
ATOM   8372  O  OE1   . GLU D  1 147  ? 207.377 179.389 240.372 1.00 71.01  ? 141  GLU C OE1   1 
ATOM   8373  O  OE2   . GLU D  1 147  ? 207.421 181.549 240.749 1.00 71.01  ? 141  GLU C OE2   1 
ATOM   8374  N  N     . CYS D  1 148  ? 206.119 178.895 235.060 1.00 65.35  ? 142  CYS C N     1 
ATOM   8375  C  CA    . CYS D  1 148  ? 206.043 177.797 234.108 1.00 65.35  ? 142  CYS C CA    1 
ATOM   8376  C  C     . CYS D  1 148  ? 206.564 178.243 232.752 1.00 65.35  ? 142  CYS C C     1 
ATOM   8377  O  O     . CYS D  1 148  ? 205.834 178.875 231.980 1.00 65.35  ? 142  CYS C O     1 
ATOM   8378  C  CB    . CYS D  1 148  ? 204.608 177.293 233.986 1.00 65.35  ? 142  CYS C CB    1 
ATOM   8379  S  SG    . CYS D  1 148  ? 203.974 176.622 235.517 1.00 65.35  ? 142  CYS C SG    1 
ATOM   8380  N  N     . PRO D  1 149  ? 207.819 177.937 232.428 1.00 55.95  ? 143  PRO C N     1 
ATOM   8381  C  CA    . PRO D  1 149  ? 208.324 178.282 231.095 1.00 55.95  ? 143  PRO C CA    1 
ATOM   8382  C  C     . PRO D  1 149  ? 207.552 177.604 229.983 1.00 55.95  ? 143  PRO C C     1 
ATOM   8383  O  O     . PRO D  1 149  ? 207.411 178.174 228.893 1.00 55.95  ? 143  PRO C O     1 
ATOM   8384  C  CB    . PRO D  1 149  ? 209.781 177.812 231.143 1.00 55.95  ? 143  PRO C CB    1 
ATOM   8385  C  CG    . PRO D  1 149  ? 209.789 176.747 232.182 1.00 55.95  ? 143  PRO C CG    1 
ATOM   8386  C  CD    . PRO D  1 149  ? 208.790 177.161 233.210 1.00 55.95  ? 143  PRO C CD    1 
ATOM   8387  N  N     . LEU D  1 150  ? 207.040 176.403 230.231 1.00 53.24  ? 144  LEU C N     1 
ATOM   8388  C  CA    . LEU D  1 150  ? 206.191 175.751 229.247 1.00 53.24  ? 144  LEU C CA    1 
ATOM   8389  C  C     . LEU D  1 150  ? 204.960 176.598 228.962 1.00 53.24  ? 144  LEU C C     1 
ATOM   8390  O  O     . LEU D  1 150  ? 204.501 176.682 227.817 1.00 53.24  ? 144  LEU C O     1 
ATOM   8391  C  CB    . LEU D  1 150  ? 205.803 174.367 229.759 1.00 53.24  ? 144  LEU C CB    1 
ATOM   8392  C  CG    . LEU D  1 150  ? 205.337 173.309 228.763 1.00 53.24  ? 144  LEU C CG    1 
ATOM   8393  C  CD1   . LEU D  1 150  ? 203.931 173.555 228.260 1.00 53.24  ? 144  LEU C CD1   1 
ATOM   8394  C  CD2   . LEU D  1 150  ? 206.320 173.257 227.615 1.00 53.24  ? 144  LEU C CD2   1 
ATOM   8395  N  N     . ALA D  1 151  ? 204.420 177.245 229.995 1.00 52.40  ? 145  ALA C N     1 
ATOM   8396  C  CA    . ALA D  1 151  ? 203.300 178.152 229.785 1.00 52.40  ? 145  ALA C CA    1 
ATOM   8397  C  C     . ALA D  1 151  ? 203.714 179.340 228.935 1.00 52.40  ? 145  ALA C C     1 
ATOM   8398  O  O     . ALA D  1 151  ? 202.923 179.846 228.134 1.00 52.40  ? 145  ALA C O     1 
ATOM   8399  C  CB    . ALA D  1 151  ? 202.744 178.618 231.129 1.00 52.40  ? 145  ALA C CB    1 
ATOM   8400  N  N     . ILE D  1 152  ? 204.955 179.792 229.087 1.00 55.28  ? 146  ILE C N     1 
ATOM   8401  C  CA    . ILE D  1 152  ? 205.446 180.868 228.238 1.00 55.28  ? 146  ILE C CA    1 
ATOM   8402  C  C     . ILE D  1 152  ? 205.496 180.412 226.791 1.00 55.28  ? 146  ILE C C     1 
ATOM   8403  O  O     . ILE D  1 152  ? 205.153 181.166 225.870 1.00 55.28  ? 146  ILE C O     1 
ATOM   8404  C  CB    . ILE D  1 152  ? 206.821 181.334 228.731 1.00 55.28  ? 146  ILE C CB    1 
ATOM   8405  C  CG1   . ILE D  1 152  ? 206.708 181.855 230.155 1.00 55.28  ? 146  ILE C CG1   1 
ATOM   8406  C  CG2   . ILE D  1 152  ? 207.358 182.409 227.831 1.00 55.28  ? 146  ILE C CG2   1 
ATOM   8407  C  CD1   . ILE D  1 152  ? 208.032 182.041 230.818 1.00 55.28  ? 146  ILE C CD1   1 
ATOM   8408  N  N     . LEU D  1 153  ? 205.931 179.175 226.569 1.00 52.92  ? 147  LEU C N     1 
ATOM   8409  C  CA    . LEU D  1 153  ? 205.900 178.623 225.223 1.00 52.92  ? 147  LEU C CA    1 
ATOM   8410  C  C     . LEU D  1 153  ? 204.486 178.613 224.671 1.00 52.92  ? 147  LEU C C     1 
ATOM   8411  O  O     . LEU D  1 153  ? 204.259 178.997 223.520 1.00 52.92  ? 147  LEU C O     1 
ATOM   8412  C  CB    . LEU D  1 153  ? 206.469 177.212 225.214 1.00 52.92  ? 147  LEU C CB    1 
ATOM   8413  C  CG    . LEU D  1 153  ? 206.396 176.607 223.819 1.00 52.92  ? 147  LEU C CG    1 
ATOM   8414  C  CD1   . LEU D  1 153  ? 207.200 177.454 222.853 1.00 52.92  ? 147  LEU C CD1   1 
ATOM   8415  C  CD2   . LEU D  1 153  ? 206.891 175.175 223.831 1.00 52.92  ? 147  LEU C CD2   1 
ATOM   8416  N  N     . ILE D  1 154  ? 203.526 178.154 225.469 1.00 54.66  ? 148  ILE C N     1 
ATOM   8417  C  CA    . ILE D  1 154  ? 202.141 178.165 225.018 1.00 54.66  ? 148  ILE C CA    1 
ATOM   8418  C  C     . ILE D  1 154  ? 201.698 179.571 224.666 1.00 54.66  ? 148  ILE C C     1 
ATOM   8419  O  O     . ILE D  1 154  ? 200.998 179.777 223.670 1.00 54.66  ? 148  ILE C O     1 
ATOM   8420  C  CB    . ILE D  1 154  ? 201.223 177.542 226.078 1.00 54.66  ? 148  ILE C CB    1 
ATOM   8421  C  CG1   . ILE D  1 154  ? 201.470 176.046 226.155 1.00 54.66  ? 148  ILE C CG1   1 
ATOM   8422  C  CG2   . ILE D  1 154  ? 199.785 177.768 225.721 1.00 54.66  ? 148  ILE C CG2   1 
ATOM   8423  C  CD1   . ILE D  1 154  ? 201.111 175.343 224.874 1.00 54.66  ? 148  ILE C CD1   1 
ATOM   8424  N  N     . LEU D  1 155  ? 202.079 180.556 225.472 1.00 50.09  ? 149  LEU C N     1 
ATOM   8425  C  CA    . LEU D  1 155  ? 201.720 181.935 225.168 1.00 50.09  ? 149  LEU C CA    1 
ATOM   8426  C  C     . LEU D  1 155  ? 202.269 182.361 223.817 1.00 50.09  ? 149  LEU C C     1 
ATOM   8427  O  O     . LEU D  1 155  ? 201.547 182.941 222.997 1.00 50.09  ? 149  LEU C O     1 
ATOM   8428  C  CB    . LEU D  1 155  ? 202.240 182.861 226.257 1.00 50.09  ? 149  LEU C CB    1 
ATOM   8429  C  CG    . LEU D  1 155  ? 201.925 184.319 225.965 1.00 50.09  ? 149  LEU C CG    1 
ATOM   8430  C  CD1   . LEU D  1 155  ? 200.434 184.497 225.896 1.00 50.09  ? 149  LEU C CD1   1 
ATOM   8431  C  CD2   . LEU D  1 155  ? 202.522 185.205 227.025 1.00 50.09  ? 149  LEU C CD2   1 
ATOM   8432  N  N     . ILE D  1 156  ? 203.554 182.100 223.581 1.00 52.56  ? 150  ILE C N     1 
ATOM   8433  C  CA    . ILE D  1 156  ? 204.164 182.465 222.308 1.00 52.56  ? 150  ILE C CA    1 
ATOM   8434  C  C     . ILE D  1 156  ? 203.433 181.787 221.165 1.00 52.56  ? 150  ILE C C     1 
ATOM   8435  O  O     . ILE D  1 156  ? 203.127 182.406 220.136 1.00 52.56  ? 150  ILE C O     1 
ATOM   8436  C  CB    . ILE D  1 156  ? 205.656 182.098 222.306 1.00 52.56  ? 150  ILE C CB    1 
ATOM   8437  C  CG1   . ILE D  1 156  ? 206.408 182.930 223.333 1.00 52.56  ? 150  ILE C CG1   1 
ATOM   8438  C  CG2   . ILE D  1 156  ? 206.246 182.298 220.936 1.00 52.56  ? 150  ILE C CG2   1 
ATOM   8439  C  CD1   . ILE D  1 156  ? 207.812 182.475 223.545 1.00 52.56  ? 150  ILE C CD1   1 
ATOM   8440  N  N     . VAL D  1 157  ? 203.142 180.500 221.332 1.00 55.12  ? 151  VAL C N     1 
ATOM   8441  C  CA    . VAL D  1 157  ? 202.466 179.744 220.290 1.00 55.12  ? 151  VAL C CA    1 
ATOM   8442  C  C     . VAL D  1 157  ? 201.114 180.355 219.986 1.00 55.12  ? 151  VAL C C     1 
ATOM   8443  O  O     . VAL D  1 157  ? 200.750 180.542 218.820 1.00 55.12  ? 151  VAL C O     1 
ATOM   8444  C  CB    . VAL D  1 157  ? 202.335 178.273 220.706 1.00 55.12  ? 151  VAL C CB    1 
ATOM   8445  C  CG1   . VAL D  1 157  ? 201.466 177.542 219.719 1.00 55.12  ? 151  VAL C CG1   1 
ATOM   8446  C  CG2   . VAL D  1 157  ? 203.697 177.641 220.772 1.00 55.12  ? 151  VAL C CG2   1 
ATOM   8447  N  N     . GLN D  1 158  ? 200.343 180.673 221.022 1.00 56.73  ? 152  GLN C N     1 
ATOM   8448  C  CA    . GLN D  1 158  ? 199.003 181.171 220.771 1.00 56.73  ? 152  GLN C CA    1 
ATOM   8449  C  C     . GLN D  1 158  ? 199.050 182.554 220.152 1.00 56.73  ? 152  GLN C C     1 
ATOM   8450  O  O     . GLN D  1 158  ? 198.215 182.881 219.309 1.00 56.73  ? 152  GLN C O     1 
ATOM   8451  C  CB    . GLN D  1 158  ? 198.165 181.183 222.044 1.00 56.73  ? 152  GLN C CB    1 
ATOM   8452  C  CG    . GLN D  1 158  ? 196.722 181.557 221.749 1.00 56.73  ? 152  GLN C CG    1 
ATOM   8453  C  CD    . GLN D  1 158  ? 195.808 181.411 222.932 1.00 56.73  ? 152  GLN C CD    1 
ATOM   8454  O  OE1   . GLN D  1 158  ? 196.241 181.082 224.032 1.00 56.73  ? 152  GLN C OE1   1 
ATOM   8455  N  NE2   . GLN D  1 158  ? 194.522 181.629 222.707 1.00 56.73  ? 152  GLN C NE2   1 
ATOM   8456  N  N     . ASN D  1 159  ? 200.035 183.367 220.521 1.00 54.76  ? 153  ASN C N     1 
ATOM   8457  C  CA    . ASN D  1 159  ? 200.130 184.683 219.904 1.00 54.76  ? 153  ASN C CA    1 
ATOM   8458  C  C     . ASN D  1 159  ? 200.480 184.574 218.431 1.00 54.76  ? 153  ASN C C     1 
ATOM   8459  O  O     . ASN D  1 159  ? 199.886 185.264 217.594 1.00 54.76  ? 153  ASN C O     1 
ATOM   8460  C  CB    . ASN D  1 159  ? 201.154 185.531 220.639 1.00 54.76  ? 153  ASN C CB    1 
ATOM   8461  C  CG    . ASN D  1 159  ? 200.651 185.994 221.971 1.00 54.76  ? 153  ASN C CG    1 
ATOM   8462  O  OD1   . ASN D  1 159  ? 199.501 186.406 222.097 1.00 54.76  ? 153  ASN C OD1   1 
ATOM   8463  N  ND2   . ASN D  1 159  ? 201.496 185.917 222.982 1.00 54.76  ? 153  ASN C ND2   1 
ATOM   8464  N  N     . ILE D  1 160  ? 201.437 183.713 218.095 1.00 61.98  ? 154  ILE C N     1 
ATOM   8465  C  CA    . ILE D  1 160  ? 201.813 183.536 216.696 1.00 61.98  ? 154  ILE C CA    1 
ATOM   8466  C  C     . ILE D  1 160  ? 200.633 183.016 215.892 1.00 61.98  ? 154  ILE C C     1 
ATOM   8467  O  O     . ILE D  1 160  ? 200.320 183.519 214.806 1.00 61.98  ? 154  ILE C O     1 
ATOM   8468  C  CB    . ILE D  1 160  ? 203.021 182.598 216.578 1.00 61.98  ? 154  ILE C CB    1 
ATOM   8469  C  CG1   . ILE D  1 160  ? 204.270 183.278 217.120 1.00 61.98  ? 154  ILE C CG1   1 
ATOM   8470  C  CG2   . ILE D  1 160  ? 203.200 182.156 215.149 1.00 61.98  ? 154  ILE C CG2   1 
ATOM   8471  C  CD1   . ILE D  1 160  ? 205.431 182.350 217.266 1.00 61.98  ? 154  ILE C CD1   1 
ATOM   8472  N  N     . VAL D  1 161  ? 199.974 181.980 216.407 1.00 61.30  ? 155  VAL C N     1 
ATOM   8473  C  CA    . VAL D  1 161  ? 198.817 181.436 215.717 1.00 61.30  ? 155  VAL C CA    1 
ATOM   8474  C  C     . VAL D  1 161  ? 197.728 182.482 215.585 1.00 61.30  ? 155  VAL C C     1 
ATOM   8475  O  O     . VAL D  1 161  ? 197.077 182.578 214.541 1.00 61.30  ? 155  VAL C O     1 
ATOM   8476  C  CB    . VAL D  1 161  ? 198.310 180.184 216.450 1.00 61.30  ? 155  VAL C CB    1 
ATOM   8477  C  CG1   . VAL D  1 161  ? 197.023 179.704 215.832 1.00 61.30  ? 155  VAL C CG1   1 
ATOM   8478  C  CG2   . VAL D  1 161  ? 199.357 179.104 216.389 1.00 61.30  ? 155  VAL C CG2   1 
ATOM   8479  N  N     . GLY D  1 162  ? 197.510 183.284 216.625 1.00 64.45  ? 156  GLY C N     1 
ATOM   8480  C  CA    . GLY D  1 162  ? 196.489 184.308 216.550 1.00 64.45  ? 156  GLY C CA    1 
ATOM   8481  C  C     . GLY D  1 162  ? 196.788 185.328 215.474 1.00 64.45  ? 156  GLY C C     1 
ATOM   8482  O  O     . GLY D  1 162  ? 195.905 185.714 214.709 1.00 64.45  ? 156  GLY C O     1 
ATOM   8483  N  N     . LEU D  1 163  ? 198.043 185.756 215.379 1.00 69.04  ? 157  LEU C N     1 
ATOM   8484  C  CA    . LEU D  1 163  ? 198.382 186.726 214.348 1.00 69.04  ? 157  LEU C CA    1 
ATOM   8485  C  C     . LEU D  1 163  ? 198.251 186.123 212.958 1.00 69.04  ? 157  LEU C C     1 
ATOM   8486  O  O     . LEU D  1 163  ? 197.730 186.770 212.043 1.00 69.04  ? 157  LEU C O     1 
ATOM   8487  C  CB    . LEU D  1 163  ? 199.784 187.274 214.572 1.00 69.04  ? 157  LEU C CB    1 
ATOM   8488  C  CG    . LEU D  1 163  ? 199.816 188.134 215.827 1.00 69.04  ? 157  LEU C CG    1 
ATOM   8489  C  CD1   . LEU D  1 163  ? 201.205 188.689 216.092 1.00 69.04  ? 157  LEU C CD1   1 
ATOM   8490  C  CD2   . LEU D  1 163  ? 198.796 189.248 215.708 1.00 69.04  ? 157  LEU C CD2   1 
ATOM   8491  N  N     . MET D  1 164  ? 198.699 184.881 212.784 1.00 73.87  ? 158  MET C N     1 
ATOM   8492  C  CA    . MET D  1 164  ? 198.594 184.243 211.478 1.00 73.87  ? 158  MET C CA    1 
ATOM   8493  C  C     . MET D  1 164  ? 197.140 184.089 211.058 1.00 73.87  ? 158  MET C C     1 
ATOM   8494  O  O     . MET D  1 164  ? 196.761 184.455 209.938 1.00 73.87  ? 158  MET C O     1 
ATOM   8495  C  CB    . MET D  1 164  ? 199.297 182.889 211.503 1.00 73.87  ? 158  MET C CB    1 
ATOM   8496  C  CG    . MET D  1 164  ? 200.815 182.971 211.589 1.00 73.87  ? 158  MET C CG    1 
ATOM   8497  S  SD    . MET D  1 164  ? 201.561 183.708 210.117 1.00 73.87  ? 158  MET C SD    1 
ATOM   8498  C  CE    . MET D  1 164  ? 201.995 185.340 210.706 1.00 73.87  ? 158  MET C CE    1 
ATOM   8499  N  N     . ILE D  1 165  ? 196.307 183.554 211.948 1.00 76.29  ? 159  ILE C N     1 
ATOM   8500  C  CA    . ILE D  1 165  ? 194.910 183.359 211.608 1.00 76.29  ? 159  ILE C CA    1 
ATOM   8501  C  C     . ILE D  1 165  ? 194.224 184.695 211.400 1.00 76.29  ? 159  ILE C C     1 
ATOM   8502  O  O     . ILE D  1 165  ? 193.363 184.823 210.525 1.00 76.29  ? 159  ILE C O     1 
ATOM   8503  C  CB    . ILE D  1 165  ? 194.200 182.519 212.684 1.00 76.29  ? 159  ILE C CB    1 
ATOM   8504  C  CG1   . ILE D  1 165  ? 192.801 182.145 212.217 1.00 76.29  ? 159  ILE C CG1   1 
ATOM   8505  C  CG2   . ILE D  1 165  ? 194.087 183.265 213.981 1.00 76.29  ? 159  ILE C CG2   1 
ATOM   8506  C  CD1   . ILE D  1 165  ? 192.146 181.125 213.088 1.00 76.29  ? 159  ILE C CD1   1 
ATOM   8507  N  N     . ASN D  1 166  ? 194.604 185.715 212.161 1.00 72.11  ? 160  ASN C N     1 
ATOM   8508  C  CA    . ASN D  1 166  ? 193.961 187.007 211.999 1.00 72.11  ? 160  ASN C CA    1 
ATOM   8509  C  C     . ASN D  1 166  ? 194.296 187.602 210.643 1.00 72.11  ? 160  ASN C C     1 
ATOM   8510  O  O     . ASN D  1 166  ? 193.413 188.117 209.950 1.00 72.11  ? 160  ASN C O     1 
ATOM   8511  C  CB    . ASN D  1 166  ? 194.388 187.935 213.129 1.00 72.11  ? 160  ASN C CB    1 
ATOM   8512  C  CG    . ASN D  1 166  ? 193.560 189.185 213.189 1.00 72.11  ? 160  ASN C CG    1 
ATOM   8513  O  OD1   . ASN D  1 166  ? 192.674 189.390 212.367 1.00 72.11  ? 160  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN D  1 166  ? 193.834 190.031 214.170 1.00 72.11  ? 160  ASN C ND2   1 
ATOM   8515  N  N     . ALA D  1 167  ? 195.561 187.514 210.236 1.00 78.91  ? 161  ALA C N     1 
ATOM   8516  C  CA    . ALA D  1 167  ? 195.946 188.036 208.934 1.00 78.91  ? 161  ALA C CA    1 
ATOM   8517  C  C     . ALA D  1 167  ? 195.270 187.266 207.812 1.00 78.91  ? 161  ALA C C     1 
ATOM   8518  O  O     . ALA D  1 167  ? 194.864 187.857 206.809 1.00 78.91  ? 161  ALA C O     1 
ATOM   8519  C  CB    . ALA D  1 167  ? 197.462 187.991 208.775 1.00 78.91  ? 161  ALA C CB    1 
ATOM   8520  N  N     . ILE D  1 168  ? 195.148 185.949 207.952 1.00 83.21  ? 162  ILE C N     1 
ATOM   8521  C  CA    . ILE D  1 168  ? 194.462 185.175 206.924 1.00 83.21  ? 162  ILE C CA    1 
ATOM   8522  C  C     . ILE D  1 168  ? 193.009 185.609 206.814 1.00 83.21  ? 162  ILE C C     1 
ATOM   8523  O  O     . ILE D  1 168  ? 192.503 185.878 205.716 1.00 83.21  ? 162  ILE C O     1 
ATOM   8524  C  CB    . ILE D  1 168  ? 194.582 183.670 207.210 1.00 83.21  ? 162  ILE C CB    1 
ATOM   8525  C  CG1   . ILE D  1 168  ? 196.030 183.214 207.046 1.00 83.21  ? 162  ILE C CG1   1 
ATOM   8526  C  CG2   . ILE D  1 168  ? 193.680 182.890 206.292 1.00 83.21  ? 162  ILE C CG2   1 
ATOM   8527  C  CD1   . ILE D  1 168  ? 196.555 183.384 205.643 1.00 83.21  ? 162  ILE C CD1   1 
ATOM   8528  N  N     . MET D  1 169  ? 192.312 185.681 207.950 1.00 99.58  ? 163  MET C N     1 
ATOM   8529  C  CA    . MET D  1 169  ? 190.920 186.105 207.928 1.00 99.58  ? 163  MET C CA    1 
ATOM   8530  C  C     . MET D  1 169  ? 190.782 187.490 207.329 1.00 99.58  ? 163  MET C C     1 
ATOM   8531  O  O     . MET D  1 169  ? 189.830 187.755 206.591 1.00 99.58  ? 163  MET C O     1 
ATOM   8532  C  CB    . MET D  1 169  ? 190.342 186.105 209.337 1.00 99.58  ? 163  MET C CB    1 
ATOM   8533  C  CG    . MET D  1 169  ? 190.429 184.779 210.062 1.00 99.58  ? 163  MET C CG    1 
ATOM   8534  S  SD    . MET D  1 169  ? 189.573 183.405 209.286 1.00 99.58  ? 163  MET C SD    1 
ATOM   8535  C  CE    . MET D  1 169  ? 190.938 182.510 208.542 1.00 99.58  ? 163  MET C CE    1 
ATOM   8536  N  N     . LEU D  1 170  ? 191.730 188.378 207.613 1.00 99.57  ? 164  LEU C N     1 
ATOM   8537  C  CA    . LEU D  1 170  ? 191.589 189.756 207.162 1.00 99.57  ? 164  LEU C CA    1 
ATOM   8538  C  C     . LEU D  1 170  ? 191.905 189.884 205.680 1.00 99.57  ? 164  LEU C C     1 
ATOM   8539  O  O     . LEU D  1 170  ? 191.249 190.647 204.967 1.00 99.57  ? 164  LEU C O     1 
ATOM   8540  C  CB    . LEU D  1 170  ? 192.479 190.665 208.003 1.00 99.57  ? 164  LEU C CB    1 
ATOM   8541  C  CG    . LEU D  1 170  ? 192.268 192.168 207.887 1.00 99.57  ? 164  LEU C CG    1 
ATOM   8542  C  CD1   . LEU D  1 170  ? 192.594 192.803 209.209 1.00 99.57  ? 164  LEU C CD1   1 
ATOM   8543  C  CD2   . LEU D  1 170  ? 193.156 192.743 206.813 1.00 99.57  ? 164  LEU C CD2   1 
ATOM   8544  N  N     . GLY D  1 171  ? 192.891 189.136 205.191 1.00 92.37  ? 165  GLY C N     1 
ATOM   8545  C  CA    . GLY D  1 171  ? 193.132 189.108 203.760 1.00 92.37  ? 165  GLY C CA    1 
ATOM   8546  C  C     . GLY D  1 171  ? 191.953 188.543 202.995 1.00 92.37  ? 165  GLY C C     1 
ATOM   8547  O  O     . GLY D  1 171  ? 191.579 189.058 201.936 1.00 92.37  ? 165  GLY C O     1 
ATOM   8548  N  N     . CYS D  1 172  ? 191.342 187.485 203.529 1.00 102.26 ? 166  CYS C N     1 
ATOM   8549  C  CA    . CYS D  1 172  ? 190.161 186.928 202.885 1.00 102.26 ? 166  CYS C CA    1 
ATOM   8550  C  C     . CYS D  1 172  ? 189.009 187.922 202.898 1.00 102.26 ? 166  CYS C C     1 
ATOM   8551  O  O     . CYS D  1 172  ? 188.349 188.130 201.874 1.00 102.26 ? 166  CYS C O     1 
ATOM   8552  C  CB    . CYS D  1 172  ? 189.753 185.626 203.562 1.00 102.26 ? 166  CYS C CB    1 
ATOM   8553  S  SG    . CYS D  1 172  ? 190.875 184.250 203.263 1.00 102.26 ? 166  CYS C SG    1 
ATOM   8554  N  N     . ILE D  1 173  ? 188.744 188.541 204.048 1.00 104.46 ? 167  ILE C N     1 
ATOM   8555  C  CA    . ILE D  1 173  ? 187.663 189.518 204.129 1.00 104.46 ? 167  ILE C CA    1 
ATOM   8556  C  C     . ILE D  1 173  ? 187.924 190.677 203.183 1.00 104.46 ? 167  ILE C C     1 
ATOM   8557  O  O     . ILE D  1 173  ? 187.001 191.223 202.573 1.00 104.46 ? 167  ILE C O     1 
ATOM   8558  C  CB    . ILE D  1 173  ? 187.469 190.001 205.576 1.00 104.46 ? 167  ILE C CB    1 
ATOM   8559  C  CG1   . ILE D  1 173  ? 186.908 188.880 206.442 1.00 104.46 ? 167  ILE C CG1   1 
ATOM   8560  C  CG2   . ILE D  1 173  ? 186.517 191.176 205.614 1.00 104.46 ? 167  ILE C CG2   1 
ATOM   8561  C  CD1   . ILE D  1 173  ? 185.502 188.493 206.061 1.00 104.46 ? 167  ILE C CD1   1 
ATOM   8562  N  N     . PHE D  1 174  ? 189.188 191.069 203.032 1.00 105.09 ? 168  PHE C N     1 
ATOM   8563  C  CA    . PHE D  1 174  ? 189.485 192.131 202.083 1.00 105.09 ? 168  PHE C CA    1 
ATOM   8564  C  C     . PHE D  1 174  ? 189.157 191.693 200.666 1.00 105.09 ? 168  PHE C C     1 
ATOM   8565  O  O     . PHE D  1 174  ? 188.294 192.276 200.002 1.00 105.09 ? 168  PHE C O     1 
ATOM   8566  C  CB    . PHE D  1 174  ? 190.942 192.564 202.151 1.00 105.09 ? 168  PHE C CB    1 
ATOM   8567  C  CG    . PHE D  1 174  ? 191.245 193.674 201.198 1.00 105.09 ? 168  PHE C CG    1 
ATOM   8568  C  CD1   . PHE D  1 174  ? 190.993 194.985 201.545 1.00 105.09 ? 168  PHE C CD1   1 
ATOM   8569  C  CD2   . PHE D  1 174  ? 191.657 193.401 199.911 1.00 105.09 ? 168  PHE C CD2   1 
ATOM   8570  C  CE1   . PHE D  1 174  ? 191.226 195.996 200.649 1.00 105.09 ? 168  PHE C CE1   1 
ATOM   8571  C  CE2   . PHE D  1 174  ? 191.898 194.398 199.014 1.00 105.09 ? 168  PHE C CE2   1 
ATOM   8572  C  CZ    . PHE D  1 174  ? 191.676 195.698 199.375 1.00 105.09 ? 168  PHE C CZ    1 
ATOM   8573  N  N     . MET D  1 175  ? 189.849 190.672 200.178 1.00 104.35 ? 169  MET C N     1 
ATOM   8574  C  CA    . MET D  1 175  ? 189.613 190.296 198.793 1.00 104.35 ? 169  MET C CA    1 
ATOM   8575  C  C     . MET D  1 175  ? 188.180 189.872 198.544 1.00 104.35 ? 169  MET C C     1 
ATOM   8576  O  O     . MET D  1 175  ? 187.771 189.798 197.383 1.00 104.35 ? 169  MET C O     1 
ATOM   8577  C  CB    . MET D  1 175  ? 190.576 189.190 198.368 1.00 104.35 ? 169  MET C CB    1 
ATOM   8578  C  CG    . MET D  1 175  ? 190.432 187.899 199.134 1.00 104.35 ? 169  MET C CG    1 
ATOM   8579  S  SD    . MET D  1 175  ? 191.732 186.754 198.650 1.00 104.35 ? 169  MET C SD    1 
ATOM   8580  C  CE    . MET D  1 175  ? 193.139 187.559 199.399 1.00 104.35 ? 169  MET C CE    1 
ATOM   8581  N  N     . LYS D  1 176  ? 187.399 189.626 199.590 1.00 101.61 ? 170  LYS C N     1 
ATOM   8582  C  CA    . LYS D  1 176  ? 185.983 189.391 199.385 1.00 101.61 ? 170  LYS C CA    1 
ATOM   8583  C  C     . LYS D  1 176  ? 185.198 190.688 199.317 1.00 101.61 ? 170  LYS C C     1 
ATOM   8584  O  O     . LYS D  1 176  ? 184.298 190.811 198.485 1.00 101.61 ? 170  LYS C O     1 
ATOM   8585  C  CB    . LYS D  1 176  ? 185.419 188.518 200.505 1.00 101.61 ? 170  LYS C CB    1 
ATOM   8586  C  CG    . LYS D  1 176  ? 184.022 188.003 200.214 1.00 101.61 ? 170  LYS C CG    1 
ATOM   8587  C  CD    . LYS D  1 176  ? 183.551 187.059 201.295 1.00 101.61 ? 170  LYS C CD    1 
ATOM   8588  C  CE    . LYS D  1 176  ? 182.153 186.505 201.004 1.00 101.61 ? 170  LYS C CE    1 
ATOM   8589  N  NZ    . LYS D  1 176  ? 182.089 185.655 199.760 1.00 101.61 ? 170  LYS C NZ    1 
ATOM   8590  N  N     . THR D  1 177  ? 185.518 191.665 200.160 1.00 111.32 ? 171  THR C N     1 
ATOM   8591  C  CA    . THR D  1 177  ? 184.840 192.950 200.111 1.00 111.32 ? 171  THR C CA    1 
ATOM   8592  C  C     . THR D  1 177  ? 185.259 193.781 198.911 1.00 111.32 ? 171  THR C C     1 
ATOM   8593  O  O     . THR D  1 177  ? 184.525 194.693 198.526 1.00 111.32 ? 171  THR C O     1 
ATOM   8594  C  CB    . THR D  1 177  ? 185.080 193.746 201.404 1.00 111.32 ? 171  THR C CB    1 
ATOM   8595  O  OG1   . THR D  1 177  ? 184.242 194.904 201.416 1.00 111.32 ? 171  THR C OG1   1 
ATOM   8596  C  CG2   . THR D  1 177  ? 186.520 194.197 201.519 1.00 111.32 ? 171  THR C CG2   1 
ATOM   8597  N  N     . ALA D  1 178  ? 186.412 193.493 198.315 1.00 112.39 ? 172  ALA C N     1 
ATOM   8598  C  CA    . ALA D  1 178  ? 186.754 194.068 197.023 1.00 112.39 ? 172  ALA C CA    1 
ATOM   8599  C  C     . ALA D  1 178  ? 186.188 193.261 195.867 1.00 112.39 ? 172  ALA C C     1 
ATOM   8600  O  O     . ALA D  1 178  ? 186.706 193.360 194.750 1.00 112.39 ? 172  ALA C O     1 
ATOM   8601  C  CB    . ALA D  1 178  ? 188.269 194.186 196.873 1.00 112.39 ? 172  ALA C CB    1 
ATOM   8602  N  N     . GLN D  1 179  ? 185.157 192.457 196.113 1.00 118.68 ? 173  GLN C N     1 
ATOM   8603  C  CA    . GLN D  1 179  ? 184.624 191.580 195.083 1.00 118.68 ? 173  GLN C CA    1 
ATOM   8604  C  C     . GLN D  1 179  ? 184.036 192.383 193.933 1.00 118.68 ? 173  GLN C C     1 
ATOM   8605  O  O     . GLN D  1 179  ? 183.527 193.491 194.114 1.00 118.68 ? 173  GLN C O     1 
ATOM   8606  C  CB    . GLN D  1 179  ? 183.556 190.662 195.675 1.00 118.68 ? 173  GLN C CB    1 
ATOM   8607  C  CG    . GLN D  1 179  ? 183.025 189.613 194.732 1.00 118.68 ? 173  GLN C CG    1 
ATOM   8608  C  CD    . GLN D  1 179  ? 184.111 188.688 194.246 1.00 118.68 ? 173  GLN C CD    1 
ATOM   8609  O  OE1   . GLN D  1 179  ? 184.531 188.762 193.095 1.00 118.68 ? 173  GLN C OE1   1 
ATOM   8610  N  NE2   . GLN D  1 179  ? 184.587 187.819 195.127 1.00 118.68 ? 173  GLN C NE2   1 
ATOM   8611  N  N     . ALA D  1 180  ? 184.131 191.806 192.741 1.00 126.84 ? 174  ALA C N     1 
ATOM   8612  C  CA    . ALA D  1 180  ? 183.474 192.290 191.544 1.00 126.84 ? 174  ALA C CA    1 
ATOM   8613  C  C     . ALA D  1 180  ? 182.104 191.629 191.397 1.00 126.84 ? 174  ALA C C     1 
ATOM   8614  O  O     . ALA D  1 180  ? 181.510 191.140 192.358 1.00 126.84 ? 174  ALA C O     1 
ATOM   8615  C  CB    . ALA D  1 180  ? 184.346 192.038 190.316 1.00 126.84 ? 174  ALA C CB    1 
ATOM   8616  N  N     . HIS D  1 181  ? 181.566 191.699 190.183 1.00 130.53 ? 175  HIS C N     1 
ATOM   8617  C  CA    . HIS D  1 181  ? 180.308 191.159 189.680 1.00 130.53 ? 175  HIS C CA    1 
ATOM   8618  C  C     . HIS D  1 181  ? 179.112 191.711 190.432 1.00 130.53 ? 175  HIS C C     1 
ATOM   8619  O  O     . HIS D  1 181  ? 177.988 191.305 190.148 1.00 130.53 ? 175  HIS C O     1 
ATOM   8620  C  CB    . HIS D  1 181  ? 180.234 189.618 189.671 1.00 130.53 ? 175  HIS C CB    1 
ATOM   8621  C  CG    . HIS D  1 181  ? 180.139 188.991 191.024 1.00 130.53 ? 175  HIS C CG    1 
ATOM   8622  N  ND1   . HIS D  1 181  ? 178.960 188.935 191.736 1.00 130.53 ? 175  HIS C ND1   1 
ATOM   8623  C  CD2   . HIS D  1 181  ? 181.059 188.333 191.768 1.00 130.53 ? 175  HIS C CD2   1 
ATOM   8624  C  CE1   . HIS D  1 181  ? 179.168 188.304 192.877 1.00 130.53 ? 175  HIS C CE1   1 
ATOM   8625  N  NE2   . HIS D  1 181  ? 180.434 187.928 192.922 1.00 130.53 ? 175  HIS C NE2   1 
ATOM   8626  N  N     . ARG D  1 182  ? 179.305 192.616 191.387 1.00 118.29 ? 176  ARG C N     1 
ATOM   8627  C  CA    . ARG D  1 182  ? 178.203 193.465 191.805 1.00 118.29 ? 176  ARG C CA    1 
ATOM   8628  C  C     . ARG D  1 182  ? 177.876 194.470 190.714 1.00 118.29 ? 176  ARG C C     1 
ATOM   8629  O  O     . ARG D  1 182  ? 176.703 194.761 190.455 1.00 118.29 ? 176  ARG C O     1 
ATOM   8630  C  CB    . ARG D  1 182  ? 178.552 194.173 193.109 1.00 118.29 ? 176  ARG C CB    1 
ATOM   8631  N  N     . ARG D  1 183  ? 178.907 194.999 190.055 1.00 130.85 ? 177  ARG C N     1 
ATOM   8632  C  CA    . ARG D  1 183  ? 178.682 195.869 188.913 1.00 130.85 ? 177  ARG C CA    1 
ATOM   8633  C  C     . ARG D  1 183  ? 178.188 195.085 187.705 1.00 130.85 ? 177  ARG C C     1 
ATOM   8634  O  O     . ARG D  1 183  ? 177.333 195.568 186.956 1.00 130.85 ? 177  ARG C O     1 
ATOM   8635  C  CB    . ARG D  1 183  ? 179.965 196.618 188.564 1.00 130.85 ? 177  ARG C CB    1 
ATOM   8636  C  CG    . ARG D  1 183  ? 179.823 197.520 187.360 1.00 130.85 ? 177  ARG C CG    1 
ATOM   8637  C  CD    . ARG D  1 183  ? 178.863 198.650 187.663 1.00 130.85 ? 177  ARG C CD    1 
ATOM   8638  N  NE    . ARG D  1 183  ? 178.640 199.506 186.505 1.00 130.85 ? 177  ARG C NE    1 
ATOM   8639  C  CZ    . ARG D  1 183  ? 179.405 200.544 186.199 1.00 130.85 ? 177  ARG C CZ    1 
ATOM   8640  N  NH1   . ARG D  1 183  ? 180.441 200.845 186.966 1.00 130.85 ? 177  ARG C NH1   1 
ATOM   8641  N  NH2   . ARG D  1 183  ? 179.140 201.280 185.130 1.00 130.85 ? 177  ARG C NH2   1 
ATOM   8642  N  N     . ALA D  1 184  ? 178.699 193.865 187.509 1.00 124.41 ? 178  ALA C N     1 
ATOM   8643  C  CA    . ALA D  1 184  ? 178.349 193.063 186.343 1.00 124.41 ? 178  ALA C CA    1 
ATOM   8644  C  C     . ALA D  1 184  ? 176.864 192.740 186.266 1.00 124.41 ? 178  ALA C C     1 
ATOM   8645  O  O     . ALA D  1 184  ? 176.410 192.238 185.234 1.00 124.41 ? 178  ALA C O     1 
ATOM   8646  C  CB    . ALA D  1 184  ? 179.152 191.766 186.341 1.00 124.41 ? 178  ALA C CB    1 
ATOM   8647  N  N     . GLU D  1 185  ? 176.105 192.997 187.326 1.00 133.16 ? 179  GLU C N     1 
ATOM   8648  C  CA    . GLU D  1 185  ? 174.663 192.836 187.266 1.00 133.16 ? 179  GLU C CA    1 
ATOM   8649  C  C     . GLU D  1 185  ? 173.969 194.083 186.756 1.00 133.16 ? 179  GLU C C     1 
ATOM   8650  O  O     . GLU D  1 185  ? 172.876 193.989 186.192 1.00 133.16 ? 179  GLU C O     1 
ATOM   8651  C  CB    . GLU D  1 185  ? 174.120 192.481 188.648 1.00 133.16 ? 179  GLU C CB    1 
ATOM   8652  C  CG    . GLU D  1 185  ? 174.567 191.121 189.136 1.00 133.16 ? 179  GLU C CG    1 
ATOM   8653  C  CD    . GLU D  1 185  ? 173.957 189.998 188.332 1.00 133.16 ? 179  GLU C CD    1 
ATOM   8654  O  OE1   . GLU D  1 185  ? 172.799 190.143 187.893 1.00 133.16 ? 179  GLU C OE1   1 
ATOM   8655  O  OE2   . GLU D  1 185  ? 174.636 188.971 188.129 1.00 133.16 ? 179  GLU C OE2   1 
ATOM   8656  N  N     . THR D  1 186  ? 174.581 195.253 186.942 1.00 130.15 ? 180  THR C N     1 
ATOM   8657  C  CA    . THR D  1 186  ? 173.990 196.491 186.454 1.00 130.15 ? 180  THR C CA    1 
ATOM   8658  C  C     . THR D  1 186  ? 174.164 196.648 184.950 1.00 130.15 ? 180  THR C C     1 
ATOM   8659  O  O     . THR D  1 186  ? 173.423 197.408 184.319 1.00 130.15 ? 180  THR C O     1 
ATOM   8660  C  CB    . THR D  1 186  ? 174.612 197.684 187.173 1.00 130.15 ? 180  THR C CB    1 
ATOM   8661  O  OG1   . THR D  1 186  ? 176.005 197.754 186.848 1.00 130.15 ? 180  THR C OG1   1 
ATOM   8662  C  CG2   . THR D  1 186  ? 174.465 197.520 188.672 1.00 130.15 ? 180  THR C CG2   1 
ATOM   8663  N  N     . LEU D  1 187  ? 175.130 195.948 184.365 1.00 117.49 ? 181  LEU C N     1 
ATOM   8664  C  CA    . LEU D  1 187  ? 175.340 196.012 182.929 1.00 117.49 ? 181  LEU C CA    1 
ATOM   8665  C  C     . LEU D  1 187  ? 174.229 195.254 182.221 1.00 117.49 ? 181  LEU C C     1 
ATOM   8666  O  O     . LEU D  1 187  ? 174.287 194.026 182.107 1.00 117.49 ? 181  LEU C O     1 
ATOM   8667  C  CB    . LEU D  1 187  ? 176.709 195.438 182.570 1.00 117.49 ? 181  LEU C CB    1 
ATOM   8668  C  CG    . LEU D  1 187  ? 177.876 196.206 183.193 1.00 117.49 ? 181  LEU C CG    1 
ATOM   8669  C  CD1   . LEU D  1 187  ? 179.197 195.534 182.873 1.00 117.49 ? 181  LEU C CD1   1 
ATOM   8670  C  CD2   . LEU D  1 187  ? 177.875 197.659 182.738 1.00 117.49 ? 181  LEU C CD2   1 
ATOM   8671  N  N     . ILE D  1 188  ? 173.223 195.960 181.753 1.00 115.33 ? 182  ILE C N     1 
ATOM   8672  C  CA    . ILE D  1 188  ? 172.002 195.320 181.283 1.00 115.33 ? 182  ILE C CA    1 
ATOM   8673  C  C     . ILE D  1 188  ? 172.013 195.172 179.772 1.00 115.33 ? 182  ILE C C     1 
ATOM   8674  O  O     . ILE D  1 188  ? 172.726 195.876 179.049 1.00 115.33 ? 182  ILE C O     1 
ATOM   8675  C  CB    . ILE D  1 188  ? 170.763 196.104 181.747 1.00 115.33 ? 182  ILE C CB    1 
ATOM   8676  C  CG1   . ILE D  1 188  ? 170.833 197.540 181.237 1.00 115.33 ? 182  ILE C CG1   1 
ATOM   8677  C  CG2   . ILE D  1 188  ? 170.634 196.033 183.253 1.00 115.33 ? 182  ILE C CG2   1 
ATOM   8678  C  CD1   . ILE D  1 188  ? 169.543 198.288 181.388 1.00 115.33 ? 182  ILE C CD1   1 
ATOM   8679  N  N     . PHE D  1 189  ? 171.190 194.245 179.295 1.00 112.47 ? 183  PHE C N     1 
ATOM   8680  C  CA    . PHE D  1 189  ? 171.069 193.936 177.881 1.00 112.47 ? 183  PHE C CA    1 
ATOM   8681  C  C     . PHE D  1 189  ? 169.615 193.632 177.569 1.00 112.47 ? 183  PHE C C     1 
ATOM   8682  O  O     . PHE D  1 189  ? 168.986 192.822 178.255 1.00 112.47 ? 183  PHE C O     1 
ATOM   8683  C  CB    . PHE D  1 189  ? 171.931 192.734 177.510 1.00 112.47 ? 183  PHE C CB    1 
ATOM   8684  C  CG    . PHE D  1 189  ? 173.378 192.931 177.796 1.00 112.47 ? 183  PHE C CG    1 
ATOM   8685  C  CD1   . PHE D  1 189  ? 174.170 193.663 176.938 1.00 112.47 ? 183  PHE C CD1   1 
ATOM   8686  C  CD2   . PHE D  1 189  ? 173.944 192.396 178.933 1.00 112.47 ? 183  PHE C CD2   1 
ATOM   8687  C  CE1   . PHE D  1 189  ? 175.501 193.852 177.206 1.00 112.47 ? 183  PHE C CE1   1 
ATOM   8688  C  CE2   . PHE D  1 189  ? 175.275 192.580 179.208 1.00 112.47 ? 183  PHE C CE2   1 
ATOM   8689  C  CZ    . PHE D  1 189  ? 176.057 193.310 178.343 1.00 112.47 ? 183  PHE C CZ    1 
ATOM   8690  N  N     . SER D  1 190  ? 169.090 194.279 176.533 1.00 115.58 ? 184  SER C N     1 
ATOM   8691  C  CA    . SER D  1 190  ? 167.714 194.055 176.127 1.00 115.58 ? 184  SER C CA    1 
ATOM   8692  C  C     . SER D  1 190  ? 167.465 192.567 175.889 1.00 115.58 ? 184  SER C C     1 
ATOM   8693  O  O     . SER D  1 190  ? 168.346 191.819 175.471 1.00 115.58 ? 184  SER C O     1 
ATOM   8694  C  CB    . SER D  1 190  ? 167.400 194.849 174.863 1.00 115.58 ? 184  SER C CB    1 
ATOM   8695  O  OG    . SER D  1 190  ? 168.184 194.391 173.777 1.00 115.58 ? 184  SER C OG    1 
ATOM   8696  N  N     . LYS D  1 191  ? 166.236 192.143 176.169 1.00 111.90 ? 185  LYS C N     1 
ATOM   8697  C  CA    . LYS D  1 191  ? 165.875 190.740 176.022 1.00 111.90 ? 185  LYS C CA    1 
ATOM   8698  C  C     . LYS D  1 191  ? 165.836 190.310 174.563 1.00 111.90 ? 185  LYS C C     1 
ATOM   8699  O  O     . LYS D  1 191  ? 165.754 189.111 174.275 1.00 111.90 ? 185  LYS C O     1 
ATOM   8700  C  CB    . LYS D  1 191  ? 164.523 190.483 176.700 1.00 111.90 ? 185  LYS C CB    1 
ATOM   8701  C  CG    . LYS D  1 191  ? 164.091 189.026 176.767 1.00 111.90 ? 185  LYS C CG    1 
ATOM   8702  C  CD    . LYS D  1 191  ? 162.893 188.828 177.676 1.00 111.90 ? 185  LYS C CD    1 
ATOM   8703  C  CE    . LYS D  1 191  ? 161.630 189.364 177.043 1.00 111.90 ? 185  LYS C CE    1 
ATOM   8704  N  NZ    . LYS D  1 191  ? 160.434 189.079 177.869 1.00 111.90 ? 185  LYS C NZ    1 
ATOM   8705  N  N     . HIS D  1 192  ? 165.935 191.258 173.634 1.00 109.80 ? 186  HIS C N     1 
ATOM   8706  C  CA    . HIS D  1 192  ? 165.809 190.983 172.211 1.00 109.80 ? 186  HIS C CA    1 
ATOM   8707  C  C     . HIS D  1 192  ? 166.918 191.682 171.445 1.00 109.80 ? 186  HIS C C     1 
ATOM   8708  O  O     . HIS D  1 192  ? 167.452 192.697 171.904 1.00 109.80 ? 186  HIS C O     1 
ATOM   8709  C  CB    . HIS D  1 192  ? 164.449 191.437 171.693 1.00 109.80 ? 186  HIS C CB    1 
ATOM   8710  C  CG    . HIS D  1 192  ? 163.309 190.720 172.331 1.00 109.80 ? 186  HIS C CG    1 
ATOM   8711  N  ND1   . HIS D  1 192  ? 162.714 191.163 173.491 1.00 109.80 ? 186  HIS C ND1   1 
ATOM   8712  C  CD2   . HIS D  1 192  ? 162.675 189.575 171.992 1.00 109.80 ? 186  HIS C CD2   1 
ATOM   8713  C  CE1   . HIS D  1 192  ? 161.749 190.330 173.830 1.00 109.80 ? 186  HIS C CE1   1 
ATOM   8714  N  NE2   . HIS D  1 192  ? 161.705 189.356 172.938 1.00 109.80 ? 186  HIS C NE2   1 
ATOM   8715  N  N     . ALA D  1 193  ? 167.261 191.132 170.290 1.00 115.41 ? 187  ALA C N     1 
ATOM   8716  C  CA    . ALA D  1 193  ? 168.158 191.774 169.344 1.00 115.41 ? 187  ALA C CA    1 
ATOM   8717  C  C     . ALA D  1 193  ? 167.450 191.895 168.004 1.00 115.41 ? 187  ALA C C     1 
ATOM   8718  O  O     . ALA D  1 193  ? 166.710 190.990 167.605 1.00 115.41 ? 187  ALA C O     1 
ATOM   8719  C  CB    . ALA D  1 193  ? 169.451 190.981 169.203 1.00 115.41 ? 187  ALA C CB    1 
ATOM   8720  N  N     . VAL D  1 194  ? 167.671 193.007 167.313 1.00 114.58 ? 188  VAL C N     1 
ATOM   8721  C  CA    . VAL D  1 194  ? 166.974 193.285 166.066 1.00 114.58 ? 188  VAL C CA    1 
ATOM   8722  C  C     . VAL D  1 194  ? 167.989 193.368 164.939 1.00 114.58 ? 188  VAL C C     1 
ATOM   8723  O  O     . VAL D  1 194  ? 169.166 193.672 165.156 1.00 114.58 ? 188  VAL C O     1 
ATOM   8724  C  CB    . VAL D  1 194  ? 166.154 194.587 166.147 1.00 114.58 ? 188  VAL C CB    1 
ATOM   8725  C  CG1   . VAL D  1 194  ? 165.221 194.550 167.344 1.00 114.58 ? 188  VAL C CG1   1 
ATOM   8726  C  CG2   . VAL D  1 194  ? 167.070 195.791 166.193 1.00 114.58 ? 188  VAL C CG2   1 
ATOM   8727  N  N     . ILE D  1 195  ? 167.530 193.076 163.732 1.00 111.89 ? 189  ILE C N     1 
ATOM   8728  C  CA    . ILE D  1 195  ? 168.306 193.310 162.522 1.00 111.89 ? 189  ILE C CA    1 
ATOM   8729  C  C     . ILE D  1 195  ? 167.584 194.393 161.737 1.00 111.89 ? 189  ILE C C     1 
ATOM   8730  O  O     . ILE D  1 195  ? 166.370 194.574 161.892 1.00 111.89 ? 189  ILE C O     1 
ATOM   8731  C  CB    . ILE D  1 195  ? 168.457 192.032 161.675 1.00 111.89 ? 189  ILE C CB    1 
ATOM   8732  C  CG1   . ILE D  1 195  ? 168.858 190.845 162.534 1.00 111.89 ? 189  ILE C CG1   1 
ATOM   8733  C  CG2   . ILE D  1 195  ? 169.511 192.219 160.607 1.00 111.89 ? 189  ILE C CG2   1 
ATOM   8734  C  CD1   . ILE D  1 195  ? 167.676 190.004 162.928 1.00 111.89 ? 189  ILE C CD1   1 
ATOM   8735  N  N     . ALA D  1 196  ? 168.318 195.114 160.900 1.00 103.74 ? 190  ALA C N     1 
ATOM   8736  C  CA    . ALA D  1 196  ? 167.712 196.105 160.030 1.00 103.74 ? 190  ALA C CA    1 
ATOM   8737  C  C     . ALA D  1 196  ? 168.674 196.388 158.885 1.00 103.74 ? 190  ALA C C     1 
ATOM   8738  O  O     . ALA D  1 196  ? 169.709 195.730 158.742 1.00 103.74 ? 190  ALA C O     1 
ATOM   8739  C  CB    . ALA D  1 196  ? 167.356 197.376 160.810 1.00 103.74 ? 190  ALA C CB    1 
ATOM   8740  N  N     . LEU D  1 197  ? 168.333 197.381 158.071 1.00 103.05 ? 191  LEU C N     1 
ATOM   8741  C  CA    . LEU D  1 197  ? 169.191 197.839 156.994 1.00 103.05 ? 191  LEU C CA    1 
ATOM   8742  C  C     . LEU D  1 197  ? 169.933 199.085 157.440 1.00 103.05 ? 191  LEU C C     1 
ATOM   8743  O  O     . LEU D  1 197  ? 169.315 200.063 157.874 1.00 103.05 ? 191  LEU C O     1 
ATOM   8744  C  CB    . LEU D  1 197  ? 168.388 198.120 155.727 1.00 103.05 ? 191  LEU C CB    1 
ATOM   8745  C  CG    . LEU D  1 197  ? 167.899 196.842 155.054 1.00 103.05 ? 191  LEU C CG    1 
ATOM   8746  C  CD1   . LEU D  1 197  ? 167.008 197.146 153.859 1.00 103.05 ? 191  LEU C CD1   1 
ATOM   8747  C  CD2   . LEU D  1 197  ? 169.097 196.010 154.640 1.00 103.05 ? 191  LEU C CD2   1 
ATOM   8748  N  N     . ARG D  1 198  ? 171.256 199.035 157.354 1.00 112.58 ? 192  ARG C N     1 
ATOM   8749  C  CA    . ARG D  1 198  ? 172.100 200.194 157.591 1.00 112.58 ? 192  ARG C CA    1 
ATOM   8750  C  C     . ARG D  1 198  ? 173.130 200.255 156.481 1.00 112.58 ? 192  ARG C C     1 
ATOM   8751  O  O     . ARG D  1 198  ? 173.748 199.237 156.152 1.00 112.58 ? 192  ARG C O     1 
ATOM   8752  C  CB    . ARG D  1 198  ? 172.785 200.131 158.961 1.00 112.58 ? 192  ARG C CB    1 
ATOM   8753  C  CG    . ARG D  1 198  ? 173.764 201.268 159.189 1.00 112.58 ? 192  ARG C CG    1 
ATOM   8754  C  CD    . ARG D  1 198  ? 174.302 201.311 160.609 1.00 112.58 ? 192  ARG C CD    1 
ATOM   8755  N  NE    . ARG D  1 198  ? 173.309 201.821 161.551 1.00 112.58 ? 192  ARG C NE    1 
ATOM   8756  C  CZ    . ARG D  1 198  ? 173.470 201.844 162.869 1.00 112.58 ? 192  ARG C CZ    1 
ATOM   8757  N  NH1   . ARG D  1 198  ? 174.588 201.379 163.403 1.00 112.58 ? 192  ARG C NH1   1 
ATOM   8758  N  NH2   . ARG D  1 198  ? 172.515 202.330 163.650 1.00 112.58 ? 192  ARG C NH2   1 
ATOM   8759  N  N     . HIS D  1 199  ? 173.294 201.441 155.895 1.00 109.71 ? 193  HIS C N     1 
ATOM   8760  C  CA    . HIS D  1 199  ? 174.223 201.640 154.785 1.00 109.71 ? 193  HIS C CA    1 
ATOM   8761  C  C     . HIS D  1 199  ? 173.886 200.704 153.628 1.00 109.71 ? 193  HIS C C     1 
ATOM   8762  O  O     . HIS D  1 199  ? 174.773 200.141 152.984 1.00 109.71 ? 193  HIS C O     1 
ATOM   8763  C  CB    . HIS D  1 199  ? 175.666 201.441 155.241 1.00 109.71 ? 193  HIS C CB    1 
ATOM   8764  C  CG    . HIS D  1 199  ? 176.101 202.412 156.290 1.00 109.71 ? 193  HIS C CG    1 
ATOM   8765  N  ND1   . HIS D  1 199  ? 177.240 202.235 157.042 1.00 109.71 ? 193  HIS C ND1   1 
ATOM   8766  C  CD2   . HIS D  1 199  ? 175.549 203.576 156.705 1.00 109.71 ? 193  HIS C CD2   1 
ATOM   8767  C  CE1   . HIS D  1 199  ? 177.367 203.242 157.885 1.00 109.71 ? 193  HIS C CE1   1 
ATOM   8768  N  NE2   . HIS D  1 199  ? 176.356 204.071 157.700 1.00 109.71 ? 193  HIS C NE2   1 
ATOM   8769  N  N     . GLY D  1 200  ? 172.592 200.520 153.377 1.00 106.04 ? 194  GLY C N     1 
ATOM   8770  C  CA    . GLY D  1 200  ? 172.168 199.546 152.398 1.00 106.04 ? 194  GLY C CA    1 
ATOM   8771  C  C     . GLY D  1 200  ? 172.542 198.122 152.728 1.00 106.04 ? 194  GLY C C     1 
ATOM   8772  O  O     . GLY D  1 200  ? 172.393 197.244 151.874 1.00 106.04 ? 194  GLY C O     1 
ATOM   8773  N  N     . ARG D  1 201  ? 173.031 197.865 153.934 1.00 107.67 ? 195  ARG C N     1 
ATOM   8774  C  CA    . ARG D  1 201  ? 173.460 196.540 154.336 1.00 107.67 ? 195  ARG C CA    1 
ATOM   8775  C  C     . ARG D  1 201  ? 172.614 196.056 155.502 1.00 107.67 ? 195  ARG C C     1 
ATOM   8776  O  O     . ARG D  1 201  ? 172.116 196.839 156.316 1.00 107.67 ? 195  ARG C O     1 
ATOM   8777  C  CB    . ARG D  1 201  ? 174.945 196.530 154.709 1.00 107.67 ? 195  ARG C CB    1 
ATOM   8778  C  CG    . ARG D  1 201  ? 175.846 196.881 153.550 1.00 107.67 ? 195  ARG C CG    1 
ATOM   8779  C  CD    . ARG D  1 201  ? 175.758 195.825 152.469 1.00 107.67 ? 195  ARG C CD    1 
ATOM   8780  N  NE    . ARG D  1 201  ? 176.150 194.510 152.964 1.00 107.67 ? 195  ARG C NE    1 
ATOM   8781  C  CZ    . ARG D  1 201  ? 177.404 194.076 153.009 1.00 107.67 ? 195  ARG C CZ    1 
ATOM   8782  N  NH1   . ARG D  1 201  ? 178.391 194.854 152.591 1.00 107.67 ? 195  ARG C NH1   1 
ATOM   8783  N  NH2   . ARG D  1 201  ? 177.675 192.866 153.474 1.00 107.67 ? 195  ARG C NH2   1 
ATOM   8784  N  N     . LEU D  1 202  ? 172.467 194.740 155.570 1.00 112.70 ? 196  LEU C N     1 
ATOM   8785  C  CA    . LEU D  1 202  ? 171.604 194.082 156.538 1.00 112.70 ? 196  LEU C CA    1 
ATOM   8786  C  C     . LEU D  1 202  ? 172.454 193.621 157.716 1.00 112.70 ? 196  LEU C C     1 
ATOM   8787  O  O     . LEU D  1 202  ? 173.128 192.589 157.633 1.00 112.70 ? 196  LEU C O     1 
ATOM   8788  C  CB    . LEU D  1 202  ? 170.886 192.904 155.884 1.00 112.70 ? 196  LEU C CB    1 
ATOM   8789  C  CG    . LEU D  1 202  ? 169.885 192.122 156.717 1.00 112.70 ? 196  LEU C CG    1 
ATOM   8790  C  CD1   . LEU D  1 202  ? 168.769 193.034 157.176 1.00 112.70 ? 196  LEU C CD1   1 
ATOM   8791  C  CD2   . LEU D  1 202  ? 169.339 190.983 155.886 1.00 112.70 ? 196  LEU C CD2   1 
ATOM   8792  N  N     . CYS D  1 203  ? 172.418 194.384 158.804 1.00 110.62 ? 197  CYS C N     1 
ATOM   8793  C  CA    . CYS D  1 203  ? 173.332 194.200 159.922 1.00 110.62 ? 197  CYS C CA    1 
ATOM   8794  C  C     . CYS D  1 203  ? 172.562 193.824 161.178 1.00 110.62 ? 197  CYS C C     1 
ATOM   8795  O  O     . CYS D  1 203  ? 171.535 194.433 161.490 1.00 110.62 ? 197  CYS C O     1 
ATOM   8796  C  CB    . CYS D  1 203  ? 174.159 195.467 160.159 1.00 110.62 ? 197  CYS C CB    1 
ATOM   8797  S  SG    . CYS D  1 203  ? 173.197 196.936 160.578 1.00 110.62 ? 197  CYS C SG    1 
ATOM   8798  N  N     . PHE D  1 204  ? 173.066 192.821 161.886 1.00 109.30 ? 198  PHE C N     1 
ATOM   8799  C  CA    . PHE D  1 204  ? 172.527 192.399 163.172 1.00 109.30 ? 198  PHE C CA    1 
ATOM   8800  C  C     . PHE D  1 204  ? 172.923 193.386 164.259 1.00 109.30 ? 198  PHE C C     1 
ATOM   8801  O  O     . PHE D  1 204  ? 174.081 193.803 164.329 1.00 109.30 ? 198  PHE C O     1 
ATOM   8802  C  CB    . PHE D  1 204  ? 173.047 191.007 163.517 1.00 109.30 ? 198  PHE C CB    1 
ATOM   8803  C  CG    . PHE D  1 204  ? 172.766 190.595 164.919 1.00 109.30 ? 198  PHE C CG    1 
ATOM   8804  C  CD1   . PHE D  1 204  ? 171.501 190.188 165.297 1.00 109.30 ? 198  PHE C CD1   1 
ATOM   8805  C  CD2   . PHE D  1 204  ? 173.770 190.615 165.865 1.00 109.30 ? 198  PHE C CD2   1 
ATOM   8806  C  CE1   . PHE D  1 204  ? 171.251 189.804 166.597 1.00 109.30 ? 198  PHE C CE1   1 
ATOM   8807  C  CE2   . PHE D  1 204  ? 173.523 190.235 167.166 1.00 109.30 ? 198  PHE C CE2   1 
ATOM   8808  C  CZ    . PHE D  1 204  ? 172.264 189.826 167.532 1.00 109.30 ? 198  PHE C CZ    1 
ATOM   8809  N  N     . MET D  1 205  ? 171.970 193.746 165.116 1.00 106.59 ? 199  MET C N     1 
ATOM   8810  C  CA    . MET D  1 205  ? 172.177 194.779 166.119 1.00 106.59 ? 199  MET C CA    1 
ATOM   8811  C  C     . MET D  1 205  ? 171.706 194.295 167.479 1.00 106.59 ? 199  MET C C     1 
ATOM   8812  O  O     . MET D  1 205  ? 171.019 193.279 167.579 1.00 106.59 ? 199  MET C O     1 
ATOM   8813  C  CB    . MET D  1 205  ? 171.425 196.064 165.761 1.00 106.59 ? 199  MET C CB    1 
ATOM   8814  C  CG    . MET D  1 205  ? 171.834 196.688 164.445 1.00 106.59 ? 199  MET C CG    1 
ATOM   8815  S  SD    . MET D  1 205  ? 171.055 198.279 164.146 1.00 106.59 ? 199  MET C SD    1 
ATOM   8816  C  CE    . MET D  1 205  ? 169.388 197.766 163.771 1.00 106.59 ? 199  MET C CE    1 
ATOM   8817  N  N     . LEU D  1 206  ? 172.099 195.026 168.520 1.00 109.22 ? 200  LEU C N     1 
ATOM   8818  C  CA    . LEU D  1 206  ? 171.501 194.920 169.845 1.00 109.22 ? 200  LEU C CA    1 
ATOM   8819  C  C     . LEU D  1 206  ? 171.932 196.125 170.667 1.00 109.22 ? 200  LEU C C     1 
ATOM   8820  O  O     . LEU D  1 206  ? 173.022 196.667 170.483 1.00 109.22 ? 200  LEU C O     1 
ATOM   8821  C  CB    . LEU D  1 206  ? 171.896 193.638 170.589 1.00 109.22 ? 200  LEU C CB    1 
ATOM   8822  C  CG    . LEU D  1 206  ? 173.295 193.640 171.200 1.00 109.22 ? 200  LEU C CG    1 
ATOM   8823  C  CD1   . LEU D  1 206  ? 173.370 192.641 172.324 1.00 109.22 ? 200  LEU C CD1   1 
ATOM   8824  C  CD2   . LEU D  1 206  ? 174.324 193.308 170.147 1.00 109.22 ? 200  LEU C CD2   1 
ATOM   8825  N  N     . ARG D  1 207  ? 171.071 196.532 171.590 1.00 109.90 ? 201  ARG C N     1 
ATOM   8826  C  CA    . ARG D  1 207  ? 171.353 197.657 172.467 1.00 109.90 ? 201  ARG C CA    1 
ATOM   8827  C  C     . ARG D  1 207  ? 172.024 197.161 173.738 1.00 109.90 ? 201  ARG C C     1 
ATOM   8828  O  O     . ARG D  1 207  ? 171.644 196.122 174.290 1.00 109.90 ? 201  ARG C O     1 
ATOM   8829  C  CB    . ARG D  1 207  ? 170.073 198.427 172.806 1.00 109.90 ? 201  ARG C CB    1 
ATOM   8830  C  CG    . ARG D  1 207  ? 170.271 199.640 173.713 1.00 109.90 ? 201  ARG C CG    1 
ATOM   8831  C  CD    . ARG D  1 207  ? 168.969 200.412 173.889 1.00 109.90 ? 201  ARG C CD    1 
ATOM   8832  N  NE    . ARG D  1 207  ? 168.606 201.170 172.693 1.00 109.90 ? 201  ARG C NE    1 
ATOM   8833  C  CZ    . ARG D  1 207  ? 167.405 201.692 172.470 1.00 109.90 ? 201  ARG C CZ    1 
ATOM   8834  N  NH1   . ARG D  1 207  ? 166.431 201.517 173.348 1.00 109.90 ? 201  ARG C NH1   1 
ATOM   8835  N  NH2   . ARG D  1 207  ? 167.169 202.373 171.358 1.00 109.90 ? 201  ARG C NH2   1 
ATOM   8836  N  N     . VAL D  1 208  ? 173.025 197.909 174.193 1.00 108.37 ? 202  VAL C N     1 
ATOM   8837  C  CA    . VAL D  1 208  ? 173.742 197.628 175.428 1.00 108.37 ? 202  VAL C CA    1 
ATOM   8838  C  C     . VAL D  1 208  ? 173.256 198.619 176.466 1.00 108.37 ? 202  VAL C C     1 
ATOM   8839  O  O     . VAL D  1 208  ? 172.759 199.694 176.117 1.00 108.37 ? 202  VAL C O     1 
ATOM   8840  C  CB    . VAL D  1 208  ? 175.268 197.744 175.235 1.00 108.37 ? 202  VAL C CB    1 
ATOM   8841  C  CG1   . VAL D  1 208  ? 175.649 199.181 174.980 1.00 108.37 ? 202  VAL C CG1   1 
ATOM   8842  C  CG2   . VAL D  1 208  ? 176.017 197.205 176.435 1.00 108.37 ? 202  VAL C CG2   1 
ATOM   8843  N  N     . GLY D  1 209  ? 173.380 198.263 177.739 1.00 116.15 ? 203  GLY C N     1 
ATOM   8844  C  CA    . GLY D  1 209  ? 172.947 199.167 178.784 1.00 116.15 ? 203  GLY C CA    1 
ATOM   8845  C  C     . GLY D  1 209  ? 173.822 199.091 180.009 1.00 116.15 ? 203  GLY C C     1 
ATOM   8846  O  O     . GLY D  1 209  ? 174.134 198.007 180.515 1.00 116.15 ? 203  GLY C O     1 
ATOM   8847  N  N     . ASP D  1 210  ? 174.214 200.268 180.488 1.00 126.31 ? 204  ASP C N     1 
ATOM   8848  C  CA    . ASP D  1 210  ? 174.873 200.424 181.775 1.00 126.31 ? 204  ASP C CA    1 
ATOM   8849  C  C     . ASP D  1 210  ? 174.025 201.321 182.661 1.00 126.31 ? 204  ASP C C     1 
ATOM   8850  O  O     . ASP D  1 210  ? 173.665 202.434 182.268 1.00 126.31 ? 204  ASP C O     1 
ATOM   8851  C  CB    . ASP D  1 210  ? 176.267 201.031 181.632 1.00 126.31 ? 204  ASP C CB    1 
ATOM   8852  C  CG    . ASP D  1 210  ? 177.045 201.000 182.929 1.00 126.31 ? 204  ASP C CG    1 
ATOM   8853  O  OD1   . ASP D  1 210  ? 176.516 200.463 183.924 1.00 126.31 ? 204  ASP C OD1   1 
ATOM   8854  O  OD2   . ASP D  1 210  ? 178.179 201.520 182.967 1.00 126.31 ? 204  ASP C OD2   1 
ATOM   8855  N  N     . LEU D  1 211  ? 173.717 200.838 183.862 1.00 128.64 ? 205  LEU C N     1 
ATOM   8856  C  CA    . LEU D  1 211  ? 172.828 201.549 184.768 1.00 128.64 ? 205  LEU C CA    1 
ATOM   8857  C  C     . LEU D  1 211  ? 173.555 202.370 185.820 1.00 128.64 ? 205  LEU C C     1 
ATOM   8858  O  O     . LEU D  1 211  ? 172.972 203.322 186.340 1.00 128.64 ? 205  LEU C O     1 
ATOM   8859  C  CB    . LEU D  1 211  ? 171.896 200.564 185.470 1.00 128.64 ? 205  LEU C CB    1 
ATOM   8860  C  CG    . LEU D  1 211  ? 170.912 199.856 184.553 1.00 128.64 ? 205  LEU C CG    1 
ATOM   8861  C  CD1   . LEU D  1 211  ? 170.101 198.866 185.348 1.00 128.64 ? 205  LEU C CD1   1 
ATOM   8862  C  CD2   . LEU D  1 211  ? 170.019 200.870 183.897 1.00 128.64 ? 205  LEU C CD2   1 
ATOM   8863  N  N     . ARG D  1 212  ? 174.796 202.037 186.145 1.00 133.48 ? 206  ARG C N     1 
ATOM   8864  C  CA    . ARG D  1 212  ? 175.553 202.784 187.132 1.00 133.48 ? 206  ARG C CA    1 
ATOM   8865  C  C     . ARG D  1 212  ? 176.209 203.991 186.483 1.00 133.48 ? 206  ARG C C     1 
ATOM   8866  O  O     . ARG D  1 212  ? 176.671 203.930 185.341 1.00 133.48 ? 206  ARG C O     1 
ATOM   8867  C  CB    . ARG D  1 212  ? 176.626 201.914 187.787 1.00 133.48 ? 206  ARG C CB    1 
ATOM   8868  C  CG    . ARG D  1 212  ? 176.074 200.771 188.594 1.00 133.48 ? 206  ARG C CG    1 
ATOM   8869  C  CD    . ARG D  1 212  ? 175.357 201.293 189.821 1.00 133.48 ? 206  ARG C CD    1 
ATOM   8870  N  NE    . ARG D  1 212  ? 174.838 200.211 190.647 1.00 133.48 ? 206  ARG C NE    1 
ATOM   8871  C  CZ    . ARG D  1 212  ? 175.517 199.640 191.635 1.00 133.48 ? 206  ARG C CZ    1 
ATOM   8872  N  NH1   . ARG D  1 212  ? 176.744 200.053 191.921 1.00 133.48 ? 206  ARG C NH1   1 
ATOM   8873  N  NH2   . ARG D  1 212  ? 174.971 198.659 192.338 1.00 133.48 ? 206  ARG C NH2   1 
ATOM   8874  N  N     . LYS D  1 213  ? 176.231 205.098 187.219 1.00 136.92 ? 207  LYS C N     1 
ATOM   8875  C  CA    . LYS D  1 213  ? 177.007 206.245 186.780 1.00 136.92 ? 207  LYS C CA    1 
ATOM   8876  C  C     . LYS D  1 213  ? 178.499 205.982 186.856 1.00 136.92 ? 207  LYS C C     1 
ATOM   8877  O  O     . LYS D  1 213  ? 179.267 206.635 186.144 1.00 136.92 ? 207  LYS C O     1 
ATOM   8878  C  CB    . LYS D  1 213  ? 176.655 207.476 187.616 1.00 136.92 ? 207  LYS C CB    1 
ATOM   8879  N  N     . SER D  1 214  ? 178.917 205.040 187.696 1.00 142.30 ? 208  SER C N     1 
ATOM   8880  C  CA    . SER D  1 214  ? 180.308 204.618 187.732 1.00 142.30 ? 208  SER C CA    1 
ATOM   8881  C  C     . SER D  1 214  ? 180.706 204.050 186.380 1.00 142.30 ? 208  SER C C     1 
ATOM   8882  O  O     . SER D  1 214  ? 179.920 203.373 185.714 1.00 142.30 ? 208  SER C O     1 
ATOM   8883  C  CB    . SER D  1 214  ? 180.514 203.581 188.831 1.00 142.30 ? 208  SER C CB    1 
ATOM   8884  O  OG    . SER D  1 214  ? 179.760 202.415 188.564 1.00 142.30 ? 208  SER C OG    1 
ATOM   8885  N  N     . MET D  1 215  ? 181.928 204.346 185.961 1.00 138.59 ? 209  MET C N     1 
ATOM   8886  C  CA    . MET D  1 215  ? 182.295 204.100 184.580 1.00 138.59 ? 209  MET C CA    1 
ATOM   8887  C  C     . MET D  1 215  ? 183.111 202.823 184.449 1.00 138.59 ? 209  MET C C     1 
ATOM   8888  O  O     . MET D  1 215  ? 183.899 202.466 185.325 1.00 138.59 ? 209  MET C O     1 
ATOM   8889  C  CB    . MET D  1 215  ? 183.071 205.292 184.025 1.00 138.59 ? 209  MET C CB    1 
ATOM   8890  C  CG    . MET D  1 215  ? 183.250 205.266 182.530 1.00 138.59 ? 209  MET C CG    1 
ATOM   8891  S  SD    . MET D  1 215  ? 181.627 205.162 181.768 1.00 138.59 ? 209  MET C SD    1 
ATOM   8892  C  CE    . MET D  1 215  ? 180.916 206.703 182.329 1.00 138.59 ? 209  MET C CE    1 
ATOM   8893  N  N     . ILE D  1 216  ? 182.902 202.131 183.348 1.00 117.08 ? 210  ILE C N     1 
ATOM   8894  C  CA    . ILE D  1 216  ? 183.696 200.965 182.993 1.00 117.08 ? 210  ILE C CA    1 
ATOM   8895  C  C     . ILE D  1 216  ? 184.796 201.429 182.055 1.00 117.08 ? 210  ILE C C     1 
ATOM   8896  O  O     . ILE D  1 216  ? 184.573 202.294 181.200 1.00 117.08 ? 210  ILE C O     1 
ATOM   8897  C  CB    . ILE D  1 216  ? 182.820 199.873 182.351 1.00 117.08 ? 210  ILE C CB    1 
ATOM   8898  C  CG1   . ILE D  1 216  ? 183.591 198.557 182.237 1.00 117.08 ? 210  ILE C CG1   1 
ATOM   8899  C  CG2   . ILE D  1 216  ? 182.271 200.337 181.014 1.00 117.08 ? 210  ILE C CG2   1 
ATOM   8900  C  CD1   . ILE D  1 216  ? 183.848 197.897 183.565 1.00 117.08 ? 210  ILE C CD1   1 
ATOM   8901  N  N     . ILE D  1 217  ? 185.993 200.885 182.228 1.00 111.42 ? 211  ILE C N     1 
ATOM   8902  C  CA    . ILE D  1 217  ? 187.159 201.307 181.464 1.00 111.42 ? 211  ILE C CA    1 
ATOM   8903  C  C     . ILE D  1 217  ? 187.510 200.207 180.478 1.00 111.42 ? 211  ILE C C     1 
ATOM   8904  O  O     . ILE D  1 217  ? 187.433 199.020 180.811 1.00 111.42 ? 211  ILE C O     1 
ATOM   8905  C  CB    . ILE D  1 217  ? 188.350 201.638 182.378 1.00 111.42 ? 211  ILE C CB    1 
ATOM   8906  C  CG1   . ILE D  1 217  ? 188.063 202.892 183.199 1.00 111.42 ? 211  ILE C CG1   1 
ATOM   8907  C  CG2   . ILE D  1 217  ? 189.604 201.850 181.569 1.00 111.42 ? 211  ILE C CG2   1 
ATOM   8908  C  CD1   . ILE D  1 217  ? 187.419 202.624 184.524 1.00 111.42 ? 211  ILE C CD1   1 
ATOM   8909  N  N     . SER D  1 218  ? 187.877 200.605 179.260 1.00 106.97 ? 212  SER C N     1 
ATOM   8910  C  CA    . SER D  1 218  ? 188.270 199.672 178.208 1.00 106.97 ? 212  SER C CA    1 
ATOM   8911  C  C     . SER D  1 218  ? 187.167 198.656 177.936 1.00 106.97 ? 212  SER C C     1 
ATOM   8912  O  O     . SER D  1 218  ? 187.430 197.486 177.659 1.00 106.97 ? 212  SER C O     1 
ATOM   8913  C  CB    . SER D  1 218  ? 189.582 198.972 178.552 1.00 106.97 ? 212  SER C CB    1 
ATOM   8914  O  OG    . SER D  1 218  ? 189.917 198.027 177.553 1.00 106.97 ? 212  SER C OG    1 
ATOM   8915  N  N     . ALA D  1 219  ? 185.921 199.112 178.031 1.00 104.79 ? 213  ALA C N     1 
ATOM   8916  C  CA    . ALA D  1 219  ? 184.771 198.269 177.741 1.00 104.79 ? 213  ALA C CA    1 
ATOM   8917  C  C     . ALA D  1 219  ? 184.900 197.668 176.351 1.00 104.79 ? 213  ALA C C     1 
ATOM   8918  O  O     . ALA D  1 219  ? 184.890 198.390 175.350 1.00 104.79 ? 213  ALA C O     1 
ATOM   8919  C  CB    . ALA D  1 219  ? 183.478 199.070 177.863 1.00 104.79 ? 213  ALA C CB    1 
ATOM   8920  N  N     . THR D  1 220  ? 185.019 196.349 176.287 1.00 104.44 ? 214  THR C N     1 
ATOM   8921  C  CA    . THR D  1 220  ? 185.325 195.641 175.054 1.00 104.44 ? 214  THR C CA    1 
ATOM   8922  C  C     . THR D  1 220  ? 184.240 194.614 174.779 1.00 104.44 ? 214  THR C C     1 
ATOM   8923  O  O     . THR D  1 220  ? 183.772 193.938 175.701 1.00 104.44 ? 214  THR C O     1 
ATOM   8924  C  CB    . THR D  1 220  ? 186.690 194.976 175.156 1.00 104.44 ? 214  THR C CB    1 
ATOM   8925  O  OG1   . THR D  1 220  ? 187.668 195.975 175.464 1.00 104.44 ? 214  THR C OG1   1 
ATOM   8926  C  CG2   . THR D  1 220  ? 187.055 194.327 173.848 1.00 104.44 ? 214  THR C CG2   1 
ATOM   8927  N  N     . ILE D  1 221  ? 183.840 194.505 173.516 1.00 99.67  ? 215  ILE C N     1 
ATOM   8928  C  CA    . ILE D  1 221  ? 182.737 193.648 173.098 1.00 99.67  ? 215  ILE C CA    1 
ATOM   8929  C  C     . ILE D  1 221  ? 183.291 192.471 172.321 1.00 99.67  ? 215  ILE C C     1 
ATOM   8930  O  O     . ILE D  1 221  ? 184.104 192.649 171.407 1.00 99.67  ? 215  ILE C O     1 
ATOM   8931  C  CB    . ILE D  1 221  ? 181.729 194.426 172.238 1.00 99.67  ? 215  ILE C CB    1 
ATOM   8932  C  CG1   . ILE D  1 221  ? 181.066 195.528 173.055 1.00 99.67  ? 215  ILE C CG1   1 
ATOM   8933  C  CG2   . ILE D  1 221  ? 180.696 193.485 171.646 1.00 99.67  ? 215  ILE C CG2   1 
ATOM   8934  C  CD1   . ILE D  1 221  ? 180.230 195.000 174.183 1.00 99.67  ? 215  ILE C CD1   1 
ATOM   8935  N  N     . HIS D  1 222  ? 182.839 191.274 172.659 1.00 94.64  ? 216  HIS C N     1 
ATOM   8936  C  CA    . HIS D  1 222  ? 183.142 190.086 171.871 1.00 94.64  ? 216  HIS C CA    1 
ATOM   8937  C  C     . HIS D  1 222  ? 181.838 189.356 171.597 1.00 94.64  ? 216  HIS C C     1 
ATOM   8938  O  O     . HIS D  1 222  ? 181.471 188.427 172.320 1.00 94.64  ? 216  HIS C O     1 
ATOM   8939  C  CB    . HIS D  1 222  ? 184.136 189.192 172.586 1.00 94.64  ? 216  HIS C CB    1 
ATOM   8940  C  CG    . HIS D  1 222  ? 185.498 189.789 172.692 1.00 94.64  ? 216  HIS C CG    1 
ATOM   8941  N  ND1   . HIS D  1 222  ? 185.858 190.634 173.719 1.00 94.64  ? 216  HIS C ND1   1 
ATOM   8942  C  CD2   . HIS D  1 222  ? 186.589 189.668 171.902 1.00 94.64  ? 216  HIS C CD2   1 
ATOM   8943  C  CE1   . HIS D  1 222  ? 187.114 191.006 173.557 1.00 94.64  ? 216  HIS C CE1   1 
ATOM   8944  N  NE2   . HIS D  1 222  ? 187.580 190.435 172.461 1.00 94.64  ? 216  HIS C NE2   1 
ATOM   8945  N  N     . MET D  1 223  ? 181.140 189.774 170.552 1.00 95.66  ? 217  MET C N     1 
ATOM   8946  C  CA    . MET D  1 223  ? 180.017 188.998 170.067 1.00 95.66  ? 217  MET C CA    1 
ATOM   8947  C  C     . MET D  1 223  ? 180.552 187.706 169.476 1.00 95.66  ? 217  MET C C     1 
ATOM   8948  O  O     . MET D  1 223  ? 181.577 187.699 168.788 1.00 95.66  ? 217  MET C O     1 
ATOM   8949  C  CB    . MET D  1 223  ? 179.226 189.786 169.028 1.00 95.66  ? 217  MET C CB    1 
ATOM   8950  C  CG    . MET D  1 223  ? 178.598 191.048 169.582 1.00 95.66  ? 217  MET C CG    1 
ATOM   8951  S  SD    . MET D  1 223  ? 177.509 191.864 168.404 1.00 95.66  ? 217  MET C SD    1 
ATOM   8952  C  CE    . MET D  1 223  ? 178.697 192.532 167.256 1.00 95.66  ? 217  MET C CE    1 
ATOM   8953  N  N     . GLN D  1 224  ? 179.869 186.601 169.755 1.00 102.07 ? 218  GLN C N     1 
ATOM   8954  C  CA    . GLN D  1 224  ? 180.416 185.304 169.381 1.00 102.07 ? 218  GLN C CA    1 
ATOM   8955  C  C     . GLN D  1 224  ? 179.249 184.359 169.112 1.00 102.07 ? 218  GLN C C     1 
ATOM   8956  O  O     . GLN D  1 224  ? 178.516 184.001 170.035 1.00 102.07 ? 218  GLN C O     1 
ATOM   8957  C  CB    . GLN D  1 224  ? 181.324 184.786 170.475 1.00 102.07 ? 218  GLN C CB    1 
ATOM   8958  C  CG    . GLN D  1 224  ? 182.042 183.509 170.158 1.00 102.07 ? 218  GLN C CG    1 
ATOM   8959  C  CD    . GLN D  1 224  ? 183.022 183.162 171.250 1.00 102.07 ? 218  GLN C CD    1 
ATOM   8960  O  OE1   . GLN D  1 224  ? 183.119 183.869 172.250 1.00 102.07 ? 218  GLN C OE1   1 
ATOM   8961  N  NE2   . GLN D  1 224  ? 183.769 182.086 171.063 1.00 102.07 ? 218  GLN C NE2   1 
ATOM   8962  N  N     . VAL D  1 225  ? 179.088 183.977 167.853 1.00 102.97 ? 219  VAL C N     1 
ATOM   8963  C  CA    . VAL D  1 225  ? 178.007 183.086 167.460 1.00 102.97 ? 219  VAL C CA    1 
ATOM   8964  C  C     . VAL D  1 225  ? 178.425 181.647 167.720 1.00 102.97 ? 219  VAL C C     1 
ATOM   8965  O  O     . VAL D  1 225  ? 179.574 181.258 167.482 1.00 102.97 ? 219  VAL C O     1 
ATOM   8966  C  CB    . VAL D  1 225  ? 177.631 183.309 165.986 1.00 102.97 ? 219  VAL C CB    1 
ATOM   8967  C  CG1   . VAL D  1 225  ? 178.814 183.031 165.084 1.00 102.97 ? 219  VAL C CG1   1 
ATOM   8968  C  CG2   . VAL D  1 225  ? 176.458 182.428 165.606 1.00 102.97 ? 219  VAL C CG2   1 
ATOM   8969  N  N     . VAL D  1 226  ? 177.495 180.855 168.239 1.00 108.86 ? 220  VAL C N     1 
ATOM   8970  C  CA    . VAL D  1 226  ? 177.764 179.473 168.600 1.00 108.86 ? 220  VAL C CA    1 
ATOM   8971  C  C     . VAL D  1 226  ? 176.667 178.585 168.040 1.00 108.86 ? 220  VAL C C     1 
ATOM   8972  O  O     . VAL D  1 226  ? 175.480 178.919 168.106 1.00 108.86 ? 220  VAL C O     1 
ATOM   8973  C  CB    . VAL D  1 226  ? 177.888 179.297 170.125 1.00 108.86 ? 220  VAL C CB    1 
ATOM   8974  C  CG1   . VAL D  1 226  ? 179.095 180.049 170.634 1.00 108.86 ? 220  VAL C CG1   1 
ATOM   8975  C  CG2   . VAL D  1 226  ? 176.636 179.785 170.819 1.00 108.86 ? 220  VAL C CG2   1 
ATOM   8976  N  N     . ARG D  1 227  ? 177.074 177.459 167.471 1.00 116.36 ? 221  ARG C N     1 
ATOM   8977  C  CA    . ARG D  1 227  ? 176.134 176.457 166.999 1.00 116.36 ? 221  ARG C CA    1 
ATOM   8978  C  C     . ARG D  1 227  ? 176.903 175.164 166.803 1.00 116.36 ? 221  ARG C C     1 
ATOM   8979  O  O     . ARG D  1 227  ? 178.117 175.102 166.999 1.00 116.36 ? 221  ARG C O     1 
ATOM   8980  C  CB    . ARG D  1 227  ? 175.455 176.867 165.692 1.00 116.36 ? 221  ARG C CB    1 
ATOM   8981  C  CG    . ARG D  1 227  ? 176.345 176.689 164.488 1.00 116.36 ? 221  ARG C CG    1 
ATOM   8982  C  CD    . ARG D  1 227  ? 175.658 177.076 163.198 1.00 116.36 ? 221  ARG C CD    1 
ATOM   8983  N  NE    . ARG D  1 227  ? 175.524 178.519 163.042 1.00 116.36 ? 221  ARG C NE    1 
ATOM   8984  C  CZ    . ARG D  1 227  ? 174.872 179.096 162.041 1.00 116.36 ? 221  ARG C CZ    1 
ATOM   8985  N  NH1   . ARG D  1 227  ? 174.293 178.347 161.113 1.00 116.36 ? 221  ARG C NH1   1 
ATOM   8986  N  NH2   . ARG D  1 227  ? 174.799 180.416 161.966 1.00 116.36 ? 221  ARG C NH2   1 
ATOM   8987  N  N     . LYS D  1 228  ? 176.177 174.133 166.401 1.00 128.30 ? 222  LYS C N     1 
ATOM   8988  C  CA    . LYS D  1 228  ? 176.757 172.839 166.074 1.00 128.30 ? 222  LYS C CA    1 
ATOM   8989  C  C     . LYS D  1 228  ? 177.038 172.843 164.579 1.00 128.30 ? 222  LYS C C     1 
ATOM   8990  O  O     . LYS D  1 228  ? 176.223 172.374 163.784 1.00 128.30 ? 222  LYS C O     1 
ATOM   8991  C  CB    . LYS D  1 228  ? 175.808 171.718 166.475 1.00 128.30 ? 222  LYS C CB    1 
ATOM   8992  C  CG    . LYS D  1 228  ? 176.369 170.329 166.318 1.00 128.30 ? 222  LYS C CG    1 
ATOM   8993  C  CD    . LYS D  1 228  ? 175.369 169.299 166.809 1.00 128.30 ? 222  LYS C CD    1 
ATOM   8994  C  CE    . LYS D  1 228  ? 175.877 167.880 166.622 1.00 128.30 ? 222  LYS C CE    1 
ATOM   8995  N  NZ    . LYS D  1 228  ? 174.884 166.882 167.109 1.00 128.30 ? 222  LYS C NZ    1 
ATOM   8996  N  N     . THR D  1 229  ? 178.185 173.383 164.196 1.00 117.91 ? 223  THR C N     1 
ATOM   8997  C  CA    . THR D  1 229  ? 178.527 173.510 162.789 1.00 117.91 ? 223  THR C CA    1 
ATOM   8998  C  C     . THR D  1 229  ? 179.571 172.473 162.398 1.00 117.91 ? 223  THR C C     1 
ATOM   8999  O  O     . THR D  1 229  ? 180.133 171.765 163.236 1.00 117.91 ? 223  THR C O     1 
ATOM   9000  C  CB    . THR D  1 229  ? 179.040 174.910 162.471 1.00 117.91 ? 223  THR C CB    1 
ATOM   9001  O  OG1   . THR D  1 229  ? 179.123 175.067 161.050 1.00 117.91 ? 223  THR C OG1   1 
ATOM   9002  C  CG2   . THR D  1 229  ? 180.412 175.093 163.051 1.00 117.91 ? 223  THR C CG2   1 
ATOM   9003  N  N     . THR D  1 230  ? 179.840 172.412 161.098 1.00 120.26 ? 224  THR C N     1 
ATOM   9004  C  CA    . THR D  1 230  ? 180.605 171.320 160.518 1.00 120.26 ? 224  THR C CA    1 
ATOM   9005  C  C     . THR D  1 230  ? 181.559 171.847 159.457 1.00 120.26 ? 224  THR C C     1 
ATOM   9006  O  O     . THR D  1 230  ? 181.191 172.714 158.659 1.00 120.26 ? 224  THR C O     1 
ATOM   9007  C  CB    . THR D  1 230  ? 179.665 170.283 159.911 1.00 120.26 ? 224  THR C CB    1 
ATOM   9008  O  OG1   . THR D  1 230  ? 178.755 169.827 160.920 1.00 120.26 ? 224  THR C OG1   1 
ATOM   9009  C  CG2   . THR D  1 230  ? 180.445 169.099 159.384 1.00 120.26 ? 224  THR C CG2   1 
ATOM   9010  N  N     . SER D  1 231  ? 182.782 171.324 159.457 1.00 120.42 ? 225  SER C N     1 
ATOM   9011  C  CA    . SER D  1 231  ? 183.734 171.609 158.401 1.00 120.42 ? 225  SER C CA    1 
ATOM   9012  C  C     . SER D  1 231  ? 183.304 170.910 157.116 1.00 120.42 ? 225  SER C C     1 
ATOM   9013  O  O     . SER D  1 231  ? 182.484 169.991 157.145 1.00 120.42 ? 225  SER C O     1 
ATOM   9014  C  CB    . SER D  1 231  ? 185.127 171.138 158.804 1.00 120.42 ? 225  SER C CB    1 
ATOM   9015  O  OG    . SER D  1 231  ? 185.183 169.723 158.836 1.00 120.42 ? 225  SER C OG    1 
ATOM   9016  N  N     . PRO D  1 232  ? 183.840 171.326 155.968 1.00 122.41 ? 226  PRO C N     1 
ATOM   9017  C  CA    . PRO D  1 232  ? 183.569 170.569 154.740 1.00 122.41 ? 226  PRO C CA    1 
ATOM   9018  C  C     . PRO D  1 232  ? 184.024 169.128 154.828 1.00 122.41 ? 226  PRO C C     1 
ATOM   9019  O  O     . PRO D  1 232  ? 183.343 168.238 154.306 1.00 122.41 ? 226  PRO C O     1 
ATOM   9020  C  CB    . PRO D  1 232  ? 184.356 171.337 153.667 1.00 122.41 ? 226  PRO C CB    1 
ATOM   9021  C  CG    . PRO D  1 232  ? 184.528 172.705 154.226 1.00 122.41 ? 226  PRO C CG    1 
ATOM   9022  C  CD    . PRO D  1 232  ? 184.674 172.511 155.704 1.00 122.41 ? 226  PRO C CD    1 
ATOM   9023  N  N     . GLU D  1 233  ? 185.148 168.870 155.494 1.00 116.69 ? 227  GLU C N     1 
ATOM   9024  C  CA    . GLU D  1 233  ? 185.669 167.515 155.597 1.00 116.69 ? 227  GLU C CA    1 
ATOM   9025  C  C     . GLU D  1 233  ? 184.742 166.631 156.415 1.00 116.69 ? 227  GLU C C     1 
ATOM   9026  O  O     . GLU D  1 233  ? 184.780 165.403 156.293 1.00 116.69 ? 227  GLU C O     1 
ATOM   9027  C  CB    . GLU D  1 233  ? 187.070 167.551 156.202 1.00 116.69 ? 227  GLU C CB    1 
ATOM   9028  C  CG    . GLU D  1 233  ? 188.091 168.219 155.301 1.00 116.69 ? 227  GLU C CG    1 
ATOM   9029  C  CD    . GLU D  1 233  ? 188.013 169.733 155.351 1.00 116.69 ? 227  GLU C CD    1 
ATOM   9030  O  OE1   . GLU D  1 233  ? 187.184 170.263 156.118 1.00 116.69 ? 227  GLU C OE1   1 
ATOM   9031  O  OE2   . GLU D  1 233  ? 188.777 170.394 154.625 1.00 116.69 ? 227  GLU C OE2   1 
ATOM   9032  N  N     . GLY D  1 234  ? 183.914 167.234 157.259 1.00 116.65 ? 228  GLY C N     1 
ATOM   9033  C  CA    . GLY D  1 234  ? 182.863 166.476 157.899 1.00 116.65 ? 228  GLY C CA    1 
ATOM   9034  C  C     . GLY D  1 234  ? 182.787 166.577 159.405 1.00 116.65 ? 228  GLY C C     1 
ATOM   9035  O  O     . GLY D  1 234  ? 181.734 166.290 159.980 1.00 116.65 ? 228  GLY C O     1 
ATOM   9036  N  N     . GLU D  1 235  ? 183.870 166.964 160.070 1.00 122.74 ? 229  GLU C N     1 
ATOM   9037  C  CA    . GLU D  1 235  ? 183.849 166.997 161.524 1.00 122.74 ? 229  GLU C CA    1 
ATOM   9038  C  C     . GLU D  1 235  ? 182.879 168.054 162.026 1.00 122.74 ? 229  GLU C C     1 
ATOM   9039  O  O     . GLU D  1 235  ? 182.869 169.194 161.556 1.00 122.74 ? 229  GLU C O     1 
ATOM   9040  C  CB    . GLU D  1 235  ? 185.238 167.247 162.103 1.00 122.74 ? 229  GLU C CB    1 
ATOM   9041  C  CG    . GLU D  1 235  ? 185.888 168.527 161.671 1.00 122.74 ? 229  GLU C CG    1 
ATOM   9042  C  CD    . GLU D  1 235  ? 187.181 168.772 162.404 1.00 122.74 ? 229  GLU C CD    1 
ATOM   9043  O  OE1   . GLU D  1 235  ? 187.487 167.997 163.333 1.00 122.74 ? 229  GLU C OE1   1 
ATOM   9044  O  OE2   . GLU D  1 235  ? 187.902 169.724 162.040 1.00 122.74 ? 229  GLU C OE2   1 
ATOM   9045  N  N     . VAL D  1 236  ? 182.049 167.654 162.977 1.00 112.07 ? 230  VAL C N     1 
ATOM   9046  C  CA    . VAL D  1 236  ? 181.091 168.536 163.625 1.00 112.07 ? 230  VAL C CA    1 
ATOM   9047  C  C     . VAL D  1 236  ? 181.481 168.655 165.088 1.00 112.07 ? 230  VAL C C     1 
ATOM   9048  O  O     . VAL D  1 236  ? 181.941 167.687 165.702 1.00 112.07 ? 230  VAL C O     1 
ATOM   9049  C  CB    . VAL D  1 236  ? 179.645 168.015 163.474 1.00 112.07 ? 230  VAL C CB    1 
ATOM   9050  C  CG1   . VAL D  1 236  ? 179.473 166.675 164.170 1.00 112.07 ? 230  VAL C CG1   1 
ATOM   9051  C  CG2   . VAL D  1 236  ? 178.666 169.018 164.022 1.00 112.07 ? 230  VAL C CG2   1 
ATOM   9052  N  N     . VAL D  1 237  ? 181.329 169.852 165.638 1.00 114.92 ? 231  VAL C N     1 
ATOM   9053  C  CA    . VAL D  1 237  ? 181.578 170.054 167.060 1.00 114.92 ? 231  VAL C CA    1 
ATOM   9054  C  C     . VAL D  1 237  ? 180.327 170.671 167.671 1.00 114.92 ? 231  VAL C C     1 
ATOM   9055  O  O     . VAL D  1 237  ? 179.733 171.586 167.082 1.00 114.92 ? 231  VAL C O     1 
ATOM   9056  C  CB    . VAL D  1 237  ? 182.837 170.898 167.289 1.00 114.92 ? 231  VAL C CB    1 
ATOM   9057  C  CG1   . VAL D  1 237  ? 184.054 170.125 166.831 1.00 114.92 ? 231  VAL C CG1   1 
ATOM   9058  C  CG2   . VAL D  1 237  ? 182.747 172.189 166.519 1.00 114.92 ? 231  VAL C CG2   1 
ATOM   9059  N  N     . PRO D  1 238  ? 179.878 170.180 168.820 1.00 120.63 ? 232  PRO C N     1 
ATOM   9060  C  CA    . PRO D  1 238  ? 178.560 170.570 169.335 1.00 120.63 ? 232  PRO C CA    1 
ATOM   9061  C  C     . PRO D  1 238  ? 178.431 172.060 169.574 1.00 120.63 ? 232  PRO C C     1 
ATOM   9062  O  O     . PRO D  1 238  ? 177.565 172.717 168.995 1.00 120.63 ? 232  PRO C O     1 
ATOM   9063  C  CB    . PRO D  1 238  ? 178.456 169.789 170.649 1.00 120.63 ? 232  PRO C CB    1 
ATOM   9064  C  CG    . PRO D  1 238  ? 179.409 168.654 170.492 1.00 120.63 ? 232  PRO C CG    1 
ATOM   9065  C  CD    . PRO D  1 238  ? 180.543 169.196 169.688 1.00 120.63 ? 232  PRO C CD    1 
ATOM   9066  N  N     . LEU D  1 239  ? 179.278 172.603 170.440 1.00 120.83 ? 233  LEU C N     1 
ATOM   9067  C  CA    . LEU D  1 239  ? 179.285 174.040 170.699 1.00 120.83 ? 233  LEU C CA    1 
ATOM   9068  C  C     . LEU D  1 239  ? 180.482 174.672 169.994 1.00 120.83 ? 233  LEU C C     1 
ATOM   9069  O  O     . LEU D  1 239  ? 181.510 174.988 170.591 1.00 120.83 ? 233  LEU C O     1 
ATOM   9070  C  CB    . LEU D  1 239  ? 179.301 174.311 172.197 1.00 120.83 ? 233  LEU C CB    1 
ATOM   9071  C  CG    . LEU D  1 239  ? 178.007 173.918 172.912 1.00 120.83 ? 233  LEU C CG    1 
ATOM   9072  C  CD1   . LEU D  1 239  ? 178.171 173.984 174.414 1.00 120.83 ? 233  LEU C CD1   1 
ATOM   9073  C  CD2   . LEU D  1 239  ? 176.875 174.819 172.460 1.00 120.83 ? 233  LEU C CD2   1 
ATOM   9074  N  N     . HIS D  1 240  ? 180.340 174.839 168.683 1.00 104.61 ? 234  HIS C N     1 
ATOM   9075  C  CA    . HIS D  1 240  ? 181.349 175.570 167.938 1.00 104.61 ? 234  HIS C CA    1 
ATOM   9076  C  C     . HIS D  1 240  ? 181.173 177.058 168.185 1.00 104.61 ? 234  HIS C C     1 
ATOM   9077  O  O     . HIS D  1 240  ? 180.060 177.528 168.437 1.00 104.61 ? 234  HIS C O     1 
ATOM   9078  C  CB    . HIS D  1 240  ? 181.269 175.289 166.448 1.00 104.61 ? 234  HIS C CB    1 
ATOM   9079  C  CG    . HIS D  1 240  ? 182.355 175.962 165.679 1.00 104.61 ? 234  HIS C CG    1 
ATOM   9080  N  ND1   . HIS D  1 240  ? 183.658 175.514 165.691 1.00 104.61 ? 234  HIS C ND1   1 
ATOM   9081  C  CD2   . HIS D  1 240  ? 182.348 177.080 164.917 1.00 104.61 ? 234  HIS C CD2   1 
ATOM   9082  C  CE1   . HIS D  1 240  ? 184.401 176.310 164.944 1.00 104.61 ? 234  HIS C CE1   1 
ATOM   9083  N  NE2   . HIS D  1 240  ? 183.631 177.268 164.463 1.00 104.61 ? 234  HIS C NE2   1 
ATOM   9084  N  N     . GLN D  1 241  ? 182.271 177.798 168.103 1.00 104.32 ? 235  GLN C N     1 
ATOM   9085  C  CA    . GLN D  1 241  ? 182.313 179.187 168.528 1.00 104.32 ? 235  GLN C CA    1 
ATOM   9086  C  C     . GLN D  1 241  ? 183.067 180.007 167.494 1.00 104.32 ? 235  GLN C C     1 
ATOM   9087  O  O     . GLN D  1 241  ? 184.240 179.735 167.221 1.00 104.32 ? 235  GLN C O     1 
ATOM   9088  C  CB    . GLN D  1 241  ? 182.996 179.293 169.888 1.00 104.32 ? 235  GLN C CB    1 
ATOM   9089  C  CG    . GLN D  1 241  ? 182.295 178.523 170.985 1.00 104.32 ? 235  GLN C CG    1 
ATOM   9090  C  CD    . GLN D  1 241  ? 183.052 178.563 172.289 1.00 104.32 ? 235  GLN C CD    1 
ATOM   9091  O  OE1   . GLN D  1 241  ? 184.135 179.136 172.370 1.00 104.32 ? 235  GLN C OE1   1 
ATOM   9092  N  NE2   . GLN D  1 241  ? 182.491 177.944 173.318 1.00 104.32 ? 235  GLN C NE2   1 
ATOM   9093  N  N     . VAL D  1 242  ? 182.401 181.007 166.926 1.00 98.61  ? 236  VAL C N     1 
ATOM   9094  C  CA    . VAL D  1 242  ? 183.014 181.884 165.939 1.00 98.61  ? 236  VAL C CA    1 
ATOM   9095  C  C     . VAL D  1 242  ? 182.893 183.312 166.433 1.00 98.61  ? 236  VAL C C     1 
ATOM   9096  O  O     . VAL D  1 242  ? 181.781 183.815 166.624 1.00 98.61  ? 236  VAL C O     1 
ATOM   9097  C  CB    . VAL D  1 242  ? 182.373 181.746 164.554 1.00 98.61  ? 236  VAL C CB    1 
ATOM   9098  C  CG1   . VAL D  1 242  ? 182.997 182.746 163.609 1.00 98.61  ? 236  VAL C CG1   1 
ATOM   9099  C  CG2   . VAL D  1 242  ? 182.555 180.348 164.035 1.00 98.61  ? 236  VAL C CG2   1 
ATOM   9100  N  N     . ASP D  1 243  ? 184.031 183.964 166.629 1.00 105.97 ? 237  ASP C N     1 
ATOM   9101  C  CA    . ASP D  1 243  ? 184.041 185.347 167.082 1.00 105.97 ? 237  ASP C CA    1 
ATOM   9102  C  C     . ASP D  1 243  ? 183.549 186.242 165.958 1.00 105.97 ? 237  ASP C C     1 
ATOM   9103  O  O     . ASP D  1 243  ? 184.279 186.510 164.999 1.00 105.97 ? 237  ASP C O     1 
ATOM   9104  C  CB    . ASP D  1 243  ? 185.445 185.736 167.528 1.00 105.97 ? 237  ASP C CB    1 
ATOM   9105  C  CG    . ASP D  1 243  ? 185.875 185.008 168.778 1.00 105.97 ? 237  ASP C CG    1 
ATOM   9106  O  OD1   . ASP D  1 243  ? 184.998 184.674 169.596 1.00 105.97 ? 237  ASP C OD1   1 
ATOM   9107  O  OD2   . ASP D  1 243  ? 187.086 184.764 168.945 1.00 105.97 ? 237  ASP C OD2   1 
ATOM   9108  N  N     . ILE D  1 244  ? 182.307 186.698 166.063 1.00 93.61  ? 238  ILE C N     1 
ATOM   9109  C  CA    . ILE D  1 244  ? 181.731 187.558 165.040 1.00 93.61  ? 238  ILE C CA    1 
ATOM   9110  C  C     . ILE D  1 244  ? 182.103 189.002 165.359 1.00 93.61  ? 238  ILE C C     1 
ATOM   9111  O  O     . ILE D  1 244  ? 181.786 189.508 166.443 1.00 93.61  ? 238  ILE C O     1 
ATOM   9112  C  CB    . ILE D  1 244  ? 180.214 187.336 164.928 1.00 93.61  ? 238  ILE C CB    1 
ATOM   9113  C  CG1   . ILE D  1 244  ? 179.623 188.175 163.801 1.00 93.61  ? 238  ILE C CG1   1 
ATOM   9114  C  CG2   . ILE D  1 244  ? 179.506 187.565 166.252 1.00 93.61  ? 238  ILE C CG2   1 
ATOM   9115  C  CD1   . ILE D  1 244  ? 178.235 187.752 163.430 1.00 93.61  ? 238  ILE C CD1   1 
ATOM   9116  N  N     . PRO D  1 245  ? 182.799 189.688 164.457 1.00 90.15  ? 239  PRO C N     1 
ATOM   9117  C  CA    . PRO D  1 245  ? 183.370 190.992 164.803 1.00 90.15  ? 239  PRO C CA    1 
ATOM   9118  C  C     . PRO D  1 245  ? 182.331 192.096 164.799 1.00 90.15  ? 239  PRO C C     1 
ATOM   9119  O  O     . PRO D  1 245  ? 181.496 192.186 163.897 1.00 90.15  ? 239  PRO C O     1 
ATOM   9120  C  CB    . PRO D  1 245  ? 184.416 191.218 163.707 1.00 90.15  ? 239  PRO C CB    1 
ATOM   9121  C  CG    . PRO D  1 245  ? 183.900 190.447 162.552 1.00 90.15  ? 239  PRO C CG    1 
ATOM   9122  C  CD    . PRO D  1 245  ? 183.217 189.236 163.120 1.00 90.15  ? 239  PRO C CD    1 
ATOM   9123  N  N     . MET D  1 246  ? 182.398 192.949 165.815 1.00 91.40  ? 240  MET C N     1 
ATOM   9124  C  CA    . MET D  1 246  ? 181.538 194.118 165.845 1.00 91.40  ? 240  MET C CA    1 
ATOM   9125  C  C     . MET D  1 246  ? 182.015 195.138 164.824 1.00 91.40  ? 240  MET C C     1 
ATOM   9126  O  O     . MET D  1 246  ? 183.213 195.294 164.577 1.00 91.40  ? 240  MET C O     1 
ATOM   9127  C  CB    . MET D  1 246  ? 181.512 194.756 167.232 1.00 91.40  ? 240  MET C CB    1 
ATOM   9128  C  CG    . MET D  1 246  ? 182.824 195.381 167.660 1.00 91.40  ? 240  MET C CG    1 
ATOM   9129  S  SD    . MET D  1 246  ? 182.695 196.229 169.243 1.00 91.40  ? 240  MET C SD    1 
ATOM   9130  C  CE    . MET D  1 246  ? 181.754 197.670 168.770 1.00 91.40  ? 240  MET C CE    1 
ATOM   9131  N  N     . GLU D  1 247  ? 181.060 195.833 164.222 1.00 95.85  ? 241  GLU C N     1 
ATOM   9132  C  CA    . GLU D  1 247  ? 181.392 196.870 163.260 1.00 95.85  ? 241  GLU C CA    1 
ATOM   9133  C  C     . GLU D  1 247  ? 181.809 198.132 164.000 1.00 95.85  ? 241  GLU C C     1 
ATOM   9134  O  O     . GLU D  1 247  ? 180.966 198.850 164.546 1.00 95.85  ? 241  GLU C O     1 
ATOM   9135  C  CB    . GLU D  1 247  ? 180.210 197.147 162.341 1.00 95.85  ? 241  GLU C CB    1 
ATOM   9136  C  CG    . GLU D  1 247  ? 180.495 198.221 161.323 1.00 95.85  ? 241  GLU C CG    1 
ATOM   9137  C  CD    . GLU D  1 247  ? 181.577 197.817 160.345 1.00 95.85  ? 241  GLU C CD    1 
ATOM   9138  O  OE1   . GLU D  1 247  ? 181.742 196.600 160.104 1.00 95.85  ? 241  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU D  1 247  ? 182.271 198.715 159.821 1.00 95.85  ? 241  GLU C OE2   1 
ATOM   9140  N  N     . ASN D  1 248  ? 183.109 198.401 164.015 1.00 99.16  ? 242  ASN C N     1 
ATOM   9141  C  CA    . ASN D  1 248  ? 183.640 199.580 164.672 1.00 99.16  ? 242  ASN C CA    1 
ATOM   9142  C  C     . ASN D  1 248  ? 184.463 200.374 163.671 1.00 99.16  ? 242  ASN C C     1 
ATOM   9143  O  O     . ASN D  1 248  ? 185.233 199.812 162.891 1.00 99.16  ? 242  ASN C O     1 
ATOM   9144  C  CB    . ASN D  1 248  ? 184.493 199.216 165.887 1.00 99.16  ? 242  ASN C CB    1 
ATOM   9145  C  CG    . ASN D  1 248  ? 184.849 200.419 166.721 1.00 99.16  ? 242  ASN C CG    1 
ATOM   9146  O  OD1   . ASN D  1 248  ? 184.480 201.545 166.390 1.00 99.16  ? 242  ASN C OD1   1 
ATOM   9147  N  ND2   . ASN D  1 248  ? 185.565 200.192 167.814 1.00 99.16  ? 242  ASN C ND2   1 
ATOM   9148  N  N     . GLY D  1 249  ? 184.284 201.696 163.704 1.00 95.73  ? 243  GLY C N     1 
ATOM   9149  C  CA    . GLY D  1 249  ? 184.955 202.552 162.743 1.00 95.73  ? 243  GLY C CA    1 
ATOM   9150  C  C     . GLY D  1 249  ? 186.449 202.323 162.689 1.00 95.73  ? 243  GLY C C     1 
ATOM   9151  O  O     . GLY D  1 249  ? 187.058 202.405 161.621 1.00 95.73  ? 243  GLY C O     1 
ATOM   9152  N  N     . VAL D  1 250  ? 187.058 202.024 163.829 1.00 99.47  ? 244  VAL C N     1 
ATOM   9153  C  CA    . VAL D  1 250  ? 188.453 201.611 163.855 1.00 99.47  ? 244  VAL C CA    1 
ATOM   9154  C  C     . VAL D  1 250  ? 188.595 200.161 163.433 1.00 99.47  ? 244  VAL C C     1 
ATOM   9155  O  O     . VAL D  1 250  ? 189.549 199.784 162.750 1.00 99.47  ? 244  VAL C O     1 
ATOM   9156  C  CB    . VAL D  1 250  ? 189.040 201.848 165.262 1.00 99.47  ? 244  VAL C CB    1 
ATOM   9157  C  CG1   . VAL D  1 250  ? 190.467 201.336 165.339 1.00 99.47  ? 244  VAL C CG1   1 
ATOM   9158  C  CG2   . VAL D  1 250  ? 188.978 203.320 165.619 1.00 99.47  ? 244  VAL C CG2   1 
ATOM   9159  N  N     . GLY D  1 251  ? 187.629 199.337 163.818 1.00 97.49  ? 245  GLY C N     1 
ATOM   9160  C  CA    . GLY D  1 251  ? 187.711 197.902 163.653 1.00 97.49  ? 245  GLY C CA    1 
ATOM   9161  C  C     . GLY D  1 251  ? 187.943 197.158 164.945 1.00 97.49  ? 245  GLY C C     1 
ATOM   9162  O  O     . GLY D  1 251  ? 187.696 195.946 164.997 1.00 97.49  ? 245  GLY C O     1 
ATOM   9163  N  N     . GLY D  1 252  ? 188.392 197.838 165.993 1.00 100.06 ? 246  GLY C N     1 
ATOM   9164  C  CA    . GLY D  1 252  ? 188.636 197.191 167.263 1.00 100.06 ? 246  GLY C CA    1 
ATOM   9165  C  C     . GLY D  1 252  ? 187.352 196.837 167.981 1.00 100.06 ? 246  GLY C C     1 
ATOM   9166  O  O     . GLY D  1 252  ? 186.261 196.995 167.428 1.00 100.06 ? 246  GLY C O     1 
ATOM   9167  N  N     . ASN D  1 253  ? 187.468 196.377 169.225 1.00 101.47 ? 247  ASN C N     1 
ATOM   9168  C  CA    . ASN D  1 253  ? 186.304 195.889 169.949 1.00 101.47 ? 247  ASN C CA    1 
ATOM   9169  C  C     . ASN D  1 253  ? 186.001 196.695 171.202 1.00 101.47 ? 247  ASN C C     1 
ATOM   9170  O  O     . ASN D  1 253  ? 185.083 196.329 171.944 1.00 101.47 ? 247  ASN C O     1 
ATOM   9171  C  CB    . ASN D  1 253  ? 186.490 194.416 170.308 1.00 101.47 ? 247  ASN C CB    1 
ATOM   9172  C  CG    . ASN D  1 253  ? 186.464 193.513 169.091 1.00 101.47 ? 247  ASN C CG    1 
ATOM   9173  O  OD1   . ASN D  1 253  ? 187.482 192.944 168.702 1.00 101.47 ? 247  ASN C OD1   1 
ATOM   9174  N  ND2   . ASN D  1 253  ? 185.290 193.359 168.497 1.00 101.47 ? 247  ASN C ND2   1 
ATOM   9175  N  N     . SER D  1 254  ? 186.731 197.771 171.461 1.00 101.47 ? 248  SER C N     1 
ATOM   9176  C  CA    . SER D  1 254  ? 186.459 198.626 172.603 1.00 101.47 ? 248  SER C CA    1 
ATOM   9177  C  C     . SER D  1 254  ? 185.315 199.573 172.285 1.00 101.47 ? 248  SER C C     1 
ATOM   9178  O  O     . SER D  1 254  ? 185.129 199.974 171.133 1.00 101.47 ? 248  SER C O     1 
ATOM   9179  C  CB    . SER D  1 254  ? 187.701 199.433 172.984 1.00 101.47 ? 248  SER C CB    1 
ATOM   9180  O  OG    . SER D  1 254  ? 188.747 198.582 173.412 1.00 101.47 ? 248  SER C OG    1 
ATOM   9181  N  N     . ILE D  1 255  ? 184.546 199.921 173.311 1.00 102.16 ? 249  ILE C N     1 
ATOM   9182  C  CA    . ILE D  1 255  ? 183.506 200.928 173.210 1.00 102.16 ? 249  ILE C CA    1 
ATOM   9183  C  C     . ILE D  1 255  ? 183.690 201.925 174.346 1.00 102.16 ? 249  ILE C C     1 
ATOM   9184  O  O     . ILE D  1 255  ? 184.574 201.783 175.190 1.00 102.16 ? 249  ILE C O     1 
ATOM   9185  C  CB    . ILE D  1 255  ? 182.091 200.325 173.255 1.00 102.16 ? 249  ILE C CB    1 
ATOM   9186  C  CG1   . ILE D  1 255  ? 181.811 199.780 174.648 1.00 102.16 ? 249  ILE C CG1   1 
ATOM   9187  C  CG2   . ILE D  1 255  ? 181.953 199.216 172.238 1.00 102.16 ? 249  ILE C CG2   1 
ATOM   9188  C  CD1   . ILE D  1 255  ? 180.362 199.490 174.897 1.00 102.16 ? 249  ILE C CD1   1 
ATOM   9189  N  N     . PHE D  1 256  ? 182.830 202.941 174.361 1.00 113.15 ? 250  PHE C N     1 
ATOM   9190  C  CA    . PHE D  1 256  ? 182.788 203.936 175.433 1.00 113.15 ? 250  PHE C CA    1 
ATOM   9191  C  C     . PHE D  1 256  ? 181.320 204.103 175.810 1.00 113.15 ? 250  PHE C C     1 
ATOM   9192  O  O     . PHE D  1 256  ? 180.614 204.944 175.248 1.00 113.15 ? 250  PHE C O     1 
ATOM   9193  C  CB    . PHE D  1 256  ? 183.419 205.247 174.994 1.00 113.15 ? 250  PHE C CB    1 
ATOM   9194  C  CG    . PHE D  1 256  ? 183.325 206.338 176.014 1.00 113.15 ? 250  PHE C CG    1 
ATOM   9195  C  CD1   . PHE D  1 256  ? 184.110 206.318 177.148 1.00 113.15 ? 250  PHE C CD1   1 
ATOM   9196  C  CD2   . PHE D  1 256  ? 182.462 207.398 175.825 1.00 113.15 ? 250  PHE C CD2   1 
ATOM   9197  C  CE1   . PHE D  1 256  ? 184.024 207.332 178.081 1.00 113.15 ? 250  PHE C CE1   1 
ATOM   9198  C  CE2   . PHE D  1 256  ? 182.377 208.409 176.752 1.00 113.15 ? 250  PHE C CE2   1 
ATOM   9199  C  CZ    . PHE D  1 256  ? 183.159 208.376 177.882 1.00 113.15 ? 250  PHE C CZ    1 
ATOM   9200  N  N     . LEU D  1 257  ? 180.867 203.293 176.761 1.00 125.55 ? 251  LEU C N     1 
ATOM   9201  C  CA    . LEU D  1 257  ? 179.455 203.230 177.116 1.00 125.55 ? 251  LEU C CA    1 
ATOM   9202  C  C     . LEU D  1 257  ? 179.160 204.206 178.245 1.00 125.55 ? 251  LEU C C     1 
ATOM   9203  O  O     . LEU D  1 257  ? 179.522 203.963 179.402 1.00 125.55 ? 251  LEU C O     1 
ATOM   9204  C  CB    . LEU D  1 257  ? 179.060 201.814 177.515 1.00 125.55 ? 251  LEU C CB    1 
ATOM   9205  C  CG    . LEU D  1 257  ? 177.591 201.717 177.915 1.00 125.55 ? 251  LEU C CG    1 
ATOM   9206  C  CD1   . LEU D  1 257  ? 176.712 202.183 176.779 1.00 125.55 ? 251  LEU C CD1   1 
ATOM   9207  C  CD2   . LEU D  1 257  ? 177.253 200.291 178.275 1.00 125.55 ? 251  LEU C CD2   1 
ATOM   9208  N  N     . VAL D  1 258  ? 178.489 205.301 177.912 1.00 132.52 ? 252  VAL C N     1 
ATOM   9209  C  CA    . VAL D  1 258  ? 177.931 206.184 178.923 1.00 132.52 ? 252  VAL C CA    1 
ATOM   9210  C  C     . VAL D  1 258  ? 176.422 206.144 178.764 1.00 132.52 ? 252  VAL C C     1 
ATOM   9211  O  O     . VAL D  1 258  ? 175.701 205.727 179.675 1.00 132.52 ? 252  VAL C O     1 
ATOM   9212  C  CB    . VAL D  1 258  ? 178.488 207.609 178.795 1.00 132.52 ? 252  VAL C CB    1 
ATOM   9213  C  CG1   . VAL D  1 258  ? 177.780 208.541 179.754 1.00 132.52 ? 252  VAL C CG1   1 
ATOM   9214  C  CG2   . VAL D  1 258  ? 179.969 207.596 179.077 1.00 132.52 ? 252  VAL C CG2   1 
ATOM   9215  N  N     . ALA D  1 259  ? 175.947 206.547 177.616 1.00 127.45 ? 253  ALA C N     1 
ATOM   9216  C  CA    . ALA D  1 259  ? 174.538 206.331 177.358 1.00 127.45 ? 253  ALA C CA    1 
ATOM   9217  C  C     . ALA D  1 259  ? 174.331 204.978 176.691 1.00 127.45 ? 253  ALA C C     1 
ATOM   9218  O  O     . ALA D  1 259  ? 175.013 204.648 175.719 1.00 127.45 ? 253  ALA C O     1 
ATOM   9219  C  CB    . ALA D  1 259  ? 173.972 207.432 176.459 1.00 127.45 ? 253  ALA C CB    1 
ATOM   9220  N  N     . PRO D  1 260  ? 173.389 204.189 177.198 1.00 120.39 ? 254  PRO C N     1 
ATOM   9221  C  CA    . PRO D  1 260  ? 173.195 202.830 176.676 1.00 120.39 ? 254  PRO C CA    1 
ATOM   9222  C  C     . PRO D  1 260  ? 172.953 202.797 175.178 1.00 120.39 ? 254  PRO C C     1 
ATOM   9223  O  O     . PRO D  1 260  ? 171.920 203.256 174.682 1.00 120.39 ? 254  PRO C O     1 
ATOM   9224  C  CB    . PRO D  1 260  ? 171.979 202.327 177.462 1.00 120.39 ? 254  PRO C CB    1 
ATOM   9225  C  CG    . PRO D  1 260  ? 171.297 203.546 177.953 1.00 120.39 ? 254  PRO C CG    1 
ATOM   9226  C  CD    . PRO D  1 260  ? 172.388 204.539 178.210 1.00 120.39 ? 254  PRO C CD    1 
ATOM   9227  N  N     . LEU D  1 261  ? 173.915 202.232 174.455 1.00 107.85 ? 255  LEU C N     1 
ATOM   9228  C  CA    . LEU D  1 261  ? 173.966 202.319 173.008 1.00 107.85 ? 255  LEU C CA    1 
ATOM   9229  C  C     . LEU D  1 261  ? 173.647 200.968 172.372 1.00 107.85 ? 255  LEU C C     1 
ATOM   9230  O  O     . LEU D  1 261  ? 173.282 200.001 173.043 1.00 107.85 ? 255  LEU C O     1 
ATOM   9231  C  CB    . LEU D  1 261  ? 175.335 202.848 172.585 1.00 107.85 ? 255  LEU C CB    1 
ATOM   9232  C  CG    . LEU D  1 261  ? 176.564 202.077 173.071 1.00 107.85 ? 255  LEU C CG    1 
ATOM   9233  C  CD1   . LEU D  1 261  ? 176.948 200.974 172.105 1.00 107.85 ? 255  LEU C CD1   1 
ATOM   9234  C  CD2   . LEU D  1 261  ? 177.731 203.014 173.318 1.00 107.85 ? 255  LEU C CD2   1 
ATOM   9235  N  N     . ILE D  1 262  ? 173.784 200.901 171.052 1.00 103.37 ? 256  ILE C N     1 
ATOM   9236  C  CA    . ILE D  1 262  ? 173.478 199.702 170.280 1.00 103.37 ? 256  ILE C CA    1 
ATOM   9237  C  C     . ILE D  1 262  ? 174.783 199.103 169.774 1.00 103.37 ? 256  ILE C C     1 
ATOM   9238  O  O     . ILE D  1 262  ? 175.597 199.797 169.155 1.00 103.37 ? 256  ILE C O     1 
ATOM   9239  C  CB    . ILE D  1 262  ? 172.524 199.992 169.114 1.00 103.37 ? 256  ILE C CB    1 
ATOM   9240  C  CG1   . ILE D  1 262  ? 171.130 200.333 169.640 1.00 103.37 ? 256  ILE C CG1   1 
ATOM   9241  C  CG2   . ILE D  1 262  ? 172.473 198.816 168.156 1.00 103.37 ? 256  ILE C CG2   1 
ATOM   9242  C  CD1   . ILE D  1 262  ? 170.178 200.815 168.571 1.00 103.37 ? 256  ILE C CD1   1 
ATOM   9243  N  N     . ILE D  1 263  ? 174.984 197.812 170.046 1.00 109.85 ? 257  ILE C N     1 
ATOM   9244  C  CA    . ILE D  1 263  ? 176.069 197.065 169.423 1.00 109.85 ? 257  ILE C CA    1 
ATOM   9245  C  C     . ILE D  1 263  ? 175.536 196.351 168.192 1.00 109.85 ? 257  ILE C C     1 
ATOM   9246  O  O     . ILE D  1 263  ? 174.409 195.838 168.194 1.00 109.85 ? 257  ILE C O     1 
ATOM   9247  C  CB    . ILE D  1 263  ? 176.671 196.069 170.425 1.00 109.85 ? 257  ILE C CB    1 
ATOM   9248  C  CG1   . ILE D  1 263  ? 177.242 196.816 171.620 1.00 109.85 ? 257  ILE C CG1   1 
ATOM   9249  C  CG2   . ILE D  1 263  ? 177.749 195.237 169.766 1.00 109.85 ? 257  ILE C CG2   1 
ATOM   9250  C  CD1   . ILE D  1 263  ? 178.351 197.766 171.242 1.00 109.85 ? 257  ILE C CD1   1 
ATOM   9251  N  N     . TYR D  1 264  ? 176.333 196.316 167.130 1.00 101.35 ? 258  TYR C N     1 
ATOM   9252  C  CA    . TYR D  1 264  ? 175.829 195.743 165.896 1.00 101.35 ? 258  TYR C CA    1 
ATOM   9253  C  C     . TYR D  1 264  ? 176.946 195.117 165.083 1.00 101.35 ? 258  TYR C C     1 
ATOM   9254  O  O     . TYR D  1 264  ? 178.082 195.594 165.079 1.00 101.35 ? 258  TYR C O     1 
ATOM   9255  C  CB    . TYR D  1 264  ? 175.110 196.792 165.053 1.00 101.35 ? 258  TYR C CB    1 
ATOM   9256  C  CG    . TYR D  1 264  ? 175.983 197.875 164.477 1.00 101.35 ? 258  TYR C CG    1 
ATOM   9257  C  CD1   . TYR D  1 264  ? 176.277 199.013 165.205 1.00 101.35 ? 258  TYR C CD1   1 
ATOM   9258  C  CD2   . TYR D  1 264  ? 176.471 197.780 163.185 1.00 101.35 ? 258  TYR C CD2   1 
ATOM   9259  C  CE1   . TYR D  1 264  ? 177.062 200.015 164.674 1.00 101.35 ? 258  TYR C CE1   1 
ATOM   9260  C  CE2   . TYR D  1 264  ? 177.246 198.777 162.642 1.00 101.35 ? 258  TYR C CE2   1 
ATOM   9261  C  CZ    . TYR D  1 264  ? 177.541 199.893 163.388 1.00 101.35 ? 258  TYR C CZ    1 
ATOM   9262  O  OH    . TYR D  1 264  ? 178.322 200.889 162.850 1.00 101.35 ? 258  TYR C OH    1 
ATOM   9263  N  N     . HIS D  1 265  ? 176.595 194.048 164.380 1.00 96.51  ? 259  HIS C N     1 
ATOM   9264  C  CA    . HIS D  1 265  ? 177.474 193.404 163.422 1.00 96.51  ? 259  HIS C CA    1 
ATOM   9265  C  C     . HIS D  1 265  ? 176.920 193.546 162.015 1.00 96.51  ? 259  HIS C C     1 
ATOM   9266  O  O     . HIS D  1 265  ? 175.740 193.280 161.774 1.00 96.51  ? 259  HIS C O     1 
ATOM   9267  C  CB    . HIS D  1 265  ? 177.653 191.929 163.721 1.00 96.51  ? 259  HIS C CB    1 
ATOM   9268  C  CG    . HIS D  1 265  ? 178.427 191.213 162.666 1.00 96.51  ? 259  HIS C CG    1 
ATOM   9269  N  ND1   . HIS D  1 265  ? 179.795 191.316 162.547 1.00 96.51  ? 259  HIS C ND1   1 
ATOM   9270  C  CD2   . HIS D  1 265  ? 178.017 190.436 161.637 1.00 96.51  ? 259  HIS C CD2   1 
ATOM   9271  C  CE1   . HIS D  1 265  ? 180.199 190.601 161.515 1.00 96.51  ? 259  HIS C CE1   1 
ATOM   9272  N  NE2   . HIS D  1 265  ? 179.139 190.054 160.947 1.00 96.51  ? 259  HIS C NE2   1 
ATOM   9273  N  N     . VAL D  1 266  ? 177.785 193.939 161.088 1.00 93.82  ? 260  VAL C N     1 
ATOM   9274  C  CA    . VAL D  1 266  ? 177.445 193.987 159.672 1.00 93.82  ? 260  VAL C CA    1 
ATOM   9275  C  C     . VAL D  1 266  ? 177.671 192.594 159.101 1.00 93.82  ? 260  VAL C C     1 
ATOM   9276  O  O     . VAL D  1 266  ? 178.768 192.043 159.202 1.00 93.82  ? 260  VAL C O     1 
ATOM   9277  C  CB    . VAL D  1 266  ? 178.279 195.034 158.930 1.00 93.82  ? 260  VAL C CB    1 
ATOM   9278  C  CG1   . VAL D  1 266  ? 177.979 194.987 157.442 1.00 93.82  ? 260  VAL C CG1   1 
ATOM   9279  C  CG2   . VAL D  1 266  ? 177.997 196.413 159.485 1.00 93.82  ? 260  VAL C CG2   1 
ATOM   9280  N  N     . ILE D  1 267  ? 176.634 192.024 158.495 1.00 104.59 ? 261  ILE C N     1 
ATOM   9281  C  CA    . ILE D  1 267  ? 176.680 190.644 158.034 1.00 104.59 ? 261  ILE C CA    1 
ATOM   9282  C  C     . ILE D  1 267  ? 177.326 190.568 156.659 1.00 104.59 ? 261  ILE C C     1 
ATOM   9283  O  O     . ILE D  1 267  ? 176.674 190.824 155.641 1.00 104.59 ? 261  ILE C O     1 
ATOM   9284  C  CB    . ILE D  1 267  ? 175.270 190.038 158.012 1.00 104.59 ? 261  ILE C CB    1 
ATOM   9285  C  CG1   . ILE D  1 267  ? 174.634 190.167 159.389 1.00 104.59 ? 261  ILE C CG1   1 
ATOM   9286  C  CG2   . ILE D  1 267  ? 175.334 188.581 157.617 1.00 104.59 ? 261  ILE C CG2   1 
ATOM   9287  C  CD1   . ILE D  1 267  ? 173.156 189.908 159.392 1.00 104.59 ? 261  ILE C CD1   1 
ATOM   9288  N  N     . ASP D  1 268  ? 178.599 190.199 156.615 1.00 117.33 ? 262  ASP C N     1 
ATOM   9289  C  CA    . ASP D  1 268  ? 179.357 190.109 155.376 1.00 117.33 ? 262  ASP C CA    1 
ATOM   9290  C  C     . ASP D  1 268  ? 179.485 188.652 154.945 1.00 117.33 ? 262  ASP C C     1 
ATOM   9291  O  O     . ASP D  1 268  ? 179.206 187.722 155.707 1.00 117.33 ? 262  ASP C O     1 
ATOM   9292  C  CB    . ASP D  1 268  ? 180.735 190.754 155.541 1.00 117.33 ? 262  ASP C CB    1 
ATOM   9293  N  N     . ALA D  1 269  ? 179.931 188.461 153.702 1.00 113.98 ? 263  ALA C N     1 
ATOM   9294  C  CA    . ALA D  1 269  ? 180.075 187.112 153.168 1.00 113.98 ? 263  ALA C CA    1 
ATOM   9295  C  C     . ALA D  1 269  ? 181.058 186.282 153.983 1.00 113.98 ? 263  ALA C C     1 
ATOM   9296  O  O     . ALA D  1 269  ? 181.089 185.054 153.852 1.00 113.98 ? 263  ALA C O     1 
ATOM   9297  C  CB    . ALA D  1 269  ? 180.513 187.170 151.705 1.00 113.98 ? 263  ALA C CB    1 
ATOM   9298  N  N     . ASN D  1 270  ? 181.873 186.929 154.813 1.00 122.15 ? 264  ASN C N     1 
ATOM   9299  C  CA    . ASN D  1 270  ? 182.721 186.212 155.754 1.00 122.15 ? 264  ASN C CA    1 
ATOM   9300  C  C     . ASN D  1 270  ? 182.025 185.929 157.073 1.00 122.15 ? 264  ASN C C     1 
ATOM   9301  O  O     . ASN D  1 270  ? 182.458 185.030 157.801 1.00 122.15 ? 264  ASN C O     1 
ATOM   9302  C  CB    . ASN D  1 270  ? 184.004 186.999 156.016 1.00 122.15 ? 264  ASN C CB    1 
ATOM   9303  C  CG    . ASN D  1 270  ? 184.888 187.096 154.793 1.00 122.15 ? 264  ASN C CG    1 
ATOM   9304  O  OD1   . ASN D  1 270  ? 185.070 188.172 154.228 1.00 122.15 ? 264  ASN C OD1   1 
ATOM   9305  N  ND2   . ASN D  1 270  ? 185.455 185.967 154.384 1.00 122.15 ? 264  ASN C ND2   1 
ATOM   9306  N  N     . SER D  1 271  ? 180.976 186.662 157.398 1.00 119.31 ? 265  SER C N     1 
ATOM   9307  C  CA    . SER D  1 271  ? 180.248 186.351 158.617 1.00 119.31 ? 265  SER C CA    1 
ATOM   9308  C  C     . SER D  1 271  ? 179.488 185.039 158.452 1.00 119.31 ? 265  SER C C     1 
ATOM   9309  O  O     . SER D  1 271  ? 178.906 184.791 157.394 1.00 119.31 ? 265  SER C O     1 
ATOM   9310  C  CB    . SER D  1 271  ? 179.266 187.465 158.954 1.00 119.31 ? 265  SER C CB    1 
ATOM   9311  O  OG    . SER D  1 271  ? 178.499 187.118 160.092 1.00 119.31 ? 265  SER C OG    1 
ATOM   9312  N  N     . PRO D  1 272  ? 179.484 184.183 159.470 1.00 114.39 ? 266  PRO C N     1 
ATOM   9313  C  CA    . PRO D  1 272  ? 178.699 182.946 159.372 1.00 114.39 ? 266  PRO C CA    1 
ATOM   9314  C  C     . PRO D  1 272  ? 177.220 183.208 159.204 1.00 114.39 ? 266  PRO C C     1 
ATOM   9315  O  O     . PRO D  1 272  ? 176.509 182.374 158.627 1.00 114.39 ? 266  PRO C O     1 
ATOM   9316  C  CB    . PRO D  1 272  ? 178.999 182.233 160.695 1.00 114.39 ? 266  PRO C CB    1 
ATOM   9317  C  CG    . PRO D  1 272  ? 180.286 182.815 161.153 1.00 114.39 ? 266  PRO C CG    1 
ATOM   9318  C  CD    . PRO D  1 272  ? 180.258 184.246 160.719 1.00 114.39 ? 266  PRO C CD    1 
ATOM   9319  N  N     . LEU D  1 273  ? 176.734 184.347 159.682 1.00 110.64 ? 267  LEU C N     1 
ATOM   9320  C  CA    . LEU D  1 273  ? 175.337 184.727 159.558 1.00 110.64 ? 267  LEU C CA    1 
ATOM   9321  C  C     . LEU D  1 273  ? 174.972 185.162 158.155 1.00 110.64 ? 267  LEU C C     1 
ATOM   9322  O  O     . LEU D  1 273  ? 173.851 185.628 157.926 1.00 110.64 ? 267  LEU C O     1 
ATOM   9323  C  CB    . LEU D  1 273  ? 175.012 185.848 160.543 1.00 110.64 ? 267  LEU C CB    1 
ATOM   9324  C  CG    . LEU D  1 273  ? 174.785 185.453 161.999 1.00 110.64 ? 267  LEU C CG    1 
ATOM   9325  C  CD1   . LEU D  1 273  ? 176.082 185.023 162.660 1.00 110.64 ? 267  LEU C CD1   1 
ATOM   9326  C  CD2   . LEU D  1 273  ? 174.160 186.613 162.755 1.00 110.64 ? 267  LEU C CD2   1 
ATOM   9327  N  N     . TYR D  1 274  ? 175.895 185.033 157.206 1.00 118.15 ? 268  TYR C N     1 
ATOM   9328  C  CA    . TYR D  1 274  ? 175.614 185.439 155.840 1.00 118.15 ? 268  TYR C CA    1 
ATOM   9329  C  C     . TYR D  1 274  ? 174.719 184.446 155.114 1.00 118.15 ? 268  TYR C C     1 
ATOM   9330  O  O     . TYR D  1 274  ? 174.247 184.750 154.014 1.00 118.15 ? 268  TYR C O     1 
ATOM   9331  C  CB    . TYR D  1 274  ? 176.931 185.633 155.097 1.00 118.15 ? 268  TYR C CB    1 
ATOM   9332  C  CG    . TYR D  1 274  ? 176.787 186.236 153.733 1.00 118.15 ? 268  TYR C CG    1 
ATOM   9333  C  CD1   . TYR D  1 274  ? 176.507 187.581 153.581 1.00 118.15 ? 268  TYR C CD1   1 
ATOM   9334  C  CD2   . TYR D  1 274  ? 176.945 185.461 152.597 1.00 118.15 ? 268  TYR C CD2   1 
ATOM   9335  C  CE1   . TYR D  1 274  ? 176.376 188.135 152.338 1.00 118.15 ? 268  TYR C CE1   1 
ATOM   9336  C  CE2   . TYR D  1 274  ? 176.819 186.004 151.353 1.00 118.15 ? 268  TYR C CE2   1 
ATOM   9337  C  CZ    . TYR D  1 274  ? 176.533 187.340 151.226 1.00 118.15 ? 268  TYR C CZ    1 
ATOM   9338  O  OH    . TYR D  1 274  ? 176.408 187.873 149.970 1.00 118.15 ? 268  TYR C OH    1 
ATOM   9339  N  N     . ASP D  1 275  ? 174.468 183.277 155.702 1.00 121.02 ? 269  ASP C N     1 
ATOM   9340  C  CA    . ASP D  1 275  ? 173.486 182.334 155.182 1.00 121.02 ? 269  ASP C CA    1 
ATOM   9341  C  C     . ASP D  1 275  ? 172.177 182.392 155.959 1.00 121.02 ? 269  ASP C C     1 
ATOM   9342  O  O     . ASP D  1 275  ? 171.246 181.637 155.661 1.00 121.02 ? 269  ASP C O     1 
ATOM   9343  C  CB    . ASP D  1 275  ? 174.044 180.913 155.198 1.00 121.02 ? 269  ASP C CB    1 
ATOM   9344  C  CG    . ASP D  1 275  ? 175.111 180.696 154.150 1.00 121.02 ? 269  ASP C CG    1 
ATOM   9345  O  OD1   . ASP D  1 275  ? 175.064 181.379 153.106 1.00 121.02 ? 269  ASP C OD1   1 
ATOM   9346  O  OD2   . ASP D  1 275  ? 175.990 179.839 154.364 1.00 121.02 ? 269  ASP C OD2   1 
ATOM   9347  N  N     . LEU D  1 276  ? 172.088 183.277 156.945 1.00 125.31 ? 270  LEU C N     1 
ATOM   9348  C  CA    . LEU D  1 276  ? 170.877 183.402 157.741 1.00 125.31 ? 270  LEU C CA    1 
ATOM   9349  C  C     . LEU D  1 276  ? 169.779 184.080 156.935 1.00 125.31 ? 270  LEU C C     1 
ATOM   9350  O  O     . LEU D  1 276  ? 170.044 184.929 156.081 1.00 125.31 ? 270  LEU C O     1 
ATOM   9351  C  CB    . LEU D  1 276  ? 171.163 184.189 159.019 1.00 125.31 ? 270  LEU C CB    1 
ATOM   9352  C  CG    . LEU D  1 276  ? 170.068 184.278 160.081 1.00 125.31 ? 270  LEU C CG    1 
ATOM   9353  C  CD1   . LEU D  1 276  ? 170.708 184.368 161.447 1.00 125.31 ? 270  LEU C CD1   1 
ATOM   9354  C  CD2   . LEU D  1 276  ? 169.163 185.480 159.857 1.00 125.31 ? 270  LEU C CD2   1 
ATOM   9355  N  N     . ALA D  1 277  ? 168.542 183.692 157.214 1.00 121.89 ? 271  ALA C N     1 
ATOM   9356  C  CA    . ALA D  1 277  ? 167.351 184.247 156.597 1.00 121.89 ? 271  ALA C CA    1 
ATOM   9357  C  C     . ALA D  1 277  ? 166.319 184.465 157.688 1.00 121.89 ? 271  ALA C C     1 
ATOM   9358  O  O     . ALA D  1 277  ? 166.385 183.827 158.743 1.00 121.89 ? 271  ALA C O     1 
ATOM   9359  C  CB    . ALA D  1 277  ? 166.779 183.305 155.529 1.00 121.89 ? 271  ALA C CB    1 
ATOM   9360  N  N     . PRO D  1 278  ? 165.359 185.355 157.471 1.00 120.14 ? 272  PRO C N     1 
ATOM   9361  C  CA    . PRO D  1 278  ? 164.212 185.413 158.373 1.00 120.14 ? 272  PRO C CA    1 
ATOM   9362  C  C     . PRO D  1 278  ? 163.461 184.098 158.327 1.00 120.14 ? 272  PRO C C     1 
ATOM   9363  O  O     . PRO D  1 278  ? 163.571 183.317 157.380 1.00 120.14 ? 272  PRO C O     1 
ATOM   9364  C  CB    . PRO D  1 278  ? 163.367 186.557 157.818 1.00 120.14 ? 272  PRO C CB    1 
ATOM   9365  C  CG    . PRO D  1 278  ? 163.731 186.619 156.401 1.00 120.14 ? 272  PRO C CG    1 
ATOM   9366  C  CD    . PRO D  1 278  ? 165.181 186.249 156.317 1.00 120.14 ? 272  PRO C CD    1 
ATOM   9367  N  N     . SER D  1 279  ? 162.740 183.829 159.412 1.00 154.87 ? 273  SER C N     1 
ATOM   9368  C  CA    . SER D  1 279  ? 161.899 182.644 159.551 1.00 154.87 ? 273  SER C CA    1 
ATOM   9369  C  C     . SER D  1 279  ? 162.765 181.398 159.673 1.00 154.87 ? 273  SER C C     1 
ATOM   9370  O  O     . SER D  1 279  ? 162.261 180.305 159.954 1.00 154.87 ? 273  SER C O     1 
ATOM   9371  C  CB    . SER D  1 279  ? 160.918 182.511 158.380 1.00 154.87 ? 273  SER C CB    1 
ATOM   9372  O  OG    . SER D  1 279  ? 161.597 182.209 157.173 1.00 154.87 ? 273  SER C OG    1 
ATOM   9373  N  N     . ASP D  1 280  ? 164.073 181.554 159.468 1.00 143.42 ? 274  ASP C N     1 
ATOM   9374  C  CA    . ASP D  1 280  ? 165.007 180.516 159.873 1.00 143.42 ? 274  ASP C CA    1 
ATOM   9375  C  C     . ASP D  1 280  ? 165.262 180.606 161.366 1.00 143.42 ? 274  ASP C C     1 
ATOM   9376  O  O     . ASP D  1 280  ? 165.485 179.587 162.028 1.00 143.42 ? 274  ASP C O     1 
ATOM   9377  C  CB    . ASP D  1 280  ? 166.310 180.652 159.078 1.00 143.42 ? 274  ASP C CB    1 
ATOM   9378  C  CG    . ASP D  1 280  ? 167.210 179.437 159.209 1.00 143.42 ? 274  ASP C CG    1 
ATOM   9379  O  OD1   . ASP D  1 280  ? 166.837 178.484 159.922 1.00 143.42 ? 274  ASP C OD1   1 
ATOM   9380  O  OD2   . ASP D  1 280  ? 168.296 179.436 158.589 1.00 143.42 ? 274  ASP C OD2   1 
ATOM   9381  N  N     . LEU D  1 281  ? 165.201 181.816 161.913 1.00 127.96 ? 275  LEU C N     1 
ATOM   9382  C  CA    . LEU D  1 281  ? 165.324 182.024 163.344 1.00 127.96 ? 275  LEU C CA    1 
ATOM   9383  C  C     . LEU D  1 281  ? 164.061 181.550 164.049 1.00 127.96 ? 275  LEU C C     1 
ATOM   9384  O  O     . LEU D  1 281  ? 162.946 181.847 163.610 1.00 127.96 ? 275  LEU C O     1 
ATOM   9385  C  CB    . LEU D  1 281  ? 165.599 183.499 163.639 1.00 127.96 ? 275  LEU C CB    1 
ATOM   9386  C  CG    . LEU D  1 281  ? 164.615 184.575 163.168 1.00 127.96 ? 275  LEU C CG    1 
ATOM   9387  C  CD1   . LEU D  1 281  ? 163.537 184.871 164.202 1.00 127.96 ? 275  LEU C CD1   1 
ATOM   9388  C  CD2   . LEU D  1 281  ? 165.357 185.845 162.789 1.00 127.96 ? 275  LEU C CD2   1 
ATOM   9389  N  N     . HIS D  1 282  ? 164.246 180.791 165.122 1.00 140.16 ? 276  HIS C N     1 
ATOM   9390  C  CA    . HIS D  1 282  ? 163.168 180.277 165.958 1.00 140.16 ? 276  HIS C CA    1 
ATOM   9391  C  C     . HIS D  1 282  ? 163.805 179.524 167.116 1.00 140.16 ? 276  HIS C C     1 
ATOM   9392  O  O     . HIS D  1 282  ? 164.962 179.103 167.045 1.00 140.16 ? 276  HIS C O     1 
ATOM   9393  C  CB    . HIS D  1 282  ? 162.207 179.381 165.172 1.00 140.16 ? 276  HIS C CB    1 
ATOM   9394  C  CG    . HIS D  1 282  ? 162.861 178.202 164.529 1.00 140.16 ? 276  HIS C CG    1 
ATOM   9395  N  ND1   . HIS D  1 282  ? 163.493 178.279 163.307 1.00 140.16 ? 276  HIS C ND1   1 
ATOM   9396  C  CD2   . HIS D  1 282  ? 162.979 176.915 164.934 1.00 140.16 ? 276  HIS C CD2   1 
ATOM   9397  C  CE1   . HIS D  1 282  ? 163.963 177.088 162.981 1.00 140.16 ? 276  HIS C CE1   1 
ATOM   9398  N  NE2   . HIS D  1 282  ? 163.674 176.245 163.957 1.00 140.16 ? 276  HIS C NE2   1 
ATOM   9399  N  N     . HIS D  1 283  ? 163.028 179.340 168.184 1.00 151.41 ? 277  HIS C N     1 
ATOM   9400  C  CA    . HIS D  1 283  ? 163.589 178.745 169.391 1.00 151.41 ? 277  HIS C CA    1 
ATOM   9401  C  C     . HIS D  1 283  ? 163.963 177.281 169.208 1.00 151.41 ? 277  HIS C C     1 
ATOM   9402  O  O     . HIS D  1 283  ? 164.435 176.652 170.160 1.00 151.41 ? 277  HIS C O     1 
ATOM   9403  C  CB    . HIS D  1 283  ? 162.620 178.876 170.567 1.00 151.41 ? 277  HIS C CB    1 
ATOM   9404  C  CG    . HIS D  1 283  ? 163.219 178.478 171.880 1.00 151.41 ? 277  HIS C CG    1 
ATOM   9405  N  ND1   . HIS D  1 283  ? 163.281 177.168 172.300 1.00 151.41 ? 277  HIS C ND1   1 
ATOM   9406  C  CD2   . HIS D  1 283  ? 163.799 179.214 172.856 1.00 151.41 ? 277  HIS C CD2   1 
ATOM   9407  C  CE1   . HIS D  1 283  ? 163.868 177.113 173.482 1.00 151.41 ? 277  HIS C CE1   1 
ATOM   9408  N  NE2   . HIS D  1 283  ? 164.189 178.342 173.843 1.00 151.41 ? 277  HIS C NE2   1 
ATOM   9409  N  N     . HIS D  1 284  ? 163.756 176.710 168.030 1.00 146.85 ? 278  HIS C N     1 
ATOM   9410  C  CA    . HIS D  1 284  ? 164.168 175.339 167.760 1.00 146.85 ? 278  HIS C CA    1 
ATOM   9411  C  C     . HIS D  1 284  ? 165.199 175.287 166.639 1.00 146.85 ? 278  HIS C C     1 
ATOM   9412  O  O     . HIS D  1 284  ? 165.499 174.225 166.089 1.00 146.85 ? 278  HIS C O     1 
ATOM   9413  C  CB    . HIS D  1 284  ? 162.953 174.476 167.455 1.00 146.85 ? 278  HIS C CB    1 
ATOM   9414  C  CG    . HIS D  1 284  ? 162.067 174.269 168.642 1.00 146.85 ? 278  HIS C CG    1 
ATOM   9415  N  ND1   . HIS D  1 284  ? 160.812 173.710 168.552 1.00 146.85 ? 278  HIS C ND1   1 
ATOM   9416  C  CD2   . HIS D  1 284  ? 162.263 174.549 169.953 1.00 146.85 ? 278  HIS C CD2   1 
ATOM   9417  C  CE1   . HIS D  1 284  ? 160.270 173.657 169.755 1.00 146.85 ? 278  HIS C CE1   1 
ATOM   9418  N  NE2   . HIS D  1 284  ? 161.131 174.157 170.623 1.00 146.85 ? 278  HIS C NE2   1 
ATOM   9419  N  N     . GLN D  1 285  ? 165.759 176.444 166.305 1.00 136.99 ? 279  GLN C N     1 
ATOM   9420  C  CA    . GLN D  1 285  ? 166.845 176.554 165.343 1.00 136.99 ? 279  GLN C CA    1 
ATOM   9421  C  C     . GLN D  1 285  ? 168.152 176.595 166.111 1.00 136.99 ? 279  GLN C C     1 
ATOM   9422  O  O     . GLN D  1 285  ? 168.348 177.477 166.957 1.00 136.99 ? 279  GLN C O     1 
ATOM   9423  C  CB    . GLN D  1 285  ? 166.707 177.807 164.484 1.00 136.99 ? 279  GLN C CB    1 
ATOM   9424  C  CG    . GLN D  1 285  ? 167.746 177.886 163.390 1.00 136.99 ? 279  GLN C CG    1 
ATOM   9425  C  CD    . GLN D  1 285  ? 167.615 176.744 162.408 1.00 136.99 ? 279  GLN C CD    1 
ATOM   9426  O  OE1   . GLN D  1 285  ? 168.382 175.785 162.451 1.00 136.99 ? 279  GLN C OE1   1 
ATOM   9427  N  NE2   . GLN D  1 285  ? 166.641 176.845 161.512 1.00 136.99 ? 279  GLN C NE2   1 
ATOM   9428  N  N     . ASP D  1 286  ? 169.049 175.658 165.809 1.00 135.17 ? 280  ASP C N     1 
ATOM   9429  C  CA    . ASP D  1 286  ? 170.312 175.626 166.528 1.00 135.17 ? 280  ASP C CA    1 
ATOM   9430  C  C     . ASP D  1 286  ? 171.099 176.872 166.152 1.00 135.17 ? 280  ASP C C     1 
ATOM   9431  O  O     . ASP D  1 286  ? 171.650 176.975 165.046 1.00 135.17 ? 280  ASP C O     1 
ATOM   9432  C  CB    . ASP D  1 286  ? 171.106 174.367 166.204 1.00 135.17 ? 280  ASP C CB    1 
ATOM   9433  C  CG    . ASP D  1 286  ? 172.406 174.291 166.965 1.00 135.17 ? 280  ASP C CG    1 
ATOM   9434  O  OD1   . ASP D  1 286  ? 172.367 174.100 168.196 1.00 135.17 ? 280  ASP C OD1   1 
ATOM   9435  O  OD2   . ASP D  1 286  ? 173.475 174.421 166.329 1.00 135.17 ? 280  ASP C OD2   1 
ATOM   9436  N  N     . LEU D  1 287  ? 171.132 177.834 167.067 1.00 125.20 ? 281  LEU C N     1 
ATOM   9437  C  CA    . LEU D  1 287  ? 171.714 179.134 166.788 1.00 125.20 ? 281  LEU C CA    1 
ATOM   9438  C  C     . LEU D  1 287  ? 171.764 179.926 168.077 1.00 125.20 ? 281  LEU C C     1 
ATOM   9439  O  O     . LEU D  1 287  ? 170.823 179.884 168.871 1.00 125.20 ? 281  LEU C O     1 
ATOM   9440  C  CB    . LEU D  1 287  ? 170.890 179.888 165.743 1.00 125.20 ? 281  LEU C CB    1 
ATOM   9441  C  CG    . LEU D  1 287  ? 171.474 181.232 165.332 1.00 125.20 ? 281  LEU C CG    1 
ATOM   9442  C  CD1   . LEU D  1 287  ? 172.799 180.981 164.647 1.00 125.20 ? 281  LEU C CD1   1 
ATOM   9443  C  CD2   . LEU D  1 287  ? 170.508 181.988 164.428 1.00 125.20 ? 281  LEU C CD2   1 
ATOM   9444  N  N     . GLU D  1 288  ? 172.858 180.657 168.265 1.00 121.72 ? 282  GLU C N     1 
ATOM   9445  C  CA    . GLU D  1 288  ? 173.042 181.472 169.451 1.00 121.72 ? 282  GLU C CA    1 
ATOM   9446  C  C     . GLU D  1 288  ? 174.280 182.327 169.254 1.00 121.72 ? 282  GLU C C     1 
ATOM   9447  O  O     . GLU D  1 288  ? 175.284 181.880 168.694 1.00 121.72 ? 282  GLU C O     1 
ATOM   9448  C  CB    . GLU D  1 288  ? 173.178 180.613 170.708 1.00 121.72 ? 282  GLU C CB    1 
ATOM   9449  C  CG    . GLU D  1 288  ? 173.278 181.397 171.993 1.00 121.72 ? 282  GLU C CG    1 
ATOM   9450  C  CD    . GLU D  1 288  ? 173.345 180.489 173.202 1.00 121.72 ? 282  GLU C CD    1 
ATOM   9451  O  OE1   . GLU D  1 288  ? 173.312 179.257 173.013 1.00 121.72 ? 282  GLU C OE1   1 
ATOM   9452  O  OE2   . GLU D  1 288  ? 173.438 180.996 174.336 1.00 121.72 ? 282  GLU C OE2   1 
ATOM   9453  N  N     . ILE D  1 289  ? 174.198 183.570 169.721 1.00 115.21 ? 283  ILE C N     1 
ATOM   9454  C  CA    . ILE D  1 289  ? 175.288 184.522 169.562 1.00 115.21 ? 283  ILE C CA    1 
ATOM   9455  C  C     . ILE D  1 289  ? 175.673 185.026 170.943 1.00 115.21 ? 283  ILE C C     1 
ATOM   9456  O  O     . ILE D  1 289  ? 174.900 185.745 171.582 1.00 115.21 ? 283  ILE C O     1 
ATOM   9457  C  CB    . ILE D  1 289  ? 174.896 185.697 168.657 1.00 115.21 ? 283  ILE C CB    1 
ATOM   9458  C  CG1   . ILE D  1 289  ? 174.478 185.184 167.287 1.00 115.21 ? 283  ILE C CG1   1 
ATOM   9459  C  CG2   . ILE D  1 289  ? 176.065 186.650 168.519 1.00 115.21 ? 283  ILE C CG2   1 
ATOM   9460  C  CD1   . ILE D  1 289  ? 173.813 186.236 166.432 1.00 115.21 ? 283  ILE C CD1   1 
ATOM   9461  N  N     . ILE D  1 290  ? 176.864 184.676 171.391 1.00 102.98 ? 284  ILE C N     1 
ATOM   9462  C  CA    . ILE D  1 290  ? 177.297 184.941 172.753 1.00 102.98 ? 284  ILE C CA    1 
ATOM   9463  C  C     . ILE D  1 290  ? 177.902 186.331 172.803 1.00 102.98 ? 284  ILE C C     1 
ATOM   9464  O  O     . ILE D  1 290  ? 178.802 186.656 172.019 1.00 102.98 ? 284  ILE C O     1 
ATOM   9465  C  CB    . ILE D  1 290  ? 178.305 183.876 173.217 1.00 102.98 ? 284  ILE C CB    1 
ATOM   9466  C  CG1   . ILE D  1 290  ? 177.753 182.487 172.935 1.00 102.98 ? 284  ILE C CG1   1 
ATOM   9467  C  CG2   . ILE D  1 290  ? 178.574 184.013 174.696 1.00 102.98 ? 284  ILE C CG2   1 
ATOM   9468  C  CD1   . ILE D  1 290  ? 176.445 182.216 173.611 1.00 102.98 ? 284  ILE C CD1   1 
ATOM   9469  N  N     . VAL D  1 291  ? 177.419 187.154 173.727 1.00 99.69  ? 285  VAL C N     1 
ATOM   9470  C  CA    . VAL D  1 291  ? 177.833 188.546 173.822 1.00 99.69  ? 285  VAL C CA    1 
ATOM   9471  C  C     . VAL D  1 291  ? 178.620 188.728 175.108 1.00 99.69  ? 285  VAL C C     1 
ATOM   9472  O  O     . VAL D  1 291  ? 178.108 188.456 176.200 1.00 99.69  ? 285  VAL C O     1 
ATOM   9473  C  CB    . VAL D  1 291  ? 176.629 189.501 173.781 1.00 99.69  ? 285  VAL C CB    1 
ATOM   9474  C  CG1   . VAL D  1 291  ? 177.090 190.936 173.896 1.00 99.69  ? 285  VAL C CG1   1 
ATOM   9475  C  CG2   . VAL D  1 291  ? 175.846 189.289 172.507 1.00 99.69  ? 285  VAL C CG2   1 
ATOM   9476  N  N     . ILE D  1 292  ? 179.855 189.197 174.977 1.00 92.92  ? 286  ILE C N     1 
ATOM   9477  C  CA    . ILE D  1 292  ? 180.789 189.337 176.084 1.00 92.92  ? 286  ILE C CA    1 
ATOM   9478  C  C     . ILE D  1 292  ? 181.153 190.803 176.250 1.00 92.92  ? 286  ILE C C     1 
ATOM   9479  O  O     . ILE D  1 292  ? 181.479 191.489 175.275 1.00 92.92  ? 286  ILE C O     1 
ATOM   9480  C  CB    . ILE D  1 292  ? 182.049 188.480 175.860 1.00 92.92  ? 286  ILE C CB    1 
ATOM   9481  C  CG1   . ILE D  1 292  ? 181.741 187.005 176.103 1.00 92.92  ? 286  ILE C CG1   1 
ATOM   9482  C  CG2   . ILE D  1 292  ? 183.202 188.978 176.696 1.00 92.92  ? 286  ILE C CG2   1 
ATOM   9483  C  CD1   . ILE D  1 292  ? 181.312 186.266 174.871 1.00 92.92  ? 286  ILE C CD1   1 
ATOM   9484  N  N     . LEU D  1 293  ? 181.101 191.276 177.490 1.00 98.75  ? 287  LEU C N     1 
ATOM   9485  C  CA    . LEU D  1 293  ? 181.450 192.647 177.840 1.00 98.75  ? 287  LEU C CA    1 
ATOM   9486  C  C     . LEU D  1 293  ? 182.507 192.597 178.932 1.00 98.75  ? 287  LEU C C     1 
ATOM   9487  O  O     . LEU D  1 293  ? 182.269 192.036 180.004 1.00 98.75  ? 287  LEU C O     1 
ATOM   9488  C  CB    . LEU D  1 293  ? 180.224 193.420 178.307 1.00 98.75  ? 287  LEU C CB    1 
ATOM   9489  C  CG    . LEU D  1 293  ? 180.479 194.851 178.756 1.00 98.75  ? 287  LEU C CG    1 
ATOM   9490  C  CD1   . LEU D  1 293  ? 181.042 195.670 177.622 1.00 98.75  ? 287  LEU C CD1   1 
ATOM   9491  C  CD2   . LEU D  1 293  ? 179.188 195.454 179.259 1.00 98.75  ? 287  LEU C CD2   1 
ATOM   9492  N  N     . GLU D  1 294  ? 183.671 193.178 178.661 1.00 109.46 ? 288  GLU C N     1 
ATOM   9493  C  CA    . GLU D  1 294  ? 184.819 193.090 179.553 1.00 109.46 ? 288  GLU C CA    1 
ATOM   9494  C  C     . GLU D  1 294  ? 185.450 194.465 179.701 1.00 109.46 ? 288  GLU C C     1 
ATOM   9495  O  O     . GLU D  1 294  ? 185.773 195.114 178.701 1.00 109.46 ? 288  GLU C O     1 
ATOM   9496  C  CB    . GLU D  1 294  ? 185.832 192.081 179.022 1.00 109.46 ? 288  GLU C CB    1 
ATOM   9497  C  CG    . GLU D  1 294  ? 185.294 190.668 179.018 1.00 109.46 ? 288  GLU C CG    1 
ATOM   9498  C  CD    . GLU D  1 294  ? 186.264 189.670 178.436 1.00 109.46 ? 288  GLU C CD    1 
ATOM   9499  O  OE1   . GLU D  1 294  ? 187.334 190.089 177.952 1.00 109.46 ? 288  GLU C OE1   1 
ATOM   9500  O  OE2   . GLU D  1 294  ? 185.947 188.461 178.450 1.00 109.46 ? 288  GLU C OE2   1 
ATOM   9501  N  N     . GLY D  1 295  ? 185.620 194.899 180.940 1.00 109.15 ? 289  GLY C N     1 
ATOM   9502  C  CA    . GLY D  1 295  ? 186.217 196.191 181.213 1.00 109.15 ? 289  GLY C CA    1 
ATOM   9503  C  C     . GLY D  1 295  ? 186.668 196.278 182.653 1.00 109.15 ? 289  GLY C C     1 
ATOM   9504  O  O     . GLY D  1 295  ? 186.518 195.337 183.431 1.00 109.15 ? 289  GLY C O     1 
ATOM   9505  N  N     . VAL D  1 296  ? 187.216 197.427 183.003 1.00 117.61 ? 290  VAL C N     1 
ATOM   9506  C  CA    . VAL D  1 296  ? 187.750 197.652 184.339 1.00 117.61 ? 290  VAL C CA    1 
ATOM   9507  C  C     . VAL D  1 296  ? 186.792 198.529 185.126 1.00 117.61 ? 290  VAL C C     1 
ATOM   9508  O  O     . VAL D  1 296  ? 186.351 199.576 184.639 1.00 117.61 ? 290  VAL C O     1 
ATOM   9509  C  CB    . VAL D  1 296  ? 189.143 198.293 184.266 1.00 117.61 ? 290  VAL C CB    1 
ATOM   9510  C  CG1   . VAL D  1 296  ? 189.610 198.694 185.647 1.00 117.61 ? 290  VAL C CG1   1 
ATOM   9511  C  CG2   . VAL D  1 296  ? 190.128 197.328 183.630 1.00 117.61 ? 290  VAL C CG2   1 
ATOM   9512  N  N     . VAL D  1 297  ? 186.468 198.103 186.344 1.00 123.54 ? 291  VAL C N     1 
ATOM   9513  C  CA    . VAL D  1 297  ? 185.660 198.925 187.230 1.00 123.54 ? 291  VAL C CA    1 
ATOM   9514  C  C     . VAL D  1 297  ? 186.426 200.191 187.578 1.00 123.54 ? 291  VAL C C     1 
ATOM   9515  O  O     . VAL D  1 297  ? 187.649 200.181 187.753 1.00 123.54 ? 291  VAL C O     1 
ATOM   9516  C  CB    . VAL D  1 297  ? 185.276 198.137 188.495 1.00 123.54 ? 291  VAL C CB    1 
ATOM   9517  C  CG1   . VAL D  1 297  ? 184.475 199.004 189.450 1.00 123.54 ? 291  VAL C CG1   1 
ATOM   9518  C  CG2   . VAL D  1 297  ? 184.502 196.896 188.118 1.00 123.54 ? 291  VAL C CG2   1 
ATOM   9519  N  N     . GLU D  1 298  ? 185.698 201.303 187.668 1.00 142.17 ? 292  GLU C N     1 
ATOM   9520  C  CA    . GLU D  1 298  ? 186.343 202.590 187.892 1.00 142.17 ? 292  GLU C CA    1 
ATOM   9521  C  C     . GLU D  1 298  ? 186.956 202.670 189.280 1.00 142.17 ? 292  GLU C C     1 
ATOM   9522  O  O     . GLU D  1 298  ? 188.148 202.963 189.423 1.00 142.17 ? 292  GLU C O     1 
ATOM   9523  C  CB    . GLU D  1 298  ? 185.335 203.714 187.682 1.00 142.17 ? 292  GLU C CB    1 
ATOM   9524  C  CG    . GLU D  1 298  ? 185.922 205.100 187.719 1.00 142.17 ? 292  GLU C CG    1 
ATOM   9525  C  CD    . GLU D  1 298  ? 184.888 206.161 187.413 1.00 142.17 ? 292  GLU C CD    1 
ATOM   9526  O  OE1   . GLU D  1 298  ? 183.706 205.803 187.220 1.00 142.17 ? 292  GLU C OE1   1 
ATOM   9527  O  OE2   . GLU D  1 298  ? 185.257 207.352 187.355 1.00 142.17 ? 292  GLU C OE2   1 
ATOM   9528  N  N     . THR D  1 299  ? 186.164 202.404 190.313 1.00 140.45 ? 293  THR C N     1 
ATOM   9529  C  CA    . THR D  1 299  ? 186.657 202.493 191.680 1.00 140.45 ? 293  THR C CA    1 
ATOM   9530  C  C     . THR D  1 299  ? 187.675 201.414 192.004 1.00 140.45 ? 293  THR C C     1 
ATOM   9531  O  O     . THR D  1 299  ? 188.737 201.717 192.557 1.00 140.45 ? 293  THR C O     1 
ATOM   9532  C  CB    . THR D  1 299  ? 185.490 202.388 192.661 1.00 140.45 ? 293  THR C CB    1 
ATOM   9533  O  OG1   . THR D  1 299  ? 184.889 201.094 192.542 1.00 140.45 ? 293  THR C OG1   1 
ATOM   9534  C  CG2   . THR D  1 299  ? 184.457 203.431 192.336 1.00 140.45 ? 293  THR C CG2   1 
ATOM   9535  N  N     . THR D  1 300  ? 187.379 200.169 191.665 1.00 137.08 ? 294  THR C N     1 
ATOM   9536  C  CA    . THR D  1 300  ? 188.289 199.061 191.874 1.00 137.08 ? 294  THR C CA    1 
ATOM   9537  C  C     . THR D  1 300  ? 188.951 198.712 190.553 1.00 137.08 ? 294  THR C C     1 
ATOM   9538  O  O     . THR D  1 300  ? 188.287 198.295 189.601 1.00 137.08 ? 294  THR C O     1 
ATOM   9539  C  CB    . THR D  1 300  ? 187.558 197.839 192.423 1.00 137.08 ? 294  THR C CB    1 
ATOM   9540  O  OG1   . THR D  1 300  ? 186.631 197.360 191.443 1.00 137.08 ? 294  THR C OG1   1 
ATOM   9541  C  CG2   . THR D  1 300  ? 186.792 198.212 193.673 1.00 137.08 ? 294  THR C CG2   1 
ATOM   9542  N  N     . GLY D  1 301  ? 190.273 198.867 190.505 1.00 135.52 ? 295  GLY C N     1 
ATOM   9543  C  CA    . GLY D  1 301  ? 191.004 198.651 189.269 1.00 135.52 ? 295  GLY C CA    1 
ATOM   9544  C  C     . GLY D  1 301  ? 190.879 197.258 188.692 1.00 135.52 ? 295  GLY C C     1 
ATOM   9545  O  O     . GLY D  1 301  ? 191.506 196.976 187.666 1.00 135.52 ? 295  GLY C O     1 
ATOM   9546  N  N     . ILE D  1 302  ? 190.100 196.386 189.322 1.00 124.68 ? 296  ILE C N     1 
ATOM   9547  C  CA    . ILE D  1 302  ? 189.932 195.017 188.865 1.00 124.68 ? 296  ILE C CA    1 
ATOM   9548  C  C     . ILE D  1 302  ? 188.992 194.984 187.670 1.00 124.68 ? 296  ILE C C     1 
ATOM   9549  O  O     . ILE D  1 302  ? 188.324 195.976 187.359 1.00 124.68 ? 296  ILE C O     1 
ATOM   9550  C  CB    . ILE D  1 302  ? 189.420 194.125 190.005 1.00 124.68 ? 296  ILE C CB    1 
ATOM   9551  C  CG1   . ILE D  1 302  ? 188.075 194.637 190.507 1.00 124.68 ? 296  ILE C CG1   1 
ATOM   9552  C  CG2   . ILE D  1 302  ? 190.422 194.106 191.136 1.00 124.68 ? 296  ILE C CG2   1 
ATOM   9553  C  CD1   . ILE D  1 302  ? 187.412 193.704 191.485 1.00 124.68 ? 296  ILE C CD1   1 
ATOM   9554  N  N     . THR D  1 303  ? 188.940 193.840 186.994 1.00 108.49 ? 297  THR C N     1 
ATOM   9555  C  CA    . THR D  1 303  ? 188.189 193.675 185.760 1.00 108.49 ? 297  THR C CA    1 
ATOM   9556  C  C     . THR D  1 303  ? 186.966 192.819 186.041 1.00 108.49 ? 297  THR C C     1 
ATOM   9557  O  O     . THR D  1 303  ? 187.026 191.894 186.856 1.00 108.49 ? 297  THR C O     1 
ATOM   9558  C  CB    . THR D  1 303  ? 189.062 193.029 184.684 1.00 108.49 ? 297  THR C CB    1 
ATOM   9559  O  OG1   . THR D  1 303  ? 190.153 193.904 184.377 1.00 108.49 ? 297  THR C OG1   1 
ATOM   9560  C  CG2   . THR D  1 303  ? 188.269 192.754 183.426 1.00 108.49 ? 297  THR C CG2   1 
ATOM   9561  N  N     . THR D  1 304  ? 185.863 193.141 185.385 1.00 100.73 ? 298  THR C N     1 
ATOM   9562  C  CA    . THR D  1 304  ? 184.665 192.325 185.447 1.00 100.73 ? 298  THR C CA    1 
ATOM   9563  C  C     . THR D  1 304  ? 184.188 191.970 184.047 1.00 100.73 ? 298  THR C C     1 
ATOM   9564  O  O     . THR D  1 304  ? 184.559 192.603 183.055 1.00 100.73 ? 298  THR C O     1 
ATOM   9565  C  CB    . THR D  1 304  ? 183.553 193.045 186.203 1.00 100.73 ? 298  THR C CB    1 
ATOM   9566  O  OG1   . THR D  1 304  ? 182.434 192.162 186.354 1.00 100.73 ? 298  THR C OG1   1 
ATOM   9567  C  CG2   . THR D  1 304  ? 183.126 194.291 185.447 1.00 100.73 ? 298  THR C CG2   1 
ATOM   9568  N  N     . GLN D  1 305  ? 183.349 190.942 183.982 1.00 104.05 ? 299  GLN C N     1 
ATOM   9569  C  CA    . GLN D  1 305  ? 182.778 190.479 182.727 1.00 104.05 ? 299  GLN C CA    1 
ATOM   9570  C  C     . GLN D  1 305  ? 181.305 190.186 182.933 1.00 104.05 ? 299  GLN C C     1 
ATOM   9571  O  O     . GLN D  1 305  ? 180.937 189.481 183.875 1.00 104.05 ? 299  GLN C O     1 
ATOM   9572  C  CB    . GLN D  1 305  ? 183.484 189.227 182.215 1.00 104.05 ? 299  GLN C CB    1 
ATOM   9573  C  CG    . GLN D  1 305  ? 182.908 188.727 180.918 1.00 104.05 ? 299  GLN C CG    1 
ATOM   9574  C  CD    . GLN D  1 305  ? 183.586 187.478 180.424 1.00 104.05 ? 299  GLN C CD    1 
ATOM   9575  O  OE1   . GLN D  1 305  ? 184.491 186.955 181.070 1.00 104.05 ? 299  GLN C OE1   1 
ATOM   9576  N  NE2   . GLN D  1 305  ? 183.150 186.984 179.277 1.00 104.05 ? 299  GLN C NE2   1 
ATOM   9577  N  N     . ALA D  1 306  ? 180.468 190.721 182.054 1.00 104.32 ? 300  ALA C N     1 
ATOM   9578  C  CA    . ALA D  1 306  ? 179.065 190.351 181.984 1.00 104.32 ? 300  ALA C CA    1 
ATOM   9579  C  C     . ALA D  1 306  ? 178.848 189.517 180.730 1.00 104.32 ? 300  ALA C C     1 
ATOM   9580  O  O     . ALA D  1 306  ? 179.551 189.698 179.731 1.00 104.32 ? 300  ALA C O     1 
ATOM   9581  C  CB    . ALA D  1 306  ? 178.166 191.587 181.972 1.00 104.32 ? 300  ALA C CB    1 
ATOM   9582  N  N     . ARG D  1 307  ? 177.900 188.596 180.792 1.00 106.87 ? 301  ARG C N     1 
ATOM   9583  C  CA    . ARG D  1 307  ? 177.556 187.770 179.651 1.00 106.87 ? 301  ARG C CA    1 
ATOM   9584  C  C     . ARG D  1 307  ? 176.061 187.840 179.393 1.00 106.87 ? 301  ARG C C     1 
ATOM   9585  O  O     . ARG D  1 307  ? 175.252 187.889 180.323 1.00 106.87 ? 301  ARG C O     1 
ATOM   9586  C  CB    . ARG D  1 307  ? 177.961 186.311 179.864 1.00 106.87 ? 301  ARG C CB    1 
ATOM   9587  C  CG    . ARG D  1 307  ? 179.409 186.025 179.561 1.00 106.87 ? 301  ARG C CG    1 
ATOM   9588  C  CD    . ARG D  1 307  ? 180.291 186.434 180.718 1.00 106.87 ? 301  ARG C CD    1 
ATOM   9589  N  NE    . ARG D  1 307  ? 180.026 185.644 181.911 1.00 106.87 ? 301  ARG C NE    1 
ATOM   9590  C  CZ    . ARG D  1 307  ? 180.473 185.956 183.121 1.00 106.87 ? 301  ARG C CZ    1 
ATOM   9591  N  NH1   . ARG D  1 307  ? 181.207 187.045 183.293 1.00 106.87 ? 301  ARG C NH1   1 
ATOM   9592  N  NH2   . ARG D  1 307  ? 180.186 185.178 184.155 1.00 106.87 ? 301  ARG C NH2   1 
ATOM   9593  N  N     . THR D  1 308  ? 175.707 187.851 178.116 1.00 108.70 ? 302  THR C N     1 
ATOM   9594  C  CA    . THR D  1 308  ? 174.328 187.675 177.703 1.00 108.70 ? 302  THR C CA    1 
ATOM   9595  C  C     . THR D  1 308  ? 174.341 186.933 176.383 1.00 108.70 ? 302  THR C C     1 
ATOM   9596  O  O     . THR D  1 308  ? 175.320 186.968 175.633 1.00 108.70 ? 302  THR C O     1 
ATOM   9597  C  CB    . THR D  1 308  ? 173.591 189.008 177.576 1.00 108.70 ? 302  THR C CB    1 
ATOM   9598  O  OG1   . THR D  1 308  ? 172.207 188.757 177.306 1.00 108.70 ? 302  THR C OG1   1 
ATOM   9599  C  CG2   . THR D  1 308  ? 174.175 189.826 176.450 1.00 108.70 ? 302  THR C CG2   1 
ATOM   9600  N  N     . SER D  1 309  ? 173.241 186.249 176.101 1.00 117.49 ? 303  SER C N     1 
ATOM   9601  C  CA    . SER D  1 309  ? 173.187 185.428 174.907 1.00 117.49 ? 303  SER C CA    1 
ATOM   9602  C  C     . SER D  1 309  ? 171.844 185.628 174.232 1.00 117.49 ? 303  SER C C     1 
ATOM   9603  O  O     . SER D  1 309  ? 170.863 186.037 174.857 1.00 117.49 ? 303  SER C O     1 
ATOM   9604  C  CB    . SER D  1 309  ? 173.422 183.953 175.233 1.00 117.49 ? 303  SER C CB    1 
ATOM   9605  O  OG    . SER D  1 309  ? 172.396 183.449 176.067 1.00 117.49 ? 303  SER C OG    1 
ATOM   9606  N  N     . TYR D  1 310  ? 171.817 185.337 172.940 1.00 112.90 ? 304  TYR C N     1 
ATOM   9607  C  CA    . TYR D  1 310  ? 170.590 185.443 172.164 1.00 112.90 ? 304  TYR C CA    1 
ATOM   9608  C  C     . TYR D  1 310  ? 170.537 184.237 171.245 1.00 112.90 ? 304  TYR C C     1 
ATOM   9609  O  O     . TYR D  1 310  ? 171.413 184.074 170.390 1.00 112.90 ? 304  TYR C O     1 
ATOM   9610  C  CB    . TYR D  1 310  ? 170.545 186.739 171.366 1.00 112.90 ? 304  TYR C CB    1 
ATOM   9611  C  CG    . TYR D  1 310  ? 170.443 187.971 172.219 1.00 112.90 ? 304  TYR C CG    1 
ATOM   9612  C  CD1   . TYR D  1 310  ? 169.237 188.346 172.781 1.00 112.90 ? 304  TYR C CD1   1 
ATOM   9613  C  CD2   . TYR D  1 310  ? 171.552 188.760 172.457 1.00 112.90 ? 304  TYR C CD2   1 
ATOM   9614  C  CE1   . TYR D  1 310  ? 169.141 189.470 173.561 1.00 112.90 ? 304  TYR C CE1   1 
ATOM   9615  C  CE2   . TYR D  1 310  ? 171.463 189.883 173.237 1.00 112.90 ? 304  TYR C CE2   1 
ATOM   9616  C  CZ    . TYR D  1 310  ? 170.258 190.236 173.785 1.00 112.90 ? 304  TYR C CZ    1 
ATOM   9617  O  OH    . TYR D  1 310  ? 170.169 191.362 174.565 1.00 112.90 ? 304  TYR C OH    1 
ATOM   9618  N  N     . LEU D  1 311  ? 169.536 183.392 171.430 1.00 126.40 ? 305  LEU C N     1 
ATOM   9619  C  CA    . LEU D  1 311  ? 169.308 182.321 170.480 1.00 126.40 ? 305  LEU C CA    1 
ATOM   9620  C  C     . LEU D  1 311  ? 168.361 182.848 169.406 1.00 126.40 ? 305  LEU C C     1 
ATOM   9621  O  O     . LEU D  1 311  ? 168.025 184.034 169.376 1.00 126.40 ? 305  LEU C O     1 
ATOM   9622  C  CB    . LEU D  1 311  ? 168.823 181.064 171.200 1.00 126.40 ? 305  LEU C CB    1 
ATOM   9623  C  CG    . LEU D  1 311  ? 167.494 181.010 171.945 1.00 126.40 ? 305  LEU C CG    1 
ATOM   9