data_6C90
# 
_entry.id   6C90 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6C90         
WWPDB D_1000232270 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6C90 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Puno, M.R.' 1 ?                   
'Lima, C.D.' 2 0000-0002-9163-6092 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            115 
_citation.language                  ? 
_citation.page_first                E5506 
_citation.page_last                 E5515 
_citation.title                     
'Structural basis for MTR4-ZCCHC8 interactions that stimulate the MTR4 helicase in the nuclear exosome-targeting complex.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1803530115 
_citation.pdbx_database_id_PubMed   29844170 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Puno, M.R.' 1 ? 
primary 'Lima, C.D.' 2 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6C90 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     147.635 
_cell.length_a_esd                 ? 
_cell.length_b                     147.635 
_cell.length_b_esd                 ? 
_cell.length_c                     101.589 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6C90 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Exosome RNA helicase MTR4,Exosome RNA helicase MTR4' 83205.773 1   3.6.4.13,3.6.4.13 ? ? ? 
2 polymer     man 'Zinc finger CCHC domain-containing protein 8'        5870.648  1   ?                 ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                            427.201   1   ?                 ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                       24.305    2   ?                 ? ? ? 
5 non-polymer syn 'MALONATE ION'                                        102.046   4   ?                 ? ? ? 
6 non-polymer syn 'L(+)-TARTARIC ACID'                                  150.087   1   ?                 ? ? ? 
7 water       nat water                                                 18.015    238 ?                 ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;ATP-dependent RNA helicase DOB1,ATP-dependent RNA helicase SKIV2L2,Superkiller viralicidic activity 2-like 2,TRAMP-like complex helicase
;
2 'TRAMP-like complex RNA-binding factor ZCCHC8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SGDTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREA
IQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVM
TTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVI
YTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQ
PVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETI
EILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTI
GKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGSRTVLQMDELKCRKRVLRRLGFATSSD
VIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAE
AKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGIT
KIKRDIVFAASLYL
;
;SGDTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREA
IQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVM
TTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVI
YTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQ
PVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETI
EILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTI
GKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGSRTVLQMDELKCRKRVLRRLGFATSSD
VIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAE
AKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGIT
KIKRDIVFAASLYL
;
A ? 
2 'polypeptide(L)' no no SGDPIPDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQKNKKASE SGDPIPDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQKNKKASE 
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ASP n 
1 4   THR n 
1 5   ASP n 
1 6   GLU n 
1 7   PRO n 
1 8   ILE n 
1 9   PHE n 
1 10  GLY n 
1 11  LYS n 
1 12  LYS n 
1 13  PRO n 
1 14  ARG n 
1 15  ILE n 
1 16  GLU n 
1 17  GLU n 
1 18  SER n 
1 19  ILE n 
1 20  THR n 
1 21  GLU n 
1 22  ASP n 
1 23  LEU n 
1 24  SER n 
1 25  LEU n 
1 26  ALA n 
1 27  ASP n 
1 28  LEU n 
1 29  MET n 
1 30  PRO n 
1 31  ARG n 
1 32  VAL n 
1 33  LYS n 
1 34  VAL n 
1 35  GLN n 
1 36  SER n 
1 37  VAL n 
1 38  GLU n 
1 39  THR n 
1 40  VAL n 
1 41  GLU n 
1 42  GLY n 
1 43  CYS n 
1 44  THR n 
1 45  HIS n 
1 46  GLU n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  PRO n 
1 51  ALA n 
1 52  GLU n 
1 53  GLU n 
1 54  ASP n 
1 55  TYR n 
1 56  LEU n 
1 57  PRO n 
1 58  LEU n 
1 59  LYS n 
1 60  PRO n 
1 61  ARG n 
1 62  VAL n 
1 63  GLY n 
1 64  LYS n 
1 65  ALA n 
1 66  ALA n 
1 67  LYS n 
1 68  GLU n 
1 69  TYR n 
1 70  PRO n 
1 71  PHE n 
1 72  ILE n 
1 73  LEU n 
1 74  ASP n 
1 75  ALA n 
1 76  PHE n 
1 77  GLN n 
1 78  ARG n 
1 79  GLU n 
1 80  ALA n 
1 81  ILE n 
1 82  GLN n 
1 83  CYS n 
1 84  VAL n 
1 85  ASP n 
1 86  ASN n 
1 87  ASN n 
1 88  GLN n 
1 89  SER n 
1 90  VAL n 
1 91  LEU n 
1 92  VAL n 
1 93  SER n 
1 94  ALA n 
1 95  HIS n 
1 96  THR n 
1 97  SER n 
1 98  ALA n 
1 99  GLY n 
1 100 LYS n 
1 101 THR n 
1 102 VAL n 
1 103 CYS n 
1 104 ALA n 
1 105 GLU n 
1 106 TYR n 
1 107 ALA n 
1 108 ILE n 
1 109 ALA n 
1 110 LEU n 
1 111 ALA n 
1 112 LEU n 
1 113 ARG n 
1 114 GLU n 
1 115 LYS n 
1 116 GLN n 
1 117 ARG n 
1 118 VAL n 
1 119 ILE n 
1 120 PHE n 
1 121 THR n 
1 122 SER n 
1 123 PRO n 
1 124 ILE n 
1 125 LYS n 
1 126 ALA n 
1 127 LEU n 
1 128 SER n 
1 129 ASN n 
1 130 GLN n 
1 131 LYS n 
1 132 TYR n 
1 133 ARG n 
1 134 GLU n 
1 135 MET n 
1 136 TYR n 
1 137 GLU n 
1 138 GLU n 
1 139 PHE n 
1 140 GLN n 
1 141 ASP n 
1 142 VAL n 
1 143 GLY n 
1 144 LEU n 
1 145 MET n 
1 146 THR n 
1 147 GLY n 
1 148 ASP n 
1 149 VAL n 
1 150 THR n 
1 151 ILE n 
1 152 ASN n 
1 153 PRO n 
1 154 THR n 
1 155 ALA n 
1 156 SER n 
1 157 CYS n 
1 158 LEU n 
1 159 VAL n 
1 160 MET n 
1 161 THR n 
1 162 THR n 
1 163 GLU n 
1 164 ILE n 
1 165 LEU n 
1 166 ARG n 
1 167 SER n 
1 168 MET n 
1 169 LEU n 
1 170 TYR n 
1 171 ARG n 
1 172 GLY n 
1 173 SER n 
1 174 GLU n 
1 175 VAL n 
1 176 MET n 
1 177 ARG n 
1 178 GLU n 
1 179 VAL n 
1 180 ALA n 
1 181 TRP n 
1 182 VAL n 
1 183 ILE n 
1 184 PHE n 
1 185 ASP n 
1 186 GLU n 
1 187 ILE n 
1 188 HIS n 
1 189 TYR n 
1 190 MET n 
1 191 ARG n 
1 192 ASP n 
1 193 SER n 
1 194 GLU n 
1 195 ARG n 
1 196 GLY n 
1 197 VAL n 
1 198 VAL n 
1 199 TRP n 
1 200 GLU n 
1 201 GLU n 
1 202 THR n 
1 203 ILE n 
1 204 ILE n 
1 205 LEU n 
1 206 LEU n 
1 207 PRO n 
1 208 ASP n 
1 209 ASN n 
1 210 VAL n 
1 211 HIS n 
1 212 TYR n 
1 213 VAL n 
1 214 PHE n 
1 215 LEU n 
1 216 SER n 
1 217 ALA n 
1 218 THR n 
1 219 ILE n 
1 220 PRO n 
1 221 ASN n 
1 222 ALA n 
1 223 ARG n 
1 224 GLN n 
1 225 PHE n 
1 226 ALA n 
1 227 GLU n 
1 228 TRP n 
1 229 ILE n 
1 230 CYS n 
1 231 HIS n 
1 232 LEU n 
1 233 HIS n 
1 234 LYS n 
1 235 GLN n 
1 236 PRO n 
1 237 CYS n 
1 238 HIS n 
1 239 VAL n 
1 240 ILE n 
1 241 TYR n 
1 242 THR n 
1 243 ASP n 
1 244 TYR n 
1 245 ARG n 
1 246 PRO n 
1 247 THR n 
1 248 PRO n 
1 249 LEU n 
1 250 GLN n 
1 251 HIS n 
1 252 TYR n 
1 253 ILE n 
1 254 PHE n 
1 255 PRO n 
1 256 ALA n 
1 257 GLY n 
1 258 GLY n 
1 259 ASP n 
1 260 GLY n 
1 261 LEU n 
1 262 HIS n 
1 263 LEU n 
1 264 VAL n 
1 265 VAL n 
1 266 ASP n 
1 267 GLU n 
1 268 ASN n 
1 269 GLY n 
1 270 ASP n 
1 271 PHE n 
1 272 ARG n 
1 273 GLU n 
1 274 ASP n 
1 275 ASN n 
1 276 PHE n 
1 277 ASN n 
1 278 THR n 
1 279 ALA n 
1 280 MET n 
1 281 GLN n 
1 282 VAL n 
1 283 LEU n 
1 284 ARG n 
1 285 ASP n 
1 286 ALA n 
1 287 GLY n 
1 288 ASP n 
1 289 LEU n 
1 290 ALA n 
1 291 LYS n 
1 292 GLY n 
1 293 ASP n 
1 294 GLN n 
1 295 LYS n 
1 296 GLY n 
1 297 ARG n 
1 298 LYS n 
1 299 GLY n 
1 300 GLY n 
1 301 THR n 
1 302 LYS n 
1 303 GLY n 
1 304 PRO n 
1 305 SER n 
1 306 ASN n 
1 307 VAL n 
1 308 PHE n 
1 309 LYS n 
1 310 ILE n 
1 311 VAL n 
1 312 LYS n 
1 313 MET n 
1 314 ILE n 
1 315 MET n 
1 316 GLU n 
1 317 ARG n 
1 318 ASN n 
1 319 PHE n 
1 320 GLN n 
1 321 PRO n 
1 322 VAL n 
1 323 ILE n 
1 324 ILE n 
1 325 PHE n 
1 326 SER n 
1 327 PHE n 
1 328 SER n 
1 329 LYS n 
1 330 LYS n 
1 331 ASP n 
1 332 CYS n 
1 333 GLU n 
1 334 ALA n 
1 335 TYR n 
1 336 ALA n 
1 337 LEU n 
1 338 GLN n 
1 339 MET n 
1 340 THR n 
1 341 LYS n 
1 342 LEU n 
1 343 ASP n 
1 344 PHE n 
1 345 ASN n 
1 346 THR n 
1 347 ASP n 
1 348 GLU n 
1 349 GLU n 
1 350 LYS n 
1 351 LYS n 
1 352 MET n 
1 353 VAL n 
1 354 GLU n 
1 355 GLU n 
1 356 VAL n 
1 357 PHE n 
1 358 SER n 
1 359 ASN n 
1 360 ALA n 
1 361 ILE n 
1 362 ASP n 
1 363 CYS n 
1 364 LEU n 
1 365 SER n 
1 366 ASP n 
1 367 GLU n 
1 368 ASP n 
1 369 LYS n 
1 370 LYS n 
1 371 LEU n 
1 372 PRO n 
1 373 GLN n 
1 374 VAL n 
1 375 GLU n 
1 376 HIS n 
1 377 VAL n 
1 378 LEU n 
1 379 PRO n 
1 380 LEU n 
1 381 LEU n 
1 382 LYS n 
1 383 ARG n 
1 384 GLY n 
1 385 ILE n 
1 386 GLY n 
1 387 ILE n 
1 388 HIS n 
1 389 HIS n 
1 390 GLY n 
1 391 GLY n 
1 392 LEU n 
1 393 LEU n 
1 394 PRO n 
1 395 ILE n 
1 396 LEU n 
1 397 LYS n 
1 398 GLU n 
1 399 THR n 
1 400 ILE n 
1 401 GLU n 
1 402 ILE n 
1 403 LEU n 
1 404 PHE n 
1 405 SER n 
1 406 GLU n 
1 407 GLY n 
1 408 LEU n 
1 409 ILE n 
1 410 LYS n 
1 411 ALA n 
1 412 LEU n 
1 413 PHE n 
1 414 ALA n 
1 415 THR n 
1 416 GLU n 
1 417 THR n 
1 418 PHE n 
1 419 ALA n 
1 420 MET n 
1 421 GLY n 
1 422 ILE n 
1 423 ASN n 
1 424 MET n 
1 425 PRO n 
1 426 ALA n 
1 427 ARG n 
1 428 THR n 
1 429 VAL n 
1 430 LEU n 
1 431 PHE n 
1 432 THR n 
1 433 ASN n 
1 434 ALA n 
1 435 ARG n 
1 436 LYS n 
1 437 PHE n 
1 438 ASP n 
1 439 GLY n 
1 440 LYS n 
1 441 ASP n 
1 442 PHE n 
1 443 ARG n 
1 444 TRP n 
1 445 ILE n 
1 446 SER n 
1 447 SER n 
1 448 GLY n 
1 449 GLU n 
1 450 TYR n 
1 451 ILE n 
1 452 GLN n 
1 453 MET n 
1 454 SER n 
1 455 GLY n 
1 456 ARG n 
1 457 ALA n 
1 458 GLY n 
1 459 ARG n 
1 460 ARG n 
1 461 GLY n 
1 462 MET n 
1 463 ASP n 
1 464 ASP n 
1 465 ARG n 
1 466 GLY n 
1 467 ILE n 
1 468 VAL n 
1 469 ILE n 
1 470 LEU n 
1 471 MET n 
1 472 VAL n 
1 473 ASP n 
1 474 GLU n 
1 475 LYS n 
1 476 MET n 
1 477 SER n 
1 478 PRO n 
1 479 THR n 
1 480 ILE n 
1 481 GLY n 
1 482 LYS n 
1 483 GLN n 
1 484 LEU n 
1 485 LEU n 
1 486 LYS n 
1 487 GLY n 
1 488 SER n 
1 489 ALA n 
1 490 ASP n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 SER n 
1 495 ALA n 
1 496 PHE n 
1 497 HIS n 
1 498 LEU n 
1 499 THR n 
1 500 TYR n 
1 501 ASN n 
1 502 MET n 
1 503 VAL n 
1 504 LEU n 
1 505 ASN n 
1 506 LEU n 
1 507 LEU n 
1 508 ARG n 
1 509 VAL n 
1 510 GLU n 
1 511 GLU n 
1 512 ILE n 
1 513 ASN n 
1 514 PRO n 
1 515 GLU n 
1 516 TYR n 
1 517 MET n 
1 518 LEU n 
1 519 GLU n 
1 520 LYS n 
1 521 SER n 
1 522 PHE n 
1 523 TYR n 
1 524 GLN n 
1 525 PHE n 
1 526 GLN n 
1 527 HIS n 
1 528 TYR n 
1 529 ARG n 
1 530 ALA n 
1 531 ILE n 
1 532 PRO n 
1 533 GLY n 
1 534 SER n 
1 535 ARG n 
1 536 THR n 
1 537 VAL n 
1 538 LEU n 
1 539 GLN n 
1 540 MET n 
1 541 ASP n 
1 542 GLU n 
1 543 LEU n 
1 544 LYS n 
1 545 CYS n 
1 546 ARG n 
1 547 LYS n 
1 548 ARG n 
1 549 VAL n 
1 550 LEU n 
1 551 ARG n 
1 552 ARG n 
1 553 LEU n 
1 554 GLY n 
1 555 PHE n 
1 556 ALA n 
1 557 THR n 
1 558 SER n 
1 559 SER n 
1 560 ASP n 
1 561 VAL n 
1 562 ILE n 
1 563 GLU n 
1 564 MET n 
1 565 LYS n 
1 566 GLY n 
1 567 ARG n 
1 568 VAL n 
1 569 ALA n 
1 570 CYS n 
1 571 GLU n 
1 572 ILE n 
1 573 SER n 
1 574 SER n 
1 575 ALA n 
1 576 ASP n 
1 577 GLU n 
1 578 LEU n 
1 579 LEU n 
1 580 LEU n 
1 581 THR n 
1 582 GLU n 
1 583 MET n 
1 584 MET n 
1 585 PHE n 
1 586 ASN n 
1 587 GLY n 
1 588 LEU n 
1 589 PHE n 
1 590 ASN n 
1 591 ASP n 
1 592 LEU n 
1 593 SER n 
1 594 ALA n 
1 595 GLU n 
1 596 GLN n 
1 597 ALA n 
1 598 THR n 
1 599 ALA n 
1 600 LEU n 
1 601 LEU n 
1 602 SER n 
1 603 CYS n 
1 604 PHE n 
1 605 VAL n 
1 606 PHE n 
1 607 GLN n 
1 608 GLU n 
1 609 ASN n 
1 610 SER n 
1 611 SER n 
1 612 GLU n 
1 613 MET n 
1 614 PRO n 
1 615 LYS n 
1 616 LEU n 
1 617 THR n 
1 618 GLU n 
1 619 GLN n 
1 620 LEU n 
1 621 ALA n 
1 622 GLY n 
1 623 PRO n 
1 624 LEU n 
1 625 ARG n 
1 626 GLN n 
1 627 MET n 
1 628 GLN n 
1 629 GLU n 
1 630 CYS n 
1 631 ALA n 
1 632 LYS n 
1 633 ARG n 
1 634 ILE n 
1 635 ALA n 
1 636 LYS n 
1 637 VAL n 
1 638 SER n 
1 639 ALA n 
1 640 GLU n 
1 641 ALA n 
1 642 LYS n 
1 643 LEU n 
1 644 GLU n 
1 645 ILE n 
1 646 ASP n 
1 647 GLU n 
1 648 GLU n 
1 649 THR n 
1 650 TYR n 
1 651 LEU n 
1 652 SER n 
1 653 SER n 
1 654 PHE n 
1 655 LYS n 
1 656 PRO n 
1 657 HIS n 
1 658 LEU n 
1 659 MET n 
1 660 ASP n 
1 661 VAL n 
1 662 VAL n 
1 663 TYR n 
1 664 THR n 
1 665 TRP n 
1 666 ALA n 
1 667 THR n 
1 668 GLY n 
1 669 ALA n 
1 670 THR n 
1 671 PHE n 
1 672 ALA n 
1 673 HIS n 
1 674 ILE n 
1 675 CYS n 
1 676 LYS n 
1 677 MET n 
1 678 THR n 
1 679 ASP n 
1 680 VAL n 
1 681 PHE n 
1 682 GLU n 
1 683 GLY n 
1 684 SER n 
1 685 ILE n 
1 686 ILE n 
1 687 ARG n 
1 688 CYS n 
1 689 MET n 
1 690 ARG n 
1 691 ARG n 
1 692 LEU n 
1 693 GLU n 
1 694 GLU n 
1 695 LEU n 
1 696 LEU n 
1 697 ARG n 
1 698 GLN n 
1 699 MET n 
1 700 CYS n 
1 701 GLN n 
1 702 ALA n 
1 703 ALA n 
1 704 LYS n 
1 705 ALA n 
1 706 ILE n 
1 707 GLY n 
1 708 ASN n 
1 709 THR n 
1 710 GLU n 
1 711 LEU n 
1 712 GLU n 
1 713 ASN n 
1 714 LYS n 
1 715 PHE n 
1 716 ALA n 
1 717 GLU n 
1 718 GLY n 
1 719 ILE n 
1 720 THR n 
1 721 LYS n 
1 722 ILE n 
1 723 LYS n 
1 724 ARG n 
1 725 ASP n 
1 726 ILE n 
1 727 VAL n 
1 728 PHE n 
1 729 ALA n 
1 730 ALA n 
1 731 SER n 
1 732 LEU n 
1 733 TYR n 
1 734 LEU n 
2 1   SER n 
2 2   GLY n 
2 3   ASP n 
2 4   PRO n 
2 5   ILE n 
2 6   PRO n 
2 7   ASP n 
2 8   MET n 
2 9   SER n 
2 10  LYS n 
2 11  PHE n 
2 12  ALA n 
2 13  THR n 
2 14  GLY n 
2 15  ILE n 
2 16  THR n 
2 17  PRO n 
2 18  PHE n 
2 19  GLU n 
2 20  PHE n 
2 21  GLU n 
2 22  ASN n 
2 23  MET n 
2 24  ALA n 
2 25  GLU n 
2 26  SER n 
2 27  THR n 
2 28  GLY n 
2 29  MET n 
2 30  TYR n 
2 31  LEU n 
2 32  ARG n 
2 33  ILE n 
2 34  ARG n 
2 35  SER n 
2 36  LEU n 
2 37  LEU n 
2 38  LYS n 
2 39  ASN n 
2 40  SER n 
2 41  PRO n 
2 42  ARG n 
2 43  ASN n 
2 44  GLN n 
2 45  GLN n 
2 46  LYS n 
2 47  ASN n 
2 48  LYS n 
2 49  LYS n 
2 50  ALA n 
2 51  SER n 
2 52  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   533 Human ? 'MTREX, DOB1, KIAA0052, MTR4, SKIV2L2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 534 734 Human ? 'MTREX, DOB1, KIAA0052, MTR4, SKIV2L2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   52  Human ? ZCCHC8                                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SK2L2_HUMAN P42285 ? 1 
;TDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREAIQC
VDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTE
ILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTD
YRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVI
IFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEIL
FSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQ
LLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPG
;
71  
2 UNP SK2L2_HUMAN P42285 ? 1 
;ARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEM
PKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLE
ELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL
;
842 
3 UNP ZCHC8_HUMAN Q6NZY4 ? 2 PIPDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQKNKKASE 659 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6C90 A 4   ? 533 ? P42285 71  ? 600  ? 71  600  
2 2 6C90 A 534 ? 734 ? P42285 842 ? 1042 ? 601 1042 
3 3 6C90 B 4   ? 52  ? Q6NZY4 659 ? 707  ? 659 707  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6C90 SER A 1   ? UNP P42285 ?   ?   'expression tag' 68  1 
1 6C90 GLY A 2   ? UNP P42285 ?   ?   'expression tag' 69  2 
1 6C90 ASP A 3   ? UNP P42285 ?   ?   'expression tag' 70  3 
2 6C90 SER A 534 ? UNP P42285 ALA 842 linker           601 4 
3 6C90 SER B 1   ? UNP Q6NZY4 ?   ?   'expression tag' 656 5 
3 6C90 GLY B 2   ? UNP Q6NZY4 ?   ?   'expression tag' 657 6 
3 6C90 ASP B 3   ? UNP Q6NZY4 ?   ?   'expression tag' 658 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
MLI non-polymer         . 'MALONATE ION'             ? 'C3 H2 O4 -2'       102.046 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TLA non-polymer         . 'L(+)-TARTARIC ACID'       ? 'C4 H6 O6'          150.087 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6C90 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.59 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.72 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.6 M sodium-potassium (L)-tartrate, 0.1 M Bis-Tris pH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-12-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            39.27 
_reflns.entry_id                         6C90 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 73.8 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       63653 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.25 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                0.08 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.2 
_reflns_shell.d_res_low                   2.3 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.64 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6188 
_reflns_shell.percent_possible_all        96.99 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.64 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.47 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6C90 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             73.8 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     63650 
_refine.ls_number_reflns_R_free                  3118 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.25 
_refine.ls_percent_reflns_R_free                 4.90 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1918 
_refine.ls_R_factor_R_free                       0.2214 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1903 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.40 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2XGJ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.81 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.30 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5853 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         67 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               6158 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        73.8 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 6106 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.508  ? 8252 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.150 ? 3725 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 922  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 1066 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1974 2.2318  . . 114 2633 94.00  . . . 0.3232 . 0.3160 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2318 2.2684  . . 139 2774 99.00  . . . 0.3231 . 0.3052 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2684 2.3075  . . 138 2740 99.00  . . . 0.3391 . 0.2955 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3075 2.3495  . . 148 2728 99.00  . . . 0.3223 . 0.2884 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3495 2.3947  . . 145 2701 99.00  . . . 0.3284 . 0.2800 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3947 2.4435  . . 150 2729 99.00  . . . 0.3071 . 0.2661 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4435 2.4967  . . 128 2784 100.00 . . . 0.3090 . 0.2550 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4967 2.5548  . . 135 2748 99.00  . . . 0.2919 . 0.2412 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5548 2.6186  . . 141 2727 99.00  . . . 0.2948 . 0.2324 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6186 2.6894  . . 141 2749 100.00 . . . 0.2556 . 0.2224 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6894 2.7686  . . 119 2771 99.00  . . . 0.2475 . 0.2228 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7686 2.8580  . . 125 2760 99.00  . . . 0.2807 . 0.2266 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8580 2.9601  . . 130 2770 100.00 . . . 0.2730 . 0.2167 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9601 3.0786  . . 156 2769 99.00  . . . 0.2345 . 0.2197 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0786 3.2187  . . 161 2705 99.00  . . . 0.2330 . 0.2055 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2187 3.3885  . . 176 2745 100.00 . . . 0.2397 . 0.1808 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3885 3.6007  . . 158 2750 100.00 . . . 0.2163 . 0.1646 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6007 3.8788  . . 139 2770 100.00 . . . 0.1787 . 0.1524 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8788 4.2691  . . 121 2793 100.00 . . . 0.1614 . 0.1393 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2691 4.8867  . . 160 2755 100.00 . . . 0.1579 . 0.1281 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8867 6.1564  . . 134 2817 100.00 . . . 0.1923 . 0.1596 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.1564 79.5904 . . 160 2815 99.00  . . . 0.1900 . 0.1843 . . . . . . . . . . 
# 
_struct.entry_id                     6C90 
_struct.title                        'Human Mtr4 helicase in complex with ZCCHC8-CTD' 
_struct.pdbx_descriptor              
'Superkiller viralicidic activity 2-like 2 (E.C.3.6.4.13), Zinc finger CCHC domain-containing protein 8' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6C90 
_struct_keywords.text            
;HYDROLASE, NEXT, EXOSOME, NUCLEOTIDE-BINDING, ATPASE, RNA, HELICASE, TRANSLOCASE, RNA BINDING PROTEIN, HYDROLASE-RNA binding protein complex
;
_struct_keywords.pdbx_keywords   'HYDROLASE/RNA binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 74  ? ASN A 86  ? ASP A 141  ASN A 153  1 ? 13 
HELX_P HELX_P2  AA2 LYS A 100 ? GLU A 114 ? LYS A 167  GLU A 181  1 ? 15 
HELX_P HELX_P3  AA3 ILE A 124 ? GLN A 140 ? ILE A 191  GLN A 207  1 ? 17 
HELX_P HELX_P4  AA4 THR A 162 ? ARG A 171 ? THR A 229  ARG A 238  1 ? 10 
HELX_P HELX_P5  AA5 SER A 173 ? ARG A 177 ? SER A 240  ARG A 244  5 ? 5  
HELX_P HELX_P6  AA6 GLU A 186 ? MET A 190 ? GLU A 253  MET A 257  5 ? 5  
HELX_P HELX_P7  AA7 ARG A 195 ? LEU A 206 ? ARG A 262  LEU A 273  1 ? 12 
HELX_P HELX_P8  AA8 ASN A 221 ? LYS A 234 ? ASN A 288  LYS A 301  1 ? 14 
HELX_P HELX_P9  AA9 ARG A 272 ? VAL A 282 ? ARG A 339  VAL A 349  1 ? 11 
HELX_P HELX_P10 AB1 PRO A 304 ? ARG A 317 ? PRO A 371  ARG A 384  1 ? 14 
HELX_P HELX_P11 AB2 SER A 328 ? MET A 339 ? SER A 395  MET A 406  1 ? 12 
HELX_P HELX_P12 AB3 THR A 340 ? LEU A 342 ? THR A 407  LEU A 409  5 ? 3  
HELX_P HELX_P13 AB4 THR A 346 ? ASP A 362 ? THR A 413  ASP A 429  1 ? 17 
HELX_P HELX_P14 AB5 SER A 365 ? LYS A 370 ? SER A 432  LYS A 437  1 ? 6  
HELX_P HELX_P15 AB6 LEU A 371 ? ARG A 383 ? LEU A 438  ARG A 450  1 ? 13 
HELX_P HELX_P16 AB7 LEU A 393 ? GLU A 406 ? LEU A 460  GLU A 473  1 ? 14 
HELX_P HELX_P17 AB8 GLU A 416 ? GLY A 421 ? GLU A 483  GLY A 488  5 ? 6  
HELX_P HELX_P18 AB9 SER A 446 ? GLY A 455 ? SER A 513  GLY A 522  1 ? 10 
HELX_P HELX_P19 AC1 SER A 477 ? GLY A 487 ? SER A 544  GLY A 554  1 ? 11 
HELX_P HELX_P20 AC2 THR A 499 ? VAL A 509 ? THR A 566  VAL A 576  1 ? 11 
HELX_P HELX_P21 AC3 ASN A 513 ? SER A 521 ? ASN A 580  SER A 588  1 ? 9  
HELX_P HELX_P22 AC4 SER A 521 ? ILE A 531 ? SER A 588  ILE A 598  1 ? 11 
HELX_P HELX_P23 AC5 GLN A 539 ? LEU A 553 ? GLN A 847  LEU A 861  1 ? 15 
HELX_P HELX_P24 AC6 GLU A 563 ? CYS A 570 ? GLU A 871  CYS A 878  1 ? 8  
HELX_P HELX_P25 AC7 ASP A 576 ? GLY A 587 ? ASP A 884  GLY A 895  1 ? 12 
HELX_P HELX_P26 AC8 SER A 593 ? SER A 602 ? SER A 901  SER A 910  1 ? 10 
HELX_P HELX_P27 AC9 CYS A 603 ? VAL A 605 ? CYS A 911  VAL A 913  5 ? 3  
HELX_P HELX_P28 AD1 THR A 617 ? ALA A 641 ? THR A 925  ALA A 949  1 ? 25 
HELX_P HELX_P29 AD2 ASP A 646 ? SER A 653 ? ASP A 954  SER A 961  1 ? 8  
HELX_P HELX_P30 AD3 LEU A 658 ? THR A 667 ? LEU A 966  THR A 975  1 ? 10 
HELX_P HELX_P31 AD4 THR A 670 ? LYS A 676 ? THR A 978  LYS A 984  1 ? 7  
HELX_P HELX_P32 AD5 PHE A 681 ? ILE A 706 ? PHE A 989  ILE A 1014 1 ? 26 
HELX_P HELX_P33 AD6 ASN A 708 ? LYS A 723 ? ASN A 1016 LYS A 1031 1 ? 16 
HELX_P HELX_P34 AD7 ARG A 724 ? ALA A 729 ? ARG A 1032 ALA A 1037 5 ? 6  
HELX_P HELX_P35 AD8 ASP B 7   ? THR B 13  ? ASP B 662  THR B 668  1 ? 7  
HELX_P HELX_P36 AD9 GLY B 28  ? LEU B 36  ? GLY B 683  LEU B 691  1 ? 9  
HELX_P HELX_P37 AE1 SER B 40  ? GLN B 45  ? SER B 695  GLN B 700  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A LEU 506 O  ? ? ? 1_555 E MG  . MG ? ? A LEU 573  A MG  1103 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc2 metalc ? ? A LEU 507 O  ? ? ? 1_555 E MG  . MG ? ? A LEU 574  A MG  1103 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc3 metalc ? ? A VAL 509 O  ? ? ? 1_555 E MG  . MG ? ? A VAL 576  A MG  1103 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc4 metalc ? ? A ILE 512 O  ? ? ? 1_555 E MG  . MG ? ? A ILE 579  A MG  1103 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc5 metalc ? ? E MG  .   MG ? ? ? 1_555 K HOH . O  ? ? A MG  1103 A HOH 1399 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc6 metalc ? ? E MG  .   MG ? ? ? 1_555 K HOH . O  ? ? A MG  1103 A HOH 1379 1_555 ? ? ? ? ? ? ? 2.301 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLN 
_struct_mon_prot_cis.label_seq_id           320 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLN 
_struct_mon_prot_cis.auth_seq_id            387 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    321 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     388 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? parallel      
AA1 4 5  ? parallel      
AA1 5 6  ? parallel      
AA1 6 7  ? parallel      
AA1 7 8  ? parallel      
AA1 8 9  ? parallel      
AA1 9 10 ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? parallel      
AA2 5 6  ? parallel      
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 32  ? VAL A 37  ? VAL A 99  VAL A 104 
AA1 2  THR A 44  ? PRO A 50  ? THR A 111 PRO A 117 
AA1 3  CYS A 237 ? TYR A 241 ? CYS A 304 TYR A 308 
AA1 4  SER A 89  ? SER A 93  ? SER A 156 SER A 160 
AA1 5  HIS A 211 ? SER A 216 ? HIS A 278 SER A 283 
AA1 6  VAL A 179 ? PHE A 184 ? VAL A 246 PHE A 251 
AA1 7  ARG A 117 ? SER A 122 ? ARG A 184 SER A 189 
AA1 8  CYS A 157 ? THR A 161 ? CYS A 224 THR A 228 
AA1 9  VAL A 142 ? MET A 145 ? VAL A 209 MET A 212 
AA1 10 THR A 150 ? ILE A 151 ? THR A 217 ILE A 218 
AA2 1  HIS A 262 ? VAL A 265 ? HIS A 329 VAL A 332 
AA2 2  LEU A 249 ? PRO A 255 ? LEU A 316 PRO A 322 
AA2 3  GLY A 466 ? VAL A 472 ? GLY A 533 VAL A 539 
AA2 4  THR A 428 ? PHE A 431 ? THR A 495 PHE A 498 
AA2 5  VAL A 322 ? PHE A 325 ? VAL A 389 PHE A 392 
AA2 6  ALA A 411 ? ALA A 414 ? ALA A 478 ALA A 481 
AA2 7  ILE A 385 ? HIS A 388 ? ILE A 452 HIS A 455 
AA3 1  ARG A 435 ? PHE A 437 ? ARG A 502 PHE A 504 
AA3 2  PHE A 442 ? TRP A 444 ? PHE A 509 TRP A 511 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N GLN A 35  ? N GLN A 102 O VAL A 47  ? O VAL A 114 
AA1 2 3  N THR A 44  ? N THR A 111 O TYR A 241 ? O TYR A 308 
AA1 3 4  O ILE A 240 ? O ILE A 307 N LEU A 91  ? N LEU A 158 
AA1 4 5  N VAL A 92  ? N VAL A 159 O PHE A 214 ? O PHE A 281 
AA1 5 6  O LEU A 215 ? O LEU A 282 N PHE A 184 ? N PHE A 251 
AA1 6 7  O ILE A 183 ? O ILE A 250 N ILE A 119 ? N ILE A 186 
AA1 7 8  N VAL A 118 ? N VAL A 185 O LEU A 158 ? O LEU A 225 
AA1 8 9  O CYS A 157 ? O CYS A 224 N GLY A 143 ? N GLY A 210 
AA1 9 10 N LEU A 144 ? N LEU A 211 O ILE A 151 ? O ILE A 218 
AA2 1 2  O VAL A 264 ? O VAL A 331 N HIS A 251 ? N HIS A 318 
AA2 2 3  N TYR A 252 ? N TYR A 319 O VAL A 468 ? O VAL A 535 
AA2 3 4  O ILE A 469 ? O ILE A 536 N PHE A 431 ? N PHE A 498 
AA2 4 5  O LEU A 430 ? O LEU A 497 N ILE A 323 ? N ILE A 390 
AA2 5 6  N ILE A 324 ? N ILE A 391 O LEU A 412 ? O LEU A 479 
AA2 6 7  O ALA A 411 ? O ALA A 478 N GLY A 386 ? N GLY A 453 
AA3 1 2  N LYS A 436 ? N LYS A 503 O ARG A 443 ? O ARG A 510 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ADP 1101 ? 12 'binding site for residue ADP A 1101' 
AC2 Software A MG  1102 ? 2  'binding site for residue MG A 1102'  
AC3 Software A MG  1103 ? 6  'binding site for residue MG A 1103'  
AC4 Software A MLI 1104 ? 5  'binding site for residue MLI A 1104' 
AC5 Software A MLI 1105 ? 6  'binding site for residue MLI A 1105' 
AC6 Software A MLI 1106 ? 6  'binding site for residue MLI A 1106' 
AC7 Software A MLI 1107 ? 3  'binding site for residue MLI A 1107' 
AC8 Software A TLA 1108 ? 4  'binding site for residue TLA A 1108' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 PHE A 71  ? PHE A 138  . ? 1_555 ? 
2  AC1 12 ILE A 72  ? ILE A 139  . ? 1_555 ? 
3  AC1 12 ASP A 74  ? ASP A 141  . ? 1_555 ? 
4  AC1 12 GLN A 77  ? GLN A 144  . ? 1_555 ? 
5  AC1 12 THR A 96  ? THR A 163  . ? 1_555 ? 
6  AC1 12 SER A 97  ? SER A 164  . ? 1_555 ? 
7  AC1 12 GLY A 99  ? GLY A 166  . ? 1_555 ? 
8  AC1 12 LYS A 100 ? LYS A 167  . ? 1_555 ? 
9  AC1 12 THR A 101 ? THR A 168  . ? 1_555 ? 
10 AC1 12 ASN A 423 ? ASN A 490  . ? 1_555 ? 
11 AC1 12 ARG A 460 ? ARG A 527  . ? 1_555 ? 
12 AC1 12 HOH K .   ? HOH A 1295 . ? 1_555 ? 
13 AC2 2  TLA J .   ? TLA A 1108 . ? 1_555 ? 
14 AC2 2  HOH K .   ? HOH A 1347 . ? 1_555 ? 
15 AC3 6  LEU A 506 ? LEU A 573  . ? 1_555 ? 
16 AC3 6  LEU A 507 ? LEU A 574  . ? 1_555 ? 
17 AC3 6  VAL A 509 ? VAL A 576  . ? 1_555 ? 
18 AC3 6  ILE A 512 ? ILE A 579  . ? 1_555 ? 
19 AC3 6  HOH K .   ? HOH A 1379 . ? 1_555 ? 
20 AC3 6  HOH K .   ? HOH A 1399 . ? 1_555 ? 
21 AC4 5  ARG A 546 ? ARG A 854  . ? 1_555 ? 
22 AC4 5  GLU A 644 ? GLU A 952  . ? 1_555 ? 
23 AC4 5  HOH K .   ? HOH A 1221 . ? 1_555 ? 
24 AC4 5  HOH K .   ? HOH A 1230 . ? 1_555 ? 
25 AC4 5  HOH K .   ? HOH A 1287 . ? 1_555 ? 
26 AC5 6  ILE A 124 ? ILE A 191  . ? 1_555 ? 
27 AC5 6  LYS A 125 ? LYS A 192  . ? 1_555 ? 
28 AC5 6  ALA A 126 ? ALA A 193  . ? 1_555 ? 
29 AC5 6  ARG A 195 ? ARG A 262  . ? 1_555 ? 
30 AC5 6  ARG A 691 ? ARG A 999  . ? 1_555 ? 
31 AC5 6  HOH K .   ? HOH A 1223 . ? 1_555 ? 
32 AC6 6  LYS A 329 ? LYS A 396  . ? 1_555 ? 
33 AC6 6  HIS A 389 ? HIS A 456  . ? 1_555 ? 
34 AC6 6  GLY A 390 ? GLY A 457  . ? 1_555 ? 
35 AC6 6  THR A 415 ? THR A 482  . ? 1_555 ? 
36 AC6 6  THR A 417 ? THR A 484  . ? 1_555 ? 
37 AC6 6  HOH K .   ? HOH A 1203 . ? 1_555 ? 
38 AC7 3  LEU A 56  ? LEU A 123  . ? 5_554 ? 
39 AC7 3  LYS A 59  ? LYS A 126  . ? 5_554 ? 
40 AC7 3  HOH K .   ? HOH A 1244 . ? 1_555 ? 
41 AC8 4  GLU A 46  ? GLU A 113  . ? 1_555 ? 
42 AC8 4  ILE A 219 ? ILE A 286  . ? 1_555 ? 
43 AC8 4  PRO A 220 ? PRO A 287  . ? 1_555 ? 
44 AC8 4  MG  D .   ? MG  A 1102 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6C90 
_atom_sites.fract_transf_matrix[1][1]   0.006773 
_atom_sites.fract_transf_matrix[1][2]   0.003911 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007821 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009844 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1 23  ? 54.575  -10.410 -45.365 1.00 81.23  ?  90   LEU A N     1 
ATOM   2    C  CA    . LEU A 1 23  ? 54.202  -9.071  -44.919 1.00 98.95  ?  90   LEU A CA    1 
ATOM   3    C  C     . LEU A 1 23  ? 52.802  -9.056  -44.315 1.00 81.79  ?  90   LEU A C     1 
ATOM   4    O  O     . LEU A 1 23  ? 51.812  -9.276  -45.012 1.00 86.97  ?  90   LEU A O     1 
ATOM   5    C  CB    . LEU A 1 23  ? 54.278  -8.079  -46.083 1.00 105.08 ?  90   LEU A CB    1 
ATOM   6    C  CG    . LEU A 1 23  ? 55.678  -7.595  -46.469 1.00 110.93 ?  90   LEU A CG    1 
ATOM   7    C  CD1   . LEU A 1 23  ? 55.658  -6.928  -47.836 1.00 92.72  ?  90   LEU A CD1   1 
ATOM   8    C  CD2   . LEU A 1 23  ? 56.228  -6.638  -45.419 1.00 78.23  ?  90   LEU A CD2   1 
ATOM   9    N  N     . SER A 1 24  ? 52.732  -8.795  -43.011 1.00 69.17  ?  91   SER A N     1 
ATOM   10   C  CA    . SER A 1 24  ? 51.468  -8.670  -42.289 1.00 66.77  ?  91   SER A CA    1 
ATOM   11   C  C     . SER A 1 24  ? 51.438  -7.298  -41.627 1.00 51.22  ?  91   SER A C     1 
ATOM   12   O  O     . SER A 1 24  ? 52.157  -7.058  -40.652 1.00 50.54  ?  91   SER A O     1 
ATOM   13   C  CB    . SER A 1 24  ? 51.316  -9.788  -41.258 1.00 59.76  ?  91   SER A CB    1 
ATOM   14   O  OG    . SER A 1 24  ? 50.061  -9.712  -40.603 1.00 77.38  ?  91   SER A OG    1 
ATOM   15   N  N     . LEU A 1 25  ? 50.611  -6.400  -42.153 1.00 50.51  ?  92   LEU A N     1 
ATOM   16   C  CA    . LEU A 1 25  ? 50.555  -5.029  -41.665 1.00 53.54  ?  92   LEU A CA    1 
ATOM   17   C  C     . LEU A 1 25  ? 49.489  -4.886  -40.586 1.00 49.14  ?  92   LEU A C     1 
ATOM   18   O  O     . LEU A 1 25  ? 48.405  -5.467  -40.682 1.00 50.01  ?  92   LEU A O     1 
ATOM   19   C  CB    . LEU A 1 25  ? 50.272  -4.061  -42.815 1.00 51.14  ?  92   LEU A CB    1 
ATOM   20   C  CG    . LEU A 1 25  ? 51.207  -4.186  -44.023 1.00 60.67  ?  92   LEU A CG    1 
ATOM   21   C  CD1   . LEU A 1 25  ? 50.944  -3.063  -45.015 1.00 61.71  ?  92   LEU A CD1   1 
ATOM   22   C  CD2   . LEU A 1 25  ? 52.673  -4.201  -43.601 1.00 54.78  ?  92   LEU A CD2   1 
ATOM   23   N  N     . ALA A 1 26  ? 49.809  -4.104  -39.559 1.00 52.85  ?  93   ALA A N     1 
ATOM   24   C  CA    . ALA A 1 26  ? 48.893  -3.905  -38.447 1.00 55.38  ?  93   ALA A CA    1 
ATOM   25   C  C     . ALA A 1 26  ? 47.709  -3.046  -38.872 1.00 61.41  ?  93   ALA A C     1 
ATOM   26   O  O     . ALA A 1 26  ? 47.870  -2.021  -39.541 1.00 55.69  ?  93   ALA A O     1 
ATOM   27   C  CB    . ALA A 1 26  ? 49.622  -3.249  -37.275 1.00 45.95  ?  93   ALA A CB    1 
ATOM   28   N  N     . ASP A 1 27  ? 46.508  -3.470  -38.470 1.00 56.10  ?  94   ASP A N     1 
ATOM   29   C  CA    . ASP A 1 27  ? 45.300  -2.726  -38.805 1.00 64.84  ?  94   ASP A CA    1 
ATOM   30   C  C     . ASP A 1 27  ? 45.159  -1.470  -37.952 1.00 64.72  ?  94   ASP A C     1 
ATOM   31   O  O     . ASP A 1 27  ? 44.794  -0.407  -38.468 1.00 71.04  ?  94   ASP A O     1 
ATOM   32   C  CB    . ASP A 1 27  ? 44.070  -3.619  -38.639 1.00 69.09  ?  94   ASP A CB    1 
ATOM   33   C  CG    . ASP A 1 27  ? 43.973  -4.685  -39.712 1.00 92.46  ?  94   ASP A CG    1 
ATOM   34   O  OD1   . ASP A 1 27  ? 44.331  -4.396  -40.874 1.00 85.22  ?  94   ASP A OD1   1 
ATOM   35   O  OD2   . ASP A 1 27  ? 43.537  -5.812  -39.395 1.00 101.63 ?  94   ASP A OD2   1 
ATOM   36   N  N     . LEU A 1 28  ? 45.438  -1.570  -36.654 1.00 55.53  ?  95   LEU A N     1 
ATOM   37   C  CA    . LEU A 1 28  ? 45.345  -0.438  -35.741 1.00 61.50  ?  95   LEU A CA    1 
ATOM   38   C  C     . LEU A 1 28  ? 46.688  -0.232  -35.055 1.00 53.41  ?  95   LEU A C     1 
ATOM   39   O  O     . LEU A 1 28  ? 47.242  -1.166  -34.465 1.00 48.30  ?  95   LEU A O     1 
ATOM   40   C  CB    . LEU A 1 28  ? 44.239  -0.653  -34.704 1.00 61.88  ?  95   LEU A CB    1 
ATOM   41   C  CG    . LEU A 1 28  ? 43.991  0.507   -33.735 1.00 74.07  ?  95   LEU A CG    1 
ATOM   42   C  CD1   . LEU A 1 28  ? 43.766  1.827   -34.472 1.00 68.80  ?  95   LEU A CD1   1 
ATOM   43   C  CD2   . LEU A 1 28  ? 42.805  0.193   -32.834 1.00 78.23  ?  95   LEU A CD2   1 
ATOM   44   N  N     . MET A 1 29  ? 47.200  0.987   -35.133 1.00 47.18  ?  96   MET A N     1 
ATOM   45   C  CA    . MET A 1 29  ? 48.504  1.353   -34.610 1.00 44.91  ?  96   MET A CA    1 
ATOM   46   C  C     . MET A 1 29  ? 48.374  2.052   -33.266 1.00 46.56  ?  96   MET A C     1 
ATOM   47   O  O     . MET A 1 29  ? 47.303  2.549   -32.907 1.00 43.65  ?  96   MET A O     1 
ATOM   48   C  CB    . MET A 1 29  ? 49.224  2.275   -35.598 1.00 42.17  ?  96   MET A CB    1 
ATOM   49   C  CG    . MET A 1 29  ? 49.638  1.585   -36.880 1.00 40.18  ?  96   MET A CG    1 
ATOM   50   S  SD    . MET A 1 29  ? 51.048  0.500   -36.617 1.00 46.83  ?  96   MET A SD    1 
ATOM   51   C  CE    . MET A 1 29  ? 52.356  1.711   -36.412 1.00 46.57  ?  96   MET A CE    1 
ATOM   52   N  N     . PRO A 1 30  ? 49.456  2.116   -32.493 1.00 43.08  ?  97   PRO A N     1 
ATOM   53   C  CA    . PRO A 1 30  ? 49.396  2.828   -31.211 1.00 39.41  ?  97   PRO A CA    1 
ATOM   54   C  C     . PRO A 1 30  ? 49.060  4.300   -31.407 1.00 47.26  ?  97   PRO A C     1 
ATOM   55   O  O     . PRO A 1 30  ? 49.565  4.957   -32.319 1.00 34.74  ?  97   PRO A O     1 
ATOM   56   C  CB    . PRO A 1 30  ? 50.805  2.642   -30.635 1.00 39.53  ?  97   PRO A CB    1 
ATOM   57   C  CG    . PRO A 1 30  ? 51.365  1.450   -31.346 1.00 40.75  ?  97   PRO A CG    1 
ATOM   58   C  CD    . PRO A 1 30  ? 50.767  1.484   -32.717 1.00 33.26  ?  97   PRO A CD    1 
ATOM   59   N  N     . ARG A 1 31  ? 48.190  4.813   -30.539 1.00 43.56  ?  98   ARG A N     1 
ATOM   60   C  CA    . ARG A 1 31  ? 47.830  6.231   -30.509 1.00 44.55  ?  98   ARG A CA    1 
ATOM   61   C  C     . ARG A 1 31  ? 48.128  6.745   -29.103 1.00 32.16  ?  98   ARG A C     1 
ATOM   62   O  O     . ARG A 1 31  ? 47.241  6.813   -28.249 1.00 35.90  ?  98   ARG A O     1 
ATOM   63   C  CB    . ARG A 1 31  ? 46.348  6.452   -30.891 1.00 53.63  ?  98   ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 31  ? 45.963  6.012   -32.300 1.00 67.25  ?  98   ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 31  ? 46.811  6.671   -33.387 1.00 101.71 ?  98   ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 31  ? 47.384  7.952   -32.977 1.00 112.69 ?  98   ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 31  ? 46.743  9.117   -33.008 1.00 129.04 ?  98   ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 31  ? 45.486  9.187   -33.427 1.00 140.59 ?  98   ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 31  ? 47.365  10.219  -32.612 1.00 145.49 ?  98   ARG A NH2   1 
ATOM   70   N  N     . VAL A 1 32  ? 49.383  7.110   -28.869 1.00 31.19  ?  99   VAL A N     1 
ATOM   71   C  CA    . VAL A 1 32  ? 49.851  7.510   -27.549 1.00 38.29  ?  99   VAL A CA    1 
ATOM   72   C  C     . VAL A 1 32  ? 50.640  8.804   -27.675 1.00 37.91  ?  99   VAL A C     1 
ATOM   73   O  O     . VAL A 1 32  ? 51.419  8.982   -28.618 1.00 41.37  ?  99   VAL A O     1 
ATOM   74   C  CB    . VAL A 1 32  ? 50.719  6.410   -26.900 1.00 30.95  ?  99   VAL A CB    1 
ATOM   75   C  CG1   . VAL A 1 32  ? 51.147  6.819   -25.496 1.00 29.12  ?  99   VAL A CG1   1 
ATOM   76   C  CG2   . VAL A 1 32  ? 49.969  5.087   -26.872 1.00 34.37  ?  99   VAL A CG2   1 
ATOM   77   N  N     . LYS A 1 33  ? 50.436  9.706   -26.718 1.00 35.52  ?  100  LYS A N     1 
ATOM   78   C  CA    . LYS A 1 33  ? 51.216  10.928  -26.600 1.00 34.47  ?  100  LYS A CA    1 
ATOM   79   C  C     . LYS A 1 33  ? 51.765  11.016  -25.184 1.00 28.78  ?  100  LYS A C     1 
ATOM   80   O  O     . LYS A 1 33  ? 51.245  10.389  -24.257 1.00 35.49  ?  100  LYS A O     1 
ATOM   81   C  CB    . LYS A 1 33  ? 50.371  12.166  -26.919 1.00 32.53  ?  100  LYS A CB    1 
ATOM   82   C  CG    . LYS A 1 33  ? 49.191  12.357  -25.976 1.00 41.88  ?  100  LYS A CG    1 
ATOM   83   C  CD    . LYS A 1 33  ? 48.261  13.469  -26.448 1.00 44.57  ?  100  LYS A CD    1 
ATOM   84   C  CE    . LYS A 1 33  ? 47.111  13.683  -25.471 1.00 41.55  ?  100  LYS A CE    1 
ATOM   85   N  NZ    . LYS A 1 33  ? 46.083  14.625  -25.994 1.00 50.87  ?  100  LYS A NZ    1 
ATOM   86   N  N     . VAL A 1 34  ? 52.824  11.805  -25.021 1.00 31.29  ?  101  VAL A N     1 
ATOM   87   C  CA    . VAL A 1 34  ? 53.510  11.942  -23.742 1.00 31.83  ?  101  VAL A CA    1 
ATOM   88   C  C     . VAL A 1 34  ? 53.464  13.402  -23.313 1.00 36.68  ?  101  VAL A C     1 
ATOM   89   O  O     . VAL A 1 34  ? 53.801  14.298  -24.095 1.00 34.68  ?  101  VAL A O     1 
ATOM   90   C  CB    . VAL A 1 34  ? 54.962  11.438  -23.822 1.00 29.19  ?  101  VAL A CB    1 
ATOM   91   C  CG1   . VAL A 1 34  ? 55.651  11.591  -22.472 1.00 28.24  ?  101  VAL A CG1   1 
ATOM   92   C  CG2   . VAL A 1 34  ? 54.986  9.983   -24.279 1.00 36.54  ?  101  VAL A CG2   1 
ATOM   93   N  N     . GLN A 1 35  ? 53.060  13.631  -22.067 1.00 37.47  ?  102  GLN A N     1 
ATOM   94   C  CA    . GLN A 1 35  ? 52.927  14.963  -21.496 1.00 34.71  ?  102  GLN A CA    1 
ATOM   95   C  C     . GLN A 1 35  ? 53.985  15.156  -20.420 1.00 39.00  ?  102  GLN A C     1 
ATOM   96   O  O     . GLN A 1 35  ? 54.086  14.348  -19.492 1.00 33.59  ?  102  GLN A O     1 
ATOM   97   C  CB    . GLN A 1 35  ? 51.529  15.160  -20.898 1.00 34.68  ?  102  GLN A CB    1 
ATOM   98   C  CG    . GLN A 1 35  ? 51.335  16.479  -20.157 1.00 47.25  ?  102  GLN A CG    1 
ATOM   99   C  CD    . GLN A 1 35  ? 51.348  17.680  -21.084 1.00 48.68  ?  102  GLN A CD    1 
ATOM   100  O  OE1   . GLN A 1 35  ? 50.713  17.670  -22.138 1.00 39.68  ?  102  GLN A OE1   1 
ATOM   101  N  NE2   . GLN A 1 35  ? 52.079  18.721  -20.698 1.00 47.70  ?  102  GLN A NE2   1 
ATOM   102  N  N     . SER A 1 36  ? 54.767  16.224  -20.544 1.00 38.58  ?  103  SER A N     1 
ATOM   103  C  CA    . SER A 1 36  ? 55.727  16.578  -19.509 1.00 33.42  ?  103  SER A CA    1 
ATOM   104  C  C     . SER A 1 36  ? 55.014  17.274  -18.359 1.00 40.59  ?  103  SER A C     1 
ATOM   105  O  O     . SER A 1 36  ? 54.095  18.068  -18.569 1.00 45.05  ?  103  SER A O     1 
ATOM   106  C  CB    . SER A 1 36  ? 56.821  17.484  -20.074 1.00 42.24  ?  103  SER A CB    1 
ATOM   107  O  OG    . SER A 1 36  ? 57.675  16.771  -20.951 1.00 54.92  ?  103  SER A OG    1 
ATOM   108  N  N     . VAL A 1 37  ? 55.439  16.964  -17.137 1.00 38.08  ?  104  VAL A N     1 
ATOM   109  C  CA    . VAL A 1 37  ? 54.827  17.497  -15.926 1.00 32.35  ?  104  VAL A CA    1 
ATOM   110  C  C     . VAL A 1 37  ? 55.928  18.129  -15.087 1.00 40.37  ?  104  VAL A C     1 
ATOM   111  O  O     . VAL A 1 37  ? 56.882  17.447  -14.692 1.00 37.59  ?  104  VAL A O     1 
ATOM   112  C  CB    . VAL A 1 37  ? 54.091  16.409  -15.126 1.00 33.43  ?  104  VAL A CB    1 
ATOM   113  C  CG1   . VAL A 1 37  ? 53.473  16.996  -13.866 1.00 36.72  ?  104  VAL A CG1   1 
ATOM   114  C  CG2   . VAL A 1 37  ? 53.029  15.744  -15.990 1.00 35.63  ?  104  VAL A CG2   1 
ATOM   115  N  N     . GLU A 1 38  ? 55.797  19.423  -14.811 1.00 49.32  ?  105  GLU A N     1 
ATOM   116  C  CA    . GLU A 1 38  ? 56.833  20.130  -14.074 1.00 47.06  ?  105  GLU A CA    1 
ATOM   117  C  C     . GLU A 1 38  ? 56.800  19.743  -12.602 1.00 35.58  ?  105  GLU A C     1 
ATOM   118  O  O     . GLU A 1 38  ? 55.730  19.587  -12.003 1.00 32.33  ?  105  GLU A O     1 
ATOM   119  C  CB    . GLU A 1 38  ? 56.668  21.642  -14.226 1.00 56.66  ?  105  GLU A CB    1 
ATOM   120  C  CG    . GLU A 1 38  ? 57.225  22.194  -15.532 1.00 45.10  ?  105  GLU A CG    1 
ATOM   121  C  CD    . GLU A 1 38  ? 57.674  23.637  -15.408 1.00 74.36  ?  105  GLU A CD    1 
ATOM   122  O  OE1   . GLU A 1 38  ? 58.328  23.973  -14.396 1.00 55.34  ?  105  GLU A OE1   1 
ATOM   123  O  OE2   . GLU A 1 38  ? 57.367  24.436  -16.320 1.00 79.54  ?  105  GLU A OE2   1 
ATOM   124  N  N     . THR A 1 39  ? 57.989  19.581  -12.025 1.00 32.44  ?  106  THR A N     1 
ATOM   125  C  CA    . THR A 1 39  ? 58.141  19.183  -10.635 1.00 35.02  ?  106  THR A CA    1 
ATOM   126  C  C     . THR A 1 39  ? 59.277  19.981  -10.015 1.00 35.26  ?  106  THR A C     1 
ATOM   127  O  O     . THR A 1 39  ? 60.117  20.554  -10.714 1.00 31.05  ?  106  THR A O     1 
ATOM   128  C  CB    . THR A 1 39  ? 58.441  17.680  -10.495 1.00 50.05  ?  106  THR A CB    1 
ATOM   129  O  OG1   . THR A 1 39  ? 59.648  17.366  -11.203 1.00 40.47  ?  106  THR A OG1   1 
ATOM   130  C  CG2   . THR A 1 39  ? 57.297  16.840  -11.045 1.00 46.83  ?  106  THR A CG2   1 
ATOM   131  N  N     . VAL A 1 40  ? 59.298  20.012  -8.683  1.00 37.25  ?  107  VAL A N     1 
ATOM   132  C  CA    . VAL A 1 40  ? 60.440  20.601  -8.005  1.00 46.30  ?  107  VAL A CA    1 
ATOM   133  C  C     . VAL A 1 40  ? 61.694  19.812  -8.379  1.00 52.63  ?  107  VAL A C     1 
ATOM   134  O  O     . VAL A 1 40  ? 61.633  18.663  -8.837  1.00 50.89  ?  107  VAL A O     1 
ATOM   135  C  CB    . VAL A 1 40  ? 60.239  20.636  -6.482  1.00 62.97  ?  107  VAL A CB    1 
ATOM   136  C  CG1   . VAL A 1 40  ? 59.112  21.597  -6.128  1.00 46.37  ?  107  VAL A CG1   1 
ATOM   137  C  CG2   . VAL A 1 40  ? 59.953  19.235  -5.937  1.00 57.92  ?  107  VAL A CG2   1 
ATOM   138  N  N     . GLU A 1 41  ? 62.845  20.450  -8.194  1.00 61.66  ?  108  GLU A N     1 
ATOM   139  C  CA    . GLU A 1 41  ? 64.104  19.851  -8.612  1.00 68.62  ?  108  GLU A CA    1 
ATOM   140  C  C     . GLU A 1 41  ? 64.282  18.479  -7.970  1.00 49.93  ?  108  GLU A C     1 
ATOM   141  O  O     . GLU A 1 41  ? 63.843  18.232  -6.843  1.00 43.13  ?  108  GLU A O     1 
ATOM   142  C  CB    . GLU A 1 41  ? 65.272  20.766  -8.235  1.00 94.48  ?  108  GLU A CB    1 
ATOM   143  C  CG    . GLU A 1 41  ? 66.460  20.700  -9.184  1.00 82.98  ?  108  GLU A CG    1 
ATOM   144  C  CD    . GLU A 1 41  ? 66.172  21.351  -10.525 1.00 100.41 ?  108  GLU A CD    1 
ATOM   145  O  OE1   . GLU A 1 41  ? 65.019  21.780  -10.749 1.00 71.68  ?  108  GLU A OE1   1 
ATOM   146  O  OE2   . GLU A 1 41  ? 67.102  21.437  -11.355 1.00 97.44  ?  108  GLU A OE2   1 
ATOM   147  N  N     . GLY A 1 42  ? 64.915  17.573  -8.712  1.00 41.38  ?  109  GLY A N     1 
ATOM   148  C  CA    . GLY A 1 42  ? 65.310  16.286  -8.178  1.00 65.28  ?  109  GLY A CA    1 
ATOM   149  C  C     . GLY A 1 42  ? 64.589  15.075  -8.733  1.00 61.63  ?  109  GLY A C     1 
ATOM   150  O  O     . GLY A 1 42  ? 64.712  13.989  -8.152  1.00 55.84  ?  109  GLY A O     1 
ATOM   151  N  N     . CYS A 1 43  ? 63.849  15.217  -9.830  1.00 47.13  ?  110  CYS A N     1 
ATOM   152  C  CA    . CYS A 1 43  ? 63.168  14.095  -10.463 1.00 39.87  ?  110  CYS A CA    1 
ATOM   153  C  C     . CYS A 1 43  ? 62.436  14.609  -11.694 1.00 43.39  ?  110  CYS A C     1 
ATOM   154  O  O     . CYS A 1 43  ? 62.100  15.793  -11.791 1.00 38.48  ?  110  CYS A O     1 
ATOM   155  C  CB    . CYS A 1 43  ? 62.173  13.416  -9.523  1.00 43.82  ?  110  CYS A CB    1 
ATOM   156  S  SG    . CYS A 1 43  ? 60.733  14.426  -9.165  1.00 51.83  ?  110  CYS A SG    1 
ATOM   157  N  N     . THR A 1 44  ? 62.183  13.696  -12.625 1.00 37.59  ?  111  THR A N     1 
ATOM   158  C  CA    . THR A 1 44  ? 61.444  13.983  -13.844 1.00 31.71  ?  111  THR A CA    1 
ATOM   159  C  C     . THR A 1 44  ? 60.109  13.253  -13.805 1.00 39.76  ?  111  THR A C     1 
ATOM   160  O  O     . THR A 1 44  ? 60.033  12.103  -13.362 1.00 39.99  ?  111  THR A O     1 
ATOM   161  C  CB    . THR A 1 44  ? 62.238  13.550  -15.078 1.00 37.48  ?  111  THR A CB    1 
ATOM   162  O  OG1   . THR A 1 44  ? 63.511  14.205  -15.078 1.00 53.59  ?  111  THR A OG1   1 
ATOM   163  C  CG2   . THR A 1 44  ? 61.485  13.898  -16.354 1.00 42.48  ?  111  THR A CG2   1 
ATOM   164  N  N     . HIS A 1 45  ? 59.059  13.926  -14.270 1.00 30.18  ?  112  HIS A N     1 
ATOM   165  C  CA    . HIS A 1 45  ? 57.715  13.363  -14.279 1.00 28.12  ?  112  HIS A CA    1 
ATOM   166  C  C     . HIS A 1 45  ? 57.117  13.548  -15.663 1.00 33.75  ?  112  HIS A C     1 
ATOM   167  O  O     . HIS A 1 45  ? 56.954  14.680  -16.128 1.00 32.73  ?  112  HIS A O     1 
ATOM   168  C  CB    . HIS A 1 45  ? 56.830  14.018  -13.218 1.00 28.32  ?  112  HIS A CB    1 
ATOM   169  C  CG    . HIS A 1 45  ? 55.460  13.420  -13.117 1.00 33.41  ?  112  HIS A CG    1 
ATOM   170  N  ND1   . HIS A 1 45  ? 54.588  13.732  -12.097 1.00 40.42  ?  112  HIS A ND1   1 
ATOM   171  C  CD2   . HIS A 1 45  ? 54.809  12.534  -13.908 1.00 36.31  ?  112  HIS A CD2   1 
ATOM   172  C  CE1   . HIS A 1 45  ? 53.461  13.064  -12.263 1.00 37.37  ?  112  HIS A CE1   1 
ATOM   173  N  NE2   . HIS A 1 45  ? 53.568  12.331  -13.356 1.00 30.92  ?  112  HIS A NE2   1 
ATOM   174  N  N     . GLU A 1 46  ? 56.798  12.434  -16.314 1.00 29.15  ?  113  GLU A N     1 
ATOM   175  C  CA    . GLU A 1 46  ? 56.069  12.424  -17.570 1.00 32.03  ?  113  GLU A CA    1 
ATOM   176  C  C     . GLU A 1 46  ? 54.908  11.454  -17.434 1.00 26.15  ?  113  GLU A C     1 
ATOM   177  O  O     . GLU A 1 46  ? 54.854  10.640  -16.510 1.00 30.65  ?  113  GLU A O     1 
ATOM   178  C  CB    . GLU A 1 46  ? 56.964  12.017  -18.747 1.00 34.39  ?  113  GLU A CB    1 
ATOM   179  C  CG    . GLU A 1 46  ? 58.255  12.804  -18.841 1.00 37.43  ?  113  GLU A CG    1 
ATOM   180  C  CD    . GLU A 1 46  ? 59.056  12.448  -20.074 1.00 45.41  ?  113  GLU A CD    1 
ATOM   181  O  OE1   . GLU A 1 46  ? 59.439  13.370  -20.823 1.00 52.88  ?  113  GLU A OE1   1 
ATOM   182  O  OE2   . GLU A 1 46  ? 59.294  11.242  -20.300 1.00 54.96  -1 113  GLU A OE2   1 
ATOM   183  N  N     . VAL A 1 47  ? 53.968  11.543  -18.365 1.00 27.86  ?  114  VAL A N     1 
ATOM   184  C  CA    . VAL A 1 47  ? 52.835  10.631  -18.389 1.00 29.72  ?  114  VAL A CA    1 
ATOM   185  C  C     . VAL A 1 47  ? 52.478  10.352  -19.839 1.00 36.48  ?  114  VAL A C     1 
ATOM   186  O  O     . VAL A 1 47  ? 52.318  11.281  -20.638 1.00 27.21  ?  114  VAL A O     1 
ATOM   187  C  CB    . VAL A 1 47  ? 51.625  11.193  -17.614 1.00 38.13  ?  114  VAL A CB    1 
ATOM   188  C  CG1   . VAL A 1 47  ? 51.211  12.553  -18.152 1.00 35.83  ?  114  VAL A CG1   1 
ATOM   189  C  CG2   . VAL A 1 47  ? 50.461  10.208  -17.658 1.00 32.95  ?  114  VAL A CG2   1 
ATOM   190  N  N     . ALA A 1 48  ? 52.393  9.072   -20.184 1.00 33.00  ?  115  ALA A N     1 
ATOM   191  C  CA    . ALA A 1 48  ? 51.859  8.645   -21.465 1.00 27.66  ?  115  ALA A CA    1 
ATOM   192  C  C     . ALA A 1 48  ? 50.358  8.459   -21.319 1.00 27.07  ?  115  ALA A C     1 
ATOM   193  O  O     . ALA A 1 48  ? 49.889  7.891   -20.330 1.00 30.02  ?  115  ALA A O     1 
ATOM   194  C  CB    . ALA A 1 48  ? 52.516  7.341   -21.919 1.00 28.37  ?  115  ALA A CB    1 
ATOM   195  N  N     . LEU A 1 49  ? 49.605  8.947   -22.294 1.00 20.97  ?  116  LEU A N     1 
ATOM   196  C  CA    . LEU A 1 49  ? 48.156  8.858   -22.234 1.00 36.23  ?  116  LEU A CA    1 
ATOM   197  C  C     . LEU A 1 49  ? 47.609  8.643   -23.635 1.00 25.31  ?  116  LEU A C     1 
ATOM   198  O  O     . LEU A 1 49  ? 48.303  8.893   -24.626 1.00 33.04  ?  116  LEU A O     1 
ATOM   199  C  CB    . LEU A 1 49  ? 47.532  10.114  -21.605 1.00 36.19  ?  116  LEU A CB    1 
ATOM   200  C  CG    . LEU A 1 49  ? 47.808  11.447  -22.286 1.00 34.33  ?  116  LEU A CG    1 
ATOM   201  C  CD1   . LEU A 1 49  ? 46.618  12.371  -22.096 1.00 56.90  ?  116  LEU A CD1   1 
ATOM   202  C  CD2   . LEU A 1 49  ? 49.056  12.087  -21.723 1.00 37.40  ?  116  LEU A CD2   1 
ATOM   203  N  N     . PRO A 1 50  ? 46.379  8.146   -23.749 1.00 31.96  ?  117  PRO A N     1 
ATOM   204  C  CA    . PRO A 1 50  ? 45.785  7.970   -25.078 1.00 33.95  ?  117  PRO A CA    1 
ATOM   205  C  C     . PRO A 1 50  ? 45.731  9.294   -25.819 1.00 38.66  ?  117  PRO A C     1 
ATOM   206  O  O     . PRO A 1 50  ? 45.358  10.327  -25.258 1.00 45.61  ?  117  PRO A O     1 
ATOM   207  C  CB    . PRO A 1 50  ? 44.387  7.427   -24.774 1.00 34.61  ?  117  PRO A CB    1 
ATOM   208  C  CG    . PRO A 1 50  ? 44.516  6.793   -23.424 1.00 29.65  ?  117  PRO A CG    1 
ATOM   209  C  CD    . PRO A 1 50  ? 45.499  7.642   -22.680 1.00 30.66  ?  117  PRO A CD    1 
ATOM   210  N  N     . ALA A 1 51  ? 46.112  9.255   -27.096 1.00 38.85  ?  118  ALA A N     1 
ATOM   211  C  CA    . ALA A 1 51  ? 46.253  10.486  -27.864 1.00 47.78  ?  118  ALA A CA    1 
ATOM   212  C  C     . ALA A 1 51  ? 44.925  11.218  -28.009 1.00 49.02  ?  118  ALA A C     1 
ATOM   213  O  O     . ALA A 1 51  ? 44.903  12.452  -28.086 1.00 44.92  ?  118  ALA A O     1 
ATOM   214  C  CB    . ALA A 1 51  ? 46.849  10.173  -29.237 1.00 48.97  ?  118  ALA A CB    1 
ATOM   215  N  N     . GLU A 1 52  ? 43.809  10.486  -28.035 1.00 42.60  ?  119  GLU A N     1 
ATOM   216  C  CA    . GLU A 1 52  ? 42.508  11.118  -28.218 1.00 52.34  ?  119  GLU A CA    1 
ATOM   217  C  C     . GLU A 1 52  ? 41.995  11.793  -26.953 1.00 51.33  ?  119  GLU A C     1 
ATOM   218  O  O     . GLU A 1 52  ? 41.065  12.602  -27.035 1.00 57.67  ?  119  GLU A O     1 
ATOM   219  C  CB    . GLU A 1 52  ? 41.475  10.092  -28.703 1.00 54.60  ?  119  GLU A CB    1 
ATOM   220  C  CG    . GLU A 1 52  ? 40.949  9.113   -27.645 1.00 64.28  ?  119  GLU A CG    1 
ATOM   221  C  CD    . GLU A 1 52  ? 41.899  7.961   -27.368 1.00 75.47  ?  119  GLU A CD    1 
ATOM   222  O  OE1   . GLU A 1 52  ? 43.029  7.968   -27.903 1.00 66.92  ?  119  GLU A OE1   1 
ATOM   223  O  OE2   . GLU A 1 52  ? 41.506  7.043   -26.616 1.00 79.24  -1 119  GLU A OE2   1 
ATOM   224  N  N     . GLU A 1 53  ? 42.567  11.480  -25.795 1.00 49.93  ?  120  GLU A N     1 
ATOM   225  C  CA    . GLU A 1 53  ? 42.101  12.036  -24.534 1.00 44.86  ?  120  GLU A CA    1 
ATOM   226  C  C     . GLU A 1 53  ? 42.848  13.321  -24.198 1.00 44.20  ?  120  GLU A C     1 
ATOM   227  O  O     . GLU A 1 53  ? 43.948  13.583  -24.693 1.00 49.65  ?  120  GLU A O     1 
ATOM   228  C  CB    . GLU A 1 53  ? 42.278  11.025  -23.400 1.00 46.29  ?  120  GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 53  ? 41.406  9.789   -23.526 1.00 49.52  ?  120  GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 53  ? 41.695  8.763   -22.447 1.00 64.54  ?  120  GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 53  ? 41.234  7.609   -22.583 1.00 76.35  ?  120  GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 53  ? 42.386  9.110   -21.464 1.00 57.43  -1 120  GLU A OE2   1 
ATOM   233  N  N     . ASP A 1 54  ? 42.225  14.128  -23.344 1.00 39.24  ?  121  ASP A N     1 
ATOM   234  C  CA    . ASP A 1 54  ? 42.846  15.337  -22.825 1.00 44.73  ?  121  ASP A CA    1 
ATOM   235  C  C     . ASP A 1 54  ? 43.685  15.007  -21.599 1.00 40.52  ?  121  ASP A C     1 
ATOM   236  O  O     . ASP A 1 54  ? 43.290  14.194  -20.758 1.00 42.50  ?  121  ASP A O     1 
ATOM   237  C  CB    . ASP A 1 54  ? 41.786  16.377  -22.457 1.00 58.13  ?  121  ASP A CB    1 
ATOM   238  C  CG    . ASP A 1 54  ? 41.403  17.259  -23.626 1.00 63.71  ?  121  ASP A CG    1 
ATOM   239  O  OD1   . ASP A 1 54  ? 42.268  17.511  -24.493 1.00 65.60  -1 121  ASP A OD1   1 
ATOM   240  O  OD2   . ASP A 1 54  ? 40.239  17.706  -23.672 1.00 69.28  ?  121  ASP A OD2   1 
ATOM   241  N  N     . TYR A 1 55  ? 44.847  15.641  -21.504 1.00 42.97  ?  122  TYR A N     1 
ATOM   242  C  CA    . TYR A 1 55  ? 45.678  15.495  -20.318 1.00 36.22  ?  122  TYR A CA    1 
ATOM   243  C  C     . TYR A 1 55  ? 44.998  16.155  -19.126 1.00 42.04  ?  122  TYR A C     1 
ATOM   244  O  O     . TYR A 1 55  ? 44.633  17.333  -19.183 1.00 38.56  ?  122  TYR A O     1 
ATOM   245  C  CB    . TYR A 1 55  ? 47.053  16.110  -20.556 1.00 39.01  ?  122  TYR A CB    1 
ATOM   246  C  CG    . TYR A 1 55  ? 47.819  16.371  -19.284 1.00 47.92  ?  122  TYR A CG    1 
ATOM   247  C  CD1   . TYR A 1 55  ? 48.247  15.321  -18.481 1.00 40.56  ?  122  TYR A CD1   1 
ATOM   248  C  CD2   . TYR A 1 55  ? 48.120  17.668  -18.886 1.00 39.67  ?  122  TYR A CD2   1 
ATOM   249  C  CE1   . TYR A 1 55  ? 48.950  15.553  -17.316 1.00 45.55  ?  122  TYR A CE1   1 
ATOM   250  C  CE2   . TYR A 1 55  ? 48.823  17.912  -17.723 1.00 38.08  ?  122  TYR A CE2   1 
ATOM   251  C  CZ    . TYR A 1 55  ? 49.236  16.851  -16.941 1.00 45.43  ?  122  TYR A CZ    1 
ATOM   252  O  OH    . TYR A 1 55  ? 49.934  17.085  -15.781 1.00 33.72  ?  122  TYR A OH    1 
ATOM   253  N  N     . LEU A 1 56  ? 44.812  15.392  -18.056 1.00 39.28  ?  123  LEU A N     1 
ATOM   254  C  CA    . LEU A 1 56  ? 44.254  15.917  -16.810 1.00 39.01  ?  123  LEU A CA    1 
ATOM   255  C  C     . LEU A 1 56  ? 45.295  15.797  -15.706 1.00 41.95  ?  123  LEU A C     1 
ATOM   256  O  O     . LEU A 1 56  ? 45.656  14.667  -15.322 1.00 33.79  ?  123  LEU A O     1 
ATOM   257  C  CB    . LEU A 1 56  ? 42.978  15.173  -16.419 1.00 39.70  ?  123  LEU A CB    1 
ATOM   258  C  CG    . LEU A 1 56  ? 41.789  15.304  -17.372 1.00 46.22  ?  123  LEU A CG    1 
ATOM   259  C  CD1   . LEU A 1 56  ? 40.567  14.614  -16.781 1.00 44.18  ?  123  LEU A CD1   1 
ATOM   260  C  CD2   . LEU A 1 56  ? 41.485  16.764  -17.683 1.00 43.31  ?  123  LEU A CD2   1 
ATOM   261  N  N     . PRO A 1 57  ? 45.811  16.904  -15.173 1.00 44.11  ?  124  PRO A N     1 
ATOM   262  C  CA    . PRO A 1 57  ? 46.799  16.808  -14.095 1.00 42.05  ?  124  PRO A CA    1 
ATOM   263  C  C     . PRO A 1 57  ? 46.274  15.997  -12.922 1.00 34.18  ?  124  PRO A C     1 
ATOM   264  O  O     . PRO A 1 57  ? 45.067  15.861  -12.712 1.00 33.73  ?  124  PRO A O     1 
ATOM   265  C  CB    . PRO A 1 57  ? 47.036  18.269  -13.696 1.00 40.90  ?  124  PRO A CB    1 
ATOM   266  C  CG    . PRO A 1 57  ? 46.692  19.051  -14.911 1.00 36.58  ?  124  PRO A CG    1 
ATOM   267  C  CD    . PRO A 1 57  ? 45.568  18.302  -15.569 1.00 40.76  ?  124  PRO A CD    1 
ATOM   268  N  N     . LEU A 1 58  ? 47.207  15.451  -12.151 1.00 32.91  ?  125  LEU A N     1 
ATOM   269  C  CA    . LEU A 1 58  ? 46.837  14.761  -10.927 1.00 41.80  ?  125  LEU A CA    1 
ATOM   270  C  C     . LEU A 1 58  ? 46.316  15.764  -9.905  1.00 39.49  ?  125  LEU A C     1 
ATOM   271  O  O     . LEU A 1 58  ? 46.676  16.944  -9.918  1.00 40.32  ?  125  LEU A O     1 
ATOM   272  C  CB    . LEU A 1 58  ? 48.032  13.996  -10.358 1.00 38.76  ?  125  LEU A CB    1 
ATOM   273  C  CG    . LEU A 1 58  ? 48.620  12.897  -11.252 1.00 37.25  ?  125  LEU A CG    1 
ATOM   274  C  CD1   . LEU A 1 58  ? 49.779  12.203  -10.551 1.00 36.91  ?  125  LEU A CD1   1 
ATOM   275  C  CD2   . LEU A 1 58  ? 47.549  11.886  -11.655 1.00 37.52  ?  125  LEU A CD2   1 
ATOM   276  N  N     . LYS A 1 59  ? 45.458  15.286  -9.018  1.00 41.65  ?  126  LYS A N     1 
ATOM   277  C  CA    . LYS A 1 59  ? 44.857  16.125  -7.999  1.00 45.56  ?  126  LYS A CA    1 
ATOM   278  C  C     . LYS A 1 59  ? 45.379  15.759  -6.617  1.00 48.37  ?  126  LYS A C     1 
ATOM   279  O  O     . LYS A 1 59  ? 45.856  14.641  -6.395  1.00 39.81  ?  126  LYS A O     1 
ATOM   280  C  CB    . LYS A 1 59  ? 43.331  15.993  -8.023  1.00 44.40  ?  126  LYS A CB    1 
ATOM   281  C  CG    . LYS A 1 59  ? 42.699  16.503  -9.304  1.00 38.26  ?  126  LYS A CG    1 
ATOM   282  C  CD    . LYS A 1 59  ? 41.186  16.487  -9.220  1.00 50.32  ?  126  LYS A CD    1 
ATOM   283  C  CE    . LYS A 1 59  ? 40.563  17.077  -10.472 1.00 65.77  ?  126  LYS A CE    1 
ATOM   284  N  NZ    . LYS A 1 59  ? 39.084  17.184  -10.364 1.00 80.39  ?  126  LYS A NZ    1 
ATOM   285  N  N     . PRO A 1 60  ? 45.318  16.686  -5.662  1.00 50.08  ?  127  PRO A N     1 
ATOM   286  C  CA    . PRO A 1 60  ? 45.785  16.372  -4.311  1.00 43.70  ?  127  PRO A CA    1 
ATOM   287  C  C     . PRO A 1 60  ? 45.059  15.168  -3.734  1.00 38.95  ?  127  PRO A C     1 
ATOM   288  O  O     . PRO A 1 60  ? 43.911  14.879  -4.077  1.00 38.40  ?  127  PRO A O     1 
ATOM   289  C  CB    . PRO A 1 60  ? 45.470  17.648  -3.520  1.00 42.44  ?  127  PRO A CB    1 
ATOM   290  C  CG    . PRO A 1 60  ? 45.467  18.725  -4.544  1.00 44.03  ?  127  PRO A CG    1 
ATOM   291  C  CD    . PRO A 1 60  ? 44.894  18.093  -5.780  1.00 41.57  ?  127  PRO A CD    1 
ATOM   292  N  N     . ARG A 1 61  ? 45.754  14.461  -2.849  1.00 42.81  ?  128  ARG A N     1 
ATOM   293  C  CA    . ARG A 1 61  ? 45.155  13.343  -2.137  1.00 46.02  ?  128  ARG A CA    1 
ATOM   294  C  C     . ARG A 1 61  ? 43.865  13.772  -1.451  1.00 44.11  ?  128  ARG A C     1 
ATOM   295  O  O     . ARG A 1 61  ? 43.815  14.806  -0.780  1.00 45.84  ?  128  ARG A O     1 
ATOM   296  C  CB    . ARG A 1 61  ? 46.148  12.804  -1.105  1.00 38.60  ?  128  ARG A CB    1 
ATOM   297  C  CG    . ARG A 1 61  ? 45.585  11.776  -0.132  1.00 40.84  ?  128  ARG A CG    1 
ATOM   298  C  CD    . ARG A 1 61  ? 46.562  11.563  1.009   1.00 38.75  ?  128  ARG A CD    1 
ATOM   299  N  NE    . ARG A 1 61  ? 47.858  11.097  0.522   1.00 55.98  ?  128  ARG A NE    1 
ATOM   300  C  CZ    . ARG A 1 61  ? 49.030  11.406  1.072   1.00 49.98  ?  128  ARG A CZ    1 
ATOM   301  N  NH1   . ARG A 1 61  ? 49.091  12.202  2.131   1.00 55.89  ?  128  ARG A NH1   1 
ATOM   302  N  NH2   . ARG A 1 61  ? 50.149  10.922  0.548   1.00 48.13  ?  128  ARG A NH2   1 
ATOM   303  N  N     . VAL A 1 62  ? 42.822  12.970  -1.624  1.00 36.97  ?  129  VAL A N     1 
ATOM   304  C  CA    . VAL A 1 62  ? 41.590  13.099  -0.856  1.00 50.55  ?  129  VAL A CA    1 
ATOM   305  C  C     . VAL A 1 62  ? 41.673  12.117  0.303   1.00 54.59  ?  129  VAL A C     1 
ATOM   306  O  O     . VAL A 1 62  ? 41.766  10.901  0.093   1.00 55.86  ?  129  VAL A O     1 
ATOM   307  C  CB    . VAL A 1 62  ? 40.351  12.829  -1.724  1.00 50.35  ?  129  VAL A CB    1 
ATOM   308  C  CG1   . VAL A 1 62  ? 39.084  12.923  -0.885  1.00 52.68  ?  129  VAL A CG1   1 
ATOM   309  C  CG2   . VAL A 1 62  ? 40.295  13.803  -2.891  1.00 48.93  ?  129  VAL A CG2   1 
ATOM   310  N  N     . GLY A 1 63  ? 41.652  12.637  1.521   1.00 53.75  ?  130  GLY A N     1 
ATOM   311  C  CA    . GLY A 1 63  ? 41.691  11.803  2.705   1.00 54.25  ?  130  GLY A CA    1 
ATOM   312  C  C     . GLY A 1 63  ? 43.085  11.700  3.287   1.00 46.36  ?  130  GLY A C     1 
ATOM   313  O  O     . GLY A 1 63  ? 44.024  12.393  2.888   1.00 49.13  ?  130  GLY A O     1 
ATOM   314  N  N     . LYS A 1 64  ? 43.208  10.803  4.260   1.00 49.04  ?  131  LYS A N     1 
ATOM   315  C  CA    . LYS A 1 64  ? 44.480  10.578  4.924   1.00 58.96  ?  131  LYS A CA    1 
ATOM   316  C  C     . LYS A 1 64  ? 45.408  9.745   4.045   1.00 55.37  ?  131  LYS A C     1 
ATOM   317  O  O     . LYS A 1 64  ? 44.975  9.011   3.151   1.00 45.53  ?  131  LYS A O     1 
ATOM   318  C  CB    . LYS A 1 64  ? 44.269  9.877   6.268   1.00 72.73  ?  131  LYS A CB    1 
ATOM   319  C  CG    . LYS A 1 64  ? 44.303  10.806  7.474   1.00 92.79  ?  131  LYS A CG    1 
ATOM   320  C  CD    . LYS A 1 64  ? 45.713  11.318  7.746   1.00 116.64 ?  131  LYS A CD    1 
ATOM   321  C  CE    . LYS A 1 64  ? 45.765  12.166  9.008   1.00 117.00 ?  131  LYS A CE    1 
ATOM   322  N  NZ    . LYS A 1 64  ? 47.151  12.599  9.335   1.00 81.44  ?  131  LYS A NZ    1 
ATOM   323  N  N     . ALA A 1 65  ? 46.705  9.875   4.310   1.00 42.07  ?  132  ALA A N     1 
ATOM   324  C  CA    . ALA A 1 65  ? 47.694  9.053   3.629   1.00 47.72  ?  132  ALA A CA    1 
ATOM   325  C  C     . ALA A 1 65  ? 47.471  7.584   3.963   1.00 47.90  ?  132  ALA A C     1 
ATOM   326  O  O     . ALA A 1 65  ? 47.259  7.225   5.125   1.00 45.65  ?  132  ALA A O     1 
ATOM   327  C  CB    . ALA A 1 65  ? 49.105  9.477   4.036   1.00 36.74  ?  132  ALA A CB    1 
ATOM   328  N  N     . ALA A 1 66  ? 47.517  6.732   2.935   1.00 46.45  ?  133  ALA A N     1 
ATOM   329  C  CA    . ALA A 1 66  ? 47.381  5.298   3.161   1.00 40.07  ?  133  ALA A CA    1 
ATOM   330  C  C     . ALA A 1 66  ? 48.471  4.777   4.087   1.00 35.88  ?  133  ALA A C     1 
ATOM   331  O  O     . ALA A 1 66  ? 48.259  3.797   4.810   1.00 48.98  ?  133  ALA A O     1 
ATOM   332  C  CB    . ALA A 1 66  ? 47.418  4.551   1.827   1.00 42.96  ?  133  ALA A CB    1 
ATOM   333  N  N     . LYS A 1 67  ? 49.636  5.417   4.084   1.00 40.11  ?  134  LYS A N     1 
ATOM   334  C  CA    . LYS A 1 67  ? 50.756  4.982   4.902   1.00 41.31  ?  134  LYS A CA    1 
ATOM   335  C  C     . LYS A 1 67  ? 51.616  6.193   5.221   1.00 45.03  ?  134  LYS A C     1 
ATOM   336  O  O     . LYS A 1 67  ? 51.758  7.095   4.392   1.00 44.36  ?  134  LYS A O     1 
ATOM   337  C  CB    . LYS A 1 67  ? 51.581  3.907   4.183   1.00 45.75  ?  134  LYS A CB    1 
ATOM   338  C  CG    . LYS A 1 67  ? 52.815  3.439   4.941   1.00 49.75  ?  134  LYS A CG    1 
ATOM   339  C  CD    . LYS A 1 67  ? 53.595  2.403   4.143   1.00 52.00  ?  134  LYS A CD    1 
ATOM   340  C  CE    . LYS A 1 67  ? 54.812  1.909   4.909   1.00 54.60  ?  134  LYS A CE    1 
ATOM   341  N  NZ    . LYS A 1 67  ? 54.431  1.062   6.075   1.00 64.41  ?  134  LYS A NZ    1 
ATOM   342  N  N     . GLU A 1 68  ? 52.181  6.207   6.423   1.00 51.38  ?  135  GLU A N     1 
ATOM   343  C  CA    . GLU A 1 68  ? 53.096  7.255   6.847   1.00 48.08  ?  135  GLU A CA    1 
ATOM   344  C  C     . GLU A 1 68  ? 54.454  6.643   7.155   1.00 49.29  ?  135  GLU A C     1 
ATOM   345  O  O     . GLU A 1 68  ? 54.557  5.464   7.507   1.00 51.24  ?  135  GLU A O     1 
ATOM   346  C  CB    . GLU A 1 68  ? 52.558  8.003   8.073   1.00 62.13  ?  135  GLU A CB    1 
ATOM   347  C  CG    . GLU A 1 68  ? 51.338  8.864   7.772   1.00 71.46  ?  135  GLU A CG    1 
ATOM   348  C  CD    . GLU A 1 68  ? 50.805  9.580   8.997   1.00 88.21  ?  135  GLU A CD    1 
ATOM   349  O  OE1   . GLU A 1 68  ? 51.273  9.280   10.115  1.00 98.03  ?  135  GLU A OE1   1 
ATOM   350  O  OE2   . GLU A 1 68  ? 49.917  10.444  8.839   1.00 89.27  -1 135  GLU A OE2   1 
ATOM   351  N  N     . TYR A 1 69  ? 55.497  7.455   7.010   1.00 47.08  ?  136  TYR A N     1 
ATOM   352  C  CA    . TYR A 1 69  ? 56.864  6.985   7.137   1.00 53.25  ?  136  TYR A CA    1 
ATOM   353  C  C     . TYR A 1 69  ? 57.604  7.791   8.198   1.00 56.48  ?  136  TYR A C     1 
ATOM   354  O  O     . TYR A 1 69  ? 57.315  8.976   8.393   1.00 54.12  ?  136  TYR A O     1 
ATOM   355  C  CB    . TYR A 1 69  ? 57.605  7.096   5.798   1.00 53.90  ?  136  TYR A CB    1 
ATOM   356  C  CG    . TYR A 1 69  ? 56.903  6.392   4.653   1.00 53.00  ?  136  TYR A CG    1 
ATOM   357  C  CD1   . TYR A 1 69  ? 55.842  6.994   3.987   1.00 50.13  ?  136  TYR A CD1   1 
ATOM   358  C  CD2   . TYR A 1 69  ? 57.302  5.128   4.238   1.00 44.33  ?  136  TYR A CD2   1 
ATOM   359  C  CE1   . TYR A 1 69  ? 55.197  6.358   2.944   1.00 40.70  ?  136  TYR A CE1   1 
ATOM   360  C  CE2   . TYR A 1 69  ? 56.663  4.484   3.195   1.00 41.61  ?  136  TYR A CE2   1 
ATOM   361  C  CZ    . TYR A 1 69  ? 55.612  5.104   2.551   1.00 49.13  ?  136  TYR A CZ    1 
ATOM   362  O  OH    . TYR A 1 69  ? 54.972  4.469   1.512   1.00 48.07  ?  136  TYR A OH    1 
ATOM   363  N  N     . PRO A 1 70  ? 58.567  7.177   8.899   1.00 60.56  ?  137  PRO A N     1 
ATOM   364  C  CA    . PRO A 1 70  ? 59.281  7.898   9.961   1.00 58.70  ?  137  PRO A CA    1 
ATOM   365  C  C     . PRO A 1 70  ? 60.450  8.721   9.442   1.00 57.16  ?  137  PRO A C     1 
ATOM   366  O  O     . PRO A 1 70  ? 61.359  9.071   10.201  1.00 63.75  ?  137  PRO A O     1 
ATOM   367  C  CB    . PRO A 1 70  ? 59.759  6.765   10.874  1.00 64.09  ?  137  PRO A CB    1 
ATOM   368  C  CG    . PRO A 1 70  ? 60.011  5.636   9.928   1.00 49.71  ?  137  PRO A CG    1 
ATOM   369  C  CD    . PRO A 1 70  ? 58.980  5.763   8.827   1.00 54.53  ?  137  PRO A CD    1 
ATOM   370  N  N     . PHE A 1 71  ? 60.442  9.024   8.148   1.00 51.93  ?  138  PHE A N     1 
ATOM   371  C  CA    . PHE A 1 71  ? 61.485  9.825   7.528   1.00 53.79  ?  138  PHE A CA    1 
ATOM   372  C  C     . PHE A 1 71  ? 60.843  10.731  6.489   1.00 49.13  ?  138  PHE A C     1 
ATOM   373  O  O     . PHE A 1 71  ? 59.682  10.554  6.109   1.00 45.54  ?  138  PHE A O     1 
ATOM   374  C  CB    . PHE A 1 71  ? 62.571  8.946   6.891   1.00 51.80  ?  138  PHE A CB    1 
ATOM   375  C  CG    . PHE A 1 71  ? 62.030  7.865   6.001   1.00 53.21  ?  138  PHE A CG    1 
ATOM   376  C  CD1   . PHE A 1 71  ? 61.688  8.137   4.688   1.00 53.12  ?  138  PHE A CD1   1 
ATOM   377  C  CD2   . PHE A 1 71  ? 61.858  6.577   6.480   1.00 56.40  ?  138  PHE A CD2   1 
ATOM   378  C  CE1   . PHE A 1 71  ? 61.185  7.146   3.868   1.00 58.41  ?  138  PHE A CE1   1 
ATOM   379  C  CE2   . PHE A 1 71  ? 61.356  5.580   5.663   1.00 51.94  ?  138  PHE A CE2   1 
ATOM   380  C  CZ    . PHE A 1 71  ? 61.019  5.866   4.355   1.00 49.34  ?  138  PHE A CZ    1 
ATOM   381  N  N     . ILE A 1 72  ? 61.611  11.713  6.031   1.00 39.12  ?  139  ILE A N     1 
ATOM   382  C  CA    . ILE A 1 72  ? 61.128  12.660  5.034   1.00 47.80  ?  139  ILE A CA    1 
ATOM   383  C  C     . ILE A 1 72  ? 61.235  12.016  3.658   1.00 50.23  ?  139  ILE A C     1 
ATOM   384  O  O     . ILE A 1 72  ? 62.335  11.692  3.198   1.00 38.16  ?  139  ILE A O     1 
ATOM   385  C  CB    . ILE A 1 72  ? 61.914  13.978  5.092   1.00 40.33  ?  139  ILE A CB    1 
ATOM   386  C  CG1   . ILE A 1 72  ? 61.526  14.762  6.349   1.00 48.53  ?  139  ILE A CG1   1 
ATOM   387  C  CG2   . ILE A 1 72  ? 61.666  14.807  3.827   1.00 45.90  ?  139  ILE A CG2   1 
ATOM   388  C  CD1   . ILE A 1 72  ? 62.290  16.060  6.539   1.00 56.63  ?  139  ILE A CD1   1 
ATOM   389  N  N     . LEU A 1 73  ? 60.093  11.837  2.998   1.00 39.58  ?  140  LEU A N     1 
ATOM   390  C  CA    . LEU A 1 73  ? 60.081  11.318  1.639   1.00 36.65  ?  140  LEU A CA    1 
ATOM   391  C  C     . LEU A 1 73  ? 60.818  12.265  0.700   1.00 43.18  ?  140  LEU A C     1 
ATOM   392  O  O     . LEU A 1 73  ? 60.801  13.487  0.870   1.00 51.56  ?  140  LEU A O     1 
ATOM   393  C  CB    . LEU A 1 73  ? 58.643  11.126  1.158   1.00 37.60  ?  140  LEU A CB    1 
ATOM   394  C  CG    . LEU A 1 73  ? 57.825  10.052  1.877   1.00 39.04  ?  140  LEU A CG    1 
ATOM   395  C  CD1   . LEU A 1 73  ? 56.374  10.115  1.449   1.00 45.23  ?  140  LEU A CD1   1 
ATOM   396  C  CD2   . LEU A 1 73  ? 58.390  8.675   1.599   1.00 48.96  ?  140  LEU A CD2   1 
ATOM   397  N  N     . ASP A 1 74  ? 61.477  11.686  -0.299  1.00 39.24  ?  141  ASP A N     1 
ATOM   398  C  CA    . ASP A 1 74  ? 62.122  12.472  -1.336  1.00 46.15  ?  141  ASP A CA    1 
ATOM   399  C  C     . ASP A 1 74  ? 61.107  12.873  -2.403  1.00 41.96  ?  141  ASP A C     1 
ATOM   400  O  O     . ASP A 1 74  ? 59.972  12.391  -2.437  1.00 43.38  ?  141  ASP A O     1 
ATOM   401  C  CB    . ASP A 1 74  ? 63.279  11.692  -1.956  1.00 52.44  ?  141  ASP A CB    1 
ATOM   402  C  CG    . ASP A 1 74  ? 64.501  11.649  -1.057  1.00 62.08  ?  141  ASP A CG    1 
ATOM   403  O  OD1   . ASP A 1 74  ? 64.806  12.680  -0.419  1.00 55.33  ?  141  ASP A OD1   1 
ATOM   404  O  OD2   . ASP A 1 74  ? 65.152  10.586  -0.984  1.00 57.97  -1 141  ASP A OD2   1 
ATOM   405  N  N     . ALA A 1 75  ? 61.536  13.771  -3.292  1.00 41.33  ?  142  ALA A N     1 
ATOM   406  C  CA    . ALA A 1 75  ? 60.627  14.330  -4.288  1.00 39.06  ?  142  ALA A CA    1 
ATOM   407  C  C     . ALA A 1 75  ? 60.051  13.244  -5.189  1.00 38.34  ?  142  ALA A C     1 
ATOM   408  O  O     . ALA A 1 75  ? 58.842  13.215  -5.450  1.00 34.35  ?  142  ALA A O     1 
ATOM   409  C  CB    . ALA A 1 75  ? 61.353  15.386  -5.122  1.00 54.85  ?  142  ALA A CB    1 
ATOM   410  N  N     . PHE A 1 76  ? 60.903  12.342  -5.684  1.00 34.54  ?  143  PHE A N     1 
ATOM   411  C  CA    . PHE A 1 76  ? 60.423  11.340  -6.628  1.00 42.18  ?  143  PHE A CA    1 
ATOM   412  C  C     . PHE A 1 76  ? 59.460  10.365  -5.960  1.00 33.39  ?  143  PHE A C     1 
ATOM   413  O  O     . PHE A 1 76  ? 58.538  9.865   -6.613  1.00 35.94  ?  143  PHE A O     1 
ATOM   414  C  CB    . PHE A 1 76  ? 61.604  10.604  -7.264  1.00 36.06  ?  143  PHE A CB    1 
ATOM   415  C  CG    . PHE A 1 76  ? 62.157  9.484   -6.428  1.00 44.71  ?  143  PHE A CG    1 
ATOM   416  C  CD1   . PHE A 1 76  ? 63.114  9.730   -5.458  1.00 38.69  ?  143  PHE A CD1   1 
ATOM   417  C  CD2   . PHE A 1 76  ? 61.736  8.180   -6.631  1.00 40.91  ?  143  PHE A CD2   1 
ATOM   418  C  CE1   . PHE A 1 76  ? 63.627  8.699   -4.695  1.00 39.10  ?  143  PHE A CE1   1 
ATOM   419  C  CE2   . PHE A 1 76  ? 62.243  7.150   -5.874  1.00 33.11  ?  143  PHE A CE2   1 
ATOM   420  C  CZ    . PHE A 1 76  ? 63.192  7.408   -4.905  1.00 40.04  ?  143  PHE A CZ    1 
ATOM   421  N  N     . GLN A 1 77  ? 59.636  10.108  -4.663  1.00 34.19  ?  144  GLN A N     1 
ATOM   422  C  CA    . GLN A 1 77  ? 58.698  9.249   -3.945  1.00 38.64  ?  144  GLN A CA    1 
ATOM   423  C  C     . GLN A 1 77  ? 57.339  9.923   -3.799  1.00 39.66  ?  144  GLN A C     1 
ATOM   424  O  O     . GLN A 1 77  ? 56.298  9.292   -4.022  1.00 37.05  ?  144  GLN A O     1 
ATOM   425  C  CB    . GLN A 1 77  ? 59.267  8.885   -2.575  1.00 38.25  ?  144  GLN A CB    1 
ATOM   426  C  CG    . GLN A 1 77  ? 60.568  8.109   -2.639  1.00 43.84  ?  144  GLN A CG    1 
ATOM   427  C  CD    . GLN A 1 77  ? 61.242  8.012   -1.289  1.00 46.17  ?  144  GLN A CD    1 
ATOM   428  O  OE1   . GLN A 1 77  ? 61.206  8.954   -0.504  1.00 45.50  ?  144  GLN A OE1   1 
ATOM   429  N  NE2   . GLN A 1 77  ? 61.849  6.865   -1.006  1.00 45.27  ?  144  GLN A NE2   1 
ATOM   430  N  N     A ARG A 1 78  ? 57.326  11.205  -3.428  0.55 40.25  ?  145  ARG A N     1 
ATOM   431  N  N     B ARG A 1 78  ? 57.331  11.201  -3.406  0.45 40.19  ?  145  ARG A N     1 
ATOM   432  C  CA    A ARG A 1 78  ? 56.060  11.921  -3.313  0.55 38.28  ?  145  ARG A CA    1 
ATOM   433  C  CA    B ARG A 1 78  ? 56.079  11.946  -3.316  0.45 38.10  ?  145  ARG A CA    1 
ATOM   434  C  C     A ARG A 1 78  ? 55.316  11.936  -4.641  0.55 32.91  ?  145  ARG A C     1 
ATOM   435  C  C     B ARG A 1 78  ? 55.327  11.917  -4.639  0.45 33.25  ?  145  ARG A C     1 
ATOM   436  O  O     A ARG A 1 78  ? 54.090  11.781  -4.678  0.55 34.78  ?  145  ARG A O     1 
ATOM   437  O  O     B ARG A 1 78  ? 54.107  11.716  -4.668  0.45 34.74  ?  145  ARG A O     1 
ATOM   438  C  CB    A ARG A 1 78  ? 56.305  13.349  -2.824  0.55 43.34  ?  145  ARG A CB    1 
ATOM   439  C  CB    B ARG A 1 78  ? 56.357  13.393  -2.904  0.45 43.28  ?  145  ARG A CB    1 
ATOM   440  C  CG    A ARG A 1 78  ? 56.925  13.429  -1.443  0.55 43.33  ?  145  ARG A CG    1 
ATOM   441  C  CG    B ARG A 1 78  ? 56.708  13.590  -1.439  0.45 43.37  ?  145  ARG A CG    1 
ATOM   442  C  CD    A ARG A 1 78  ? 56.855  14.838  -0.889  0.55 49.11  ?  145  ARG A CD    1 
ATOM   443  C  CD    B ARG A 1 78  ? 55.517  13.318  -0.535  0.45 47.51  ?  145  ARG A CD    1 
ATOM   444  N  NE    A ARG A 1 78  ? 57.604  15.793  -1.704  0.55 48.60  ?  145  ARG A NE    1 
ATOM   445  N  NE    B ARG A 1 78  ? 55.666  13.958  0.769   0.45 43.99  ?  145  ARG A NE    1 
ATOM   446  C  CZ    A ARG A 1 78  ? 58.877  16.126  -1.500  0.55 44.27  ?  145  ARG A CZ    1 
ATOM   447  C  CZ    B ARG A 1 78  ? 54.835  13.780  1.791   0.45 48.90  ?  145  ARG A CZ    1 
ATOM   448  N  NH1   A ARG A 1 78  ? 59.565  15.592  -0.498  0.55 39.33  ?  145  ARG A NH1   1 
ATOM   449  N  NH1   B ARG A 1 78  ? 53.791  12.970  1.670   0.45 61.14  ?  145  ARG A NH1   1 
ATOM   450  N  NH2   A ARG A 1 78  ? 59.462  17.007  -2.300  0.55 39.21  ?  145  ARG A NH2   1 
ATOM   451  N  NH2   B ARG A 1 78  ? 55.052  14.409  2.938   0.45 52.95  ?  145  ARG A NH2   1 
ATOM   452  N  N     . GLU A 1 79  ? 56.041  12.122  -5.746  1.00 30.58  ?  146  GLU A N     1 
ATOM   453  C  CA    . GLU A 1 79  ? 55.395  12.158  -7.052  1.00 35.25  ?  146  GLU A CA    1 
ATOM   454  C  C     . GLU A 1 79  ? 54.793  10.801  -7.395  1.00 35.82  ?  146  GLU A C     1 
ATOM   455  O  O     . GLU A 1 79  ? 53.621  10.706  -7.781  1.00 33.90  ?  146  GLU A O     1 
ATOM   456  C  CB    . GLU A 1 79  ? 56.405  12.593  -8.115  1.00 32.78  ?  146  GLU A CB    1 
ATOM   457  C  CG    . GLU A 1 79  ? 55.781  13.307  -9.298  1.00 52.02  ?  146  GLU A CG    1 
ATOM   458  C  CD    . GLU A 1 79  ? 55.187  14.650  -8.920  1.00 36.68  ?  146  GLU A CD    1 
ATOM   459  O  OE1   . GLU A 1 79  ? 55.666  15.261  -7.941  1.00 40.04  ?  146  GLU A OE1   1 
ATOM   460  O  OE2   . GLU A 1 79  ? 54.236  15.089  -9.597  1.00 48.25  ?  146  GLU A OE2   1 
ATOM   461  N  N     . ALA A 1 80  ? 55.580  9.733   -7.246  1.00 32.48  ?  147  ALA A N     1 
ATOM   462  C  CA    . ALA A 1 80  ? 55.062  8.392   -7.496  1.00 31.07  ?  147  ALA A CA    1 
ATOM   463  C  C     . ALA A 1 80  ? 53.852  8.100   -6.619  1.00 27.44  ?  147  ALA A C     1 
ATOM   464  O  O     . ALA A 1 80  ? 52.856  7.534   -7.089  1.00 28.15  ?  147  ALA A O     1 
ATOM   465  C  CB    . ALA A 1 80  ? 56.165  7.357   -7.258  1.00 37.85  ?  147  ALA A CB    1 
ATOM   466  N  N     . ILE A 1 81  ? 53.912  8.491   -5.344  1.00 31.01  ?  148  ILE A N     1 
ATOM   467  C  CA    . ILE A 1 81  ? 52.808  8.224   -4.425  1.00 34.65  ?  148  ILE A CA    1 
ATOM   468  C  C     . ILE A 1 81  ? 51.544  8.954   -4.871  1.00 37.29  ?  148  ILE A C     1 
ATOM   469  O  O     . ILE A 1 81  ? 50.428  8.443   -4.711  1.00 30.88  ?  148  ILE A O     1 
ATOM   470  C  CB    . ILE A 1 81  ? 53.210  8.603   -2.986  1.00 35.69  ?  148  ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 81  ? 54.108  7.510   -2.395  1.00 37.31  ?  148  ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 81  ? 51.972  8.820   -2.120  1.00 37.46  ?  148  ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 81  ? 54.747  7.865   -1.064  1.00 38.95  ?  148  ILE A CD1   1 
ATOM   474  N  N     . GLN A 1 82  ? 51.689  10.162  -5.426  1.00 34.49  ?  149  GLN A N     1 
ATOM   475  C  CA    . GLN A 1 82  ? 50.509  10.893  -5.876  1.00 34.66  ?  149  GLN A CA    1 
ATOM   476  C  C     . GLN A 1 82  ? 49.825  10.169  -7.029  1.00 29.91  ?  149  GLN A C     1 
ATOM   477  O  O     . GLN A 1 82  ? 48.594  10.182  -7.134  1.00 32.91  ?  149  GLN A O     1 
ATOM   478  C  CB    . GLN A 1 82  ? 50.880  12.321  -6.283  1.00 38.62  ?  149  GLN A CB    1 
ATOM   479  C  CG    . GLN A 1 82  ? 49.690  13.275  -6.219  1.00 48.47  ?  149  GLN A CG    1 
ATOM   480  C  CD    . GLN A 1 82  ? 49.961  14.630  -6.845  1.00 42.87  ?  149  GLN A CD    1 
ATOM   481  O  OE1   . GLN A 1 82  ? 51.099  14.970  -7.170  1.00 48.23  ?  149  GLN A OE1   1 
ATOM   482  N  NE2   . GLN A 1 82  ? 48.905  15.411  -7.023  1.00 46.90  ?  149  GLN A NE2   1 
ATOM   483  N  N     . CYS A 1 83  ? 50.604  9.525   -7.900  1.00 34.77  ?  150  CYS A N     1 
ATOM   484  C  CA    . CYS A 1 83  ? 50.011  8.706   -8.953  1.00 38.09  ?  150  CYS A CA    1 
ATOM   485  C  C     . CYS A 1 83  ? 49.124  7.622   -8.358  1.00 31.77  ?  150  CYS A C     1 
ATOM   486  O  O     . CYS A 1 83  ? 47.997  7.398   -8.816  1.00 29.58  ?  150  CYS A O     1 
ATOM   487  C  CB    . CYS A 1 83  ? 51.109  8.085   -9.815  1.00 30.65  ?  150  CYS A CB    1 
ATOM   488  S  SG    . CYS A 1 83  ? 52.151  9.282   -10.679 1.00 31.15  ?  150  CYS A SG    1 
ATOM   489  N  N     . VAL A 1 84  ? 49.618  6.941   -7.324  1.00 32.12  ?  151  VAL A N     1 
ATOM   490  C  CA    . VAL A 1 84  ? 48.835  5.888   -6.689  1.00 36.32  ?  151  VAL A CA    1 
ATOM   491  C  C     . VAL A 1 84  ? 47.584  6.471   -6.037  1.00 32.86  ?  151  VAL A C     1 
ATOM   492  O  O     . VAL A 1 84  ? 46.492  5.898   -6.141  1.00 40.61  ?  151  VAL A O     1 
ATOM   493  C  CB    . VAL A 1 84  ? 49.710  5.124   -5.678  1.00 31.88  ?  151  VAL A CB    1 
ATOM   494  C  CG1   . VAL A 1 84  ? 48.889  4.075   -4.933  1.00 33.09  ?  151  VAL A CG1   1 
ATOM   495  C  CG2   . VAL A 1 84  ? 50.890  4.479   -6.393  1.00 32.07  ?  151  VAL A CG2   1 
ATOM   496  N  N     . ASP A 1 85  ? 47.720  7.614   -5.355  1.00 36.05  ?  152  ASP A N     1 
ATOM   497  C  CA    . ASP A 1 85  ? 46.559  8.253   -4.739  1.00 33.53  ?  152  ASP A CA    1 
ATOM   498  C  C     . ASP A 1 85  ? 45.482  8.576   -5.765  1.00 37.02  ?  152  ASP A C     1 
ATOM   499  O  O     . ASP A 1 85  ? 44.290  8.575   -5.436  1.00 40.46  ?  152  ASP A O     1 
ATOM   500  C  CB    . ASP A 1 85  ? 46.977  9.530   -4.010  1.00 34.13  ?  152  ASP A CB    1 
ATOM   501  C  CG    . ASP A 1 85  ? 47.463  9.268   -2.597  1.00 37.58  ?  152  ASP A CG    1 
ATOM   502  O  OD1   . ASP A 1 85  ? 46.936  8.342   -1.946  1.00 35.16  -1 152  ASP A OD1   1 
ATOM   503  O  OD2   . ASP A 1 85  ? 48.366  9.998   -2.134  1.00 33.94  ?  152  ASP A OD2   1 
ATOM   504  N  N     . ASN A 1 86  ? 45.876  8.859   -7.003  1.00 36.57  ?  153  ASN A N     1 
ATOM   505  C  CA    . ASN A 1 86  ? 44.935  9.130   -8.080  1.00 33.35  ?  153  ASN A CA    1 
ATOM   506  C  C     . ASN A 1 86  ? 44.567  7.879   -8.869  1.00 38.55  ?  153  ASN A C     1 
ATOM   507  O  O     . ASN A 1 86  ? 43.890  7.987   -9.898  1.00 29.99  ?  153  ASN A O     1 
ATOM   508  C  CB    . ASN A 1 86  ? 45.513  10.192  -9.018  1.00 33.75  ?  153  ASN A CB    1 
ATOM   509  C  CG    . ASN A 1 86  ? 45.479  11.584  -8.412  1.00 37.71  ?  153  ASN A CG    1 
ATOM   510  O  OD1   . ASN A 1 86  ? 44.538  12.345  -8.636  1.00 38.14  ?  153  ASN A OD1   1 
ATOM   511  N  ND2   . ASN A 1 86  ? 46.506  11.921  -7.639  1.00 35.32  ?  153  ASN A ND2   1 
ATOM   512  N  N     . ASN A 1 87  ? 44.995  6.701   -8.410  1.00 35.30  ?  154  ASN A N     1 
ATOM   513  C  CA    . ASN A 1 87  ? 44.653  5.425   -9.044  1.00 38.18  ?  154  ASN A CA    1 
ATOM   514  C  C     . ASN A 1 87  ? 45.089  5.386   -10.508 1.00 36.22  ?  154  ASN A C     1 
ATOM   515  O  O     . ASN A 1 87  ? 44.329  5.000   -11.400 1.00 35.65  ?  154  ASN A O     1 
ATOM   516  C  CB    . ASN A 1 87  ? 43.157  5.136   -8.907  1.00 44.29  ?  154  ASN A CB    1 
ATOM   517  C  CG    . ASN A 1 87  ? 42.815  4.509   -7.576  1.00 66.25  ?  154  ASN A CG    1 
ATOM   518  O  OD1   . ASN A 1 87  ? 42.665  5.202   -6.568  1.00 74.51  ?  154  ASN A OD1   1 
ATOM   519  N  ND2   . ASN A 1 87  ? 42.705  3.186   -7.560  1.00 70.47  ?  154  ASN A ND2   1 
ATOM   520  N  N     . GLN A 1 88  ? 46.340  5.771   -10.747 1.00 29.43  ?  155  GLN A N     1 
ATOM   521  C  CA    . GLN A 1 88  ? 46.926  5.728   -12.078 1.00 33.69  ?  155  GLN A CA    1 
ATOM   522  C  C     . GLN A 1 88  ? 48.270  5.018   -12.013 1.00 28.65  ?  155  GLN A C     1 
ATOM   523  O  O     . GLN A 1 88  ? 48.999  5.131   -11.022 1.00 29.91  ?  155  GLN A O     1 
ATOM   524  C  CB    . GLN A 1 88  ? 47.069  7.142   -12.662 1.00 35.05  ?  155  GLN A CB    1 
ATOM   525  C  CG    . GLN A 1 88  ? 45.713  7.808   -12.900 1.00 40.02  ?  155  GLN A CG    1 
ATOM   526  C  CD    . GLN A 1 88  ? 45.807  9.167   -13.565 1.00 40.76  ?  155  GLN A CD    1 
ATOM   527  O  OE1   . GLN A 1 88  ? 46.803  9.493   -14.212 1.00 33.99  ?  155  GLN A OE1   1 
ATOM   528  N  NE2   . GLN A 1 88  ? 44.758  9.969   -13.411 1.00 43.30  ?  155  GLN A NE2   1 
ATOM   529  N  N     . SER A 1 89  ? 48.579  4.272   -13.070 1.00 31.63  ?  156  SER A N     1 
ATOM   530  C  CA    . SER A 1 89  ? 49.779  3.449   -13.092 1.00 29.00  ?  156  SER A CA    1 
ATOM   531  C  C     . SER A 1 89  ? 51.025  4.319   -13.194 1.00 30.45  ?  156  SER A C     1 
ATOM   532  O  O     . SER A 1 89  ? 50.991  5.436   -13.714 1.00 29.30  ?  156  SER A O     1 
ATOM   533  C  CB    . SER A 1 89  ? 49.719  2.469   -14.260 1.00 31.49  ?  156  SER A CB    1 
ATOM   534  O  OG    . SER A 1 89  ? 48.580  1.630   -14.152 1.00 29.43  ?  156  SER A OG    1 
ATOM   535  N  N     . VAL A 1 90  ? 52.140  3.795   -12.692 1.00 28.39  ?  157  VAL A N     1 
ATOM   536  C  CA    . VAL A 1 90  ? 53.371  4.573   -12.613 1.00 27.68  ?  157  VAL A CA    1 
ATOM   537  C  C     . VAL A 1 90  ? 54.565  3.638   -12.713 1.00 27.87  ?  157  VAL A C     1 
ATOM   538  O  O     . VAL A 1 90  ? 54.629  2.613   -12.028 1.00 26.78  ?  157  VAL A O     1 
ATOM   539  C  CB    . VAL A 1 90  ? 53.436  5.396   -11.310 1.00 27.68  ?  157  VAL A CB    1 
ATOM   540  C  CG1   . VAL A 1 90  ? 53.193  4.501   -10.105 1.00 27.79  ?  157  VAL A CG1   1 
ATOM   541  C  CG2   . VAL A 1 90  ? 54.775  6.123   -11.193 1.00 27.98  ?  157  VAL A CG2   1 
ATOM   542  N  N     . LEU A 1 91  ? 55.510  4.002   -13.572 1.00 29.77  ?  158  LEU A N     1 
ATOM   543  C  CA    . LEU A 1 91  ? 56.837  3.405   -13.602 1.00 22.24  ?  158  LEU A CA    1 
ATOM   544  C  C     . LEU A 1 91  ? 57.785  4.310   -12.826 1.00 31.37  ?  158  LEU A C     1 
ATOM   545  O  O     . LEU A 1 91  ? 57.891  5.505   -13.129 1.00 29.17  ?  158  LEU A O     1 
ATOM   546  C  CB    . LEU A 1 91  ? 57.321  3.228   -15.042 1.00 22.31  ?  158  LEU A CB    1 
ATOM   547  C  CG    . LEU A 1 91  ? 58.819  2.997   -15.259 1.00 22.38  ?  158  LEU A CG    1 
ATOM   548  C  CD1   . LEU A 1 91  ? 59.277  1.689   -14.628 1.00 28.12  ?  158  LEU A CD1   1 
ATOM   549  C  CD2   . LEU A 1 91  ? 59.148  3.027   -16.746 1.00 29.37  ?  158  LEU A CD2   1 
ATOM   550  N  N     . VAL A 1 92  ? 58.464  3.747   -11.831 1.00 28.80  ?  159  VAL A N     1 
ATOM   551  C  CA    . VAL A 1 92  ? 59.475  4.461   -11.057 1.00 24.28  ?  159  VAL A CA    1 
ATOM   552  C  C     . VAL A 1 92  ? 60.835  3.909   -11.452 1.00 27.20  ?  159  VAL A C     1 
ATOM   553  O  O     . VAL A 1 92  ? 61.132  2.731   -11.211 1.00 25.96  ?  159  VAL A O     1 
ATOM   554  C  CB    . VAL A 1 92  ? 59.246  4.325   -9.544  1.00 28.32  ?  159  VAL A CB    1 
ATOM   555  C  CG1   . VAL A 1 92  ? 60.237  5.195   -8.783  1.00 26.95  ?  159  VAL A CG1   1 
ATOM   556  C  CG2   . VAL A 1 92  ? 57.816  4.697   -9.183  1.00 31.19  ?  159  VAL A CG2   1 
ATOM   557  N  N     . SER A 1 93  ? 61.658  4.757   -12.055 1.00 24.21  ?  160  SER A N     1 
ATOM   558  C  CA    . SER A 1 93  ? 62.986  4.385   -12.525 1.00 21.44  ?  160  SER A CA    1 
ATOM   559  C  C     . SER A 1 93  ? 63.997  5.171   -11.701 1.00 26.55  ?  160  SER A C     1 
ATOM   560  O  O     . SER A 1 93  ? 64.122  6.391   -11.860 1.00 26.93  ?  160  SER A O     1 
ATOM   561  C  CB    . SER A 1 93  ? 63.131  4.673   -14.018 1.00 27.01  ?  160  SER A CB    1 
ATOM   562  O  OG    . SER A 1 93  ? 64.343  4.155   -14.534 1.00 29.44  ?  160  SER A OG    1 
ATOM   563  N  N     . ALA A 1 94  ? 64.701  4.478   -10.811 1.00 31.34  ?  161  ALA A N     1 
ATOM   564  C  CA    . ALA A 1 94  ? 65.655  5.121   -9.919  1.00 29.17  ?  161  ALA A CA    1 
ATOM   565  C  C     . ALA A 1 94  ? 66.686  4.094   -9.482  1.00 35.10  ?  161  ALA A C     1 
ATOM   566  O  O     . ALA A 1 94  ? 66.475  2.885   -9.602  1.00 31.78  ?  161  ALA A O     1 
ATOM   567  C  CB    . ALA A 1 94  ? 64.957  5.735   -8.699  1.00 30.45  ?  161  ALA A CB    1 
ATOM   568  N  N     . HIS A 1 95  ? 67.805  4.595   -8.966  1.00 33.94  ?  162  HIS A N     1 
ATOM   569  C  CA    . HIS A 1 95  ? 68.853  3.716   -8.475  1.00 36.57  ?  162  HIS A CA    1 
ATOM   570  C  C     . HIS A 1 95  ? 68.343  2.877   -7.314  1.00 47.04  ?  162  HIS A C     1 
ATOM   571  O  O     . HIS A 1 95  ? 67.508  3.315   -6.517  1.00 39.14  ?  162  HIS A O     1 
ATOM   572  C  CB    . HIS A 1 95  ? 70.069  4.520   -8.014  1.00 38.57  ?  162  HIS A CB    1 
ATOM   573  C  CG    . HIS A 1 95  ? 70.799  5.201   -9.125  1.00 35.35  ?  162  HIS A CG    1 
ATOM   574  N  ND1   . HIS A 1 95  ? 71.378  4.508   -10.166 1.00 38.50  ?  162  HIS A ND1   1 
ATOM   575  C  CD2   . HIS A 1 95  ? 71.050  6.510   -9.358  1.00 38.06  ?  162  HIS A CD2   1 
ATOM   576  C  CE1   . HIS A 1 95  ? 71.948  5.362   -10.996 1.00 38.58  ?  162  HIS A CE1   1 
ATOM   577  N  NE2   . HIS A 1 95  ? 71.764  6.584   -10.529 1.00 43.06  ?  162  HIS A NE2   1 
ATOM   578  N  N     . THR A 1 96  ? 68.857  1.654   -7.227  1.00 56.67  ?  163  THR A N     1 
ATOM   579  C  CA    . THR A 1 96  ? 68.677  0.838   -6.034  1.00 73.16  ?  163  THR A CA    1 
ATOM   580  C  C     . THR A 1 96  ? 69.435  1.506   -4.894  1.00 66.05  ?  163  THR A C     1 
ATOM   581  O  O     . THR A 1 96  ? 70.665  1.614   -4.948  1.00 76.08  ?  163  THR A O     1 
ATOM   582  C  CB    . THR A 1 96  ? 69.177  -0.585  -6.272  1.00 72.93  ?  163  THR A CB    1 
ATOM   583  O  OG1   . THR A 1 96  ? 68.690  -1.063  -7.533  1.00 76.00  ?  163  THR A OG1   1 
ATOM   584  C  CG2   . THR A 1 96  ? 68.688  -1.513  -5.167  1.00 60.62  ?  163  THR A CG2   1 
ATOM   585  N  N     . SER A 1 97  ? 68.692  1.967   -3.883  1.00 53.07  ?  164  SER A N     1 
ATOM   586  C  CA    . SER A 1 97  ? 69.188  2.731   -2.736  1.00 67.02  ?  164  SER A CA    1 
ATOM   587  C  C     . SER A 1 97  ? 68.413  4.037   -2.621  1.00 58.21  ?  164  SER A C     1 
ATOM   588  O  O     . SER A 1 97  ? 68.356  4.638   -1.544  1.00 56.54  ?  164  SER A O     1 
ATOM   589  C  CB    . SER A 1 97  ? 70.685  3.044   -2.820  1.00 60.11  ?  164  SER A CB    1 
ATOM   590  O  OG    . SER A 1 97  ? 70.992  3.801   -3.977  1.00 59.26  ?  164  SER A OG    1 
ATOM   591  N  N     . ALA A 1 98  ? 67.821  4.492   -3.728  1.00 39.46  ?  165  ALA A N     1 
ATOM   592  C  CA    . ALA A 1 98  ? 67.032  5.715   -3.693  1.00 50.38  ?  165  ALA A CA    1 
ATOM   593  C  C     . ALA A 1 98  ? 65.718  5.527   -2.946  1.00 44.76  ?  165  ALA A C     1 
ATOM   594  O  O     . ALA A 1 98  ? 65.149  6.513   -2.466  1.00 45.98  ?  165  ALA A O     1 
ATOM   595  C  CB    . ALA A 1 98  ? 66.765  6.211   -5.115  1.00 34.79  ?  165  ALA A CB    1 
ATOM   596  N  N     . GLY A 1 99  ? 65.227  4.292   -2.835  1.00 45.42  ?  166  GLY A N     1 
ATOM   597  C  CA    . GLY A 1 99  ? 64.048  4.012   -2.037  1.00 44.74  ?  166  GLY A CA    1 
ATOM   598  C  C     . GLY A 1 99  ? 62.782  3.761   -2.831  1.00 41.65  ?  166  GLY A C     1 
ATOM   599  O  O     . GLY A 1 99  ? 61.711  4.260   -2.470  1.00 40.10  ?  166  GLY A O     1 
ATOM   600  N  N     . LYS A 1 100 ? 62.882  2.981   -3.909  1.00 43.46  ?  167  LYS A N     1 
ATOM   601  C  CA    . LYS A 1 100 ? 61.702  2.668   -4.708  1.00 36.89  ?  167  LYS A CA    1 
ATOM   602  C  C     . LYS A 1 100 ? 60.675  1.866   -3.919  1.00 37.25  ?  167  LYS A C     1 
ATOM   603  O  O     . LYS A 1 100 ? 59.469  2.000   -4.157  1.00 33.54  ?  167  LYS A O     1 
ATOM   604  C  CB    . LYS A 1 100 ? 62.111  1.899   -5.962  1.00 33.99  ?  167  LYS A CB    1 
ATOM   605  C  CG    . LYS A 1 100 ? 62.801  2.743   -7.019  1.00 29.97  ?  167  LYS A CG    1 
ATOM   606  C  CD    . LYS A 1 100 ? 63.378  1.876   -8.128  1.00 39.68  ?  167  LYS A CD    1 
ATOM   607  C  CE    . LYS A 1 100 ? 64.652  1.166   -7.664  1.00 40.47  ?  167  LYS A CE    1 
ATOM   608  N  NZ    . LYS A 1 100 ? 65.210  0.260   -8.701  1.00 48.38  ?  167  LYS A NZ    1 
ATOM   609  N  N     . THR A 1 101 ? 61.126  1.027   -2.982  1.00 41.66  ?  168  THR A N     1 
ATOM   610  C  CA    . THR A 1 101 ? 60.200  0.154   -2.262  1.00 43.12  ?  168  THR A CA    1 
ATOM   611  C  C     . THR A 1 101 ? 59.179  0.956   -1.465  1.00 39.66  ?  168  THR A C     1 
ATOM   612  O  O     . THR A 1 101 ? 58.065  0.476   -1.219  1.00 31.80  ?  168  THR A O     1 
ATOM   613  C  CB    . THR A 1 101 ? 60.978  -0.788  -1.341  1.00 44.44  ?  168  THR A CB    1 
ATOM   614  O  OG1   . THR A 1 101 ? 61.882  -1.578  -2.122  1.00 53.83  ?  168  THR A OG1   1 
ATOM   615  C  CG2   . THR A 1 101 ? 60.034  -1.714  -0.579  1.00 48.10  ?  168  THR A CG2   1 
ATOM   616  N  N     . VAL A 1 102 ? 59.542  2.170   -1.047  1.00 42.64  ?  169  VAL A N     1 
ATOM   617  C  CA    . VAL A 1 102 ? 58.590  3.060   -0.388  1.00 32.36  ?  169  VAL A CA    1 
ATOM   618  C  C     . VAL A 1 102 ? 57.326  3.194   -1.226  1.00 35.53  ?  169  VAL A C     1 
ATOM   619  O  O     . VAL A 1 102 ? 56.205  3.164   -0.702  1.00 30.53  ?  169  VAL A O     1 
ATOM   620  C  CB    . VAL A 1 102 ? 59.252  4.428   -0.125  1.00 43.84  ?  169  VAL A CB    1 
ATOM   621  C  CG1   . VAL A 1 102 ? 58.217  5.525   -0.002  1.00 41.54  ?  169  VAL A CG1   1 
ATOM   622  C  CG2   . VAL A 1 102 ? 60.107  4.367   1.133   1.00 36.37  ?  169  VAL A CG2   1 
ATOM   623  N  N     . CYS A 1 103 ? 57.485  3.325   -2.544  1.00 31.41  ?  170  CYS A N     1 
ATOM   624  C  CA    . CYS A 1 103 ? 56.331  3.501   -3.420  1.00 39.80  ?  170  CYS A CA    1 
ATOM   625  C  C     . CYS A 1 103 ? 55.468  2.245   -3.462  1.00 39.95  ?  170  CYS A C     1 
ATOM   626  O  O     . CYS A 1 103 ? 54.234  2.332   -3.473  1.00 34.25  ?  170  CYS A O     1 
ATOM   627  C  CB    . CYS A 1 103 ? 56.805  3.881   -4.820  1.00 34.50  ?  170  CYS A CB    1 
ATOM   628  S  SG    . CYS A 1 103 ? 58.057  5.179   -4.810  1.00 40.94  ?  170  CYS A SG    1 
ATOM   629  N  N     . ALA A 1 104 ? 56.096  1.067   -3.494  1.00 35.60  ?  171  ALA A N     1 
ATOM   630  C  CA    . ALA A 1 104 ? 55.330  -0.174  -3.451  1.00 35.64  ?  171  ALA A CA    1 
ATOM   631  C  C     . ALA A 1 104 ? 54.585  -0.307  -2.129  1.00 28.93  ?  171  ALA A C     1 
ATOM   632  O  O     . ALA A 1 104 ? 53.418  -0.714  -2.105  1.00 30.95  ?  171  ALA A O     1 
ATOM   633  C  CB    . ALA A 1 104 ? 56.253  -1.371  -3.670  1.00 37.43  ?  171  ALA A CB    1 
ATOM   634  N  N     . GLU A 1 105 ? 55.240  0.045   -1.019  1.00 30.70  ?  172  GLU A N     1 
ATOM   635  C  CA    . GLU A 1 105 ? 54.594  -0.052  0.286   1.00 28.90  ?  172  GLU A CA    1 
ATOM   636  C  C     . GLU A 1 105 ? 53.332  0.800   0.343   1.00 37.57  ?  172  GLU A C     1 
ATOM   637  O  O     . GLU A 1 105 ? 52.334  0.402   0.954   1.00 36.96  ?  172  GLU A O     1 
ATOM   638  C  CB    . GLU A 1 105 ? 55.569  0.363   1.388   1.00 38.47  ?  172  GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 105 ? 56.726  -0.608  1.605   1.00 46.05  ?  172  GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 105 ? 57.735  -0.103  2.627   1.00 51.88  ?  172  GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 105 ? 57.582  1.039   3.109   1.00 55.75  ?  172  GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 105 ? 58.683  -0.850  2.950   1.00 62.72  -1 172  GLU A OE2   1 
ATOM   643  N  N     . TYR A 1 106 ? 53.350  1.977   -0.287  1.00 34.05  ?  173  TYR A N     1 
ATOM   644  C  CA    . TYR A 1 106 ? 52.163  2.824   -0.260  1.00 37.26  ?  173  TYR A CA    1 
ATOM   645  C  C     . TYR A 1 106 ? 51.020  2.188   -1.040  1.00 36.97  ?  173  TYR A C     1 
ATOM   646  O  O     . TYR A 1 106 ? 49.859  2.251   -0.615  1.00 32.94  ?  173  TYR A O     1 
ATOM   647  C  CB    . TYR A 1 106 ? 52.479  4.212   -0.813  1.00 34.13  ?  173  TYR A CB    1 
ATOM   648  C  CG    . TYR A 1 106 ? 51.362  5.199   -0.567  1.00 33.86  ?  173  TYR A CG    1 
ATOM   649  C  CD1   . TYR A 1 106 ? 50.293  5.301   -1.446  1.00 33.65  ?  173  TYR A CD1   1 
ATOM   650  C  CD2   . TYR A 1 106 ? 51.364  6.012   0.558   1.00 36.01  ?  173  TYR A CD2   1 
ATOM   651  C  CE1   . TYR A 1 106 ? 49.262  6.193   -1.216  1.00 41.40  ?  173  TYR A CE1   1 
ATOM   652  C  CE2   . TYR A 1 106 ? 50.339  6.908   0.796   1.00 38.07  ?  173  TYR A CE2   1 
ATOM   653  C  CZ    . TYR A 1 106 ? 49.291  6.995   -0.092  1.00 43.51  ?  173  TYR A CZ    1 
ATOM   654  O  OH    . TYR A 1 106 ? 48.268  7.887   0.141   1.00 40.19  ?  173  TYR A OH    1 
ATOM   655  N  N     . ALA A 1 107 ? 51.327  1.567   -2.181  1.00 34.91  ?  174  ALA A N     1 
ATOM   656  C  CA    . ALA A 1 107 ? 50.289  0.899   -2.957  1.00 32.23  ?  174  ALA A CA    1 
ATOM   657  C  C     . ALA A 1 107 ? 49.677  -0.254  -2.171  1.00 37.61  ?  174  ALA A C     1 
ATOM   658  O  O     . ALA A 1 107 ? 48.454  -0.439  -2.176  1.00 32.11  ?  174  ALA A O     1 
ATOM   659  C  CB    . ALA A 1 107 ? 50.862  0.402   -4.283  1.00 27.51  ?  174  ALA A CB    1 
ATOM   660  N  N     . ILE A 1 108 ? 50.512  -1.040  -1.488  1.00 32.84  ?  175  ILE A N     1 
ATOM   661  C  CA    . ILE A 1 108 ? 50.001  -2.137  -0.669  1.00 38.88  ?  175  ILE A CA    1 
ATOM   662  C  C     . ILE A 1 108 ? 49.104  -1.592  0.437   1.00 41.48  ?  175  ILE A C     1 
ATOM   663  O  O     . ILE A 1 108 ? 47.972  -2.054  0.631   1.00 34.91  ?  175  ILE A O     1 
ATOM   664  C  CB    . ILE A 1 108 ? 51.168  -2.967  -0.100  1.00 42.08  ?  175  ILE A CB    1 
ATOM   665  C  CG1   . ILE A 1 108 ? 51.960  -3.622  -1.238  1.00 42.46  ?  175  ILE A CG1   1 
ATOM   666  C  CG2   . ILE A 1 108 ? 50.652  -4.033  0.859   1.00 44.56  ?  175  ILE A CG2   1 
ATOM   667  C  CD1   . ILE A 1 108 ? 53.301  -4.185  -0.820  1.00 36.73  ?  175  ILE A CD1   1 
ATOM   668  N  N     . ALA A 1 109 ? 49.596  -0.590  1.171   1.00 35.95  ?  176  ALA A N     1 
ATOM   669  C  CA    . ALA A 1 109 ? 48.809  0.013   2.243   1.00 43.51  ?  176  ALA A CA    1 
ATOM   670  C  C     . ALA A 1 109 ? 47.465  0.520   1.728   1.00 39.33  ?  176  ALA A C     1 
ATOM   671  O  O     . ALA A 1 109 ? 46.417  0.265   2.334   1.00 34.94  ?  176  ALA A O     1 
ATOM   672  C  CB    . ALA A 1 109 ? 49.601  1.151   2.889   1.00 37.04  ?  176  ALA A CB    1 
ATOM   673  N  N     . LEU A 1 110 ? 47.475  1.246   0.608   1.00 35.12  ?  177  LEU A N     1 
ATOM   674  C  CA    . LEU A 1 110 ? 46.227  1.753   0.048   1.00 32.75  ?  177  LEU A CA    1 
ATOM   675  C  C     . LEU A 1 110 ? 45.309  0.613   -0.377  1.00 43.70  ?  177  LEU A C     1 
ATOM   676  O  O     . LEU A 1 110 ? 44.089  0.683   -0.183  1.00 43.52  ?  177  LEU A O     1 
ATOM   677  C  CB    . LEU A 1 110 ? 46.519  2.676   -1.136  1.00 34.80  ?  177  LEU A CB    1 
ATOM   678  C  CG    . LEU A 1 110 ? 45.299  3.310   -1.806  1.00 40.42  ?  177  LEU A CG    1 
ATOM   679  C  CD1   . LEU A 1 110 ? 44.538  4.184   -0.820  1.00 44.68  ?  177  LEU A CD1   1 
ATOM   680  C  CD2   . LEU A 1 110 ? 45.710  4.117   -3.022  1.00 41.35  ?  177  LEU A CD2   1 
ATOM   681  N  N     . ALA A 1 111 ? 45.872  -0.446  -0.963  1.00 38.79  ?  178  ALA A N     1 
ATOM   682  C  CA    . ALA A 1 111 ? 45.044  -1.566  -1.396  1.00 38.77  ?  178  ALA A CA    1 
ATOM   683  C  C     . ALA A 1 111 ? 44.376  -2.246  -0.207  1.00 36.25  ?  178  ALA A C     1 
ATOM   684  O  O     . ALA A 1 111 ? 43.193  -2.598  -0.269  1.00 35.48  ?  178  ALA A O     1 
ATOM   685  C  CB    . ALA A 1 111 ? 45.882  -2.570  -2.188  1.00 40.73  ?  178  ALA A CB    1 
ATOM   686  N  N     . LEU A 1 112 ? 45.115  -2.434  0.889   1.00 41.25  ?  179  LEU A N     1 
ATOM   687  C  CA    . LEU A 1 112 ? 44.531  -3.075  2.062   1.00 43.61  ?  179  LEU A CA    1 
ATOM   688  C  C     . LEU A 1 112 ? 43.491  -2.176  2.721   1.00 43.04  ?  179  LEU A C     1 
ATOM   689  O  O     . LEU A 1 112 ? 42.453  -2.658  3.186   1.00 49.90  ?  179  LEU A O     1 
ATOM   690  C  CB    . LEU A 1 112 ? 45.624  -3.448  3.062   1.00 34.25  ?  179  LEU A CB    1 
ATOM   691  C  CG    . LEU A 1 112 ? 46.801  -4.277  2.542   1.00 48.56  ?  179  LEU A CG    1 
ATOM   692  C  CD1   . LEU A 1 112 ? 47.424  -5.064  3.679   1.00 38.34  ?  179  LEU A CD1   1 
ATOM   693  C  CD2   . LEU A 1 112 ? 46.389  -5.200  1.405   1.00 35.77  ?  179  LEU A CD2   1 
ATOM   694  N  N     . ARG A 1 113 ? 43.751  -0.868  2.775   1.00 46.55  ?  180  ARG A N     1 
ATOM   695  C  CA    . ARG A 1 113 ? 42.777  0.050   3.359   1.00 42.79  ?  180  ARG A CA    1 
ATOM   696  C  C     . ARG A 1 113 ? 41.455  -0.010  2.608   1.00 48.89  ?  180  ARG A C     1 
ATOM   697  O  O     . ARG A 1 113 ? 40.381  0.044   3.219   1.00 55.14  ?  180  ARG A O     1 
ATOM   698  C  CB    . ARG A 1 113 ? 43.326  1.475   3.353   1.00 48.85  ?  180  ARG A CB    1 
ATOM   699  C  CG    . ARG A 1 113 ? 42.511  2.452   4.184   1.00 41.07  ?  180  ARG A CG    1 
ATOM   700  C  CD    . ARG A 1 113 ? 43.038  3.863   4.047   1.00 44.32  ?  180  ARG A CD    1 
ATOM   701  N  NE    . ARG A 1 113 ? 42.671  4.460   2.767   1.00 52.36  ?  180  ARG A NE    1 
ATOM   702  C  CZ    . ARG A 1 113 ? 43.110  5.639   2.341   1.00 45.13  ?  180  ARG A CZ    1 
ATOM   703  N  NH1   . ARG A 1 113 ? 42.722  6.106   1.162   1.00 48.72  ?  180  ARG A NH1   1 
ATOM   704  N  NH2   . ARG A 1 113 ? 43.943  6.349   3.091   1.00 45.21  ?  180  ARG A NH2   1 
ATOM   705  N  N     . GLU A 1 114 ? 41.513  -0.124  1.282   1.00 48.16  ?  181  GLU A N     1 
ATOM   706  C  CA    . GLU A 1 114 ? 40.321  -0.191  0.447   1.00 46.01  ?  181  GLU A CA    1 
ATOM   707  C  C     . GLU A 1 114 ? 39.711  -1.587  0.391   1.00 46.17  ?  181  GLU A C     1 
ATOM   708  O  O     . GLU A 1 114 ? 38.766  -1.803  -0.377  1.00 55.13  ?  181  GLU A O     1 
ATOM   709  C  CB    . GLU A 1 114 ? 40.655  0.282   -0.970  1.00 53.81  ?  181  GLU A CB    1 
ATOM   710  C  CG    . GLU A 1 114 ? 41.196  1.700   -1.028  1.00 54.99  ?  181  GLU A CG    1 
ATOM   711  C  CD    . GLU A 1 114 ? 40.187  2.726   -0.554  1.00 67.03  ?  181  GLU A CD    1 
ATOM   712  O  OE1   . GLU A 1 114 ? 38.997  2.597   -0.913  1.00 61.60  ?  181  GLU A OE1   1 
ATOM   713  O  OE2   . GLU A 1 114 ? 40.582  3.656   0.184   1.00 66.52  -1 181  GLU A OE2   1 
ATOM   714  N  N     . LYS A 1 115 ? 40.218  -2.531  1.182   1.00 49.05  ?  182  LYS A N     1 
ATOM   715  C  CA    . LYS A 1 115 ? 39.709  -3.902  1.183   1.00 57.44  ?  182  LYS A CA    1 
ATOM   716  C  C     . LYS A 1 115 ? 39.860  -4.544  -0.194  1.00 51.76  ?  182  LYS A C     1 
ATOM   717  O  O     . LYS A 1 115 ? 39.000  -5.303  -0.647  1.00 46.72  ?  182  LYS A O     1 
ATOM   718  C  CB    . LYS A 1 115 ? 38.252  -3.946  1.651   1.00 61.92  ?  182  LYS A CB    1 
ATOM   719  C  CG    . LYS A 1 115 ? 38.032  -3.371  3.045   1.00 71.89  ?  182  LYS A CG    1 
ATOM   720  C  CD    . LYS A 1 115 ? 38.860  -4.104  4.093   1.00 84.77  ?  182  LYS A CD    1 
ATOM   721  C  CE    . LYS A 1 115 ? 38.583  -3.585  5.493   1.00 102.44 ?  182  LYS A CE    1 
ATOM   722  N  NZ    . LYS A 1 115 ? 39.415  -4.281  6.513   1.00 118.09 ?  182  LYS A NZ    1 
ATOM   723  N  N     . GLN A 1 116 ? 40.964  -4.232  -0.864  1.00 45.17  ?  183  GLN A N     1 
ATOM   724  C  CA    . GLN A 1 116 ? 41.320  -4.816  -2.148  1.00 40.53  ?  183  GLN A CA    1 
ATOM   725  C  C     . GLN A 1 116 ? 42.476  -5.790  -1.967  1.00 44.53  ?  183  GLN A C     1 
ATOM   726  O  O     . GLN A 1 116 ? 43.063  -5.913  -0.887  1.00 45.15  ?  183  GLN A O     1 
ATOM   727  C  CB    . GLN A 1 116 ? 41.709  -3.727  -3.155  1.00 46.99  ?  183  GLN A CB    1 
ATOM   728  C  CG    . GLN A 1 116 ? 40.636  -2.682  -3.412  1.00 49.43  ?  183  GLN A CG    1 
ATOM   729  C  CD    . GLN A 1 116 ? 41.201  -1.413  -4.028  1.00 55.36  ?  183  GLN A CD    1 
ATOM   730  O  OE1   . GLN A 1 116 ? 42.401  -1.144  -3.936  1.00 51.37  ?  183  GLN A OE1   1 
ATOM   731  N  NE2   . GLN A 1 116 ? 40.339  -0.628  -4.662  1.00 53.26  ?  183  GLN A NE2   1 
ATOM   732  N  N     . ARG A 1 117 ? 42.808  -6.483  -3.050  1.00 40.97  ?  184  ARG A N     1 
ATOM   733  C  CA    . ARG A 1 117 ? 43.965  -7.361  -3.091  1.00 46.90  ?  184  ARG A CA    1 
ATOM   734  C  C     . ARG A 1 117 ? 45.036  -6.753  -3.986  1.00 39.55  ?  184  ARG A C     1 
ATOM   735  O  O     . ARG A 1 117 ? 44.733  -6.058  -4.961  1.00 38.15  ?  184  ARG A O     1 
ATOM   736  C  CB    . ARG A 1 117 ? 43.580  -8.753  -3.597  1.00 55.35  ?  184  ARG A CB    1 
ATOM   737  C  CG    . ARG A 1 117 ? 44.762  -9.660  -3.887  1.00 67.07  ?  184  ARG A CG    1 
ATOM   738  C  CD    . ARG A 1 117 ? 44.332  -11.114 -3.919  1.00 88.35  ?  184  ARG A CD    1 
ATOM   739  N  NE    . ARG A 1 117 ? 44.263  -11.686 -2.577  1.00 70.48  ?  184  ARG A NE    1 
ATOM   740  C  CZ    . ARG A 1 117 ? 43.572  -12.775 -2.259  1.00 56.42  ?  184  ARG A CZ    1 
ATOM   741  N  NH1   . ARG A 1 117 ? 42.868  -13.415 -3.180  1.00 55.42  ?  184  ARG A NH1   1 
ATOM   742  N  NH2   . ARG A 1 117 ? 43.576  -13.218 -1.012  1.00 68.12  ?  184  ARG A NH2   1 
ATOM   743  N  N     . VAL A 1 118 ? 46.294  -7.019  -3.641  1.00 37.18  ?  185  VAL A N     1 
ATOM   744  C  CA    . VAL A 1 118 ? 47.442  -6.475  -4.356  1.00 34.07  ?  185  VAL A CA    1 
ATOM   745  C  C     . VAL A 1 118 ? 48.479  -7.578  -4.513  1.00 35.87  ?  185  VAL A C     1 
ATOM   746  O  O     . VAL A 1 118 ? 48.656  -8.411  -3.618  1.00 36.70  ?  185  VAL A O     1 
ATOM   747  C  CB    . VAL A 1 118 ? 48.037  -5.252  -3.619  1.00 35.60  ?  185  VAL A CB    1 
ATOM   748  C  CG1   . VAL A 1 118 ? 48.360  -5.602  -2.168  1.00 34.41  ?  185  VAL A CG1   1 
ATOM   749  C  CG2   . VAL A 1 118 ? 49.276  -4.726  -4.342  1.00 36.28  ?  185  VAL A CG2   1 
ATOM   750  N  N     . ILE A 1 119 ? 49.172  -7.579  -5.648  1.00 37.59  ?  186  ILE A N     1 
ATOM   751  C  CA    . ILE A 1 119 ? 50.183  -8.583  -5.954  1.00 31.25  ?  186  ILE A CA    1 
ATOM   752  C  C     . ILE A 1 119 ? 51.527  -7.889  -6.126  1.00 33.85  ?  186  ILE A C     1 
ATOM   753  O  O     . ILE A 1 119 ? 51.619  -6.857  -6.799  1.00 35.13  ?  186  ILE A O     1 
ATOM   754  C  CB    . ILE A 1 119 ? 49.813  -9.393  -7.210  1.00 32.19  ?  186  ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 119 ? 48.588  -10.264 -6.911  1.00 34.90  ?  186  ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 119 ? 50.997  -10.255 -7.665  1.00 35.23  ?  186  ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 119 ? 48.039  -10.987 -8.108  1.00 41.02  ?  186  ILE A CD1   1 
ATOM   758  N  N     . PHE A 1 120 ? 52.562  -8.464  -5.517  1.00 36.35  ?  187  PHE A N     1 
ATOM   759  C  CA    . PHE A 1 120 ? 53.938  -7.987  -5.628  1.00 35.56  ?  187  PHE A CA    1 
ATOM   760  C  C     . PHE A 1 120 ? 54.753  -9.123  -6.232  1.00 36.39  ?  187  PHE A C     1 
ATOM   761  O  O     . PHE A 1 120 ? 54.942  -10.161 -5.591  1.00 43.48  ?  187  PHE A O     1 
ATOM   762  C  CB    . PHE A 1 120 ? 54.484  -7.578  -4.258  1.00 34.22  ?  187  PHE A CB    1 
ATOM   763  C  CG    . PHE A 1 120 ? 55.876  -7.004  -4.297  1.00 36.31  ?  187  PHE A CG    1 
ATOM   764  C  CD1   . PHE A 1 120 ? 56.976  -7.821  -4.499  1.00 43.74  ?  187  PHE A CD1   1 
ATOM   765  C  CD2   . PHE A 1 120 ? 56.082  -5.650  -4.110  1.00 38.32  ?  187  PHE A CD2   1 
ATOM   766  C  CE1   . PHE A 1 120 ? 58.251  -7.293  -4.531  1.00 43.76  ?  187  PHE A CE1   1 
ATOM   767  C  CE2   . PHE A 1 120 ? 57.357  -5.117  -4.139  1.00 34.91  ?  187  PHE A CE2   1 
ATOM   768  C  CZ    . PHE A 1 120 ? 58.440  -5.936  -4.349  1.00 45.55  ?  187  PHE A CZ    1 
ATOM   769  N  N     A THR A 1 121 ? 55.234  -8.920  -7.458  0.50 36.16  ?  188  THR A N     1 
ATOM   770  N  N     B THR A 1 121 ? 55.233  -8.940  -7.457  0.50 35.94  ?  188  THR A N     1 
ATOM   771  C  CA    A THR A 1 121 ? 55.945  -9.943  -8.210  0.50 34.25  ?  188  THR A CA    1 
ATOM   772  C  CA    B THR A 1 121 ? 55.929  -10.002 -8.167  0.50 34.15  ?  188  THR A CA    1 
ATOM   773  C  C     A THR A 1 121 ? 57.431  -9.621  -8.275  0.50 36.80  ?  188  THR A C     1 
ATOM   774  C  C     B THR A 1 121 ? 57.401  -9.658  -8.350  0.50 36.49  ?  188  THR A C     1 
ATOM   775  O  O     A THR A 1 121 ? 57.818  -8.466  -8.476  0.50 35.60  ?  188  THR A O     1 
ATOM   776  O  O     B THR A 1 121 ? 57.749  -8.525  -8.699  0.50 35.33  ?  188  THR A O     1 
ATOM   777  C  CB    A THR A 1 121 ? 55.409  -10.063 -9.640  0.50 39.03  ?  188  THR A CB    1 
ATOM   778  C  CB    B THR A 1 121 ? 55.283  -10.277 -9.530  0.50 38.44  ?  188  THR A CB    1 
ATOM   779  O  OG1   A THR A 1 121 ? 55.921  -8.982  -10.430 0.50 45.70  ?  188  THR A OG1   1 
ATOM   780  O  OG1   B THR A 1 121 ? 55.998  -11.326 -10.193 0.50 38.13  ?  188  THR A OG1   1 
ATOM   781  C  CG2   A THR A 1 121 ? 53.893  -10.025 -9.662  0.50 33.10  ?  188  THR A CG2   1 
ATOM   782  C  CG2   B THR A 1 121 ? 55.287  -9.032  -10.402 0.50 45.68  ?  188  THR A CG2   1 
ATOM   783  N  N     . SER A 1 122 ? 58.254  -10.649 -8.116  1.00 33.85  ?  189  SER A N     1 
ATOM   784  C  CA    . SER A 1 122 ? 59.691  -10.557 -8.306  1.00 30.75  ?  189  SER A CA    1 
ATOM   785  C  C     . SER A 1 122 ? 60.116  -11.535 -9.394  1.00 37.15  ?  189  SER A C     1 
ATOM   786  O  O     . SER A 1 122 ? 59.410  -12.511 -9.675  1.00 43.20  ?  189  SER A O     1 
ATOM   787  C  CB    . SER A 1 122 ? 60.454  -10.871 -7.011  1.00 43.35  ?  189  SER A CB    1 
ATOM   788  O  OG    . SER A 1 122 ? 60.030  -10.034 -5.952  1.00 58.65  ?  189  SER A OG    1 
ATOM   789  N  N     . PRO A 1 123 ? 61.272  -11.311 -10.022 1.00 40.05  ?  190  PRO A N     1 
ATOM   790  C  CA    . PRO A 1 123 ? 61.705  -12.223 -11.093 1.00 51.11  ?  190  PRO A CA    1 
ATOM   791  C  C     . PRO A 1 123 ? 62.201  -13.565 -10.585 1.00 42.87  ?  190  PRO A C     1 
ATOM   792  O  O     . PRO A 1 123 ? 62.155  -14.546 -11.336 1.00 49.74  ?  190  PRO A O     1 
ATOM   793  C  CB    . PRO A 1 123 ? 62.840  -11.448 -11.787 1.00 51.41  ?  190  PRO A CB    1 
ATOM   794  C  CG    . PRO A 1 123 ? 62.895  -10.089 -11.118 1.00 43.53  ?  190  PRO A CG    1 
ATOM   795  C  CD    . PRO A 1 123 ? 62.252  -10.240 -9.785  1.00 46.75  ?  190  PRO A CD    1 
ATOM   796  N  N     . ILE A 1 124 ? 62.657  -13.641 -9.337  1.00 39.44  ?  191  ILE A N     1 
ATOM   797  C  CA    . ILE A 1 124 ? 63.378  -14.795 -8.819  1.00 45.14  ?  191  ILE A CA    1 
ATOM   798  C  C     . ILE A 1 124 ? 62.679  -15.290 -7.563  1.00 46.16  ?  191  ILE A C     1 
ATOM   799  O  O     . ILE A 1 124 ? 62.086  -14.509 -6.812  1.00 46.33  ?  191  ILE A O     1 
ATOM   800  C  CB    . ILE A 1 124 ? 64.852  -14.430 -8.525  1.00 48.72  ?  191  ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 124 ? 65.533  -13.902 -9.790  1.00 52.48  ?  191  ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 124 ? 65.612  -15.614 -7.977  1.00 58.28  ?  191  ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 124 ? 65.506  -14.870 -10.954 1.00 50.43  ?  191  ILE A CD1   1 
ATOM   804  N  N     . LYS A 1 125 ? 62.745  -16.606 -7.337  1.00 41.45  ?  192  LYS A N     1 
ATOM   805  C  CA    . LYS A 1 125 ? 62.157  -17.178 -6.130  1.00 42.31  ?  192  LYS A CA    1 
ATOM   806  C  C     . LYS A 1 125 ? 62.893  -16.696 -4.885  1.00 38.51  ?  192  LYS A C     1 
ATOM   807  O  O     . LYS A 1 125 ? 62.267  -16.299 -3.895  1.00 36.70  ?  192  LYS A O     1 
ATOM   808  C  CB    . LYS A 1 125 ? 62.178  -18.706 -6.201  1.00 45.53  ?  192  LYS A CB    1 
ATOM   809  C  CG    . LYS A 1 125 ? 61.148  -19.311 -7.141  1.00 55.53  ?  192  LYS A CG    1 
ATOM   810  C  CD    . LYS A 1 125 ? 61.165  -20.837 -7.090  1.00 52.26  ?  192  LYS A CD    1 
ATOM   811  C  CE    . LYS A 1 125 ? 62.403  -21.411 -7.767  1.00 61.44  ?  192  LYS A CE    1 
ATOM   812  N  NZ    . LYS A 1 125 ? 62.490  -22.892 -7.637  1.00 71.19  ?  192  LYS A NZ    1 
ATOM   813  N  N     . ALA A 1 126 ? 64.227  -16.732 -4.915  1.00 40.24  ?  193  ALA A N     1 
ATOM   814  C  CA    . ALA A 1 126 ? 65.008  -16.282 -3.769  1.00 52.23  ?  193  ALA A CA    1 
ATOM   815  C  C     . ALA A 1 126 ? 64.629  -14.863 -3.363  1.00 40.49  ?  193  ALA A C     1 
ATOM   816  O  O     . ALA A 1 126 ? 64.520  -14.557 -2.171  1.00 45.64  ?  193  ALA A O     1 
ATOM   817  C  CB    . ALA A 1 126 ? 66.500  -16.369 -4.089  1.00 38.96  ?  193  ALA A CB    1 
ATOM   818  N  N     . LEU A 1 127 ? 64.409  -13.983 -4.342  1.00 42.09  ?  194  LEU A N     1 
ATOM   819  C  CA    . LEU A 1 127 ? 64.050  -12.605 -4.019  1.00 43.08  ?  194  LEU A CA    1 
ATOM   820  C  C     . LEU A 1 127 ? 62.627  -12.518 -3.480  1.00 37.84  ?  194  LEU A C     1 
ATOM   821  O  O     . LEU A 1 127 ? 62.351  -11.718 -2.578  1.00 40.41  ?  194  LEU A O     1 
ATOM   822  C  CB    . LEU A 1 127 ? 64.219  -11.714 -5.249  1.00 42.90  ?  194  LEU A CB    1 
ATOM   823  C  CG    . LEU A 1 127 ? 65.620  -11.728 -5.874  1.00 59.63  ?  194  LEU A CG    1 
ATOM   824  C  CD1   . LEU A 1 127 ? 65.682  -10.789 -7.072  1.00 61.08  ?  194  LEU A CD1   1 
ATOM   825  C  CD2   . LEU A 1 127 ? 66.692  -11.365 -4.851  1.00 57.39  ?  194  LEU A CD2   1 
ATOM   826  N  N     . SER A 1 128 ? 61.712  -13.333 -4.012  1.00 37.79  ?  195  SER A N     1 
ATOM   827  C  CA    . SER A 1 128 ? 60.351  -13.355 -3.482  1.00 33.18  ?  195  SER A CA    1 
ATOM   828  C  C     . SER A 1 128 ? 60.341  -13.741 -2.007  1.00 42.15  ?  195  SER A C     1 
ATOM   829  O  O     . SER A 1 128 ? 59.570  -13.182 -1.219  1.00 44.64  ?  195  SER A O     1 
ATOM   830  C  CB    . SER A 1 128 ? 59.484  -14.319 -4.293  1.00 41.08  ?  195  SER A CB    1 
ATOM   831  O  OG    . SER A 1 128 ? 59.268  -13.831 -5.605  1.00 40.66  ?  195  SER A OG    1 
ATOM   832  N  N     . ASN A 1 129 ? 61.191  -14.696 -1.614  1.00 39.26  ?  196  ASN A N     1 
ATOM   833  C  CA    . ASN A 1 129 ? 61.281  -15.077 -0.206  1.00 43.88  ?  196  ASN A CA    1 
ATOM   834  C  C     . ASN A 1 129 ? 61.719  -13.894 0.649   1.00 35.85  ?  196  ASN A C     1 
ATOM   835  O  O     . ASN A 1 129 ? 61.138  -13.626 1.707   1.00 37.90  ?  196  ASN A O     1 
ATOM   836  C  CB    . ASN A 1 129 ? 62.255  -16.244 -0.030  1.00 43.01  ?  196  ASN A CB    1 
ATOM   837  C  CG    . ASN A 1 129 ? 61.853  -17.474 -0.825  1.00 40.43  ?  196  ASN A CG    1 
ATOM   838  O  OD1   . ASN A 1 129 ? 60.675  -17.701 -1.096  1.00 41.09  ?  196  ASN A OD1   1 
ATOM   839  N  ND2   . ASN A 1 129 ? 62.839  -18.276 -1.201  1.00 42.42  ?  196  ASN A ND2   1 
ATOM   840  N  N     . GLN A 1 130 ? 62.759  -13.179 0.211   1.00 37.59  ?  197  GLN A N     1 
ATOM   841  C  CA    . GLN A 1 130 ? 63.205  -11.994 0.938   1.00 42.54  ?  197  GLN A CA    1 
ATOM   842  C  C     . GLN A 1 130 ? 62.107  -10.938 1.003   1.00 43.15  ?  197  GLN A C     1 
ATOM   843  O  O     . GLN A 1 130 ? 61.865  -10.349 2.063   1.00 41.77  ?  197  GLN A O     1 
ATOM   844  C  CB    . GLN A 1 130 ? 64.457  -11.417 0.280   1.00 40.75  ?  197  GLN A CB    1 
ATOM   845  C  CG    . GLN A 1 130 ? 65.630  -12.386 0.220   1.00 42.94  ?  197  GLN A CG    1 
ATOM   846  C  CD    . GLN A 1 130 ? 66.817  -11.834 -0.553  1.00 48.87  ?  197  GLN A CD    1 
ATOM   847  O  OE1   . GLN A 1 130 ? 66.878  -10.643 -0.859  1.00 66.00  ?  197  GLN A OE1   1 
ATOM   848  N  NE2   . GLN A 1 130 ? 67.764  -12.703 -0.876  1.00 49.37  ?  197  GLN A NE2   1 
ATOM   849  N  N     . LYS A 1 131 ? 61.431  -10.685 -0.121  1.00 40.69  ?  198  LYS A N     1 
ATOM   850  C  CA    . LYS A 1 131 ? 60.392  -9.661  -0.144  1.00 37.11  ?  198  LYS A CA    1 
ATOM   851  C  C     . LYS A 1 131 ? 59.184  -10.060 0.691   1.00 37.93  ?  198  LYS A C     1 
ATOM   852  O  O     . LYS A 1 131 ? 58.525  -9.192  1.274   1.00 41.31  ?  198  LYS A O     1 
ATOM   853  C  CB    . LYS A 1 131 ? 59.967  -9.372  -1.585  1.00 39.47  ?  198  LYS A CB    1 
ATOM   854  C  CG    . LYS A 1 131 ? 60.879  -8.399  -2.321  1.00 52.38  ?  198  LYS A CG    1 
ATOM   855  C  CD    . LYS A 1 131 ? 60.776  -6.987  -1.747  1.00 55.55  ?  198  LYS A CD    1 
ATOM   856  C  CE    . LYS A 1 131 ? 61.752  -6.034  -2.417  1.00 59.00  ?  198  LYS A CE    1 
ATOM   857  N  NZ    . LYS A 1 131 ? 62.178  -4.946  -1.494  1.00 67.57  ?  198  LYS A NZ    1 
ATOM   858  N  N     . TYR A 1 132 ? 58.868  -11.355 0.759   1.00 40.90  ?  199  TYR A N     1 
ATOM   859  C  CA    . TYR A 1 132 ? 57.782  -11.794 1.628   1.00 39.69  ?  199  TYR A CA    1 
ATOM   860  C  C     . TYR A 1 132 ? 58.074  -11.431 3.076   1.00 37.22  ?  199  TYR A C     1 
ATOM   861  O  O     . TYR A 1 132 ? 57.208  -10.907 3.785   1.00 42.79  ?  199  TYR A O     1 
ATOM   862  C  CB    . TYR A 1 132 ? 57.562  -13.300 1.498   1.00 44.92  ?  199  TYR A CB    1 
ATOM   863  C  CG    . TYR A 1 132 ? 56.764  -13.871 2.651   1.00 37.31  ?  199  TYR A CG    1 
ATOM   864  C  CD1   . TYR A 1 132 ? 55.383  -13.745 2.693   1.00 43.69  ?  199  TYR A CD1   1 
ATOM   865  C  CD2   . TYR A 1 132 ? 57.395  -14.522 3.706   1.00 43.54  ?  199  TYR A CD2   1 
ATOM   866  C  CE1   . TYR A 1 132 ? 54.648  -14.256 3.745   1.00 47.94  ?  199  TYR A CE1   1 
ATOM   867  C  CE2   . TYR A 1 132 ? 56.668  -15.037 4.765   1.00 44.00  ?  199  TYR A CE2   1 
ATOM   868  C  CZ    . TYR A 1 132 ? 55.295  -14.902 4.778   1.00 50.96  ?  199  TYR A CZ    1 
ATOM   869  O  OH    . TYR A 1 132 ? 54.561  -15.410 5.826   1.00 54.59  ?  199  TYR A OH    1 
ATOM   870  N  N     . ARG A 1 133 ? 59.293  -11.714 3.537   1.00 42.67  ?  200  ARG A N     1 
ATOM   871  C  CA    . ARG A 1 133 ? 59.664  -11.356 4.900   1.00 44.12  ?  200  ARG A CA    1 
ATOM   872  C  C     . ARG A 1 133 ? 59.540  -9.854  5.112   1.00 50.75  ?  200  ARG A C     1 
ATOM   873  O  O     . ARG A 1 133 ? 58.915  -9.399  6.078   1.00 48.89  ?  200  ARG A O     1 
ATOM   874  C  CB    . ARG A 1 133 ? 61.086  -11.831 5.198   1.00 48.69  ?  200  ARG A CB    1 
ATOM   875  C  CG    . ARG A 1 133 ? 61.601  -11.440 6.578   1.00 54.95  ?  200  ARG A CG    1 
ATOM   876  C  CD    . ARG A 1 133 ? 60.609  -11.806 7.671   1.00 60.48  ?  200  ARG A CD    1 
ATOM   877  N  NE    . ARG A 1 133 ? 60.203  -13.207 7.592   1.00 60.54  ?  200  ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1 133 ? 59.333  -13.786 8.413   1.00 53.89  ?  200  ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1 133 ? 58.767  -13.091 9.391   1.00 65.12  ?  200  ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1 133 ? 59.027  -15.065 8.256   1.00 53.06  ?  200  ARG A NH2   1 
ATOM   881  N  N     . GLU A 1 134 ? 60.116  -9.067  4.201   1.00 51.07  ?  201  GLU A N     1 
ATOM   882  C  CA    . GLU A 1 134 ? 60.065  -7.614  4.327   1.00 46.13  ?  201  GLU A CA    1 
ATOM   883  C  C     . GLU A 1 134 ? 58.626  -7.126  4.437   1.00 46.49  ?  201  GLU A C     1 
ATOM   884  O  O     . GLU A 1 134 ? 58.288  -6.352  5.339   1.00 51.23  ?  201  GLU A O     1 
ATOM   885  C  CB    . GLU A 1 134 ? 60.771  -6.966  3.134   1.00 54.16  ?  201  GLU A CB    1 
ATOM   886  C  CG    . GLU A 1 134 ? 61.008  -5.468  3.283   1.00 70.17  ?  201  GLU A CG    1 
ATOM   887  C  CD    . GLU A 1 134 ? 61.660  -4.848  2.055   1.00 81.28  ?  201  GLU A CD    1 
ATOM   888  O  OE1   . GLU A 1 134 ? 61.352  -5.285  0.926   1.00 71.34  ?  201  GLU A OE1   1 
ATOM   889  O  OE2   . GLU A 1 134 ? 62.485  -3.924  2.219   1.00 81.58  -1 201  GLU A OE2   1 
ATOM   890  N  N     . MET A 1 135 ? 57.754  -7.585  3.535   1.00 44.10  ?  202  MET A N     1 
ATOM   891  C  CA    . MET A 1 135 ? 56.385  -7.080  3.510   1.00 47.21  ?  202  MET A CA    1 
ATOM   892  C  C     . MET A 1 135 ? 55.558  -7.651  4.655   1.00 53.74  ?  202  MET A C     1 
ATOM   893  O  O     . MET A 1 135 ? 54.704  -6.954  5.214   1.00 43.24  ?  202  MET A O     1 
ATOM   894  C  CB    . MET A 1 135 ? 55.738  -7.400  2.163   1.00 46.02  ?  202  MET A CB    1 
ATOM   895  C  CG    . MET A 1 135 ? 56.422  -6.739  0.969   1.00 54.54  ?  202  MET A CG    1 
ATOM   896  S  SD    . MET A 1 135 ? 56.389  -4.928  1.003   1.00 50.39  ?  202  MET A SD    1 
ATOM   897  C  CE    . MET A 1 135 ? 57.941  -4.543  1.811   1.00 62.43  ?  202  MET A CE    1 
ATOM   898  N  N     . TYR A 1 136 ? 55.791  -8.916  5.021   1.00 61.68  ?  203  TYR A N     1 
ATOM   899  C  CA    . TYR A 1 136 ? 55.055  -9.499  6.139   1.00 54.92  ?  203  TYR A CA    1 
ATOM   900  C  C     . TYR A 1 136 ? 55.368  -8.770  7.439   1.00 50.50  ?  203  TYR A C     1 
ATOM   901  O  O     . TYR A 1 136 ? 54.468  -8.505  8.245   1.00 54.53  ?  203  TYR A O     1 
ATOM   902  C  CB    . TYR A 1 136 ? 55.379  -10.988 6.276   1.00 57.64  ?  203  TYR A CB    1 
ATOM   903  C  CG    . TYR A 1 136 ? 54.767  -11.611 7.513   1.00 58.28  ?  203  TYR A CG    1 
ATOM   904  C  CD1   . TYR A 1 136 ? 53.429  -11.982 7.536   1.00 59.28  ?  203  TYR A CD1   1 
ATOM   905  C  CD2   . TYR A 1 136 ? 55.522  -11.814 8.659   1.00 63.89  ?  203  TYR A CD2   1 
ATOM   906  C  CE1   . TYR A 1 136 ? 52.862  -12.544 8.665   1.00 65.82  ?  203  TYR A CE1   1 
ATOM   907  C  CE2   . TYR A 1 136 ? 54.964  -12.375 9.793   1.00 72.10  ?  203  TYR A CE2   1 
ATOM   908  C  CZ    . TYR A 1 136 ? 53.634  -12.739 9.789   1.00 67.12  ?  203  TYR A CZ    1 
ATOM   909  O  OH    . TYR A 1 136 ? 53.074  -13.298 10.914  1.00 82.16  ?  203  TYR A OH    1 
ATOM   910  N  N     . GLU A 1 137 ? 56.641  -8.441  7.663   1.00 47.71  ?  204  GLU A N     1 
ATOM   911  C  CA    . GLU A 1 137 ? 57.019  -7.693  8.854   1.00 61.55  ?  204  GLU A CA    1 
ATOM   912  C  C     . GLU A 1 137 ? 56.374  -6.314  8.888   1.00 66.76  ?  204  GLU A C     1 
ATOM   913  O  O     . GLU A 1 137 ? 56.248  -5.725  9.967   1.00 65.12  ?  204  GLU A O     1 
ATOM   914  C  CB    . GLU A 1 137 ? 58.542  -7.558  8.922   1.00 59.62  ?  204  GLU A CB    1 
ATOM   915  C  CG    . GLU A 1 137 ? 59.116  -7.628  10.329  1.00 99.89  ?  204  GLU A CG    1 
ATOM   916  C  CD    . GLU A 1 137 ? 59.026  -9.020  10.932  1.00 96.89  ?  204  GLU A CD    1 
ATOM   917  O  OE1   . GLU A 1 137 ? 58.566  -9.950  10.234  1.00 79.11  ?  204  GLU A OE1   1 
ATOM   918  O  OE2   . GLU A 1 137 ? 59.419  -9.184  12.107  1.00 98.33  ?  204  GLU A OE2   1 
ATOM   919  N  N     . GLU A 1 138 ? 55.955  -5.794  7.734   1.00 59.45  ?  205  GLU A N     1 
ATOM   920  C  CA    . GLU A 1 138 ? 55.374  -4.462  7.623   1.00 52.11  ?  205  GLU A CA    1 
ATOM   921  C  C     . GLU A 1 138 ? 53.852  -4.473  7.618   1.00 53.13  ?  205  GLU A C     1 
ATOM   922  O  O     . GLU A 1 138 ? 53.232  -3.593  8.221   1.00 59.59  ?  205  GLU A O     1 
ATOM   923  C  CB    . GLU A 1 138 ? 55.875  -3.783  6.343   1.00 59.34  ?  205  GLU A CB    1 
ATOM   924  C  CG    . GLU A 1 138 ? 55.569  -2.298  6.249   1.00 61.77  ?  205  GLU A CG    1 
ATOM   925  C  CD    . GLU A 1 138 ? 56.354  -1.481  7.255   1.00 68.85  ?  205  GLU A CD    1 
ATOM   926  O  OE1   . GLU A 1 138 ? 55.753  -1.006  8.242   1.00 78.25  ?  205  GLU A OE1   1 
ATOM   927  O  OE2   . GLU A 1 138 ? 57.578  -1.325  7.064   1.00 61.26  -1 205  GLU A OE2   1 
ATOM   928  N  N     . PHE A 1 139 ? 53.233  -5.450  6.952   1.00 46.94  ?  206  PHE A N     1 
ATOM   929  C  CA    . PHE A 1 139 ? 51.789  -5.478  6.784   1.00 52.43  ?  206  PHE A CA    1 
ATOM   930  C  C     . PHE A 1 139 ? 51.115  -6.695  7.401   1.00 57.39  ?  206  PHE A C     1 
ATOM   931  O  O     . PHE A 1 139 ? 49.889  -6.679  7.554   1.00 49.47  ?  206  PHE A O     1 
ATOM   932  C  CB    . PHE A 1 139 ? 51.429  -5.420  5.290   1.00 46.58  ?  206  PHE A CB    1 
ATOM   933  C  CG    . PHE A 1 139 ? 51.984  -4.218  4.581   1.00 52.12  ?  206  PHE A CG    1 
ATOM   934  C  CD1   . PHE A 1 139 ? 51.336  -2.996  4.655   1.00 41.57  ?  206  PHE A CD1   1 
ATOM   935  C  CD2   . PHE A 1 139 ? 53.153  -4.308  3.841   1.00 42.46  ?  206  PHE A CD2   1 
ATOM   936  C  CE1   . PHE A 1 139 ? 51.840  -1.885  4.005   1.00 35.61  ?  206  PHE A CE1   1 
ATOM   937  C  CE2   . PHE A 1 139 ? 53.662  -3.200  3.188   1.00 49.90  ?  206  PHE A CE2   1 
ATOM   938  C  CZ    . PHE A 1 139 ? 53.003  -1.986  3.271   1.00 38.64  ?  206  PHE A CZ    1 
ATOM   939  N  N     . GLN A 1 140 ? 51.866  -7.743  7.748   1.00 62.08  ?  207  GLN A N     1 
ATOM   940  C  CA    . GLN A 1 140 ? 51.314  -8.947  8.367   1.00 57.96  ?  207  GLN A CA    1 
ATOM   941  C  C     . GLN A 1 140 ? 50.374  -9.700  7.429   1.00 56.72  ?  207  GLN A C     1 
ATOM   942  O  O     . GLN A 1 140 ? 50.586  -10.888 7.164   1.00 51.79  ?  207  GLN A O     1 
ATOM   943  C  CB    . GLN A 1 140 ? 50.585  -8.602  9.672   1.00 58.44  ?  207  GLN A CB    1 
ATOM   944  C  CG    . GLN A 1 140 ? 51.517  -8.276  10.834  1.00 73.92  ?  207  GLN A CG    1 
ATOM   945  C  CD    . GLN A 1 140 ? 52.299  -6.991  10.625  1.00 83.72  ?  207  GLN A CD    1 
ATOM   946  O  OE1   . GLN A 1 140 ? 53.531  -6.987  10.655  1.00 74.19  ?  207  GLN A OE1   1 
ATOM   947  N  NE2   . GLN A 1 140 ? 51.583  -5.889  10.419  1.00 81.27  ?  207  GLN A NE2   1 
ATOM   948  N  N     . ASP A 1 141 ? 49.334  -9.030  6.929   1.00 45.75  ?  208  ASP A N     1 
ATOM   949  C  CA    . ASP A 1 141 ? 48.373  -9.650  6.020   1.00 43.43  ?  208  ASP A CA    1 
ATOM   950  C  C     . ASP A 1 141 ? 49.007  -9.951  4.665   1.00 48.78  ?  208  ASP A C     1 
ATOM   951  O  O     . ASP A 1 141 ? 48.537  -9.468  3.628   1.00 44.36  ?  208  ASP A O     1 
ATOM   952  C  CB    . ASP A 1 141 ? 47.157  -8.735  5.852   1.00 41.64  ?  208  ASP A CB    1 
ATOM   953  C  CG    . ASP A 1 141 ? 46.031  -9.388  5.074   1.00 51.93  ?  208  ASP A CG    1 
ATOM   954  O  OD1   . ASP A 1 141 ? 46.155  -10.582 4.727   1.00 55.66  ?  208  ASP A OD1   1 
ATOM   955  O  OD2   . ASP A 1 141 ? 45.020  -8.701  4.808   1.00 49.47  -1 208  ASP A OD2   1 
ATOM   956  N  N     . VAL A 1 142 ? 50.062  -10.763 4.660   1.00 51.96  ?  209  VAL A N     1 
ATOM   957  C  CA    . VAL A 1 142 ? 50.857  -11.026 3.467   1.00 48.28  ?  209  VAL A CA    1 
ATOM   958  C  C     . VAL A 1 142 ? 50.952  -12.530 3.256   1.00 48.73  ?  209  VAL A C     1 
ATOM   959  O  O     . VAL A 1 142 ? 51.027  -13.298 4.222   1.00 50.57  ?  209  VAL A O     1 
ATOM   960  C  CB    . VAL A 1 142 ? 52.267  -10.408 3.587   1.00 39.67  ?  209  VAL A CB    1 
ATOM   961  C  CG1   . VAL A 1 142 ? 53.078  -10.670 2.330   1.00 43.81  ?  209  VAL A CG1   1 
ATOM   962  C  CG2   . VAL A 1 142 ? 52.173  -8.913  3.866   1.00 53.61  ?  209  VAL A CG2   1 
ATOM   963  N  N     . GLY A 1 143 ? 50.954  -12.950 1.985   1.00 49.74  ?  210  GLY A N     1 
ATOM   964  C  CA    . GLY A 1 143 ? 51.158  -14.338 1.636   1.00 42.97  ?  210  GLY A CA    1 
ATOM   965  C  C     . GLY A 1 143 ? 52.277  -14.475 0.617   1.00 48.11  ?  210  GLY A C     1 
ATOM   966  O  O     . GLY A 1 143 ? 52.799  -13.484 0.099   1.00 46.92  ?  210  GLY A O     1 
ATOM   967  N  N     . LEU A 1 144 ? 52.635  -15.728 0.337   1.00 38.36  ?  211  LEU A N     1 
ATOM   968  C  CA    . LEU A 1 144 ? 53.724  -16.039 -0.582  1.00 41.15  ?  211  LEU A CA    1 
ATOM   969  C  C     . LEU A 1 144 ? 53.323  -17.202 -1.477  1.00 45.08  ?  211  LEU A C     1 
ATOM   970  O  O     . LEU A 1 144 ? 52.695  -18.161 -1.019  1.00 44.74  ?  211  LEU A O     1 
ATOM   971  C  CB    . LEU A 1 144 ? 55.013  -16.385 0.174   1.00 38.84  ?  211  LEU A CB    1 
ATOM   972  C  CG    . LEU A 1 144 ? 56.210  -16.811 -0.679  1.00 42.17  ?  211  LEU A CG    1 
ATOM   973  C  CD1   . LEU A 1 144 ? 56.671  -15.674 -1.576  1.00 42.14  ?  211  LEU A CD1   1 
ATOM   974  C  CD2   . LEU A 1 144 ? 57.348  -17.288 0.207   1.00 45.56  ?  211  LEU A CD2   1 
ATOM   975  N  N     . MET A 1 145 ? 53.695  -17.114 -2.756  1.00 39.19  ?  212  MET A N     1 
ATOM   976  C  CA    . MET A 1 145 ? 53.353  -18.152 -3.728  1.00 36.40  ?  212  MET A CA    1 
ATOM   977  C  C     . MET A 1 145 ? 54.490  -18.237 -4.741  1.00 45.55  ?  212  MET A C     1 
ATOM   978  O  O     . MET A 1 145 ? 54.608  -17.379 -5.621  1.00 39.80  ?  212  MET A O     1 
ATOM   979  C  CB    . MET A 1 145 ? 52.025  -17.854 -4.410  1.00 37.69  ?  212  MET A CB    1 
ATOM   980  C  CG    . MET A 1 145 ? 50.816  -17.997 -3.502  1.00 44.59  ?  212  MET A CG    1 
ATOM   981  S  SD    . MET A 1 145 ? 49.278  -17.415 -4.245  1.00 55.74  ?  212  MET A SD    1 
ATOM   982  C  CE    . MET A 1 145 ? 49.177  -18.450 -5.693  1.00 55.04  ?  212  MET A CE    1 
ATOM   983  N  N     . THR A 1 146 ? 55.313  -19.269 -4.613  1.00 38.76  ?  213  THR A N     1 
ATOM   984  C  CA    . THR A 1 146 ? 56.365  -19.566 -5.572  1.00 41.36  ?  213  THR A CA    1 
ATOM   985  C  C     . THR A 1 146 ? 56.184  -20.991 -6.085  1.00 40.78  ?  213  THR A C     1 
ATOM   986  O  O     . THR A 1 146 ? 55.211  -21.677 -5.760  1.00 48.01  ?  213  THR A O     1 
ATOM   987  C  CB    . THR A 1 146 ? 57.752  -19.392 -4.946  1.00 50.06  ?  213  THR A CB    1 
ATOM   988  O  OG1   . THR A 1 146 ? 57.923  -20.336 -3.882  1.00 50.53  ?  213  THR A OG1   1 
ATOM   989  C  CG2   . THR A 1 146 ? 57.925  -17.983 -4.399  1.00 42.35  ?  213  THR A CG2   1 
ATOM   990  N  N     . GLY A 1 147 ? 57.133  -21.432 -6.903  1.00 47.48  ?  214  GLY A N     1 
ATOM   991  C  CA    . GLY A 1 147 ? 57.203  -22.819 -7.301  1.00 69.36  ?  214  GLY A CA    1 
ATOM   992  C  C     . GLY A 1 147 ? 57.777  -23.742 -6.252  1.00 63.82  ?  214  GLY A C     1 
ATOM   993  O  O     . GLY A 1 147 ? 58.054  -24.907 -6.548  1.00 83.28  ?  214  GLY A O     1 
ATOM   994  N  N     . ASP A 1 148 ? 57.963  -23.253 -5.023  1.00 58.58  ?  215  ASP A N     1 
ATOM   995  C  CA    . ASP A 1 148 ? 58.535  -24.044 -3.945  1.00 58.31  ?  215  ASP A CA    1 
ATOM   996  C  C     . ASP A 1 148 ? 57.769  -23.948 -2.635  1.00 57.64  ?  215  ASP A C     1 
ATOM   997  O  O     . ASP A 1 148 ? 58.113  -24.672 -1.694  1.00 67.62  ?  215  ASP A O     1 
ATOM   998  C  CB    . ASP A 1 148 ? 59.990  -23.623 -3.682  1.00 51.70  ?  215  ASP A CB    1 
ATOM   999  C  CG    . ASP A 1 148 ? 60.895  -23.858 -4.878  1.00 71.10  ?  215  ASP A CG    1 
ATOM   1000 O  OD1   . ASP A 1 148 ? 60.446  -24.493 -5.857  1.00 70.04  -1 215  ASP A OD1   1 
ATOM   1001 O  OD2   . ASP A 1 148 ? 62.059  -23.404 -4.840  1.00 67.99  ?  215  ASP A OD2   1 
ATOM   1002 N  N     . VAL A 1 149 ? 56.757  -23.086 -2.532  1.00 49.42  ?  216  VAL A N     1 
ATOM   1003 C  CA    . VAL A 1 149 ? 56.022  -22.927 -1.282  1.00 46.92  ?  216  VAL A CA    1 
ATOM   1004 C  C     . VAL A 1 149 ? 54.787  -22.063 -1.499  1.00 48.98  ?  216  VAL A C     1 
ATOM   1005 O  O     . VAL A 1 149 ? 54.752  -21.220 -2.404  1.00 44.73  ?  216  VAL A O     1 
ATOM   1006 C  CB    . VAL A 1 149 ? 56.926  -22.326 -0.187  1.00 50.30  ?  216  VAL A CB    1 
ATOM   1007 C  CG1   . VAL A 1 149 ? 57.362  -20.911 -0.559  1.00 60.37  ?  216  VAL A CG1   1 
ATOM   1008 C  CG2   . VAL A 1 149 ? 56.217  -22.340 1.161   1.00 54.76  ?  216  VAL A CG2   1 
ATOM   1009 N  N     . THR A 1 150 ? 53.765  -22.276 -0.671  1.00 44.95  ?  217  THR A N     1 
ATOM   1010 C  CA    . THR A 1 150 ? 52.568  -21.445 -0.652  1.00 46.18  ?  217  THR A CA    1 
ATOM   1011 C  C     . THR A 1 150 ? 52.208  -21.158 0.797   1.00 52.29  ?  217  THR A C     1 
ATOM   1012 O  O     . THR A 1 150 ? 52.068  -22.088 1.596   1.00 57.48  ?  217  THR A O     1 
ATOM   1013 C  CB    . THR A 1 150 ? 51.392  -22.128 -1.361  1.00 44.39  ?  217  THR A CB    1 
ATOM   1014 O  OG1   . THR A 1 150 ? 51.724  -22.356 -2.736  1.00 57.90  ?  217  THR A OG1   1 
ATOM   1015 C  CG2   . THR A 1 150 ? 50.143  -21.261 -1.284  1.00 43.28  ?  217  THR A CG2   1 
ATOM   1016 N  N     . ILE A 1 151 ? 52.060  -19.879 1.132   1.00 48.77  ?  218  ILE A N     1 
ATOM   1017 C  CA    . ILE A 1 151 ? 51.780  -19.449 2.496   1.00 42.23  ?  218  ILE A CA    1 
ATOM   1018 C  C     . ILE A 1 151 ? 50.649  -18.435 2.461   1.00 48.42  ?  218  ILE A C     1 
ATOM   1019 O  O     . ILE A 1 151 ? 50.679  -17.495 1.658   1.00 50.51  ?  218  ILE A O     1 
ATOM   1020 C  CB    . ILE A 1 151 ? 53.021  -18.836 3.173   1.00 51.28  ?  218  ILE A CB    1 
ATOM   1021 C  CG1   . ILE A 1 151 ? 54.188  -19.820 3.132   1.00 49.46  ?  218  ILE A CG1   1 
ATOM   1022 C  CG2   . ILE A 1 151 ? 52.702  -18.446 4.612   1.00 49.03  ?  218  ILE A CG2   1 
ATOM   1023 C  CD1   . ILE A 1 151 ? 55.486  -19.243 3.633   1.00 56.59  ?  218  ILE A CD1   1 
ATOM   1024 N  N     . ASN A 1 152 ? 49.662  -18.622 3.333   1.00 53.29  ?  219  ASN A N     1 
ATOM   1025 C  CA    . ASN A 1 152 ? 48.568  -17.676 3.514   1.00 46.78  ?  219  ASN A CA    1 
ATOM   1026 C  C     . ASN A 1 152 ? 47.990  -17.226 2.169   1.00 46.95  ?  219  ASN A C     1 
ATOM   1027 O  O     . ASN A 1 152 ? 47.892  -16.026 1.900   1.00 48.00  ?  219  ASN A O     1 
ATOM   1028 C  CB    . ASN A 1 152 ? 49.039  -16.476 4.324   1.00 45.08  ?  219  ASN A CB    1 
ATOM   1029 C  CG    . ASN A 1 152 ? 47.892  -15.695 4.930   1.00 54.15  ?  219  ASN A CG    1 
ATOM   1030 O  OD1   . ASN A 1 152 ? 46.770  -16.190 5.024   1.00 54.70  ?  219  ASN A OD1   1 
ATOM   1031 N  ND2   . ASN A 1 152 ? 48.170  -14.464 5.351   1.00 56.15  ?  219  ASN A ND2   1 
ATOM   1032 N  N     . PRO A 1 153 ? 47.586  -18.166 1.309   1.00 52.05  ?  220  PRO A N     1 
ATOM   1033 C  CA    . PRO A 1 153 ? 47.164  -17.791 -0.051  1.00 43.85  ?  220  PRO A CA    1 
ATOM   1034 C  C     . PRO A 1 153 ? 45.936  -16.899 -0.096  1.00 49.10  ?  220  PRO A C     1 
ATOM   1035 O  O     . PRO A 1 153 ? 45.613  -16.385 -1.175  1.00 50.93  ?  220  PRO A O     1 
ATOM   1036 C  CB    . PRO A 1 153 ? 46.891  -19.145 -0.722  1.00 53.94  ?  220  PRO A CB    1 
ATOM   1037 C  CG    . PRO A 1 153 ? 46.598  -20.075 0.410   1.00 53.70  ?  220  PRO A CG    1 
ATOM   1038 C  CD    . PRO A 1 153 ? 47.452  -19.613 1.552   1.00 50.63  ?  220  PRO A CD    1 
ATOM   1039 N  N     . THR A 1 154 ? 45.240  -16.707 1.021   1.00 46.53  ?  221  THR A N     1 
ATOM   1040 C  CA    . THR A 1 154 ? 44.114  -15.787 1.086   1.00 49.92  ?  221  THR A CA    1 
ATOM   1041 C  C     . THR A 1 154 ? 44.522  -14.404 1.574   1.00 44.80  ?  221  THR A C     1 
ATOM   1042 O  O     . THR A 1 154 ? 43.651  -13.558 1.803   1.00 47.32  ?  221  THR A O     1 
ATOM   1043 C  CB    . THR A 1 154 ? 43.019  -16.348 1.998   1.00 47.81  ?  221  THR A CB    1 
ATOM   1044 O  OG1   . THR A 1 154 ? 43.560  -16.592 3.303   1.00 53.22  ?  221  THR A OG1   1 
ATOM   1045 C  CG2   . THR A 1 154 ? 42.460  -17.642 1.426   1.00 45.65  ?  221  THR A CG2   1 
ATOM   1046 N  N     . ALA A 1 155 ? 45.818  -14.157 1.741   1.00 41.94  ?  222  ALA A N     1 
ATOM   1047 C  CA    . ALA A 1 155 ? 46.279  -12.854 2.190   1.00 44.09  ?  222  ALA A CA    1 
ATOM   1048 C  C     . ALA A 1 155 ? 45.830  -11.767 1.220   1.00 48.52  ?  222  ALA A C     1 
ATOM   1049 O  O     . ALA A 1 155 ? 45.613  -12.011 0.030   1.00 40.07  ?  222  ALA A O     1 
ATOM   1050 C  CB    . ALA A 1 155 ? 47.801  -12.848 2.321   1.00 45.37  ?  222  ALA A CB    1 
ATOM   1051 N  N     . SER A 1 156 ? 45.681  -10.550 1.746   1.00 42.91  ?  223  SER A N     1 
ATOM   1052 C  CA    . SER A 1 156 ? 45.329  -9.424  0.889   1.00 51.14  ?  223  SER A CA    1 
ATOM   1053 C  C     . SER A 1 156 ? 46.489  -9.050  -0.028  1.00 41.36  ?  223  SER A C     1 
ATOM   1054 O  O     . SER A 1 156 ? 46.275  -8.680  -1.187  1.00 40.13  ?  223  SER A O     1 
ATOM   1055 C  CB    . SER A 1 156 ? 44.908  -8.228  1.742   1.00 43.85  ?  223  SER A CB    1 
ATOM   1056 O  OG    . SER A 1 156 ? 43.861  -8.576  2.630   1.00 47.41  ?  223  SER A OG    1 
ATOM   1057 N  N     . CYS A 1 157 ? 47.721  -9.145  0.472   1.00 34.41  ?  224  CYS A N     1 
ATOM   1058 C  CA    . CYS A 1 157 ? 48.924  -8.889  -0.311  1.00 34.40  ?  224  CYS A CA    1 
ATOM   1059 C  C     . CYS A 1 157 ? 49.615  -10.217 -0.593  1.00 41.44  ?  224  CYS A C     1 
ATOM   1060 O  O     . CYS A 1 157 ? 50.032  -10.910 0.340   1.00 37.06  ?  224  CYS A O     1 
ATOM   1061 C  CB    . CYS A 1 157 ? 49.870  -7.943  0.429   1.00 30.79  ?  224  CYS A CB    1 
ATOM   1062 S  SG    . CYS A 1 157 ? 51.455  -7.652  -0.405  1.00 37.28  ?  224  CYS A SG    1 
ATOM   1063 N  N     . LEU A 1 158 ? 49.744  -10.562 -1.874  1.00 41.94  ?  225  LEU A N     1 
ATOM   1064 C  CA    . LEU A 1 158 ? 50.367  -11.811 -2.301  1.00 36.22  ?  225  LEU A CA    1 
ATOM   1065 C  C     . LEU A 1 158 ? 51.686  -11.504 -2.997  1.00 33.12  ?  225  LEU A C     1 
ATOM   1066 O  O     . LEU A 1 158 ? 51.702  -10.887 -4.067  1.00 41.43  ?  225  LEU A O     1 
ATOM   1067 C  CB    . LEU A 1 158 ? 49.444  -12.593 -3.232  1.00 42.35  ?  225  LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1 158 ? 48.193  -13.216 -2.612  1.00 44.42  ?  225  LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1 158 ? 47.401  -13.940 -3.684  1.00 43.93  ?  225  LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1 158 ? 48.557  -14.166 -1.480  1.00 44.03  ?  225  LEU A CD2   1 
ATOM   1071 N  N     . VAL A 1 159 ? 52.784  -11.937 -2.390  1.00 35.78  ?  226  VAL A N     1 
ATOM   1072 C  CA    . VAL A 1 159 ? 54.088  -11.942 -3.041  1.00 31.36  ?  226  VAL A CA    1 
ATOM   1073 C  C     . VAL A 1 159 ? 54.211  -13.241 -3.826  1.00 39.27  ?  226  VAL A C     1 
ATOM   1074 O  O     . VAL A 1 159 ? 53.913  -14.320 -3.303  1.00 36.43  ?  226  VAL A O     1 
ATOM   1075 C  CB    . VAL A 1 159 ? 55.220  -11.811 -2.009  1.00 33.00  ?  226  VAL A CB    1 
ATOM   1076 C  CG1   . VAL A 1 159 ? 56.568  -11.728 -2.708  1.00 38.67  ?  226  VAL A CG1   1 
ATOM   1077 C  CG2   . VAL A 1 159 ? 54.996  -10.600 -1.117  1.00 34.03  ?  226  VAL A CG2   1 
ATOM   1078 N  N     . MET A 1 160 ? 54.643  -13.145 -5.081  1.00 36.34  ?  227  MET A N     1 
ATOM   1079 C  CA    . MET A 1 160 ? 54.730  -14.329 -5.926  1.00 39.36  ?  227  MET A CA    1 
ATOM   1080 C  C     . MET A 1 160 ? 55.751  -14.088 -7.029  1.00 38.71  ?  227  MET A C     1 
ATOM   1081 O  O     . MET A 1 160 ? 56.192  -12.964 -7.263  1.00 32.85  ?  227  MET A O     1 
ATOM   1082 C  CB    . MET A 1 160 ? 53.361  -14.685 -6.519  1.00 35.79  ?  227  MET A CB    1 
ATOM   1083 C  CG    . MET A 1 160 ? 52.838  -13.676 -7.527  1.00 31.26  ?  227  MET A CG    1 
ATOM   1084 S  SD    . MET A 1 160 ? 51.150  -14.012 -8.053  1.00 37.60  ?  227  MET A SD    1 
ATOM   1085 C  CE    . MET A 1 160 ? 50.250  -13.684 -6.539  1.00 38.18  ?  227  MET A CE    1 
ATOM   1086 N  N     . THR A 1 161 ? 56.129  -15.171 -7.699  1.00 37.85  ?  228  THR A N     1 
ATOM   1087 C  CA    . THR A 1 161 ? 56.982  -15.072 -8.869  1.00 27.71  ?  228  THR A CA    1 
ATOM   1088 C  C     . THR A 1 161 ? 56.138  -14.785 -10.104 1.00 31.84  ?  228  THR A C     1 
ATOM   1089 O  O     . THR A 1 161 ? 54.924  -15.002 -10.127 1.00 29.68  ?  228  THR A O     1 
ATOM   1090 C  CB    . THR A 1 161 ? 57.773  -16.362 -9.078  1.00 35.44  ?  228  THR A CB    1 
ATOM   1091 O  OG1   . THR A 1 161 ? 56.877  -17.478 -9.047  1.00 35.24  ?  228  THR A OG1   1 
ATOM   1092 C  CG2   . THR A 1 161 ? 58.828  -16.526 -8.000  1.00 38.70  ?  228  THR A CG2   1 
ATOM   1093 N  N     A THR A 1 162 ? 56.793  -14.287 -11.151 0.54 33.31  ?  229  THR A N     1 
ATOM   1094 N  N     B THR A 1 162 ? 56.810  -14.284 -11.142 0.46 33.01  ?  229  THR A N     1 
ATOM   1095 C  CA    A THR A 1 162 ? 56.055  -13.971 -12.367 0.54 34.45  ?  229  THR A CA    1 
ATOM   1096 C  CA    B THR A 1 162 ? 56.132  -13.981 -12.396 0.46 35.82  ?  229  THR A CA    1 
ATOM   1097 C  C     A THR A 1 162 ? 55.523  -15.221 -13.060 0.54 32.91  ?  229  THR A C     1 
ATOM   1098 C  C     B THR A 1 162 ? 55.500  -15.227 -13.003 0.46 34.87  ?  229  THR A C     1 
ATOM   1099 O  O     A THR A 1 162 ? 54.528  -15.131 -13.788 0.54 30.37  ?  229  THR A O     1 
ATOM   1100 O  O     B THR A 1 162 ? 54.424  -15.147 -13.609 0.46 30.24  ?  229  THR A O     1 
ATOM   1101 C  CB    A THR A 1 162 ? 56.930  -13.156 -13.323 0.54 34.03  ?  229  THR A CB    1 
ATOM   1102 C  CB    B THR A 1 162 ? 57.121  -13.360 -13.382 0.46 34.59  ?  229  THR A CB    1 
ATOM   1103 O  OG1   A THR A 1 162 ? 58.211  -13.781 -13.476 0.54 40.12  ?  229  THR A OG1   1 
ATOM   1104 O  OG1   B THR A 1 162 ? 58.109  -12.611 -12.662 0.46 41.51  ?  229  THR A OG1   1 
ATOM   1105 C  CG2   A THR A 1 162 ? 57.116  -11.739 -12.784 0.54 39.38  ?  229  THR A CG2   1 
ATOM   1106 C  CG2   B THR A 1 162 ? 56.405  -12.436 -14.345 0.46 31.83  ?  229  THR A CG2   1 
ATOM   1107 N  N     . GLU A 1 163 ? 56.145  -16.384 -12.838 1.00 31.64  ?  230  GLU A N     1 
ATOM   1108 C  CA    . GLU A 1 163 ? 55.626  -17.622 -13.416 1.00 33.22  ?  230  GLU A CA    1 
ATOM   1109 C  C     . GLU A 1 163 ? 54.297  -18.005 -12.778 1.00 31.47  ?  230  GLU A C     1 
ATOM   1110 O  O     . GLU A 1 163 ? 53.366  -18.431 -13.472 1.00 30.89  ?  230  GLU A O     1 
ATOM   1111 C  CB    . GLU A 1 163 ? 56.637  -18.761 -13.242 1.00 33.85  ?  230  GLU A CB    1 
ATOM   1112 C  CG    . GLU A 1 163 ? 58.069  -18.403 -13.592 1.00 49.74  ?  230  GLU A CG    1 
ATOM   1113 C  CD    . GLU A 1 163 ? 58.840  -17.851 -12.403 1.00 57.73  ?  230  GLU A CD    1 
ATOM   1114 O  OE1   . GLU A 1 163 ? 59.348  -18.651 -11.585 1.00 62.80  ?  230  GLU A OE1   1 
ATOM   1115 O  OE2   . GLU A 1 163 ? 58.925  -16.611 -12.280 1.00 63.02  ?  230  GLU A OE2   1 
ATOM   1116 N  N     . ILE A 1 164 ? 54.191  -17.862 -11.457 1.00 31.41  ?  231  ILE A N     1 
ATOM   1117 C  CA    . ILE A 1 164 ? 52.931  -18.140 -10.774 1.00 26.66  ?  231  ILE A CA    1 
ATOM   1118 C  C     . ILE A 1 164 ? 51.833  -17.222 -11.298 1.00 35.68  ?  231  ILE A C     1 
ATOM   1119 O  O     . ILE A 1 164 ? 50.720  -17.666 -11.604 1.00 30.66  ?  231  ILE A O     1 
ATOM   1120 C  CB    . ILE A 1 164 ? 53.108  -17.999 -9.252  1.00 32.64  ?  231  ILE A CB    1 
ATOM   1121 C  CG1   . ILE A 1 164 ? 54.091  -19.050 -8.722  1.00 39.00  ?  231  ILE A CG1   1 
ATOM   1122 C  CG2   . ILE A 1 164 ? 51.770  -18.117 -8.546  1.00 40.93  ?  231  ILE A CG2   1 
ATOM   1123 C  CD1   . ILE A 1 164 ? 53.597  -20.488 -8.835  1.00 40.63  ?  231  ILE A CD1   1 
ATOM   1124 N  N     . LEU A 1 165 ? 52.130  -15.923 -11.407 1.00 31.55  ?  232  LEU A N     1 
ATOM   1125 C  CA    . LEU A 1 165 ? 51.135  -14.979 -11.906 1.00 30.80  ?  232  LEU A CA    1 
ATOM   1126 C  C     . LEU A 1 165 ? 50.672  -15.360 -13.306 1.00 24.42  ?  232  LEU A C     1 
ATOM   1127 O  O     . LEU A 1 165 ? 49.476  -15.294 -13.613 1.00 25.14  ?  232  LEU A O     1 
ATOM   1128 C  CB    . LEU A 1 165 ? 51.705  -13.559 -11.896 1.00 35.05  ?  232  LEU A CB    1 
ATOM   1129 C  CG    . LEU A 1 165 ? 50.819  -12.453 -12.481 1.00 30.87  ?  232  LEU A CG    1 
ATOM   1130 C  CD1   . LEU A 1 165 ? 49.483  -12.393 -11.765 1.00 28.27  ?  232  LEU A CD1   1 
ATOM   1131 C  CD2   . LEU A 1 165 ? 51.530  -11.103 -12.406 1.00 30.49  ?  232  LEU A CD2   1 
ATOM   1132 N  N     . ARG A 1 166 ? 51.609  -15.754 -14.171 1.00 25.83  ?  233  ARG A N     1 
ATOM   1133 C  CA    . ARG A 1 166 ? 51.240  -16.201 -15.510 1.00 34.12  ?  233  ARG A CA    1 
ATOM   1134 C  C     . ARG A 1 166 ? 50.307  -17.405 -15.447 1.00 32.43  ?  233  ARG A C     1 
ATOM   1135 O  O     . ARG A 1 166 ? 49.329  -17.484 -16.198 1.00 36.52  ?  233  ARG A O     1 
ATOM   1136 C  CB    . ARG A 1 166 ? 52.497  -16.545 -16.307 1.00 32.20  ?  233  ARG A CB    1 
ATOM   1137 C  CG    . ARG A 1 166 ? 52.238  -17.008 -17.736 1.00 40.98  ?  233  ARG A CG    1 
ATOM   1138 C  CD    . ARG A 1 166 ? 53.290  -18.003 -18.183 1.00 38.21  ?  233  ARG A CD    1 
ATOM   1139 N  NE    . ARG A 1 166 ? 53.264  -18.231 -19.625 1.00 40.41  ?  233  ARG A NE    1 
ATOM   1140 C  CZ    . ARG A 1 166 ? 52.726  -19.290 -20.224 1.00 35.11  ?  233  ARG A CZ    1 
ATOM   1141 N  NH1   . ARG A 1 166 ? 52.150  -20.255 -19.519 1.00 36.21  ?  233  ARG A NH1   1 
ATOM   1142 N  NH2   . ARG A 1 166 ? 52.775  -19.386 -21.546 1.00 27.44  ?  233  ARG A NH2   1 
ATOM   1143 N  N     . SER A 1 167 ? 50.596  -18.355 -14.556 1.00 28.53  ?  234  SER A N     1 
ATOM   1144 C  CA    . SER A 1 167 ? 49.755  -19.541 -14.450 1.00 37.92  ?  234  SER A CA    1 
ATOM   1145 C  C     . SER A 1 167 ? 48.344  -19.164 -14.019 1.00 32.56  ?  234  SER A C     1 
ATOM   1146 O  O     . SER A 1 167 ? 47.360  -19.649 -14.589 1.00 34.52  ?  234  SER A O     1 
ATOM   1147 C  CB    . SER A 1 167 ? 50.379  -20.537 -13.468 1.00 36.65  ?  234  SER A CB    1 
ATOM   1148 O  OG    . SER A 1 167 ? 49.764  -21.807 -13.566 1.00 52.44  ?  234  SER A OG    1 
ATOM   1149 N  N     . MET A 1 168 ? 48.227  -18.280 -13.027 1.00 33.94  ?  235  MET A N     1 
ATOM   1150 C  CA    . MET A 1 168 ? 46.911  -17.852 -12.569 1.00 37.86  ?  235  MET A CA    1 
ATOM   1151 C  C     . MET A 1 168 ? 46.129  -17.167 -13.682 1.00 35.47  ?  235  MET A C     1 
ATOM   1152 O  O     . MET A 1 168 ? 44.907  -17.327 -13.782 1.00 30.31  ?  235  MET A O     1 
ATOM   1153 C  CB    . MET A 1 168 ? 47.053  -16.915 -11.371 1.00 41.48  ?  235  MET A CB    1 
ATOM   1154 C  CG    . MET A 1 168 ? 47.270  -17.625 -10.055 1.00 44.34  ?  235  MET A CG    1 
ATOM   1155 S  SD    . MET A 1 168 ? 47.110  -16.500 -8.660  1.00 58.73  ?  235  MET A SD    1 
ATOM   1156 C  CE    . MET A 1 168 ? 48.818  -16.287 -8.217  1.00 50.14  ?  235  MET A CE    1 
ATOM   1157 N  N     . LEU A 1 169 ? 46.811  -16.396 -14.528 1.00 32.19  ?  236  LEU A N     1 
ATOM   1158 C  CA    . LEU A 1 169 ? 46.104  -15.661 -15.571 1.00 42.19  ?  236  LEU A CA    1 
ATOM   1159 C  C     . LEU A 1 169 ? 45.624  -16.597 -16.674 1.00 30.75  ?  236  LEU A C     1 
ATOM   1160 O  O     . LEU A 1 169 ? 44.466  -16.527 -17.100 1.00 34.25  ?  236  LEU A O     1 
ATOM   1161 C  CB    . LEU A 1 169 ? 47.001  -14.564 -16.140 1.00 28.18  ?  236  LEU A CB    1 
ATOM   1162 C  CG    . LEU A 1 169 ? 47.264  -13.396 -15.185 1.00 43.21  ?  236  LEU A CG    1 
ATOM   1163 C  CD1   . LEU A 1 169 ? 48.405  -12.531 -15.697 1.00 27.47  ?  236  LEU A CD1   1 
ATOM   1164 C  CD2   . LEU A 1 169 ? 46.004  -12.557 -14.985 1.00 32.51  ?  236  LEU A CD2   1 
ATOM   1165 N  N     . TYR A 1 170 ? 46.501  -17.483 -17.151 1.00 32.00  ?  237  TYR A N     1 
ATOM   1166 C  CA    . TYR A 1 170 ? 46.107  -18.405 -18.209 1.00 38.15  ?  237  TYR A CA    1 
ATOM   1167 C  C     . TYR A 1 170 ? 45.045  -19.395 -17.748 1.00 35.97  ?  237  TYR A C     1 
ATOM   1168 O  O     . TYR A 1 170 ? 44.300  -19.916 -18.584 1.00 36.33  ?  237  TYR A O     1 
ATOM   1169 C  CB    . TYR A 1 170 ? 47.325  -19.161 -18.732 1.00 36.49  ?  237  TYR A CB    1 
ATOM   1170 C  CG    . TYR A 1 170 ? 48.029  -18.482 -19.887 1.00 34.98  ?  237  TYR A CG    1 
ATOM   1171 C  CD1   . TYR A 1 170 ? 47.412  -18.362 -21.124 1.00 32.66  ?  237  TYR A CD1   1 
ATOM   1172 C  CD2   . TYR A 1 170 ? 49.315  -17.981 -19.745 1.00 31.97  ?  237  TYR A CD2   1 
ATOM   1173 C  CE1   . TYR A 1 170 ? 48.053  -17.752 -22.190 1.00 30.90  ?  237  TYR A CE1   1 
ATOM   1174 C  CE2   . TYR A 1 170 ? 49.968  -17.368 -20.807 1.00 30.73  ?  237  TYR A CE2   1 
ATOM   1175 C  CZ    . TYR A 1 170 ? 49.330  -17.258 -22.025 1.00 33.65  ?  237  TYR A CZ    1 
ATOM   1176 O  OH    . TYR A 1 170 ? 49.968  -16.651 -23.083 1.00 31.29  ?  237  TYR A OH    1 
ATOM   1177 N  N     . ARG A 1 171 ? 44.953  -19.656 -16.444 1.00 34.84  ?  238  ARG A N     1 
ATOM   1178 C  CA    . ARG A 1 171 ? 43.952  -20.558 -15.887 1.00 39.36  ?  238  ARG A CA    1 
ATOM   1179 C  C     . ARG A 1 171 ? 42.739  -19.827 -15.327 1.00 43.94  ?  238  ARG A C     1 
ATOM   1180 O  O     . ARG A 1 171 ? 41.858  -20.473 -14.751 1.00 45.75  ?  238  ARG A O     1 
ATOM   1181 C  CB    . ARG A 1 171 ? 44.580  -21.424 -14.790 1.00 37.58  ?  238  ARG A CB    1 
ATOM   1182 C  CG    . ARG A 1 171 ? 45.693  -22.331 -15.298 1.00 30.32  ?  238  ARG A CG    1 
ATOM   1183 C  CD    . ARG A 1 171 ? 46.486  -22.947 -14.163 1.00 31.76  ?  238  ARG A CD    1 
ATOM   1184 N  NE    . ARG A 1 171 ? 47.688  -23.613 -14.657 1.00 31.89  ?  238  ARG A NE    1 
ATOM   1185 C  CZ    . ARG A 1 171 ? 47.733  -24.863 -15.111 1.00 45.48  ?  238  ARG A CZ    1 
ATOM   1186 N  NH1   . ARG A 1 171 ? 46.638  -25.618 -15.142 1.00 41.14  ?  238  ARG A NH1   1 
ATOM   1187 N  NH2   . ARG A 1 171 ? 48.884  -25.361 -15.540 1.00 36.29  ?  238  ARG A NH2   1 
ATOM   1188 N  N     . GLY A 1 172 ? 42.672  -18.508 -15.481 1.00 41.60  ?  239  GLY A N     1 
ATOM   1189 C  CA    . GLY A 1 172 ? 41.523  -17.748 -15.014 1.00 39.19  ?  239  GLY A CA    1 
ATOM   1190 C  C     . GLY A 1 172 ? 41.237  -17.913 -13.538 1.00 39.67  ?  239  GLY A C     1 
ATOM   1191 O  O     . GLY A 1 172 ? 40.068  -17.979 -13.137 1.00 51.24  ?  239  GLY A O     1 
ATOM   1192 N  N     . SER A 1 173 ? 42.281  -17.979 -12.716 1.00 35.25  ?  240  SER A N     1 
ATOM   1193 C  CA    . SER A 1 173 ? 42.095  -18.139 -11.280 1.00 40.28  ?  240  SER A CA    1 
ATOM   1194 C  C     . SER A 1 173 ? 41.329  -16.956 -10.703 1.00 50.72  ?  240  SER A C     1 
ATOM   1195 O  O     . SER A 1 173 ? 41.661  -15.797 -10.968 1.00 43.05  ?  240  SER A O     1 
ATOM   1196 C  CB    . SER A 1 173 ? 43.450  -18.273 -10.588 1.00 35.04  ?  240  SER A CB    1 
ATOM   1197 O  OG    . SER A 1 173 ? 43.312  -18.143 -9.184  1.00 48.57  ?  240  SER A OG    1 
ATOM   1198 N  N     . GLU A 1 174 ? 40.305  -17.255 -9.900  1.00 47.83  ?  241  GLU A N     1 
ATOM   1199 C  CA    . GLU A 1 174 ? 39.488  -16.218 -9.284  1.00 49.98  ?  241  GLU A CA    1 
ATOM   1200 C  C     . GLU A 1 174 ? 40.262  -15.360 -8.293  1.00 44.72  ?  241  GLU A C     1 
ATOM   1201 O  O     . GLU A 1 174 ? 39.761  -14.303 -7.897  1.00 46.71  ?  241  GLU A O     1 
ATOM   1202 C  CB    . GLU A 1 174 ? 38.284  -16.845 -8.576  1.00 59.90  ?  241  GLU A CB    1 
ATOM   1203 C  CG    . GLU A 1 174 ? 37.166  -17.287 -9.510  1.00 63.00  ?  241  GLU A CG    1 
ATOM   1204 C  CD    . GLU A 1 174 ? 36.593  -16.139 -10.320 1.00 62.30  ?  241  GLU A CD    1 
ATOM   1205 O  OE1   . GLU A 1 174 ? 36.594  -16.228 -11.566 1.00 59.22  ?  241  GLU A OE1   1 
ATOM   1206 O  OE2   . GLU A 1 174 ? 36.150  -15.142 -9.709  1.00 64.23  -1 241  GLU A OE2   1 
ATOM   1207 N  N     . VAL A 1 175 ? 41.461  -15.781 -7.884  1.00 46.69  ?  242  VAL A N     1 
ATOM   1208 C  CA    . VAL A 1 175 ? 42.287  -14.944 -7.019  1.00 52.71  ?  242  VAL A CA    1 
ATOM   1209 C  C     . VAL A 1 175 ? 42.532  -13.582 -7.660  1.00 53.74  ?  242  VAL A C     1 
ATOM   1210 O  O     . VAL A 1 175 ? 42.773  -12.591 -6.959  1.00 57.62  ?  242  VAL A O     1 
ATOM   1211 C  CB    . VAL A 1 175 ? 43.614  -15.665 -6.702  1.00 53.82  ?  242  VAL A CB    1 
ATOM   1212 C  CG1   . VAL A 1 175 ? 44.526  -14.780 -5.858  1.00 54.72  ?  242  VAL A CG1   1 
ATOM   1213 C  CG2   . VAL A 1 175 ? 43.345  -16.987 -5.993  1.00 58.49  ?  242  VAL A CG2   1 
ATOM   1214 N  N     A MET A 1 176 ? 42.471  -13.506 -8.990  0.05 48.17  ?  243  MET A N     1 
ATOM   1215 N  N     B MET A 1 176 ? 42.469  -13.507 -8.989  0.95 47.86  ?  243  MET A N     1 
ATOM   1216 C  CA    A MET A 1 176 ? 42.749  -12.268 -9.706  0.05 50.37  ?  243  MET A CA    1 
ATOM   1217 C  CA    B MET A 1 176 ? 42.748  -12.271 -9.704  0.95 50.41  ?  243  MET A CA    1 
ATOM   1218 C  C     A MET A 1 176 ? 41.568  -11.308 -9.737  0.05 52.11  ?  243  MET A C     1 
ATOM   1219 C  C     B MET A 1 176 ? 41.572  -11.307 -9.725  0.95 52.30  ?  243  MET A C     1 
ATOM   1220 O  O     A MET A 1 176 ? 41.755  -10.140 -10.094 0.05 49.07  ?  243  MET A O     1 
ATOM   1221 O  O     B MET A 1 176 ? 41.768  -10.132 -10.053 0.95 48.97  ?  243  MET A O     1 
ATOM   1222 C  CB    A MET A 1 176 ? 43.171  -12.581 -11.144 0.05 50.79  ?  243  MET A CB    1 
ATOM   1223 C  CB    B MET A 1 176 ? 43.161  -12.588 -11.144 0.95 50.80  ?  243  MET A CB    1 
ATOM   1224 C  CG    A MET A 1 176 ? 44.496  -13.308 -11.247 0.05 50.03  ?  243  MET A CG    1 
ATOM   1225 C  CG    B MET A 1 176 ? 44.454  -13.384 -11.257 0.95 50.08  ?  243  MET A CG    1 
ATOM   1226 S  SD    A MET A 1 176 ? 45.879  -12.280 -10.721 0.05 50.04  ?  243  MET A SD    1 
ATOM   1227 S  SD    B MET A 1 176 ? 45.824  -12.617 -10.368 0.95 51.99  ?  243  MET A SD    1 
ATOM   1228 C  CE    A MET A 1 176 ? 46.973  -13.528 -10.058 0.05 44.56  ?  243  MET A CE    1 
ATOM   1229 C  CE    B MET A 1 176 ? 45.791  -10.971 -11.080 0.95 42.00  ?  243  MET A CE    1 
ATOM   1230 N  N     . ARG A 1 177 ? 40.365  -11.760 -9.375  1.00 50.95  ?  244  ARG A N     1 
ATOM   1231 C  CA    . ARG A 1 177 ? 39.190  -10.910 -9.531  1.00 57.49  ?  244  ARG A CA    1 
ATOM   1232 C  C     . ARG A 1 177 ? 39.213  -9.712  -8.588  1.00 50.56  ?  244  ARG A C     1 
ATOM   1233 O  O     . ARG A 1 177 ? 38.703  -8.643  -8.943  1.00 56.36  ?  244  ARG A O     1 
ATOM   1234 C  CB    . ARG A 1 177 ? 37.915  -11.727 -9.321  1.00 62.72  ?  244  ARG A CB    1 
ATOM   1235 C  CG    . ARG A 1 177 ? 36.664  -11.010 -9.803  1.00 65.15  ?  244  ARG A CG    1 
ATOM   1236 C  CD    . ARG A 1 177 ? 35.497  -11.963 -9.999  1.00 77.29  ?  244  ARG A CD    1 
ATOM   1237 N  NE    . ARG A 1 177 ? 35.715  -12.898 -11.101 1.00 70.82  ?  244  ARG A NE    1 
ATOM   1238 C  CZ    . ARG A 1 177 ? 35.641  -12.575 -12.390 1.00 75.01  ?  244  ARG A CZ    1 
ATOM   1239 N  NH1   . ARG A 1 177 ? 35.371  -11.327 -12.756 1.00 66.16  ?  244  ARG A NH1   1 
ATOM   1240 N  NH2   . ARG A 1 177 ? 35.848  -13.500 -13.317 1.00 71.09  ?  244  ARG A NH2   1 
ATOM   1241 N  N     . GLU A 1 178 ? 39.794  -9.856  -7.397  1.00 44.27  ?  245  GLU A N     1 
ATOM   1242 C  CA    . GLU A 1 178 ? 39.840  -8.772  -6.424  1.00 52.85  ?  245  GLU A CA    1 
ATOM   1243 C  C     . GLU A 1 178 ? 41.153  -7.996  -6.461  1.00 53.86  ?  245  GLU A C     1 
ATOM   1244 O  O     . GLU A 1 178 ? 41.384  -7.148  -5.592  1.00 41.54  ?  245  GLU A O     1 
ATOM   1245 C  CB    . GLU A 1 178 ? 39.601  -9.322  -5.015  1.00 68.57  ?  245  GLU A CB    1 
ATOM   1246 C  CG    . GLU A 1 178 ? 38.213  -9.917  -4.809  1.00 100.69 ?  245  GLU A CG    1 
ATOM   1247 C  CD    . GLU A 1 178 ? 37.102  -8.902  -5.015  1.00 92.40  ?  245  GLU A CD    1 
ATOM   1248 O  OE1   . GLU A 1 178 ? 37.281  -7.731  -4.618  1.00 108.91 ?  245  GLU A OE1   1 
ATOM   1249 O  OE2   . GLU A 1 178 ? 36.053  -9.272  -5.584  1.00 91.55  -1 245  GLU A OE2   1 
ATOM   1250 N  N     . VAL A 1 179 ? 42.006  -8.252  -7.448  1.00 38.19  ?  246  VAL A N     1 
ATOM   1251 C  CA    . VAL A 1 179 ? 43.303  -7.589  -7.533  1.00 41.49  ?  246  VAL A CA    1 
ATOM   1252 C  C     . VAL A 1 179 ? 43.103  -6.199  -8.121  1.00 40.08  ?  246  VAL A C     1 
ATOM   1253 O  O     . VAL A 1 179 ? 42.614  -6.050  -9.246  1.00 38.61  ?  246  VAL A O     1 
ATOM   1254 C  CB    . VAL A 1 179 ? 44.292  -8.410  -8.375  1.00 38.21  ?  246  VAL A CB    1 
ATOM   1255 C  CG1   . VAL A 1 179 ? 45.633  -7.691  -8.486  1.00 38.44  ?  246  VAL A CG1   1 
ATOM   1256 C  CG2   . VAL A 1 179 ? 44.483  -9.784  -7.766  1.00 37.77  ?  246  VAL A CG2   1 
ATOM   1257 N  N     . ALA A 1 180 ? 43.480  -5.177  -7.357  1.00 37.40  ?  247  ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 180 ? 43.426  -3.799  -7.823  1.00 40.88  ?  247  ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 180 ? 44.775  -3.285  -8.296  1.00 37.08  ?  247  ALA A C     1 
ATOM   1260 O  O     . ALA A 1 180 ? 44.824  -2.462  -9.217  1.00 31.10  ?  247  ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 180 ? 42.907  -2.882  -6.710  1.00 43.01  ?  247  ALA A CB    1 
ATOM   1262 N  N     . TRP A 1 181 ? 45.864  -3.762  -7.695  1.00 34.47  ?  248  TRP A N     1 
ATOM   1263 C  CA    . TRP A 1 181 ? 47.207  -3.295  -8.000  1.00 33.27  ?  248  TRP A CA    1 
ATOM   1264 C  C     . TRP A 1 181 ? 48.143  -4.477  -8.186  1.00 35.63  ?  248  TRP A C     1 
ATOM   1265 O  O     . TRP A 1 181 ? 48.083  -5.455  -7.434  1.00 30.70  ?  248  TRP A O     1 
ATOM   1266 C  CB    . TRP A 1 181 ? 47.746  -2.394  -6.885  1.00 34.23  ?  248  TRP A CB    1 
ATOM   1267 C  CG    . TRP A 1 181 ? 47.121  -1.039  -6.864  1.00 43.58  ?  248  TRP A CG    1 
ATOM   1268 C  CD1   . TRP A 1 181 ? 46.005  -0.662  -6.177  1.00 36.21  ?  248  TRP A CD1   1 
ATOM   1269 C  CD2   . TRP A 1 181 ? 47.574  0.125   -7.563  1.00 34.13  ?  248  TRP A CD2   1 
ATOM   1270 N  NE1   . TRP A 1 181 ? 45.736  0.666   -6.404  1.00 39.46  ?  248  TRP A NE1   1 
ATOM   1271 C  CE2   . TRP A 1 181 ? 46.684  1.172   -7.253  1.00 32.11  ?  248  TRP A CE2   1 
ATOM   1272 C  CE3   . TRP A 1 181 ? 48.644  0.383   -8.423  1.00 33.85  ?  248  TRP A CE3   1 
ATOM   1273 C  CZ2   . TRP A 1 181 ? 46.831  2.456   -7.769  1.00 38.96  ?  248  TRP A CZ2   1 
ATOM   1274 C  CZ3   . TRP A 1 181 ? 48.790  1.661   -8.935  1.00 37.64  ?  248  TRP A CZ3   1 
ATOM   1275 C  CH2   . TRP A 1 181 ? 47.888  2.681   -8.606  1.00 37.33  ?  248  TRP A CH2   1 
ATOM   1276 N  N     . VAL A 1 182 ? 49.009  -4.379  -9.190  1.00 31.33  ?  249  VAL A N     1 
ATOM   1277 C  CA    . VAL A 1 182 ? 50.107  -5.316  -9.389  1.00 36.70  ?  249  VAL A CA    1 
ATOM   1278 C  C     . VAL A 1 182 ? 51.401  -4.518  -9.373  1.00 29.21  ?  249  VAL A C     1 
ATOM   1279 O  O     . VAL A 1 182 ? 51.523  -3.511  -10.079 1.00 30.08  ?  249  VAL A O     1 
ATOM   1280 C  CB    . VAL A 1 182 ? 49.963  -6.105  -10.704 1.00 33.03  ?  249  VAL A CB    1 
ATOM   1281 C  CG1   . VAL A 1 182 ? 51.154  -7.037  -10.905 1.00 30.97  ?  249  VAL A CG1   1 
ATOM   1282 C  CG2   . VAL A 1 182 ? 48.669  -6.894  -10.700 1.00 35.58  ?  249  VAL A CG2   1 
ATOM   1283 N  N     . ILE A 1 183 ? 52.356  -4.964  -8.566  1.00 28.48  ?  250  ILE A N     1 
ATOM   1284 C  CA    . ILE A 1 183 ? 53.656  -4.319  -8.439  1.00 32.60  ?  250  ILE A CA    1 
ATOM   1285 C  C     . ILE A 1 183 ? 54.696  -5.248  -9.049  1.00 35.19  ?  250  ILE A C     1 
ATOM   1286 O  O     . ILE A 1 183 ? 54.889  -6.372  -8.570  1.00 37.47  ?  250  ILE A O     1 
ATOM   1287 C  CB    . ILE A 1 183 ? 53.988  -4.009  -6.972  1.00 33.50  ?  250  ILE A CB    1 
ATOM   1288 C  CG1   . ILE A 1 183 ? 52.876  -3.169  -6.340  1.00 30.25  ?  250  ILE A CG1   1 
ATOM   1289 C  CG2   . ILE A 1 183 ? 55.325  -3.293  -6.872  1.00 31.49  ?  250  ILE A CG2   1 
ATOM   1290 C  CD1   . ILE A 1 183 ? 52.921  -3.133  -4.832  1.00 37.07  ?  250  ILE A CD1   1 
ATOM   1291 N  N     . PHE A 1 184 ? 55.355  -4.785  -10.109 1.00 30.36  ?  251  PHE A N     1 
ATOM   1292 C  CA    . PHE A 1 184 ? 56.464  -5.503  -10.730 1.00 26.60  ?  251  PHE A CA    1 
ATOM   1293 C  C     . PHE A 1 184 ? 57.773  -4.915  -10.215 1.00 32.80  ?  251  PHE A C     1 
ATOM   1294 O  O     . PHE A 1 184 ? 58.085  -3.751  -10.488 1.00 29.08  ?  251  PHE A O     1 
ATOM   1295 C  CB    . PHE A 1 184 ? 56.407  -5.403  -12.254 1.00 32.31  ?  251  PHE A CB    1 
ATOM   1296 C  CG    . PHE A 1 184 ? 55.261  -6.143  -12.870 1.00 34.28  ?  251  PHE A CG    1 
ATOM   1297 C  CD1   . PHE A 1 184 ? 55.403  -7.462  -13.259 1.00 34.42  ?  251  PHE A CD1   1 
ATOM   1298 C  CD2   . PHE A 1 184 ? 54.046  -5.515  -13.073 1.00 30.22  ?  251  PHE A CD2   1 
ATOM   1299 C  CE1   . PHE A 1 184 ? 54.348  -8.147  -13.829 1.00 33.53  ?  251  PHE A CE1   1 
ATOM   1300 C  CE2   . PHE A 1 184 ? 52.991  -6.191  -13.644 1.00 29.84  ?  251  PHE A CE2   1 
ATOM   1301 C  CZ    . PHE A 1 184 ? 53.141  -7.511  -14.025 1.00 28.72  ?  251  PHE A CZ    1 
ATOM   1302 N  N     . ASP A 1 185 ? 58.535  -5.722  -9.485  1.00 28.51  ?  252  ASP A N     1 
ATOM   1303 C  CA    . ASP A 1 185 ? 59.800  -5.296  -8.907  1.00 31.55  ?  252  ASP A CA    1 
ATOM   1304 C  C     . ASP A 1 185 ? 60.956  -5.667  -9.828  1.00 30.70  ?  252  ASP A C     1 
ATOM   1305 O  O     . ASP A 1 185 ? 60.979  -6.756  -10.408 1.00 39.70  ?  252  ASP A O     1 
ATOM   1306 C  CB    . ASP A 1 185 ? 60.002  -5.940  -7.533  1.00 34.82  ?  252  ASP A CB    1 
ATOM   1307 C  CG    . ASP A 1 185 ? 61.113  -5.286  -6.739  1.00 44.34  ?  252  ASP A CG    1 
ATOM   1308 O  OD1   . ASP A 1 185 ? 61.478  -4.134  -7.059  1.00 40.88  ?  252  ASP A OD1   1 
ATOM   1309 O  OD2   . ASP A 1 185 ? 61.625  -5.928  -5.795  1.00 51.44  -1 252  ASP A OD2   1 
ATOM   1310 N  N     . GLU A 1 186 ? 61.915  -4.749  -9.957  1.00 31.97  ?  253  GLU A N     1 
ATOM   1311 C  CA    . GLU A 1 186 ? 63.165  -5.000  -10.680 1.00 34.32  ?  253  GLU A CA    1 
ATOM   1312 C  C     . GLU A 1 186 ? 62.906  -5.419  -12.127 1.00 30.53  ?  253  GLU A C     1 
ATOM   1313 O  O     . GLU A 1 186 ? 63.501  -6.372  -12.633 1.00 34.10  ?  253  GLU A O     1 
ATOM   1314 C  CB    . GLU A 1 186 ? 64.005  -6.059  -9.958  1.00 39.43  ?  253  GLU A CB    1 
ATOM   1315 C  CG    . GLU A 1 186 ? 64.350  -5.730  -8.511  1.00 45.24  ?  253  GLU A CG    1 
ATOM   1316 C  CD    . GLU A 1 186 ? 65.331  -4.578  -8.382  1.00 50.48  ?  253  GLU A CD    1 
ATOM   1317 O  OE1   . GLU A 1 186 ? 65.018  -3.463  -8.853  0.78 54.38  ?  253  GLU A OE1   1 
ATOM   1318 O  OE2   . GLU A 1 186 ? 66.422  -4.791  -7.813  0.79 54.90  -1 253  GLU A OE2   1 
ATOM   1319 N  N     . ILE A 1 187 ? 62.025  -4.682  -12.809 1.00 32.12  ?  254  ILE A N     1 
ATOM   1320 C  CA    . ILE A 1 187 ? 61.626  -5.082  -14.154 1.00 37.04  ?  254  ILE A CA    1 
ATOM   1321 C  C     . ILE A 1 187 ? 62.800  -5.063  -15.125 1.00 34.02  ?  254  ILE A C     1 
ATOM   1322 O  O     . ILE A 1 187 ? 62.761  -5.743  -16.156 1.00 40.89  ?  254  ILE A O     1 
ATOM   1323 C  CB    . ILE A 1 187 ? 60.477  -4.196  -14.680 1.00 36.25  ?  254  ILE A CB    1 
ATOM   1324 C  CG1   . ILE A 1 187 ? 60.896  -2.729  -14.767 1.00 32.27  ?  254  ILE A CG1   1 
ATOM   1325 C  CG2   . ILE A 1 187 ? 59.259  -4.336  -13.791 1.00 33.92  ?  254  ILE A CG2   1 
ATOM   1326 C  CD1   . ILE A 1 187 ? 59.984  -1.912  -15.649 1.00 32.46  ?  254  ILE A CD1   1 
ATOM   1327 N  N     . HIS A 1 188 ? 63.848  -4.294  -14.830 1.00 33.41  ?  255  HIS A N     1 
ATOM   1328 C  CA    . HIS A 1 188 ? 65.025  -4.281  -15.690 1.00 32.45  ?  255  HIS A CA    1 
ATOM   1329 C  C     . HIS A 1 188 ? 65.774  -5.607  -15.666 1.00 39.41  ?  255  HIS A C     1 
ATOM   1330 O  O     . HIS A 1 188 ? 66.619  -5.845  -16.535 1.00 33.92  ?  255  HIS A O     1 
ATOM   1331 C  CB    . HIS A 1 188 ? 65.970  -3.166  -15.257 1.00 30.32  ?  255  HIS A CB    1 
ATOM   1332 C  CG    . HIS A 1 188 ? 66.516  -3.352  -13.877 1.00 32.34  ?  255  HIS A CG    1 
ATOM   1333 N  ND1   . HIS A 1 188 ? 65.740  -3.217  -12.746 1.00 31.96  ?  255  HIS A ND1   1 
ATOM   1334 C  CD2   . HIS A 1 188 ? 67.759  -3.673  -13.446 1.00 27.87  ?  255  HIS A CD2   1 
ATOM   1335 C  CE1   . HIS A 1 188 ? 66.483  -3.441  -11.677 1.00 44.96  ?  255  HIS A CE1   1 
ATOM   1336 N  NE2   . HIS A 1 188 ? 67.712  -3.722  -12.074 1.00 35.28  ?  255  HIS A NE2   1 
ATOM   1337 N  N     . TYR A 1 189 ? 65.497  -6.461  -14.685 1.00 36.65  ?  256  TYR A N     1 
ATOM   1338 C  CA    . TYR A 1 189 ? 66.177  -7.738  -14.532 1.00 43.60  ?  256  TYR A CA    1 
ATOM   1339 C  C     . TYR A 1 189 ? 65.373  -8.905  -15.092 1.00 48.35  ?  256  TYR A C     1 
ATOM   1340 O  O     . TYR A 1 189 ? 65.844  -10.045 -15.039 1.00 45.85  ?  256  TYR A O     1 
ATOM   1341 C  CB    . TYR A 1 189 ? 66.487  -7.979  -13.048 1.00 44.57  ?  256  TYR A CB    1 
ATOM   1342 C  CG    . TYR A 1 189 ? 67.322  -9.208  -12.768 1.00 65.58  ?  256  TYR A CG    1 
ATOM   1343 C  CD1   . TYR A 1 189 ? 68.592  -9.348  -13.313 1.00 74.56  ?  256  TYR A CD1   1 
ATOM   1344 C  CD2   . TYR A 1 189 ? 66.844  -10.222 -11.946 1.00 66.36  ?  256  TYR A CD2   1 
ATOM   1345 C  CE1   . TYR A 1 189 ? 69.360  -10.468 -13.055 1.00 78.29  ?  256  TYR A CE1   1 
ATOM   1346 C  CE2   . TYR A 1 189 ? 67.606  -11.347 -11.682 1.00 68.32  ?  256  TYR A CE2   1 
ATOM   1347 C  CZ    . TYR A 1 189 ? 68.863  -11.464 -12.240 1.00 75.66  ?  256  TYR A CZ    1 
ATOM   1348 O  OH    . TYR A 1 189 ? 69.626  -12.580 -11.981 1.00 69.79  ?  256  TYR A OH    1 
ATOM   1349 N  N     . MET A 1 190 ? 64.181  -8.650  -15.639 1.00 39.66  ?  257  MET A N     1 
ATOM   1350 C  CA    . MET A 1 190 ? 63.344  -9.744  -16.123 1.00 50.55  ?  257  MET A CA    1 
ATOM   1351 C  C     . MET A 1 190 ? 64.031  -10.511 -17.243 1.00 51.27  ?  257  MET A C     1 
ATOM   1352 O  O     . MET A 1 190 ? 63.917  -11.740 -17.323 1.00 50.41  ?  257  MET A O     1 
ATOM   1353 C  CB    . MET A 1 190 ? 61.996  -9.208  -16.602 1.00 40.25  ?  257  MET A CB    1 
ATOM   1354 C  CG    . MET A 1 190 ? 61.217  -8.474  -15.536 1.00 40.87  ?  257  MET A CG    1 
ATOM   1355 S  SD    . MET A 1 190 ? 60.986  -9.431  -14.026 1.00 49.63  ?  257  MET A SD    1 
ATOM   1356 C  CE    . MET A 1 190 ? 59.921  -10.741 -14.600 1.00 42.66  ?  257  MET A CE    1 
ATOM   1357 N  N     . ARG A 1 191 ? 64.753  -9.805  -18.114 1.00 49.93  ?  258  ARG A N     1 
ATOM   1358 C  CA    . ARG A 1 191 ? 65.429  -10.467 -19.225 1.00 52.64  ?  258  ARG A CA    1 
ATOM   1359 C  C     . ARG A 1 191 ? 66.487  -11.442 -18.719 1.00 53.14  ?  258  ARG A C     1 
ATOM   1360 O  O     . ARG A 1 191 ? 66.483  -12.623 -19.084 1.00 55.00  ?  258  ARG A O     1 
ATOM   1361 C  CB    . ARG A 1 191 ? 66.047  -9.421  -20.152 1.00 57.66  ?  258  ARG A CB    1 
ATOM   1362 C  CG    . ARG A 1 191 ? 66.644  -9.998  -21.422 1.00 53.00  ?  258  ARG A CG    1 
ATOM   1363 C  CD    . ARG A 1 191 ? 66.800  -8.931  -22.494 1.00 68.56  ?  258  ARG A CD    1 
ATOM   1364 N  NE    . ARG A 1 191 ? 67.241  -9.495  -23.767 1.00 80.32  ?  258  ARG A NE    1 
ATOM   1365 C  CZ    . ARG A 1 191 ? 67.242  -8.833  -24.921 1.00 92.41  ?  258  ARG A CZ    1 
ATOM   1366 N  NH1   . ARG A 1 191 ? 66.818  -7.577  -24.972 1.00 84.03  ?  258  ARG A NH1   1 
ATOM   1367 N  NH2   . ARG A 1 191 ? 67.661  -9.431  -26.028 1.00 103.29 ?  258  ARG A NH2   1 
ATOM   1368 N  N     . ASP A 1 192 ? 67.396  -10.967 -17.863 1.00 64.91  ?  259  ASP A N     1 
ATOM   1369 C  CA    . ASP A 1 192 ? 68.461  -11.824 -17.352 1.00 69.18  ?  259  ASP A CA    1 
ATOM   1370 C  C     . ASP A 1 192 ? 67.937  -12.948 -16.465 1.00 58.78  ?  259  ASP A C     1 
ATOM   1371 O  O     . ASP A 1 192 ? 68.618  -13.967 -16.312 1.00 59.81  ?  259  ASP A O     1 
ATOM   1372 C  CB    . ASP A 1 192 ? 69.478  -10.991 -16.568 1.00 67.86  ?  259  ASP A CB    1 
ATOM   1373 C  CG    . ASP A 1 192 ? 70.234  -10.015 -17.448 1.00 79.20  ?  259  ASP A CG    1 
ATOM   1374 O  OD1   . ASP A 1 192 ? 70.382  -10.291 -18.657 1.00 66.01  ?  259  ASP A OD1   1 
ATOM   1375 O  OD2   . ASP A 1 192 ? 70.682  -8.970  -16.929 1.00 96.92  ?  259  ASP A OD2   1 
ATOM   1376 N  N     . SER A 1 193 ? 66.750  -12.790 -15.881 1.00 52.54  ?  260  SER A N     1 
ATOM   1377 C  CA    . SER A 1 193 ? 66.216  -13.787 -14.964 1.00 63.66  ?  260  SER A CA    1 
ATOM   1378 C  C     . SER A 1 193 ? 65.579  -14.977 -15.670 1.00 56.59  ?  260  SER A C     1 
ATOM   1379 O  O     . SER A 1 193 ? 65.191  -15.934 -14.992 1.00 52.48  ?  260  SER A O     1 
ATOM   1380 C  CB    . SER A 1 193 ? 65.182  -13.142 -14.039 1.00 64.29  ?  260  SER A CB    1 
ATOM   1381 O  OG    . SER A 1 193 ? 64.077  -12.658 -14.781 1.00 62.12  ?  260  SER A OG    1 
ATOM   1382 N  N     . GLU A 1 194 ? 65.461  -14.939 -16.998 1.00 52.61  ?  261  GLU A N     1 
ATOM   1383 C  CA    . GLU A 1 194 ? 64.818  -15.951 -17.841 1.00 71.75  ?  261  GLU A CA    1 
ATOM   1384 C  C     . GLU A 1 194 ? 63.303  -15.761 -17.900 1.00 54.65  ?  261  GLU A C     1 
ATOM   1385 O  O     . GLU A 1 194 ? 62.642  -16.483 -18.655 1.00 52.39  ?  261  GLU A O     1 
ATOM   1386 C  CB    . GLU A 1 194 ? 65.109  -17.394 -17.391 1.00 83.52  ?  261  GLU A CB    1 
ATOM   1387 C  CG    . GLU A 1 194 ? 66.591  -17.731 -17.256 1.00 75.44  ?  261  GLU A CG    1 
ATOM   1388 C  CD    . GLU A 1 194 ? 66.831  -19.177 -16.850 1.00 85.35  ?  261  GLU A CD    1 
ATOM   1389 O  OE1   . GLU A 1 194 ? 65.942  -20.024 -17.081 1.00 78.33  ?  261  GLU A OE1   1 
ATOM   1390 O  OE2   . GLU A 1 194 ? 67.911  -19.468 -16.294 1.00 78.68  ?  261  GLU A OE2   1 
ATOM   1391 N  N     . ARG A 1 195 ? 62.732  -14.821 -17.146 1.00 52.00  ?  262  ARG A N     1 
ATOM   1392 C  CA    . ARG A 1 195 ? 61.293  -14.591 -17.134 1.00 43.72  ?  262  ARG A CA    1 
ATOM   1393 C  C     . ARG A 1 195 ? 60.860  -13.504 -18.112 1.00 34.13  ?  262  ARG A C     1 
ATOM   1394 O  O     . ARG A 1 195 ? 59.779  -12.928 -17.943 1.00 33.57  ?  262  ARG A O     1 
ATOM   1395 C  CB    . ARG A 1 195 ? 60.831  -14.229 -15.719 1.00 50.67  ?  262  ARG A CB    1 
ATOM   1396 C  CG    . ARG A 1 195 ? 60.697  -15.414 -14.770 1.00 55.11  ?  262  ARG A CG    1 
ATOM   1397 C  CD    . ARG A 1 195 ? 62.046  -15.975 -14.348 1.00 61.20  ?  262  ARG A CD    1 
ATOM   1398 N  NE    . ARG A 1 195 ? 61.910  -16.865 -13.199 1.00 60.46  ?  262  ARG A NE    1 
ATOM   1399 C  CZ    . ARG A 1 195 ? 62.927  -17.430 -12.554 1.00 68.23  ?  262  ARG A CZ    1 
ATOM   1400 N  NH1   . ARG A 1 195 ? 64.177  -17.203 -12.938 1.00 56.46  ?  262  ARG A NH1   1 
ATOM   1401 N  NH2   . ARG A 1 195 ? 62.690  -18.223 -11.518 1.00 63.07  ?  262  ARG A NH2   1 
ATOM   1402 N  N     . GLY A 1 196 ? 61.670  -13.219 -19.133 1.00 37.18  ?  263  GLY A N     1 
ATOM   1403 C  CA    . GLY A 1 196 ? 61.358  -12.118 -20.031 1.00 35.14  ?  263  GLY A CA    1 
ATOM   1404 C  C     . GLY A 1 196 ? 60.030  -12.289 -20.743 1.00 30.30  ?  263  GLY A C     1 
ATOM   1405 O  O     . GLY A 1 196 ? 59.250  -11.340 -20.861 1.00 31.35  ?  263  GLY A O     1 
ATOM   1406 N  N     . VAL A 1 197 ? 59.753  -13.498 -21.232 1.00 43.54  ?  264  VAL A N     1 
ATOM   1407 C  CA    . VAL A 1 197 ? 58.496  -13.748 -21.929 1.00 30.30  ?  264  VAL A CA    1 
ATOM   1408 C  C     . VAL A 1 197 ? 57.342  -13.777 -20.935 1.00 33.29  ?  264  VAL A C     1 
ATOM   1409 O  O     . VAL A 1 197 ? 56.336  -13.077 -21.101 1.00 30.07  ?  264  VAL A O     1 
ATOM   1410 C  CB    . VAL A 1 197 ? 58.582  -15.061 -22.728 1.00 34.15  ?  264  VAL A CB    1 
ATOM   1411 C  CG1   . VAL A 1 197 ? 57.345  -15.241 -23.600 1.00 37.47  ?  264  VAL A CG1   1 
ATOM   1412 C  CG2   . VAL A 1 197 ? 59.846  -15.085 -23.575 1.00 44.36  ?  264  VAL A CG2   1 
ATOM   1413 N  N     . VAL A 1 198 ? 57.478  -14.588 -19.885 1.00 32.66  ?  265  VAL A N     1 
ATOM   1414 C  CA    . VAL A 1 198 ? 56.441  -14.701 -18.863 1.00 38.77  ?  265  VAL A CA    1 
ATOM   1415 C  C     . VAL A 1 198 ? 55.997  -13.320 -18.398 1.00 30.47  ?  265  VAL A C     1 
ATOM   1416 O  O     . VAL A 1 198 ? 54.802  -13.056 -18.215 1.00 27.18  ?  265  VAL A O     1 
ATOM   1417 C  CB    . VAL A 1 198 ? 56.964  -15.557 -17.692 1.00 39.73  ?  265  VAL A CB    1 
ATOM   1418 C  CG1   . VAL A 1 198 ? 55.985  -15.570 -16.542 1.00 42.34  ?  265  VAL A CG1   1 
ATOM   1419 C  CG2   . VAL A 1 198 ? 57.237  -16.978 -18.162 1.00 49.52  ?  265  VAL A CG2   1 
ATOM   1420 N  N     . TRP A 1 199 ? 56.959  -12.417 -18.218 1.00 31.92  ?  266  TRP A N     1 
ATOM   1421 C  CA    . TRP A 1 199 ? 56.677  -11.084 -17.697 1.00 31.58  ?  266  TRP A CA    1 
ATOM   1422 C  C     . TRP A 1 199 ? 55.726  -10.319 -18.608 1.00 26.48  ?  266  TRP A C     1 
ATOM   1423 O  O     . TRP A 1 199 ? 54.715  -9.771  -18.151 1.00 27.42  ?  266  TRP A O     1 
ATOM   1424 C  CB    . TRP A 1 199 ? 58.002  -10.341 -17.523 1.00 35.18  ?  266  TRP A CB    1 
ATOM   1425 C  CG    . TRP A 1 199 ? 57.886  -8.921  -17.135 1.00 40.16  ?  266  TRP A CG    1 
ATOM   1426 C  CD1   . TRP A 1 199 ? 57.229  -8.413  -16.053 1.00 42.49  ?  266  TRP A CD1   1 
ATOM   1427 C  CD2   . TRP A 1 199 ? 58.467  -7.807  -17.815 1.00 46.51  ?  266  TRP A CD2   1 
ATOM   1428 N  NE1   . TRP A 1 199 ? 57.357  -7.045  -16.025 1.00 45.85  ?  266  TRP A NE1   1 
ATOM   1429 C  CE2   . TRP A 1 199 ? 58.115  -6.649  -17.096 1.00 45.17  ?  266  TRP A CE2   1 
ATOM   1430 C  CE3   . TRP A 1 199 ? 59.250  -7.677  -18.967 1.00 45.55  ?  266  TRP A CE3   1 
ATOM   1431 C  CZ2   . TRP A 1 199 ? 58.515  -5.377  -17.491 1.00 43.04  ?  266  TRP A CZ2   1 
ATOM   1432 C  CZ3   . TRP A 1 199 ? 59.646  -6.416  -19.358 1.00 44.13  ?  266  TRP A CZ3   1 
ATOM   1433 C  CH2   . TRP A 1 199 ? 59.280  -5.281  -18.622 1.00 51.00  ?  266  TRP A CH2   1 
ATOM   1434 N  N     . GLU A 1 200 ? 56.032  -10.264 -19.905 1.00 25.70  ?  267  GLU A N     1 
ATOM   1435 C  CA    . GLU A 1 200 ? 55.155  -9.557  -20.830 1.00 30.77  ?  267  GLU A CA    1 
ATOM   1436 C  C     . GLU A 1 200 ? 53.802  -10.246 -20.958 1.00 31.72  ?  267  GLU A C     1 
ATOM   1437 O  O     . GLU A 1 200 ? 52.782  -9.573  -21.144 1.00 28.98  ?  267  GLU A O     1 
ATOM   1438 C  CB    . GLU A 1 200 ? 55.820  -9.437  -22.199 1.00 27.81  ?  267  GLU A CB    1 
ATOM   1439 C  CG    . GLU A 1 200 ? 57.088  -8.612  -22.183 1.00 26.05  ?  267  GLU A CG    1 
ATOM   1440 C  CD    . GLU A 1 200 ? 57.552  -8.227  -23.574 1.00 37.66  ?  267  GLU A CD    1 
ATOM   1441 O  OE1   . GLU A 1 200 ? 58.770  -8.009  -23.755 1.00 31.22  ?  267  GLU A OE1   1 
ATOM   1442 O  OE2   . GLU A 1 200 ? 56.699  -8.142  -24.483 1.00 30.54  -1 267  GLU A OE2   1 
ATOM   1443 N  N     . GLU A 1 201 ? 53.770  -11.578 -20.861 1.00 27.16  ?  268  GLU A N     1 
ATOM   1444 C  CA    . GLU A 1 201 ? 52.497  -12.287 -20.905 1.00 29.41  ?  268  GLU A CA    1 
ATOM   1445 C  C     . GLU A 1 201 ? 51.581  -11.850 -19.770 1.00 24.40  ?  268  GLU A C     1 
ATOM   1446 O  O     . GLU A 1 201 ? 50.380  -11.643 -19.983 1.00 25.43  ?  268  GLU A O     1 
ATOM   1447 C  CB    . GLU A 1 201 ? 52.725  -13.797 -20.844 1.00 33.12  ?  268  GLU A CB    1 
ATOM   1448 C  CG    . GLU A 1 201 ? 53.258  -14.405 -22.122 1.00 31.15  ?  268  GLU A CG    1 
ATOM   1449 C  CD    . GLU A 1 201 ? 53.398  -15.910 -22.023 1.00 37.64  ?  268  GLU A CD    1 
ATOM   1450 O  OE1   . GLU A 1 201 ? 54.300  -16.373 -21.294 1.00 30.53  ?  268  GLU A OE1   1 
ATOM   1451 O  OE2   . GLU A 1 201 ? 52.594  -16.629 -22.659 1.00 31.63  -1 268  GLU A OE2   1 
ATOM   1452 N  N     . THR A 1 202 ? 52.119  -11.713 -18.552 1.00 23.19  ?  269  THR A N     1 
ATOM   1453 C  CA    . THR A 1 202 ? 51.272  -11.308 -17.431 1.00 28.12  ?  269  THR A CA    1 
ATOM   1454 C  C     . THR A 1 202 ? 50.748  -9.891  -17.623 1.00 28.23  ?  269  THR A C     1 
ATOM   1455 O  O     . THR A 1 202 ? 49.575  -9.613  -17.345 1.00 29.36  ?  269  THR A O     1 
ATOM   1456 C  CB    . THR A 1 202 ? 52.026  -11.413 -16.101 1.00 30.33  ?  269  THR A CB    1 
ATOM   1457 O  OG1   . THR A 1 202 ? 53.110  -10.477 -16.075 1.00 30.55  ?  269  THR A OG1   1 
ATOM   1458 C  CG2   . THR A 1 202 ? 52.556  -12.833 -15.880 1.00 29.01  ?  269  THR A CG2   1 
ATOM   1459 N  N     . ILE A 1 203 ? 51.598  -8.978  -18.098 1.00 28.50  ?  270  ILE A N     1 
ATOM   1460 C  CA    . ILE A 1 203 ? 51.140  -7.613  -18.342 1.00 27.63  ?  270  ILE A CA    1 
ATOM   1461 C  C     . ILE A 1 203 ? 50.051  -7.604  -19.407 1.00 30.10  ?  270  ILE A C     1 
ATOM   1462 O  O     . ILE A 1 203 ? 49.063  -6.868  -19.300 1.00 26.88  ?  270  ILE A O     1 
ATOM   1463 C  CB    . ILE A 1 203 ? 52.325  -6.712  -18.736 1.00 29.26  ?  270  ILE A CB    1 
ATOM   1464 C  CG1   . ILE A 1 203 ? 53.298  -6.584  -17.562 1.00 30.82  ?  270  ILE A CG1   1 
ATOM   1465 C  CG2   . ILE A 1 203 ? 51.827  -5.332  -19.161 1.00 35.00  ?  270  ILE A CG2   1 
ATOM   1466 C  CD1   . ILE A 1 203 ? 54.623  -5.983  -17.929 1.00 30.93  ?  270  ILE A CD1   1 
ATOM   1467 N  N     . ILE A 1 204 ? 50.206  -8.426  -20.445 1.00 31.03  ?  271  ILE A N     1 
ATOM   1468 C  CA    . ILE A 1 204 ? 49.257  -8.402  -21.552 1.00 31.17  ?  271  ILE A CA    1 
ATOM   1469 C  C     . ILE A 1 204 ? 47.920  -9.015  -21.148 1.00 32.14  ?  271  ILE A C     1 
ATOM   1470 O  O     . ILE A 1 204 ? 46.868  -8.609  -21.656 1.00 32.98  ?  271  ILE A O     1 
ATOM   1471 C  CB    . ILE A 1 204 ? 49.866  -9.117  -22.774 1.00 29.61  ?  271  ILE A CB    1 
ATOM   1472 C  CG1   . ILE A 1 204 ? 51.013  -8.283  -23.347 1.00 32.29  ?  271  ILE A CG1   1 
ATOM   1473 C  CG2   . ILE A 1 204 ? 48.801  -9.374  -23.840 1.00 32.32  ?  271  ILE A CG2   1 
ATOM   1474 C  CD1   . ILE A 1 204 ? 51.881  -9.022  -24.340 1.00 30.82  ?  271  ILE A CD1   1 
ATOM   1475 N  N     . LEU A 1 205 ? 47.928  -9.987  -20.232 1.00 33.59  ?  272  LEU A N     1 
ATOM   1476 C  CA    . LEU A 1 205 ? 46.720  -10.723 -19.876 1.00 36.66  ?  272  LEU A CA    1 
ATOM   1477 C  C     . LEU A 1 205 ? 45.956  -10.114 -18.706 1.00 33.31  ?  272  LEU A C     1 
ATOM   1478 O  O     . LEU A 1 205 ? 44.793  -10.475 -18.496 1.00 35.73  ?  272  LEU A O     1 
ATOM   1479 C  CB    . LEU A 1 205 ? 47.068  -12.181 -19.541 1.00 34.48  ?  272  LEU A CB    1 
ATOM   1480 C  CG    . LEU A 1 205 ? 47.586  -13.060 -20.683 1.00 33.51  ?  272  LEU A CG    1 
ATOM   1481 C  CD1   . LEU A 1 205 ? 47.841  -14.474 -20.183 1.00 40.39  ?  272  LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A 1 205 ? 46.626  -13.085 -21.861 1.00 33.41  ?  272  LEU A CD2   1 
ATOM   1483 N  N     . LEU A 1 206 ? 46.566  -9.213  -17.940 1.00 33.51  ?  273  LEU A N     1 
ATOM   1484 C  CA    . LEU A 1 206 ? 45.852  -8.578  -16.845 1.00 37.05  ?  273  LEU A CA    1 
ATOM   1485 C  C     . LEU A 1 206 ? 44.734  -7.687  -17.392 1.00 36.91  ?  273  LEU A C     1 
ATOM   1486 O  O     . LEU A 1 206 ? 44.871  -7.094  -18.465 1.00 38.31  ?  273  LEU A O     1 
ATOM   1487 C  CB    . LEU A 1 206 ? 46.808  -7.752  -15.990 1.00 28.19  ?  273  LEU A CB    1 
ATOM   1488 C  CG    . LEU A 1 206 ? 47.687  -8.566  -15.039 1.00 35.54  ?  273  LEU A CG    1 
ATOM   1489 C  CD1   . LEU A 1 206 ? 48.909  -7.771  -14.612 1.00 31.34  ?  273  LEU A CD1   1 
ATOM   1490 C  CD2   . LEU A 1 206 ? 46.888  -9.000  -13.821 1.00 35.41  ?  273  LEU A CD2   1 
ATOM   1491 N  N     . PRO A 1 207 ? 43.611  -7.587  -16.682 1.00 40.52  ?  274  PRO A N     1 
ATOM   1492 C  CA    . PRO A 1 207 ? 42.514  -6.741  -17.163 1.00 42.53  ?  274  PRO A CA    1 
ATOM   1493 C  C     . PRO A 1 207 ? 42.833  -5.258  -17.020 1.00 35.42  ?  274  PRO A C     1 
ATOM   1494 O  O     . PRO A 1 207 ? 43.659  -4.839  -16.207 1.00 32.95  ?  274  PRO A O     1 
ATOM   1495 C  CB    . PRO A 1 207 ? 41.331  -7.147  -16.278 1.00 43.47  ?  274  PRO A CB    1 
ATOM   1496 C  CG    . PRO A 1 207 ? 41.945  -7.696  -15.047 1.00 41.82  ?  274  PRO A CG    1 
ATOM   1497 C  CD    . PRO A 1 207 ? 43.251  -8.313  -15.450 1.00 41.73  ?  274  PRO A CD    1 
ATOM   1498 N  N     . ASP A 1 208 ? 42.139  -4.456  -17.833 1.00 40.53  ?  275  ASP A N     1 
ATOM   1499 C  CA    . ASP A 1 208 ? 42.425  -3.028  -17.916 1.00 41.71  ?  275  ASP A CA    1 
ATOM   1500 C  C     . ASP A 1 208 ? 42.051  -2.266  -16.651 1.00 36.86  ?  275  ASP A C     1 
ATOM   1501 O  O     . ASP A 1 208 ? 42.510  -1.134  -16.475 1.00 40.41  ?  275  ASP A O     1 
ATOM   1502 C  CB    . ASP A 1 208 ? 41.689  -2.412  -19.106 1.00 33.54  ?  275  ASP A CB    1 
ATOM   1503 C  CG    . ASP A 1 208 ? 42.262  -2.850  -20.436 1.00 43.98  ?  275  ASP A CG    1 
ATOM   1504 O  OD1   . ASP A 1 208 ? 43.442  -3.260  -20.474 1.00 45.53  ?  275  ASP A OD1   1 
ATOM   1505 O  OD2   . ASP A 1 208 ? 41.532  -2.777  -21.446 1.00 46.83  -1 275  ASP A OD2   1 
ATOM   1506 N  N     . ASN A 1 209 ? 41.226  -2.841  -15.775 1.00 29.71  ?  276  ASN A N     1 
ATOM   1507 C  CA    . ASN A 1 209 ? 40.880  -2.154  -14.536 1.00 36.31  ?  276  ASN A CA    1 
ATOM   1508 C  C     . ASN A 1 209 ? 41.987  -2.229  -13.493 1.00 39.61  ?  276  ASN A C     1 
ATOM   1509 O  O     . ASN A 1 209 ? 41.932  -1.491  -12.502 1.00 40.97  ?  276  ASN A O     1 
ATOM   1510 C  CB    . ASN A 1 209 ? 39.584  -2.725  -13.952 1.00 40.11  ?  276  ASN A CB    1 
ATOM   1511 C  CG    . ASN A 1 209 ? 39.705  -4.184  -13.581 1.00 43.31  ?  276  ASN A CG    1 
ATOM   1512 O  OD1   . ASN A 1 209 ? 39.553  -5.062  -14.428 1.00 48.18  ?  276  ASN A OD1   1 
ATOM   1513 N  ND2   . ASN A 1 209 ? 39.975  -4.454  -12.308 1.00 42.25  ?  276  ASN A ND2   1 
ATOM   1514 N  N     . VAL A 1 210 ? 42.985  -3.087  -13.693 1.00 36.84  ?  277  VAL A N     1 
ATOM   1515 C  CA    . VAL A 1 210 ? 44.113  -3.190  -12.776 1.00 34.27  ?  277  VAL A CA    1 
ATOM   1516 C  C     . VAL A 1 210 ? 45.105  -2.072  -13.070 1.00 34.92  ?  277  VAL A C     1 
ATOM   1517 O  O     . VAL A 1 210 ? 45.289  -1.654  -14.219 1.00 31.50  ?  277  VAL A O     1 
ATOM   1518 C  CB    . VAL A 1 210 ? 44.775  -4.579  -12.890 1.00 40.12  ?  277  VAL A CB    1 
ATOM   1519 C  CG1   . VAL A 1 210 ? 46.054  -4.642  -12.070 1.00 37.37  ?  277  VAL A CG1   1 
ATOM   1520 C  CG2   . VAL A 1 210 ? 43.808  -5.664  -12.440 1.00 44.01  ?  277  VAL A CG2   1 
ATOM   1521 N  N     . HIS A 1 211 ? 45.752  -1.581  -12.018 1.00 31.73  ?  278  HIS A N     1 
ATOM   1522 C  CA    . HIS A 1 211 ? 46.765  -0.545  -12.138 1.00 36.59  ?  278  HIS A CA    1 
ATOM   1523 C  C     . HIS A 1 211 ? 48.092  -1.070  -11.611 1.00 36.53  ?  278  HIS A C     1 
ATOM   1524 O  O     . HIS A 1 211 ? 48.139  -2.024  -10.829 1.00 30.75  ?  278  HIS A O     1 
ATOM   1525 C  CB    . HIS A 1 211 ? 46.334  0.725   -11.400 1.00 39.81  ?  278  HIS A CB    1 
ATOM   1526 C  CG    . HIS A 1 211 ? 45.094  1.338   -11.967 1.00 39.41  ?  278  HIS A CG    1 
ATOM   1527 N  ND1   . HIS A 1 211 ? 43.867  1.254   -11.344 1.00 37.91  ?  278  HIS A ND1   1 
ATOM   1528 C  CD2   . HIS A 1 211 ? 44.883  2.000   -13.129 1.00 35.89  ?  278  HIS A CD2   1 
ATOM   1529 C  CE1   . HIS A 1 211 ? 42.958  1.860   -12.087 1.00 38.10  ?  278  HIS A CE1   1 
ATOM   1530 N  NE2   . HIS A 1 211 ? 43.548  2.321   -13.175 1.00 43.85  ?  278  HIS A NE2   1 
ATOM   1531 N  N     . TYR A 1 212 ? 49.175  -0.431  -12.054 1.00 32.42  ?  279  TYR A N     1 
ATOM   1532 C  CA    . TYR A 1 212 ? 50.511  -0.985  -11.916 1.00 31.57  ?  279  TYR A CA    1 
ATOM   1533 C  C     . TYR A 1 212 ? 51.451  -0.011  -11.224 1.00 33.30  ?  279  TYR A C     1 
ATOM   1534 O  O     . TYR A 1 212 ? 51.362  1.207   -11.399 1.00 29.85  ?  279  TYR A O     1 
ATOM   1535 C  CB    . TYR A 1 212 ? 51.112  -1.334  -13.284 1.00 35.55  ?  279  TYR A CB    1 
ATOM   1536 C  CG    . TYR A 1 212 ? 50.219  -2.182  -14.148 1.00 30.93  ?  279  TYR A CG    1 
ATOM   1537 C  CD1   . TYR A 1 212 ? 50.272  -3.568  -14.079 1.00 35.21  ?  279  TYR A CD1   1 
ATOM   1538 C  CD2   . TYR A 1 212 ? 49.324  -1.601  -15.037 1.00 30.01  ?  279  TYR A CD2   1 
ATOM   1539 C  CE1   . TYR A 1 212 ? 49.457  -4.353  -14.869 1.00 41.13  ?  279  TYR A CE1   1 
ATOM   1540 C  CE2   . TYR A 1 212 ? 48.502  -2.379  -15.833 1.00 40.33  ?  279  TYR A CE2   1 
ATOM   1541 C  CZ    . TYR A 1 212 ? 48.574  -3.755  -15.743 1.00 41.35  ?  279  TYR A CZ    1 
ATOM   1542 O  OH    . TYR A 1 212 ? 47.765  -4.541  -16.528 1.00 44.65  ?  279  TYR A OH    1 
ATOM   1543 N  N     . VAL A 1 213 ? 52.366  -0.578  -10.446 1.00 32.99  ?  280  VAL A N     1 
ATOM   1544 C  CA    . VAL A 1 213 ? 53.590  0.094   -10.034 1.00 31.65  ?  280  VAL A CA    1 
ATOM   1545 C  C     . VAL A 1 213 ? 54.736  -0.736  -10.594 1.00 31.26  ?  280  VAL A C     1 
ATOM   1546 O  O     . VAL A 1 213 ? 54.954  -1.875  -10.161 1.00 30.33  ?  280  VAL A O     1 
ATOM   1547 C  CB    . VAL A 1 213 ? 53.701  0.234   -8.511  1.00 27.02  ?  280  VAL A CB    1 
ATOM   1548 C  CG1   . VAL A 1 213 ? 55.034  0.867   -8.130  1.00 30.17  ?  280  VAL A CG1   1 
ATOM   1549 C  CG2   . VAL A 1 213 ? 52.548  1.056   -7.968  1.00 34.70  ?  280  VAL A CG2   1 
ATOM   1550 N  N     . PHE A 1 214 ? 55.445  -0.188  -11.574 1.00 30.36  ?  281  PHE A N     1 
ATOM   1551 C  CA    . PHE A 1 214 ? 56.665  -0.794  -12.088 1.00 25.68  ?  281  PHE A CA    1 
ATOM   1552 C  C     . PHE A 1 214 ? 57.856  -0.139  -11.403 1.00 24.76  ?  281  PHE A C     1 
ATOM   1553 O  O     . PHE A 1 214 ? 57.977  1.090   -11.407 1.00 28.16  ?  281  PHE A O     1 
ATOM   1554 C  CB    . PHE A 1 214 ? 56.781  -0.623  -13.603 1.00 27.46  ?  281  PHE A CB    1 
ATOM   1555 C  CG    . PHE A 1 214 ? 55.579  -1.097  -14.369 1.00 27.18  ?  281  PHE A CG    1 
ATOM   1556 C  CD1   . PHE A 1 214 ? 55.428  -2.434  -14.692 1.00 32.81  ?  281  PHE A CD1   1 
ATOM   1557 C  CD2   . PHE A 1 214 ? 54.612  -0.201  -14.787 1.00 24.85  ?  281  PHE A CD2   1 
ATOM   1558 C  CE1   . PHE A 1 214 ? 54.328  -2.867  -15.405 1.00 28.06  ?  281  PHE A CE1   1 
ATOM   1559 C  CE2   . PHE A 1 214 ? 53.512  -0.629  -15.500 1.00 28.74  ?  281  PHE A CE2   1 
ATOM   1560 C  CZ    . PHE A 1 214 ? 53.371  -1.966  -15.806 1.00 28.84  ?  281  PHE A CZ    1 
ATOM   1561 N  N     . LEU A 1 215 ? 58.724  -0.956  -10.815 1.00 23.10  ?  282  LEU A N     1 
ATOM   1562 C  CA    . LEU A 1 215 ? 59.943  -0.487  -10.169 1.00 23.41  ?  282  LEU A CA    1 
ATOM   1563 C  C     . LEU A 1 215 ? 61.133  -0.951  -10.993 1.00 27.51  ?  282  LEU A C     1 
ATOM   1564 O  O     . LEU A 1 215 ? 61.295  -2.154  -11.234 1.00 27.30  ?  282  LEU A O     1 
ATOM   1565 C  CB    . LEU A 1 215 ? 60.048  -1.011  -8.738  1.00 26.83  ?  282  LEU A CB    1 
ATOM   1566 C  CG    . LEU A 1 215 ? 58.859  -0.695  -7.831  1.00 33.67  ?  282  LEU A CG    1 
ATOM   1567 C  CD1   . LEU A 1 215 ? 59.117  -1.234  -6.434  1.00 31.70  ?  282  LEU A CD1   1 
ATOM   1568 C  CD2   . LEU A 1 215 ? 58.564  0.803   -7.789  1.00 30.19  ?  282  LEU A CD2   1 
ATOM   1569 N  N     . SER A 1 216 ? 61.964  -0.003  -11.415 1.00 22.84  ?  283  SER A N     1 
ATOM   1570 C  CA    . SER A 1 216 ? 63.084  -0.301  -12.292 1.00 27.62  ?  283  SER A CA    1 
ATOM   1571 C  C     . SER A 1 216 ? 64.314  0.472   -11.850 1.00 29.27  ?  283  SER A C     1 
ATOM   1572 O  O     . SER A 1 216 ? 64.213  1.545   -11.251 1.00 31.91  ?  283  SER A O     1 
ATOM   1573 C  CB    . SER A 1 216 ? 62.765  0.058   -13.749 1.00 25.20  ?  283  SER A CB    1 
ATOM   1574 O  OG    . SER A 1 216 ? 63.849  -0.277  -14.601 1.00 26.49  ?  283  SER A OG    1 
ATOM   1575 N  N     . ALA A 1 217 ? 65.479  -0.089  -12.157 1.00 33.40  ?  284  ALA A N     1 
ATOM   1576 C  CA    . ALA A 1 217 ? 66.696  0.698   -12.144 1.00 28.06  ?  284  ALA A CA    1 
ATOM   1577 C  C     . ALA A 1 217 ? 66.573  1.811   -13.179 1.00 31.32  ?  284  ALA A C     1 
ATOM   1578 O  O     . ALA A 1 217 ? 65.635  1.852   -13.978 1.00 29.72  ?  284  ALA A O     1 
ATOM   1579 C  CB    . ALA A 1 217 ? 67.909  -0.181  -12.437 1.00 33.14  ?  284  ALA A CB    1 
ATOM   1580 N  N     . THR A 1 218 ? 67.529  2.734   -13.155 1.00 29.76  ?  285  THR A N     1 
ATOM   1581 C  CA    . THR A 1 218 ? 67.530  3.800   -14.146 1.00 35.18  ?  285  THR A CA    1 
ATOM   1582 C  C     . THR A 1 218 ? 67.700  3.198   -15.535 1.00 29.06  ?  285  THR A C     1 
ATOM   1583 O  O     . THR A 1 218 ? 68.621  2.415   -15.778 1.00 34.69  ?  285  THR A O     1 
ATOM   1584 C  CB    . THR A 1 218 ? 68.642  4.811   -13.853 1.00 36.46  ?  285  THR A CB    1 
ATOM   1585 O  OG1   . THR A 1 218 ? 69.913  4.151   -13.829 1.00 35.43  ?  285  THR A OG1   1 
ATOM   1586 C  CG2   . THR A 1 218 ? 68.402  5.489   -12.511 1.00 31.76  ?  285  THR A CG2   1 
ATOM   1587 N  N     . ILE A 1 219 ? 66.786  3.538   -16.438 1.00 28.20  ?  286  ILE A N     1 
ATOM   1588 C  CA    . ILE A 1 219 ? 66.842  3.035   -17.808 1.00 31.50  ?  286  ILE A CA    1 
ATOM   1589 C  C     . ILE A 1 219 ? 66.619  4.202   -18.762 1.00 25.89  ?  286  ILE A C     1 
ATOM   1590 O  O     . ILE A 1 219 ? 65.814  5.097   -18.468 1.00 32.83  ?  286  ILE A O     1 
ATOM   1591 C  CB    . ILE A 1 219 ? 65.810  1.918   -18.049 1.00 27.43  ?  286  ILE A CB    1 
ATOM   1592 C  CG1   . ILE A 1 219 ? 64.418  2.353   -17.587 1.00 26.22  ?  286  ILE A CG1   1 
ATOM   1593 C  CG2   . ILE A 1 219 ? 66.240  0.635   -17.343 1.00 28.34  ?  286  ILE A CG2   1 
ATOM   1594 C  CD1   . ILE A 1 219 ? 63.299  1.409   -18.020 1.00 31.71  ?  286  ILE A CD1   1 
ATOM   1595 N  N     . PRO A 1 220 ? 67.301  4.235   -19.910 1.00 34.39  ?  287  PRO A N     1 
ATOM   1596 C  CA    . PRO A 1 220 ? 67.132  5.369   -20.832 1.00 32.18  ?  287  PRO A CA    1 
ATOM   1597 C  C     . PRO A 1 220 ? 65.797  5.394   -21.552 1.00 33.21  ?  287  PRO A C     1 
ATOM   1598 O  O     . PRO A 1 220 ? 65.431  6.449   -22.084 1.00 33.35  ?  287  PRO A O     1 
ATOM   1599 C  CB    . PRO A 1 220 ? 68.285  5.186   -21.827 1.00 33.38  ?  287  PRO A CB    1 
ATOM   1600 C  CG    . PRO A 1 220 ? 68.577  3.721   -21.789 1.00 32.68  ?  287  PRO A CG    1 
ATOM   1601 C  CD    . PRO A 1 220 ? 68.348  3.305   -20.367 1.00 31.72  ?  287  PRO A CD    1 
ATOM   1602 N  N     . ASN A 1 221 ? 65.060  4.285   -21.600 1.00 29.65  ?  288  ASN A N     1 
ATOM   1603 C  CA    . ASN A 1 221 ? 63.833  4.211   -22.383 1.00 28.92  ?  288  ASN A CA    1 
ATOM   1604 C  C     . ASN A 1 221 ? 62.614  3.996   -21.494 1.00 33.09  ?  288  ASN A C     1 
ATOM   1605 O  O     . ASN A 1 221 ? 61.683  3.271   -21.851 1.00 27.79  ?  288  ASN A O     1 
ATOM   1606 C  CB    . ASN A 1 221 ? 63.928  3.116   -23.445 1.00 29.79  ?  288  ASN A CB    1 
ATOM   1607 C  CG    . ASN A 1 221 ? 64.087  1.725   -22.854 1.00 32.09  ?  288  ASN A CG    1 
ATOM   1608 O  OD1   . ASN A 1 221 ? 64.731  1.535   -21.823 1.00 33.40  ?  288  ASN A OD1   1 
ATOM   1609 N  ND2   . ASN A 1 221 ? 63.504  0.740   -23.521 1.00 30.57  ?  288  ASN A ND2   1 
ATOM   1610 N  N     . ALA A 1 222 ? 62.596  4.654   -20.329 1.00 27.27  ?  289  ALA A N     1 
ATOM   1611 C  CA    . ALA A 1 222 ? 61.451  4.543   -19.431 1.00 30.84  ?  289  ALA A CA    1 
ATOM   1612 C  C     . ALA A 1 222 ? 60.179  5.058   -20.094 1.00 27.26  ?  289  ALA A C     1 
ATOM   1613 O  O     . ALA A 1 222 ? 59.107  4.458   -19.950 1.00 28.69  ?  289  ALA A O     1 
ATOM   1614 C  CB    . ALA A 1 222 ? 61.727  5.303   -18.133 1.00 28.44  ?  289  ALA A CB    1 
ATOM   1615 N  N     . ARG A 1 223 ? 60.275  6.172   -20.821 1.00 30.93  ?  290  ARG A N     1 
ATOM   1616 C  CA    . ARG A 1 223 ? 59.111  6.710   -21.518 1.00 31.09  ?  290  ARG A CA    1 
ATOM   1617 C  C     . ARG A 1 223 ? 58.521  5.685   -22.476 1.00 25.91  ?  290  ARG A C     1 
ATOM   1618 O  O     . ARG A 1 223 ? 57.296  5.526   -22.554 1.00 27.19  ?  290  ARG A O     1 
ATOM   1619 C  CB    . ARG A 1 223 ? 59.503  7.976   -22.276 1.00 28.62  ?  290  ARG A CB    1 
ATOM   1620 C  CG    . ARG A 1 223 ? 58.362  8.642   -23.040 1.00 32.67  ?  290  ARG A CG    1 
ATOM   1621 C  CD    . ARG A 1 223 ? 58.891  9.741   -23.948 1.00 40.79  ?  290  ARG A CD    1 
ATOM   1622 N  NE    . ARG A 1 223 ? 59.680  10.721  -23.208 1.00 56.64  ?  290  ARG A NE    1 
ATOM   1623 C  CZ    . ARG A 1 223 ? 60.486  11.616  -23.771 1.00 72.77  ?  290  ARG A CZ    1 
ATOM   1624 N  NH1   . ARG A 1 223 ? 60.620  11.661  -25.090 1.00 79.33  ?  290  ARG A NH1   1 
ATOM   1625 N  NH2   . ARG A 1 223 ? 61.163  12.465  -23.010 1.00 69.79  ?  290  ARG A NH2   1 
ATOM   1626 N  N     . GLN A 1 224 ? 59.380  4.992   -23.226 1.00 29.60  ?  291  GLN A N     1 
ATOM   1627 C  CA    . GLN A 1 224 ? 58.917  3.992   -24.182 1.00 24.55  ?  291  GLN A CA    1 
ATOM   1628 C  C     . GLN A 1 224 ? 58.088  2.917   -23.491 1.00 24.80  ?  291  GLN A C     1 
ATOM   1629 O  O     . GLN A 1 224 ? 57.055  2.483   -24.013 1.00 25.29  ?  291  GLN A O     1 
ATOM   1630 C  CB    . GLN A 1 224 ? 60.123  3.372   -24.892 1.00 33.73  ?  291  GLN A CB    1 
ATOM   1631 C  CG    . GLN A 1 224 ? 59.819  2.725   -26.228 1.00 37.81  ?  291  GLN A CG    1 
ATOM   1632 C  CD    . GLN A 1 224 ? 61.043  2.061   -26.852 1.00 38.30  ?  291  GLN A CD    1 
ATOM   1633 O  OE1   . GLN A 1 224 ? 61.805  1.356   -26.179 1.00 28.29  ?  291  GLN A OE1   1 
ATOM   1634 N  NE2   . GLN A 1 224 ? 61.234  2.285   -28.147 1.00 41.80  ?  291  GLN A NE2   1 
ATOM   1635 N  N     . PHE A 1 225 ? 58.524  2.475   -22.310 1.00 26.88  ?  292  PHE A N     1 
ATOM   1636 C  CA    . PHE A 1 225 ? 57.793  1.433   -21.599 1.00 26.50  ?  292  PHE A CA    1 
ATOM   1637 C  C     . PHE A 1 225 ? 56.418  1.924   -21.170 1.00 30.59  ?  292  PHE A C     1 
ATOM   1638 O  O     . PHE A 1 225 ? 55.419  1.208   -21.320 1.00 26.22  ?  292  PHE A O     1 
ATOM   1639 C  CB    . PHE A 1 225 ? 58.596  0.963   -20.388 1.00 28.64  ?  292  PHE A CB    1 
ATOM   1640 C  CG    . PHE A 1 225 ? 57.971  -0.195  -19.666 1.00 28.37  ?  292  PHE A CG    1 
ATOM   1641 C  CD1   . PHE A 1 225 ? 58.200  -1.494  -20.091 1.00 31.30  ?  292  PHE A CD1   1 
ATOM   1642 C  CD2   . PHE A 1 225 ? 57.148  0.013   -18.570 1.00 29.78  ?  292  PHE A CD2   1 
ATOM   1643 C  CE1   . PHE A 1 225 ? 57.627  -2.563  -19.432 1.00 35.59  ?  292  PHE A CE1   1 
ATOM   1644 C  CE2   . PHE A 1 225 ? 56.572  -1.057  -17.904 1.00 32.24  ?  292  PHE A CE2   1 
ATOM   1645 C  CZ    . PHE A 1 225 ? 56.811  -2.345  -18.338 1.00 35.03  ?  292  PHE A CZ    1 
ATOM   1646 N  N     . ALA A 1 226 ? 56.346  3.144   -20.634 1.00 27.03  ?  293  ALA A N     1 
ATOM   1647 C  CA    . ALA A 1 226 ? 55.060  3.695   -20.223 1.00 26.73  ?  293  ALA A CA    1 
ATOM   1648 C  C     . ALA A 1 226 ? 54.130  3.868   -21.417 1.00 25.74  ?  293  ALA A C     1 
ATOM   1649 O  O     . ALA A 1 226 ? 52.917  3.657   -21.305 1.00 26.41  ?  293  ALA A O     1 
ATOM   1650 C  CB    . ALA A 1 226 ? 55.269  5.028   -19.506 1.00 31.95  ?  293  ALA A CB    1 
ATOM   1651 N  N     . GLU A 1 227 ? 54.675  4.256   -22.572 1.00 25.59  ?  294  GLU A N     1 
ATOM   1652 C  CA    . GLU A 1 227 ? 53.845  4.351   -23.768 1.00 26.36  ?  294  GLU A CA    1 
ATOM   1653 C  C     . GLU A 1 227 ? 53.237  2.998   -24.114 1.00 28.55  ?  294  GLU A C     1 
ATOM   1654 O  O     . GLU A 1 227 ? 52.068  2.915   -24.508 1.00 23.29  ?  294  GLU A O     1 
ATOM   1655 C  CB    . GLU A 1 227 ? 54.662  4.875   -24.946 1.00 31.10  ?  294  GLU A CB    1 
ATOM   1656 C  CG    . GLU A 1 227 ? 55.104  6.320   -24.815 1.00 35.40  ?  294  GLU A CG    1 
ATOM   1657 C  CD    . GLU A 1 227 ? 55.759  6.830   -26.085 1.00 43.35  ?  294  GLU A CD    1 
ATOM   1658 O  OE1   . GLU A 1 227 ? 55.045  6.985   -27.098 1.00 44.84  ?  294  GLU A OE1   1 
ATOM   1659 O  OE2   . GLU A 1 227 ? 56.988  7.054   -26.078 1.00 45.00  -1 294  GLU A OE2   1 
ATOM   1660 N  N     . TRP A 1 228 ? 54.018  1.926   -23.972 1.00 28.05  ?  295  TRP A N     1 
ATOM   1661 C  CA    . TRP A 1 228 ? 53.502  0.588   -24.243 1.00 28.33  ?  295  TRP A CA    1 
ATOM   1662 C  C     . TRP A 1 228 ? 52.351  0.249   -23.305 1.00 27.13  ?  295  TRP A C     1 
ATOM   1663 O  O     . TRP A 1 228 ? 51.285  -0.195  -23.747 1.00 24.78  ?  295  TRP A O     1 
ATOM   1664 C  CB    . TRP A 1 228 ? 54.631  -0.432  -24.119 1.00 25.39  ?  295  TRP A CB    1 
ATOM   1665 C  CG    . TRP A 1 228 ? 54.191  -1.845  -24.284 1.00 30.06  ?  295  TRP A CG    1 
ATOM   1666 C  CD1   . TRP A 1 228 ? 53.486  -2.368  -25.327 1.00 33.19  ?  295  TRP A CD1   1 
ATOM   1667 C  CD2   . TRP A 1 228 ? 54.439  -2.927  -23.382 1.00 26.87  ?  295  TRP A CD2   1 
ATOM   1668 N  NE1   . TRP A 1 228 ? 53.270  -3.710  -25.126 1.00 28.52  ?  295  TRP A NE1   1 
ATOM   1669 C  CE2   . TRP A 1 228 ? 53.847  -4.078  -23.939 1.00 33.90  ?  295  TRP A CE2   1 
ATOM   1670 C  CE3   . TRP A 1 228 ? 55.099  -3.035  -22.155 1.00 26.96  ?  295  TRP A CE3   1 
ATOM   1671 C  CZ2   . TRP A 1 228 ? 53.897  -5.321  -23.311 1.00 31.43  ?  295  TRP A CZ2   1 
ATOM   1672 C  CZ3   . TRP A 1 228 ? 55.147  -4.273  -21.531 1.00 29.88  ?  295  TRP A CZ3   1 
ATOM   1673 C  CH2   . TRP A 1 228 ? 54.552  -5.397  -22.111 1.00 28.01  ?  295  TRP A CH2   1 
ATOM   1674 N  N     . ILE A 1 229 ? 52.544  0.468   -22.001 1.00 23.22  ?  296  ILE A N     1 
ATOM   1675 C  CA    . ILE A 1 229 ? 51.477  0.215   -21.037 1.00 24.31  ?  296  ILE A CA    1 
ATOM   1676 C  C     . ILE A 1 229 ? 50.232  1.013   -21.401 1.00 28.48  ?  296  ILE A C     1 
ATOM   1677 O  O     . ILE A 1 229 ? 49.105  0.511   -21.307 1.00 29.64  ?  296  ILE A O     1 
ATOM   1678 C  CB    . ILE A 1 229 ? 51.954  0.543   -19.611 1.00 22.14  ?  296  ILE A CB    1 
ATOM   1679 C  CG1   . ILE A 1 229 ? 53.159  -0.325  -19.232 1.00 25.88  ?  296  ILE A CG1   1 
ATOM   1680 C  CG2   . ILE A 1 229 ? 50.808  0.368   -18.616 1.00 21.99  ?  296  ILE A CG2   1 
ATOM   1681 C  CD1   . ILE A 1 229 ? 52.906  -1.823  -19.305 1.00 29.37  ?  296  ILE A CD1   1 
ATOM   1682 N  N     . CYS A 1 230 ? 50.411  2.272   -21.808 1.00 25.28  ?  297  CYS A N     1 
ATOM   1683 C  CA    . CYS A 1 230 ? 49.273  3.088   -22.219 1.00 27.02  ?  297  CYS A CA    1 
ATOM   1684 C  C     . CYS A 1 230 ? 48.591  2.490   -23.443 1.00 23.50  ?  297  CYS A C     1 
ATOM   1685 O  O     . CYS A 1 230 ? 47.362  2.370   -23.489 1.00 26.23  ?  297  CYS A O     1 
ATOM   1686 C  CB    . CYS A 1 230 ? 49.732  4.519   -22.501 1.00 30.29  ?  297  CYS A CB    1 
ATOM   1687 S  SG    . CYS A 1 230 ? 48.404  5.619   -23.048 1.00 34.14  ?  297  CYS A SG    1 
ATOM   1688 N  N     . HIS A 1 231 ? 49.382  2.113   -24.450 1.00 24.09  ?  298  HIS A N     1 
ATOM   1689 C  CA    . HIS A 1 231 ? 48.843  1.432   -25.623 1.00 34.11  ?  298  HIS A CA    1 
ATOM   1690 C  C     . HIS A 1 231 ? 48.096  0.163   -25.231 1.00 31.70  ?  298  HIS A C     1 
ATOM   1691 O  O     . HIS A 1 231 ? 47.037  -0.144  -25.790 1.00 31.23  ?  298  HIS A O     1 
ATOM   1692 C  CB    . HIS A 1 231 ? 49.983  1.103   -26.593 1.00 29.50  ?  298  HIS A CB    1 
ATOM   1693 C  CG    . HIS A 1 231 ? 49.567  0.274   -27.769 1.00 34.50  ?  298  HIS A CG    1 
ATOM   1694 N  ND1   . HIS A 1 231 ? 48.588  0.672   -28.655 1.00 41.68  ?  298  HIS A ND1   1 
ATOM   1695 C  CD2   . HIS A 1 231 ? 50.011  -0.927  -28.214 1.00 31.87  ?  298  HIS A CD2   1 
ATOM   1696 C  CE1   . HIS A 1 231 ? 48.442  -0.250  -29.590 1.00 43.38  ?  298  HIS A CE1   1 
ATOM   1697 N  NE2   . HIS A 1 231 ? 49.294  -1.230  -29.346 1.00 38.23  ?  298  HIS A NE2   1 
ATOM   1698 N  N     . LEU A 1 232 ? 48.631  -0.586  -24.266 1.00 28.78  ?  299  LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 232 ? 48.043  -1.870  -23.904 1.00 28.60  ?  299  LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 232 ? 46.697  -1.690  -23.215 1.00 31.64  ?  299  LEU A C     1 
ATOM   1701 O  O     . LEU A 1 232 ? 45.689  -2.263  -23.643 1.00 32.86  ?  299  LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 232 ? 48.997  -2.646  -22.996 1.00 32.16  ?  299  LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 232 ? 49.718  -3.845  -23.603 1.00 36.98  ?  299  LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 232 ? 50.687  -4.415  -22.585 1.00 39.85  ?  299  LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 232 ? 48.723  -4.900  -24.043 1.00 44.81  ?  299  LEU A CD2   1 
ATOM   1706 N  N     . HIS A 1 233 ? 46.660  -0.901  -22.143 1.00 31.77  ?  300  HIS A N     1 
ATOM   1707 C  CA    . HIS A 1 233 ? 45.510  -0.864  -21.250 1.00 31.98  ?  300  HIS A CA    1 
ATOM   1708 C  C     . HIS A 1 233 ? 44.703  0.425   -21.359 1.00 34.57  ?  300  HIS A C     1 
ATOM   1709 O  O     . HIS A 1 233 ? 43.787  0.639   -20.558 1.00 34.05  ?  300  HIS A O     1 
ATOM   1710 C  CB    . HIS A 1 233 ? 45.982  -1.095  -19.813 1.00 33.77  ?  300  HIS A CB    1 
ATOM   1711 C  CG    . HIS A 1 233 ? 46.638  -2.426  -19.612 1.00 36.10  ?  300  HIS A CG    1 
ATOM   1712 N  ND1   . HIS A 1 233 ? 45.950  -3.617  -19.715 1.00 36.01  ?  300  HIS A ND1   1 
ATOM   1713 C  CD2   . HIS A 1 233 ? 47.921  -2.757  -19.332 1.00 33.87  ?  300  HIS A CD2   1 
ATOM   1714 C  CE1   . HIS A 1 233 ? 46.779  -4.623  -19.500 1.00 32.79  ?  300  HIS A CE1   1 
ATOM   1715 N  NE2   . HIS A 1 233 ? 47.981  -4.128  -19.263 1.00 29.68  ?  300  HIS A NE2   1 
ATOM   1716 N  N     . LYS A 1 234 ? 45.012  1.281   -22.333 1.00 36.17  ?  301  LYS A N     1 
ATOM   1717 C  CA    . LYS A 1 234 ? 44.166  2.428   -22.674 1.00 37.36  ?  301  LYS A CA    1 
ATOM   1718 C  C     . LYS A 1 234 ? 43.952  3.350   -21.476 1.00 34.34  ?  301  LYS A C     1 
ATOM   1719 O  O     . LYS A 1 234 ? 42.873  3.912   -21.285 1.00 42.03  ?  301  LYS A O     1 
ATOM   1720 C  CB    . LYS A 1 234 ? 42.824  1.959   -23.240 1.00 37.23  ?  301  LYS A CB    1 
ATOM   1721 C  CG    . LYS A 1 234 ? 42.944  0.928   -24.353 1.00 46.68  ?  301  LYS A CG    1 
ATOM   1722 C  CD    . LYS A 1 234 ? 43.834  1.421   -25.485 1.00 55.86  ?  301  LYS A CD    1 
ATOM   1723 C  CE    . LYS A 1 234 ? 43.907  0.414   -26.622 1.00 63.06  ?  301  LYS A CE    1 
ATOM   1724 N  NZ    . LYS A 1 234 ? 44.836  0.862   -27.696 1.00 59.81  ?  301  LYS A NZ    1 
ATOM   1725 N  N     . GLN A 1 235 ? 44.986  3.512   -20.666 1.00 33.08  ?  302  GLN A N     1 
ATOM   1726 C  CA    . GLN A 1 235 ? 44.951  4.387   -19.507 1.00 31.48  ?  302  GLN A CA    1 
ATOM   1727 C  C     . GLN A 1 235 ? 46.274  5.129   -19.430 1.00 30.75  ?  302  GLN A C     1 
ATOM   1728 O  O     . GLN A 1 235 ? 47.246  4.746   -20.088 1.00 33.06  ?  302  GLN A O     1 
ATOM   1729 C  CB    . GLN A 1 235 ? 44.714  3.602   -18.210 1.00 34.19  ?  302  GLN A CB    1 
ATOM   1730 C  CG    . GLN A 1 235 ? 43.342  2.946   -18.118 1.00 55.55  ?  302  GLN A CG    1 
ATOM   1731 C  CD    . GLN A 1 235 ? 42.231  3.941   -17.831 1.00 68.28  ?  302  GLN A CD    1 
ATOM   1732 O  OE1   . GLN A 1 235 ? 41.345  4.160   -18.661 1.00 67.48  ?  302  GLN A OE1   1 
ATOM   1733 N  NE2   . GLN A 1 235 ? 42.267  4.543   -16.647 1.00 63.29  ?  302  GLN A NE2   1 
ATOM   1734 N  N     . PRO A 1 236 ? 46.342  6.201   -18.645 1.00 36.81  ?  303  PRO A N     1 
ATOM   1735 C  CA    . PRO A 1 236 ? 47.628  6.885   -18.471 1.00 38.29  ?  303  PRO A CA    1 
ATOM   1736 C  C     . PRO A 1 236 ? 48.600  6.023   -17.686 1.00 27.12  ?  303  PRO A C     1 
ATOM   1737 O  O     . PRO A 1 236 ? 48.212  5.290   -16.773 1.00 33.36  ?  303  PRO A O     1 
ATOM   1738 C  CB    . PRO A 1 236 ? 47.262  8.159   -17.696 1.00 33.75  ?  303  PRO A CB    1 
ATOM   1739 C  CG    . PRO A 1 236 ? 45.780  8.289   -17.810 1.00 34.84  ?  303  PRO A CG    1 
ATOM   1740 C  CD    . PRO A 1 236 ? 45.252  6.896   -17.943 1.00 28.46  ?  303  PRO A CD    1 
ATOM   1741 N  N     . CYS A 1 237 ? 49.874  6.108   -18.053 1.00 29.18  ?  304  CYS A N     1 
ATOM   1742 C  CA    . CYS A 1 237 ? 50.943  5.504   -17.271 1.00 26.91  ?  304  CYS A CA    1 
ATOM   1743 C  C     . CYS A 1 237 ? 52.027  6.547   -17.072 1.00 22.51  ?  304  CYS A C     1 
ATOM   1744 O  O     . CYS A 1 237 ? 52.572  7.077   -18.045 1.00 28.25  ?  304  CYS A O     1 
ATOM   1745 C  CB    . CYS A 1 237 ? 51.507  4.251   -17.947 1.00 27.34  ?  304  CYS A CB    1 
ATOM   1746 S  SG    . CYS A 1 237 ? 52.760  3.419   -16.941 1.00 29.45  ?  304  CYS A SG    1 
ATOM   1747 N  N     . HIS A 1 238 ? 52.337  6.837   -15.818 1.00 30.33  ?  305  HIS A N     1 
ATOM   1748 C  CA    . HIS A 1 238 ? 53.295  7.875   -15.485 1.00 25.58  ?  305  HIS A CA    1 
ATOM   1749 C  C     . HIS A 1 238 ? 54.708  7.312   -15.457 1.00 31.28  ?  305  HIS A C     1 
ATOM   1750 O  O     . HIS A 1 238 ? 54.922  6.101   -15.347 1.00 30.98  ?  305  HIS A O     1 
ATOM   1751 C  CB    . HIS A 1 238 ? 52.946  8.498   -14.135 1.00 33.48  ?  305  HIS A CB    1 
ATOM   1752 C  CG    . HIS A 1 238 ? 51.572  9.089   -14.090 1.00 32.78  ?  305  HIS A CG    1 
ATOM   1753 N  ND1   . HIS A 1 238 ? 51.340  10.440  -14.220 1.00 33.28  ?  305  HIS A ND1   1 
ATOM   1754 C  CD2   . HIS A 1 238 ? 50.356  8.512   -13.945 1.00 32.86  ?  305  HIS A CD2   1 
ATOM   1755 C  CE1   . HIS A 1 238 ? 50.042  10.673  -14.149 1.00 36.22  ?  305  HIS A CE1   1 
ATOM   1756 N  NE2   . HIS A 1 238 ? 49.422  9.519   -13.983 1.00 32.35  ?  305  HIS A NE2   1 
ATOM   1757 N  N     . VAL A 1 239 ? 55.678  8.216   -15.573 1.00 28.76  ?  306  VAL A N     1 
ATOM   1758 C  CA    . VAL A 1 239 ? 57.093  7.888   -15.448 1.00 27.01  ?  306  VAL A CA    1 
ATOM   1759 C  C     . VAL A 1 239 ? 57.698  8.852   -14.440 1.00 33.07  ?  306  VAL A C     1 
ATOM   1760 O  O     . VAL A 1 239 ? 57.754  10.063  -14.691 1.00 33.06  ?  306  VAL A O     1 
ATOM   1761 C  CB    . VAL A 1 239 ? 57.840  7.976   -16.785 1.00 30.63  ?  306  VAL A CB    1 
ATOM   1762 C  CG1   . VAL A 1 239 ? 59.272  7.482   -16.619 1.00 30.69  ?  306  VAL A CG1   1 
ATOM   1763 C  CG2   . VAL A 1 239 ? 57.126  7.178   -17.847 1.00 35.83  ?  306  VAL A CG2   1 
ATOM   1764 N  N     . ILE A 1 240 ? 58.150  8.322   -13.309 1.00 32.50  ?  307  ILE A N     1 
ATOM   1765 C  CA    . ILE A 1 240 ? 58.936  9.072   -12.337 1.00 24.54  ?  307  ILE A CA    1 
ATOM   1766 C  C     . ILE A 1 240 ? 60.368  8.575   -12.441 1.00 28.39  ?  307  ILE A C     1 
ATOM   1767 O  O     . ILE A 1 240 ? 60.647  7.403   -12.155 1.00 31.40  ?  307  ILE A O     1 
ATOM   1768 C  CB    . ILE A 1 240 ? 58.395  8.904   -10.910 1.00 24.73  ?  307  ILE A CB    1 
ATOM   1769 C  CG1   . ILE A 1 240 ? 56.907  9.249   -10.856 1.00 32.77  ?  307  ILE A CG1   1 
ATOM   1770 C  CG2   . ILE A 1 240 ? 59.183  9.770   -9.935  1.00 33.30  ?  307  ILE A CG2   1 
ATOM   1771 C  CD1   . ILE A 1 240 ? 56.567  10.615  -11.410 1.00 35.92  ?  307  ILE A CD1   1 
ATOM   1772 N  N     . TYR A 1 241 ? 61.273  9.460   -12.857 1.00 26.86  ?  308  TYR A N     1 
ATOM   1773 C  CA    . TYR A 1 241 ? 62.668  9.114   -13.092 1.00 27.63  ?  308  TYR A CA    1 
ATOM   1774 C  C     . TYR A 1 241 ? 63.570  10.050  -12.304 1.00 34.83  ?  308  TYR A C     1 
ATOM   1775 O  O     . TYR A 1 241 ? 63.306  11.253  -12.222 1.00 35.37  ?  308  TYR A O     1 
ATOM   1776 C  CB    . TYR A 1 241 ? 63.011  9.205   -14.586 1.00 32.47  ?  308  TYR A CB    1 
ATOM   1777 C  CG    . TYR A 1 241 ? 64.458  8.913   -14.911 1.00 36.06  ?  308  TYR A CG    1 
ATOM   1778 C  CD1   . TYR A 1 241 ? 65.434  9.895   -14.788 1.00 43.23  ?  308  TYR A CD1   1 
ATOM   1779 C  CD2   . TYR A 1 241 ? 64.848  7.657   -15.356 1.00 35.77  ?  308  TYR A CD2   1 
ATOM   1780 C  CE1   . TYR A 1 241 ? 66.763  9.628   -15.088 1.00 43.44  ?  308  TYR A CE1   1 
ATOM   1781 C  CE2   . TYR A 1 241 ? 66.167  7.382   -15.662 1.00 34.17  ?  308  TYR A CE2   1 
ATOM   1782 C  CZ    . TYR A 1 241 ? 67.121  8.370   -15.525 1.00 45.81  ?  308  TYR A CZ    1 
ATOM   1783 O  OH    . TYR A 1 241 ? 68.435  8.092   -15.830 1.00 46.29  ?  308  TYR A OH    1 
ATOM   1784 N  N     . THR A 1 242 ? 64.642  9.498   -11.740 1.00 27.08  ?  309  THR A N     1 
ATOM   1785 C  CA    . THR A 1 242 ? 65.629  10.316  -11.051 1.00 31.25  ?  309  THR A CA    1 
ATOM   1786 C  C     . THR A 1 242 ? 66.961  9.585   -11.009 1.00 29.54  ?  309  THR A C     1 
ATOM   1787 O  O     . THR A 1 242 ? 67.004  8.369   -10.809 1.00 32.65  ?  309  THR A O     1 
ATOM   1788 C  CB    . THR A 1 242 ? 65.190  10.658  -9.623  1.00 34.87  ?  309  THR A CB    1 
ATOM   1789 O  OG1   . THR A 1 242 ? 66.226  11.408  -8.975  1.00 41.20  ?  309  THR A OG1   1 
ATOM   1790 C  CG2   . THR A 1 242 ? 64.914  9.395   -8.826  1.00 33.22  ?  309  THR A CG2   1 
ATOM   1791 N  N     . ASP A 1 243 ? 68.039  10.342  -11.194 1.00 35.67  ?  310  ASP A N     1 
ATOM   1792 C  CA    . ASP A 1 243 ? 69.394  9.853   -10.982 1.00 37.26  ?  310  ASP A CA    1 
ATOM   1793 C  C     . ASP A 1 243 ? 69.864  10.053  -9.549  1.00 41.04  ?  310  ASP A C     1 
ATOM   1794 O  O     . ASP A 1 243 ? 71.021  9.747   -9.241  1.00 39.25  ?  310  ASP A O     1 
ATOM   1795 C  CB    . ASP A 1 243 ? 70.365  10.556  -11.937 1.00 46.46  ?  310  ASP A CB    1 
ATOM   1796 C  CG    . ASP A 1 243 ? 70.263  10.040  -13.360 1.00 69.82  ?  310  ASP A CG    1 
ATOM   1797 O  OD1   . ASP A 1 243 ? 70.284  8.805   -13.550 1.00 77.35  -1 310  ASP A OD1   1 
ATOM   1798 O  OD2   . ASP A 1 243 ? 70.160  10.869  -14.290 1.00 77.29  ?  310  ASP A OD2   1 
ATOM   1799 N  N     . TYR A 1 244 ? 68.996  10.553  -8.670  1.00 33.30  ?  311  TYR A N     1 
ATOM   1800 C  CA    . TYR A 1 244 ? 69.392  10.856  -7.302  1.00 38.67  ?  311  TYR A CA    1 
ATOM   1801 C  C     . TYR A 1 244 ? 70.042  9.651   -6.638  1.00 45.59  ?  311  TYR A C     1 
ATOM   1802 O  O     . TYR A 1 244 ? 69.550  8.525   -6.737  1.00 35.15  ?  311  TYR A O     1 
ATOM   1803 C  CB    . TYR A 1 244 ? 68.177  11.293  -6.488  1.00 40.61  ?  311  TYR A CB    1 
ATOM   1804 C  CG    . TYR A 1 244 ? 68.455  11.409  -5.009  1.00 45.76  ?  311  TYR A CG    1 
ATOM   1805 C  CD1   . TYR A 1 244 ? 69.462  12.240  -4.535  1.00 50.38  ?  311  TYR A CD1   1 
ATOM   1806 C  CD2   . TYR A 1 244 ? 67.704  10.697  -4.084  1.00 52.08  ?  311  TYR A CD2   1 
ATOM   1807 C  CE1   . TYR A 1 244 ? 69.718  12.353  -3.184  1.00 48.62  ?  311  TYR A CE1   1 
ATOM   1808 C  CE2   . TYR A 1 244 ? 67.951  10.806  -2.729  1.00 55.44  ?  311  TYR A CE2   1 
ATOM   1809 C  CZ    . TYR A 1 244 ? 68.957  11.636  -2.285  1.00 50.02  ?  311  TYR A CZ    1 
ATOM   1810 O  OH    . TYR A 1 244 ? 69.207  11.747  -0.935  1.00 65.32  ?  311  TYR A OH    1 
ATOM   1811 N  N     . ARG A 1 245 ? 71.149  9.905   -5.950  1.00 43.45  ?  312  ARG A N     1 
ATOM   1812 C  CA    . ARG A 1 245 ? 71.845  8.891   -5.159  1.00 46.57  ?  312  ARG A CA    1 
ATOM   1813 C  C     . ARG A 1 245 ? 72.040  9.441   -3.750  1.00 42.68  ?  312  ARG A C     1 
ATOM   1814 O  O     . ARG A 1 245 ? 72.799  10.416  -3.573  1.00 50.94  ?  312  ARG A O     1 
ATOM   1815 C  CB    . ARG A 1 245 ? 73.183  8.527   -5.798  1.00 43.56  ?  312  ARG A CB    1 
ATOM   1816 C  CG    . ARG A 1 245 ? 73.752  7.215   -5.307  1.00 50.29  ?  312  ARG A CG    1 
ATOM   1817 C  CD    . ARG A 1 245 ? 75.122  6.937   -5.895  1.00 57.75  ?  312  ARG A CD    1 
ATOM   1818 N  NE    . ARG A 1 245 ? 75.089  6.710   -7.339  1.00 49.44  ?  312  ARG A NE    1 
ATOM   1819 C  CZ    . ARG A 1 245 ? 74.731  5.564   -7.911  1.00 49.43  ?  312  ARG A CZ    1 
ATOM   1820 N  NH1   . ARG A 1 245 ? 74.350  4.530   -7.167  1.00 44.77  ?  312  ARG A NH1   1 
ATOM   1821 N  NH2   . ARG A 1 245 ? 74.744  5.452   -9.233  1.00 49.50  ?  312  ARG A NH2   1 
ATOM   1822 N  N     . PRO A 1 246 ? 71.390  8.872   -2.728  1.00 51.02  ?  313  PRO A N     1 
ATOM   1823 C  CA    . PRO A 1 246 ? 71.522  9.448   -1.377  1.00 49.23  ?  313  PRO A CA    1 
ATOM   1824 C  C     . PRO A 1 246 ? 72.944  9.446   -0.854  1.00 53.96  ?  313  PRO A C     1 
ATOM   1825 O  O     . PRO A 1 246 ? 73.301  10.314  -0.047  1.00 50.20  ?  313  PRO A O     1 
ATOM   1826 C  CB    . PRO A 1 246 ? 70.612  8.555   -0.520  1.00 52.55  ?  313  PRO A CB    1 
ATOM   1827 C  CG    . PRO A 1 246 ? 69.708  7.872   -1.482  1.00 57.68  ?  313  PRO A CG    1 
ATOM   1828 C  CD    . PRO A 1 246 ? 70.490  7.706   -2.740  1.00 47.75  ?  313  PRO A CD    1 
ATOM   1829 N  N     . THR A 1 247 ? 73.759  8.489   -1.273  1.00 46.14  ?  314  THR A N     1 
ATOM   1830 C  CA    . THR A 1 247 ? 75.157  8.415   -0.855  1.00 44.49  ?  314  THR A CA    1 
ATOM   1831 C  C     . THR A 1 247 ? 76.025  8.531   -2.098  1.00 45.39  ?  314  THR A C     1 
ATOM   1832 O  O     . THR A 1 247 ? 76.033  7.602   -2.927  1.00 45.57  ?  314  THR A O     1 
ATOM   1833 C  CB    . THR A 1 247 ? 75.440  7.108   -0.114  1.00 45.40  ?  314  THR A CB    1 
ATOM   1834 O  OG1   . THR A 1 247 ? 74.504  6.953   0.962   1.00 46.90  ?  314  THR A OG1   1 
ATOM   1835 C  CG2   . THR A 1 247 ? 76.853  7.104   0.450   1.00 50.30  ?  314  THR A CG2   1 
ATOM   1836 N  N     . PRO A 1 248 ? 76.745  9.632   -2.301  1.00 47.08  ?  315  PRO A N     1 
ATOM   1837 C  CA    . PRO A 1 248 ? 77.554  9.751   -3.518  1.00 45.69  ?  315  PRO A CA    1 
ATOM   1838 C  C     . PRO A 1 248 ? 78.678  8.731   -3.535  1.00 44.99  ?  315  PRO A C     1 
ATOM   1839 O  O     . PRO A 1 248 ? 79.135  8.256   -2.492  1.00 44.08  ?  315  PRO A O     1 
ATOM   1840 C  CB    . PRO A 1 248 ? 78.092  11.186  -3.456  1.00 48.95  ?  315  PRO A CB    1 
ATOM   1841 C  CG    . PRO A 1 248 ? 78.000  11.576  -2.029  1.00 54.86  ?  315  PRO A CG    1 
ATOM   1842 C  CD    . PRO A 1 248 ? 76.822  10.843  -1.466  1.00 53.40  ?  315  PRO A CD    1 
ATOM   1843 N  N     . LEU A 1 249 ? 79.113  8.388   -4.745  1.00 40.69  ?  316  LEU A N     1 
ATOM   1844 C  CA    . LEU A 1 249 ? 80.139  7.381   -4.960  1.00 42.31  ?  316  LEU A CA    1 
ATOM   1845 C  C     . LEU A 1 249 ? 81.433  8.020   -5.444  1.00 44.55  ?  316  LEU A C     1 
ATOM   1846 O  O     . LEU A 1 249 ? 81.424  9.027   -6.159  1.00 47.22  ?  316  LEU A O     1 
ATOM   1847 C  CB    . LEU A 1 249 ? 79.692  6.339   -5.993  1.00 42.45  ?  316  LEU A CB    1 
ATOM   1848 C  CG    . LEU A 1 249 ? 78.434  5.528   -5.689  1.00 43.90  ?  316  LEU A CG    1 
ATOM   1849 C  CD1   . LEU A 1 249 ? 78.118  4.613   -6.858  1.00 46.67  ?  316  LEU A CD1   1 
ATOM   1850 C  CD2   . LEU A 1 249 ? 78.591  4.729   -4.408  1.00 50.36  ?  316  LEU A CD2   1 
ATOM   1851 N  N     . GLN A 1 250 ? 82.549  7.411   -5.054  1.00 46.80  ?  317  GLN A N     1 
ATOM   1852 C  CA    . GLN A 1 250 ? 83.857  7.710   -5.620  1.00 52.11  ?  317  GLN A CA    1 
ATOM   1853 C  C     . GLN A 1 250 ? 84.389  6.440   -6.266  1.00 45.26  ?  317  GLN A C     1 
ATOM   1854 O  O     . GLN A 1 250 ? 84.367  5.370   -5.649  1.00 51.74  ?  317  GLN A O     1 
ATOM   1855 C  CB    . GLN A 1 250 ? 84.829  8.220   -4.555  1.00 47.72  ?  317  GLN A CB    1 
ATOM   1856 C  CG    . GLN A 1 250 ? 84.477  9.593   -4.006  1.00 58.76  ?  317  GLN A CG    1 
ATOM   1857 C  CD    . GLN A 1 250 ? 85.469  10.072  -2.967  1.00 69.94  ?  317  GLN A CD    1 
ATOM   1858 O  OE1   . GLN A 1 250 ? 86.562  9.520   -2.835  1.00 58.46  ?  317  GLN A OE1   1 
ATOM   1859 N  NE2   . GLN A 1 250 ? 85.091  11.100  -2.216  1.00 67.29  ?  317  GLN A NE2   1 
ATOM   1860 N  N     . HIS A 1 251 ? 84.855  6.559   -7.504  1.00 46.04  ?  318  HIS A N     1 
ATOM   1861 C  CA    . HIS A 1 251 ? 85.287  5.417   -8.296  1.00 50.37  ?  318  HIS A CA    1 
ATOM   1862 C  C     . HIS A 1 251 ? 86.800  5.445   -8.446  1.00 50.08  ?  318  HIS A C     1 
ATOM   1863 O  O     . HIS A 1 251 ? 87.371  6.468   -8.837  1.00 53.51  ?  318  HIS A O     1 
ATOM   1864 C  CB    . HIS A 1 251 ? 84.610  5.427   -9.668  1.00 48.32  ?  318  HIS A CB    1 
ATOM   1865 C  CG    . HIS A 1 251 ? 83.118  5.548   -9.601  1.00 53.82  ?  318  HIS A CG    1 
ATOM   1866 N  ND1   . HIS A 1 251 ? 82.268  4.534   -9.989  1.00 49.34  ?  318  HIS A ND1   1 
ATOM   1867 C  CD2   . HIS A 1 251 ? 82.325  6.561   -9.176  1.00 50.38  ?  318  HIS A CD2   1 
ATOM   1868 C  CE1   . HIS A 1 251 ? 81.017  4.920   -9.813  1.00 53.11  ?  318  HIS A CE1   1 
ATOM   1869 N  NE2   . HIS A 1 251 ? 81.024  6.145   -9.321  1.00 53.94  ?  318  HIS A NE2   1 
ATOM   1870 N  N     . TYR A 1 252 ? 87.441  4.323   -8.135  1.00 56.52  ?  319  TYR A N     1 
ATOM   1871 C  CA    . TYR A 1 252 ? 88.887  4.191   -8.213  1.00 48.74  ?  319  TYR A CA    1 
ATOM   1872 C  C     . TYR A 1 252 ? 89.256  3.034   -9.130  1.00 57.27  ?  319  TYR A C     1 
ATOM   1873 O  O     . TYR A 1 252 ? 88.498  2.071   -9.280  1.00 55.39  ?  319  TYR A O     1 
ATOM   1874 C  CB    . TYR A 1 252 ? 89.503  3.951   -6.829  1.00 47.01  ?  319  TYR A CB    1 
ATOM   1875 C  CG    . TYR A 1 252 ? 89.299  5.082   -5.851  1.00 55.64  ?  319  TYR A CG    1 
ATOM   1876 C  CD1   . TYR A 1 252 ? 88.131  5.178   -5.105  1.00 54.72  ?  319  TYR A CD1   1 
ATOM   1877 C  CD2   . TYR A 1 252 ? 90.277  6.052   -5.668  1.00 57.98  ?  319  TYR A CD2   1 
ATOM   1878 C  CE1   . TYR A 1 252 ? 87.940  6.212   -4.207  1.00 57.24  ?  319  TYR A CE1   1 
ATOM   1879 C  CE2   . TYR A 1 252 ? 90.095  7.089   -4.773  1.00 55.74  ?  319  TYR A CE2   1 
ATOM   1880 C  CZ    . TYR A 1 252 ? 88.926  7.164   -4.045  1.00 61.32  ?  319  TYR A CZ    1 
ATOM   1881 O  OH    . TYR A 1 252 ? 88.741  8.194   -3.152  1.00 62.55  ?  319  TYR A OH    1 
ATOM   1882 N  N     . ILE A 1 253 ? 90.431  3.141   -9.741  1.00 58.40  ?  320  ILE A N     1 
ATOM   1883 C  CA    . ILE A 1 253 ? 91.041  2.048   -10.488 1.00 54.66  ?  320  ILE A CA    1 
ATOM   1884 C  C     . ILE A 1 253 ? 92.283  1.610   -9.729  1.00 62.99  ?  320  ILE A C     1 
ATOM   1885 O  O     . ILE A 1 253 ? 93.085  2.449   -9.301  1.00 62.01  ?  320  ILE A O     1 
ATOM   1886 C  CB    . ILE A 1 253 ? 91.390  2.464   -11.928 1.00 62.13  ?  320  ILE A CB    1 
ATOM   1887 C  CG1   . ILE A 1 253 ? 90.109  2.593   -12.758 1.00 72.42  ?  320  ILE A CG1   1 
ATOM   1888 C  CG2   . ILE A 1 253 ? 92.351  1.453   -12.557 1.00 63.83  ?  320  ILE A CG2   1 
ATOM   1889 C  CD1   . ILE A 1 253 ? 90.329  3.085   -14.179 1.00 77.37  ?  320  ILE A CD1   1 
ATOM   1890 N  N     . PHE A 1 254 ? 92.435  0.297   -9.549  1.00 63.03  ?  321  PHE A N     1 
ATOM   1891 C  CA    . PHE A 1 254 ? 93.613  -0.283  -8.914  1.00 67.97  ?  321  PHE A CA    1 
ATOM   1892 C  C     . PHE A 1 254 ? 94.394  -1.051  -9.973  1.00 74.88  ?  321  PHE A C     1 
ATOM   1893 O  O     . PHE A 1 254 ? 94.168  -2.254  -10.167 1.00 71.68  ?  321  PHE A O     1 
ATOM   1894 C  CB    . PHE A 1 254 ? 93.220  -1.200  -7.754  1.00 66.97  ?  321  PHE A CB    1 
ATOM   1895 C  CG    . PHE A 1 254 ? 94.391  -1.856  -7.080  1.00 79.71  ?  321  PHE A CG    1 
ATOM   1896 C  CD1   . PHE A 1 254 ? 95.326  -1.097  -6.396  1.00 81.06  ?  321  PHE A CD1   1 
ATOM   1897 C  CD2   . PHE A 1 254 ? 94.555  -3.231  -7.125  1.00 86.17  ?  321  PHE A CD2   1 
ATOM   1898 C  CE1   . PHE A 1 254 ? 96.405  -1.696  -5.774  1.00 90.12  ?  321  PHE A CE1   1 
ATOM   1899 C  CE2   . PHE A 1 254 ? 95.631  -3.837  -6.505  1.00 88.41  ?  321  PHE A CE2   1 
ATOM   1900 C  CZ    . PHE A 1 254 ? 96.558  -3.068  -5.827  1.00 89.44  ?  321  PHE A CZ    1 
ATOM   1901 N  N     . PRO A 1 255 ? 95.316  -0.408  -10.689 1.00 86.10  ?  322  PRO A N     1 
ATOM   1902 C  CA    . PRO A 1 255 ? 96.034  -1.115  -11.754 1.00 84.10  ?  322  PRO A CA    1 
ATOM   1903 C  C     . PRO A 1 255 ? 96.867  -2.258  -11.197 1.00 91.28  ?  322  PRO A C     1 
ATOM   1904 O  O     . PRO A 1 255 ? 97.339  -2.217  -10.059 1.00 95.34  ?  322  PRO A O     1 
ATOM   1905 C  CB    . PRO A 1 255 ? 96.916  -0.025  -12.374 1.00 85.68  ?  322  PRO A CB    1 
ATOM   1906 C  CG    . PRO A 1 255 ? 97.093  0.978   -11.290 1.00 87.82  ?  322  PRO A CG    1 
ATOM   1907 C  CD    . PRO A 1 255 ? 95.812  0.968   -10.509 1.00 78.39  ?  322  PRO A CD    1 
ATOM   1908 N  N     . ALA A 1 256 ? 97.038  -3.291  -12.018 1.00 97.86  ?  323  ALA A N     1 
ATOM   1909 C  CA    . ALA A 1 256 ? 97.842  -4.436  -11.616 1.00 102.31 ?  323  ALA A CA    1 
ATOM   1910 C  C     . ALA A 1 256 ? 99.277  -4.003  -11.349 1.00 110.72 ?  323  ALA A C     1 
ATOM   1911 O  O     . ALA A 1 256 ? 99.857  -3.214  -12.101 1.00 95.71  ?  323  ALA A O     1 
ATOM   1912 C  CB    . ALA A 1 256 ? 97.805  -5.515  -12.698 1.00 101.24 ?  323  ALA A CB    1 
ATOM   1913 N  N     . GLY A 1 257 ? 99.849  -4.521  -10.261 1.00 106.87 ?  324  GLY A N     1 
ATOM   1914 C  CA    . GLY A 1 257 ? 101.190 -4.167  -9.854  1.00 102.79 ?  324  GLY A CA    1 
ATOM   1915 C  C     . GLY A 1 257 ? 101.310 -2.860  -9.103  1.00 105.47 ?  324  GLY A C     1 
ATOM   1916 O  O     . GLY A 1 257 ? 102.289 -2.672  -8.371  1.00 108.84 ?  324  GLY A O     1 
ATOM   1917 N  N     . GLY A 1 258 ? 100.354 -1.951  -9.255  1.00 103.11 ?  325  GLY A N     1 
ATOM   1918 C  CA    . GLY A 1 258 ? 100.400 -0.689  -8.545  1.00 96.73  ?  325  GLY A CA    1 
ATOM   1919 C  C     . GLY A 1 258 ? 100.293 -0.875  -7.044  1.00 96.18  ?  325  GLY A C     1 
ATOM   1920 O  O     . GLY A 1 258 ? 100.011 -1.954  -6.524  1.00 90.83  ?  325  GLY A O     1 
ATOM   1921 N  N     . ASP A 1 259 ? 100.530 0.226   -6.332  1.00 97.06  ?  326  ASP A N     1 
ATOM   1922 C  CA    . ASP A 1 259 ? 100.493 0.236   -4.876  1.00 99.32  ?  326  ASP A CA    1 
ATOM   1923 C  C     . ASP A 1 259 ? 99.288  0.960   -4.299  1.00 100.74 ?  326  ASP A C     1 
ATOM   1924 O  O     . ASP A 1 259 ? 98.868  0.636   -3.187  1.00 95.44  ?  326  ASP A O     1 
ATOM   1925 C  CB    . ASP A 1 259 ? 101.766 0.885   -4.317  1.00 111.16 ?  326  ASP A CB    1 
ATOM   1926 C  CG    . ASP A 1 259 ? 102.993 0.011   -4.494  1.00 113.90 ?  326  ASP A CG    1 
ATOM   1927 O  OD1   . ASP A 1 259 ? 102.875 -1.222  -4.337  1.00 107.27 -1 326  ASP A OD1   1 
ATOM   1928 O  OD2   . ASP A 1 259 ? 104.076 0.559   -4.789  1.00 103.37 ?  326  ASP A OD2   1 
ATOM   1929 N  N     . GLY A 1 260 ? 98.720  1.926   -5.025  1.00 95.98  ?  327  GLY A N     1 
ATOM   1930 C  CA    . GLY A 1 260 ? 97.636  2.737   -4.513  1.00 94.60  ?  327  GLY A CA    1 
ATOM   1931 C  C     . GLY A 1 260 ? 96.453  2.767   -5.464  1.00 77.92  ?  327  GLY A C     1 
ATOM   1932 O  O     . GLY A 1 260 ? 96.445  2.107   -6.506  1.00 75.34  ?  327  GLY A O     1 
ATOM   1933 N  N     . LEU A 1 261 ? 95.456  3.556   -5.076  1.00 75.99  ?  328  LEU A N     1 
ATOM   1934 C  CA    . LEU A 1 261 ? 94.223  3.714   -5.830  1.00 65.77  ?  328  LEU A CA    1 
ATOM   1935 C  C     . LEU A 1 261 ? 94.205  5.078   -6.504  1.00 67.24  ?  328  LEU A C     1 
ATOM   1936 O  O     . LEU A 1 261 ? 94.697  6.066   -5.952  1.00 84.33  ?  328  LEU A O     1 
ATOM   1937 C  CB    . LEU A 1 261 ? 93.002  3.572   -4.917  1.00 65.14  ?  328  LEU A CB    1 
ATOM   1938 C  CG    . LEU A 1 261 ? 92.944  2.288   -4.089  1.00 65.27  ?  328  LEU A CG    1 
ATOM   1939 C  CD1   . LEU A 1 261 ? 91.854  2.386   -3.037  1.00 69.99  ?  328  LEU A CD1   1 
ATOM   1940 C  CD2   . LEU A 1 261 ? 92.721  1.077   -4.984  1.00 54.36  ?  328  LEU A CD2   1 
ATOM   1941 N  N     . HIS A 1 262 ? 93.623  5.128   -7.700  1.00 60.12  ?  329  HIS A N     1 
ATOM   1942 C  CA    . HIS A 1 262 ? 93.590  6.341   -8.508  1.00 62.76  ?  329  HIS A CA    1 
ATOM   1943 C  C     . HIS A 1 262 ? 92.143  6.763   -8.709  1.00 68.58  ?  329  HIS A C     1 
ATOM   1944 O  O     . HIS A 1 262 ? 91.364  6.040   -9.340  1.00 63.90  ?  329  HIS A O     1 
ATOM   1945 C  CB    . HIS A 1 262 ? 94.285  6.115   -9.853  1.00 72.01  ?  329  HIS A CB    1 
ATOM   1946 C  CG    . HIS A 1 262 ? 95.710  5.676   -9.725  1.00 88.75  ?  329  HIS A CG    1 
ATOM   1947 N  ND1   . HIS A 1 262 ? 96.065  4.403   -9.332  1.00 82.58  ?  329  HIS A ND1   1 
ATOM   1948 C  CD2   . HIS A 1 262 ? 96.871  6.344   -9.927  1.00 78.27  ?  329  HIS A CD2   1 
ATOM   1949 C  CE1   . HIS A 1 262 ? 97.382  4.304   -9.304  1.00 77.39  ?  329  HIS A CE1   1 
ATOM   1950 N  NE2   . HIS A 1 262 ? 97.895  5.468   -9.660  1.00 86.20  ?  329  HIS A NE2   1 
ATOM   1951 N  N     . LEU A 1 263 ? 91.787  7.928   -8.170  1.00 61.66  ?  330  LEU A N     1 
ATOM   1952 C  CA    . LEU A 1 263 ? 90.433  8.448   -8.307  1.00 61.07  ?  330  LEU A CA    1 
ATOM   1953 C  C     . LEU A 1 263 ? 90.169  8.819   -9.763  1.00 63.55  ?  330  LEU A C     1 
ATOM   1954 O  O     . LEU A 1 263 ? 90.846  9.687   -10.322 1.00 73.01  ?  330  LEU A O     1 
ATOM   1955 C  CB    . LEU A 1 263 ? 90.243  9.660   -7.398  1.00 52.88  ?  330  LEU A CB    1 
ATOM   1956 C  CG    . LEU A 1 263 ? 88.854  10.302  -7.423  1.00 61.06  ?  330  LEU A CG    1 
ATOM   1957 C  CD1   . LEU A 1 263 ? 87.804  9.348   -6.873  1.00 65.48  ?  330  LEU A CD1   1 
ATOM   1958 C  CD2   . LEU A 1 263 ? 88.857  11.603  -6.644  1.00 58.62  ?  330  LEU A CD2   1 
ATOM   1959 N  N     . VAL A 1 264 ? 89.175  8.172   -10.370 1.00 58.67  ?  331  VAL A N     1 
ATOM   1960 C  CA    . VAL A 1 264 ? 88.840  8.395   -11.772 1.00 58.73  ?  331  VAL A CA    1 
ATOM   1961 C  C     . VAL A 1 264 ? 87.448  8.972   -11.957 1.00 60.97  ?  331  VAL A C     1 
ATOM   1962 O  O     . VAL A 1 264 ? 87.144  9.477   -13.050 1.00 64.03  ?  331  VAL A O     1 
ATOM   1963 C  CB    . VAL A 1 264 ? 88.988  7.098   -12.600 1.00 65.96  ?  331  VAL A CB    1 
ATOM   1964 C  CG1   . VAL A 1 264 ? 90.462  6.748   -12.760 1.00 66.31  ?  331  VAL A CG1   1 
ATOM   1965 C  CG2   . VAL A 1 264 ? 88.240  5.950   -11.939 1.00 65.23  ?  331  VAL A CG2   1 
ATOM   1966 N  N     . VAL A 1 265 ? 86.587  8.917   -10.943 1.00 61.18  ?  332  VAL A N     1 
ATOM   1967 C  CA    . VAL A 1 265 ? 85.315  9.630   -10.970 1.00 58.93  ?  332  VAL A CA    1 
ATOM   1968 C  C     . VAL A 1 265 ? 85.017  10.129  -9.558  1.00 59.12  ?  332  VAL A C     1 
ATOM   1969 O  O     . VAL A 1 265 ? 84.908  9.334   -8.619  1.00 60.60  ?  332  VAL A O     1 
ATOM   1970 C  CB    . VAL A 1 265 ? 84.170  8.747   -11.505 1.00 56.96  ?  332  VAL A CB    1 
ATOM   1971 C  CG1   . VAL A 1 265 ? 82.872  9.552   -11.597 1.00 62.75  ?  332  VAL A CG1   1 
ATOM   1972 C  CG2   . VAL A 1 265 ? 84.523  8.151   -12.866 1.00 53.24  ?  332  VAL A CG2   1 
ATOM   1973 N  N     . ASP A 1 266 ? 84.891  11.444  -9.401  1.00 65.58  ?  333  ASP A N     1 
ATOM   1974 C  CA    . ASP A 1 266 ? 84.732  12.025  -8.079  1.00 72.72  ?  333  ASP A CA    1 
ATOM   1975 C  C     . ASP A 1 266 ? 83.257  12.052  -7.677  1.00 69.49  ?  333  ASP A C     1 
ATOM   1976 O  O     . ASP A 1 266 ? 82.372  11.593  -8.403  1.00 61.92  ?  333  ASP A O     1 
ATOM   1977 C  CB    . ASP A 1 266 ? 85.342  13.425  -8.037  1.00 89.64  ?  333  ASP A CB    1 
ATOM   1978 C  CG    . ASP A 1 266 ? 84.698  14.372  -9.030  1.00 98.01  ?  333  ASP A CG    1 
ATOM   1979 O  OD1   . ASP A 1 266 ? 83.820  13.923  -9.797  1.00 91.35  ?  333  ASP A OD1   1 
ATOM   1980 O  OD2   . ASP A 1 266 ? 85.071  15.564  -9.046  1.00 99.14  ?  333  ASP A OD2   1 
ATOM   1981 N  N     . GLU A 1 267 ? 82.995  12.612  -6.493  1.00 73.00  ?  334  GLU A N     1 
ATOM   1982 C  CA    . GLU A 1 267 ? 81.648  12.597  -5.933  1.00 70.78  ?  334  GLU A CA    1 
ATOM   1983 C  C     . GLU A 1 267 ? 80.638  13.242  -6.872  1.00 77.74  ?  334  GLU A C     1 
ATOM   1984 O  O     . GLU A 1 267 ? 79.466  12.851  -6.885  1.00 81.02  ?  334  GLU A O     1 
ATOM   1985 C  CB    . GLU A 1 267 ? 81.623  13.319  -4.582  1.00 82.70  ?  334  GLU A CB    1 
ATOM   1986 C  CG    . GLU A 1 267 ? 82.863  13.125  -3.718  1.00 99.08  ?  334  GLU A CG    1 
ATOM   1987 C  CD    . GLU A 1 267 ? 83.903  14.216  -3.926  1.00 106.99 ?  334  GLU A CD    1 
ATOM   1988 O  OE1   . GLU A 1 267 ? 83.871  14.879  -4.985  1.00 109.64 ?  334  GLU A OE1   1 
ATOM   1989 O  OE2   . GLU A 1 267 ? 84.752  14.412  -3.030  1.00 103.39 ?  334  GLU A OE2   1 
ATOM   1990 N  N     . ASN A 1 268 ? 81.065  14.229  -7.655  1.00 92.10  ?  335  ASN A N     1 
ATOM   1991 C  CA    . ASN A 1 268 ? 80.165  14.979  -8.519  1.00 95.86  ?  335  ASN A CA    1 
ATOM   1992 C  C     . ASN A 1 268 ? 80.005  14.353  -9.898  1.00 90.19  ?  335  ASN A C     1 
ATOM   1993 O  O     . ASN A 1 268 ? 79.307  14.923  -10.743 1.00 88.26  ?  335  ASN A O     1 
ATOM   1994 C  CB    . ASN A 1 268 ? 80.664  16.421  -8.660  1.00 102.06 ?  335  ASN A CB    1 
ATOM   1995 C  CG    . ASN A 1 268 ? 81.005  17.051  -7.320  1.00 109.20 ?  335  ASN A CG    1 
ATOM   1996 O  OD1   . ASN A 1 268 ? 80.123  17.514  -6.595  1.00 87.90  ?  335  ASN A OD1   1 
ATOM   1997 N  ND2   . ASN A 1 268 ? 82.292  17.070  -6.985  1.00 92.48  ?  335  ASN A ND2   1 
ATOM   1998 N  N     . GLY A 1 269 ? 80.627  13.204  -10.147 1.00 82.62  ?  336  GLY A N     1 
ATOM   1999 C  CA    . GLY A 1 269 ? 80.478  12.533  -11.422 1.00 80.22  ?  336  GLY A CA    1 
ATOM   2000 C  C     . GLY A 1 269 ? 81.402  13.020  -12.510 1.00 89.37  ?  336  GLY A C     1 
ATOM   2001 O  O     . GLY A 1 269 ? 81.171  12.710  -13.684 1.00 85.81  ?  336  GLY A O     1 
ATOM   2002 N  N     . ASP A 1 270 ? 82.445  13.768  -12.163 1.00 96.89  ?  337  ASP A N     1 
ATOM   2003 C  CA    . ASP A 1 270 ? 83.380  14.300  -13.146 1.00 100.54 ?  337  ASP A CA    1 
ATOM   2004 C  C     . ASP A 1 270 ? 84.511  13.302  -13.364 1.00 86.67  ?  337  ASP A C     1 
ATOM   2005 O  O     . ASP A 1 270 ? 85.217  12.936  -12.418 1.00 77.75  ?  337  ASP A O     1 
ATOM   2006 C  CB    . ASP A 1 270 ? 83.937  15.649  -12.690 1.00 114.28 ?  337  ASP A CB    1 
ATOM   2007 C  CG    . ASP A 1 270 ? 82.865  16.716  -12.579 1.00 105.06 ?  337  ASP A CG    1 
ATOM   2008 O  OD1   . ASP A 1 270 ? 81.888  16.666  -13.357 1.00 102.12 -1 337  ASP A OD1   1 
ATOM   2009 O  OD2   . ASP A 1 270 ? 83.001  17.606  -11.713 1.00 91.62  ?  337  ASP A OD2   1 
ATOM   2010 N  N     . PHE A 1 271 ? 84.680  12.865  -14.609 1.00 86.16  ?  338  PHE A N     1 
ATOM   2011 C  CA    . PHE A 1 271 ? 85.757  11.947  -14.949 1.00 74.40  ?  338  PHE A CA    1 
ATOM   2012 C  C     . PHE A 1 271 ? 87.105  12.646  -14.823 1.00 82.11  ?  338  PHE A C     1 
ATOM   2013 O  O     . PHE A 1 271 ? 87.272  13.790  -15.254 1.00 94.89  ?  338  PHE A O     1 
ATOM   2014 C  CB    . PHE A 1 271 ? 85.564  11.417  -16.370 1.00 79.75  ?  338  PHE A CB    1 
ATOM   2015 C  CG    . PHE A 1 271 ? 86.610  10.430  -16.802 1.00 84.73  ?  338  PHE A CG    1 
ATOM   2016 C  CD1   . PHE A 1 271 ? 86.570  9.119   -16.360 1.00 90.50  ?  338  PHE A CD1   1 
ATOM   2017 C  CD2   . PHE A 1 271 ? 87.624  10.809  -17.665 1.00 92.28  ?  338  PHE A CD2   1 
ATOM   2018 C  CE1   . PHE A 1 271 ? 87.530  8.206   -16.762 1.00 91.15  ?  338  PHE A CE1   1 
ATOM   2019 C  CE2   . PHE A 1 271 ? 88.584  9.900   -18.071 1.00 97.28  ?  338  PHE A CE2   1 
ATOM   2020 C  CZ    . PHE A 1 271 ? 88.536  8.598   -17.618 1.00 94.60  ?  338  PHE A CZ    1 
ATOM   2021 N  N     . ARG A 1 272 ? 88.070  11.951  -14.222 1.00 83.03  ?  339  ARG A N     1 
ATOM   2022 C  CA    . ARG A 1 272 ? 89.417  12.483  -14.014 1.00 79.70  ?  339  ARG A CA    1 
ATOM   2023 C  C     . ARG A 1 272 ? 90.337  11.839  -15.047 1.00 86.60  ?  339  ARG A C     1 
ATOM   2024 O  O     . ARG A 1 272 ? 90.956  10.804  -14.798 1.00 89.16  ?  339  ARG A O     1 
ATOM   2025 C  CB    . ARG A 1 272 ? 89.896  12.214  -12.592 1.00 77.91  ?  339  ARG A CB    1 
ATOM   2026 C  CG    . ARG A 1 272 ? 89.017  12.819  -11.509 1.00 78.35  ?  339  ARG A CG    1 
ATOM   2027 C  CD    . ARG A 1 272 ? 89.097  14.335  -11.495 1.00 84.08  ?  339  ARG A CD    1 
ATOM   2028 N  NE    . ARG A 1 272 ? 88.405  14.905  -10.341 1.00 90.60  ?  339  ARG A NE    1 
ATOM   2029 C  CZ    . ARG A 1 272 ? 88.941  15.038  -9.131  1.00 91.31  ?  339  ARG A CZ    1 
ATOM   2030 N  NH1   . ARG A 1 272 ? 90.186  14.639  -8.897  1.00 76.58  ?  339  ARG A NH1   1 
ATOM   2031 N  NH2   . ARG A 1 272 ? 88.227  15.569  -8.147  1.00 88.48  ?  339  ARG A NH2   1 
ATOM   2032 N  N     . GLU A 1 273 ? 90.431  12.470  -16.220 1.00 94.15  ?  340  GLU A N     1 
ATOM   2033 C  CA    . GLU A 1 273 ? 91.236  11.910  -17.300 1.00 91.37  ?  340  GLU A CA    1 
ATOM   2034 C  C     . GLU A 1 273 ? 92.716  11.886  -16.943 1.00 91.37  ?  340  GLU A C     1 
ATOM   2035 O  O     . GLU A 1 273 ? 93.467  11.064  -17.480 1.00 88.26  ?  340  GLU A O     1 
ATOM   2036 C  CB    . GLU A 1 273 ? 91.006  12.709  -18.583 1.00 94.87  ?  340  GLU A CB    1 
ATOM   2037 C  CG    . GLU A 1 273 ? 91.280  11.930  -19.859 1.00 91.57  ?  340  GLU A CG    1 
ATOM   2038 C  CD    . GLU A 1 273 ? 90.757  12.640  -21.092 1.00 99.72  ?  340  GLU A CD    1 
ATOM   2039 O  OE1   . GLU A 1 273 ? 90.523  13.865  -21.021 1.00 99.00  ?  340  GLU A OE1   1 
ATOM   2040 O  OE2   . GLU A 1 273 ? 90.573  11.972  -22.131 1.00 97.71  -1 340  GLU A OE2   1 
ATOM   2041 N  N     . ASP A 1 274 ? 93.154  12.767  -16.042 1.00 91.10  ?  341  ASP A N     1 
ATOM   2042 C  CA    . ASP A 1 274 ? 94.552  12.771  -15.627 1.00 93.93  ?  341  ASP A CA    1 
ATOM   2043 C  C     . ASP A 1 274 ? 94.876  11.538  -14.789 1.00 96.94  ?  341  ASP A C     1 
ATOM   2044 O  O     . ASP A 1 274 ? 95.789  10.771  -15.115 1.00 91.45  ?  341  ASP A O     1 
ATOM   2045 C  CB    . ASP A 1 274 ? 94.869  14.054  -14.854 1.00 112.35 ?  341  ASP A CB    1 
ATOM   2046 C  CG    . ASP A 1 274 ? 93.908  14.302  -13.707 1.00 115.30 ?  341  ASP A CG    1 
ATOM   2047 O  OD1   . ASP A 1 274 ? 92.684  14.149  -13.908 1.00 105.10 ?  341  ASP A OD1   1 
ATOM   2048 O  OD2   . ASP A 1 274 ? 94.379  14.645  -12.602 1.00 114.33 ?  341  ASP A OD2   1 
ATOM   2049 N  N     . ASN A 1 275 ? 94.129  11.327  -13.702 1.00 101.36 ?  342  ASN A N     1 
ATOM   2050 C  CA    . ASN A 1 275 ? 94.380  10.172  -12.847 1.00 91.57  ?  342  ASN A CA    1 
ATOM   2051 C  C     . ASN A 1 275 ? 94.163  8.865   -13.597 1.00 85.69  ?  342  ASN A C     1 
ATOM   2052 O  O     . ASN A 1 275 ? 94.809  7.858   -13.288 1.00 84.34  ?  342  ASN A O     1 
ATOM   2053 C  CB    . ASN A 1 275 ? 93.482  10.226  -11.612 1.00 82.41  ?  342  ASN A CB    1 
ATOM   2054 C  CG    . ASN A 1 275 ? 93.794  11.406  -10.713 1.00 80.17  ?  342  ASN A CG    1 
ATOM   2055 O  OD1   . ASN A 1 275 ? 94.912  11.921  -10.709 1.00 83.22  ?  342  ASN A OD1   1 
ATOM   2056 N  ND2   . ASN A 1 275 ? 92.804  11.838  -9.941  1.00 82.69  ?  342  ASN A ND2   1 
ATOM   2057 N  N     . PHE A 1 276 ? 93.261  8.858   -14.581 1.00 90.98  ?  343  PHE A N     1 
ATOM   2058 C  CA    . PHE A 1 276 ? 93.026  7.646   -15.360 1.00 101.81 ?  343  PHE A CA    1 
ATOM   2059 C  C     . PHE A 1 276 ? 94.287  7.226   -16.104 1.00 102.75 ?  343  PHE A C     1 
ATOM   2060 O  O     . PHE A 1 276 ? 94.739  6.081   -15.989 1.00 101.59 ?  343  PHE A O     1 
ATOM   2061 C  CB    . PHE A 1 276 ? 91.870  7.868   -16.337 1.00 97.42  ?  343  PHE A CB    1 
ATOM   2062 C  CG    . PHE A 1 276 ? 91.524  6.653   -17.149 1.00 104.58 ?  343  PHE A CG    1 
ATOM   2063 C  CD1   . PHE A 1 276 ? 90.540  5.777   -16.723 1.00 103.01 ?  343  PHE A CD1   1 
ATOM   2064 C  CD2   . PHE A 1 276 ? 92.183  6.384   -18.337 1.00 113.49 ?  343  PHE A CD2   1 
ATOM   2065 C  CE1   . PHE A 1 276 ? 90.220  4.658   -17.467 1.00 114.38 ?  343  PHE A CE1   1 
ATOM   2066 C  CE2   . PHE A 1 276 ? 91.868  5.266   -19.083 1.00 110.57 ?  343  PHE A CE2   1 
ATOM   2067 C  CZ    . PHE A 1 276 ? 90.885  4.403   -18.649 1.00 107.70 ?  343  PHE A CZ    1 
ATOM   2068 N  N     . ASN A 1 277 ? 94.869  8.144   -16.879 1.00 109.46 ?  344  ASN A N     1 
ATOM   2069 C  CA    . ASN A 1 277 ? 96.103  7.833   -17.593 1.00 101.24 ?  344  ASN A CA    1 
ATOM   2070 C  C     . ASN A 1 277 ? 97.230  7.512   -16.621 1.00 91.40  ?  344  ASN A C     1 
ATOM   2071 O  O     . ASN A 1 277 ? 98.046  6.619   -16.877 1.00 91.20  ?  344  ASN A O     1 
ATOM   2072 C  CB    . ASN A 1 277 ? 96.487  9.000   -18.501 1.00 94.70  ?  344  ASN A CB    1 
ATOM   2073 C  CG    . ASN A 1 277 ? 95.463  9.248   -19.590 1.00 101.57 ?  344  ASN A CG    1 
ATOM   2074 O  OD1   . ASN A 1 277 ? 94.952  8.309   -20.201 1.00 104.21 ?  344  ASN A OD1   1 
ATOM   2075 N  ND2   . ASN A 1 277 ? 95.152  10.515  -19.835 1.00 101.37 ?  344  ASN A ND2   1 
ATOM   2076 N  N     . THR A 1 278 ? 97.291  8.231   -15.497 1.00 87.13  ?  345  THR A N     1 
ATOM   2077 C  CA    . THR A 1 278 ? 98.259  7.896   -14.459 1.00 87.60  ?  345  THR A CA    1 
ATOM   2078 C  C     . THR A 1 278 ? 98.072  6.465   -13.972 1.00 97.43  ?  345  THR A C     1 
ATOM   2079 O  O     . THR A 1 278 ? 99.048  5.801   -13.604 1.00 91.88  ?  345  THR A O     1 
ATOM   2080 C  CB    . THR A 1 278 ? 98.132  8.871   -13.287 1.00 84.96  ?  345  THR A CB    1 
ATOM   2081 O  OG1   . THR A 1 278 ? 98.245  10.217  -13.767 1.00 96.88  ?  345  THR A OG1   1 
ATOM   2082 C  CG2   . THR A 1 278 ? 99.219  8.613   -12.250 1.00 76.69  ?  345  THR A CG2   1 
ATOM   2083 N  N     . ALA A 1 279 ? 96.830  5.974   -13.958 1.00 97.03  ?  346  ALA A N     1 
ATOM   2084 C  CA    . ALA A 1 279 ? 96.590  4.585   -13.585 1.00 99.02  ?  346  ALA A CA    1 
ATOM   2085 C  C     . ALA A 1 279 ? 97.060  3.637   -14.681 1.00 96.85  ?  346  ALA A C     1 
ATOM   2086 O  O     . ALA A 1 279 ? 97.682  2.607   -14.395 1.00 94.15  ?  346  ALA A O     1 
ATOM   2087 C  CB    . ALA A 1 279 ? 95.107  4.370   -13.286 1.00 99.04  ?  346  ALA A CB    1 
ATOM   2088 N  N     . MET A 1 280 ? 96.775  3.968   -15.943 1.00 93.56  ?  347  MET A N     1 
ATOM   2089 C  CA    . MET A 1 280 ? 97.271  3.155   -17.047 1.00 99.87  ?  347  MET A CA    1 
ATOM   2090 C  C     . MET A 1 280 ? 98.791  3.194   -17.121 1.00 106.80 ?  347  MET A C     1 
ATOM   2091 O  O     . MET A 1 280 ? 99.417  2.223   -17.563 1.00 101.20 ?  347  MET A O     1 
ATOM   2092 C  CB    . MET A 1 280 ? 96.666  3.634   -18.366 1.00 91.30  ?  347  MET A CB    1 
ATOM   2093 C  CG    . MET A 1 280 ? 95.145  3.683   -18.379 1.00 113.38 ?  347  MET A CG    1 
ATOM   2094 S  SD    . MET A 1 280 ? 94.373  2.168   -17.777 1.00 112.10 ?  347  MET A SD    1 
ATOM   2095 C  CE    . MET A 1 280 ? 95.211  0.939   -18.771 1.00 108.78 ?  347  MET A CE    1 
ATOM   2096 N  N     . GLN A 1 281 ? 99.400  4.305   -16.698 1.00 102.51 ?  348  GLN A N     1 
ATOM   2097 C  CA    . GLN A 1 281 ? 100.856 4.385   -16.647 1.00 102.74 ?  348  GLN A CA    1 
ATOM   2098 C  C     . GLN A 1 281 ? 101.443 3.217   -15.866 1.00 101.20 ?  348  GLN A C     1 
ATOM   2099 O  O     . GLN A 1 281 ? 102.430 2.606   -16.292 1.00 111.38 ?  348  GLN A O     1 
ATOM   2100 C  CB    . GLN A 1 281 ? 101.280 5.715   -16.020 1.00 102.81 ?  348  GLN A CB    1 
ATOM   2101 C  CG    . GLN A 1 281 ? 102.772 5.844   -15.731 1.00 99.89  ?  348  GLN A CG    1 
ATOM   2102 C  CD    . GLN A 1 281 ? 103.101 7.110   -14.961 1.00 109.17 ?  348  GLN A CD    1 
ATOM   2103 O  OE1   . GLN A 1 281 ? 102.279 8.022   -14.865 1.00 104.67 ?  348  GLN A OE1   1 
ATOM   2104 N  NE2   . GLN A 1 281 ? 104.304 7.167   -14.401 1.00 109.43 ?  348  GLN A NE2   1 
ATOM   2105 N  N     . VAL A 1 282 ? 100.849 2.894   -14.714 1.00 94.09  ?  349  VAL A N     1 
ATOM   2106 C  CA    . VAL A 1 282 ? 101.349 1.801   -13.891 1.00 93.02  ?  349  VAL A CA    1 
ATOM   2107 C  C     . VAL A 1 282 ? 101.348 0.487   -14.657 1.00 97.30  ?  349  VAL A C     1 
ATOM   2108 O  O     . VAL A 1 282 ? 102.099 -0.431  -14.312 1.00 99.55  ?  349  VAL A O     1 
ATOM   2109 C  CB    . VAL A 1 282 ? 100.516 1.691   -12.596 1.00 93.74  ?  349  VAL A CB    1 
ATOM   2110 C  CG1   . VAL A 1 282 ? 101.018 0.547   -11.730 1.00 89.76  ?  349  VAL A CG1   1 
ATOM   2111 C  CG2   . VAL A 1 282 ? 100.560 3.003   -11.823 1.00 91.80  ?  349  VAL A CG2   1 
ATOM   2112 N  N     . LEU A 1 283 ? 100.518 0.369   -15.693 1.00 97.86  ?  350  LEU A N     1 
ATOM   2113 C  CA    . LEU A 1 283 ? 100.544 -0.801  -16.561 1.00 103.40 ?  350  LEU A CA    1 
ATOM   2114 C  C     . LEU A 1 283 ? 101.528 -0.616  -17.713 1.00 112.34 ?  350  LEU A C     1 
ATOM   2115 O  O     . LEU A 1 283 ? 102.415 -1.451  -17.916 1.00 109.98 ?  350  LEU A O     1 
ATOM   2116 C  CB    . LEU A 1 283 ? 99.140  -1.087  -17.104 1.00 106.70 ?  350  LEU A CB    1 
ATOM   2117 C  CG    . LEU A 1 283 ? 98.064  -1.430  -16.071 1.00 99.44  ?  350  LEU A CG    1 
ATOM   2118 C  CD1   . LEU A 1 283 ? 96.742  -1.703  -16.764 1.00 107.17 ?  350  LEU A CD1   1 
ATOM   2119 C  CD2   . LEU A 1 283 ? 98.473  -2.623  -15.218 1.00 95.10  ?  350  LEU A CD2   1 
ATOM   2120 N  N     . ARG A 1 284 ? 101.387 0.471   -18.464 1.00 116.64 ?  351  ARG A N     1 
ATOM   2121 C  CA    . ARG A 1 284 ? 102.285 0.762   -19.575 1.00 115.20 ?  351  ARG A CA    1 
ATOM   2122 C  C     . ARG A 1 284 ? 103.662 1.181   -19.066 1.00 102.20 ?  351  ARG A C     1 
ATOM   2123 O  O     . ARG A 1 284 ? 104.346 0.413   -18.388 1.00 87.40  ?  351  ARG A O     1 
ATOM   2124 C  CB    . ARG A 1 284 ? 101.696 1.859   -20.465 1.00 84.98  ?  351  ARG A CB    1 
ATOM   2125 N  N     . GLY A 1 303 ? 93.836  -12.523 -10.626 1.00 89.53  ?  370  GLY A N     1 
ATOM   2126 C  CA    . GLY A 1 303 ? 95.058  -12.108 -9.961  1.00 104.23 ?  370  GLY A CA    1 
ATOM   2127 C  C     . GLY A 1 303 ? 95.002  -12.331 -8.462  1.00 118.69 ?  370  GLY A C     1 
ATOM   2128 O  O     . GLY A 1 303 ? 94.809  -11.382 -7.702  1.00 111.32 ?  370  GLY A O     1 
ATOM   2129 N  N     . PRO A 1 304 ? 95.171  -13.590 -8.037  1.00 117.24 ?  371  PRO A N     1 
ATOM   2130 C  CA    . PRO A 1 304 ? 95.074  -13.920 -6.607  1.00 118.11 ?  371  PRO A CA    1 
ATOM   2131 C  C     . PRO A 1 304 ? 95.787  -12.951 -5.674  1.00 102.58 ?  371  PRO A C     1 
ATOM   2132 O  O     . PRO A 1 304 ? 95.139  -12.305 -4.843  1.00 87.68  ?  371  PRO A O     1 
ATOM   2133 C  CB    . PRO A 1 304 ? 95.704  -15.317 -6.546  1.00 120.20 ?  371  PRO A CB    1 
ATOM   2134 C  CG    . PRO A 1 304 ? 95.340  -15.925 -7.858  1.00 114.11 ?  371  PRO A CG    1 
ATOM   2135 C  CD    . PRO A 1 304 ? 95.351  -14.796 -8.866  1.00 101.78 ?  371  PRO A CD    1 
ATOM   2136 N  N     . SER A 1 305 ? 97.112  -12.843 -5.790  1.00 105.85 ?  372  SER A N     1 
ATOM   2137 C  CA    . SER A 1 305 ? 97.869  -12.024 -4.847  1.00 98.42  ?  372  SER A CA    1 
ATOM   2138 C  C     . SER A 1 305 ? 97.406  -10.572 -4.880  1.00 95.03  ?  372  SER A C     1 
ATOM   2139 O  O     . SER A 1 305 ? 97.340  -9.910  -3.838  1.00 77.89  ?  372  SER A O     1 
ATOM   2140 C  CB    . SER A 1 305 ? 99.364  -12.118 -5.151  1.00 95.63  ?  372  SER A CB    1 
ATOM   2141 O  OG    . SER A 1 305 ? 100.134 -11.639 -4.062  1.00 85.96  ?  372  SER A OG    1 
ATOM   2142 N  N     . ASN A 1 306 ? 97.083  -10.057 -6.070  1.00 100.46 ?  373  ASN A N     1 
ATOM   2143 C  CA    . ASN A 1 306 ? 96.577  -8.692  -6.167  1.00 101.91 ?  373  ASN A CA    1 
ATOM   2144 C  C     . ASN A 1 306 ? 95.277  -8.530  -5.388  1.00 87.25  ?  373  ASN A C     1 
ATOM   2145 O  O     . ASN A 1 306 ? 95.031  -7.477  -4.789  1.00 79.78  ?  373  ASN A O     1 
ATOM   2146 C  CB    . ASN A 1 306 ? 96.370  -8.308  -7.634  1.00 116.30 ?  373  ASN A CB    1 
ATOM   2147 C  CG    . ASN A 1 306 ? 97.590  -7.638  -8.243  1.00 108.18 ?  373  ASN A CG    1 
ATOM   2148 O  OD1   . ASN A 1 306 ? 98.318  -6.910  -7.567  1.00 95.69  ?  373  ASN A OD1   1 
ATOM   2149 N  ND2   . ASN A 1 306 ? 97.815  -7.878  -9.529  1.00 111.05 ?  373  ASN A ND2   1 
ATOM   2150 N  N     . VAL A 1 307 ? 94.432  -9.564  -5.383  1.00 81.31  ?  374  VAL A N     1 
ATOM   2151 C  CA    . VAL A 1 307 ? 93.158  -9.479  -4.676  1.00 73.92  ?  374  VAL A CA    1 
ATOM   2152 C  C     . VAL A 1 307 ? 93.384  -9.380  -3.173  1.00 66.15  ?  374  VAL A C     1 
ATOM   2153 O  O     . VAL A 1 307 ? 92.721  -8.595  -2.485  1.00 53.17  ?  374  VAL A O     1 
ATOM   2154 C  CB    . VAL A 1 307 ? 92.265  -10.679 -5.040  1.00 69.44  ?  374  VAL A CB    1 
ATOM   2155 C  CG1   . VAL A 1 307 ? 91.124  -10.829 -4.041  1.00 56.17  ?  374  VAL A CG1   1 
ATOM   2156 C  CG2   . VAL A 1 307 ? 91.713  -10.511 -6.445  1.00 69.59  ?  374  VAL A CG2   1 
ATOM   2157 N  N     . PHE A 1 308 ? 94.314  -10.173 -2.634  1.00 65.51  ?  375  PHE A N     1 
ATOM   2158 C  CA    . PHE A 1 308 ? 94.607  -10.096 -1.206  1.00 63.06  ?  375  PHE A CA    1 
ATOM   2159 C  C     . PHE A 1 308 ? 95.147  -8.721  -0.835  1.00 60.56  ?  375  PHE A C     1 
ATOM   2160 O  O     . PHE A 1 308 ? 94.737  -8.129  0.170   1.00 52.07  ?  375  PHE A O     1 
ATOM   2161 C  CB    . PHE A 1 308 ? 95.607  -11.182 -0.808  1.00 63.83  ?  375  PHE A CB    1 
ATOM   2162 C  CG    . PHE A 1 308 ? 95.972  -11.157 0.652   1.00 61.48  ?  375  PHE A CG    1 
ATOM   2163 C  CD1   . PHE A 1 308 ? 96.988  -10.336 1.115   1.00 53.87  ?  375  PHE A CD1   1 
ATOM   2164 C  CD2   . PHE A 1 308 ? 95.293  -11.948 1.562   1.00 64.66  ?  375  PHE A CD2   1 
ATOM   2165 C  CE1   . PHE A 1 308 ? 97.318  -10.307 2.456   1.00 46.39  ?  375  PHE A CE1   1 
ATOM   2166 C  CE2   . PHE A 1 308 ? 95.622  -11.923 2.904   1.00 59.63  ?  375  PHE A CE2   1 
ATOM   2167 C  CZ    . PHE A 1 308 ? 96.635  -11.103 3.350   1.00 48.51  ?  375  PHE A CZ    1 
ATOM   2168 N  N     . LYS A 1 309 ? 96.082  -8.202  -1.633  1.00 58.46  ?  376  LYS A N     1 
ATOM   2169 C  CA    . LYS A 1 309 ? 96.648  -6.886  -1.357  1.00 54.93  ?  376  LYS A CA    1 
ATOM   2170 C  C     . LYS A 1 309 ? 95.554  -5.831  -1.269  1.00 59.17  ?  376  LYS A C     1 
ATOM   2171 O  O     . LYS A 1 309 ? 95.471  -5.088  -0.284  1.00 54.83  ?  376  LYS A O     1 
ATOM   2172 C  CB    . LYS A 1 309 ? 97.667  -6.519  -2.438  1.00 65.88  ?  376  LYS A CB    1 
ATOM   2173 C  CG    . LYS A 1 309 ? 98.233  -5.111  -2.318  1.00 88.90  ?  376  LYS A CG    1 
ATOM   2174 C  CD    . LYS A 1 309 ? 99.317  -4.854  -3.356  1.00 100.85 ?  376  LYS A CD    1 
ATOM   2175 C  CE    . LYS A 1 309 ? 99.826  -3.420  -3.293  1.00 104.55 ?  376  LYS A CE    1 
ATOM   2176 N  NZ    . LYS A 1 309 ? 100.437 -3.090  -1.974  1.00 120.76 ?  376  LYS A NZ    1 
ATOM   2177 N  N     . ILE A 1 310 ? 94.694  -5.756  -2.288  1.00 59.90  ?  377  ILE A N     1 
ATOM   2178 C  CA    . ILE A 1 310 ? 93.680  -4.706  -2.320  1.00 60.70  ?  377  ILE A CA    1 
ATOM   2179 C  C     . ILE A 1 310 ? 92.685  -4.890  -1.182  1.00 45.39  ?  377  ILE A C     1 
ATOM   2180 O  O     . ILE A 1 310 ? 92.283  -3.919  -0.531  1.00 45.25  ?  377  ILE A O     1 
ATOM   2181 C  CB    . ILE A 1 310 ? 92.977  -4.670  -3.691  1.00 62.11  ?  377  ILE A CB    1 
ATOM   2182 C  CG1   . ILE A 1 310 ? 91.919  -3.562  -3.732  1.00 54.00  ?  377  ILE A CG1   1 
ATOM   2183 C  CG2   . ILE A 1 310 ? 92.311  -6.001  -4.001  1.00 72.38  ?  377  ILE A CG2   1 
ATOM   2184 C  CD1   . ILE A 1 310 ? 92.450  -2.185  -3.409  1.00 63.04  ?  377  ILE A CD1   1 
ATOM   2185 N  N     . VAL A 1 311 ? 92.271  -6.130  -0.917  1.00 49.54  ?  378  VAL A N     1 
ATOM   2186 C  CA    . VAL A 1 311 ? 91.330  -6.368  0.174   1.00 47.90  ?  378  VAL A CA    1 
ATOM   2187 C  C     . VAL A 1 311 ? 91.936  -5.906  1.492   1.00 46.66  ?  378  VAL A C     1 
ATOM   2188 O  O     . VAL A 1 311 ? 91.303  -5.175  2.258   1.00 44.34  ?  378  VAL A O     1 
ATOM   2189 C  CB    . VAL A 1 311 ? 90.918  -7.850  0.225   1.00 52.70  ?  378  VAL A CB    1 
ATOM   2190 C  CG1   . VAL A 1 311 ? 90.147  -8.149  1.507   1.00 48.85  ?  378  VAL A CG1   1 
ATOM   2191 C  CG2   . VAL A 1 311 ? 90.067  -8.198  -0.986  1.00 56.31  ?  378  VAL A CG2   1 
ATOM   2192 N  N     . LYS A 1 312 ? 93.182  -6.306  1.762   1.00 51.35  ?  379  LYS A N     1 
ATOM   2193 C  CA    . LYS A 1 312 ? 93.846  -5.893  2.995   1.00 49.48  ?  379  LYS A CA    1 
ATOM   2194 C  C     . LYS A 1 312 ? 93.913  -4.373  3.107   1.00 41.83  ?  379  LYS A C     1 
ATOM   2195 O  O     . LYS A 1 312 ? 93.663  -3.812  4.180   1.00 40.25  ?  379  LYS A O     1 
ATOM   2196 C  CB    . LYS A 1 312 ? 95.246  -6.504  3.061   1.00 50.01  ?  379  LYS A CB    1 
ATOM   2197 C  CG    . LYS A 1 312 ? 96.096  -6.001  4.219   1.00 61.50  ?  379  LYS A CG    1 
ATOM   2198 C  CD    . LYS A 1 312 ? 97.108  -7.050  4.658   1.00 78.70  ?  379  LYS A CD    1 
ATOM   2199 C  CE    . LYS A 1 312 ? 98.212  -6.454  5.519   1.00 78.28  ?  379  LYS A CE    1 
ATOM   2200 N  NZ    . LYS A 1 312 ? 99.198  -5.677  4.714   1.00 90.69  ?  379  LYS A NZ    1 
ATOM   2201 N  N     . MET A 1 313 ? 94.249  -3.689  2.010   1.00 40.16  ?  380  MET A N     1 
ATOM   2202 C  CA    . MET A 1 313 ? 94.232  -2.229  2.014   1.00 44.56  ?  380  MET A CA    1 
ATOM   2203 C  C     . MET A 1 313 ? 92.858  -1.697  2.404   1.00 43.28  ?  380  MET A C     1 
ATOM   2204 O  O     . MET A 1 313 ? 92.749  -0.743  3.182   1.00 42.27  ?  380  MET A O     1 
ATOM   2205 C  CB    . MET A 1 313 ? 94.631  -1.695  0.639   1.00 50.35  ?  380  MET A CB    1 
ATOM   2206 C  CG    . MET A 1 313 ? 96.091  -1.907  0.284   1.00 65.85  ?  380  MET A CG    1 
ATOM   2207 S  SD    . MET A 1 313 ? 96.434  -1.596  -1.461  1.00 79.64  ?  380  MET A SD    1 
ATOM   2208 C  CE    . MET A 1 313 ? 95.773  0.057   -1.660  1.00 71.82  ?  380  MET A CE    1 
ATOM   2209 N  N     . ILE A 1 314 ? 91.797  -2.300  1.861   1.00 43.20  ?  381  ILE A N     1 
ATOM   2210 C  CA    . ILE A 1 314 ? 90.435  -1.876  2.173   1.00 42.11  ?  381  ILE A CA    1 
ATOM   2211 C  C     . ILE A 1 314 ? 90.176  -1.978  3.670   1.00 43.34  ?  381  ILE A C     1 
ATOM   2212 O  O     . ILE A 1 314 ? 89.538  -1.104  4.271   1.00 40.29  ?  381  ILE A O     1 
ATOM   2213 C  CB    . ILE A 1 314 ? 89.434  -2.719  1.356   1.00 48.39  ?  381  ILE A CB    1 
ATOM   2214 C  CG1   . ILE A 1 314 ? 89.397  -2.229  -0.096  1.00 46.75  ?  381  ILE A CG1   1 
ATOM   2215 C  CG2   . ILE A 1 314 ? 88.034  -2.706  1.981   1.00 46.51  ?  381  ILE A CG2   1 
ATOM   2216 C  CD1   . ILE A 1 314 ? 88.686  -3.172  -1.049  1.00 47.31  ?  381  ILE A CD1   1 
ATOM   2217 N  N     A MET A 1 315 ? 90.692  -3.024  4.308   0.50 39.74  ?  382  MET A N     1 
ATOM   2218 N  N     B MET A 1 315 ? 90.653  -3.064  4.287   0.50 39.69  ?  382  MET A N     1 
ATOM   2219 C  CA    A MET A 1 315 ? 90.388  -3.227  5.719   0.50 42.68  ?  382  MET A CA    1 
ATOM   2220 C  CA    B MET A 1 315 ? 90.447  -3.297  5.713   0.50 42.69  ?  382  MET A CA    1 
ATOM   2221 C  C     A MET A 1 315 ? 91.200  -2.289  6.604   0.50 43.42  ?  382  MET A C     1 
ATOM   2222 C  C     B MET A 1 315 ? 91.183  -2.260  6.552   0.50 43.42  ?  382  MET A C     1 
ATOM   2223 O  O     A MET A 1 315 ? 90.687  -1.787  7.611   0.50 40.59  ?  382  MET A O     1 
ATOM   2224 O  O     B MET A 1 315 ? 90.607  -1.660  7.467   0.50 40.47  ?  382  MET A O     1 
ATOM   2225 C  CB    A MET A 1 315 ? 90.640  -4.683  6.103   0.50 42.62  ?  382  MET A CB    1 
ATOM   2226 C  CB    B MET A 1 315 ? 90.921  -4.711  6.065   0.50 42.76  ?  382  MET A CB    1 
ATOM   2227 C  CG    A MET A 1 315 ? 90.291  -5.667  5.000   0.50 47.67  ?  382  MET A CG    1 
ATOM   2228 C  CG    B MET A 1 315 ? 90.811  -5.100  7.535   0.50 43.34  ?  382  MET A CG    1 
ATOM   2229 S  SD    A MET A 1 315 ? 88.605  -5.542  4.354   0.50 51.10  ?  382  MET A SD    1 
ATOM   2230 S  SD    B MET A 1 315 ? 91.611  -6.689  7.887   0.50 53.59  ?  382  MET A SD    1 
ATOM   2231 C  CE    A MET A 1 315 ? 87.629  -6.020  5.774   0.50 42.49  ?  382  MET A CE    1 
ATOM   2232 C  CE    B MET A 1 315 ? 93.337  -6.223  7.807   0.50 50.78  ?  382  MET A CE    1 
ATOM   2233 N  N     . GLU A 1 316 ? 92.465  -2.039  6.251   1.00 42.21  ?  383  GLU A N     1 
ATOM   2234 C  CA    . GLU A 1 316 ? 93.273  -1.109  7.032   1.00 46.47  ?  383  GLU A CA    1 
ATOM   2235 C  C     . GLU A 1 316 ? 92.735  0.311   6.957   1.00 40.03  ?  383  GLU A C     1 
ATOM   2236 O  O     . GLU A 1 316 ? 92.895  1.084   7.908   1.00 48.01  ?  383  GLU A O     1 
ATOM   2237 C  CB    . GLU A 1 316 ? 94.720  -1.139  6.547   1.00 43.11  ?  383  GLU A CB    1 
ATOM   2238 C  CG    . GLU A 1 316 ? 95.390  -2.489  6.682   1.00 47.27  ?  383  GLU A CG    1 
ATOM   2239 C  CD    . GLU A 1 316 ? 96.777  -2.504  6.076   1.00 55.76  ?  383  GLU A CD    1 
ATOM   2240 O  OE1   . GLU A 1 316 ? 97.610  -3.325  6.515   1.00 57.23  ?  383  GLU A OE1   1 
ATOM   2241 O  OE2   . GLU A 1 316 ? 97.032  -1.690  5.162   1.00 49.58  -1 383  GLU A OE2   1 
ATOM   2242 N  N     . ARG A 1 317 ? 92.109  0.678   5.843   1.00 38.68  ?  384  ARG A N     1 
ATOM   2243 C  CA    . ARG A 1 317 ? 91.574  2.018   5.659   1.00 36.99  ?  384  ARG A CA    1 
ATOM   2244 C  C     . ARG A 1 317 ? 90.129  2.143   6.122   1.00 38.75  ?  384  ARG A C     1 
ATOM   2245 O  O     . ARG A 1 317 ? 89.493  3.167   5.857   1.00 38.18  ?  384  ARG A O     1 
ATOM   2246 C  CB    . ARG A 1 317 ? 91.692  2.423   4.189   1.00 42.57  ?  384  ARG A CB    1 
ATOM   2247 C  CG    . ARG A 1 317 ? 93.124  2.656   3.757   1.00 46.66  ?  384  ARG A CG    1 
ATOM   2248 C  CD    . ARG A 1 317 ? 93.285  2.643   2.249   1.00 58.16  ?  384  ARG A CD    1 
ATOM   2249 N  NE    . ARG A 1 317 ? 94.674  2.880   1.861   1.00 64.11  ?  384  ARG A NE    1 
ATOM   2250 C  CZ    . ARG A 1 317 ? 95.653  1.989   1.996   1.00 63.05  ?  384  ARG A CZ    1 
ATOM   2251 N  NH1   . ARG A 1 317 ? 95.404  0.793   2.515   1.00 60.91  ?  384  ARG A NH1   1 
ATOM   2252 N  NH2   . ARG A 1 317 ? 96.886  2.295   1.617   1.00 68.41  ?  384  ARG A NH2   1 
ATOM   2253 N  N     . ASN A 1 318 ? 89.604  1.136   6.818   1.00 39.08  ?  385  ASN A N     1 
ATOM   2254 C  CA    . ASN A 1 318 ? 88.227  1.152   7.307   1.00 41.98  ?  385  ASN A CA    1 
ATOM   2255 C  C     . ASN A 1 318 ? 87.244  1.412   6.169   1.00 38.86  ?  385  ASN A C     1 
ATOM   2256 O  O     . ASN A 1 318 ? 86.240  2.111   6.328   1.00 40.59  ?  385  ASN A O     1 
ATOM   2257 C  CB    . ASN A 1 318 ? 88.046  2.181   8.423   1.00 39.85  ?  385  ASN A CB    1 
ATOM   2258 C  CG    . ASN A 1 318 ? 86.717  2.022   9.146   1.00 43.24  ?  385  ASN A CG    1 
ATOM   2259 O  OD1   . ASN A 1 318 ? 86.136  0.936   9.162   1.00 41.30  ?  385  ASN A OD1   1 
ATOM   2260 N  ND2   . ASN A 1 318 ? 86.228  3.104   9.741   1.00 42.07  ?  385  ASN A ND2   1 
ATOM   2261 N  N     . PHE A 1 319 ? 87.539  0.845   5.004   1.00 42.99  ?  386  PHE A N     1 
ATOM   2262 C  CA    . PHE A 1 319 ? 86.624  0.887   3.873   1.00 48.66  ?  386  PHE A CA    1 
ATOM   2263 C  C     . PHE A 1 319 ? 85.621  -0.261  3.888   1.00 46.31  ?  386  PHE A C     1 
ATOM   2264 O  O     . PHE A 1 319 ? 84.744  -0.310  3.018   1.00 42.79  ?  386  PHE A O     1 
ATOM   2265 C  CB    . PHE A 1 319 ? 87.412  0.867   2.556   1.00 47.65  ?  386  PHE A CB    1 
ATOM   2266 C  CG    . PHE A 1 319 ? 88.119  2.161   2.234   1.00 45.64  ?  386  PHE A CG    1 
ATOM   2267 C  CD1   . PHE A 1 319 ? 87.977  3.284   3.039   1.00 49.49  ?  386  PHE A CD1   1 
ATOM   2268 C  CD2   . PHE A 1 319 ? 88.926  2.250   1.112   1.00 42.70  ?  386  PHE A CD2   1 
ATOM   2269 C  CE1   . PHE A 1 319 ? 88.628  4.464   2.728   1.00 46.60  ?  386  PHE A CE1   1 
ATOM   2270 C  CE2   . PHE A 1 319 ? 89.578  3.426   0.798   1.00 48.66  ?  386  PHE A CE2   1 
ATOM   2271 C  CZ    . PHE A 1 319 ? 89.430  4.534   1.608   1.00 56.00  ?  386  PHE A CZ    1 
ATOM   2272 N  N     . GLN A 1 320 ? 85.713  -1.170  4.854   1.00 34.25  ?  387  GLN A N     1 
ATOM   2273 C  CA    . GLN A 1 320 ? 84.762  -2.263  4.941   1.00 39.15  ?  387  GLN A CA    1 
ATOM   2274 C  C     . GLN A 1 320 ? 83.483  -1.796  5.629   1.00 41.10  ?  387  GLN A C     1 
ATOM   2275 O  O     . GLN A 1 320 ? 83.475  -0.766  6.306   1.00 42.05  ?  387  GLN A O     1 
ATOM   2276 C  CB    . GLN A 1 320 ? 85.374  -3.439  5.697   1.00 47.65  ?  387  GLN A CB    1 
ATOM   2277 C  CG    . GLN A 1 320 ? 85.648  -3.204  7.181   1.00 52.84  ?  387  GLN A CG    1 
ATOM   2278 C  CD    . GLN A 1 320 ? 87.053  -2.707  7.433   1.00 43.61  ?  387  GLN A CD    1 
ATOM   2279 O  OE1   . GLN A 1 320 ? 87.531  -1.806  6.747   1.00 49.65  ?  387  GLN A OE1   1 
ATOM   2280 N  NE2   . GLN A 1 320 ? 87.732  -3.303  8.409   1.00 41.60  ?  387  GLN A NE2   1 
ATOM   2281 N  N     . PRO A 1 321 ? 82.374  -2.544  5.475   1.00 41.24  ?  388  PRO A N     1 
ATOM   2282 C  CA    . PRO A 1 321 ? 82.216  -3.797  4.723   1.00 41.58  ?  388  PRO A CA    1 
ATOM   2283 C  C     . PRO A 1 321 ? 82.441  -3.638  3.222   1.00 39.30  ?  388  PRO A C     1 
ATOM   2284 O  O     . PRO A 1 321 ? 82.173  -2.572  2.669   1.00 41.87  ?  388  PRO A O     1 
ATOM   2285 C  CB    . PRO A 1 321 ? 80.761  -4.196  5.005   1.00 43.30  ?  388  PRO A CB    1 
ATOM   2286 C  CG    . PRO A 1 321 ? 80.391  -3.464  6.243   1.00 44.70  ?  388  PRO A CG    1 
ATOM   2287 C  CD    . PRO A 1 321 ? 81.129  -2.172  6.166   1.00 39.93  ?  388  PRO A CD    1 
ATOM   2288 N  N     . VAL A 1 322 ? 82.934  -4.691  2.577   1.00 36.47  ?  389  VAL A N     1 
ATOM   2289 C  CA    . VAL A 1 322 ? 83.221  -4.678  1.149   1.00 39.82  ?  389  VAL A CA    1 
ATOM   2290 C  C     . VAL A 1 322 ? 82.549  -5.880  0.499   1.00 46.19  ?  389  VAL A C     1 
ATOM   2291 O  O     . VAL A 1 322 ? 82.519  -6.975  1.072   1.00 35.43  ?  389  VAL A O     1 
ATOM   2292 C  CB    . VAL A 1 322 ? 84.741  -4.691  0.875   1.00 40.20  ?  389  VAL A CB    1 
ATOM   2293 C  CG1   . VAL A 1 322 ? 85.404  -5.877  1.563   1.00 41.40  ?  389  VAL A CG1   1 
ATOM   2294 C  CG2   . VAL A 1 322 ? 85.024  -4.711  -0.627  1.00 35.84  ?  389  VAL A CG2   1 
ATOM   2295 N  N     . ILE A 1 323 ? 82.002  -5.668  -0.694  1.00 41.36  ?  390  ILE A N     1 
ATOM   2296 C  CA    . ILE A 1 323 ? 81.526  -6.742  -1.558  1.00 42.82  ?  390  ILE A CA    1 
ATOM   2297 C  C     . ILE A 1 323 ? 82.518  -6.867  -2.705  1.00 43.68  ?  390  ILE A C     1 
ATOM   2298 O  O     . ILE A 1 323 ? 82.754  -5.899  -3.438  1.00 39.89  ?  390  ILE A O     1 
ATOM   2299 C  CB    . ILE A 1 323 ? 80.107  -6.472  -2.082  1.00 39.16  ?  390  ILE A CB    1 
ATOM   2300 C  CG1   . ILE A 1 323 ? 79.110  -6.423  -0.923  1.00 34.41  ?  390  ILE A CG1   1 
ATOM   2301 C  CG2   . ILE A 1 323 ? 79.695  -7.544  -3.086  1.00 38.68  ?  390  ILE A CG2   1 
ATOM   2302 C  CD1   . ILE A 1 323 ? 77.787  -5.778  -1.286  1.00 37.59  ?  390  ILE A CD1   1 
ATOM   2303 N  N     . ILE A 1 324 ? 83.103  -8.050  -2.852  1.00 41.85  ?  391  ILE A N     1 
ATOM   2304 C  CA    . ILE A 1 324 ? 84.068  -8.330  -3.909  1.00 40.00  ?  391  ILE A CA    1 
ATOM   2305 C  C     . ILE A 1 324 ? 83.340  -9.114  -4.993  1.00 45.53  ?  391  ILE A C     1 
ATOM   2306 O  O     . ILE A 1 324 ? 83.061  -10.307 -4.827  1.00 40.73  ?  391  ILE A O     1 
ATOM   2307 C  CB    . ILE A 1 324 ? 85.281  -9.109  -3.380  1.00 40.65  ?  391  ILE A CB    1 
ATOM   2308 C  CG1   . ILE A 1 324 ? 85.913  -8.383  -2.190  1.00 45.62  ?  391  ILE A CG1   1 
ATOM   2309 C  CG2   . ILE A 1 324 ? 86.310  -9.303  -4.483  1.00 45.33  ?  391  ILE A CG2   1 
ATOM   2310 C  CD1   . ILE A 1 324 ? 85.394  -8.844  -0.843  1.00 42.93  ?  391  ILE A CD1   1 
ATOM   2311 N  N     . PHE A 1 325 ? 83.034  -8.450  -6.104  1.00 41.97  ?  392  PHE A N     1 
ATOM   2312 C  CA    . PHE A 1 325 ? 82.317  -9.076  -7.208  1.00 43.33  ?  392  PHE A CA    1 
ATOM   2313 C  C     . PHE A 1 325 ? 83.304  -9.789  -8.124  1.00 48.06  ?  392  PHE A C     1 
ATOM   2314 O  O     . PHE A 1 325 ? 84.248  -9.173  -8.633  1.00 48.10  ?  392  PHE A O     1 
ATOM   2315 C  CB    . PHE A 1 325 ? 81.516  -8.043  -8.000  1.00 41.60  ?  392  PHE A CB    1 
ATOM   2316 C  CG    . PHE A 1 325 ? 80.215  -7.653  -7.354  1.00 37.71  ?  392  PHE A CG    1 
ATOM   2317 C  CD1   . PHE A 1 325 ? 79.224  -8.598  -7.133  1.00 40.76  ?  392  PHE A CD1   1 
ATOM   2318 C  CD2   . PHE A 1 325 ? 79.976  -6.339  -6.984  1.00 43.10  ?  392  PHE A CD2   1 
ATOM   2319 C  CE1   . PHE A 1 325 ? 78.025  -8.244  -6.544  1.00 45.94  ?  392  PHE A CE1   1 
ATOM   2320 C  CE2   . PHE A 1 325 ? 78.779  -5.976  -6.395  1.00 41.21  ?  392  PHE A CE2   1 
ATOM   2321 C  CZ    . PHE A 1 325 ? 77.801  -6.931  -6.176  1.00 41.44  ?  392  PHE A CZ    1 
ATOM   2322 N  N     . SER A 1 326 ? 83.082  -11.084 -8.326  1.00 47.25  ?  393  SER A N     1 
ATOM   2323 C  CA    . SER A 1 326 ? 83.797  -11.871 -9.319  1.00 52.49  ?  393  SER A CA    1 
ATOM   2324 C  C     . SER A 1 326 ? 82.771  -12.611 -10.163 1.00 53.43  ?  393  SER A C     1 
ATOM   2325 O  O     . SER A 1 326 ? 81.752  -13.076 -9.645  1.00 51.15  ?  393  SER A O     1 
ATOM   2326 C  CB    . SER A 1 326 ? 84.759  -12.867 -8.664  1.00 51.50  ?  393  SER A CB    1 
ATOM   2327 O  OG    . SER A 1 326 ? 85.635  -12.209 -7.767  1.00 52.59  ?  393  SER A OG    1 
ATOM   2328 N  N     . PHE A 1 327 ? 83.036  -12.711 -11.467 1.00 56.00  ?  394  PHE A N     1 
ATOM   2329 C  CA    . PHE A 1 327 ? 82.107  -13.337 -12.400 1.00 63.13  ?  394  PHE A CA    1 
ATOM   2330 C  C     . PHE A 1 327 ? 82.308  -14.844 -12.509 1.00 62.58  ?  394  PHE A C     1 
ATOM   2331 O  O     . PHE A 1 327 ? 82.082  -15.422 -13.581 1.00 68.91  ?  394  PHE A O     1 
ATOM   2332 C  CB    . PHE A 1 327 ? 82.235  -12.680 -13.774 1.00 66.87  ?  394  PHE A CB    1 
ATOM   2333 C  CG    . PHE A 1 327 ? 82.137  -11.184 -13.734 1.00 66.87  ?  394  PHE A CG    1 
ATOM   2334 C  CD1   . PHE A 1 327 ? 80.945  -10.565 -13.400 1.00 69.20  ?  394  PHE A CD1   1 
ATOM   2335 C  CD2   . PHE A 1 327 ? 83.236  -10.397 -14.026 1.00 77.23  ?  394  PHE A CD2   1 
ATOM   2336 C  CE1   . PHE A 1 327 ? 80.852  -9.189  -13.358 1.00 69.95  ?  394  PHE A CE1   1 
ATOM   2337 C  CE2   . PHE A 1 327 ? 83.148  -9.020  -13.987 1.00 77.04  ?  394  PHE A CE2   1 
ATOM   2338 C  CZ    . PHE A 1 327 ? 81.955  -8.417  -13.651 1.00 72.71  ?  394  PHE A CZ    1 
ATOM   2339 N  N     . SER A 1 328 ? 82.712  -15.500 -11.423 1.00 65.35  ?  395  SER A N     1 
ATOM   2340 C  CA    . SER A 1 328 ? 82.962  -16.935 -11.443 1.00 49.97  ?  395  SER A CA    1 
ATOM   2341 C  C     . SER A 1 328 ? 82.874  -17.471 -10.024 1.00 52.16  ?  395  SER A C     1 
ATOM   2342 O  O     . SER A 1 328 ? 83.517  -16.932 -9.119  1.00 53.72  ?  395  SER A O     1 
ATOM   2343 C  CB    . SER A 1 328 ? 84.339  -17.242 -12.039 1.00 55.97  ?  395  SER A CB    1 
ATOM   2344 O  OG    . SER A 1 328 ? 84.729  -18.570 -11.742 1.00 73.28  ?  395  SER A OG    1 
ATOM   2345 N  N     . LYS A 1 329 ? 82.085  -18.534 -9.836  1.00 54.77  ?  396  LYS A N     1 
ATOM   2346 C  CA    . LYS A 1 329 ? 81.993  -19.166 -8.524  1.00 59.18  ?  396  LYS A CA    1 
ATOM   2347 C  C     . LYS A 1 329 ? 83.373  -19.549 -8.000  1.00 60.58  ?  396  LYS A C     1 
ATOM   2348 O  O     . LYS A 1 329 ? 83.682  -19.337 -6.822  1.00 58.93  ?  396  LYS A O     1 
ATOM   2349 C  CB    . LYS A 1 329 ? 81.105  -20.412 -8.589  1.00 57.53  ?  396  LYS A CB    1 
ATOM   2350 C  CG    . LYS A 1 329 ? 79.749  -20.225 -9.252  1.00 63.37  ?  396  LYS A CG    1 
ATOM   2351 C  CD    . LYS A 1 329 ? 78.971  -21.538 -9.235  1.00 69.00  ?  396  LYS A CD    1 
ATOM   2352 C  CE    . LYS A 1 329 ? 77.858  -21.565 -10.270 1.00 72.98  ?  396  LYS A CE    1 
ATOM   2353 N  NZ    . LYS A 1 329 ? 76.732  -20.656 -9.929  1.00 81.21  ?  396  LYS A NZ    1 
ATOM   2354 N  N     . LYS A 1 330 ? 84.215  -20.120 -8.865  1.00 60.10  ?  397  LYS A N     1 
ATOM   2355 C  CA    . LYS A 1 330 ? 85.524  -20.592 -8.426  1.00 62.98  ?  397  LYS A CA    1 
ATOM   2356 C  C     . LYS A 1 330 ? 86.387  -19.442 -7.925  1.00 60.08  ?  397  LYS A C     1 
ATOM   2357 O  O     . LYS A 1 330 ? 87.052  -19.561 -6.889  1.00 56.86  ?  397  LYS A O     1 
ATOM   2358 C  CB    . LYS A 1 330 ? 86.223  -21.328 -9.569  1.00 75.32  ?  397  LYS A CB    1 
ATOM   2359 C  CG    . LYS A 1 330 ? 87.564  -21.935 -9.184  1.00 101.41 ?  397  LYS A CG    1 
ATOM   2360 C  CD    . LYS A 1 330 ? 88.222  -22.642 -10.358 1.00 111.98 ?  397  LYS A CD    1 
ATOM   2361 C  CE    . LYS A 1 330 ? 89.579  -23.207 -9.971  1.00 105.98 ?  397  LYS A CE    1 
ATOM   2362 N  NZ    . LYS A 1 330 ? 90.214  -23.957 -11.089 1.00 118.06 ?  397  LYS A NZ    1 
ATOM   2363 N  N     . ASP A 1 331 ? 86.399  -18.321 -8.650  1.00 53.30  ?  398  ASP A N     1 
ATOM   2364 C  CA    . ASP A 1 331 ? 87.143  -17.155 -8.185  1.00 59.10  ?  398  ASP A CA    1 
ATOM   2365 C  C     . ASP A 1 331 ? 86.676  -16.721 -6.801  1.00 55.56  ?  398  ASP A C     1 
ATOM   2366 O  O     . ASP A 1 331 ? 87.497  -16.388 -5.939  1.00 57.87  ?  398  ASP A O     1 
ATOM   2367 C  CB    . ASP A 1 331 ? 87.000  -16.010 -9.187  1.00 59.34  ?  398  ASP A CB    1 
ATOM   2368 C  CG    . ASP A 1 331 ? 87.706  -16.293 -10.500 1.00 64.35  ?  398  ASP A CG    1 
ATOM   2369 O  OD1   . ASP A 1 331 ? 88.331  -17.368 -10.621 1.00 68.71  ?  398  ASP A OD1   1 
ATOM   2370 O  OD2   . ASP A 1 331 ? 87.637  -15.439 -11.410 1.00 72.23  -1 398  ASP A OD2   1 
ATOM   2371 N  N     . CYS A 1 332 ? 85.361  -16.730 -6.564  1.00 50.32  ?  399  CYS A N     1 
ATOM   2372 C  CA    . CYS A 1 332 ? 84.839  -16.353 -5.254  1.00 51.42  ?  399  CYS A CA    1 
ATOM   2373 C  C     . CYS A 1 332 ? 85.430  -17.230 -4.157  1.00 55.26  ?  399  CYS A C     1 
ATOM   2374 O  O     . CYS A 1 332 ? 85.874  -16.730 -3.117  1.00 55.28  ?  399  CYS A O     1 
ATOM   2375 C  CB    . CYS A 1 332 ? 83.312  -16.447 -5.243  1.00 51.26  ?  399  CYS A CB    1 
ATOM   2376 S  SG    . CYS A 1 332 ? 82.466  -15.181 -6.219  1.00 47.24  ?  399  CYS A SG    1 
ATOM   2377 N  N     . GLU A 1 333 ? 85.444  -18.548 -4.372  1.00 57.23  ?  400  GLU A N     1 
ATOM   2378 C  CA    . GLU A 1 333 ? 85.930  -19.458 -3.340  1.00 60.76  ?  400  GLU A CA    1 
ATOM   2379 C  C     . GLU A 1 333 ? 87.441  -19.350 -3.173  1.00 53.23  ?  400  GLU A C     1 
ATOM   2380 O  O     . GLU A 1 333 ? 87.952  -19.408 -2.048  1.00 61.10  ?  400  GLU A O     1 
ATOM   2381 C  CB    . GLU A 1 333 ? 85.528  -20.894 -3.677  1.00 61.37  ?  400  GLU A CB    1 
ATOM   2382 C  CG    . GLU A 1 333 ? 84.082  -21.041 -4.119  1.00 65.62  ?  400  GLU A CG    1 
ATOM   2383 C  CD    . GLU A 1 333 ? 83.458  -22.339 -3.655  1.00 63.87  ?  400  GLU A CD    1 
ATOM   2384 O  OE1   . GLU A 1 333 ? 82.670  -22.306 -2.687  1.00 52.26  ?  400  GLU A OE1   1 
ATOM   2385 O  OE2   . GLU A 1 333 ? 83.762  -23.392 -4.254  1.00 82.47  -1 400  GLU A OE2   1 
ATOM   2386 N  N     . ALA A 1 334 ? 88.172  -19.195 -4.276  1.00 49.35  ?  401  ALA A N     1 
ATOM   2387 C  CA    . ALA A 1 334 ? 89.621  -19.055 -4.193  1.00 58.47  ?  401  ALA A CA    1 
ATOM   2388 C  C     . ALA A 1 334 ? 90.001  -17.789 -3.435  1.00 59.04  ?  401  ALA A C     1 
ATOM   2389 O  O     . ALA A 1 334 ? 90.744  -17.835 -2.448  1.00 61.01  ?  401  ALA A O     1 
ATOM   2390 C  CB    . ALA A 1 334 ? 90.226  -19.046 -5.597  1.00 58.84  ?  401  ALA A CB    1 
ATOM   2391 N  N     . TYR A 1 335 ? 89.494  -16.639 -3.888  1.00 58.91  ?  402  TYR A N     1 
ATOM   2392 C  CA    . TYR A 1 335 ? 89.823  -15.376 -3.237  1.00 54.20  ?  402  TYR A CA    1 
ATOM   2393 C  C     . TYR A 1 335 ? 89.452  -15.405 -1.760  1.00 47.91  ?  402  TYR A C     1 
ATOM   2394 O  O     . TYR A 1 335 ? 90.221  -14.942 -0.909  1.00 53.69  ?  402  TYR A O     1 
ATOM   2395 C  CB    . TYR A 1 335 ? 89.111  -14.223 -3.945  1.00 54.88  ?  402  TYR A CB    1 
ATOM   2396 C  CG    . TYR A 1 335 ? 89.549  -13.996 -5.376  1.00 58.01  ?  402  TYR A CG    1 
ATOM   2397 C  CD1   . TYR A 1 335 ? 90.856  -14.244 -5.775  1.00 63.10  ?  402  TYR A CD1   1 
ATOM   2398 C  CD2   . TYR A 1 335 ? 88.655  -13.527 -6.328  1.00 53.77  ?  402  TYR A CD2   1 
ATOM   2399 C  CE1   . TYR A 1 335 ? 91.258  -14.032 -7.080  1.00 75.08  ?  402  TYR A CE1   1 
ATOM   2400 C  CE2   . TYR A 1 335 ? 89.048  -13.313 -7.636  1.00 57.43  ?  402  TYR A CE2   1 
ATOM   2401 C  CZ    . TYR A 1 335 ? 90.350  -13.568 -8.006  1.00 65.78  ?  402  TYR A CZ    1 
ATOM   2402 O  OH    . TYR A 1 335 ? 90.746  -13.354 -9.307  1.00 76.53  ?  402  TYR A OH    1 
ATOM   2403 N  N     . ALA A 1 336 ? 88.278  -15.948 -1.434  1.00 51.13  ?  403  ALA A N     1 
ATOM   2404 C  CA    . ALA A 1 336 ? 87.851  -16.000 -0.041  1.00 53.66  ?  403  ALA A CA    1 
ATOM   2405 C  C     . ALA A 1 336 ? 88.852  -16.762 0.814   1.00 56.26  ?  403  ALA A C     1 
ATOM   2406 O  O     . ALA A 1 336 ? 89.170  -16.344 1.934   1.00 59.35  ?  403  ALA A O     1 
ATOM   2407 C  CB    . ALA A 1 336 ? 86.469  -16.641 0.057   1.00 45.25  ?  403  ALA A CB    1 
ATOM   2408 N  N     . LEU A 1 337 ? 89.364  -17.882 0.301   1.00 63.08  ?  404  LEU A N     1 
ATOM   2409 C  CA    . LEU A 1 337 ? 90.314  -18.688 1.057   1.00 63.49  ?  404  LEU A CA    1 
ATOM   2410 C  C     . LEU A 1 337 ? 91.665  -18.005 1.208   1.00 58.73  ?  404  LEU A C     1 
ATOM   2411 O  O     . LEU A 1 337 ? 92.421  -18.352 2.121   1.00 66.81  ?  404  LEU A O     1 
ATOM   2412 C  CB    . LEU A 1 337 ? 90.483  -20.052 0.386   1.00 60.19  ?  404  LEU A CB    1 
ATOM   2413 C  CG    . LEU A 1 337 ? 89.384  -21.048 0.757   1.00 65.29  ?  404  LEU A CG    1 
ATOM   2414 C  CD1   . LEU A 1 337 ? 89.260  -22.146 -0.284  1.00 66.77  ?  404  LEU A CD1   1 
ATOM   2415 C  CD2   . LEU A 1 337 ? 89.665  -21.634 2.131   1.00 71.65  ?  404  LEU A CD2   1 
ATOM   2416 N  N     . GLN A 1 338 ? 91.986  -17.042 0.342   1.00 57.58  ?  405  GLN A N     1 
ATOM   2417 C  CA    . GLN A 1 338 ? 93.229  -16.296 0.488   1.00 58.16  ?  405  GLN A CA    1 
ATOM   2418 C  C     . GLN A 1 338 ? 93.185  -15.323 1.658   1.00 54.00  ?  405  GLN A C     1 
ATOM   2419 O  O     . GLN A 1 338 ? 94.239  -14.834 2.078   1.00 60.97  ?  405  GLN A O     1 
ATOM   2420 C  CB    . GLN A 1 338 ? 93.539  -15.540 -0.804  1.00 57.96  ?  405  GLN A CB    1 
ATOM   2421 C  CG    . GLN A 1 338 ? 93.846  -16.450 -1.980  1.00 58.01  ?  405  GLN A CG    1 
ATOM   2422 C  CD    . GLN A 1 338 ? 93.834  -15.725 -3.312  1.00 75.47  ?  405  GLN A CD    1 
ATOM   2423 O  OE1   . GLN A 1 338 ? 93.561  -16.329 -4.349  1.00 78.04  ?  405  GLN A OE1   1 
ATOM   2424 N  NE2   . GLN A 1 338 ? 94.133  -14.429 -3.294  1.00 72.93  ?  405  GLN A NE2   1 
ATOM   2425 N  N     . MET A 1 339 ? 91.998  -15.031 2.188   1.00 59.56  ?  406  MET A N     1 
ATOM   2426 C  CA    . MET A 1 339 ? 91.842  -14.121 3.315   1.00 63.30  ?  406  MET A CA    1 
ATOM   2427 C  C     . MET A 1 339 ? 91.919  -14.833 4.659   1.00 65.50  ?  406  MET A C     1 
ATOM   2428 O  O     . MET A 1 339 ? 91.668  -14.206 5.693   1.00 62.50  ?  406  MET A O     1 
ATOM   2429 C  CB    . MET A 1 339 ? 90.506  -13.377 3.212   1.00 60.85  ?  406  MET A CB    1 
ATOM   2430 C  CG    . MET A 1 339 ? 90.243  -12.758 1.855   1.00 53.55  ?  406  MET A CG    1 
ATOM   2431 S  SD    . MET A 1 339 ? 91.529  -11.608 1.354   1.00 55.78  ?  406  MET A SD    1 
ATOM   2432 C  CE    . MET A 1 339 ? 91.523  -11.856 -0.419  1.00 59.34  ?  406  MET A CE    1 
ATOM   2433 N  N     . THR A 1 340 ? 92.257  -16.124 4.671   1.00 79.02  ?  407  THR A N     1 
ATOM   2434 C  CA    . THR A 1 340 ? 92.306  -16.870 5.923   1.00 83.07  ?  407  THR A CA    1 
ATOM   2435 C  C     . THR A 1 340 ? 93.373  -16.337 6.871   1.00 72.51  ?  407  THR A C     1 
ATOM   2436 O  O     . THR A 1 340 ? 93.291  -16.585 8.079   1.00 70.47  ?  407  THR A O     1 
ATOM   2437 C  CB    . THR A 1 340 ? 92.549  -18.358 5.643   1.00 90.94  ?  407  THR A CB    1 
ATOM   2438 O  OG1   . THR A 1 340 ? 92.535  -19.089 6.876   1.00 96.86  ?  407  THR A OG1   1 
ATOM   2439 C  CG2   . THR A 1 340 ? 93.890  -18.574 4.936   1.00 75.39  ?  407  THR A CG2   1 
ATOM   2440 N  N     . LYS A 1 341 ? 94.372  -15.615 6.355   1.00 62.95  ?  408  LYS A N     1 
ATOM   2441 C  CA    . LYS A 1 341 ? 95.348  -14.976 7.231   1.00 67.80  ?  408  LYS A CA    1 
ATOM   2442 C  C     . LYS A 1 341 ? 94.693  -13.926 8.119   1.00 76.55  ?  408  LYS A C     1 
ATOM   2443 O  O     . LYS A 1 341 ? 95.153  -13.683 9.240   1.00 78.44  ?  408  LYS A O     1 
ATOM   2444 C  CB    . LYS A 1 341 ? 96.460  -14.327 6.404   1.00 81.05  ?  408  LYS A CB    1 
ATOM   2445 C  CG    . LYS A 1 341 ? 97.050  -15.203 5.308   1.00 96.13  ?  408  LYS A CG    1 
ATOM   2446 C  CD    . LYS A 1 341 ? 98.079  -14.431 4.491   1.00 100.06 ?  408  LYS A CD    1 
ATOM   2447 C  CE    . LYS A 1 341 ? 98.184  -14.965 3.070   1.00 91.96  ?  408  LYS A CE    1 
ATOM   2448 N  NZ    . LYS A 1 341 ? 99.164  -14.197 2.251   1.00 82.27  ?  408  LYS A NZ    1 
ATOM   2449 N  N     . LEU A 1 342 ? 93.624  -13.300 7.638   1.00 69.53  ?  409  LEU A N     1 
ATOM   2450 C  CA    . LEU A 1 342 ? 92.997  -12.166 8.299   1.00 63.20  ?  409  LEU A CA    1 
ATOM   2451 C  C     . LEU A 1 342 ? 91.791  -12.607 9.124   1.00 60.63  ?  409  LEU A C     1 
ATOM   2452 O  O     . LEU A 1 342 ? 91.237  -13.692 8.936   1.00 55.81  ?  409  LEU A O     1 
ATOM   2453 C  CB    . LEU A 1 342 ? 92.563  -11.126 7.262   1.00 61.04  ?  409  LEU A CB    1 
ATOM   2454 C  CG    . LEU A 1 342 ? 93.626  -10.743 6.229   1.00 71.14  ?  409  LEU A CG    1 
ATOM   2455 C  CD1   . LEU A 1 342 ? 92.999  -9.965  5.083   1.00 72.97  ?  409  LEU A CD1   1 
ATOM   2456 C  CD2   . LEU A 1 342 ? 94.744  -9.943  6.877   1.00 73.47  ?  409  LEU A CD2   1 
ATOM   2457 N  N     . ASP A 1 343 ? 91.385  -11.733 10.043  1.00 49.47  ?  410  ASP A N     1 
ATOM   2458 C  CA    . ASP A 1 343 ? 90.222  -11.981 10.891  1.00 50.08  ?  410  ASP A CA    1 
ATOM   2459 C  C     . ASP A 1 343 ? 89.555  -10.639 11.156  1.00 49.75  ?  410  ASP A C     1 
ATOM   2460 O  O     . ASP A 1 343 ? 90.143  -9.772  11.809  1.00 52.85  ?  410  ASP A O     1 
ATOM   2461 C  CB    . ASP A 1 343 ? 90.629  -12.672 12.190  1.00 43.04  ?  410  ASP A CB    1 
ATOM   2462 C  CG    . ASP A 1 343 ? 89.443  -13.006 13.070  1.00 53.15  ?  410  ASP A CG    1 
ATOM   2463 O  OD1   . ASP A 1 343 ? 88.301  -12.640 12.715  1.00 52.25  ?  410  ASP A OD1   1 
ATOM   2464 O  OD2   . ASP A 1 343 ? 89.654  -13.643 14.124  1.00 64.52  -1 410  ASP A OD2   1 
ATOM   2465 N  N     A PHE A 1 344 ? 88.321  -10.489 10.686  0.30 46.89  ?  411  PHE A N     1 
ATOM   2466 N  N     B PHE A 1 344 ? 88.335  -10.463 10.641  0.70 46.85  ?  411  PHE A N     1 
ATOM   2467 C  CA    A PHE A 1 344 ? 87.643  -9.203  10.673  0.30 46.07  ?  411  PHE A CA    1 
ATOM   2468 C  CA    B PHE A 1 344 ? 87.656  -9.173  10.678  0.70 46.00  ?  411  PHE A CA    1 
ATOM   2469 C  C     A PHE A 1 344 ? 86.633  -9.031  11.795  0.30 45.84  ?  411  PHE A C     1 
ATOM   2470 C  C     B PHE A 1 344 ? 86.680  -9.013  11.837  0.70 45.88  ?  411  PHE A C     1 
ATOM   2471 O  O     A PHE A 1 344 ? 86.142  -7.915  11.994  0.30 43.72  ?  411  PHE A O     1 
ATOM   2472 O  O     B PHE A 1 344 ? 86.237  -7.888  12.092  0.70 43.70  ?  411  PHE A O     1 
ATOM   2473 C  CB    A PHE A 1 344 ? 86.939  -9.020  9.328   0.30 52.04  ?  411  PHE A CB    1 
ATOM   2474 C  CB    B PHE A 1 344 ? 86.860  -8.936  9.388   0.70 52.08  ?  411  PHE A CB    1 
ATOM   2475 C  CG    A PHE A 1 344 ? 87.839  -9.252  8.163   0.30 56.99  ?  411  PHE A CG    1 
ATOM   2476 C  CG    B PHE A 1 344 ? 87.692  -8.888  8.138   0.70 57.66  ?  411  PHE A CG    1 
ATOM   2477 C  CD1   A PHE A 1 344 ? 88.779  -8.309  7.823   0.30 60.10  ?  411  PHE A CD1   1 
ATOM   2478 C  CD1   B PHE A 1 344 ? 87.991  -7.676  7.538   0.70 61.19  ?  411  PHE A CD1   1 
ATOM   2479 C  CD2   A PHE A 1 344 ? 87.773  -10.422 7.427   0.30 56.93  ?  411  PHE A CD2   1 
ATOM   2480 C  CD2   B PHE A 1 344 ? 88.141  -10.053 7.540   0.70 56.70  ?  411  PHE A CD2   1 
ATOM   2481 C  CE1   A PHE A 1 344 ? 89.623  -8.515  6.766   0.30 62.87  ?  411  PHE A CE1   1 
ATOM   2482 C  CE1   B PHE A 1 344 ? 88.739  -7.627  6.379   0.70 62.33  ?  411  PHE A CE1   1 
ATOM   2483 C  CE2   A PHE A 1 344 ? 88.621  -10.629 6.361   0.30 60.88  ?  411  PHE A CE2   1 
ATOM   2484 C  CE2   B PHE A 1 344 ? 88.891  -10.009 6.382   0.70 59.83  ?  411  PHE A CE2   1 
ATOM   2485 C  CZ    A PHE A 1 344 ? 89.547  -9.671  6.030   0.30 62.12  ?  411  PHE A CZ    1 
ATOM   2486 C  CZ    B PHE A 1 344 ? 89.190  -8.796  5.801   0.70 62.47  ?  411  PHE A CZ    1 
ATOM   2487 N  N     . ASN A 1 345 ? 86.310  -10.092 12.522  1.00 42.48  ?  412  ASN A N     1 
ATOM   2488 C  CA    . ASN A 1 345 ? 85.244  -10.050 13.511  1.00 48.20  ?  412  ASN A CA    1 
ATOM   2489 C  C     . ASN A 1 345 ? 85.785  -9.962  14.931  1.00 39.88  ?  412  ASN A C     1 
ATOM   2490 O  O     . ASN A 1 345 ? 86.877  -10.448 15.238  1.00 49.43  ?  412  ASN A O     1 
ATOM   2491 C  CB    . ASN A 1 345 ? 84.342  -11.280 13.378  1.00 43.03  ?  412  ASN A CB    1 
ATOM   2492 C  CG    . ASN A 1 345 ? 83.362  -11.160 12.229  1.00 42.61  ?  412  ASN A CG    1 
ATOM   2493 O  OD1   . ASN A 1 345 ? 83.441  -10.231 11.426  1.00 36.75  ?  412  ASN A OD1   1 
ATOM   2494 N  ND2   . ASN A 1 345 ? 82.434  -12.102 12.143  1.00 48.99  ?  412  ASN A ND2   1 
ATOM   2495 N  N     . THR A 1 346 ? 85.004  -9.316  15.792  1.00 40.87  ?  413  THR A N     1 
ATOM   2496 C  CA    . THR A 1 346 ? 85.262  -9.323  17.219  1.00 50.43  ?  413  THR A CA    1 
ATOM   2497 C  C     . THR A 1 346 ? 84.784  -10.642 17.820  1.00 53.18  ?  413  THR A C     1 
ATOM   2498 O  O     . THR A 1 346 ? 84.041  -11.406 17.199  1.00 55.16  ?  413  THR A O     1 
ATOM   2499 C  CB    . THR A 1 346 ? 84.558  -8.152  17.902  1.00 46.56  ?  413  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 346 ? 83.141  -8.371  17.890  1.00 41.72  ?  413  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 346 ? 84.869  -6.837  17.189  1.00 45.47  ?  413  THR A CG2   1 
ATOM   2502 N  N     . ASP A 1 347 ? 85.220  -10.910 19.052  1.00 56.06  ?  414  ASP A N     1 
ATOM   2503 C  CA    . ASP A 1 347 ? 84.767  -12.115 19.739  1.00 52.16  ?  414  ASP A CA    1 
ATOM   2504 C  C     . ASP A 1 347 ? 83.248  -12.135 19.861  1.00 53.42  ?  414  ASP A C     1 
ATOM   2505 O  O     . ASP A 1 347 ? 82.614  -13.171 19.630  1.00 57.46  ?  414  ASP A O     1 
ATOM   2506 C  CB    . ASP A 1 347 ? 85.424  -12.210 21.116  1.00 60.12  ?  414  ASP A CB    1 
ATOM   2507 C  CG    . ASP A 1 347 ? 86.926  -12.396 21.030  1.00 73.83  ?  414  ASP A CG    1 
ATOM   2508 O  OD1   . ASP A 1 347 ? 87.389  -13.066 20.081  1.00 69.39  -1 414  ASP A OD1   1 
ATOM   2509 O  OD2   . ASP A 1 347 ? 87.644  -11.870 21.907  1.00 85.52  ?  414  ASP A OD2   1 
ATOM   2510 N  N     . GLU A 1 348 ? 82.644  -10.996 20.210  1.00 47.24  ?  415  GLU A N     1 
ATOM   2511 C  CA    . GLU A 1 348 ? 81.188  -10.934 20.297  1.00 56.43  ?  415  GLU A CA    1 
ATOM   2512 C  C     . GLU A 1 348 ? 80.537  -11.193 18.945  1.00 57.14  ?  415  GLU A C     1 
ATOM   2513 O  O     . GLU A 1 348 ? 79.425  -11.731 18.883  1.00 54.98  ?  415  GLU A O     1 
ATOM   2514 C  CB    . GLU A 1 348 ? 80.746  -9.573  20.841  1.00 52.62  ?  415  GLU A CB    1 
ATOM   2515 C  CG    . GLU A 1 348 ? 79.241  -9.454  21.068  1.00 81.44  ?  415  GLU A CG    1 
ATOM   2516 C  CD    . GLU A 1 348 ? 78.792  -8.030  21.336  1.00 96.32  ?  415  GLU A CD    1 
ATOM   2517 O  OE1   . GLU A 1 348 ? 77.637  -7.845  21.774  1.00 101.61 ?  415  GLU A OE1   1 
ATOM   2518 O  OE2   . GLU A 1 348 ? 79.590  -7.096  21.107  1.00 97.30  -1 415  GLU A OE2   1 
ATOM   2519 N  N     . GLU A 1 349 ? 81.203  -10.810 17.854  1.00 53.89  ?  416  GLU A N     1 
ATOM   2520 C  CA    . GLU A 1 349 ? 80.655  -11.058 16.526  1.00 56.73  ?  416  GLU A CA    1 
ATOM   2521 C  C     . GLU A 1 349 ? 80.796  -12.526 16.140  1.00 45.11  ?  416  GLU A C     1 
ATOM   2522 O  O     . GLU A 1 349 ? 79.912  -13.085 15.482  1.00 43.73  ?  416  GLU A O     1 
ATOM   2523 C  CB    . GLU A 1 349 ? 81.340  -10.147 15.502  1.00 43.42  ?  416  GLU A CB    1 
ATOM   2524 C  CG    . GLU A 1 349 ? 80.955  -8.671  15.653  1.00 51.01  ?  416  GLU A CG    1 
ATOM   2525 C  CD    . GLU A 1 349 ? 81.803  -7.729  14.804  1.00 52.18  ?  416  GLU A CD    1 
ATOM   2526 O  OE1   . GLU A 1 349 ? 82.947  -8.090  14.458  1.00 47.03  ?  416  GLU A OE1   1 
ATOM   2527 O  OE2   . GLU A 1 349 ? 81.323  -6.620  14.484  1.00 49.52  -1 416  GLU A OE2   1 
ATOM   2528 N  N     . LYS A 1 350 ? 81.890  -13.168 16.555  1.00 45.96  ?  417  LYS A N     1 
ATOM   2529 C  CA    . LYS A 1 350 ? 82.047  -14.601 16.326  1.00 46.61  ?  417  LYS A CA    1 
ATOM   2530 C  C     . LYS A 1 350 ? 80.927  -15.389 16.993  1.00 50.85  ?  417  LYS A C     1 
ATOM   2531 O  O     . LYS A 1 350 ? 80.349  -16.300 16.389  1.00 55.92  ?  417  LYS A O     1 
ATOM   2532 C  CB    . LYS A 1 350 ? 83.405  -15.066 16.846  1.00 48.55  ?  417  LYS A CB    1 
ATOM   2533 C  CG    . LYS A 1 350 ? 84.576  -14.711 15.957  1.00 53.70  ?  417  LYS A CG    1 
ATOM   2534 C  CD    . LYS A 1 350 ? 85.877  -15.151 16.605  1.00 50.74  ?  417  LYS A CD    1 
ATOM   2535 C  CE    . LYS A 1 350 ? 86.933  -15.496 15.573  1.00 58.09  ?  417  LYS A CE    1 
ATOM   2536 N  NZ    . LYS A 1 350 ? 87.396  -14.297 14.834  1.00 54.37  ?  417  LYS A NZ    1 
ATOM   2537 N  N     . LYS A 1 351 ? 80.614  -15.059 18.248  1.00 45.51  ?  418  LYS A N     1 
ATOM   2538 C  CA    . LYS A 1 351 ? 79.532  -15.747 18.945  1.00 59.38  ?  418  LYS A CA    1 
ATOM   2539 C  C     . LYS A 1 351 ? 78.226  -15.629 18.170  1.00 58.45  ?  418  LYS A C     1 
ATOM   2540 O  O     . LYS A 1 351 ? 77.505  -16.617 17.990  1.00 64.43  ?  418  LYS A O     1 
ATOM   2541 C  CB    . LYS A 1 351 ? 79.365  -15.185 20.357  1.00 52.34  ?  418  LYS A CB    1 
ATOM   2542 C  CG    . LYS A 1 351 ? 80.240  -15.849 21.414  1.00 90.34  ?  418  LYS A CG    1 
ATOM   2543 C  CD    . LYS A 1 351 ? 81.560  -15.119 21.611  1.00 107.68 ?  418  LYS A CD    1 
ATOM   2544 C  CE    . LYS A 1 351 ? 82.314  -15.657 22.820  1.00 100.86 ?  418  LYS A CE    1 
ATOM   2545 N  NZ    . LYS A 1 351 ? 83.489  -14.813 23.179  1.00 76.24  ?  418  LYS A NZ    1 
ATOM   2546 N  N     . MET A 1 352 ? 77.905  -14.422 17.702  1.00 51.13  ?  419  MET A N     1 
ATOM   2547 C  CA    . MET A 1 352 ? 76.665  -14.222 16.960  1.00 49.22  ?  419  MET A CA    1 
ATOM   2548 C  C     . MET A 1 352 ? 76.636  -15.084 15.704  1.00 38.53  ?  419  MET A C     1 
ATOM   2549 O  O     . MET A 1 352 ? 75.625  -15.726 15.402  1.00 47.79  ?  419  MET A O     1 
ATOM   2550 C  CB    . MET A 1 352 ? 76.499  -12.744 16.609  1.00 50.64  ?  419  MET A CB    1 
ATOM   2551 C  CG    . MET A 1 352 ? 75.435  -12.042 17.434  1.00 71.64  ?  419  MET A CG    1 
ATOM   2552 S  SD    . MET A 1 352 ? 75.224  -10.305 16.995  1.00 89.89  ?  419  MET A SD    1 
ATOM   2553 C  CE    . MET A 1 352 ? 76.765  -9.605  17.583  1.00 70.85  ?  419  MET A CE    1 
ATOM   2554 N  N     . VAL A 1 353 ? 77.741  -15.109 14.957  1.00 33.61  ?  420  VAL A N     1 
ATOM   2555 C  CA    . VAL A 1 353 ? 77.813  -15.948 13.764  1.00 42.35  ?  420  VAL A CA    1 
ATOM   2556 C  C     . VAL A 1 353 ? 77.559  -17.403 14.132  1.00 54.22  ?  420  VAL A C     1 
ATOM   2557 O  O     . VAL A 1 353 ? 76.690  -18.068 13.554  1.00 49.20  ?  420  VAL A O     1 
ATOM   2558 C  CB    . VAL A 1 353 ? 79.175  -15.775 13.065  1.00 38.57  ?  420  VAL A CB    1 
ATOM   2559 C  CG1   . VAL A 1 353 ? 79.320  -16.765 11.916  1.00 40.76  ?  420  VAL A CG1   1 
ATOM   2560 C  CG2   . VAL A 1 353 ? 79.345  -14.352 12.557  1.00 38.85  ?  420  VAL A CG2   1 
ATOM   2561 N  N     . GLU A 1 354 ? 78.313  -17.917 15.108  1.00 55.32  ?  421  GLU A N     1 
ATOM   2562 C  CA    . GLU A 1 354 ? 78.170  -19.313 15.510  1.00 58.88  ?  421  GLU A CA    1 
ATOM   2563 C  C     . GLU A 1 354 ? 76.733  -19.628 15.911  1.00 48.43  ?  421  GLU A C     1 
ATOM   2564 O  O     . GLU A 1 354 ? 76.175  -20.655 15.508  1.00 53.70  ?  421  GLU A O     1 
ATOM   2565 C  CB    . GLU A 1 354 ? 79.131  -19.626 16.657  1.00 50.26  ?  421  GLU A CB    1 
ATOM   2566 C  CG    . GLU A 1 354 ? 80.601  -19.613 16.253  1.00 83.71  ?  421  GLU A CG    1 
ATOM   2567 C  CD    . GLU A 1 354 ? 81.540  -19.847 17.427  1.00 95.58  ?  421  GLU A CD    1 
ATOM   2568 O  OE1   . GLU A 1 354 ? 81.100  -19.695 18.587  1.00 90.80  ?  421  GLU A OE1   1 
ATOM   2569 O  OE2   . GLU A 1 354 ? 82.720  -20.184 17.188  1.00 86.59  -1 421  GLU A OE2   1 
ATOM   2570 N  N     . GLU A 1 355 ? 76.116  -18.753 16.707  1.00 41.45  ?  422  GLU A N     1 
ATOM   2571 C  CA    . GLU A 1 355 ? 74.750  -19.002 17.155  1.00 52.28  ?  422  GLU A CA    1 
ATOM   2572 C  C     . GLU A 1 355 ? 73.778  -18.991 15.982  1.00 55.19  ?  422  GLU A C     1 
ATOM   2573 O  O     . GLU A 1 355 ? 72.956  -19.902 15.833  1.00 59.93  ?  422  GLU A O     1 
ATOM   2574 C  CB    . GLU A 1 355 ? 74.344  -17.966 18.204  1.00 58.45  ?  422  GLU A CB    1 
ATOM   2575 C  CG    . GLU A 1 355 ? 75.058  -18.128 19.537  1.00 69.92  ?  422  GLU A CG    1 
ATOM   2576 C  CD    . GLU A 1 355 ? 74.583  -17.136 20.582  1.00 90.99  ?  422  GLU A CD    1 
ATOM   2577 O  OE1   . GLU A 1 355 ? 75.437  -16.584 21.309  1.00 91.85  ?  422  GLU A OE1   1 
ATOM   2578 O  OE2   . GLU A 1 355 ? 73.358  -16.904 20.675  1.00 78.45  -1 422  GLU A OE2   1 
ATOM   2579 N  N     . VAL A 1 356 ? 73.858  -17.963 15.134  1.00 55.87  ?  423  VAL A N     1 
ATOM   2580 C  CA    . VAL A 1 356 ? 72.988  -17.897 13.964  1.00 52.36  ?  423  VAL A CA    1 
ATOM   2581 C  C     . VAL A 1 356 ? 73.200  -19.117 13.077  1.00 46.80  ?  423  VAL A C     1 
ATOM   2582 O  O     . VAL A 1 356 ? 72.239  -19.728 12.594  1.00 46.75  ?  423  VAL A O     1 
ATOM   2583 C  CB    . VAL A 1 356 ? 73.233  -16.587 13.193  1.00 48.33  ?  423  VAL A CB    1 
ATOM   2584 C  CG1   . VAL A 1 356 ? 72.542  -16.624 11.834  1.00 36.05  ?  423  VAL A CG1   1 
ATOM   2585 C  CG2   . VAL A 1 356 ? 72.752  -15.396 14.013  1.00 51.36  ?  423  VAL A CG2   1 
ATOM   2586 N  N     . PHE A 1 357 ? 74.460  -19.495 12.855  1.00 39.61  ?  424  PHE A N     1 
ATOM   2587 C  CA    . PHE A 1 357 ? 74.760  -20.615 11.969  1.00 48.93  ?  424  PHE A CA    1 
ATOM   2588 C  C     . PHE A 1 357 ? 74.152  -21.910 12.494  1.00 56.28  ?  424  PHE A C     1 
ATOM   2589 O  O     . PHE A 1 357 ? 73.528  -22.665 11.742  1.00 51.11  ?  424  PHE A O     1 
ATOM   2590 C  CB    . PHE A 1 357 ? 76.271  -20.758 11.812  1.00 42.10  ?  424  PHE A CB    1 
ATOM   2591 C  CG    . PHE A 1 357 ? 76.686  -21.650 10.676  1.00 47.47  ?  424  PHE A CG    1 
ATOM   2592 C  CD1   . PHE A 1 357 ? 76.856  -21.136 9.402   1.00 42.72  ?  424  PHE A CD1   1 
ATOM   2593 C  CD2   . PHE A 1 357 ? 76.926  -22.996 10.886  1.00 42.36  ?  424  PHE A CD2   1 
ATOM   2594 C  CE1   . PHE A 1 357 ? 77.248  -21.949 8.357   1.00 49.64  ?  424  PHE A CE1   1 
ATOM   2595 C  CE2   . PHE A 1 357 ? 77.318  -23.814 9.846   1.00 48.12  ?  424  PHE A CE2   1 
ATOM   2596 C  CZ    . PHE A 1 357 ? 77.480  -23.289 8.579   1.00 49.60  ?  424  PHE A CZ    1 
ATOM   2597 N  N     . SER A 1 358 ? 74.328  -22.185 13.789  1.00 58.82  ?  425  SER A N     1 
ATOM   2598 C  CA    . SER A 1 358 ? 73.790  -23.415 14.361  1.00 63.73  ?  425  SER A CA    1 
ATOM   2599 C  C     . SER A 1 358 ? 72.267  -23.418 14.328  1.00 57.17  ?  425  SER A C     1 
ATOM   2600 O  O     . SER A 1 358 ? 71.652  -24.431 13.975  1.00 65.95  ?  425  SER A O     1 
ATOM   2601 C  CB    . SER A 1 358 ? 74.291  -23.594 15.793  1.00 60.39  ?  425  SER A CB    1 
ATOM   2602 O  OG    . SER A 1 358 ? 73.706  -22.635 16.656  1.00 65.40  ?  425  SER A OG    1 
ATOM   2603 N  N     . ASN A 1 359 ? 71.639  -22.298 14.696  1.00 46.55  ?  426  ASN A N     1 
ATOM   2604 C  CA    . ASN A 1 359 ? 70.183  -22.220 14.641  1.00 54.26  ?  426  ASN A CA    1 
ATOM   2605 C  C     . ASN A 1 359 ? 69.663  -22.435 13.228  1.00 56.12  ?  426  ASN A C     1 
ATOM   2606 O  O     . ASN A 1 359 ? 68.571  -22.986 13.047  1.00 54.13  ?  426  ASN A O     1 
ATOM   2607 C  CB    . ASN A 1 359 ? 69.704  -20.868 15.172  1.00 56.42  ?  426  ASN A CB    1 
ATOM   2608 C  CG    . ASN A 1 359 ? 69.348  -20.911 16.642  1.00 64.82  ?  426  ASN A CG    1 
ATOM   2609 O  OD1   . ASN A 1 359 ? 68.173  -20.982 17.004  1.00 67.13  ?  426  ASN A OD1   1 
ATOM   2610 N  ND2   . ASN A 1 359 ? 70.361  -20.872 17.501  1.00 67.66  ?  426  ASN A ND2   1 
ATOM   2611 N  N     . ALA A 1 360 ? 70.422  -22.010 12.217  1.00 55.38  ?  427  ALA A N     1 
ATOM   2612 C  CA    . ALA A 1 360 ? 69.955  -22.127 10.840  1.00 63.23  ?  427  ALA A CA    1 
ATOM   2613 C  C     . ALA A 1 360 ? 69.958  -23.580 10.382  1.00 57.69  ?  427  ALA A C     1 
ATOM   2614 O  O     . ALA A 1 360 ? 68.940  -24.093 9.901   1.00 51.53  ?  427  ALA A O     1 
ATOM   2615 C  CB    . ALA A 1 360 ? 70.823  -21.272 9.917   1.00 45.30  ?  427  ALA A CB    1 
ATOM   2616 N  N     . ILE A 1 361 ? 71.101  -24.262 10.518  1.00 51.05  ?  428  ILE A N     1 
ATOM   2617 C  CA    . ILE A 1 361 ? 71.210  -25.651 10.077  1.00 58.02  ?  428  ILE A CA    1 
ATOM   2618 C  C     . ILE A 1 361 ? 70.564  -26.627 11.042  1.00 53.81  ?  428  ILE A C     1 
ATOM   2619 O  O     . ILE A 1 361 ? 70.535  -27.830 10.758  1.00 63.01  ?  428  ILE A O     1 
ATOM   2620 C  CB    . ILE A 1 361 ? 72.684  -26.054 9.872   1.00 56.94  ?  428  ILE A CB    1 
ATOM   2621 C  CG1   . ILE A 1 361 ? 73.468  -25.937 11.183  1.00 50.10  ?  428  ILE A CG1   1 
ATOM   2622 C  CG2   . ILE A 1 361 ? 73.317  -25.191 8.791   1.00 47.50  ?  428  ILE A CG2   1 
ATOM   2623 C  CD1   . ILE A 1 361 ? 74.899  -26.427 11.076  1.00 50.47  ?  428  ILE A CD1   1 
ATOM   2624 N  N     . ASP A 1 362 ? 70.042  -26.150 12.175  1.00 56.69  ?  429  ASP A N     1 
ATOM   2625 C  CA    . ASP A 1 362 ? 69.385  -27.045 13.121  1.00 67.49  ?  429  ASP A CA    1 
ATOM   2626 C  C     . ASP A 1 362 ? 68.201  -27.758 12.482  1.00 73.42  ?  429  ASP A C     1 
ATOM   2627 O  O     . ASP A 1 362 ? 67.836  -28.859 12.907  1.00 80.01  ?  429  ASP A O     1 
ATOM   2628 C  CB    . ASP A 1 362 ? 68.928  -26.263 14.352  1.00 68.68  ?  429  ASP A CB    1 
ATOM   2629 C  CG    . ASP A 1 362 ? 68.461  -27.167 15.474  1.00 90.26  ?  429  ASP A CG    1 
ATOM   2630 O  OD1   . ASP A 1 362 ? 69.314  -27.846 16.084  1.00 93.80  -1 429  ASP A OD1   1 
ATOM   2631 O  OD2   . ASP A 1 362 ? 67.242  -27.200 15.745  1.00 87.59  ?  429  ASP A OD2   1 
ATOM   2632 N  N     . CYS A 1 363 ? 67.587  -27.147 11.466  1.00 68.85  ?  430  CYS A N     1 
ATOM   2633 C  CA    . CYS A 1 363 ? 66.498  -27.797 10.751  1.00 69.10  ?  430  CYS A CA    1 
ATOM   2634 C  C     . CYS A 1 363 ? 66.986  -28.959 9.896   1.00 62.45  ?  430  CYS A C     1 
ATOM   2635 O  O     . CYS A 1 363 ? 66.177  -29.803 9.499   1.00 71.36  ?  430  CYS A O     1 
ATOM   2636 C  CB    . CYS A 1 363 ? 65.772  -26.785 9.866   1.00 64.47  ?  430  CYS A CB    1 
ATOM   2637 S  SG    . CYS A 1 363 ? 66.722  -26.296 8.412   1.00 60.89  ?  430  CYS A SG    1 
ATOM   2638 N  N     . LEU A 1 364 ? 68.282  -29.016 9.602   1.00 55.97  ?  431  LEU A N     1 
ATOM   2639 C  CA    . LEU A 1 364 ? 68.824  -30.101 8.804   1.00 60.94  ?  431  LEU A CA    1 
ATOM   2640 C  C     . LEU A 1 364 ? 68.899  -31.387 9.621   1.00 70.49  ?  431  LEU A C     1 
ATOM   2641 O  O     . LEU A 1 364 ? 68.884  -31.380 10.856  1.00 65.27  ?  431  LEU A O     1 
ATOM   2642 C  CB    . LEU A 1 364 ? 70.219  -29.751 8.286   1.00 55.71  ?  431  LEU A CB    1 
ATOM   2643 C  CG    . LEU A 1 364 ? 70.346  -28.574 7.319   1.00 55.79  ?  431  LEU A CG    1 
ATOM   2644 C  CD1   . LEU A 1 364 ? 71.804  -28.380 6.926   1.00 57.11  ?  431  LEU A CD1   1 
ATOM   2645 C  CD2   . LEU A 1 364 ? 69.484  -28.785 6.086   1.00 62.50  ?  431  LEU A CD2   1 
ATOM   2646 N  N     . SER A 1 365 ? 68.977  -32.504 8.907   1.00 74.53  ?  432  SER A N     1 
ATOM   2647 C  CA    . SER A 1 365 ? 69.256  -33.781 9.538   1.00 76.46  ?  432  SER A CA    1 
ATOM   2648 C  C     . SER A 1 365 ? 70.744  -33.883 9.845   1.00 74.40  ?  432  SER A C     1 
ATOM   2649 O  O     . SER A 1 365 ? 71.586  -33.323 9.137   1.00 63.98  ?  432  SER A O     1 
ATOM   2650 C  CB    . SER A 1 365 ? 68.824  -34.937 8.635   1.00 70.12  ?  432  SER A CB    1 
ATOM   2651 O  OG    . SER A 1 365 ? 69.581  -34.958 7.436   1.00 74.31  ?  432  SER A OG    1 
ATOM   2652 N  N     . ASP A 1 366 ? 71.063  -34.610 10.918  1.00 78.51  ?  433  ASP A N     1 
ATOM   2653 C  CA    . ASP A 1 366 ? 72.453  -34.755 11.335  1.00 74.79  ?  433  ASP A CA    1 
ATOM   2654 C  C     . ASP A 1 366 ? 73.343  -35.240 10.201  1.00 66.60  ?  433  ASP A C     1 
ATOM   2655 O  O     . ASP A 1 366 ? 74.558  -35.012 10.234  1.00 67.17  ?  433  ASP A O     1 
ATOM   2656 C  CB    . ASP A 1 366 ? 72.537  -35.716 12.522  1.00 92.05  ?  433  ASP A CB    1 
ATOM   2657 C  CG    . ASP A 1 366 ? 71.582  -35.340 13.641  1.00 111.66 ?  433  ASP A CG    1 
ATOM   2658 O  OD1   . ASP A 1 366 ? 71.442  -34.130 13.925  1.00 102.60 -1 433  ASP A OD1   1 
ATOM   2659 O  OD2   . ASP A 1 366 ? 70.961  -36.251 14.227  1.00 108.09 ?  433  ASP A OD2   1 
ATOM   2660 N  N     . GLU A 1 367 ? 72.768  -35.902 9.195   1.00 73.04  ?  434  GLU A N     1 
ATOM   2661 C  CA    . GLU A 1 367 ? 73.548  -36.310 8.032   1.00 81.44  ?  434  GLU A CA    1 
ATOM   2662 C  C     . GLU A 1 367 ? 73.934  -35.106 7.180   1.00 76.07  ?  434  GLU A C     1 
ATOM   2663 O  O     . GLU A 1 367 ? 75.069  -35.019 6.696   1.00 61.75  ?  434  GLU A O     1 
ATOM   2664 C  CB    . GLU A 1 367 ? 72.753  -37.322 7.205   1.00 86.73  ?  434  GLU A CB    1 
ATOM   2665 C  CG    . GLU A 1 367 ? 73.524  -37.936 6.043   1.00 91.30  ?  434  GLU A CG    1 
ATOM   2666 C  CD    . GLU A 1 367 ? 74.576  -38.933 6.495   1.00 110.01 ?  434  GLU A CD    1 
ATOM   2667 O  OE1   . GLU A 1 367 ? 74.433  -39.495 7.601   1.00 113.15 ?  434  GLU A OE1   1 
ATOM   2668 O  OE2   . GLU A 1 367 ? 75.547  -39.155 5.742   1.00 132.85 -1 434  GLU A OE2   1 
ATOM   2669 N  N     . ASP A 1 368 ? 73.005  -34.165 6.989   1.00 70.82  ?  435  ASP A N     1 
ATOM   2670 C  CA    . ASP A 1 368 ? 73.262  -33.019 6.123   1.00 73.36  ?  435  ASP A CA    1 
ATOM   2671 C  C     . ASP A 1 368 ? 74.096  -31.945 6.812   1.00 61.56  ?  435  ASP A C     1 
ATOM   2672 O  O     . ASP A 1 368 ? 74.841  -31.224 6.139   1.00 55.59  ?  435  ASP A O     1 
ATOM   2673 C  CB    . ASP A 1 368 ? 71.939  -32.424 5.637   1.00 68.11  ?  435  ASP A CB    1 
ATOM   2674 C  CG    . ASP A 1 368 ? 71.214  -33.334 4.658   1.00 64.93  ?  435  ASP A CG    1 
ATOM   2675 O  OD1   . ASP A 1 368 ? 71.895  -34.091 3.934   1.00 63.53  ?  435  ASP A OD1   1 
ATOM   2676 O  OD2   . ASP A 1 368 ? 69.965  -33.290 4.609   1.00 41.87  ?  435  ASP A OD2   1 
ATOM   2677 N  N     . LYS A 1 369 ? 73.987  -31.819 8.139   1.00 59.10  ?  436  LYS A N     1 
ATOM   2678 C  CA    . LYS A 1 369 ? 74.832  -30.874 8.862   1.00 58.38  ?  436  LYS A CA    1 
ATOM   2679 C  C     . LYS A 1 369 ? 76.310  -31.135 8.605   1.00 57.31  ?  436  LYS A C     1 
ATOM   2680 O  O     . LYS A 1 369 ? 77.117  -30.199 8.627   1.00 61.93  ?  436  LYS A O     1 
ATOM   2681 C  CB    . LYS A 1 369 ? 74.552  -30.948 10.364  1.00 48.80  ?  436  LYS A CB    1 
ATOM   2682 C  CG    . LYS A 1 369 ? 73.145  -30.547 10.770  1.00 58.39  ?  436  LYS A CG    1 
ATOM   2683 C  CD    . LYS A 1 369 ? 72.999  -30.538 12.286  1.00 50.88  ?  436  LYS A CD    1 
ATOM   2684 C  CE    . LYS A 1 369 ? 71.586  -30.189 12.715  1.00 63.03  ?  436  LYS A CE    1 
ATOM   2685 N  NZ    . LYS A 1 369 ? 71.457  -30.098 14.195  1.00 71.31  ?  436  LYS A NZ    1 
ATOM   2686 N  N     . LYS A 1 370 ? 76.684  -32.390 8.359   1.00 51.90  ?  437  LYS A N     1 
ATOM   2687 C  CA    . LYS A 1 370 ? 78.080  -32.771 8.188   1.00 59.94  ?  437  LYS A CA    1 
ATOM   2688 C  C     . LYS A 1 370 ? 78.579  -32.592 6.761   1.00 60.94  ?  437  LYS A C     1 
ATOM   2689 O  O     . LYS A 1 370 ? 79.723  -32.960 6.472   1.00 59.94  ?  437  LYS A O     1 
ATOM   2690 C  CB    . LYS A 1 370 ? 78.281  -34.230 8.613   1.00 65.31  ?  437  LYS A CB    1 
ATOM   2691 C  CG    . LYS A 1 370 ? 77.846  -34.533 10.040  1.00 77.08  ?  437  LYS A CG    1 
ATOM   2692 C  CD    . LYS A 1 370 ? 77.983  -36.017 10.359  1.00 87.91  ?  437  LYS A CD    1 
ATOM   2693 C  CE    . LYS A 1 370 ? 77.392  -36.358 11.722  1.00 91.98  ?  437  LYS A CE    1 
ATOM   2694 N  NZ    . LYS A 1 370 ? 77.461  -37.820 12.018  1.00 84.51  ?  437  LYS A NZ    1 
ATOM   2695 N  N     . LEU A 1 371 ? 77.763  -32.042 5.868   1.00 61.74  ?  438  LEU A N     1 
ATOM   2696 C  CA    . LEU A 1 371 ? 78.194  -31.872 4.489   1.00 55.06  ?  438  LEU A CA    1 
ATOM   2697 C  C     . LEU A 1 371 ? 79.475  -31.043 4.445   1.00 53.09  ?  438  LEU A C     1 
ATOM   2698 O  O     . LEU A 1 371 ? 79.638  -30.110 5.241   1.00 56.47  ?  438  LEU A O     1 
ATOM   2699 C  CB    . LEU A 1 371 ? 77.098  -31.198 3.663   1.00 53.48  ?  438  LEU A CB    1 
ATOM   2700 C  CG    . LEU A 1 371 ? 75.940  -32.110 3.249   1.00 61.69  ?  438  LEU A CG    1 
ATOM   2701 C  CD1   . LEU A 1 371 ? 74.740  -31.294 2.798   1.00 54.06  ?  438  LEU A CD1   1 
ATOM   2702 C  CD2   . LEU A 1 371 ? 76.385  -33.066 2.145   1.00 54.35  ?  438  LEU A CD2   1 
ATOM   2703 N  N     . PRO A 1 372 ? 80.405  -31.353 3.536   1.00 55.02  ?  439  PRO A N     1 
ATOM   2704 C  CA    . PRO A 1 372 ? 81.671  -30.599 3.510   1.00 50.04  ?  439  PRO A CA    1 
ATOM   2705 C  C     . PRO A 1 372 ? 81.484  -29.100 3.341   1.00 56.05  ?  439  PRO A C     1 
ATOM   2706 O  O     . PRO A 1 372 ? 82.199  -28.320 3.982   1.00 55.92  ?  439  PRO A O     1 
ATOM   2707 C  CB    . PRO A 1 372 ? 82.428  -31.220 2.323   1.00 37.18  ?  439  PRO A CB    1 
ATOM   2708 C  CG    . PRO A 1 372 ? 81.397  -31.948 1.525   1.00 60.49  ?  439  PRO A CG    1 
ATOM   2709 C  CD    . PRO A 1 372 ? 80.364  -32.401 2.503   1.00 53.49  ?  439  PRO A CD    1 
ATOM   2710 N  N     . GLN A 1 373 ? 80.543  -28.668 2.498   1.00 53.45  ?  440  GLN A N     1 
ATOM   2711 C  CA    . GLN A 1 373 ? 80.354  -27.235 2.291   1.00 55.13  ?  440  GLN A CA    1 
ATOM   2712 C  C     . GLN A 1 373 ? 79.890  -26.552 3.572   1.00 42.42  ?  440  GLN A C     1 
ATOM   2713 O  O     . GLN A 1 373 ? 80.328  -25.439 3.882   1.00 56.60  ?  440  GLN A O     1 
ATOM   2714 C  CB    . GLN A 1 373 ? 79.355  -26.988 1.161   1.00 57.96  ?  440  GLN A CB    1 
ATOM   2715 C  CG    . GLN A 1 373 ? 79.408  -25.572 0.606   1.00 56.01  ?  440  GLN A CG    1 
ATOM   2716 C  CD    . GLN A 1 373 ? 78.353  -25.316 -0.449  1.00 48.91  ?  440  GLN A CD    1 
ATOM   2717 O  OE1   . GLN A 1 373 ? 77.179  -25.119 -0.134  1.00 53.20  ?  440  GLN A OE1   1 
ATOM   2718 N  NE2   . GLN A 1 373 ? 78.764  -25.315 -1.712  1.00 46.06  ?  440  GLN A NE2   1 
ATOM   2719 N  N     . VAL A 1 374 ? 79.004  -27.201 4.330   1.00 45.87  ?  441  VAL A N     1 
ATOM   2720 C  CA    . VAL A 1 374 ? 78.571  -26.645 5.610   1.00 37.58  ?  441  VAL A CA    1 
ATOM   2721 C  C     . VAL A 1 374 ? 79.769  -26.448 6.531   1.00 57.51  ?  441  VAL A C     1 
ATOM   2722 O  O     . VAL A 1 374 ? 79.962  -25.372 7.110   1.00 56.06  ?  441  VAL A O     1 
ATOM   2723 C  CB    . VAL A 1 374 ? 77.509  -27.552 6.256   1.00 41.16  ?  441  VAL A CB    1 
ATOM   2724 C  CG1   . VAL A 1 374 ? 77.117  -27.028 7.634   1.00 42.99  ?  441  VAL A CG1   1 
ATOM   2725 C  CG2   . VAL A 1 374 ? 76.289  -27.655 5.358   1.00 51.11  ?  441  VAL A CG2   1 
ATOM   2726 N  N     . GLU A 1 375 ? 80.594  -27.487 6.678   1.00 55.43  ?  442  GLU A N     1 
ATOM   2727 C  CA    . GLU A 1 375 ? 81.742  -27.406 7.571   1.00 55.83  ?  442  GLU A CA    1 
ATOM   2728 C  C     . GLU A 1 375 ? 82.807  -26.446 7.060   1.00 45.14  ?  442  GLU A C     1 
ATOM   2729 O  O     . GLU A 1 375 ? 83.642  -25.992 7.849   1.00 49.23  ?  442  GLU A O     1 
ATOM   2730 C  CB    . GLU A 1 375 ? 82.347  -28.799 7.766   1.00 62.33  ?  442  GLU A CB    1 
ATOM   2731 C  CG    . GLU A 1 375 ? 81.421  -29.780 8.472   1.00 69.95  ?  442  GLU A CG    1 
ATOM   2732 C  CD    . GLU A 1 375 ? 82.065  -31.136 8.696   1.00 77.36  ?  442  GLU A CD    1 
ATOM   2733 O  OE1   . GLU A 1 375 ? 83.204  -31.343 8.224   1.00 67.00  ?  442  GLU A OE1   1 
ATOM   2734 O  OE2   . GLU A 1 375 ? 81.430  -31.995 9.344   1.00 76.11  ?  442  GLU A OE2   1 
ATOM   2735 N  N     . HIS A 1 376 ? 82.791  -26.119 5.769   1.00 49.41  ?  443  HIS A N     1 
ATOM   2736 C  CA    . HIS A 1 376 ? 83.826  -25.279 5.181   1.00 50.76  ?  443  HIS A CA    1 
ATOM   2737 C  C     . HIS A 1 376 ? 83.547  -23.789 5.332   1.00 57.71  ?  443  HIS A C     1 
ATOM   2738 O  O     . HIS A 1 376 ? 84.493  -22.999 5.413   1.00 55.08  ?  443  HIS A O     1 
ATOM   2739 C  CB    . HIS A 1 376 ? 83.984  -25.618 3.696   1.00 54.77  ?  443  HIS A CB    1 
ATOM   2740 C  CG    . HIS A 1 376 ? 84.952  -24.737 2.971   1.00 62.72  ?  443  HIS A CG    1 
ATOM   2741 N  ND1   . HIS A 1 376 ? 84.567  -23.581 2.327   1.00 77.27  ?  443  HIS A ND1   1 
ATOM   2742 C  CD2   . HIS A 1 376 ? 86.289  -24.846 2.779   1.00 75.15  ?  443  HIS A CD2   1 
ATOM   2743 C  CE1   . HIS A 1 376 ? 85.624  -23.013 1.773   1.00 70.57  ?  443  HIS A CE1   1 
ATOM   2744 N  NE2   . HIS A 1 376 ? 86.681  -23.761 2.032   1.00 78.77  ?  443  HIS A NE2   1 
ATOM   2745 N  N     . VAL A 1 377 ? 82.277  -23.381 5.379   1.00 55.20  ?  444  VAL A N     1 
ATOM   2746 C  CA    . VAL A 1 377 ? 81.971  -21.954 5.379   1.00 54.41  ?  444  VAL A CA    1 
ATOM   2747 C  C     . VAL A 1 377 ? 82.109  -21.363 6.776   1.00 53.75  ?  444  VAL A C     1 
ATOM   2748 O  O     . VAL A 1 377 ? 82.549  -20.219 6.930   1.00 55.13  ?  444  VAL A O     1 
ATOM   2749 C  CB    . VAL A 1 377 ? 80.566  -21.695 4.797   1.00 48.19  ?  444  VAL A CB    1 
ATOM   2750 C  CG1   . VAL A 1 377 ? 80.484  -22.188 3.362   1.00 50.29  ?  444  VAL A CG1   1 
ATOM   2751 C  CG2   . VAL A 1 377 ? 79.485  -22.336 5.659   1.00 53.20  ?  444  VAL A CG2   1 
ATOM   2752 N  N     . LEU A 1 378 ? 81.742  -22.116 7.813   1.00 50.74  ?  445  LEU A N     1 
ATOM   2753 C  CA    . LEU A 1 378 ? 81.686  -21.531 9.150   1.00 57.43  ?  445  LEU A CA    1 
ATOM   2754 C  C     . LEU A 1 378 ? 83.011  -20.924 9.588   1.00 56.32  ?  445  LEU A C     1 
ATOM   2755 O  O     . LEU A 1 378 ? 82.994  -19.809 10.138  1.00 51.95  ?  445  LEU A O     1 
ATOM   2756 C  CB    . LEU A 1 378 ? 81.216  -22.579 10.167  1.00 53.15  ?  445  LEU A CB    1 
ATOM   2757 C  CG    . LEU A 1 378 ? 81.017  -22.049 11.591  1.00 51.25  ?  445  LEU A CG    1 
ATOM   2758 C  CD1   . LEU A 1 378 ? 80.041  -20.877 11.611  1.00 50.35  ?  445  LEU A CD1   1 
ATOM   2759 C  CD2   . LEU A 1 378 ? 80.535  -23.154 12.516  1.00 62.61  ?  445  LEU A CD2   1 
ATOM   2760 N  N     . PRO A 1 379 ? 84.165  -21.567 9.393   1.00 53.99  ?  446  PRO A N     1 
ATOM   2761 C  CA    . PRO A 1 379 ? 85.422  -20.900 9.766   1.00 58.33  ?  446  PRO A CA    1 
ATOM   2762 C  C     . PRO A 1 379 ? 85.601  -19.559 9.077   1.00 58.75  ?  446  PRO A C     1 
ATOM   2763 O  O     . PRO A 1 379 ? 86.126  -18.618 9.686   1.00 53.76  ?  446  PRO A O     1 
ATOM   2764 C  CB    . PRO A 1 379 ? 86.498  -21.914 9.345   1.00 49.89  ?  446  PRO A CB    1 
ATOM   2765 C  CG    . PRO A 1 379 ? 85.791  -23.225 9.277   1.00 52.33  ?  446  PRO A CG    1 
ATOM   2766 C  CD    . PRO A 1 379 ? 84.397  -22.910 8.834   1.00 59.07  ?  446  PRO A CD    1 
ATOM   2767 N  N     . LEU A 1 380 ? 85.173  -19.446 7.817   1.00 49.65  ?  447  LEU A N     1 
ATOM   2768 C  CA    . LEU A 1 380 ? 85.246  -18.164 7.124   1.00 54.39  ?  447  LEU A CA    1 
ATOM   2769 C  C     . LEU A 1 380 ? 84.324  -17.141 7.775   1.00 43.57  ?  447  LEU A C     1 
ATOM   2770 O  O     . LEU A 1 380 ? 84.761  -16.048 8.154   1.00 39.20  ?  447  LEU A O     1 
ATOM   2771 C  CB    . LEU A 1 380 ? 84.882  -18.338 5.649   1.00 48.19  ?  447  LEU A CB    1 
ATOM   2772 C  CG    . LEU A 1 380 ? 85.704  -19.321 4.817   1.00 53.11  ?  447  LEU A CG    1 
ATOM   2773 C  CD1   . LEU A 1 380 ? 85.340  -19.180 3.347   1.00 59.60  ?  447  LEU A CD1   1 
ATOM   2774 C  CD2   . LEU A 1 380 ? 87.191  -19.107 5.024   1.00 58.03  ?  447  LEU A CD2   1 
ATOM   2775 N  N     . LEU A 1 381 ? 83.042  -17.485 7.918   1.00 37.21  ?  448  LEU A N     1 
ATOM   2776 C  CA    . LEU A 1 381 ? 82.069  -16.538 8.453   1.00 43.54  ?  448  LEU A CA    1 
ATOM   2777 C  C     . LEU A 1 381 ? 82.495  -16.015 9.818   1.00 47.18  ?  448  LEU A C     1 
ATOM   2778 O  O     . LEU A 1 381 ? 82.356  -14.820 10.104  1.00 41.77  ?  448  LEU A O     1 
ATOM   2779 C  CB    . LEU A 1 381 ? 80.693  -17.198 8.542   1.00 37.85  ?  448  LEU A CB    1 
ATOM   2780 C  CG    . LEU A 1 381 ? 80.155  -17.838 7.257   1.00 41.01  ?  448  LEU A CG    1 
ATOM   2781 C  CD1   . LEU A 1 381 ? 78.800  -18.482 7.523   1.00 41.61  ?  448  LEU A CD1   1 
ATOM   2782 C  CD2   . LEU A 1 381 ? 80.058  -16.827 6.121   1.00 40.88  ?  448  LEU A CD2   1 
ATOM   2783 N  N     . LYS A 1 382 ? 83.010  -16.897 10.679  1.00 45.44  ?  449  LYS A N     1 
ATOM   2784 C  CA    . LYS A 1 382 ? 83.479  -16.462 11.991  1.00 50.95  ?  449  LYS A CA    1 
ATOM   2785 C  C     . LYS A 1 382 ? 84.536  -15.374 11.871  1.00 42.40  ?  449  LYS A C     1 
ATOM   2786 O  O     . LYS A 1 382 ? 84.621  -14.494 12.734  1.00 44.62  ?  449  LYS A O     1 
ATOM   2787 C  CB    . LYS A 1 382 ? 84.030  -17.653 12.772  1.00 53.86  ?  449  LYS A CB    1 
ATOM   2788 C  CG    . LYS A 1 382 ? 82.968  -18.473 13.483  1.00 56.88  ?  449  LYS A CG    1 
ATOM   2789 C  CD    . LYS A 1 382 ? 83.486  -19.856 13.852  1.00 60.21  ?  449  LYS A CD    1 
ATOM   2790 C  CE    . LYS A 1 382 ? 84.693  -19.801 14.780  1.00 68.13  ?  449  LYS A CE    1 
ATOM   2791 N  NZ    . LYS A 1 382 ? 85.348  -21.134 14.904  1.00 73.18  ?  449  LYS A NZ    1 
ATOM   2792 N  N     A ARG A 1 383 ? 85.352  -15.417 10.820  0.48 39.98  ?  450  ARG A N     1 
ATOM   2793 N  N     B ARG A 1 383 ? 85.347  -15.419 10.817  0.52 39.96  ?  450  ARG A N     1 
ATOM   2794 C  CA    A ARG A 1 383 ? 86.341  -14.382 10.563  0.48 44.76  ?  450  ARG A CA    1 
ATOM   2795 C  CA    B ARG A 1 383 ? 86.340  -14.391 10.543  0.52 44.75  ?  450  ARG A CA    1 
ATOM   2796 C  C     A ARG A 1 383 ? 85.783  -13.237 9.722   0.48 44.74  ?  450  ARG A C     1 
ATOM   2797 C  C     B ARG A 1 383 ? 85.783  -13.245 9.710   0.52 44.72  ?  450  ARG A C     1 
ATOM   2798 O  O     A ARG A 1 383 ? 86.561  -12.439 9.190   0.48 42.39  ?  450  ARG A O     1 
ATOM   2799 O  O     B ARG A 1 383 ? 86.561  -12.454 9.167   0.52 42.38  ?  450  ARG A O     1 
ATOM   2800 C  CB    A ARG A 1 383 ? 87.568  -14.984 9.876   0.48 46.75  ?  450  ARG A CB    1 
ATOM   2801 C  CB    B ARG A 1 383 ? 87.546  -15.008 9.831   0.52 46.75  ?  450  ARG A CB    1 
ATOM   2802 C  CG    A ARG A 1 383 ? 88.281  -16.050 10.694  0.48 49.60  ?  450  ARG A CG    1 
ATOM   2803 C  CG    B ARG A 1 383 ? 88.277  -16.041 10.666  0.52 49.60  ?  450  ARG A CG    1 
ATOM   2804 C  CD    A ARG A 1 383 ? 89.649  -16.370 10.113  0.48 49.97  ?  450  ARG A CD    1 
ATOM   2805 C  CD    B ARG A 1 383 ? 89.563  -16.505 10.009  0.52 49.77  ?  450  ARG A CD    1 
ATOM   2806 N  NE    A ARG A 1 383 ? 89.580  -16.716 8.695   0.48 51.14  ?  450  ARG A NE    1 
ATOM   2807 N  NE    B ARG A 1 383 ? 90.625  -16.679 10.997  0.52 56.25  ?  450  ARG A NE    1 
ATOM   2808 C  CZ    A ARG A 1 383 ? 89.514  -17.957 8.216   0.48 65.34  ?  450  ARG A CZ    1 
ATOM   2809 C  CZ    B ARG A 1 383 ? 91.767  -17.320 10.773  0.52 61.84  ?  450  ARG A CZ    1 
ATOM   2810 N  NH1   A ARG A 1 383 ? 89.510  -19.003 9.034   0.48 72.46  ?  450  ARG A NH1   1 
ATOM   2811 N  NH1   B ARG A 1 383 ? 92.009  -17.869 9.590   0.52 72.09  ?  450  ARG A NH1   1 
ATOM   2812 N  NH2   A ARG A 1 383 ? 89.453  -18.152 6.907   0.48 63.37  ?  450  ARG A NH2   1 
ATOM   2813 N  NH2   B ARG A 1 383 ? 92.666  -17.419 11.741  0.52 64.69  ?  450  ARG A NH2   1 
ATOM   2814 N  N     . GLY A 1 384 ? 84.461  -13.139 9.592   1.00 45.26  ?  451  GLY A N     1 
ATOM   2815 C  CA    . GLY A 1 384 ? 83.862  -12.077 8.809   1.00 44.94  ?  451  GLY A CA    1 
ATOM   2816 C  C     . GLY A 1 384 ? 84.050  -12.203 7.315   1.00 44.33  ?  451  GLY A C     1 
ATOM   2817 O  O     . GLY A 1 384 ? 83.850  -11.224 6.591   1.00 41.89  ?  451  GLY A O     1 
ATOM   2818 N  N     . ILE A 1 385 ? 84.429  -13.383 6.830   1.00 45.00  ?  452  ILE A N     1 
ATOM   2819 C  CA    . ILE A 1 385 ? 84.622  -13.638 5.407   1.00 47.47  ?  452  ILE A CA    1 
ATOM   2820 C  C     . ILE A 1 385 ? 83.454  -14.481 4.914   1.00 48.71  ?  452  ILE A C     1 
ATOM   2821 O  O     . ILE A 1 385 ? 83.156  -15.536 5.488   1.00 46.77  ?  452  ILE A O     1 
ATOM   2822 C  CB    . ILE A 1 385 ? 85.963  -14.342 5.138   1.00 42.37  ?  452  ILE A CB    1 
ATOM   2823 C  CG1   . ILE A 1 385 ? 87.121  -13.479 5.645   1.00 48.32  ?  452  ILE A CG1   1 
ATOM   2824 C  CG2   . ILE A 1 385 ? 86.120  -14.625 3.648   1.00 44.58  ?  452  ILE A CG2   1 
ATOM   2825 C  CD1   . ILE A 1 385 ? 88.427  -14.232 5.815   1.00 47.06  ?  452  ILE A CD1   1 
ATOM   2826 N  N     . GLY A 1 386 ? 82.794  -14.016 3.849   1.00 45.07  ?  453  GLY A N     1 
ATOM   2827 C  CA    . GLY A 1 386 ? 81.632  -14.681 3.308   1.00 40.97  ?  453  GLY A CA    1 
ATOM   2828 C  C     . GLY A 1 386 ? 81.800  -15.005 1.831   1.00 41.12  ?  453  GLY A C     1 
ATOM   2829 O  O     . GLY A 1 386 ? 82.709  -14.511 1.150   1.00 36.68  ?  453  GLY A O     1 
ATOM   2830 N  N     . ILE A 1 387 ? 80.896  -15.853 1.343   1.00 45.17  ?  454  ILE A N     1 
ATOM   2831 C  CA    . ILE A 1 387 ? 80.841  -16.246 -0.059  1.00 46.09  ?  454  ILE A CA    1 
ATOM   2832 C  C     . ILE A 1 387 ? 79.374  -16.338 -0.453  1.00 41.03  ?  454  ILE A C     1 
ATOM   2833 O  O     . ILE A 1 387 ? 78.525  -16.733 0.350   1.00 36.76  ?  454  ILE A O     1 
ATOM   2834 C  CB    . ILE A 1 387 ? 81.558  -17.591 -0.316  1.00 50.82  ?  454  ILE A CB    1 
ATOM   2835 C  CG1   . ILE A 1 387 ? 83.047  -17.477 0.020   1.00 51.74  ?  454  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE A 1 387 ? 81.372  -18.026 -1.768  1.00 46.95  ?  454  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE A 1 387 ? 83.779  -18.811 0.016   1.00 69.47  ?  454  ILE A CD1   1 
ATOM   2838 N  N     . HIS A 1 388 ? 79.076  -15.973 -1.700  1.00 35.88  ?  455  HIS A N     1 
ATOM   2839 C  CA    . HIS A 1 388 ? 77.693  -15.961 -2.172  1.00 40.10  ?  455  HIS A CA    1 
ATOM   2840 C  C     . HIS A 1 388 ? 77.685  -16.224 -3.670  1.00 47.15  ?  455  HIS A C     1 
ATOM   2841 O  O     . HIS A 1 388 ? 78.074  -15.353 -4.454  1.00 45.74  ?  455  HIS A O     1 
ATOM   2842 C  CB    . HIS A 1 388 ? 77.021  -14.630 -1.850  1.00 38.24  ?  455  HIS A CB    1 
ATOM   2843 C  CG    . HIS A 1 388 ? 75.539  -14.639 -2.058  1.00 44.04  ?  455  HIS A CG    1 
ATOM   2844 N  ND1   . HIS A 1 388 ? 74.963  -14.580 -3.309  1.00 40.10  ?  455  HIS A ND1   1 
ATOM   2845 C  CD2   . HIS A 1 388 ? 74.515  -14.706 -1.175  1.00 36.25  ?  455  HIS A CD2   1 
ATOM   2846 C  CE1   . HIS A 1 388 ? 73.648  -14.609 -3.187  1.00 42.66  ?  455  HIS A CE1   1 
ATOM   2847 N  NE2   . HIS A 1 388 ? 73.350  -14.684 -1.902  1.00 38.78  ?  455  HIS A NE2   1 
ATOM   2848 N  N     . HIS A 1 389 ? 77.240  -17.415 -4.067  1.00 42.98  ?  456  HIS A N     1 
ATOM   2849 C  CA    . HIS A 1 389 ? 77.093  -17.740 -5.480  1.00 46.58  ?  456  HIS A CA    1 
ATOM   2850 C  C     . HIS A 1 389 ? 76.124  -18.908 -5.616  1.00 48.94  ?  456  HIS A C     1 
ATOM   2851 O  O     . HIS A 1 389 ? 75.744  -19.548 -4.631  1.00 35.87  ?  456  HIS A O     1 
ATOM   2852 C  CB    . HIS A 1 389 ? 78.449  -18.046 -6.132  1.00 44.74  ?  456  HIS A CB    1 
ATOM   2853 C  CG    . HIS A 1 389 ? 79.181  -19.197 -5.515  1.00 56.46  ?  456  HIS A CG    1 
ATOM   2854 N  ND1   . HIS A 1 389 ? 78.723  -20.495 -5.582  1.00 54.36  ?  456  HIS A ND1   1 
ATOM   2855 C  CD2   . HIS A 1 389 ? 80.352  -19.247 -4.837  1.00 54.29  ?  456  HIS A CD2   1 
ATOM   2856 C  CE1   . HIS A 1 389 ? 79.574  -21.293 -4.963  1.00 56.24  ?  456  HIS A CE1   1 
ATOM   2857 N  NE2   . HIS A 1 389 ? 80.571  -20.561 -4.501  1.00 55.14  ?  456  HIS A NE2   1 
ATOM   2858 N  N     . GLY A 1 390 ? 75.721  -19.170 -6.862  1.00 43.48  ?  457  GLY A N     1 
ATOM   2859 C  CA    . GLY A 1 390 ? 74.700  -20.167 -7.134  1.00 57.72  ?  457  GLY A CA    1 
ATOM   2860 C  C     . GLY A 1 390 ? 75.103  -21.584 -6.783  1.00 49.50  ?  457  GLY A C     1 
ATOM   2861 O  O     . GLY A 1 390 ? 74.230  -22.437 -6.589  1.00 50.34  ?  457  GLY A O     1 
ATOM   2862 N  N     . GLY A 1 391 ? 76.400  -21.859 -6.705  1.00 44.19  ?  458  GLY A N     1 
ATOM   2863 C  CA    . GLY A 1 391 ? 76.870  -23.174 -6.319  1.00 47.35  ?  458  GLY A CA    1 
ATOM   2864 C  C     . GLY A 1 391 ? 76.702  -23.517 -4.855  1.00 47.91  ?  458  GLY A C     1 
ATOM   2865 O  O     . GLY A 1 391 ? 77.014  -24.646 -4.465  1.00 52.04  ?  458  GLY A O     1 
ATOM   2866 N  N     . LEU A 1 392 ? 76.215  -22.590 -4.035  1.00 39.29  ?  459  LEU A N     1 
ATOM   2867 C  CA    . LEU A 1 392 ? 76.095  -22.818 -2.603  1.00 40.70  ?  459  LEU A CA    1 
ATOM   2868 C  C     . LEU A 1 392 ? 74.775  -23.491 -2.257  1.00 45.92  ?  459  LEU A C     1 
ATOM   2869 O  O     . LEU A 1 392 ? 73.758  -23.300 -2.930  1.00 43.42  ?  459  LEU A O     1 
ATOM   2870 C  CB    . LEU A 1 392 ? 76.195  -21.502 -1.829  1.00 48.25  ?  459  LEU A CB    1 
ATOM   2871 C  CG    . LEU A 1 392 ? 77.508  -20.723 -1.894  1.00 49.27  ?  459  LEU A CG    1 
ATOM   2872 C  CD1   . LEU A 1 392 ? 77.418  -19.510 -0.977  1.00 50.40  ?  459  LEU A CD1   1 
ATOM   2873 C  CD2   . LEU A 1 392 ? 78.701  -21.591 -1.521  1.00 47.05  ?  459  LEU A CD2   1 
ATOM   2874 N  N     . LEU A 1 393 ? 74.803  -24.278 -1.189  1.00 47.31  ?  460  LEU A N     1 
ATOM   2875 C  CA    . LEU A 1 393 ? 73.573  -24.786 -0.607  1.00 36.90  ?  460  LEU A CA    1 
ATOM   2876 C  C     . LEU A 1 393 ? 72.660  -23.612 -0.273  1.00 44.14  ?  460  LEU A C     1 
ATOM   2877 O  O     . LEU A 1 393 ? 73.085  -22.689 0.436   1.00 49.27  ?  460  LEU A O     1 
ATOM   2878 C  CB    . LEU A 1 393 ? 73.869  -25.594 0.655   1.00 49.04  ?  460  LEU A CB    1 
ATOM   2879 C  CG    . LEU A 1 393 ? 74.684  -26.874 0.462   1.00 49.32  ?  460  LEU A CG    1 
ATOM   2880 C  CD1   . LEU A 1 393 ? 75.257  -27.334 1.791   1.00 46.49  ?  460  LEU A CD1   1 
ATOM   2881 C  CD2   . LEU A 1 393 ? 73.827  -27.966 -0.163  1.00 56.05  ?  460  LEU A CD2   1 
ATOM   2882 N  N     . PRO A 1 394 ? 71.415  -23.598 -0.756  1.00 46.89  ?  461  PRO A N     1 
ATOM   2883 C  CA    . PRO A 1 394 ? 70.548  -22.439 -0.479  1.00 49.03  ?  461  PRO A CA    1 
ATOM   2884 C  C     . PRO A 1 394 ? 70.479  -22.062 0.991   1.00 46.57  ?  461  PRO A C     1 
ATOM   2885 O  O     . PRO A 1 394 ? 70.439  -20.868 1.312   1.00 38.40  ?  461  PRO A O     1 
ATOM   2886 C  CB    . PRO A 1 394 ? 69.185  -22.894 -1.019  1.00 35.29  ?  461  PRO A CB    1 
ATOM   2887 C  CG    . PRO A 1 394 ? 69.523  -23.842 -2.112  1.00 47.29  ?  461  PRO A CG    1 
ATOM   2888 C  CD    . PRO A 1 394 ? 70.765  -24.566 -1.659  1.00 49.29  ?  461  PRO A CD    1 
ATOM   2889 N  N     . ILE A 1 395 ? 70.476  -23.042 1.898   1.00 41.80  ?  462  ILE A N     1 
ATOM   2890 C  CA    . ILE A 1 395 ? 70.368  -22.712 3.315   1.00 50.10  ?  462  ILE A CA    1 
ATOM   2891 C  C     . ILE A 1 395 ? 71.592  -21.932 3.777   1.00 40.16  ?  462  ILE A C     1 
ATOM   2892 O  O     . ILE A 1 395 ? 71.489  -21.063 4.652   1.00 41.73  ?  462  ILE A O     1 
ATOM   2893 C  CB    . ILE A 1 395 ? 70.154  -23.984 4.158   1.00 43.90  ?  462  ILE A CB    1 
ATOM   2894 C  CG1   . ILE A 1 395 ? 69.799  -23.601 5.599   1.00 41.04  ?  462  ILE A CG1   1 
ATOM   2895 C  CG2   . ILE A 1 395 ? 71.391  -24.879 4.120   1.00 36.57  ?  462  ILE A CG2   1 
ATOM   2896 C  CD1   . ILE A 1 395 ? 69.350  -24.766 6.454   1.00 50.65  ?  462  ILE A CD1   1 
ATOM   2897 N  N     . LEU A 1 396 ? 72.763  -22.211 3.203   1.00 36.64  ?  463  LEU A N     1 
ATOM   2898 C  CA    . LEU A 1 396 ? 73.951  -21.446 3.562   1.00 44.88  ?  463  LEU A CA    1 
ATOM   2899 C  C     . LEU A 1 396 ? 73.928  -20.064 2.924   1.00 47.28  ?  463  LEU A C     1 
ATOM   2900 O  O     . LEU A 1 396 ? 74.309  -19.075 3.561   1.00 43.44  ?  463  LEU A O     1 
ATOM   2901 C  CB    . LEU A 1 396 ? 75.212  -22.197 3.142   1.00 40.96  ?  463  LEU A CB    1 
ATOM   2902 C  CG    . LEU A 1 396 ? 75.472  -23.537 3.832   1.00 53.89  ?  463  LEU A CG    1 
ATOM   2903 C  CD1   . LEU A 1 396 ? 76.750  -24.161 3.290   1.00 46.55  ?  463  LEU A CD1   1 
ATOM   2904 C  CD2   . LEU A 1 396 ? 75.546  -23.368 5.345   1.00 44.93  ?  463  LEU A CD2   1 
ATOM   2905 N  N     . LYS A 1 397 ? 73.483  -19.983 1.668   1.00 39.70  ?  464  LYS A N     1 
ATOM   2906 C  CA    . LYS A 1 397 ? 73.381  -18.695 0.996   1.00 41.97  ?  464  LYS A CA    1 
ATOM   2907 C  C     . LYS A 1 397 ? 72.451  -17.759 1.757   1.00 39.60  ?  464  LYS A C     1 
ATOM   2908 O  O     . LYS A 1 397 ? 72.744  -16.568 1.910   1.00 40.02  ?  464  LYS A O     1 
ATOM   2909 C  CB    . LYS A 1 397 ? 72.896  -18.905 -0.438  1.00 42.11  ?  464  LYS A CB    1 
ATOM   2910 C  CG    . LYS A 1 397 ? 73.187  -17.745 -1.365  1.00 53.05  ?  464  LYS A CG    1 
ATOM   2911 C  CD    . LYS A 1 397 ? 73.079  -18.153 -2.828  1.00 54.75  ?  464  LYS A CD    1 
ATOM   2912 C  CE    . LYS A 1 397 ? 71.651  -18.484 -3.220  1.00 52.09  ?  464  LYS A CE    1 
ATOM   2913 N  NZ    . LYS A 1 397 ? 71.543  -18.817 -4.669  1.00 58.17  ?  464  LYS A NZ    1 
ATOM   2914 N  N     . GLU A 1 398 ? 71.333  -18.285 2.263   1.00 34.53  ?  465  GLU A N     1 
ATOM   2915 C  CA    . GLU A 1 398 ? 70.413  -17.464 3.041   1.00 40.83  ?  465  GLU A CA    1 
ATOM   2916 C  C     . GLU A 1 398 ? 71.019  -17.085 4.386   1.00 38.69  ?  465  GLU A C     1 
ATOM   2917 O  O     . GLU A 1 398 ? 70.834  -15.959 4.860   1.00 38.56  ?  465  GLU A O     1 
ATOM   2918 C  CB    . GLU A 1 398 ? 69.086  -18.202 3.231   1.00 33.17  ?  465  GLU A CB    1 
ATOM   2919 C  CG    . GLU A 1 398 ? 68.374  -18.519 1.920   1.00 44.65  ?  465  GLU A CG    1 
ATOM   2920 C  CD    . GLU A 1 398 ? 67.142  -19.394 2.099   1.00 50.56  ?  465  GLU A CD    1 
ATOM   2921 O  OE1   . GLU A 1 398 ? 66.359  -19.515 1.134   1.00 55.15  ?  465  GLU A OE1   1 
ATOM   2922 O  OE2   . GLU A 1 398 ? 66.953  -19.960 3.196   1.00 48.06  -1 465  GLU A OE2   1 
ATOM   2923 N  N     . THR A 1 399 ? 71.741  -18.012 5.018   1.00 38.02  ?  466  THR A N     1 
ATOM   2924 C  CA    . THR A 1 399 ? 72.440  -17.684 6.257   1.00 42.54  ?  466  THR A CA    1 
ATOM   2925 C  C     . THR A 1 399 ? 73.428  -16.551 6.024   1.00 38.29  ?  466  THR A C     1 
ATOM   2926 O  O     . THR A 1 399 ? 73.489  -15.591 6.799   1.00 37.70  ?  466  THR A O     1 
ATOM   2927 C  CB    . THR A 1 399 ? 73.170  -18.915 6.804   1.00 41.62  ?  466  THR A CB    1 
ATOM   2928 O  OG1   . THR A 1 399 ? 72.232  -19.967 7.073   1.00 42.08  ?  466  THR A OG1   1 
ATOM   2929 C  CG2   . THR A 1 399 ? 73.915  -18.567 8.090   1.00 39.92  ?  466  THR A CG2   1 
ATOM   2930 N  N     . ILE A 1 400 ? 74.205  -16.649 4.946   1.00 34.65  ?  467  ILE A N     1 
ATOM   2931 C  CA    . ILE A 1 400 ? 75.218  -15.646 4.649   1.00 33.11  ?  467  ILE A CA    1 
ATOM   2932 C  C     . ILE A 1 400 ? 74.570  -14.308 4.325   1.00 43.24  ?  467  ILE A C     1 
ATOM   2933 O  O     . ILE A 1 400 ? 75.074  -13.250 4.720   1.00 41.43  ?  467  ILE A O     1 
ATOM   2934 C  CB    . ILE A 1 400 ? 76.115  -16.149 3.505   1.00 32.97  ?  467  ILE A CB    1 
ATOM   2935 C  CG1   . ILE A 1 400 ? 76.952  -17.331 4.006   1.00 39.80  ?  467  ILE A CG1   1 
ATOM   2936 C  CG2   . ILE A 1 400 ? 76.991  -15.021 2.964   1.00 44.37  ?  467  ILE A CG2   1 
ATOM   2937 C  CD1   . ILE A 1 400 ? 77.729  -18.046 2.928   1.00 40.29  ?  467  ILE A CD1   1 
ATOM   2938 N  N     . GLU A 1 401 ? 73.444  -14.327 3.608   1.00 44.33  ?  468  GLU A N     1 
ATOM   2939 C  CA    . GLU A 1 401 ? 72.725  -13.087 3.328   1.00 35.95  ?  468  GLU A CA    1 
ATOM   2940 C  C     . GLU A 1 401 ? 72.316  -12.397 4.621   1.00 38.05  ?  468  GLU A C     1 
ATOM   2941 O  O     . GLU A 1 401 ? 72.531  -11.192 4.792   1.00 41.63  ?  468  GLU A O     1 
ATOM   2942 C  CB    . GLU A 1 401 ? 71.493  -13.370 2.466   1.00 35.50  ?  468  GLU A CB    1 
ATOM   2943 C  CG    . GLU A 1 401 ? 71.804  -13.731 1.024   1.00 39.44  ?  468  GLU A CG    1 
ATOM   2944 C  CD    . GLU A 1 401 ? 70.591  -14.270 0.282   1.00 43.65  ?  468  GLU A CD    1 
ATOM   2945 O  OE1   . GLU A 1 401 ? 69.488  -14.308 0.871   1.00 33.24  ?  468  GLU A OE1   1 
ATOM   2946 O  OE2   . GLU A 1 401 ? 70.744  -14.657 -0.894  1.00 43.88  -1 468  GLU A OE2   1 
ATOM   2947 N  N     . ILE A 1 402 ? 71.725  -13.150 5.549   1.00 38.40  ?  469  ILE A N     1 
ATOM   2948 C  CA    . ILE A 1 402 ? 71.246  -12.557 6.792   1.00 41.68  ?  469  ILE A CA    1 
ATOM   2949 C  C     . ILE A 1 402 ? 72.416  -12.050 7.625   1.00 40.06  ?  469  ILE A C     1 
ATOM   2950 O  O     . ILE A 1 402 ? 72.321  -11.010 8.285   1.00 41.10  ?  469  ILE A O     1 
ATOM   2951 C  CB    . ILE A 1 402 ? 70.388  -13.572 7.570   1.00 38.15  ?  469  ILE A CB    1 
ATOM   2952 C  CG1   . ILE A 1 402 ? 69.131  -13.924 6.763   1.00 44.59  ?  469  ILE A CG1   1 
ATOM   2953 C  CG2   . ILE A 1 402 ? 70.017  -13.012 8.941   1.00 40.19  ?  469  ILE A CG2   1 
ATOM   2954 C  CD1   . ILE A 1 402 ? 68.311  -15.070 7.336   1.00 45.74  ?  469  ILE A CD1   1 
ATOM   2955 N  N     . LEU A 1 403 ? 73.535  -12.773 7.611   1.00 37.54  ?  470  LEU A N     1 
ATOM   2956 C  CA    . LEU A 1 403 ? 74.705  -12.324 8.354   1.00 41.52  ?  470  LEU A CA    1 
ATOM   2957 C  C     . LEU A 1 403 ? 75.261  -11.036 7.762   1.00 42.07  ?  470  LEU A C     1 
ATOM   2958 O  O     . LEU A 1 403 ? 75.539  -10.076 8.490   1.00 38.58  ?  470  LEU A O     1 
ATOM   2959 C  CB    . LEU A 1 403 ? 75.771  -13.417 8.369   1.00 35.61  ?  470  LEU A CB    1 
ATOM   2960 C  CG    . LEU A 1 403 ? 75.479  -14.619 9.268   1.00 43.65  ?  470  LEU A CG    1 
ATOM   2961 C  CD1   . LEU A 1 403 ? 76.585  -15.651 9.134   1.00 38.82  ?  470  LEU A CD1   1 
ATOM   2962 C  CD2   . LEU A 1 403 ? 75.317  -14.190 10.719  1.00 35.18  ?  470  LEU A CD2   1 
ATOM   2963 N  N     . PHE A 1 404 ? 75.422  -10.992 6.438   1.00 36.03  ?  471  PHE A N     1 
ATOM   2964 C  CA    . PHE A 1 404 ? 75.932  -9.785  5.799   1.00 43.56  ?  471  PHE A CA    1 
ATOM   2965 C  C     . PHE A 1 404 ? 74.979  -8.614  6.000   1.00 44.80  ?  471  PHE A C     1 
ATOM   2966 O  O     . PHE A 1 404 ? 75.418  -7.476  6.203   1.00 39.12  ?  471  PHE A O     1 
ATOM   2967 C  CB    . PHE A 1 404 ? 76.164  -10.033 4.311   1.00 41.19  ?  471  PHE A CB    1 
ATOM   2968 C  CG    . PHE A 1 404 ? 76.705  -8.842  3.582   1.00 40.92  ?  471  PHE A CG    1 
ATOM   2969 C  CD1   . PHE A 1 404 ? 78.071  -8.656  3.448   1.00 38.61  ?  471  PHE A CD1   1 
ATOM   2970 C  CD2   . PHE A 1 404 ? 75.850  -7.901  3.035   1.00 38.58  ?  471  PHE A CD2   1 
ATOM   2971 C  CE1   . PHE A 1 404 ? 78.571  -7.558  2.779   1.00 44.95  ?  471  PHE A CE1   1 
ATOM   2972 C  CE2   . PHE A 1 404 ? 76.346  -6.801  2.366   1.00 40.29  ?  471  PHE A CE2   1 
ATOM   2973 C  CZ    . PHE A 1 404 ? 77.707  -6.629  2.239   1.00 40.16  ?  471  PHE A CZ    1 
ATOM   2974 N  N     . SER A 1 405 ? 73.670  -8.869  5.945   1.00 42.35  ?  472  SER A N     1 
ATOM   2975 C  CA    . SER A 1 405 ? 72.702  -7.795  6.123   1.00 43.78  ?  472  SER A CA    1 
ATOM   2976 C  C     . SER A 1 405 ? 72.737  -7.223  7.533   1.00 47.37  ?  472  SER A C     1 
ATOM   2977 O  O     . SER A 1 405 ? 72.256  -6.105  7.746   1.00 50.00  ?  472  SER A O     1 
ATOM   2978 C  CB    . SER A 1 405 ? 71.290  -8.290  5.801   1.00 49.13  ?  472  SER A CB    1 
ATOM   2979 O  OG    . SER A 1 405 ? 70.712  -8.945  6.916   1.00 55.50  ?  472  SER A OG    1 
ATOM   2980 N  N     . GLU A 1 406 ? 73.294  -7.958  8.493   1.00 45.12  ?  473  GLU A N     1 
ATOM   2981 C  CA    . GLU A 1 406 ? 73.404  -7.492  9.868   1.00 55.04  ?  473  GLU A CA    1 
ATOM   2982 C  C     . GLU A 1 406 ? 74.821  -7.055  10.227  1.00 46.29  ?  473  GLU A C     1 
ATOM   2983 O  O     . GLU A 1 406 ? 75.085  -6.746  11.392  1.00 54.22  ?  473  GLU A O     1 
ATOM   2984 C  CB    . GLU A 1 406 ? 72.926  -8.584  10.827  1.00 53.73  ?  473  GLU A CB    1 
ATOM   2985 C  CG    . GLU A 1 406 ? 71.427  -8.848  10.748  1.00 63.59  ?  473  GLU A CG    1 
ATOM   2986 C  CD    . GLU A 1 406 ? 70.602  -7.658  11.198  1.00 76.54  ?  473  GLU A CD    1 
ATOM   2987 O  OE1   . GLU A 1 406 ? 69.797  -7.151  10.390  1.00 87.27  ?  473  GLU A OE1   1 
ATOM   2988 O  OE2   . GLU A 1 406 ? 70.769  -7.224  12.357  1.00 81.71  -1 473  GLU A OE2   1 
ATOM   2989 N  N     . GLY A 1 407 ? 75.732  -7.023  9.258   1.00 41.41  ?  474  GLY A N     1 
ATOM   2990 C  CA    . GLY A 1 407 ? 77.063  -6.500  9.479   1.00 40.16  ?  474  GLY A CA    1 
ATOM   2991 C  C     . GLY A 1 407 ? 78.069  -7.476  10.045  1.00 41.63  ?  474  GLY A C     1 
ATOM   2992 O  O     . GLY A 1 407 ? 79.178  -7.056  10.397  1.00 35.82  ?  474  GLY A O     1 
ATOM   2993 N  N     . LEU A 1 408 ? 77.730  -8.758  10.142  1.00 41.90  ?  475  LEU A N     1 
ATOM   2994 C  CA    . LEU A 1 408 ? 78.652  -9.752  10.680  1.00 37.72  ?  475  LEU A CA    1 
ATOM   2995 C  C     . LEU A 1 408 ? 79.599  -10.311 9.626   1.00 35.60  ?  475  LEU A C     1 
ATOM   2996 O  O     . LEU A 1 408 ? 80.443  -11.150 9.954   1.00 39.41  ?  475  LEU A O     1 
ATOM   2997 C  CB    . LEU A 1 408 ? 77.868  -10.892 11.333  1.00 39.74  ?  475  LEU A CB    1 
ATOM   2998 C  CG    . LEU A 1 408 ? 76.972  -10.467 12.499  1.00 41.93  ?  475  LEU A CG    1 
ATOM   2999 C  CD1   . LEU A 1 408 ? 76.101  -11.617 12.964  1.00 51.75  ?  475  LEU A CD1   1 
ATOM   3000 C  CD2   . LEU A 1 408 ? 77.808  -9.942  13.654  1.00 46.90  ?  475  LEU A CD2   1 
ATOM   3001 N  N     . ILE A 1 409 ? 79.482  -9.866  8.379   1.00 39.83  ?  476  ILE A N     1 
ATOM   3002 C  CA    . ILE A 1 409 ? 80.383  -10.258 7.302   1.00 39.93  ?  476  ILE A CA    1 
ATOM   3003 C  C     . ILE A 1 409 ? 80.964  -8.982  6.713   1.00 38.05  ?  476  ILE A C     1 
ATOM   3004 O  O     . ILE A 1 409 ? 80.228  -8.158  6.158   1.00 39.55  ?  476  ILE A O     1 
ATOM   3005 C  CB    . ILE A 1 409 ? 79.662  -11.089 6.229   1.00 43.06  ?  476  ILE A CB    1 
ATOM   3006 C  CG1   . ILE A 1 409 ? 79.179  -12.412 6.827   1.00 43.57  ?  476  ILE A CG1   1 
ATOM   3007 C  CG2   . ILE A 1 409 ? 80.581  -11.347 5.041   1.00 39.78  ?  476  ILE A CG2   1 
ATOM   3008 C  CD1   . ILE A 1 409 ? 78.239  -13.173 5.933   1.00 48.14  ?  476  ILE A CD1   1 
ATOM   3009 N  N     . LYS A 1 410 ? 82.280  -8.818  6.837   1.00 38.31  ?  477  LYS A N     1 
ATOM   3010 C  CA    . LYS A 1 410 ? 82.950  -7.596  6.417   1.00 43.09  ?  477  LYS A CA    1 
ATOM   3011 C  C     . LYS A 1 410 ? 83.546  -7.688  5.019   1.00 41.62  ?  477  LYS A C     1 
ATOM   3012 O  O     . LYS A 1 410 ? 83.905  -6.653  4.449   1.00 35.97  ?  477  LYS A O     1 
ATOM   3013 C  CB    . LYS A 1 410 ? 84.065  -7.232  7.410   1.00 43.11  ?  477  LYS A CB    1 
ATOM   3014 C  CG    . LYS A 1 410 ? 83.744  -7.525  8.871   1.00 44.72  ?  477  LYS A CG    1 
ATOM   3015 C  CD    . LYS A 1 410 ? 82.544  -6.752  9.372   1.00 39.27  ?  477  LYS A CD    1 
ATOM   3016 C  CE    . LYS A 1 410 ? 82.182  -7.168  10.791  1.00 42.76  ?  477  LYS A CE    1 
ATOM   3017 N  NZ    . LYS A 1 410 ? 83.357  -7.122  11.708  1.00 43.28  ?  477  LYS A NZ    1 
ATOM   3018 N  N     . ALA A 1 411 ? 83.666  -8.892  4.458   1.00 41.49  ?  478  ALA A N     1 
ATOM   3019 C  CA    . ALA A 1 411 ? 84.238  -9.063  3.123   1.00 43.35  ?  478  ALA A CA    1 
ATOM   3020 C  C     . ALA A 1 411 ? 83.495  -10.219 2.456   1.00 45.07  ?  478  ALA A C     1 
ATOM   3021 O  O     . ALA A 1 411 ? 83.754  -11.386 2.765   1.00 45.25  ?  478  ALA A O     1 
ATOM   3022 C  CB    . ALA A 1 411 ? 85.736  -9.323  3.194   1.00 43.42  ?  478  ALA A CB    1 
ATOM   3023 N  N     . LEU A 1 412 ? 82.578  -9.886  1.551   1.00 43.17  ?  479  LEU A N     1 
ATOM   3024 C  CA    . LEU A 1 412 ? 81.737  -10.870 0.881   1.00 41.88  ?  479  LEU A CA    1 
ATOM   3025 C  C     . LEU A 1 412 ? 82.198  -11.031 -0.561  1.00 44.14  ?  479  LEU A C     1 
ATOM   3026 O  O     . LEU A 1 412 ? 82.184  -10.066 -1.334  1.00 37.86  ?  479  LEU A O     1 
ATOM   3027 C  CB    . LEU A 1 412 ? 80.270  -10.451 0.929   1.00 38.65  ?  479  LEU A CB    1 
ATOM   3028 C  CG    . LEU A 1 412 ? 79.292  -11.410 0.252   1.00 42.86  ?  479  LEU A CG    1 
ATOM   3029 C  CD1   . LEU A 1 412 ? 79.261  -12.753 0.969   1.00 45.65  ?  479  LEU A CD1   1 
ATOM   3030 C  CD2   . LEU A 1 412 ? 77.915  -10.792 0.209   1.00 38.98  ?  479  LEU A CD2   1 
ATOM   3031 N  N     . PHE A 1 413 ? 82.598  -12.250 -0.918  1.00 37.21  ?  480  PHE A N     1 
ATOM   3032 C  CA    . PHE A 1 413 ? 83.015  -12.581 -2.276  1.00 39.70  ?  480  PHE A CA    1 
ATOM   3033 C  C     . PHE A 1 413 ? 81.815  -13.188 -2.993  1.00 47.27  ?  480  PHE A C     1 
ATOM   3034 O  O     . PHE A 1 413 ? 81.423  -14.325 -2.710  1.00 44.20  ?  480  PHE A O     1 
ATOM   3035 C  CB    . PHE A 1 413 ? 84.209  -13.533 -2.255  1.00 43.25  ?  480  PHE A CB    1 
ATOM   3036 C  CG    . PHE A 1 413 ? 85.431  -12.944 -1.604  1.00 47.40  ?  480  PHE A CG    1 
ATOM   3037 C  CD1   . PHE A 1 413 ? 85.567  -12.948 -0.225  1.00 45.33  ?  480  PHE A CD1   1 
ATOM   3038 C  CD2   . PHE A 1 413 ? 86.434  -12.371 -2.369  1.00 43.24  ?  480  PHE A CD2   1 
ATOM   3039 C  CE1   . PHE A 1 413 ? 86.685  -12.400 0.378   1.00 48.25  ?  480  PHE A CE1   1 
ATOM   3040 C  CE2   . PHE A 1 413 ? 87.554  -11.821 -1.772  1.00 48.95  ?  480  PHE A CE2   1 
ATOM   3041 C  CZ    . PHE A 1 413 ? 87.678  -11.836 -0.396  1.00 45.01  ?  480  PHE A CZ    1 
ATOM   3042 N  N     . ALA A 1 414 ? 81.233  -12.426 -3.916  1.00 42.19  ?  481  ALA A N     1 
ATOM   3043 C  CA    . ALA A 1 414 ? 79.943  -12.758 -4.498  1.00 38.61  ?  481  ALA A CA    1 
ATOM   3044 C  C     . ALA A 1 414 ? 79.996  -12.664 -6.014  1.00 42.28  ?  481  ALA A C     1 
ATOM   3045 O  O     . ALA A 1 414 ? 80.815  -11.938 -6.584  1.00 42.83  ?  481  ALA A O     1 
ATOM   3046 C  CB    . ALA A 1 414 ? 78.843  -11.824 -3.970  1.00 35.24  ?  481  ALA A CB    1 
ATOM   3047 N  N     . THR A 1 415 ? 79.109  -13.414 -6.660  1.00 45.67  ?  482  THR A N     1 
ATOM   3048 C  CA    . THR A 1 415 ? 78.872  -13.269 -8.086  1.00 46.32  ?  482  THR A CA    1 
ATOM   3049 C  C     . THR A 1 415 ? 77.827  -12.181 -8.327  1.00 37.43  ?  482  THR A C     1 
ATOM   3050 O  O     . THR A 1 415 ? 77.215  -11.650 -7.397  1.00 41.62  ?  482  THR A O     1 
ATOM   3051 C  CB    . THR A 1 415 ? 78.419  -14.594 -8.700  1.00 49.05  ?  482  THR A CB    1 
ATOM   3052 O  OG1   . THR A 1 415 ? 77.297  -15.108 -7.968  1.00 45.09  ?  482  THR A OG1   1 
ATOM   3053 C  CG2   . THR A 1 415 ? 79.554  -15.608 -8.679  1.00 42.56  ?  482  THR A CG2   1 
ATOM   3054 N  N     . GLU A 1 416 ? 77.614  -11.868 -9.607  1.00 44.29  ?  483  GLU A N     1 
ATOM   3055 C  CA    . GLU A 1 416 ? 76.799  -10.713 -9.970  1.00 52.38  ?  483  GLU A CA    1 
ATOM   3056 C  C     . GLU A 1 416 ? 75.395  -10.794 -9.384  1.00 47.34  ?  483  GLU A C     1 
ATOM   3057 O  O     . GLU A 1 416 ? 74.777  -9.758  -9.111  1.00 53.70  ?  483  GLU A O     1 
ATOM   3058 C  CB    . GLU A 1 416 ? 76.737  -10.592 -11.494 1.00 48.77  ?  483  GLU A CB    1 
ATOM   3059 C  CG    . GLU A 1 416 ? 76.015  -9.354  -11.994 1.00 71.63  ?  483  GLU A CG    1 
ATOM   3060 C  CD    . GLU A 1 416 ? 76.187  -9.147  -13.487 1.00 79.22  ?  483  GLU A CD    1 
ATOM   3061 O  OE1   . GLU A 1 416 ? 77.027  -9.847  -14.093 1.00 77.95  ?  483  GLU A OE1   1 
ATOM   3062 O  OE2   . GLU A 1 416 ? 75.483  -8.285  -14.054 1.00 93.13  -1 483  GLU A OE2   1 
ATOM   3063 N  N     . THR A 1 417 ? 74.881  -12.006 -9.169  1.00 55.23  ?  484  THR A N     1 
ATOM   3064 C  CA    . THR A 1 417 ? 73.502  -12.159 -8.717  1.00 44.54  ?  484  THR A CA    1 
ATOM   3065 C  C     . THR A 1 417 ? 73.265  -11.485 -7.371  1.00 45.62  ?  484  THR A C     1 
ATOM   3066 O  O     . THR A 1 417 ? 72.143  -11.052 -7.086  1.00 50.66  ?  484  THR A O     1 
ATOM   3067 C  CB    . THR A 1 417 ? 73.143  -13.643 -8.627  1.00 55.42  ?  484  THR A CB    1 
ATOM   3068 O  OG1   . THR A 1 417 ? 73.506  -14.302 -9.847  1.00 58.27  ?  484  THR A OG1   1 
ATOM   3069 C  CG2   . THR A 1 417 ? 71.654  -13.816 -8.381  1.00 48.29  ?  484  THR A CG2   1 
ATOM   3070 N  N     . PHE A 1 418 ? 74.299  -11.387 -6.532  1.00 51.70  ?  485  PHE A N     1 
ATOM   3071 C  CA    . PHE A 1 418 ? 74.116  -10.817 -5.203  1.00 46.25  ?  485  PHE A CA    1 
ATOM   3072 C  C     . PHE A 1 418 ? 73.650  -9.370  -5.277  1.00 41.37  ?  485  PHE A C     1 
ATOM   3073 O  O     . PHE A 1 418 ? 73.003  -8.877  -4.347  1.00 45.62  ?  485  PHE A O     1 
ATOM   3074 C  CB    . PHE A 1 418 ? 75.416  -10.915 -4.402  1.00 41.04  ?  485  PHE A CB    1 
ATOM   3075 C  CG    . PHE A 1 418 ? 75.295  -10.404 -2.998  1.00 38.45  ?  485  PHE A CG    1 
ATOM   3076 C  CD1   . PHE A 1 418 ? 74.587  -11.119 -2.048  1.00 38.31  ?  485  PHE A CD1   1 
ATOM   3077 C  CD2   . PHE A 1 418 ? 75.881  -9.206  -2.629  1.00 46.64  ?  485  PHE A CD2   1 
ATOM   3078 C  CE1   . PHE A 1 418 ? 74.465  -10.649 -0.755  1.00 45.92  ?  485  PHE A CE1   1 
ATOM   3079 C  CE2   . PHE A 1 418 ? 75.762  -8.730  -1.336  1.00 42.38  ?  485  PHE A CE2   1 
ATOM   3080 C  CZ    . PHE A 1 418 ? 75.053  -9.454  -0.398  1.00 42.76  ?  485  PHE A CZ    1 
ATOM   3081 N  N     . ALA A 1 419 ? 73.954  -8.678  -6.377  1.00 42.08  ?  486  ALA A N     1 
ATOM   3082 C  CA    . ALA A 1 419 ? 73.548  -7.284  -6.508  1.00 46.88  ?  486  ALA A CA    1 
ATOM   3083 C  C     . ALA A 1 419 ? 72.035  -7.121  -6.493  1.00 63.32  ?  486  ALA A C     1 
ATOM   3084 O  O     . ALA A 1 419 ? 71.544  -6.037  -6.155  1.00 50.82  ?  486  ALA A O     1 
ATOM   3085 C  CB    . ALA A 1 419 ? 74.119  -6.684  -7.793  1.00 51.39  ?  486  ALA A CB    1 
ATOM   3086 N  N     . MET A 1 420 ? 71.288  -8.170  -6.846  1.00 58.93  ?  487  MET A N     1 
ATOM   3087 C  CA    . MET A 1 420 ? 69.832  -8.120  -6.850  1.00 52.60  ?  487  MET A CA    1 
ATOM   3088 C  C     . MET A 1 420 ? 69.221  -8.406  -5.485  1.00 53.30  ?  487  MET A C     1 
ATOM   3089 O  O     . MET A 1 420 ? 67.997  -8.305  -5.342  1.00 48.93  ?  487  MET A O     1 
ATOM   3090 C  CB    . MET A 1 420 ? 69.287  -9.114  -7.875  1.00 47.24  ?  487  MET A CB    1 
ATOM   3091 C  CG    . MET A 1 420 ? 69.698  -8.798  -9.307  1.00 67.06  ?  487  MET A CG    1 
ATOM   3092 S  SD    . MET A 1 420 ? 69.040  -7.217  -9.891  1.00 78.32  ?  487  MET A SD    1 
ATOM   3093 C  CE    . MET A 1 420 ? 70.156  -6.860  -11.246 1.00 81.74  ?  487  MET A CE    1 
ATOM   3094 N  N     . GLY A 1 421 ? 70.030  -8.761  -4.490  1.00 56.49  ?  488  GLY A N     1 
ATOM   3095 C  CA    . GLY A 1 421 ? 69.510  -8.939  -3.150  1.00 63.97  ?  488  GLY A CA    1 
ATOM   3096 C  C     . GLY A 1 421 ? 69.029  -7.628  -2.558  1.00 65.77  ?  488  GLY A C     1 
ATOM   3097 O  O     . GLY A 1 421 ? 69.537  -6.550  -2.869  1.00 72.32  ?  488  GLY A O     1 
ATOM   3098 N  N     . ILE A 1 422 ? 68.037  -7.723  -1.685  1.00 60.76  ?  489  ILE A N     1 
ATOM   3099 C  CA    . ILE A 1 422 ? 67.360  -6.542  -1.165  1.00 74.23  ?  489  ILE A CA    1 
ATOM   3100 C  C     . ILE A 1 422 ? 68.019  -6.110  0.136   1.00 78.76  ?  489  ILE A C     1 
ATOM   3101 O  O     . ILE A 1 422 ? 68.341  -6.940  0.996   1.00 70.41  ?  489  ILE A O     1 
ATOM   3102 C  CB    . ILE A 1 422 ? 65.855  -6.815  -0.973  1.00 76.14  ?  489  ILE A CB    1 
ATOM   3103 C  CG1   . ILE A 1 422 ? 65.589  -7.610  0.309   1.00 71.27  ?  489  ILE A CG1   1 
ATOM   3104 C  CG2   . ILE A 1 422 ? 65.305  -7.574  -2.178  1.00 75.47  ?  489  ILE A CG2   1 
ATOM   3105 C  CD1   . ILE A 1 422 ? 64.120  -7.832  0.590   1.00 64.63  ?  489  ILE A CD1   1 
ATOM   3106 N  N     . ASN A 1 423 ? 68.222  -4.799  0.277   1.00 81.14  ?  490  ASN A N     1 
ATOM   3107 C  CA    . ASN A 1 423 ? 68.710  -4.193  1.515   1.00 84.59  ?  490  ASN A CA    1 
ATOM   3108 C  C     . ASN A 1 423 ? 69.981  -4.880  2.009   1.00 65.84  ?  490  ASN A C     1 
ATOM   3109 O  O     . ASN A 1 423 ? 70.078  -5.313  3.159   1.00 80.91  ?  490  ASN A O     1 
ATOM   3110 C  CB    . ASN A 1 423 ? 67.627  -4.219  2.597   1.00 109.98 ?  490  ASN A CB    1 
ATOM   3111 C  CG    . ASN A 1 423 ? 66.364  -3.482  2.183   1.00 111.31 ?  490  ASN A CG    1 
ATOM   3112 O  OD1   . ASN A 1 423 ? 66.224  -3.059  1.035   1.00 113.66 ?  490  ASN A OD1   1 
ATOM   3113 N  ND2   . ASN A 1 423 ? 65.434  -3.331  3.120   1.00 106.64 ?  490  ASN A ND2   1 
ATOM   3114 N  N     . MET A 1 424 ? 70.972  -4.978  1.125   1.00 48.61  ?  491  MET A N     1 
ATOM   3115 C  CA    . MET A 1 424 ? 72.279  -5.540  1.472   1.00 51.82  ?  491  MET A CA    1 
ATOM   3116 C  C     . MET A 1 424 ? 73.377  -4.743  0.780   1.00 44.30  ?  491  MET A C     1 
ATOM   3117 O  O     . MET A 1 424 ? 74.092  -5.257  -0.089  1.00 39.90  ?  491  MET A O     1 
ATOM   3118 C  CB    . MET A 1 424 ? 72.348  -7.021  1.097   1.00 47.00  ?  491  MET A CB    1 
ATOM   3119 C  CG    . MET A 1 424 ? 71.404  -7.896  1.910   1.00 52.05  ?  491  MET A CG    1 
ATOM   3120 S  SD    . MET A 1 424 ? 71.597  -9.657  1.582   1.00 54.21  ?  491  MET A SD    1 
ATOM   3121 C  CE    . MET A 1 424 ? 71.236  -9.730  -0.171  1.00 53.34  ?  491  MET A CE    1 
ATOM   3122 N  N     . PRO A 1 425 ? 73.542  -3.476  1.147   1.00 43.31  ?  492  PRO A N     1 
ATOM   3123 C  CA    . PRO A 1 425 ? 74.651  -2.681  0.619   1.00 48.24  ?  492  PRO A CA    1 
ATOM   3124 C  C     . PRO A 1 425 ? 75.891  -2.780  1.502   1.00 40.41  ?  492  PRO A C     1 
ATOM   3125 O  O     . PRO A 1 425 ? 75.865  -3.319  2.610   1.00 43.46  ?  492  PRO A O     1 
ATOM   3126 C  CB    . PRO A 1 425 ? 74.083  -1.257  0.633   1.00 40.30  ?  492  PRO A CB    1 
ATOM   3127 C  CG    . PRO A 1 425 ? 73.186  -1.252  1.819   1.00 45.91  ?  492  PRO A CG    1 
ATOM   3128 C  CD    . PRO A 1 425 ? 72.618  -2.650  1.944   1.00 43.34  ?  492  PRO A CD    1 
ATOM   3129 N  N     . ALA A 1 426 ? 76.985  -2.232  0.985   1.00 37.25  ?  493  ALA A N     1 
ATOM   3130 C  CA    . ALA A 1 426 ? 78.256  -2.191  1.689   1.00 45.16  ?  493  ALA A CA    1 
ATOM   3131 C  C     . ALA A 1 426 ? 78.847  -0.794  1.572   1.00 37.84  ?  493  ALA A C     1 
ATOM   3132 O  O     . ALA A 1 426 ? 78.332  0.067   0.855   1.00 37.61  ?  493  ALA A O     1 
ATOM   3133 C  CB    . ALA A 1 426 ? 79.238  -3.233  1.134   1.00 34.73  ?  493  ALA A CB    1 
ATOM   3134 N  N     . ARG A 1 427 ? 79.940  -0.568  2.298   1.00 37.76  ?  494  ARG A N     1 
ATOM   3135 C  CA    . ARG A 1 427 ? 80.664  0.688   2.150   1.00 32.96  ?  494  ARG A CA    1 
ATOM   3136 C  C     . ARG A 1 427 ? 81.450  0.711   0.846   1.00 33.48  ?  494  ARG A C     1 
ATOM   3137 O  O     . ARG A 1 427 ? 81.512  1.744   0.168   1.00 41.29  ?  494  ARG A O     1 
ATOM   3138 C  CB    . ARG A 1 427 ? 81.593  0.903   3.345   1.00 39.45  ?  494  ARG A CB    1 
ATOM   3139 C  CG    . ARG A 1 427 ? 82.562  2.070   3.184   1.00 46.54  ?  494  ARG A CG    1 
ATOM   3140 C  CD    . ARG A 1 427 ? 83.237  2.411   4.502   1.00 46.34  ?  494  ARG A CD    1 
ATOM   3141 N  NE    . ARG A 1 427 ? 82.286  2.942   5.475   1.00 36.58  ?  494  ARG A NE    1 
ATOM   3142 C  CZ    . ARG A 1 427 ? 82.556  3.139   6.761   1.00 48.63  ?  494  ARG A CZ    1 
ATOM   3143 N  NH1   . ARG A 1 427 ? 83.755  2.845   7.247   1.00 47.63  ?  494  ARG A NH1   1 
ATOM   3144 N  NH2   . ARG A 1 427 ? 81.622  3.629   7.565   1.00 49.86  ?  494  ARG A NH2   1 
ATOM   3145 N  N     . THR A 1 428 ? 82.032  -0.424  0.468   1.00 35.03  ?  495  THR A N     1 
ATOM   3146 C  CA    . THR A 1 428 ? 82.897  -0.518  -0.698  1.00 37.19  ?  495  THR A CA    1 
ATOM   3147 C  C     . THR A 1 428 ? 82.450  -1.668  -1.586  1.00 37.82  ?  495  THR A C     1 
ATOM   3148 O  O     . THR A 1 428 ? 82.041  -2.724  -1.095  1.00 34.83  ?  495  THR A O     1 
ATOM   3149 C  CB    . THR A 1 428 ? 84.364  -0.732  -0.290  1.00 38.58  ?  495  THR A CB    1 
ATOM   3150 O  OG1   . THR A 1 428 ? 84.816  0.384   0.487   1.00 42.22  ?  495  THR A OG1   1 
ATOM   3151 C  CG2   . THR A 1 428 ? 85.255  -0.891  -1.519  1.00 36.61  ?  495  THR A CG2   1 
ATOM   3152 N  N     . VAL A 1 429 ? 82.538  -1.455  -2.896  1.00 36.29  ?  496  VAL A N     1 
ATOM   3153 C  CA    . VAL A 1 429 ? 82.360  -2.506  -3.890  1.00 40.22  ?  496  VAL A CA    1 
ATOM   3154 C  C     . VAL A 1 429 ? 83.670  -2.646  -4.651  1.00 42.72  ?  496  VAL A C     1 
ATOM   3155 O  O     . VAL A 1 429 ? 84.228  -1.649  -5.124  1.00 41.06  ?  496  VAL A O     1 
ATOM   3156 C  CB    . VAL A 1 429 ? 81.193  -2.199  -4.847  1.00 44.25  ?  496  VAL A CB    1 
ATOM   3157 C  CG1   . VAL A 1 429 ? 81.239  -3.111  -6.066  1.00 38.01  ?  496  VAL A CG1   1 
ATOM   3158 C  CG2   . VAL A 1 429 ? 79.862  -2.354  -4.123  1.00 36.18  ?  496  VAL A CG2   1 
ATOM   3159 N  N     . LEU A 1 430 ? 84.159  -3.878  -4.757  1.00 41.09  ?  497  LEU A N     1 
ATOM   3160 C  CA    . LEU A 1 430 ? 85.401  -4.182  -5.457  1.00 46.22  ?  497  LEU A CA    1 
ATOM   3161 C  C     . LEU A 1 430 ? 85.099  -5.097  -6.635  1.00 51.77  ?  497  LEU A C     1 
ATOM   3162 O  O     . LEU A 1 430 ? 84.441  -6.130  -6.471  1.00 45.26  ?  497  LEU A O     1 
ATOM   3163 C  CB    . LEU A 1 430 ? 86.413  -4.846  -4.515  1.00 44.17  ?  497  LEU A CB    1 
ATOM   3164 C  CG    . LEU A 1 430 ? 87.715  -5.370  -5.132  1.00 51.91  ?  497  LEU A CG    1 
ATOM   3165 C  CD1   . LEU A 1 430 ? 88.554  -4.239  -5.710  1.00 43.89  ?  497  LEU A CD1   1 
ATOM   3166 C  CD2   . LEU A 1 430 ? 88.507  -6.145  -4.094  1.00 42.24  ?  497  LEU A CD2   1 
ATOM   3167 N  N     . PHE A 1 431 ? 85.569  -4.706  -7.818  1.00 48.83  ?  498  PHE A N     1 
ATOM   3168 C  CA    . PHE A 1 431 ? 85.506  -5.540  -9.012  1.00 46.54  ?  498  PHE A CA    1 
ATOM   3169 C  C     . PHE A 1 431 ? 86.868  -6.192  -9.216  1.00 47.64  ?  498  PHE A C     1 
ATOM   3170 O  O     . PHE A 1 431 ? 87.864  -5.494  -9.434  1.00 54.71  ?  498  PHE A O     1 
ATOM   3171 C  CB    . PHE A 1 431 ? 85.126  -4.718  -10.245 1.00 41.34  ?  498  PHE A CB    1 
ATOM   3172 C  CG    . PHE A 1 431 ? 83.715  -4.199  -10.228 1.00 44.04  ?  498  PHE A CG    1 
ATOM   3173 C  CD1   . PHE A 1 431 ? 83.415  -2.986  -9.632  1.00 39.98  ?  498  PHE A CD1   1 
ATOM   3174 C  CD2   . PHE A 1 431 ? 82.692  -4.914  -10.826 1.00 47.32  ?  498  PHE A CD2   1 
ATOM   3175 C  CE1   . PHE A 1 431 ? 82.124  -2.502  -9.621  1.00 47.35  ?  498  PHE A CE1   1 
ATOM   3176 C  CE2   . PHE A 1 431 ? 81.395  -4.434  -10.819 1.00 55.31  ?  498  PHE A CE2   1 
ATOM   3177 C  CZ    . PHE A 1 431 ? 81.111  -3.226  -10.215 1.00 53.10  ?  498  PHE A CZ    1 
ATOM   3178 N  N     . THR A 1 432 ? 86.914  -7.524  -9.144  1.00 46.97  ?  499  THR A N     1 
ATOM   3179 C  CA    . THR A 1 432 ? 88.170  -8.231  -9.366  1.00 56.39  ?  499  THR A CA    1 
ATOM   3180 C  C     . THR A 1 432 ? 88.552  -8.297  -10.837 1.00 58.53  ?  499  THR A C     1 
ATOM   3181 O  O     . THR A 1 432 ? 89.712  -8.589  -11.148 1.00 67.44  ?  499  THR A O     1 
ATOM   3182 C  CB    . THR A 1 432 ? 88.100  -9.654  -8.805  1.00 53.92  ?  499  THR A CB    1 
ATOM   3183 O  OG1   . THR A 1 432 ? 86.984  -10.346 -9.378  1.00 55.64  ?  499  THR A OG1   1 
ATOM   3184 C  CG2   . THR A 1 432 ? 87.965  -9.631  -7.290  1.00 49.71  ?  499  THR A CG2   1 
ATOM   3185 N  N     . ASN A 1 433 ? 87.613  -8.037  -11.744 1.00 64.45  ?  500  ASN A N     1 
ATOM   3186 C  CA    . ASN A 1 433 ? 87.892  -8.097  -13.171 1.00 80.11  ?  500  ASN A CA    1 
ATOM   3187 C  C     . ASN A 1 433 ? 86.939  -7.164  -13.899 1.00 76.84  ?  500  ASN A C     1 
ATOM   3188 O  O     . ASN A 1 433 ? 85.747  -7.114  -13.585 1.00 75.40  ?  500  ASN A O     1 
ATOM   3189 C  CB    . ASN A 1 433 ? 87.752  -9.528  -13.707 1.00 88.32  ?  500  ASN A CB    1 
ATOM   3190 C  CG    . ASN A 1 433 ? 88.438  -9.720  -15.046 1.00 91.79  ?  500  ASN A CG    1 
ATOM   3191 O  OD1   . ASN A 1 433 ? 88.446  -8.822  -15.889 1.00 98.88  ?  500  ASN A OD1   1 
ATOM   3192 N  ND2   . ASN A 1 433 ? 89.026  -10.894 -15.245 1.00 88.12  ?  500  ASN A ND2   1 
ATOM   3193 N  N     . ALA A 1 434 ? 87.473  -6.425  -14.868 1.00 90.24  ?  501  ALA A N     1 
ATOM   3194 C  CA    . ALA A 1 434 ? 86.678  -5.513  -15.678 1.00 95.23  ?  501  ALA A CA    1 
ATOM   3195 C  C     . ALA A 1 434 ? 86.034  -6.196  -16.876 1.00 100.71 ?  501  ALA A C     1 
ATOM   3196 O  O     . ALA A 1 434 ? 85.270  -5.550  -17.601 1.00 98.97  ?  501  ALA A O     1 
ATOM   3197 C  CB    . ALA A 1 434 ? 87.546  -4.347  -16.161 1.00 97.16  ?  501  ALA A CB    1 
ATOM   3198 N  N     . ARG A 1 435 ? 86.318  -7.478  -17.099 1.00 108.63 ?  502  ARG A N     1 
ATOM   3199 C  CA    . ARG A 1 435 ? 85.807  -8.209  -18.247 1.00 110.95 ?  502  ARG A CA    1 
ATOM   3200 C  C     . ARG A 1 435 ? 85.121  -9.484  -17.780 1.00 94.72  ?  502  ARG A C     1 
ATOM   3201 O  O     . ARG A 1 435 ? 85.507  -10.084 -16.774 1.00 93.41  ?  502  ARG A O     1 
ATOM   3202 C  CB    . ARG A 1 435 ? 86.928  -8.570  -19.231 1.00 117.06 ?  502  ARG A CB    1 
ATOM   3203 C  CG    . ARG A 1 435 ? 87.929  -7.454  -19.492 1.00 126.30 ?  502  ARG A CG    1 
ATOM   3204 C  CD    . ARG A 1 435 ? 89.083  -7.960  -20.340 1.00 136.31 ?  502  ARG A CD    1 
ATOM   3205 N  NE    . ARG A 1 435 ? 89.392  -7.065  -21.450 1.00 148.29 ?  502  ARG A NE    1 
ATOM   3206 C  CZ    . ARG A 1 435 ? 88.602  -6.881  -22.504 1.00 135.53 ?  502  ARG A CZ    1 
ATOM   3207 N  NH1   . ARG A 1 435 ? 87.442  -7.519  -22.589 1.00 126.87 ?  502  ARG A NH1   1 
ATOM   3208 N  NH2   . ARG A 1 435 ? 88.969  -6.052  -23.470 1.00 136.18 ?  502  ARG A NH2   1 
ATOM   3209 N  N     . LYS A 1 436 ? 84.100  -9.894  -18.528 1.00 105.84 ?  503  LYS A N     1 
ATOM   3210 C  CA    . LYS A 1 436 ? 83.387  -11.138 -18.279 1.00 103.34 ?  503  LYS A CA    1 
ATOM   3211 C  C     . LYS A 1 436 ? 83.201  -11.870 -19.603 1.00 114.24 ?  503  LYS A C     1 
ATOM   3212 O  O     . LYS A 1 436 ? 83.571  -11.373 -20.671 1.00 113.34 ?  503  LYS A O     1 
ATOM   3213 C  CB    . LYS A 1 436 ? 82.035  -10.880 -17.601 1.00 87.22  ?  503  LYS A CB    1 
ATOM   3214 C  CG    . LYS A 1 436 ? 81.023  -10.181 -18.492 1.00 93.62  ?  503  LYS A CG    1 
ATOM   3215 C  CD    . LYS A 1 436 ? 79.828  -9.680  -17.699 1.00 87.86  ?  503  LYS A CD    1 
ATOM   3216 C  CE    . LYS A 1 436 ? 78.986  -10.823 -17.158 1.00 84.45  ?  503  LYS A CE    1 
ATOM   3217 N  NZ    . LYS A 1 436 ? 77.820  -10.323 -16.379 1.00 80.61  ?  503  LYS A NZ    1 
ATOM   3218 N  N     . PHE A 1 437 ? 82.619  -13.064 -19.527 1.00 123.24 ?  504  PHE A N     1 
ATOM   3219 C  CA    . PHE A 1 437 ? 82.364  -13.895 -20.698 1.00 143.98 ?  504  PHE A CA    1 
ATOM   3220 C  C     . PHE A 1 437 ? 80.875  -14.215 -20.733 1.00 149.58 ?  504  PHE A C     1 
ATOM   3221 O  O     . PHE A 1 437 ? 80.384  -14.999 -19.913 1.00 150.50 ?  504  PHE A O     1 
ATOM   3222 C  CB    . PHE A 1 437 ? 83.204  -15.171 -20.658 1.00 137.28 ?  504  PHE A CB    1 
ATOM   3223 C  CG    . PHE A 1 437 ? 83.217  -15.931 -21.955 1.00 137.46 ?  504  PHE A CG    1 
ATOM   3224 C  CD1   . PHE A 1 437 ? 84.053  -15.545 -22.989 1.00 137.03 ?  504  PHE A CD1   1 
ATOM   3225 C  CD2   . PHE A 1 437 ? 82.399  -17.034 -22.138 1.00 133.73 ?  504  PHE A CD2   1 
ATOM   3226 C  CE1   . PHE A 1 437 ? 84.071  -16.242 -24.183 1.00 135.09 ?  504  PHE A CE1   1 
ATOM   3227 C  CE2   . PHE A 1 437 ? 82.412  -17.735 -23.330 1.00 129.38 ?  504  PHE A CE2   1 
ATOM   3228 C  CZ    . PHE A 1 437 ? 83.249  -17.338 -24.354 1.00 122.59 ?  504  PHE A CZ    1 
ATOM   3229 N  N     . ASP A 1 438 ? 80.161  -13.605 -21.676 1.00 147.44 ?  505  ASP A N     1 
ATOM   3230 C  CA    . ASP A 1 438 ? 78.724  -13.823 -21.843 1.00 151.75 ?  505  ASP A CA    1 
ATOM   3231 C  C     . ASP A 1 438 ? 78.427  -15.036 -22.711 1.00 162.36 ?  505  ASP A C     1 
ATOM   3232 O  O     . ASP A 1 438 ? 77.483  -15.022 -23.507 1.00 140.97 ?  505  ASP A O     1 
ATOM   3233 C  CB    . ASP A 1 438 ? 78.085  -12.571 -22.434 1.00 144.11 ?  505  ASP A CB    1 
ATOM   3234 C  CG    . ASP A 1 438 ? 78.602  -12.256 -23.825 1.00 148.89 ?  505  ASP A CG    1 
ATOM   3235 O  OD1   . ASP A 1 438 ? 79.793  -12.520 -24.092 1.00 140.87 ?  505  ASP A OD1   1 
ATOM   3236 O  OD2   . ASP A 1 438 ? 77.816  -11.748 -24.653 1.00 146.83 ?  505  ASP A OD2   1 
ATOM   3237 N  N     . GLY A 1 439 ? 79.211  -16.104 -22.577 1.00 162.01 ?  506  GLY A N     1 
ATOM   3238 C  CA    . GLY A 1 439 ? 79.074  -17.244 -23.458 1.00 148.04 ?  506  GLY A CA    1 
ATOM   3239 C  C     . GLY A 1 439 ? 79.527  -16.997 -24.877 1.00 154.46 ?  506  GLY A C     1 
ATOM   3240 O  O     . GLY A 1 439 ? 79.340  -17.870 -25.730 1.00 147.66 ?  506  GLY A O     1 
ATOM   3241 N  N     . LYS A 1 440 ? 80.120  -15.835 -25.157 1.00 153.36 ?  507  LYS A N     1 
ATOM   3242 C  CA    . LYS A 1 440 ? 80.554  -15.498 -26.506 1.00 150.21 ?  507  LYS A CA    1 
ATOM   3243 C  C     . LYS A 1 440 ? 82.015  -15.062 -26.532 1.00 146.89 ?  507  LYS A C     1 
ATOM   3244 O  O     . LYS A 1 440 ? 82.844  -15.705 -27.185 1.00 141.82 ?  507  LYS A O     1 
ATOM   3245 C  CB    . LYS A 1 440 ? 79.666  -14.396 -27.093 1.00 130.93 ?  507  LYS A CB    1 
ATOM   3246 C  CG    . LYS A 1 440 ? 78.231  -14.831 -27.363 1.00 131.88 ?  507  LYS A CG    1 
ATOM   3247 C  CD    . LYS A 1 440 ? 77.478  -13.793 -28.186 1.00 127.82 ?  507  LYS A CD    1 
ATOM   3248 C  CE    . LYS A 1 440 ? 76.081  -14.272 -28.557 1.00 119.56 ?  507  LYS A CE    1 
ATOM   3249 N  NZ    . LYS A 1 440 ? 75.186  -14.396 -27.373 1.00 118.57 ?  507  LYS A NZ    1 
ATOM   3250 N  N     . ASP A 1 441 ? 82.348  -13.980 -25.830 1.00 149.72 ?  508  ASP A N     1 
ATOM   3251 C  CA    . ASP A 1 441 ? 83.691  -13.422 -25.919 1.00 150.86 ?  508  ASP A CA    1 
ATOM   3252 C  C     . ASP A 1 441 ? 83.997  -12.620 -24.662 1.00 146.29 ?  508  ASP A C     1 
ATOM   3253 O  O     . ASP A 1 441 ? 83.095  -12.221 -23.920 1.00 138.27 ?  508  ASP A O     1 
ATOM   3254 C  CB    . ASP A 1 441 ? 83.837  -12.540 -27.164 1.00 144.00 ?  508  ASP A CB    1 
ATOM   3255 C  CG    . ASP A 1 441 ? 85.279  -12.370 -27.595 1.00 142.92 ?  508  ASP A CG    1 
ATOM   3256 O  OD1   . ASP A 1 441 ? 86.172  -12.408 -26.722 1.00 164.35 ?  508  ASP A OD1   1 
ATOM   3257 O  OD2   . ASP A 1 441 ? 85.519  -12.199 -28.809 1.00 148.82 ?  508  ASP A OD2   1 
ATOM   3258 N  N     . PHE A 1 442 ? 85.291  -12.394 -24.435 1.00 148.54 ?  509  PHE A N     1 
ATOM   3259 C  CA    . PHE A 1 442 ? 85.758  -11.510 -23.368 1.00 139.34 ?  509  PHE A CA    1 
ATOM   3260 C  C     . PHE A 1 442 ? 85.446  -10.071 -23.757 1.00 128.98 ?  509  PHE A C     1 
ATOM   3261 O  O     . PHE A 1 442 ? 86.118  -9.483  -24.608 1.00 117.53 ?  509  PHE A O     1 
ATOM   3262 C  CB    . PHE A 1 442 ? 87.256  -11.684 -23.133 1.00 128.47 ?  509  PHE A CB    1 
ATOM   3263 C  CG    . PHE A 1 442 ? 87.622  -12.798 -22.175 1.00 138.67 ?  509  PHE A CG    1 
ATOM   3264 C  CD1   . PHE A 1 442 ? 86.657  -13.538 -21.504 1.00 146.90 ?  509  PHE A CD1   1 
ATOM   3265 C  CD2   . PHE A 1 442 ? 88.957  -13.089 -21.940 1.00 130.29 ?  509  PHE A CD2   1 
ATOM   3266 C  CE1   . PHE A 1 442 ? 87.020  -14.548 -20.628 1.00 141.44 ?  509  PHE A CE1   1 
ATOM   3267 C  CE2   . PHE A 1 442 ? 89.323  -14.096 -21.067 1.00 142.71 ?  509  PHE A CE2   1 
ATOM   3268 C  CZ    . PHE A 1 442 ? 88.354  -14.826 -20.411 1.00 131.22 ?  509  PHE A CZ    1 
ATOM   3269 N  N     . ARG A 1 443 ? 84.424  -9.498  -23.129 1.00 127.85 ?  510  ARG A N     1 
ATOM   3270 C  CA    . ARG A 1 443 ? 84.049  -8.109  -23.335 1.00 113.41 ?  510  ARG A CA    1 
ATOM   3271 C  C     . ARG A 1 443 ? 84.111  -7.363  -22.010 1.00 106.29 ?  510  ARG A C     1 
ATOM   3272 O  O     . ARG A 1 443 ? 83.894  -7.945  -20.942 1.00 105.38 ?  510  ARG A O     1 
ATOM   3273 C  CB    . ARG A 1 443 ? 82.635  -7.993  -23.918 1.00 95.34  ?  510  ARG A CB    1 
ATOM   3274 C  CG    . ARG A 1 443 ? 81.582  -8.750  -23.118 1.00 107.07 ?  510  ARG A CG    1 
ATOM   3275 C  CD    . ARG A 1 443 ? 80.183  -8.210  -23.369 1.00 114.57 ?  510  ARG A CD    1 
ATOM   3276 N  NE    . ARG A 1 443 ? 79.194  -8.816  -22.479 1.00 106.92 ?  510  ARG A NE    1 
ATOM   3277 C  CZ    . ARG A 1 443 ? 78.827  -8.318  -21.300 1.00 103.27 ?  510  ARG A CZ    1 
ATOM   3278 N  NH1   . ARG A 1 443 ? 77.918  -8.952  -20.572 1.00 110.55 ?  510  ARG A NH1   1 
ATOM   3279 N  NH2   . ARG A 1 443 ? 79.360  -7.192  -20.843 1.00 91.83  ?  510  ARG A NH2   1 
ATOM   3280 N  N     . TRP A 1 444 ? 84.414  -6.069  -22.081 1.00 104.08 ?  511  TRP A N     1 
ATOM   3281 C  CA    . TRP A 1 444 ? 84.282  -5.227  -20.903 1.00 103.44 ?  511  TRP A CA    1 
ATOM   3282 C  C     . TRP A 1 444 ? 82.834  -5.249  -20.430 1.00 95.34  ?  511  TRP A C     1 
ATOM   3283 O  O     . TRP A 1 444 ? 81.901  -5.262  -21.238 1.00 101.09 ?  511  TRP A O     1 
ATOM   3284 C  CB    . TRP A 1 444 ? 84.705  -3.788  -21.206 1.00 102.54 ?  511  TRP A CB    1 
ATOM   3285 C  CG    . TRP A 1 444 ? 86.091  -3.636  -21.764 1.00 114.53 ?  511  TRP A CG    1 
ATOM   3286 C  CD1   . TRP A 1 444 ? 86.437  -3.575  -23.081 1.00 115.58 ?  511  TRP A CD1   1 
ATOM   3287 C  CD2   . TRP A 1 444 ? 87.312  -3.505  -21.021 1.00 122.30 ?  511  TRP A CD2   1 
ATOM   3288 N  NE1   . TRP A 1 444 ? 87.796  -3.420  -23.207 1.00 132.11 ?  511  TRP A NE1   1 
ATOM   3289 C  CE2   . TRP A 1 444 ? 88.356  -3.375  -21.958 1.00 128.88 ?  511  TRP A CE2   1 
ATOM   3290 C  CE3   . TRP A 1 444 ? 87.623  -3.489  -19.658 1.00 128.71 ?  511  TRP A CE3   1 
ATOM   3291 C  CZ2   . TRP A 1 444 ? 89.690  -3.232  -21.576 1.00 129.98 ?  511  TRP A CZ2   1 
ATOM   3292 C  CZ3   . TRP A 1 444 ? 88.948  -3.347  -19.281 1.00 122.30 ?  511  TRP A CZ3   1 
ATOM   3293 C  CH2   . TRP A 1 444 ? 89.964  -3.220  -20.236 1.00 124.98 ?  511  TRP A CH2   1 
ATOM   3294 N  N     . ILE A 1 445 ? 82.644  -5.266  -19.110 1.00 91.42  ?  512  ILE A N     1 
ATOM   3295 C  CA    . ILE A 1 445 ? 81.294  -5.224  -18.571 1.00 82.29  ?  512  ILE A CA    1 
ATOM   3296 C  C     . ILE A 1 445 ? 80.621  -3.938  -19.039 1.00 72.57  ?  512  ILE A C     1 
ATOM   3297 O  O     . ILE A 1 445 ? 81.269  -2.901  -19.226 1.00 76.90  ?  512  ILE A O     1 
ATOM   3298 C  CB    . ILE A 1 445 ? 81.307  -5.322  -17.036 1.00 93.20  ?  512  ILE A CB    1 
ATOM   3299 C  CG1   . ILE A 1 445 ? 81.901  -4.049  -16.421 1.00 86.76  ?  512  ILE A CG1   1 
ATOM   3300 C  CG2   . ILE A 1 445 ? 82.086  -6.558  -16.595 1.00 97.58  ?  512  ILE A CG2   1 
ATOM   3301 C  CD1   . ILE A 1 445 ? 82.045  -4.093  -14.912 1.00 74.86  ?  512  ILE A CD1   1 
ATOM   3302 N  N     . SER A 1 446 ? 79.310  -4.004  -19.244 1.00 66.60  ?  513  SER A N     1 
ATOM   3303 C  CA    . SER A 1 446 ? 78.593  -2.839  -19.732 1.00 68.37  ?  513  SER A CA    1 
ATOM   3304 C  C     . SER A 1 446 ? 78.411  -1.814  -18.615 1.00 56.83  ?  513  SER A C     1 
ATOM   3305 O  O     . SER A 1 446 ? 78.535  -2.116  -17.425 1.00 59.83  ?  513  SER A O     1 
ATOM   3306 C  CB    . SER A 1 446 ? 77.230  -3.237  -20.301 1.00 62.68  ?  513  SER A CB    1 
ATOM   3307 O  OG    . SER A 1 446 ? 76.301  -3.506  -19.267 1.00 59.31  ?  513  SER A OG    1 
ATOM   3308 N  N     . SER A 1 447 ? 78.123  -0.577  -19.020 1.00 58.70  ?  514  SER A N     1 
ATOM   3309 C  CA    . SER A 1 447 ? 77.847  0.469   -18.043 1.00 61.66  ?  514  SER A CA    1 
ATOM   3310 C  C     . SER A 1 447 ? 76.660  0.106   -17.160 1.00 61.86  ?  514  SER A C     1 
ATOM   3311 O  O     . SER A 1 447 ? 76.632  0.468   -15.977 1.00 47.18  ?  514  SER A O     1 
ATOM   3312 C  CB    . SER A 1 447 ? 77.600  1.796   -18.761 1.00 72.83  ?  514  SER A CB    1 
ATOM   3313 O  OG    . SER A 1 447 ? 76.693  1.632   -19.839 1.00 80.54  ?  514  SER A OG    1 
ATOM   3314 N  N     . GLY A 1 448 ? 75.676  -0.610  -17.709 1.00 55.18  ?  515  GLY A N     1 
ATOM   3315 C  CA    . GLY A 1 448 ? 74.532  -1.019  -16.911 1.00 56.83  ?  515  GLY A CA    1 
ATOM   3316 C  C     . GLY A 1 448 ? 74.899  -2.017  -15.829 1.00 53.33  ?  515  GLY A C     1 
ATOM   3317 O  O     . GLY A 1 448 ? 74.407  -1.930  -14.700 1.00 48.53  ?  515  GLY A O     1 
ATOM   3318 N  N     . GLU A 1 449 ? 75.758  -2.985  -16.159 1.00 45.47  ?  516  GLU A N     1 
ATOM   3319 C  CA    . GLU A 1 449 ? 76.247  -3.917  -15.148 1.00 60.21  ?  516  GLU A CA    1 
ATOM   3320 C  C     . GLU A 1 449 ? 77.070  -3.192  -14.091 1.00 55.96  ?  516  GLU A C     1 
ATOM   3321 O  O     . GLU A 1 449 ? 76.926  -3.454  -12.891 1.00 44.41  ?  516  GLU A O     1 
ATOM   3322 C  CB    . GLU A 1 449 ? 77.083  -5.017  -15.802 1.00 61.67  ?  516  GLU A CB    1 
ATOM   3323 C  CG    . GLU A 1 449 ? 76.376  -5.770  -16.914 1.00 79.57  ?  516  GLU A CG    1 
ATOM   3324 C  CD    . GLU A 1 449 ? 77.294  -6.744  -17.625 1.00 98.53  ?  516  GLU A CD    1 
ATOM   3325 O  OE1   . GLU A 1 449 ? 77.284  -7.941  -17.268 1.00 109.27 ?  516  GLU A OE1   1 
ATOM   3326 O  OE2   . GLU A 1 449 ? 78.036  -6.310  -18.532 1.00 83.57  -1 516  GLU A OE2   1 
ATOM   3327 N  N     . TYR A 1 450 ? 77.946  -2.280  -14.520 1.00 52.73  ?  517  TYR A N     1 
ATOM   3328 C  CA    . TYR A 1 450 ? 78.740  -1.513  -13.568 1.00 51.70  ?  517  TYR A CA    1 
ATOM   3329 C  C     . TYR A 1 450 ? 77.846  -0.674  -12.664 1.00 46.52  ?  517  TYR A C     1 
ATOM   3330 O  O     . TYR A 1 450 ? 78.077  -0.596  -11.452 1.00 50.40  ?  517  TYR A O     1 
ATOM   3331 C  CB    . TYR A 1 450 ? 79.740  -0.626  -14.313 1.00 63.28  ?  517  TYR A CB    1 
ATOM   3332 C  CG    . TYR A 1 450 ? 80.731  0.075   -13.410 1.00 54.05  ?  517  TYR A CG    1 
ATOM   3333 C  CD1   . TYR A 1 450 ? 81.811  -0.609  -12.871 1.00 54.84  ?  517  TYR A CD1   1 
ATOM   3334 C  CD2   . TYR A 1 450 ? 80.588  1.420   -13.099 1.00 55.24  ?  517  TYR A CD2   1 
ATOM   3335 C  CE1   . TYR A 1 450 ? 82.718  0.026   -12.046 1.00 55.21  ?  517  TYR A CE1   1 
ATOM   3336 C  CE2   . TYR A 1 450 ? 81.492  2.064   -12.275 1.00 53.47  ?  517  TYR A CE2   1 
ATOM   3337 C  CZ    . TYR A 1 450 ? 82.554  1.362   -11.752 1.00 56.66  ?  517  TYR A CZ    1 
ATOM   3338 O  OH    . TYR A 1 450 ? 83.453  1.999   -10.930 1.00 67.88  ?  517  TYR A OH    1 
ATOM   3339 N  N     . ILE A 1 451 ? 76.811  -0.050  -13.230 1.00 45.75  ?  518  ILE A N     1 
ATOM   3340 C  CA    . ILE A 1 451 ? 75.900  0.752   -12.418 1.00 50.67  ?  518  ILE A CA    1 
ATOM   3341 C  C     . ILE A 1 451 ? 75.166  -0.131  -11.418 1.00 47.83  ?  518  ILE A C     1 
ATOM   3342 O  O     . ILE A 1 451 ? 75.010  0.230   -10.245 1.00 48.40  ?  518  ILE A O     1 
ATOM   3343 C  CB    . ILE A 1 451 ? 74.917  1.527   -13.317 1.00 47.06  ?  518  ILE A CB    1 
ATOM   3344 C  CG1   . ILE A 1 451 ? 75.656  2.617   -14.100 1.00 58.68  ?  518  ILE A CG1   1 
ATOM   3345 C  CG2   . ILE A 1 451 ? 73.798  2.147   -12.481 1.00 49.28  ?  518  ILE A CG2   1 
ATOM   3346 C  CD1   . ILE A 1 451 ? 74.849  3.222   -15.240 1.00 52.70  ?  518  ILE A CD1   1 
ATOM   3347 N  N     . GLN A 1 452 ? 74.703  -1.301  -11.864 1.00 53.06  ?  519  GLN A N     1 
ATOM   3348 C  CA    . GLN A 1 452 ? 73.942  -2.183  -10.986 1.00 47.61  ?  519  GLN A CA    1 
ATOM   3349 C  C     . GLN A 1 452 ? 74.795  -2.663  -9.819  1.00 44.01  ?  519  GLN A C     1 
ATOM   3350 O  O     . GLN A 1 452 ? 74.368  -2.616  -8.659  1.00 47.97  ?  519  GLN A O     1 
ATOM   3351 C  CB    . GLN A 1 452 ? 73.403  -3.371  -11.784 1.00 58.31  ?  519  GLN A CB    1 
ATOM   3352 C  CG    . GLN A 1 452 ? 72.563  -4.348  -10.967 1.00 75.16  ?  519  GLN A CG    1 
ATOM   3353 C  CD    . GLN A 1 452 ? 71.277  -3.727  -10.450 1.00 75.35  ?  519  GLN A CD    1 
ATOM   3354 O  OE1   . GLN A 1 452 ? 70.707  -2.834  -11.078 1.00 81.53  ?  519  GLN A OE1   1 
ATOM   3355 N  NE2   . GLN A 1 452 ? 70.816  -4.196  -9.296  1.00 66.91  ?  519  GLN A NE2   1 
ATOM   3356 N  N     . MET A 1 453 ? 76.011  -3.129  -10.107 1.00 43.59  ?  520  MET A N     1 
ATOM   3357 C  CA    . MET A 1 453 ? 76.885  -3.649  -9.060  1.00 47.28  ?  520  MET A CA    1 
ATOM   3358 C  C     . MET A 1 453 ? 77.495  -2.524  -8.229  1.00 45.32  ?  520  MET A C     1 
ATOM   3359 O  O     . MET A 1 453 ? 77.461  -2.570  -6.994  1.00 37.08  ?  520  MET A O     1 
ATOM   3360 C  CB    . MET A 1 453 ? 77.980  -4.519  -9.683  1.00 44.16  ?  520  MET A CB    1 
ATOM   3361 C  CG    . MET A 1 453 ? 77.544  -5.953  -9.967  1.00 50.14  ?  520  MET A CG    1 
ATOM   3362 S  SD    . MET A 1 453 ? 78.778  -6.900  -10.881 1.00 54.09  ?  520  MET A SD    1 
ATOM   3363 C  CE    . MET A 1 453 ? 78.626  -6.151  -12.502 1.00 58.61  ?  520  MET A CE    1 
ATOM   3364 N  N     . SER A 1 454 ? 78.059  -1.505  -8.884  1.00 42.43  ?  521  SER A N     1 
ATOM   3365 C  CA    . SER A 1 454 ? 78.652  -0.393  -8.147  1.00 47.62  ?  521  SER A CA    1 
ATOM   3366 C  C     . SER A 1 454 ? 77.626  0.343   -7.297  1.00 46.91  ?  521  SER A C     1 
ATOM   3367 O  O     . SER A 1 454 ? 78.009  1.047   -6.356  1.00 37.41  ?  521  SER A O     1 
ATOM   3368 C  CB    . SER A 1 454 ? 79.315  0.595   -9.108  1.00 44.63  ?  521  SER A CB    1 
ATOM   3369 O  OG    . SER A 1 454 ? 78.351  1.440   -9.712  1.00 47.75  ?  521  SER A OG    1 
ATOM   3370 N  N     . GLY A 1 455 ? 76.337  0.198   -7.604  1.00 41.06  ?  522  GLY A N     1 
ATOM   3371 C  CA    . GLY A 1 455 ? 75.296  0.848   -6.831  1.00 33.18  ?  522  GLY A CA    1 
ATOM   3372 C  C     . GLY A 1 455 ? 75.052  0.236   -5.468  1.00 42.44  ?  522  GLY A C     1 
ATOM   3373 O  O     . GLY A 1 455 ? 74.277  0.798   -4.686  1.00 38.65  ?  522  GLY A O     1 
ATOM   3374 N  N     . ARG A 1 456 ? 75.677  -0.896  -5.166  1.00 39.35  ?  523  ARG A N     1 
ATOM   3375 C  CA    . ARG A 1 456 ? 75.578  -1.488  -3.840  1.00 37.00  ?  523  ARG A CA    1 
ATOM   3376 C  C     . ARG A 1 456 ? 76.603  -0.913  -2.865  1.00 46.57  ?  523  ARG A C     1 
ATOM   3377 O  O     . ARG A 1 456 ? 76.651  -1.344  -1.708  1.00 36.27  ?  523  ARG A O     1 
ATOM   3378 C  CB    . ARG A 1 456 ? 75.727  -3.011  -3.939  1.00 46.60  ?  523  ARG A CB    1 
ATOM   3379 C  CG    . ARG A 1 456 ? 74.659  -3.691  -4.806  1.00 50.91  ?  523  ARG A CG    1 
ATOM   3380 C  CD    . ARG A 1 456 ? 73.291  -3.698  -4.124  1.00 55.41  ?  523  ARG A CD    1 
ATOM   3381 N  NE    . ARG A 1 456 ? 72.648  -2.383  -4.143  1.00 60.21  ?  523  ARG A NE    1 
ATOM   3382 C  CZ    . ARG A 1 456 ? 71.866  -1.905  -3.176  1.00 64.32  ?  523  ARG A CZ    1 
ATOM   3383 N  NH1   . ARG A 1 456 ? 71.617  -2.621  -2.086  1.00 60.41  ?  523  ARG A NH1   1 
ATOM   3384 N  NH2   . ARG A 1 456 ? 71.335  -0.695  -3.295  1.00 63.29  ?  523  ARG A NH2   1 
ATOM   3385 N  N     . ALA A 1 457 ? 77.412  0.051   -3.295  1.00 39.68  ?  524  ALA A N     1 
ATOM   3386 C  CA    . ALA A 1 457 ? 78.289  0.777   -2.389  1.00 46.26  ?  524  ALA A CA    1 
ATOM   3387 C  C     . ALA A 1 457 ? 77.550  1.979   -1.818  1.00 39.12  ?  524  ALA A C     1 
ATOM   3388 O  O     . ALA A 1 457 ? 76.780  2.640   -2.520  1.00 39.76  ?  524  ALA A O     1 
ATOM   3389 C  CB    . ALA A 1 457 ? 79.562  1.234   -3.104  1.00 36.06  ?  524  ALA A CB    1 
ATOM   3390 N  N     . GLY A 1 458 ? 77.783  2.251   -0.537  1.00 41.17  ?  525  GLY A N     1 
ATOM   3391 C  CA    . GLY A 1 458 ? 77.166  3.385   0.120   1.00 44.74  ?  525  GLY A CA    1 
ATOM   3392 C  C     . GLY A 1 458 ? 75.935  3.004   0.913   1.00 41.72  ?  525  GLY A C     1 
ATOM   3393 O  O     . GLY A 1 458 ? 74.841  2.875   0.356   1.00 56.68  ?  525  GLY A O     1 
ATOM   3394 N  N     . ARG A 1 459 ? 76.105  2.813   2.218   1.00 47.98  ?  526  ARG A N     1 
ATOM   3395 C  CA    . ARG A 1 459 ? 74.999  2.484   3.111   1.00 49.68  ?  526  ARG A CA    1 
ATOM   3396 C  C     . ARG A 1 459 ? 74.411  3.787   3.636   1.00 48.40  ?  526  ARG A C     1 
ATOM   3397 O  O     . ARG A 1 459 ? 75.071  4.516   4.383   1.00 50.29  ?  526  ARG A O     1 
ATOM   3398 C  CB    . ARG A 1 459 ? 75.475  1.601   4.261   1.00 48.84  ?  526  ARG A CB    1 
ATOM   3399 C  CG    . ARG A 1 459 ? 76.191  0.335   3.828   1.00 44.33  ?  526  ARG A CG    1 
ATOM   3400 C  CD    . ARG A 1 459 ? 76.863  -0.339  5.008   1.00 51.67  ?  526  ARG A CD    1 
ATOM   3401 N  NE    . ARG A 1 459 ? 77.951  0.475   5.542   1.00 50.93  ?  526  ARG A NE    1 
ATOM   3402 C  CZ    . ARG A 1 459 ? 78.612  0.201   6.662   1.00 51.50  ?  526  ARG A CZ    1 
ATOM   3403 N  NH1   . ARG A 1 459 ? 78.298  -0.870  7.382   1.00 51.51  ?  526  ARG A NH1   1 
ATOM   3404 N  NH2   . ARG A 1 459 ? 79.588  1.003   7.064   1.00 43.61  ?  526  ARG A NH2   1 
ATOM   3405 N  N     . ARG A 1 460 ? 73.174  4.083   3.245   1.00 56.90  ?  527  ARG A N     1 
ATOM   3406 C  CA    . ARG A 1 460 ? 72.536  5.320   3.673   1.00 66.23  ?  527  ARG A CA    1 
ATOM   3407 C  C     . ARG A 1 460 ? 72.474  5.378   5.193   1.00 65.36  ?  527  ARG A C     1 
ATOM   3408 O  O     . ARG A 1 460 ? 72.023  4.432   5.845   1.00 57.65  ?  527  ARG A O     1 
ATOM   3409 C  CB    . ARG A 1 460 ? 71.131  5.427   3.081   1.00 72.39  ?  527  ARG A CB    1 
ATOM   3410 C  CG    . ARG A 1 460 ? 70.494  6.796   3.277   1.00 75.08  ?  527  ARG A CG    1 
ATOM   3411 C  CD    . ARG A 1 460 ? 69.004  6.688   3.549   1.00 90.86  ?  527  ARG A CD    1 
ATOM   3412 N  NE    . ARG A 1 460 ? 68.246  6.300   2.361   1.00 92.94  ?  527  ARG A NE    1 
ATOM   3413 C  CZ    . ARG A 1 460 ? 67.623  7.150   1.548   1.00 82.43  ?  527  ARG A CZ    1 
ATOM   3414 N  NH1   . ARG A 1 460 ? 66.960  6.686   0.497   1.00 73.19  ?  527  ARG A NH1   1 
ATOM   3415 N  NH2   . ARG A 1 460 ? 67.652  8.458   1.777   1.00 72.48  ?  527  ARG A NH2   1 
ATOM   3416 N  N     . GLY A 1 461 ? 72.939  6.491   5.755   1.00 72.34  ?  528  GLY A N     1 
ATOM   3417 C  CA    . GLY A 1 461 ? 72.909  6.686   7.190   1.00 72.62  ?  528  GLY A CA    1 
ATOM   3418 C  C     . GLY A 1 461 ? 74.273  6.608   7.845   1.00 68.13  ?  528  GLY A C     1 
ATOM   3419 O  O     . GLY A 1 461 ? 74.667  7.520   8.578   1.00 89.46  ?  528  GLY A O     1 
ATOM   3420 N  N     . MET A 1 462 ? 75.007  5.527   7.586   1.00 60.27  ?  529  MET A N     1 
ATOM   3421 C  CA    . MET A 1 462 ? 76.287  5.283   8.237   1.00 59.93  ?  529  MET A CA    1 
ATOM   3422 C  C     . MET A 1 462 ? 77.481  5.482   7.311   1.00 62.96  ?  529  MET A C     1 
ATOM   3423 O  O     . MET A 1 462 ? 78.624  5.360   7.764   1.00 54.63  ?  529  MET A O     1 
ATOM   3424 C  CB    . MET A 1 462 ? 76.318  3.865   8.830   1.00 67.09  ?  529  MET A CB    1 
ATOM   3425 C  CG    . MET A 1 462 ? 75.733  2.778   7.941   1.00 61.13  ?  529  MET A CG    1 
ATOM   3426 S  SD    . MET A 1 462 ? 75.563  1.210   8.813   1.00 81.43  ?  529  MET A SD    1 
ATOM   3427 C  CE    . MET A 1 462 ? 74.258  0.441   7.857   1.00 81.01  ?  529  MET A CE    1 
ATOM   3428 N  N     . ASP A 1 463 ? 77.254  5.792   6.038   1.00 58.63  ?  530  ASP A N     1 
ATOM   3429 C  CA    . ASP A 1 463 ? 78.324  6.103   5.102   1.00 47.63  ?  530  ASP A CA    1 
ATOM   3430 C  C     . ASP A 1 463 ? 78.095  7.492   4.529   1.00 54.17  ?  530  ASP A C     1 
ATOM   3431 O  O     . ASP A 1 463 ? 77.015  7.781   4.004   1.00 60.07  ?  530  ASP A O     1 
ATOM   3432 C  CB    . ASP A 1 463 ? 78.392  5.081   3.963   1.00 52.04  ?  530  ASP A CB    1 
ATOM   3433 C  CG    . ASP A 1 463 ? 78.848  3.716   4.426   1.00 49.37  ?  530  ASP A CG    1 
ATOM   3434 O  OD1   . ASP A 1 463 ? 79.531  3.629   5.469   1.00 40.09  ?  530  ASP A OD1   1 
ATOM   3435 O  OD2   . ASP A 1 463 ? 78.528  2.728   3.735   1.00 48.31  ?  530  ASP A OD2   1 
ATOM   3436 N  N     . ASP A 1 464 ? 79.107  8.352   4.639   1.00 61.74  ?  531  ASP A N     1 
ATOM   3437 C  CA    . ASP A 1 464 ? 79.064  9.632   3.946   1.00 64.02  ?  531  ASP A CA    1 
ATOM   3438 C  C     . ASP A 1 464 ? 79.341  9.463   2.460   1.00 60.97  ?  531  ASP A C     1 
ATOM   3439 O  O     . ASP A 1 464 ? 78.814  10.226  1.643   1.00 60.16  ?  531  ASP A O     1 
ATOM   3440 C  CB    . ASP A 1 464 ? 80.075  10.601  4.560   1.00 75.79  ?  531  ASP A CB    1 
ATOM   3441 C  CG    . ASP A 1 464 ? 79.799  10.881  6.024   1.00 95.03  ?  531  ASP A CG    1 
ATOM   3442 O  OD1   . ASP A 1 464 ? 78.617  10.838  6.428   1.00 90.74  ?  531  ASP A OD1   1 
ATOM   3443 O  OD2   . ASP A 1 464 ? 80.765  11.143  6.771   1.00 107.22 -1 531  ASP A OD2   1 
ATOM   3444 N  N     . ARG A 1 465 ? 80.145  8.466   2.098   1.00 49.74  ?  532  ARG A N     1 
ATOM   3445 C  CA    . ARG A 1 465 ? 80.520  8.211   0.718   1.00 50.50  ?  532  ARG A CA    1 
ATOM   3446 C  C     . ARG A 1 465 ? 80.455  6.714   0.455   1.00 53.59  ?  532  ARG A C     1 
ATOM   3447 O  O     . ARG A 1 465 ? 80.503  5.897   1.377   1.00 49.51  ?  532  ARG A O     1 
ATOM   3448 C  CB    . ARG A 1 465 ? 81.936  8.726   0.411   1.00 51.49  ?  532  ARG A CB    1 
ATOM   3449 C  CG    . ARG A 1 465 ? 81.994  9.957   -0.481  1.00 80.69  ?  532  ARG A CG    1 
ATOM   3450 C  CD    . ARG A 1 465 ? 81.249  11.134  0.125   1.00 88.81  ?  532  ARG A CD    1 
ATOM   3451 N  NE    . ARG A 1 465 ? 81.591  12.396  -0.527  1.00 81.17  ?  532  ARG A NE    1 
ATOM   3452 C  CZ    . ARG A 1 465 ? 80.956  13.544  -0.312  1.00 95.64  ?  532  ARG A CZ    1 
ATOM   3453 N  NH1   . ARG A 1 465 ? 79.937  13.597  0.536   1.00 95.67  ?  532  ARG A NH1   1 
ATOM   3454 N  NH2   . ARG A 1 465 ? 81.337  14.643  -0.949  1.00 111.25 ?  532  ARG A NH2   1 
ATOM   3455 N  N     . GLY A 1 466 ? 80.342  6.366   -0.823  1.00 56.28  ?  533  GLY A N     1 
ATOM   3456 C  CA    . GLY A 1 466 ? 80.478  4.994   -1.278  1.00 46.34  ?  533  GLY A CA    1 
ATOM   3457 C  C     . GLY A 1 466 ? 81.725  4.864   -2.136  1.00 42.29  ?  533  GLY A C     1 
ATOM   3458 O  O     . GLY A 1 466 ? 81.977  5.695   -3.009  1.00 52.59  ?  533  GLY A O     1 
ATOM   3459 N  N     . ILE A 1 467 ? 82.500  3.818   -1.869  1.00 42.35  ?  534  ILE A N     1 
ATOM   3460 C  CA    . ILE A 1 467 ? 83.783  3.600   -2.525  1.00 46.13  ?  534  ILE A CA    1 
ATOM   3461 C  C     . ILE A 1 467 ? 83.619  2.475   -3.534  1.00 43.02  ?  534  ILE A C     1 
ATOM   3462 O  O     . ILE A 1 467 ? 83.101  1.403   -3.201  1.00 39.21  ?  534  ILE A O     1 
ATOM   3463 C  CB    . ILE A 1 467 ? 84.886  3.271   -1.504  1.00 40.38  ?  534  ILE A CB    1 
ATOM   3464 C  CG1   . ILE A 1 467 ? 85.049  4.434   -0.521  1.00 44.68  ?  534  ILE A CG1   1 
ATOM   3465 C  CG2   . ILE A 1 467 ? 86.201  2.976   -2.215  1.00 39.27  ?  534  ILE A CG2   1 
ATOM   3466 C  CD1   . ILE A 1 467 ? 85.933  4.119   0.662   1.00 60.93  ?  534  ILE A CD1   1 
ATOM   3467 N  N     . VAL A 1 468 ? 84.056  2.721   -4.766  1.00 40.33  ?  535  VAL A N     1 
ATOM   3468 C  CA    . VAL A 1 468 ? 84.041  1.725   -5.829  1.00 43.39  ?  535  VAL A CA    1 
ATOM   3469 C  C     . VAL A 1 468 ? 85.460  1.592   -6.360  1.00 39.48  ?  535  VAL A C     1 
ATOM   3470 O  O     . VAL A 1 468 ? 86.111  2.598   -6.661  1.00 42.34  ?  535  VAL A O     1 
ATOM   3471 C  CB    . VAL A 1 468 ? 83.067  2.109   -6.958  1.00 45.75  ?  535  VAL A CB    1 
ATOM   3472 C  CG1   . VAL A 1 468 ? 82.901  0.950   -7.934  1.00 44.64  ?  535  VAL A CG1   1 
ATOM   3473 C  CG2   . VAL A 1 468 ? 81.727  2.531   -6.379  1.00 41.63  ?  535  VAL A CG2   1 
ATOM   3474 N  N     . ILE A 1 469 ? 85.937  0.356   -6.468  1.00 47.70  ?  536  ILE A N     1 
ATOM   3475 C  CA    . ILE A 1 469 ? 87.302  0.077   -6.897  1.00 47.56  ?  536  ILE A CA    1 
ATOM   3476 C  C     . ILE A 1 469 ? 87.240  -0.930  -8.034  1.00 52.28  ?  536  ILE A C     1 
ATOM   3477 O  O     . ILE A 1 469 ? 86.698  -2.030  -7.867  1.00 50.85  ?  536  ILE A O     1 
ATOM   3478 C  CB    . ILE A 1 469 ? 88.173  -0.452  -5.745  1.00 50.91  ?  536  ILE A CB    1 
ATOM   3479 C  CG1   . ILE A 1 469 ? 88.215  0.571   -4.605  1.00 46.16  ?  536  ILE A CG1   1 
ATOM   3480 C  CG2   . ILE A 1 469 ? 89.584  -0.760  -6.244  1.00 46.68  ?  536  ILE A CG2   1 
ATOM   3481 C  CD1   . ILE A 1 469 ? 88.897  0.073   -3.346  1.00 47.80  ?  536  ILE A CD1   1 
ATOM   3482 N  N     . LEU A 1 470 ? 87.795  -0.557  -9.182  1.00 54.55  ?  537  LEU A N     1 
ATOM   3483 C  CA    . LEU A 1 470 ? 87.800  -1.392  -10.377 1.00 55.57  ?  537  LEU A CA    1 
ATOM   3484 C  C     . LEU A 1 470 ? 89.228  -1.857  -10.631 1.00 56.57  ?  537  LEU A C     1 
ATOM   3485 O  O     . LEU A 1 470 ? 90.087  -1.057  -11.013 1.00 64.33  ?  537  LEU A O     1 
ATOM   3486 C  CB    . LEU A 1 470 ? 87.252  -0.618  -11.574 1.00 52.09  ?  537  LEU A CB    1 
ATOM   3487 C  CG    . LEU A 1 470 ? 87.280  -1.329  -12.928 1.00 59.77  ?  537  LEU A CG    1 
ATOM   3488 C  CD1   . LEU A 1 470 ? 86.455  -2.604  -12.885 1.00 61.73  ?  537  LEU A CD1   1 
ATOM   3489 C  CD2   . LEU A 1 470 ? 86.780  -0.395  -14.022 1.00 70.59  ?  537  LEU A CD2   1 
ATOM   3490 N  N     . MET A 1 471 ? 89.480  -3.145  -10.413 1.00 52.27  ?  538  MET A N     1 
ATOM   3491 C  CA    . MET A 1 471 ? 90.783  -3.713  -10.730 1.00 58.62  ?  538  MET A CA    1 
ATOM   3492 C  C     . MET A 1 471 ? 90.936  -3.841  -12.241 1.00 68.70  ?  538  MET A C     1 
ATOM   3493 O  O     . MET A 1 471 ? 90.045  -4.356  -12.925 1.00 64.19  ?  538  MET A O     1 
ATOM   3494 C  CB    . MET A 1 471 ? 90.949  -5.076  -10.060 1.00 45.34  ?  538  MET A CB    1 
ATOM   3495 C  CG    . MET A 1 471 ? 91.013  -5.011  -8.546  1.00 51.23  ?  538  MET A CG    1 
ATOM   3496 S  SD    . MET A 1 471 ? 91.102  -6.635  -7.771  1.00 55.44  ?  538  MET A SD    1 
ATOM   3497 C  CE    . MET A 1 471 ? 92.811  -7.078  -8.066  1.00 79.06  ?  538  MET A CE    1 
ATOM   3498 N  N     . VAL A 1 472 ? 92.066  -3.366  -12.759 1.00 72.51  ?  539  VAL A N     1 
ATOM   3499 C  CA    . VAL A 1 472 ? 92.359  -3.390  -14.187 1.00 77.63  ?  539  VAL A CA    1 
ATOM   3500 C  C     . VAL A 1 472 ? 93.705  -4.075  -14.372 1.00 83.60  ?  539  VAL A C     1 
ATOM   3501 O  O     . VAL A 1 472 ? 94.707  -3.648  -13.785 1.00 82.92  ?  539  VAL A O     1 
ATOM   3502 C  CB    . VAL A 1 472 ? 92.380  -1.976  -14.792 1.00 76.94  ?  539  VAL A CB    1 
ATOM   3503 C  CG1   . VAL A 1 472 ? 92.698  -2.032  -16.279 1.00 99.26  ?  539  VAL A CG1   1 
ATOM   3504 C  CG2   . VAL A 1 472 ? 91.047  -1.280  -14.553 1.00 74.22  ?  539  VAL A CG2   1 
ATOM   3505 N  N     . ASP A 1 473 ? 93.730  -5.133  -15.183 1.00 90.83  ?  540  ASP A N     1 
ATOM   3506 C  CA    . ASP A 1 473 ? 94.930  -5.932  -15.381 1.00 97.07  ?  540  ASP A CA    1 
ATOM   3507 C  C     . ASP A 1 473 ? 95.529  -5.785  -16.772 1.00 107.53 ?  540  ASP A C     1 
ATOM   3508 O  O     . ASP A 1 473 ? 96.546  -6.424  -17.061 1.00 119.91 ?  540  ASP A O     1 
ATOM   3509 C  CB    . ASP A 1 473 ? 94.630  -7.413  -15.118 1.00 104.97 ?  540  ASP A CB    1 
ATOM   3510 C  CG    . ASP A 1 473 ? 93.879  -8.069  -16.261 1.00 99.97  ?  540  ASP A CG    1 
ATOM   3511 O  OD1   . ASP A 1 473 ? 93.135  -7.363  -16.973 1.00 98.87  ?  540  ASP A OD1   1 
ATOM   3512 O  OD2   . ASP A 1 473 ? 94.034  -9.294  -16.447 1.00 101.90 ?  540  ASP A OD2   1 
ATOM   3513 N  N     . GLU A 1 474 ? 94.933  -4.974  -17.644 1.00 98.58  ?  541  GLU A N     1 
ATOM   3514 C  CA    . GLU A 1 474 ? 95.454  -4.803  -18.991 1.00 114.98 ?  541  GLU A CA    1 
ATOM   3515 C  C     . GLU A 1 474 ? 95.182  -3.378  -19.453 1.00 123.34 ?  541  GLU A C     1 
ATOM   3516 O  O     . GLU A 1 474 ? 94.605  -2.563  -18.728 1.00 120.83 ?  541  GLU A O     1 
ATOM   3517 C  CB    . GLU A 1 474 ? 94.842  -5.823  -19.960 1.00 113.32 ?  541  GLU A CB    1 
ATOM   3518 C  CG    . GLU A 1 474 ? 93.380  -5.575  -20.309 1.00 113.43 ?  541  GLU A CG    1 
ATOM   3519 C  CD    . GLU A 1 474 ? 92.891  -6.479  -21.424 1.00 126.54 ?  541  GLU A CD    1 
ATOM   3520 O  OE1   . GLU A 1 474 ? 92.852  -6.021  -22.585 1.00 128.02 ?  541  GLU A OE1   1 
ATOM   3521 O  OE2   . GLU A 1 474 ? 92.559  -7.650  -21.142 1.00 115.62 ?  541  GLU A OE2   1 
ATOM   3522 N  N     . LYS A 1 475 ? 95.597  -3.093  -20.683 1.00 131.12 ?  542  LYS A N     1 
ATOM   3523 C  CA    . LYS A 1 475 ? 95.435  -1.765  -21.251 1.00 125.13 ?  542  LYS A CA    1 
ATOM   3524 C  C     . LYS A 1 475 ? 93.960  -1.470  -21.505 1.00 111.26 ?  542  LYS A C     1 
ATOM   3525 O  O     . LYS A 1 475 ? 93.154  -2.372  -21.753 1.00 108.64 ?  542  LYS A O     1 
ATOM   3526 C  CB    . LYS A 1 475 ? 96.234  -1.646  -22.552 1.00 137.74 ?  542  LYS A CB    1 
ATOM   3527 C  CG    . LYS A 1 475 ? 97.722  -1.989  -22.420 1.00 140.11 ?  542  LYS A CG    1 
ATOM   3528 C  CD    . LYS A 1 475 ? 98.023  -3.440  -22.801 1.00 139.69 ?  542  LYS A CD    1 
ATOM   3529 C  CE    . LYS A 1 475 ? 99.524  -3.703  -22.869 1.00 138.71 ?  542  LYS A CE    1 
ATOM   3530 N  NZ    . LYS A 1 475 ? 99.851  -4.945  -23.630 1.00 90.63  ?  542  LYS A NZ    1 
ATOM   3531 N  N     . MET A 1 476 ? 93.610  -0.188  -21.435 1.00 102.33 ?  543  MET A N     1 
ATOM   3532 C  CA    . MET A 1 476 ? 92.240  0.250   -21.661 1.00 109.67 ?  543  MET A CA    1 
ATOM   3533 C  C     . MET A 1 476 ? 92.258  1.754   -21.899 1.00 112.18 ?  543  MET A C     1 
ATOM   3534 O  O     . MET A 1 476 ? 92.958  2.489   -21.198 1.00 104.50 ?  543  MET A O     1 
ATOM   3535 C  CB    . MET A 1 476 ? 91.333  -0.111  -20.475 1.00 127.85 ?  543  MET A CB    1 
ATOM   3536 C  CG    . MET A 1 476 ? 91.036  1.034   -19.513 1.00 130.97 ?  543  MET A CG    1 
ATOM   3537 S  SD    . MET A 1 476 ? 90.064  0.512   -18.085 1.00 131.28 ?  543  MET A SD    1 
ATOM   3538 C  CE    . MET A 1 476 ? 88.456  0.257   -18.828 1.00 119.86 ?  543  MET A CE    1 
ATOM   3539 N  N     . SER A 1 477 ? 91.485  2.199   -22.884 1.00 108.41 ?  544  SER A N     1 
ATOM   3540 C  CA    . SER A 1 477 ? 91.533  3.584   -23.319 1.00 107.53 ?  544  SER A CA    1 
ATOM   3541 C  C     . SER A 1 477 ? 90.667  4.473   -22.432 1.00 113.53 ?  544  SER A C     1 
ATOM   3542 O  O     . SER A 1 477 ? 89.755  3.995   -21.754 1.00 118.87 ?  544  SER A O     1 
ATOM   3543 C  CB    . SER A 1 477 ? 91.065  3.695   -24.766 1.00 110.10 ?  544  SER A CB    1 
ATOM   3544 O  OG    . SER A 1 477 ? 89.689  3.372   -24.880 1.00 116.89 ?  544  SER A OG    1 
ATOM   3545 N  N     . PRO A 1 478 ? 90.937  5.782   -22.417 1.00 116.97 ?  545  PRO A N     1 
ATOM   3546 C  CA    . PRO A 1 478 ? 90.044  6.696   -21.686 1.00 114.76 ?  545  PRO A CA    1 
ATOM   3547 C  C     . PRO A 1 478 ? 88.636  6.731   -22.247 1.00 118.99 ?  545  PRO A C     1 
ATOM   3548 O  O     . PRO A 1 478 ? 87.684  6.973   -21.494 1.00 117.04 ?  545  PRO A O     1 
ATOM   3549 C  CB    . PRO A 1 478 ? 90.740  8.059   -21.827 1.00 117.30 ?  545  PRO A CB    1 
ATOM   3550 C  CG    . PRO A 1 478 ? 92.158  7.744   -22.158 1.00 113.26 ?  545  PRO A CG    1 
ATOM   3551 C  CD    . PRO A 1 478 ? 92.120  6.478   -22.953 1.00 120.91 ?  545  PRO A CD    1 
ATOM   3552 N  N     . THR A 1 479 ? 88.472  6.500   -23.551 1.00 115.09 ?  546  THR A N     1 
ATOM   3553 C  CA    . THR A 1 479 ? 87.142  6.524   -24.151 1.00 124.71 ?  546  THR A CA    1 
ATOM   3554 C  C     . THR A 1 479 ? 86.257  5.441   -23.548 1.00 122.74 ?  546  THR A C     1 
ATOM   3555 O  O     . THR A 1 479 ? 85.212  5.730   -22.954 1.00 113.13 ?  546  THR A O     1 
ATOM   3556 C  CB    . THR A 1 479 ? 87.249  6.354   -25.669 1.00 122.27 ?  546  THR A CB    1 
ATOM   3557 O  OG1   . THR A 1 479 ? 88.069  7.395   -26.213 1.00 131.17 ?  546  THR A OG1   1 
ATOM   3558 C  CG2   . THR A 1 479 ? 85.869  6.409   -26.318 1.00 109.38 ?  546  THR A CG2   1 
ATOM   3559 N  N     . ILE A 1 480 ? 86.665  4.177   -23.689 1.00 115.43 ?  547  ILE A N     1 
ATOM   3560 C  CA    . ILE A 1 480 ? 85.864  3.083   -23.153 1.00 116.95 ?  547  ILE A CA    1 
ATOM   3561 C  C     . ILE A 1 480 ? 85.858  3.121   -21.630 1.00 107.92 ?  547  ILE A C     1 
ATOM   3562 O  O     . ILE A 1 480 ? 84.889  2.686   -20.995 1.00 97.43  ?  547  ILE A O     1 
ATOM   3563 C  CB    . ILE A 1 480 ? 86.376  1.732   -23.687 1.00 109.10 ?  547  ILE A CB    1 
ATOM   3564 C  CG1   . ILE A 1 480 ? 87.763  1.415   -23.129 1.00 99.93  ?  547  ILE A CG1   1 
ATOM   3565 C  CG2   . ILE A 1 480 ? 86.413  1.738   -25.209 1.00 101.05 ?  547  ILE A CG2   1 
ATOM   3566 C  CD1   . ILE A 1 480 ? 87.736  0.430   -21.988 1.00 103.95 ?  547  ILE A CD1   1 
ATOM   3567 N  N     . GLY A 1 481 ? 86.924  3.639   -21.018 1.00 105.21 ?  548  GLY A N     1 
ATOM   3568 C  CA    . GLY A 1 481 ? 86.925  3.807   -19.575 1.00 98.70  ?  548  GLY A CA    1 
ATOM   3569 C  C     . GLY A 1 481 ? 85.877  4.800   -19.109 1.00 96.43  ?  548  GLY A C     1 
ATOM   3570 O  O     . GLY A 1 481 ? 85.260  4.619   -18.057 1.00 93.62  ?  548  GLY A O     1 
ATOM   3571 N  N     . LYS A 1 482 ? 85.663  5.865   -19.886 1.00 93.81  ?  549  LYS A N     1 
ATOM   3572 C  CA    . LYS A 1 482 ? 84.608  6.816   -19.556 1.00 92.21  ?  549  LYS A CA    1 
ATOM   3573 C  C     . LYS A 1 482 ? 83.235  6.231   -19.860 1.00 91.40  ?  549  LYS A C     1 
ATOM   3574 O  O     . LYS A 1 482 ? 82.279  6.451   -19.107 1.00 89.36  ?  549  LYS A O     1 
ATOM   3575 C  CB    . LYS A 1 482 ? 84.818  8.123   -20.320 1.00 100.65 ?  549  LYS A CB    1 
ATOM   3576 C  CG    . LYS A 1 482 ? 83.878  9.244   -19.899 1.00 103.72 ?  549  LYS A CG    1 
ATOM   3577 C  CD    . LYS A 1 482 ? 84.087  10.499  -20.733 1.00 98.82  ?  549  LYS A CD    1 
ATOM   3578 C  CE    . LYS A 1 482 ? 83.155  11.619  -20.294 1.00 119.25 ?  549  LYS A CE    1 
ATOM   3579 N  NZ    . LYS A 1 482 ? 83.252  12.816  -21.175 1.00 122.02 ?  549  LYS A NZ    1 
ATOM   3580 N  N     . GLN A 1 483 ? 83.116  5.486   -20.962 1.00 94.28  ?  550  GLN A N     1 
ATOM   3581 C  CA    . GLN A 1 483 ? 81.870  4.787   -21.258 1.00 96.91  ?  550  GLN A CA    1 
ATOM   3582 C  C     . GLN A 1 483 ? 81.505  3.834   -20.128 1.00 87.45  ?  550  GLN A C     1 
ATOM   3583 O  O     . GLN A 1 483 ? 80.350  3.780   -19.689 1.00 77.05  ?  550  GLN A O     1 
ATOM   3584 C  CB    . GLN A 1 483 ? 81.996  4.022   -22.575 1.00 98.42  ?  550  GLN A CB    1 
ATOM   3585 C  CG    . GLN A 1 483 ? 82.176  4.901   -23.800 1.00 120.46 ?  550  GLN A CG    1 
ATOM   3586 C  CD    . GLN A 1 483 ? 82.462  4.094   -25.052 1.00 132.78 ?  550  GLN A CD    1 
ATOM   3587 O  OE1   . GLN A 1 483 ? 82.646  2.877   -24.991 1.00 118.75 ?  550  GLN A OE1   1 
ATOM   3588 N  NE2   . GLN A 1 483 ? 82.500  4.768   -26.197 1.00 141.16 ?  550  GLN A NE2   1 
ATOM   3589 N  N     . LEU A 1 484 ? 82.486  3.073   -19.641 1.00 88.43  ?  551  LEU A N     1 
ATOM   3590 C  CA    . LEU A 1 484 ? 82.225  2.105   -18.582 1.00 76.73  ?  551  LEU A CA    1 
ATOM   3591 C  C     . LEU A 1 484 ? 81.878  2.800   -17.271 1.00 78.96  ?  551  LEU A C     1 
ATOM   3592 O  O     . LEU A 1 484 ? 80.861  2.487   -16.641 1.00 69.29  ?  551  LEU A O     1 
ATOM   3593 C  CB    . LEU A 1 484 ? 83.438  1.191   -18.407 1.00 71.89  ?  551  LEU A CB    1 
ATOM   3594 C  CG    . LEU A 1 484 ? 83.375  0.179   -17.263 1.00 76.71  ?  551  LEU A CG    1 
ATOM   3595 C  CD1   . LEU A 1 484 ? 82.045  -0.547  -17.257 1.00 95.65  ?  551  LEU A CD1   1 
ATOM   3596 C  CD2   . LEU A 1 484 ? 84.521  -0.813  -17.374 1.00 77.75  ?  551  LEU A CD2   1 
ATOM   3597 N  N     . LEU A 1 485 ? 82.709  3.756   -16.847 1.00 81.44  ?  552  LEU A N     1 
ATOM   3598 C  CA    . LEU A 1 485 ? 82.525  4.394   -15.550 1.00 68.39  ?  552  LEU A CA    1 
ATOM   3599 C  C     . LEU A 1 485 ? 81.525  5.540   -15.583 1.00 70.75  ?  552  LEU A C     1 
ATOM   3600 O  O     . LEU A 1 485 ? 81.021  5.930   -14.524 1.00 72.20  ?  552  LEU A O     1 
ATOM   3601 C  CB    . LEU A 1 485 ? 83.865  4.910   -15.022 1.00 68.37  ?  552  LEU A CB    1 
ATOM   3602 C  CG    . LEU A 1 485 ? 84.746  3.877   -14.315 1.00 66.26  ?  552  LEU A CG    1 
ATOM   3603 C  CD1   . LEU A 1 485 ? 85.266  2.835   -15.289 1.00 80.02  ?  552  LEU A CD1   1 
ATOM   3604 C  CD2   . LEU A 1 485 ? 85.897  4.563   -13.606 1.00 83.47  ?  552  LEU A CD2   1 
ATOM   3605 N  N     . LYS A 1 486 ? 81.224  6.088   -16.761 1.00 80.77  ?  553  LYS A N     1 
ATOM   3606 C  CA    . LYS A 1 486 ? 80.321  7.226   -16.864 1.00 89.67  ?  553  LYS A CA    1 
ATOM   3607 C  C     . LYS A 1 486 ? 79.168  7.015   -17.836 1.00 92.27  ?  553  LYS A C     1 
ATOM   3608 O  O     . LYS A 1 486 ? 78.254  7.847   -17.861 1.00 88.36  ?  553  LYS A O     1 
ATOM   3609 C  CB    . LYS A 1 486 ? 81.098  8.485   -17.280 1.00 96.57  ?  553  LYS A CB    1 
ATOM   3610 C  CG    . LYS A 1 486 ? 80.411  9.791   -16.915 1.00 113.30 ?  553  LYS A CG    1 
ATOM   3611 C  CD    . LYS A 1 486 ? 81.348  10.975  -17.096 1.00 121.00 ?  553  LYS A CD    1 
ATOM   3612 C  CE    . LYS A 1 486 ? 80.651  12.291  -16.800 1.00 126.96 ?  553  LYS A CE    1 
ATOM   3613 N  NZ    . LYS A 1 486 ? 81.580  13.450  -16.916 1.00 126.46 ?  553  LYS A NZ    1 
ATOM   3614 N  N     . GLY A 1 487 ? 79.172  5.942   -18.626 1.00 85.70  ?  554  GLY A N     1 
ATOM   3615 C  CA    . GLY A 1 487 ? 78.065  5.684   -19.525 1.00 80.29  ?  554  GLY A CA    1 
ATOM   3616 C  C     . GLY A 1 487 ? 76.765  5.455   -18.779 1.00 66.56  ?  554  GLY A C     1 
ATOM   3617 O  O     . GLY A 1 487 ? 76.739  5.172   -17.580 1.00 64.03  ?  554  GLY A O     1 
ATOM   3618 N  N     . SER A 1 488 ? 75.664  5.586   -19.510 1.00 61.21  ?  555  SER A N     1 
ATOM   3619 C  CA    . SER A 1 488 ? 74.342  5.423   -18.928 1.00 67.53  ?  555  SER A CA    1 
ATOM   3620 C  C     . SER A 1 488 ? 73.936  3.951   -18.922 1.00 64.10  ?  555  SER A C     1 
ATOM   3621 O  O     . SER A 1 488 ? 74.529  3.109   -19.600 1.00 48.45  ?  555  SER A O     1 
ATOM   3622 C  CB    . SER A 1 488 ? 73.304  6.246   -19.694 1.00 84.37  ?  555  SER A CB    1 
ATOM   3623 O  OG    . SER A 1 488 ? 72.938  5.612   -20.908 1.00 82.24  ?  555  SER A OG    1 
ATOM   3624 N  N     . ALA A 1 489 ? 72.902  3.653   -18.140 1.00 56.55  ?  556  ALA A N     1 
ATOM   3625 C  CA    . ALA A 1 489 ? 72.405  2.294   -18.042 1.00 50.60  ?  556  ALA A CA    1 
ATOM   3626 C  C     . ALA A 1 489 ? 71.954  1.790   -19.413 1.00 44.62  ?  556  ALA A C     1 
ATOM   3627 O  O     . ALA A 1 489 ? 71.778  2.551   -20.368 1.00 44.66  ?  556  ALA A O     1 
ATOM   3628 C  CB    . ALA A 1 489 ? 71.252  2.222   -17.044 1.00 54.22  ?  556  ALA A CB    1 
ATOM   3629 N  N     . ASP A 1 490 ? 71.763  0.483   -19.496 1.00 39.54  ?  557  ASP A N     1 
ATOM   3630 C  CA    . ASP A 1 490 ? 71.308  -0.119  -20.737 1.00 43.70  ?  557  ASP A CA    1 
ATOM   3631 C  C     . ASP A 1 490 ? 69.792  0.018   -20.859 1.00 31.76  ?  557  ASP A C     1 
ATOM   3632 O  O     . ASP A 1 490 ? 69.082  0.028   -19.851 1.00 31.79  ?  557  ASP A O     1 
ATOM   3633 C  CB    . ASP A 1 490 ? 71.695  -1.592  -20.791 1.00 48.76  ?  557  ASP A CB    1 
ATOM   3634 C  CG    . ASP A 1 490 ? 73.153  -1.829  -20.439 1.00 62.08  ?  557  ASP A CG    1 
ATOM   3635 O  OD1   . ASP A 1 490 ? 74.009  -0.999  -20.817 1.00 66.43  -1 557  ASP A OD1   1 
ATOM   3636 O  OD2   . ASP A 1 490 ? 73.441  -2.850  -19.779 1.00 71.77  ?  557  ASP A OD2   1 
ATOM   3637 N  N     . PRO A 1 491 ? 69.271  0.132   -22.077 1.00 32.75  ?  558  PRO A N     1 
ATOM   3638 C  CA    . PRO A 1 491 ? 67.816  0.191   -22.244 1.00 35.31  ?  558  PRO A CA    1 
ATOM   3639 C  C     . PRO A 1 491 ? 67.161  -1.131  -21.883 1.00 33.98  ?  558  PRO A C     1 
ATOM   3640 O  O     . PRO A 1 491 ? 67.780  -2.196  -21.934 1.00 32.96  ?  558  PRO A O     1 
ATOM   3641 C  CB    . PRO A 1 491 ? 67.639  0.514   -23.733 1.00 40.11  ?  558  PRO A CB    1 
ATOM   3642 C  CG    . PRO A 1 491 ? 68.882  0.030   -24.377 1.00 43.01  ?  558  PRO A CG    1 
ATOM   3643 C  CD    . PRO A 1 491 ? 69.978  0.222   -23.366 1.00 41.47  ?  558  PRO A CD    1 
ATOM   3644 N  N     . LEU A 1 492 ? 65.891  -1.047  -21.495 1.00 34.29  ?  559  LEU A N     1 
ATOM   3645 C  CA    . LEU A 1 492 ? 65.078  -2.228  -21.226 1.00 30.89  ?  559  LEU A CA    1 
ATOM   3646 C  C     . LEU A 1 492 ? 64.476  -2.681  -22.551 1.00 30.59  ?  559  LEU A C     1 
ATOM   3647 O  O     . LEU A 1 492 ? 63.550  -2.049  -23.069 1.00 29.35  ?  559  LEU A O     1 
ATOM   3648 C  CB    . LEU A 1 492 ? 63.993  -1.927  -20.195 1.00 26.48  ?  559  LEU A CB    1 
ATOM   3649 C  CG    . LEU A 1 492 ? 63.407  -3.131  -19.447 1.00 37.80  ?  559  LEU A CG    1 
ATOM   3650 C  CD1   . LEU A 1 492 ? 62.548  -2.679  -18.274 1.00 33.47  ?  559  LEU A CD1   1 
ATOM   3651 C  CD2   . LEU A 1 492 ? 62.593  -4.016  -20.371 1.00 38.98  ?  559  LEU A CD2   1 
ATOM   3652 N  N     . ASN A 1 493 ? 65.013  -3.764  -23.103 1.00 27.87  ?  560  ASN A N     1 
ATOM   3653 C  CA    . ASN A 1 493 ? 64.586  -4.291  -24.391 1.00 41.32  ?  560  ASN A CA    1 
ATOM   3654 C  C     . ASN A 1 493 ? 63.761  -5.556  -24.199 1.00 33.18  ?  560  ASN A C     1 
ATOM   3655 O  O     . ASN A 1 493 ? 64.037  -6.365  -23.306 1.00 31.60  ?  560  ASN A O     1 
ATOM   3656 C  CB    . ASN A 1 493 ? 65.790  -4.586  -25.289 1.00 33.94  ?  560  ASN A CB    1 
ATOM   3657 C  CG    . ASN A 1 493 ? 66.440  -3.326  -25.814 1.00 39.99  ?  560  ASN A CG    1 
ATOM   3658 O  OD1   . ASN A 1 493 ? 65.774  -2.309  -26.008 1.00 36.46  ?  560  ASN A OD1   1 
ATOM   3659 N  ND2   . ASN A 1 493 ? 67.747  -3.383  -26.043 1.00 42.76  ?  560  ASN A ND2   1 
ATOM   3660 N  N     . SER A 1 494 ? 62.758  -5.723  -25.055 1.00 35.21  ?  561  SER A N     1 
ATOM   3661 C  CA    . SER A 1 494 ? 61.871  -6.872  -24.956 1.00 30.52  ?  561  SER A CA    1 
ATOM   3662 C  C     . SER A 1 494 ? 62.636  -8.170  -25.176 1.00 33.43  ?  561  SER A C     1 
ATOM   3663 O  O     . SER A 1 494 ? 63.473  -8.276  -26.076 1.00 29.13  ?  561  SER A O     1 
ATOM   3664 C  CB    . SER A 1 494 ? 60.744  -6.761  -25.980 1.00 31.47  ?  561  SER A CB    1 
ATOM   3665 O  OG    . SER A 1 494 ? 59.911  -7.905  -25.937 1.00 28.37  ?  561  SER A OG    1 
ATOM   3666 N  N     . ALA A 1 495 ? 62.342  -9.159  -24.337 1.00 33.89  ?  562  ALA A N     1 
ATOM   3667 C  CA    . ALA A 1 495 ? 62.809  -10.524 -24.527 1.00 38.56  ?  562  ALA A CA    1 
ATOM   3668 C  C     . ALA A 1 495 ? 61.708  -11.432 -25.058 1.00 37.46  ?  562  ALA A C     1 
ATOM   3669 O  O     . ALA A 1 495 ? 61.884  -12.653 -25.089 1.00 31.66  ?  562  ALA A O     1 
ATOM   3670 C  CB    . ALA A 1 495 ? 63.357  -11.080 -23.212 1.00 36.13  ?  562  ALA A CB    1 
ATOM   3671 N  N     . PHE A 1 496 ? 60.583  -10.859 -25.481 1.00 34.15  ?  563  PHE A N     1 
ATOM   3672 C  CA    . PHE A 1 496 ? 59.435  -11.656 -25.888 1.00 39.90  ?  563  PHE A CA    1 
ATOM   3673 C  C     . PHE A 1 496 ? 59.766  -12.527 -27.092 1.00 37.31  ?  563  PHE A C     1 
ATOM   3674 O  O     . PHE A 1 496 ? 60.442  -12.097 -28.031 1.00 29.11  ?  563  PHE A O     1 
ATOM   3675 C  CB    . PHE A 1 496 ? 58.251  -10.742 -26.220 1.00 30.16  ?  563  PHE A CB    1 
ATOM   3676 C  CG    . PHE A 1 496 ? 57.012  -11.482 -26.645 1.00 27.55  ?  563  PHE A CG    1 
ATOM   3677 C  CD1   . PHE A 1 496 ? 56.813  -11.825 -27.973 1.00 33.16  ?  563  PHE A CD1   1 
ATOM   3678 C  CD2   . PHE A 1 496 ? 56.044  -11.827 -25.719 1.00 28.70  ?  563  PHE A CD2   1 
ATOM   3679 C  CE1   . PHE A 1 496 ? 55.675  -12.504 -28.367 1.00 40.37  ?  563  PHE A CE1   1 
ATOM   3680 C  CE2   . PHE A 1 496 ? 54.902  -12.508 -26.106 1.00 34.52  ?  563  PHE A CE2   1 
ATOM   3681 C  CZ    . PHE A 1 496 ? 54.718  -12.846 -27.433 1.00 31.69  ?  563  PHE A CZ    1 
ATOM   3682 N  N     . HIS A 1 497 ? 59.270  -13.760 -27.060 1.00 35.31  ?  564  HIS A N     1 
ATOM   3683 C  CA    . HIS A 1 497 ? 59.310  -14.643 -28.216 1.00 40.06  ?  564  HIS A CA    1 
ATOM   3684 C  C     . HIS A 1 497 ? 58.190  -15.662 -28.058 1.00 36.10  ?  564  HIS A C     1 
ATOM   3685 O  O     . HIS A 1 497 ? 57.678  -15.881 -26.957 1.00 33.55  ?  564  HIS A O     1 
ATOM   3686 C  CB    . HIS A 1 497 ? 60.676  -15.324 -28.363 1.00 34.02  ?  564  HIS A CB    1 
ATOM   3687 C  CG    . HIS A 1 497 ? 61.071  -16.155 -27.183 1.00 37.09  ?  564  HIS A CG    1 
ATOM   3688 N  ND1   . HIS A 1 497 ? 60.532  -17.399 -26.934 1.00 47.32  ?  564  HIS A ND1   1 
ATOM   3689 C  CD2   . HIS A 1 497 ? 61.952  -15.921 -26.181 1.00 38.51  ?  564  HIS A CD2   1 
ATOM   3690 C  CE1   . HIS A 1 497 ? 61.064  -17.895 -25.831 1.00 44.11  ?  564  HIS A CE1   1 
ATOM   3691 N  NE2   . HIS A 1 497 ? 61.929  -17.018 -25.355 1.00 43.82  ?  564  HIS A NE2   1 
ATOM   3692 N  N     . LEU A 1 498 ? 57.808  -16.271 -29.174 1.00 43.87  ?  565  LEU A N     1 
ATOM   3693 C  CA    . LEU A 1 498 ? 56.703  -17.221 -29.164 1.00 39.39  ?  565  LEU A CA    1 
ATOM   3694 C  C     . LEU A 1 498 ? 57.113  -18.523 -28.490 1.00 34.30  ?  565  LEU A C     1 
ATOM   3695 O  O     . LEU A 1 498 ? 58.261  -18.962 -28.596 1.00 37.97  ?  565  LEU A O     1 
ATOM   3696 C  CB    . LEU A 1 498 ? 56.240  -17.504 -30.592 1.00 30.00  ?  565  LEU A CB    1 
ATOM   3697 C  CG    . LEU A 1 498 ? 55.494  -16.374 -31.294 1.00 37.75  ?  565  LEU A CG    1 
ATOM   3698 C  CD1   . LEU A 1 498 ? 55.293  -16.717 -32.757 1.00 45.01  ?  565  LEU A CD1   1 
ATOM   3699 C  CD2   . LEU A 1 498 ? 54.160  -16.113 -30.613 1.00 44.98  ?  565  LEU A CD2   1 
ATOM   3700 N  N     . THR A 1 499 ? 56.165  -19.139 -27.784 1.00 34.10  ?  566  THR A N     1 
ATOM   3701 C  CA    . THR A 1 499 ? 56.325  -20.492 -27.273 1.00 33.64  ?  566  THR A CA    1 
ATOM   3702 C  C     . THR A 1 499 ? 55.076  -21.295 -27.612 1.00 36.12  ?  566  THR A C     1 
ATOM   3703 O  O     . THR A 1 499 ? 53.985  -20.737 -27.776 1.00 30.45  ?  566  THR A O     1 
ATOM   3704 C  CB    . THR A 1 499 ? 56.566  -20.520 -25.753 1.00 32.00  ?  566  THR A CB    1 
ATOM   3705 O  OG1   . THR A 1 499 ? 55.348  -20.218 -25.062 1.00 35.55  ?  566  THR A OG1   1 
ATOM   3706 C  CG2   . THR A 1 499 ? 57.642  -19.513 -25.358 1.00 33.76  ?  566  THR A CG2   1 
ATOM   3707 N  N     . TYR A 1 500 ? 55.244  -22.615 -27.720 1.00 31.02  ?  567  TYR A N     1 
ATOM   3708 C  CA    . TYR A 1 500 ? 54.108  -23.472 -28.047 1.00 30.30  ?  567  TYR A CA    1 
ATOM   3709 C  C     . TYR A 1 500 ? 53.037  -23.403 -26.965 1.00 29.70  ?  567  TYR A C     1 
ATOM   3710 O  O     . TYR A 1 500 ? 51.841  -23.342 -27.271 1.00 30.78  ?  567  TYR A O     1 
ATOM   3711 C  CB    . TYR A 1 500 ? 54.578  -24.912 -28.261 1.00 30.88  ?  567  TYR A CB    1 
ATOM   3712 C  CG    . TYR A 1 500 ? 55.318  -25.102 -29.566 1.00 25.12  ?  567  TYR A CG    1 
ATOM   3713 C  CD1   . TYR A 1 500 ? 54.684  -24.870 -30.781 1.00 28.95  ?  567  TYR A CD1   1 
ATOM   3714 C  CD2   . TYR A 1 500 ? 56.645  -25.511 -29.588 1.00 32.26  ?  567  TYR A CD2   1 
ATOM   3715 C  CE1   . TYR A 1 500 ? 55.346  -25.038 -31.978 1.00 30.22  ?  567  TYR A CE1   1 
ATOM   3716 C  CE2   . TYR A 1 500 ? 57.317  -25.685 -30.784 1.00 28.32  ?  567  TYR A CE2   1 
ATOM   3717 C  CZ    . TYR A 1 500 ? 56.660  -25.446 -31.976 1.00 31.94  ?  567  TYR A CZ    1 
ATOM   3718 O  OH    . TYR A 1 500 ? 57.316  -25.611 -33.172 1.00 48.94  ?  567  TYR A OH    1 
ATOM   3719 N  N     . ASN A 1 501 ? 53.445  -23.400 -25.692 1.00 25.45  ?  568  ASN A N     1 
ATOM   3720 C  CA    . ASN A 1 501 ? 52.476  -23.259 -24.610 1.00 28.33  ?  568  ASN A CA    1 
ATOM   3721 C  C     . ASN A 1 501 ? 51.662  -21.978 -24.767 1.00 34.72  ?  568  ASN A C     1 
ATOM   3722 O  O     . ASN A 1 501 ? 50.440  -21.982 -24.578 1.00 31.36  ?  568  ASN A O     1 
ATOM   3723 C  CB    . ASN A 1 501 ? 53.192  -23.275 -23.259 1.00 35.49  ?  568  ASN A CB    1 
ATOM   3724 C  CG    . ASN A 1 501 ? 52.235  -23.137 -22.087 1.00 35.31  ?  568  ASN A CG    1 
ATOM   3725 O  OD1   . ASN A 1 501 ? 51.637  -22.082 -21.881 1.00 32.65  ?  568  ASN A OD1   1 
ATOM   3726 N  ND2   . ASN A 1 501 ? 52.088  -24.205 -21.311 1.00 33.73  ?  568  ASN A ND2   1 
ATOM   3727 N  N     . MET A 1 502 ? 52.327  -20.873 -25.114 1.00 36.32  ?  569  MET A N     1 
ATOM   3728 C  CA    . MET A 1 502 ? 51.631  -19.608 -25.333 1.00 37.21  ?  569  MET A CA    1 
ATOM   3729 C  C     . MET A 1 502 ? 50.628  -19.725 -26.474 1.00 28.76  ?  569  MET A C     1 
ATOM   3730 O  O     . MET A 1 502 ? 49.456  -19.355 -26.329 1.00 26.83  ?  569  MET A O     1 
ATOM   3731 C  CB    . MET A 1 502 ? 52.660  -18.511 -25.626 1.00 31.61  ?  569  MET A CB    1 
ATOM   3732 C  CG    . MET A 1 502 ? 52.104  -17.175 -26.140 1.00 29.07  ?  569  MET A CG    1 
ATOM   3733 S  SD    . MET A 1 502 ? 53.420  -16.158 -26.876 1.00 35.55  ?  569  MET A SD    1 
ATOM   3734 C  CE    . MET A 1 502 ? 54.590  -16.092 -25.522 1.00 31.02  ?  569  MET A CE    1 
ATOM   3735 N  N     . VAL A 1 503 ? 51.079  -20.228 -27.625 1.00 29.23  ?  570  VAL A N     1 
ATOM   3736 C  CA    . VAL A 1 503 ? 50.219  -20.304 -28.804 1.00 34.59  ?  570  VAL A CA    1 
ATOM   3737 C  C     . VAL A 1 503 ? 49.010  -21.191 -28.526 1.00 37.87  ?  570  VAL A C     1 
ATOM   3738 O  O     . VAL A 1 503 ? 47.872  -20.840 -28.860 1.00 30.18  ?  570  VAL A O     1 
ATOM   3739 C  CB    . VAL A 1 503 ? 51.020  -20.811 -30.017 1.00 33.41  ?  570  VAL A CB    1 
ATOM   3740 C  CG1   . VAL A 1 503 ? 50.108  -21.020 -31.217 1.00 36.69  ?  570  VAL A CG1   1 
ATOM   3741 C  CG2   . VAL A 1 503 ? 52.128  -19.835 -30.360 1.00 31.24  ?  570  VAL A CG2   1 
ATOM   3742 N  N     . LEU A 1 504 ? 49.239  -22.354 -27.910 1.00 30.12  ?  571  LEU A N     1 
ATOM   3743 C  CA    . LEU A 1 504 ? 48.147  -23.296 -27.683 1.00 31.17  ?  571  LEU A CA    1 
ATOM   3744 C  C     . LEU A 1 504 ? 47.127  -22.737 -26.703 1.00 31.56  ?  571  LEU A C     1 
ATOM   3745 O  O     . LEU A 1 504 ? 45.917  -22.851 -26.927 1.00 30.34  ?  571  LEU A O     1 
ATOM   3746 C  CB    . LEU A 1 504 ? 48.697  -24.629 -27.173 1.00 31.45  ?  571  LEU A CB    1 
ATOM   3747 C  CG    . LEU A 1 504 ? 49.405  -25.481 -28.227 1.00 34.48  ?  571  LEU A CG    1 
ATOM   3748 C  CD1   . LEU A 1 504 ? 50.191  -26.604 -27.573 1.00 36.08  ?  571  LEU A CD1   1 
ATOM   3749 C  CD2   . LEU A 1 504 ? 48.391  -26.036 -29.220 1.00 34.49  ?  571  LEU A CD2   1 
ATOM   3750 N  N     . ASN A 1 505 ? 47.591  -22.131 -25.609 1.00 32.51  ?  572  ASN A N     1 
ATOM   3751 C  CA    . ASN A 1 505 ? 46.660  -21.586 -24.628 1.00 33.56  ?  572  ASN A CA    1 
ATOM   3752 C  C     . ASN A 1 505 ? 45.818  -20.469 -25.227 1.00 32.52  ?  572  ASN A C     1 
ATOM   3753 O  O     . ASN A 1 505 ? 44.639  -20.324 -24.884 1.00 29.53  ?  572  ASN A O     1 
ATOM   3754 C  CB    . ASN A 1 505 ? 47.423  -21.087 -23.403 1.00 37.44  ?  572  ASN A CB    1 
ATOM   3755 C  CG    . ASN A 1 505 ? 47.525  -22.136 -22.319 1.00 33.57  ?  572  ASN A CG    1 
ATOM   3756 O  OD1   . ASN A 1 505 ? 46.514  -22.669 -21.861 1.00 38.08  ?  572  ASN A OD1   1 
ATOM   3757 N  ND2   . ASN A 1 505 ? 48.747  -22.450 -21.911 1.00 34.67  ?  572  ASN A ND2   1 
ATOM   3758 N  N     . LEU A 1 506 ? 46.398  -19.675 -26.128 1.00 31.99  ?  573  LEU A N     1 
ATOM   3759 C  CA    . LEU A 1 506 ? 45.644  -18.588 -26.744 1.00 38.12  ?  573  LEU A CA    1 
ATOM   3760 C  C     . LEU A 1 506 ? 44.686  -19.108 -27.808 1.00 33.76  ?  573  LEU A C     1 
ATOM   3761 O  O     . LEU A 1 506 ? 43.591  -18.558 -27.979 1.00 32.29  ?  573  LEU A O     1 
ATOM   3762 C  CB    . LEU A 1 506 ? 46.602  -17.555 -27.339 1.00 32.70  ?  573  LEU A CB    1 
ATOM   3763 C  CG    . LEU A 1 506 ? 47.446  -16.789 -26.316 1.00 38.50  ?  573  LEU A CG    1 
ATOM   3764 C  CD1   . LEU A 1 506 ? 48.502  -15.946 -27.014 1.00 42.45  ?  573  LEU A CD1   1 
ATOM   3765 C  CD2   . LEU A 1 506 ? 46.565  -15.916 -25.432 1.00 34.83  ?  573  LEU A CD2   1 
ATOM   3766 N  N     . LEU A 1 507 ? 45.077  -20.153 -28.540 1.00 34.40  ?  574  LEU A N     1 
ATOM   3767 C  CA    . LEU A 1 507 ? 44.117  -20.854 -29.385 1.00 38.08  ?  574  LEU A CA    1 
ATOM   3768 C  C     . LEU A 1 507 ? 42.965  -21.388 -28.545 1.00 29.53  ?  574  LEU A C     1 
ATOM   3769 O  O     . LEU A 1 507 ? 41.790  -21.197 -28.880 1.00 31.79  ?  574  LEU A O     1 
ATOM   3770 C  CB    . LEU A 1 507 ? 44.805  -21.995 -30.138 1.00 28.17  ?  574  LEU A CB    1 
ATOM   3771 C  CG    . LEU A 1 507 ? 45.800  -21.620 -31.243 1.00 35.69  ?  574  LEU A CG    1 
ATOM   3772 C  CD1   . LEU A 1 507 ? 46.473  -22.869 -31.795 1.00 39.86  ?  574  LEU A CD1   1 
ATOM   3773 C  CD2   . LEU A 1 507 ? 45.113  -20.863 -32.363 1.00 30.16  ?  574  LEU A CD2   1 
ATOM   3774 N  N     . ARG A 1 508 ? 43.294  -22.037 -27.425 1.00 35.38  ?  575  ARG A N     1 
ATOM   3775 C  CA    . ARG A 1 508 ? 42.278  -22.634 -26.564 1.00 38.63  ?  575  ARG A CA    1 
ATOM   3776 C  C     . ARG A 1 508 ? 41.252  -21.602 -26.115 1.00 37.00  ?  575  ARG A C     1 
ATOM   3777 O  O     . ARG A 1 508 ? 40.041  -21.807 -26.261 1.00 43.47  ?  575  ARG A O     1 
ATOM   3778 C  CB    . ARG A 1 508 ? 42.950  -23.282 -25.350 1.00 32.16  ?  575  ARG A CB    1 
ATOM   3779 C  CG    . ARG A 1 508 ? 41.994  -23.660 -24.229 1.00 38.08  ?  575  ARG A CG    1 
ATOM   3780 C  CD    . ARG A 1 508 ? 42.726  -24.299 -23.062 1.00 34.61  ?  575  ARG A CD    1 
ATOM   3781 N  NE    . ARG A 1 508 ? 43.632  -23.370 -22.390 1.00 34.76  ?  575  ARG A NE    1 
ATOM   3782 C  CZ    . ARG A 1 508 ? 43.257  -22.476 -21.477 1.00 32.79  ?  575  ARG A CZ    1 
ATOM   3783 N  NH1   . ARG A 1 508 ? 41.983  -22.364 -21.119 1.00 35.38  ?  575  ARG A NH1   1 
ATOM   3784 N  NH2   . ARG A 1 508 ? 44.162  -21.686 -20.922 1.00 40.03  ?  575  ARG A NH2   1 
ATOM   3785 N  N     . VAL A 1 509 ? 41.718  -20.495 -25.541 1.00 38.29  ?  576  VAL A N     1 
ATOM   3786 C  CA    . VAL A 1 509 ? 40.809  -19.518 -24.955 1.00 38.93  ?  576  VAL A CA    1 
ATOM   3787 C  C     . VAL A 1 509 ? 40.030  -18.826 -26.064 1.00 37.74  ?  576  VAL A C     1 
ATOM   3788 O  O     . VAL A 1 509 ? 40.603  -18.379 -27.067 1.00 37.91  ?  576  VAL A O     1 
ATOM   3789 C  CB    . VAL A 1 509 ? 41.584  -18.511 -24.093 1.00 35.05  ?  576  VAL A CB    1 
ATOM   3790 C  CG1   . VAL A 1 509 ? 40.638  -17.470 -23.505 1.00 39.85  ?  576  VAL A CG1   1 
ATOM   3791 C  CG2   . VAL A 1 509 ? 42.330  -19.238 -22.982 1.00 38.25  ?  576  VAL A CG2   1 
ATOM   3792 N  N     . GLU A 1 510 ? 38.715  -18.750 -25.897 1.00 45.57  ?  577  GLU A N     1 
ATOM   3793 C  CA    . GLU A 1 510 ? 37.866  -18.137 -26.905 1.00 55.57  ?  577  GLU A CA    1 
ATOM   3794 C  C     . GLU A 1 510 ? 37.917  -16.620 -26.784 1.00 47.42  ?  577  GLU A C     1 
ATOM   3795 O  O     . GLU A 1 510 ? 38.163  -16.068 -25.708 1.00 39.89  ?  577  GLU A O     1 
ATOM   3796 C  CB    . GLU A 1 510 ? 36.427  -18.636 -26.767 1.00 59.92  ?  577  GLU A CB    1 
ATOM   3797 C  CG    . GLU A 1 510 ? 35.737  -18.220 -25.478 1.00 78.31  ?  577  GLU A CG    1 
ATOM   3798 C  CD    . GLU A 1 510 ? 34.422  -18.952 -25.260 1.00 93.21  ?  577  GLU A CD    1 
ATOM   3799 O  OE1   . GLU A 1 510 ? 34.439  -20.199 -25.172 1.00 75.76  ?  577  GLU A OE1   1 
ATOM   3800 O  OE2   . GLU A 1 510 ? 33.370  -18.281 -25.187 1.00 93.64  -1 577  GLU A OE2   1 
ATOM   3801 N  N     . GLU A 1 511 ? 37.692  -15.948 -27.914 1.00 44.91  ?  578  GLU A N     1 
ATOM   3802 C  CA    . GLU A 1 511 ? 37.732  -14.490 -27.995 1.00 52.56  ?  578  GLU A CA    1 
ATOM   3803 C  C     . GLU A 1 511 ? 39.148  -13.953 -27.806 1.00 47.74  ?  578  GLU A C     1 
ATOM   3804 O  O     . GLU A 1 511 ? 39.338  -12.844 -27.306 1.00 46.70  ?  578  GLU A O     1 
ATOM   3805 C  CB    . GLU A 1 511 ? 36.778  -13.847 -26.982 1.00 67.14  ?  578  GLU A CB    1 
ATOM   3806 C  CG    . GLU A 1 511 ? 35.322  -14.261 -27.159 1.00 67.69  ?  578  GLU A CG    1 
ATOM   3807 C  CD    . GLU A 1 511 ? 34.409  -13.666 -26.103 1.00 77.64  ?  578  GLU A CD    1 
ATOM   3808 O  OE1   . GLU A 1 511 ? 34.908  -12.941 -25.216 1.00 72.07  ?  578  GLU A OE1   1 
ATOM   3809 O  OE2   . GLU A 1 511 ? 33.189  -13.926 -26.162 1.00 99.79  -1 578  GLU A OE2   1 
ATOM   3810 N  N     . ILE A 1 512 ? 40.145  -14.745 -28.199 1.00 48.89  ?  579  ILE A N     1 
ATOM   3811 C  CA    . ILE A 1 512 ? 41.534  -14.298 -28.229 1.00 40.19  ?  579  ILE A CA    1 
ATOM   3812 C  C     . ILE A 1 512 ? 42.302  -15.288 -29.087 1.00 39.74  ?  579  ILE A C     1 
ATOM   3813 O  O     . ILE A 1 512 ? 41.898  -16.442 -29.240 1.00 41.12  ?  579  ILE A O     1 
ATOM   3814 C  CB    . ILE A 1 512 ? 42.137  -14.189 -26.805 1.00 40.61  ?  579  ILE A CB    1 
ATOM   3815 C  CG1   . ILE A 1 512 ? 43.468  -13.434 -26.853 1.00 38.12  ?  579  ILE A CG1   1 
ATOM   3816 C  CG2   . ILE A 1 512 ? 42.325  -15.573 -26.190 1.00 38.51  ?  579  ILE A CG2   1 
ATOM   3817 C  CD1   . ILE A 1 512 ? 43.991  -13.041 -25.491 1.00 41.89  ?  579  ILE A CD1   1 
ATOM   3818 N  N     . ASN A 1 513 ? 43.412  -14.837 -29.658 1.00 37.77  ?  580  ASN A N     1 
ATOM   3819 C  CA    . ASN A 1 513 ? 44.209  -15.685 -30.532 1.00 40.90  ?  580  ASN A CA    1 
ATOM   3820 C  C     . ASN A 1 513 ? 45.671  -15.298 -30.392 1.00 40.81  ?  580  ASN A C     1 
ATOM   3821 O  O     . ASN A 1 513 ? 45.988  -14.223 -29.869 1.00 38.60  ?  580  ASN A O     1 
ATOM   3822 C  CB    . ASN A 1 513 ? 43.752  -15.565 -31.991 1.00 44.32  ?  580  ASN A CB    1 
ATOM   3823 C  CG    . ASN A 1 513 ? 43.542  -14.133 -32.417 1.00 56.94  ?  580  ASN A CG    1 
ATOM   3824 O  OD1   . ASN A 1 513 ? 44.129  -13.211 -31.850 1.00 65.94  ?  580  ASN A OD1   1 
ATOM   3825 N  ND2   . ASN A 1 513 ? 42.698  -13.934 -33.422 1.00 76.13  ?  580  ASN A ND2   1 
ATOM   3826 N  N     . PRO A 1 514 ? 46.590  -16.158 -30.840 1.00 36.58  ?  581  PRO A N     1 
ATOM   3827 C  CA    . PRO A 1 514 ? 48.019  -15.837 -30.703 1.00 39.26  ?  581  PRO A CA    1 
ATOM   3828 C  C     . PRO A 1 514 ? 48.410  -14.523 -31.352 1.00 41.44  ?  581  PRO A C     1 
ATOM   3829 O  O     . PRO A 1 514 ? 49.328  -13.852 -30.864 1.00 36.27  ?  581  PRO A O     1 
ATOM   3830 C  CB    . PRO A 1 514 ? 48.708  -17.028 -31.384 1.00 34.57  ?  581  PRO A CB    1 
ATOM   3831 C  CG    . PRO A 1 514 ? 47.720  -18.137 -31.295 1.00 43.33  ?  581  PRO A CG    1 
ATOM   3832 C  CD    . PRO A 1 514 ? 46.378  -17.492 -31.426 1.00 39.30  ?  581  PRO A CD    1 
ATOM   3833 N  N     . GLU A 1 515 ? 47.743  -14.136 -32.442 1.00 38.88  ?  582  GLU A N     1 
ATOM   3834 C  CA    . GLU A 1 515 ? 48.075  -12.881 -33.107 1.00 43.71  ?  582  GLU A CA    1 
ATOM   3835 C  C     . GLU A 1 515 ? 47.911  -11.693 -32.169 1.00 45.75  ?  582  GLU A C     1 
ATOM   3836 O  O     . GLU A 1 515 ? 48.655  -10.710 -32.274 1.00 41.93  ?  582  GLU A O     1 
ATOM   3837 C  CB    . GLU A 1 515 ? 47.200  -12.689 -34.347 1.00 39.10  ?  582  GLU A CB    1 
ATOM   3838 C  CG    . GLU A 1 515 ? 47.483  -13.664 -35.486 1.00 51.13  ?  582  GLU A CG    1 
ATOM   3839 C  CD    . GLU A 1 515 ? 46.887  -15.045 -35.261 1.00 54.08  ?  582  GLU A CD    1 
ATOM   3840 O  OE1   . GLU A 1 515 ? 46.127  -15.227 -34.284 1.00 43.90  ?  582  GLU A OE1   1 
ATOM   3841 O  OE2   . GLU A 1 515 ? 47.180  -15.953 -36.068 1.00 67.35  -1 582  GLU A OE2   1 
ATOM   3842 N  N     . TYR A 1 516 ? 46.949  -11.760 -31.248 1.00 37.90  ?  583  TYR A N     1 
ATOM   3843 C  CA    . TYR A 1 516 ? 46.734  -10.648 -30.331 1.00 39.26  ?  583  TYR A CA    1 
ATOM   3844 C  C     . TYR A 1 516 ? 47.967  -10.406 -29.470 1.00 46.28  ?  583  TYR A C     1 
ATOM   3845 O  O     . TYR A 1 516 ? 48.417  -9.266  -29.317 1.00 36.21  ?  583  TYR A O     1 
ATOM   3846 C  CB    . TYR A 1 516 ? 45.506  -10.907 -29.455 1.00 38.25  ?  583  TYR A CB    1 
ATOM   3847 C  CG    . TYR A 1 516 ? 45.268  -9.807  -28.444 1.00 55.01  ?  583  TYR A CG    1 
ATOM   3848 C  CD1   . TYR A 1 516 ? 44.622  -8.632  -28.808 1.00 69.90  ?  583  TYR A CD1   1 
ATOM   3849 C  CD2   . TYR A 1 516 ? 45.711  -9.932  -27.134 1.00 58.43  ?  583  TYR A CD2   1 
ATOM   3850 C  CE1   . TYR A 1 516 ? 44.413  -7.616  -27.892 1.00 59.55  ?  583  TYR A CE1   1 
ATOM   3851 C  CE2   . TYR A 1 516 ? 45.507  -8.922  -26.211 1.00 62.97  ?  583  TYR A CE2   1 
ATOM   3852 C  CZ    . TYR A 1 516 ? 44.858  -7.766  -26.596 1.00 66.36  ?  583  TYR A CZ    1 
ATOM   3853 O  OH    . TYR A 1 516 ? 44.653  -6.758  -25.681 1.00 64.92  ?  583  TYR A OH    1 
ATOM   3854 N  N     . MET A 1 517 ? 48.539  -11.470 -28.900 1.00 35.63  ?  584  MET A N     1 
ATOM   3855 C  CA    . MET A 1 517 ? 49.679  -11.274 -28.012 1.00 40.42  ?  584  MET A CA    1 
ATOM   3856 C  C     . MET A 1 517 ? 50.915  -10.813 -28.778 1.00 37.53  ?  584  MET A C     1 
ATOM   3857 O  O     . MET A 1 517 ? 51.735  -10.068 -28.231 1.00 33.32  ?  584  MET A O     1 
ATOM   3858 C  CB    . MET A 1 517 ? 49.976  -12.554 -27.232 1.00 35.91  ?  584  MET A CB    1 
ATOM   3859 C  CG    . MET A 1 517 ? 51.024  -12.353 -26.146 1.00 28.69  ?  584  MET A CG    1 
ATOM   3860 S  SD    . MET A 1 517 ? 50.951  -13.546 -24.806 1.00 49.09  ?  584  MET A SD    1 
ATOM   3861 C  CE    . MET A 1 517 ? 49.416  -13.103 -24.004 1.00 40.90  ?  584  MET A CE    1 
ATOM   3862 N  N     . LEU A 1 518 ? 51.068  -11.237 -30.036 1.00 40.43  ?  585  LEU A N     1 
ATOM   3863 C  CA    . LEU A 1 518 ? 52.189  -10.766 -30.846 1.00 39.60  ?  585  LEU A CA    1 
ATOM   3864 C  C     . LEU A 1 518 ? 52.127  -9.256  -31.044 1.00 38.94  ?  585  LEU A C     1 
ATOM   3865 O  O     . LEU A 1 518 ? 53.109  -8.544  -30.806 1.00 35.81  ?  585  LEU A O     1 
ATOM   3866 C  CB    . LEU A 1 518 ? 52.193  -11.471 -32.202 1.00 44.36  ?  585  LEU A CB    1 
ATOM   3867 C  CG    . LEU A 1 518 ? 52.798  -12.871 -32.282 1.00 58.75  ?  585  LEU A CG    1 
ATOM   3868 C  CD1   . LEU A 1 518 ? 52.642  -13.421 -33.691 1.00 49.45  ?  585  LEU A CD1   1 
ATOM   3869 C  CD2   . LEU A 1 518 ? 54.261  -12.840 -31.882 1.00 70.56  ?  585  LEU A CD2   1 
ATOM   3870 N  N     . GLU A 1 519 ? 50.977  -8.752  -31.499 1.00 34.71  ?  586  GLU A N     1 
ATOM   3871 C  CA    . GLU A 1 519 ? 50.837  -7.330  -31.776 1.00 41.07  ?  586  GLU A CA    1 
ATOM   3872 C  C     . GLU A 1 519 ? 50.950  -6.475  -30.523 1.00 38.29  ?  586  GLU A C     1 
ATOM   3873 O  O     . GLU A 1 519 ? 51.298  -5.293  -30.629 1.00 34.05  ?  586  GLU A O     1 
ATOM   3874 C  CB    . GLU A 1 519 ? 49.495  -7.061  -32.455 1.00 38.71  ?  586  GLU A CB    1 
ATOM   3875 C  CG    . GLU A 1 519 ? 49.341  -7.729  -33.804 1.00 48.48  ?  586  GLU A CG    1 
ATOM   3876 C  CD    . GLU A 1 519 ? 48.102  -7.263  -34.545 1.00 55.51  ?  586  GLU A CD    1 
ATOM   3877 O  OE1   . GLU A 1 519 ? 47.436  -6.321  -34.065 1.00 53.25  ?  586  GLU A OE1   1 
ATOM   3878 O  OE2   . GLU A 1 519 ? 47.796  -7.841  -35.608 1.00 83.02  -1 586  GLU A OE2   1 
ATOM   3879 N  N     . LYS A 1 520 ? 50.662  -7.034  -29.350 1.00 30.68  ?  587  LYS A N     1 
ATOM   3880 C  CA    . LYS A 1 520 ? 50.684  -6.281  -28.105 1.00 30.99  ?  587  LYS A CA    1 
ATOM   3881 C  C     . LYS A 1 520 ? 51.953  -6.505  -27.294 1.00 29.24  ?  587  LYS A C     1 
ATOM   3882 O  O     . LYS A 1 520 ? 52.073  -5.953  -26.197 1.00 30.93  ?  587  LYS A O     1 
ATOM   3883 C  CB    . LYS A 1 520 ? 49.462  -6.643  -27.253 1.00 31.36  ?  587  LYS A CB    1 
ATOM   3884 C  CG    . LYS A 1 520 ? 48.124  -6.469  -27.966 1.00 38.39  ?  587  LYS A CG    1 
ATOM   3885 C  CD    . LYS A 1 520 ? 47.857  -5.021  -28.343 1.00 55.46  ?  587  LYS A CD    1 
ATOM   3886 C  CE    . LYS A 1 520 ? 46.593  -4.889  -29.178 1.00 55.92  ?  587  LYS A CE    1 
ATOM   3887 N  NZ    . LYS A 1 520 ? 46.400  -3.497  -29.673 1.00 59.61  ?  587  LYS A NZ    1 
ATOM   3888 N  N     . SER A 1 521 ? 52.894  -7.302  -27.789 1.00 27.82  ?  588  SER A N     1 
ATOM   3889 C  CA    . SER A 1 521 ? 54.151  -7.473  -27.079 1.00 31.72  ?  588  SER A CA    1 
ATOM   3890 C  C     . SER A 1 521 ? 54.932  -6.163  -27.067 1.00 35.08  ?  588  SER A C     1 
ATOM   3891 O  O     . SER A 1 521 ? 54.769  -5.304  -27.940 1.00 26.30  ?  588  SER A O     1 
ATOM   3892 C  CB    . SER A 1 521 ? 54.992  -8.578  -27.722 1.00 28.31  ?  588  SER A CB    1 
ATOM   3893 O  OG    . SER A 1 521 ? 55.383  -8.229  -29.036 1.00 29.64  ?  588  SER A OG    1 
ATOM   3894 N  N     . PHE A 1 522 ? 55.777  -6.006  -26.047 1.00 29.21  ?  589  PHE A N     1 
ATOM   3895 C  CA    . PHE A 1 522 ? 56.690  -4.870  -26.022 1.00 29.36  ?  589  PHE A CA    1 
ATOM   3896 C  C     . PHE A 1 522 ? 57.708  -4.968  -27.151 1.00 31.52  ?  589  PHE A C     1 
ATOM   3897 O  O     . PHE A 1 522 ? 58.150  -3.940  -27.679 1.00 27.80  ?  589  PHE A O     1 
ATOM   3898 C  CB    . PHE A 1 522 ? 57.383  -4.793  -24.660 1.00 29.26  ?  589  PHE A CB    1 
ATOM   3899 C  CG    . PHE A 1 522 ? 58.194  -3.542  -24.452 1.00 28.65  ?  589  PHE A CG    1 
ATOM   3900 C  CD1   . PHE A 1 522 ? 57.644  -2.294  -24.687 1.00 32.99  ?  589  PHE A CD1   1 
ATOM   3901 C  CD2   . PHE A 1 522 ? 59.500  -3.617  -23.997 1.00 28.58  ?  589  PHE A CD2   1 
ATOM   3902 C  CE1   . PHE A 1 522 ? 58.389  -1.144  -24.488 1.00 29.26  ?  589  PHE A CE1   1 
ATOM   3903 C  CE2   . PHE A 1 522 ? 60.249  -2.469  -23.796 1.00 31.77  ?  589  PHE A CE2   1 
ATOM   3904 C  CZ    . PHE A 1 522 ? 59.690  -1.233  -24.041 1.00 31.80  ?  589  PHE A CZ    1 
ATOM   3905 N  N     . TYR A 1 523 ? 58.076  -6.192  -27.544 1.00 29.88  ?  590  TYR A N     1 
ATOM   3906 C  CA    . TYR A 1 523 ? 58.937  -6.387  -28.707 1.00 25.79  ?  590  TYR A CA    1 
ATOM   3907 C  C     . TYR A 1 523 ? 58.349  -5.709  -29.937 1.00 28.99  ?  590  TYR A C     1 
ATOM   3908 O  O     . TYR A 1 523 ? 59.050  -4.998  -30.665 1.00 29.26  ?  590  TYR A O     1 
ATOM   3909 C  CB    . TYR A 1 523 ? 59.132  -7.886  -28.955 1.00 34.18  ?  590  TYR A CB    1 
ATOM   3910 C  CG    . TYR A 1 523 ? 60.049  -8.234  -30.107 1.00 36.90  ?  590  TYR A CG    1 
ATOM   3911 C  CD1   . TYR A 1 523 ? 61.429  -8.220  -29.950 1.00 41.88  ?  590  TYR A CD1   1 
ATOM   3912 C  CD2   . TYR A 1 523 ? 59.535  -8.602  -31.345 1.00 44.84  ?  590  TYR A CD2   1 
ATOM   3913 C  CE1   . TYR A 1 523 ? 62.272  -8.547  -30.999 1.00 46.95  ?  590  TYR A CE1   1 
ATOM   3914 C  CE2   . TYR A 1 523 ? 60.371  -8.931  -32.399 1.00 40.92  ?  590  TYR A CE2   1 
ATOM   3915 C  CZ    . TYR A 1 523 ? 61.736  -8.903  -32.220 1.00 47.19  ?  590  TYR A CZ    1 
ATOM   3916 O  OH    . TYR A 1 523 ? 62.568  -9.232  -33.267 1.00 56.29  ?  590  TYR A OH    1 
ATOM   3917 N  N     . GLN A 1 524 ? 57.053  -5.914  -30.182 1.00 32.40  ?  591  GLN A N     1 
ATOM   3918 C  CA    . GLN A 1 524 ? 56.404  -5.279  -31.324 1.00 27.66  ?  591  GLN A CA    1 
ATOM   3919 C  C     . GLN A 1 524 ? 56.295  -3.770  -31.133 1.00 34.56  ?  591  GLN A C     1 
ATOM   3920 O  O     . GLN A 1 524 ? 56.411  -3.006  -32.099 1.00 31.52  ?  591  GLN A O     1 
ATOM   3921 C  CB    . GLN A 1 524 ? 55.020  -5.892  -31.542 1.00 29.15  ?  591  GLN A CB    1 
ATOM   3922 C  CG    . GLN A 1 524 ? 54.238  -5.282  -32.699 1.00 32.96  ?  591  GLN A CG    1 
ATOM   3923 C  CD    . GLN A 1 524 ? 54.907  -5.519  -34.038 1.00 33.85  ?  591  GLN A CD    1 
ATOM   3924 O  OE1   . GLN A 1 524 ? 55.245  -6.650  -34.381 1.00 35.59  ?  591  GLN A OE1   1 
ATOM   3925 N  NE2   . GLN A 1 524 ? 55.105  -4.451  -34.800 1.00 37.87  ?  591  GLN A NE2   1 
ATOM   3926 N  N     . PHE A 1 525 ? 56.064  -3.320  -29.898 1.00 30.13  ?  592  PHE A N     1 
ATOM   3927 C  CA    . PHE A 1 525 ? 55.938  -1.887  -29.651 1.00 30.82  ?  592  PHE A CA    1 
ATOM   3928 C  C     . PHE A 1 525 ? 57.267  -1.177  -29.878 1.00 35.83  ?  592  PHE A C     1 
ATOM   3929 O  O     . PHE A 1 525 ? 57.300  -0.067  -30.425 1.00 27.01  ?  592  PHE A O     1 
ATOM   3930 C  CB    . PHE A 1 525 ? 55.432  -1.642  -28.230 1.00 26.46  ?  592  PHE A CB    1 
ATOM   3931 C  CG    . PHE A 1 525 ? 54.970  -0.235  -27.985 1.00 29.64  ?  592  PHE A CG    1 
ATOM   3932 C  CD1   . PHE A 1 525 ? 53.666  0.138   -28.276 1.00 27.70  ?  592  PHE A CD1   1 
ATOM   3933 C  CD2   . PHE A 1 525 ? 55.835  0.716   -27.463 1.00 28.63  ?  592  PHE A CD2   1 
ATOM   3934 C  CE1   . PHE A 1 525 ? 53.234  1.437   -28.054 1.00 32.82  ?  592  PHE A CE1   1 
ATOM   3935 C  CE2   . PHE A 1 525 ? 55.409  2.018   -27.238 1.00 28.70  ?  592  PHE A CE2   1 
ATOM   3936 C  CZ    . PHE A 1 525 ? 54.106  2.377   -27.534 1.00 29.97  ?  592  PHE A CZ    1 
ATOM   3937 N  N     . GLN A 1 526 ? 58.375  -1.805  -29.472 1.00 25.55  ?  593  GLN A N     1 
ATOM   3938 C  CA    . GLN A 1 526 ? 59.689  -1.214  -29.702 1.00 30.41  ?  593  GLN A CA    1 
ATOM   3939 C  C     . GLN A 1 526 ? 59.996  -1.096  -31.188 1.00 34.66  ?  593  GLN A C     1 
ATOM   3940 O  O     . GLN A 1 526 ? 60.650  -0.137  -31.613 1.00 34.54  ?  593  GLN A O     1 
ATOM   3941 C  CB    . GLN A 1 526 ? 60.768  -2.033  -28.993 1.00 27.80  ?  593  GLN A CB    1 
ATOM   3942 C  CG    . GLN A 1 526 ? 60.726  -1.915  -27.476 1.00 30.78  ?  593  GLN A CG    1 
ATOM   3943 C  CD    . GLN A 1 526 ? 61.958  -2.492  -26.804 1.00 28.94  ?  593  GLN A CD    1 
ATOM   3944 O  OE1   . GLN A 1 526 ? 62.213  -3.696  -26.868 1.00 32.70  ?  593  GLN A OE1   1 
ATOM   3945 N  NE2   . GLN A 1 526 ? 62.732  -1.631  -26.160 1.00 31.38  ?  593  GLN A NE2   1 
ATOM   3946 N  N     . HIS A 1 527 ? 59.544  -2.058  -31.997 1.00 30.39  ?  594  HIS A N     1 
ATOM   3947 C  CA    . HIS A 1 527 ? 59.673  -1.916  -33.443 1.00 31.88  ?  594  HIS A CA    1 
ATOM   3948 C  C     . HIS A 1 527 ? 58.892  -0.705  -33.944 1.00 31.92  ?  594  HIS A C     1 
ATOM   3949 O  O     . HIS A 1 527 ? 59.416  0.114   -34.706 1.00 31.61  ?  594  HIS A O     1 
ATOM   3950 C  CB    . HIS A 1 527 ? 59.195  -3.180  -34.153 1.00 28.25  ?  594  HIS A CB    1 
ATOM   3951 C  CG    . HIS A 1 527 ? 59.014  -2.998  -35.627 1.00 32.77  ?  594  HIS A CG    1 
ATOM   3952 N  ND1   . HIS A 1 527 ? 60.065  -3.055  -36.517 1.00 32.39  ?  594  HIS A ND1   1 
ATOM   3953 C  CD2   . HIS A 1 527 ? 57.911  -2.725  -36.364 1.00 34.06  ?  594  HIS A CD2   1 
ATOM   3954 C  CE1   . HIS A 1 527 ? 59.614  -2.843  -37.740 1.00 36.97  ?  594  HIS A CE1   1 
ATOM   3955 N  NE2   . HIS A 1 527 ? 58.311  -2.639  -37.675 1.00 34.01  ?  594  HIS A NE2   1 
ATOM   3956 N  N     . TYR A 1 528 ? 57.625  -0.583  -33.534 1.00 31.71  ?  595  TYR A N     1 
ATOM   3957 C  CA    . TYR A 1 528 ? 56.817  0.564   -33.941 1.00 37.29  ?  595  TYR A CA    1 
ATOM   3958 C  C     . TYR A 1 528 ? 57.532  1.879   -33.656 1.00 39.18  ?  595  TYR A C     1 
ATOM   3959 O  O     . TYR A 1 528 ? 57.495  2.809   -34.471 1.00 32.94  ?  595  TYR A O     1 
ATOM   3960 C  CB    . TYR A 1 528 ? 55.468  0.547   -33.216 1.00 34.57  ?  595  TYR A CB    1 
ATOM   3961 C  CG    . TYR A 1 528 ? 54.462  -0.470  -33.713 1.00 36.65  ?  595  TYR A CG    1 
ATOM   3962 C  CD1   . TYR A 1 528 ? 54.406  -0.837  -35.051 1.00 38.59  ?  595  TYR A CD1   1 
ATOM   3963 C  CD2   . TYR A 1 528 ? 53.553  -1.050  -32.837 1.00 35.48  ?  595  TYR A CD2   1 
ATOM   3964 C  CE1   . TYR A 1 528 ? 53.479  -1.755  -35.500 1.00 43.34  ?  595  TYR A CE1   1 
ATOM   3965 C  CE2   . TYR A 1 528 ? 52.624  -1.973  -33.276 1.00 36.12  ?  595  TYR A CE2   1 
ATOM   3966 C  CZ    . TYR A 1 528 ? 52.591  -2.322  -34.608 1.00 47.32  ?  595  TYR A CZ    1 
ATOM   3967 O  OH    . TYR A 1 528 ? 51.667  -3.240  -35.050 1.00 40.10  ?  595  TYR A OH    1 
ATOM   3968 N  N     . ARG A 1 529 ? 58.182  1.979   -32.497 1.00 36.23  ?  596  ARG A N     1 
ATOM   3969 C  CA    . ARG A 1 529 ? 58.800  3.235   -32.093 1.00 39.26  ?  596  ARG A CA    1 
ATOM   3970 C  C     . ARG A 1 529 ? 60.193  3.415   -32.686 1.00 35.90  ?  596  ARG A C     1 
ATOM   3971 O  O     . ARG A 1 529 ? 60.611  4.552   -32.933 1.00 46.23  ?  596  ARG A O     1 
ATOM   3972 C  CB    . ARG A 1 529 ? 58.855  3.312   -30.565 1.00 30.98  ?  596  ARG A CB    1 
ATOM   3973 C  CG    . ARG A 1 529 ? 57.509  3.609   -29.916 1.00 37.92  ?  596  ARG A CG    1 
ATOM   3974 C  CD    . ARG A 1 529 ? 57.072  5.049   -30.194 1.00 46.76  ?  596  ARG A CD    1 
ATOM   3975 N  NE    . ARG A 1 529 ? 55.868  5.434   -29.458 1.00 37.36  ?  596  ARG A NE    1 
ATOM   3976 C  CZ    . ARG A 1 529 ? 54.642  5.496   -29.975 1.00 46.65  ?  596  ARG A CZ    1 
ATOM   3977 N  NH1   . ARG A 1 529 ? 54.419  5.199   -31.251 1.00 45.75  ?  596  ARG A NH1   1 
ATOM   3978 N  NH2   . ARG A 1 529 ? 53.626  5.863   -29.206 1.00 39.17  ?  596  ARG A NH2   1 
ATOM   3979 N  N     . ALA A 1 530 ? 60.924  2.323   -32.926 1.00 33.99  ?  597  ALA A N     1 
ATOM   3980 C  CA    . ALA A 1 530 ? 62.248  2.444   -33.527 1.00 32.82  ?  597  ALA A CA    1 
ATOM   3981 C  C     . ALA A 1 530 ? 62.164  2.797   -35.006 1.00 39.90  ?  597  ALA A C     1 
ATOM   3982 O  O     . ALA A 1 530 ? 63.052  3.480   -35.529 1.00 40.75  ?  597  ALA A O     1 
ATOM   3983 C  CB    . ALA A 1 530 ? 63.035  1.146   -33.343 1.00 27.09  ?  597  ALA A CB    1 
ATOM   3984 N  N     . ILE A 1 531 ? 61.114  2.347   -35.689 1.00 37.42  ?  598  ILE A N     1 
ATOM   3985 C  CA    . ILE A 1 531 ? 60.921  2.613   -37.113 1.00 34.67  ?  598  ILE A CA    1 
ATOM   3986 C  C     . ILE A 1 531 ? 59.588  3.331   -37.290 1.00 38.26  ?  598  ILE A C     1 
ATOM   3987 O  O     . ILE A 1 531 ? 58.585  2.695   -37.646 1.00 40.70  ?  598  ILE A O     1 
ATOM   3988 C  CB    . ILE A 1 531 ? 60.959  1.315   -37.936 1.00 38.80  ?  598  ILE A CB    1 
ATOM   3989 C  CG1   . ILE A 1 531 ? 62.233  0.516   -37.643 1.00 39.65  ?  598  ILE A CG1   1 
ATOM   3990 C  CG2   . ILE A 1 531 ? 60.850  1.627   -39.423 1.00 40.12  ?  598  ILE A CG2   1 
ATOM   3991 C  CD1   . ILE A 1 531 ? 63.511  1.212   -38.034 1.00 51.62  ?  598  ILE A CD1   1 
ATOM   3992 N  N     . PRO A 1 532 ? 59.521  4.638   -37.050 1.00 42.73  ?  599  PRO A N     1 
ATOM   3993 C  CA    . PRO A 1 532 ? 58.240  5.345   -37.178 1.00 35.65  ?  599  PRO A CA    1 
ATOM   3994 C  C     . PRO A 1 532 ? 57.656  5.194   -38.575 1.00 34.64  ?  599  PRO A C     1 
ATOM   3995 O  O     . PRO A 1 532 ? 58.356  5.334   -39.580 1.00 42.09  ?  599  PRO A O     1 
ATOM   3996 C  CB    . PRO A 1 532 ? 58.609  6.800   -36.868 1.00 37.82  ?  599  PRO A CB    1 
ATOM   3997 C  CG    . PRO A 1 532 ? 59.852  6.706   -36.046 1.00 39.54  ?  599  PRO A CG    1 
ATOM   3998 C  CD    . PRO A 1 532 ? 60.598  5.523   -36.577 1.00 43.33  ?  599  PRO A CD    1 
ATOM   3999 N  N     . GLY A 1 533 ? 56.357  4.901   -38.630 1.00 37.86  ?  600  GLY A N     1 
ATOM   4000 C  CA    . GLY A 1 533 ? 55.654  4.711   -39.876 1.00 42.25  ?  600  GLY A CA    1 
ATOM   4001 C  C     . GLY A 1 533 ? 55.485  3.263   -40.291 1.00 44.87  ?  600  GLY A C     1 
ATOM   4002 O  O     . GLY A 1 533 ? 54.568  2.958   -41.065 1.00 44.02  ?  600  GLY A O     1 
ATOM   4003 N  N     . SER A 1 534 ? 56.338  2.366   -39.803 1.00 34.55  ?  601  SER A N     1 
ATOM   4004 C  CA    . SER A 1 534 ? 56.214  0.957   -40.147 1.00 43.56  ?  601  SER A CA    1 
ATOM   4005 C  C     . SER A 1 534 ? 55.017  0.334   -39.442 1.00 38.38  ?  601  SER A C     1 
ATOM   4006 O  O     . SER A 1 534 ? 54.763  0.596   -38.263 1.00 42.40  ?  601  SER A O     1 
ATOM   4007 C  CB    . SER A 1 534 ? 57.483  0.200   -39.769 1.00 41.47  ?  601  SER A CB    1 
ATOM   4008 O  OG    . SER A 1 534 ? 57.295  -1.196  -39.923 1.00 41.29  ?  601  SER A OG    1 
ATOM   4009 N  N     . ARG A 1 535 ? 54.280  -0.498  -40.179 1.00 45.63  ?  843  ARG A N     1 
ATOM   4010 C  CA    . ARG A 1 535 ? 53.148  -1.239  -39.638 1.00 45.31  ?  843  ARG A CA    1 
ATOM   4011 C  C     . ARG A 1 535 ? 53.371  -2.748  -39.680 1.00 44.07  ?  843  ARG A C     1 
ATOM   4012 O  O     . ARG A 1 535 ? 52.440  -3.508  -39.388 1.00 38.77  ?  843  ARG A O     1 
ATOM   4013 C  CB    . ARG A 1 535 ? 51.869  -0.887  -40.404 1.00 41.56  ?  843  ARG A CB    1 
ATOM   4014 C  CG    . ARG A 1 535 ? 51.548  0.598   -40.459 1.00 45.71  ?  843  ARG A CG    1 
ATOM   4015 C  CD    . ARG A 1 535 ? 50.338  0.871   -41.350 1.00 51.13  ?  843  ARG A CD    1 
ATOM   4016 N  NE    . ARG A 1 535 ? 49.078  0.474   -40.721 1.00 59.03  ?  843  ARG A NE    1 
ATOM   4017 C  CZ    . ARG A 1 535 ? 48.243  1.305   -40.096 1.00 63.20  ?  843  ARG A CZ    1 
ATOM   4018 N  NH1   . ARG A 1 535 ? 48.513  2.602   -40.005 1.00 67.88  ?  843  ARG A NH1   1 
ATOM   4019 N  NH2   . ARG A 1 535 ? 47.127  0.834   -39.558 1.00 58.32  ?  843  ARG A NH2   1 
ATOM   4020 N  N     . THR A 1 536 ? 54.572  -3.204  -40.032 1.00 34.80  ?  844  THR A N     1 
ATOM   4021 C  CA    . THR A 1 536 ? 54.820  -4.635  -40.172 1.00 42.05  ?  844  THR A CA    1 
ATOM   4022 C  C     . THR A 1 536 ? 54.774  -5.312  -38.807 1.00 42.70  ?  844  THR A C     1 
ATOM   4023 O  O     . THR A 1 536 ? 55.514  -4.935  -37.891 1.00 36.44  ?  844  THR A O     1 
ATOM   4024 C  CB    . THR A 1 536 ? 56.170  -4.889  -40.844 1.00 40.26  ?  844  THR A CB    1 
ATOM   4025 O  OG1   . THR A 1 536 ? 57.232  -4.382  -40.025 1.00 40.31  ?  844  THR A OG1   1 
ATOM   4026 C  CG2   . THR A 1 536 ? 56.220  -4.229  -42.218 1.00 42.72  ?  844  THR A CG2   1 
ATOM   4027 N  N     . VAL A 1 537 ? 53.903  -6.308  -38.673 1.00 43.10  ?  845  VAL A N     1 
ATOM   4028 C  CA    . VAL A 1 537 ? 53.831  -7.116  -37.461 1.00 36.82  ?  845  VAL A CA    1 
ATOM   4029 C  C     . VAL A 1 537 ? 54.888  -8.208  -37.571 1.00 35.43  ?  845  VAL A C     1 
ATOM   4030 O  O     . VAL A 1 537 ? 54.781  -9.108  -38.408 1.00 43.14  ?  845  VAL A O     1 
ATOM   4031 C  CB    . VAL A 1 537 ? 52.436  -7.717  -37.260 1.00 43.24  ?  845  VAL A CB    1 
ATOM   4032 C  CG1   . VAL A 1 537 ? 52.398  -8.542  -35.979 1.00 44.18  ?  845  VAL A CG1   1 
ATOM   4033 C  CG2   . VAL A 1 537 ? 51.382  -6.620  -37.227 1.00 39.42  ?  845  VAL A CG2   1 
ATOM   4034 N  N     . LEU A 1 538 ? 55.912  -8.129  -36.727 1.00 37.02  ?  846  LEU A N     1 
ATOM   4035 C  CA    . LEU A 1 538 ? 56.977  -9.114  -36.742 1.00 35.40  ?  846  LEU A CA    1 
ATOM   4036 C  C     . LEU A 1 538 ? 56.472  -10.443 -36.181 1.00 44.67  ?  846  LEU A C     1 
ATOM   4037 O  O     . LEU A 1 538 ? 55.400  -10.532 -35.575 1.00 51.71  ?  846  LEU A O     1 
ATOM   4038 C  CB    . LEU A 1 538 ? 58.172  -8.613  -35.932 1.00 41.78  ?  846  LEU A CB    1 
ATOM   4039 C  CG    . LEU A 1 538 ? 58.640  -7.179  -36.210 1.00 44.92  ?  846  LEU A CG    1 
ATOM   4040 C  CD1   . LEU A 1 538 ? 59.822  -6.817  -35.319 1.00 43.17  ?  846  LEU A CD1   1 
ATOM   4041 C  CD2   . LEU A 1 538 ? 59.003  -6.990  -37.675 1.00 41.25  ?  846  LEU A CD2   1 
ATOM   4042 N  N     . GLN A 1 539 ? 57.258  -11.495 -36.401 1.00 36.55  ?  847  GLN A N     1 
ATOM   4043 C  CA    . GLN A 1 539 ? 57.040  -12.816 -35.819 1.00 53.39  ?  847  GLN A CA    1 
ATOM   4044 C  C     . GLN A 1 539 ? 55.845  -13.554 -36.414 1.00 44.09  ?  847  GLN A C     1 
ATOM   4045 O  O     . GLN A 1 539 ? 55.546  -14.666 -35.966 1.00 45.30  ?  847  GLN A O     1 
ATOM   4046 C  CB    . GLN A 1 539 ? 56.846  -12.750 -34.296 1.00 40.98  ?  847  GLN A CB    1 
ATOM   4047 C  CG    . GLN A 1 539 ? 57.965  -12.042 -33.550 1.00 51.86  ?  847  GLN A CG    1 
ATOM   4048 C  CD    . GLN A 1 539 ? 57.632  -11.813 -32.087 1.00 52.38  ?  847  GLN A CD    1 
ATOM   4049 O  OE1   . GLN A 1 539 ? 56.719  -11.053 -31.755 1.00 62.96  ?  847  GLN A OE1   1 
ATOM   4050 N  NE2   . GLN A 1 539 ? 58.370  -12.472 -31.205 1.00 43.54  ?  847  GLN A NE2   1 
ATOM   4051 N  N     . MET A 1 540 ? 55.144  -12.980 -37.394 1.00 45.44  ?  848  MET A N     1 
ATOM   4052 C  CA    . MET A 1 540 ? 54.004  -13.672 -37.988 1.00 46.61  ?  848  MET A CA    1 
ATOM   4053 C  C     . MET A 1 540 ? 54.448  -14.925 -38.731 1.00 55.72  ?  848  MET A C     1 
ATOM   4054 O  O     . MET A 1 540 ? 53.870  -16.002 -38.549 1.00 54.50  ?  848  MET A O     1 
ATOM   4055 C  CB    . MET A 1 540 ? 53.252  -12.732 -38.926 1.00 46.27  ?  848  MET A CB    1 
ATOM   4056 C  CG    . MET A 1 540 ? 52.274  -11.819 -38.220 1.00 48.01  ?  848  MET A CG    1 
ATOM   4057 S  SD    . MET A 1 540 ? 50.920  -12.720 -37.440 1.00 52.48  ?  848  MET A SD    1 
ATOM   4058 C  CE    . MET A 1 540 ? 49.821  -11.366 -37.026 1.00 69.18  ?  848  MET A CE    1 
ATOM   4059 N  N     . ASP A 1 541 ? 55.470  -14.802 -39.582 1.00 47.25  ?  849  ASP A N     1 
ATOM   4060 C  CA    . ASP A 1 541 ? 55.999  -15.970 -40.276 1.00 42.10  ?  849  ASP A CA    1 
ATOM   4061 C  C     . ASP A 1 541 ? 56.296  -17.098 -39.297 1.00 54.23  ?  849  ASP A C     1 
ATOM   4062 O  O     . ASP A 1 541 ? 55.959  -18.261 -39.553 1.00 49.94  ?  849  ASP A O     1 
ATOM   4063 C  CB    . ASP A 1 541 ? 57.261  -15.586 -41.053 1.00 53.51  ?  849  ASP A CB    1 
ATOM   4064 C  CG    . ASP A 1 541 ? 57.892  -16.767 -41.771 1.00 63.00  ?  849  ASP A CG    1 
ATOM   4065 O  OD1   . ASP A 1 541 ? 57.259  -17.841 -41.841 0.63 65.15  ?  849  ASP A OD1   1 
ATOM   4066 O  OD2   . ASP A 1 541 ? 59.029  -16.619 -42.268 1.00 59.77  -1 849  ASP A OD2   1 
ATOM   4067 N  N     . GLU A 1 542 ? 56.921  -16.772 -38.164 1.00 43.75  ?  850  GLU A N     1 
ATOM   4068 C  CA    . GLU A 1 542 ? 57.228  -17.795 -37.170 1.00 48.89  ?  850  GLU A CA    1 
ATOM   4069 C  C     . GLU A 1 542 ? 55.953  -18.389 -36.584 1.00 49.77  ?  850  GLU A C     1 
ATOM   4070 O  O     . GLU A 1 542 ? 55.881  -19.596 -36.331 1.00 44.00  ?  850  GLU A O     1 
ATOM   4071 C  CB    . GLU A 1 542 ? 58.105  -17.200 -36.068 1.00 45.63  ?  850  GLU A CB    1 
ATOM   4072 C  CG    . GLU A 1 542 ? 58.475  -18.171 -34.955 1.00 41.51  ?  850  GLU A CG    1 
ATOM   4073 C  CD    . GLU A 1 542 ? 59.298  -17.512 -33.862 1.00 55.67  ?  850  GLU A CD    1 
ATOM   4074 O  OE1   . GLU A 1 542 ? 59.764  -16.371 -34.072 1.00 56.94  ?  850  GLU A OE1   1 
ATOM   4075 O  OE2   . GLU A 1 542 ? 59.477  -18.133 -32.792 1.00 51.25  -1 850  GLU A OE2   1 
ATOM   4076 N  N     . LEU A 1 543 ? 54.933  -17.557 -36.359 1.00 39.72  ?  851  LEU A N     1 
ATOM   4077 C  CA    . LEU A 1 543 ? 53.675  -18.067 -35.824 1.00 48.21  ?  851  LEU A CA    1 
ATOM   4078 C  C     . LEU A 1 543 ? 53.062  -19.105 -36.755 1.00 44.85  ?  851  LEU A C     1 
ATOM   4079 O  O     . LEU A 1 543 ? 52.562  -20.139 -36.299 1.00 39.11  ?  851  LEU A O     1 
ATOM   4080 C  CB    . LEU A 1 543 ? 52.695  -16.918 -35.587 1.00 39.40  ?  851  LEU A CB    1 
ATOM   4081 C  CG    . LEU A 1 543 ? 51.286  -17.324 -35.140 1.00 40.67  ?  851  LEU A CG    1 
ATOM   4082 C  CD1   . LEU A 1 543 ? 51.327  -18.055 -33.807 1.00 37.57  ?  851  LEU A CD1   1 
ATOM   4083 C  CD2   . LEU A 1 543 ? 50.375  -16.110 -35.058 1.00 46.54  ?  851  LEU A CD2   1 
ATOM   4084 N  N     . LYS A 1 544 ? 53.086  -18.848 -38.065 1.00 44.63  ?  852  LYS A N     1 
ATOM   4085 C  CA    . LYS A 1 544 ? 52.496  -19.790 -39.010 1.00 51.84  ?  852  LYS A CA    1 
ATOM   4086 C  C     . LYS A 1 544 ? 53.259  -21.108 -39.008 1.00 46.78  ?  852  LYS A C     1 
ATOM   4087 O  O     . LYS A 1 544 ? 52.657  -22.187 -38.961 1.00 54.94  ?  852  LYS A O     1 
ATOM   4088 C  CB    . LYS A 1 544 ? 52.470  -19.188 -40.417 1.00 52.63  ?  852  LYS A CB    1 
ATOM   4089 C  CG    . LYS A 1 544 ? 51.947  -17.754 -40.494 1.00 75.35  ?  852  LYS A CG    1 
ATOM   4090 C  CD    . LYS A 1 544 ? 50.666  -17.540 -39.691 1.00 94.13  ?  852  LYS A CD    1 
ATOM   4091 C  CE    . LYS A 1 544 ? 49.522  -18.410 -40.191 1.00 118.60 ?  852  LYS A CE    1 
ATOM   4092 N  NZ    . LYS A 1 544 ? 48.266  -18.160 -39.429 1.00 159.85 ?  852  LYS A NZ    1 
ATOM   4093 N  N     . CYS A 1 545 ? 54.591  -21.039 -39.050 1.00 42.49  ?  853  CYS A N     1 
ATOM   4094 C  CA    . CYS A 1 545 ? 55.396  -22.255 -39.039 1.00 46.97  ?  853  CYS A CA    1 
ATOM   4095 C  C     . CYS A 1 545 ? 55.157  -23.059 -37.770 1.00 51.75  ?  853  CYS A C     1 
ATOM   4096 O  O     . CYS A 1 545 ? 55.083  -24.294 -37.812 1.00 42.94  ?  853  CYS A O     1 
ATOM   4097 C  CB    . CYS A 1 545 ? 56.878  -21.906 -39.177 1.00 48.65  ?  853  CYS A CB    1 
ATOM   4098 S  SG    . CYS A 1 545 ? 57.307  -21.106 -40.738 1.00 57.86  ?  853  CYS A SG    1 
ATOM   4099 N  N     . ARG A 1 546 ? 55.035  -22.378 -36.627 1.00 40.19  ?  854  ARG A N     1 
ATOM   4100 C  CA    . ARG A 1 546 ? 54.813  -23.090 -35.375 1.00 48.38  ?  854  ARG A CA    1 
ATOM   4101 C  C     . ARG A 1 546 ? 53.440  -23.747 -35.345 1.00 37.23  ?  854  ARG A C     1 
ATOM   4102 O  O     . ARG A 1 546 ? 53.285  -24.828 -34.766 1.00 36.59  ?  854  ARG A O     1 
ATOM   4103 C  CB    . ARG A 1 546 ? 54.982  -22.137 -34.191 1.00 43.20  ?  854  ARG A CB    1 
ATOM   4104 C  CG    . ARG A 1 546 ? 56.410  -21.630 -34.012 1.00 49.27  ?  854  ARG A CG    1 
ATOM   4105 C  CD    . ARG A 1 546 ? 56.531  -20.687 -32.824 1.00 53.09  ?  854  ARG A CD    1 
ATOM   4106 N  NE    . ARG A 1 546 ? 56.899  -21.399 -31.604 1.00 56.66  ?  854  ARG A NE    1 
ATOM   4107 C  CZ    . ARG A 1 546 ? 58.129  -21.462 -31.102 1.00 53.36  ?  854  ARG A CZ    1 
ATOM   4108 N  NH1   . ARG A 1 546 ? 59.140  -20.845 -31.699 1.00 60.43  ?  854  ARG A NH1   1 
ATOM   4109 N  NH2   . ARG A 1 546 ? 58.348  -22.147 -29.986 1.00 65.78  ?  854  ARG A NH2   1 
ATOM   4110 N  N     . LYS A 1 547 ? 52.438  -23.127 -35.970 1.00 35.95  ?  855  LYS A N     1 
ATOM   4111 C  CA    . LYS A 1 547 ? 51.119  -23.746 -36.020 1.00 47.45  ?  855  LYS A CA    1 
ATOM   4112 C  C     . LYS A 1 547 ? 51.122  -24.960 -36.941 1.00 45.83  ?  855  LYS A C     1 
ATOM   4113 O  O     . LYS A 1 547 ? 50.449  -25.959 -36.661 1.00 36.38  ?  855  LYS A O     1 
ATOM   4114 C  CB    . LYS A 1 547 ? 50.072  -22.721 -36.456 1.00 36.51  ?  855  LYS A CB    1 
ATOM   4115 C  CG    . LYS A 1 547 ? 49.811  -21.660 -35.398 1.00 42.38  ?  855  LYS A CG    1 
ATOM   4116 C  CD    . LYS A 1 547 ? 48.424  -21.049 -35.505 1.00 49.76  ?  855  LYS A CD    1 
ATOM   4117 C  CE    . LYS A 1 547 ? 48.271  -20.203 -36.751 1.00 48.01  ?  855  LYS A CE    1 
ATOM   4118 N  NZ    . LYS A 1 547 ? 47.040  -19.373 -36.686 1.00 54.26  ?  855  LYS A NZ    1 
ATOM   4119 N  N     . ARG A 1 548 ? 51.889  -24.903 -38.033 1.00 41.33  ?  856  ARG A N     1 
ATOM   4120 C  CA    . ARG A 1 548 ? 52.046  -26.082 -38.880 1.00 44.87  ?  856  ARG A CA    1 
ATOM   4121 C  C     . ARG A 1 548 ? 52.587  -27.261 -38.082 1.00 40.78  ?  856  ARG A C     1 
ATOM   4122 O  O     . ARG A 1 548 ? 52.114  -28.393 -38.235 1.00 44.62  ?  856  ARG A O     1 
ATOM   4123 C  CB    . ARG A 1 548 ? 52.966  -25.769 -40.061 1.00 46.35  ?  856  ARG A CB    1 
ATOM   4124 C  CG    . ARG A 1 548 ? 52.324  -24.876 -41.110 1.00 66.15  ?  856  ARG A CG    1 
ATOM   4125 C  CD    . ARG A 1 548 ? 52.891  -25.138 -42.494 1.00 75.90  ?  856  ARG A CD    1 
ATOM   4126 N  NE    . ARG A 1 548 ? 54.222  -24.565 -42.664 1.00 72.91  ?  856  ARG A NE    1 
ATOM   4127 C  CZ    . ARG A 1 548 ? 54.475  -23.397 -43.248 1.00 74.66  ?  856  ARG A CZ    1 
ATOM   4128 N  NH1   . ARG A 1 548 ? 53.488  -22.652 -43.733 1.00 66.09  ?  856  ARG A NH1   1 
ATOM   4129 N  NH2   . ARG A 1 548 ? 55.727  -22.972 -43.350 1.00 66.25  ?  856  ARG A NH2   1 
ATOM   4130 N  N     . VAL A 1 549 ? 53.574  -27.017 -37.219 1.00 38.44  ?  857  VAL A N     1 
ATOM   4131 C  CA    . VAL A 1 549 ? 54.087  -28.081 -36.362 1.00 41.78  ?  857  VAL A CA    1 
ATOM   4132 C  C     . VAL A 1 549 ? 52.977  -28.632 -35.478 1.00 36.53  ?  857  VAL A C     1 
ATOM   4133 O  O     . VAL A 1 549 ? 52.848  -29.850 -35.304 1.00 40.71  ?  857  VAL A O     1 
ATOM   4134 C  CB    . VAL A 1 549 ? 55.268  -27.565 -35.522 1.00 40.05  ?  857  VAL A CB    1 
ATOM   4135 C  CG1   . VAL A 1 549 ? 55.682  -28.605 -34.489 1.00 35.94  ?  857  VAL A CG1   1 
ATOM   4136 C  CG2   . VAL A 1 549 ? 56.437  -27.198 -36.425 1.00 45.83  ?  857  VAL A CG2   1 
ATOM   4137 N  N     . LEU A 1 550 ? 52.164  -27.746 -34.900 1.00 39.07  ?  858  LEU A N     1 
ATOM   4138 C  CA    . LEU A 1 550 ? 51.111  -28.188 -33.993 1.00 40.85  ?  858  LEU A CA    1 
ATOM   4139 C  C     . LEU A 1 550 ? 50.060  -29.014 -34.727 1.00 34.17  ?  858  LEU A C     1 
ATOM   4140 O  O     . LEU A 1 550 ? 49.550  -30.002 -34.186 1.00 34.21  ?  858  LEU A O     1 
ATOM   4141 C  CB    . LEU A 1 550 ? 50.473  -26.977 -33.311 1.00 34.13  ?  858  LEU A CB    1 
ATOM   4142 C  CG    . LEU A 1 550 ? 51.383  -26.195 -32.356 1.00 37.57  ?  858  LEU A CG    1 
ATOM   4143 C  CD1   . LEU A 1 550 ? 50.725  -24.890 -31.937 1.00 39.84  ?  858  LEU A CD1   1 
ATOM   4144 C  CD2   . LEU A 1 550 ? 51.738  -27.027 -31.128 1.00 29.34  ?  858  LEU A CD2   1 
ATOM   4145 N  N     . ARG A 1 551 ? 49.720  -28.622 -35.957 1.00 34.19  ?  859  ARG A N     1 
ATOM   4146 C  CA    . ARG A 1 551 ? 48.779  -29.397 -36.758 1.00 38.10  ?  859  ARG A CA    1 
ATOM   4147 C  C     . ARG A 1 551 ? 49.359  -30.756 -37.124 1.00 40.65  ?  859  ARG A C     1 
ATOM   4148 O  O     . ARG A 1 551 ? 48.749  -31.799 -36.860 1.00 46.61  ?  859  ARG A O     1 
ATOM   4149 C  CB    . ARG A 1 551 ? 48.416  -28.627 -38.026 1.00 35.73  ?  859  ARG A CB    1 
ATOM   4150 C  CG    . ARG A 1 551 ? 47.723  -27.302 -37.782 1.00 42.20  ?  859  ARG A CG    1 
ATOM   4151 C  CD    . ARG A 1 551 ? 47.729  -26.468 -39.045 1.00 44.68  ?  859  ARG A CD    1 
ATOM   4152 N  NE    . ARG A 1 551 ? 47.118  -25.161 -38.847 1.00 57.80  ?  859  ARG A NE    1 
ATOM   4153 C  CZ    . ARG A 1 551 ? 47.229  -24.152 -39.704 1.00 57.94  ?  859  ARG A CZ    1 
ATOM   4154 N  NH1   . ARG A 1 551 ? 47.935  -24.298 -40.818 1.00 78.24  ?  859  ARG A NH1   1 
ATOM   4155 N  NH2   . ARG A 1 551 ? 46.638  -22.994 -39.444 1.00 61.06  ?  859  ARG A NH2   1 
ATOM   4156 N  N     . ARG A 1 552 ? 50.544  -30.763 -37.733 1.00 46.75  ?  860  ARG A N     1 
ATOM   4157 C  CA    . ARG A 1 552 ? 51.137  -32.007 -38.208 1.00 45.48  ?  860  ARG A CA    1 
ATOM   4158 C  C     . ARG A 1 552 ? 51.341  -33.021 -37.091 1.00 42.74  ?  860  ARG A C     1 
ATOM   4159 O  O     . ARG A 1 552 ? 51.433  -34.220 -37.373 1.00 51.76  ?  860  ARG A O     1 
ATOM   4160 C  CB    . ARG A 1 552 ? 52.463  -31.702 -38.905 1.00 42.03  ?  860  ARG A CB    1 
ATOM   4161 C  CG    . ARG A 1 552 ? 52.292  -30.847 -40.155 1.00 59.47  ?  860  ARG A CG    1 
ATOM   4162 C  CD    . ARG A 1 552 ? 53.623  -30.429 -40.755 1.00 82.64  ?  860  ARG A CD    1 
ATOM   4163 N  NE    . ARG A 1 552 ? 53.442  -29.553 -41.910 1.00 84.87  ?  860  ARG A NE    1 
ATOM   4164 C  CZ    . ARG A 1 552 ? 54.437  -29.060 -42.641 1.00 86.58  ?  860  ARG A CZ    1 
ATOM   4165 N  NH1   . ARG A 1 552 ? 55.697  -29.357 -42.344 1.00 75.96  ?  860  ARG A NH1   1 
ATOM   4166 N  NH2   . ARG A 1 552 ? 54.173  -28.270 -43.673 1.00 78.98  ?  860  ARG A NH2   1 
ATOM   4167 N  N     . LEU A 1 553 ? 51.401  -32.577 -35.837 1.00 43.11  ?  861  LEU A N     1 
ATOM   4168 C  CA    . LEU A 1 553 ? 51.614  -33.467 -34.702 1.00 34.25  ?  861  LEU A CA    1 
ATOM   4169 C  C     . LEU A 1 553 ? 50.358  -33.656 -33.862 1.00 32.56  ?  861  LEU A C     1 
ATOM   4170 O  O     . LEU A 1 553 ? 50.429  -34.264 -32.788 1.00 40.22  ?  861  LEU A O     1 
ATOM   4171 C  CB    . LEU A 1 553 ? 52.759  -32.944 -33.828 1.00 37.80  ?  861  LEU A CB    1 
ATOM   4172 C  CG    . LEU A 1 553 ? 54.160  -33.062 -34.434 1.00 43.31  ?  861  LEU A CG    1 
ATOM   4173 C  CD1   . LEU A 1 553 ? 55.186  -32.297 -33.605 1.00 42.39  ?  861  LEU A CD1   1 
ATOM   4174 C  CD2   . LEU A 1 553 ? 54.568  -34.523 -34.558 1.00 46.40  ?  861  LEU A CD2   1 
ATOM   4175 N  N     . GLY A 1 554 ? 49.215  -33.148 -34.314 1.00 35.49  ?  862  GLY A N     1 
ATOM   4176 C  CA    . GLY A 1 554 ? 47.964  -33.428 -33.641 1.00 35.54  ?  862  GLY A CA    1 
ATOM   4177 C  C     . GLY A 1 554 ? 47.681  -32.591 -32.417 1.00 40.23  ?  862  GLY A C     1 
ATOM   4178 O  O     . GLY A 1 554 ? 46.830  -32.971 -31.608 1.00 37.24  ?  862  GLY A O     1 
ATOM   4179 N  N     . PHE A 1 555 ? 48.363  -31.456 -32.252 1.00 35.84  ?  863  PHE A N     1 
ATOM   4180 C  CA    . PHE A 1 555 ? 48.049  -30.558 -31.147 1.00 35.13  ?  863  PHE A CA    1 
ATOM   4181 C  C     . PHE A 1 555 ? 46.839  -29.684 -31.456 1.00 32.09  ?  863  PHE A C     1 
ATOM   4182 O  O     . PHE A 1 555 ? 46.113  -29.287 -30.537 1.00 31.85  ?  863  PHE A O     1 
ATOM   4183 C  CB    . PHE A 1 555 ? 49.261  -29.679 -30.824 1.00 32.60  ?  863  PHE A CB    1 
ATOM   4184 C  CG    . PHE A 1 555 ? 50.412  -30.432 -30.217 1.00 34.54  ?  863  PHE A CG    1 
ATOM   4185 C  CD1   . PHE A 1 555 ? 51.358  -31.046 -31.019 1.00 36.95  ?  863  PHE A CD1   1 
ATOM   4186 C  CD2   . PHE A 1 555 ? 50.546  -30.524 -28.843 1.00 33.88  ?  863  PHE A CD2   1 
ATOM   4187 C  CE1   . PHE A 1 555 ? 52.417  -31.738 -30.459 1.00 40.41  ?  863  PHE A CE1   1 
ATOM   4188 C  CE2   . PHE A 1 555 ? 51.599  -31.215 -28.279 1.00 33.06  ?  863  PHE A CE2   1 
ATOM   4189 C  CZ    . PHE A 1 555 ? 52.536  -31.822 -29.086 1.00 38.99  ?  863  PHE A CZ    1 
ATOM   4190 N  N     . ALA A 1 556 ? 46.609  -29.377 -32.730 1.00 28.78  ?  864  ALA A N     1 
ATOM   4191 C  CA    . ALA A 1 556 ? 45.500  -28.528 -33.135 1.00 31.43  ?  864  ALA A CA    1 
ATOM   4192 C  C     . ALA A 1 556 ? 45.067  -28.931 -34.535 1.00 35.04  ?  864  ALA A C     1 
ATOM   4193 O  O     . ALA A 1 556 ? 45.833  -29.529 -35.294 1.00 34.65  ?  864  ALA A O     1 
ATOM   4194 C  CB    . ALA A 1 556 ? 45.886  -27.042 -33.097 1.00 37.13  ?  864  ALA A CB    1 
ATOM   4195 N  N     . THR A 1 557 ? 43.827  -28.588 -34.873 1.00 37.45  ?  865  THR A N     1 
ATOM   4196 C  CA    . THR A 1 557 ? 43.276  -28.933 -36.174 1.00 43.81  ?  865  THR A CA    1 
ATOM   4197 C  C     . THR A 1 557 ? 43.757  -27.952 -37.239 1.00 47.63  ?  865  THR A C     1 
ATOM   4198 O  O     . THR A 1 557 ? 44.313  -26.891 -36.946 1.00 48.63  ?  865  THR A O     1 
ATOM   4199 C  CB    . THR A 1 557 ? 41.748  -28.931 -36.134 1.00 40.62  ?  865  THR A CB    1 
ATOM   4200 O  OG1   . THR A 1 557 ? 41.275  -27.589 -35.960 1.00 44.25  ?  865  THR A OG1   1 
ATOM   4201 C  CG2   . THR A 1 557 ? 41.241  -29.792 -34.995 1.00 35.90  ?  865  THR A CG2   1 
ATOM   4202 N  N     . SER A 1 558 ? 43.516  -28.319 -38.501 1.00 52.87  ?  866  SER A N     1 
ATOM   4203 C  CA    . SER A 1 558 ? 43.836  -27.427 -39.611 1.00 48.60  ?  866  SER A CA    1 
ATOM   4204 C  C     . SER A 1 558 ? 43.212  -26.052 -39.419 1.00 44.55  ?  866  SER A C     1 
ATOM   4205 O  O     . SER A 1 558 ? 43.758  -25.049 -39.894 1.00 54.71  ?  866  SER A O     1 
ATOM   4206 C  CB    . SER A 1 558 ? 43.358  -28.040 -40.928 1.00 56.49  ?  866  SER A CB    1 
ATOM   4207 O  OG    . SER A 1 558 ? 44.020  -29.266 -41.187 1.00 63.03  ?  866  SER A OG    1 
ATOM   4208 N  N     . SER A 1 559 ? 42.076  -25.984 -38.731 1.00 50.34  ?  867  SER A N     1 
ATOM   4209 C  CA    . SER A 1 559 ? 41.402  -24.726 -38.446 1.00 46.45  ?  867  SER A CA    1 
ATOM   4210 C  C     . SER A 1 559 ? 41.882  -24.082 -37.149 1.00 41.81  ?  867  SER A C     1 
ATOM   4211 O  O     . SER A 1 559 ? 41.238  -23.148 -36.659 1.00 44.25  ?  867  SER A O     1 
ATOM   4212 C  CB    . SER A 1 559 ? 39.889  -24.951 -38.384 1.00 41.53  ?  867  SER A CB    1 
ATOM   4213 O  OG    . SER A 1 559 ? 39.412  -25.488 -39.605 1.00 56.39  ?  867  SER A OG    1 
ATOM   4214 N  N     . ASP A 1 560 ? 42.985  -24.566 -36.581 1.00 45.12  ?  868  ASP A N     1 
ATOM   4215 C  CA    . ASP A 1 560 ? 43.570  -23.998 -35.368 1.00 50.31  ?  868  ASP A CA    1 
ATOM   4216 C  C     . ASP A 1 560 ? 42.650  -24.143 -34.159 1.00 44.79  ?  868  ASP A C     1 
ATOM   4217 O  O     . ASP A 1 560 ? 42.647  -23.289 -33.267 1.00 40.70  ?  868  ASP A O     1 
ATOM   4218 C  CB    . ASP A 1 560 ? 43.945  -22.527 -35.574 1.00 51.60  ?  868  ASP A CB    1 
ATOM   4219 C  CG    . ASP A 1 560 ? 44.961  -22.338 -36.682 1.00 48.12  ?  868  ASP A CG    1 
ATOM   4220 O  OD1   . ASP A 1 560 ? 45.827  -23.225 -36.857 1.00 47.79  ?  868  ASP A OD1   1 
ATOM   4221 O  OD2   . ASP A 1 560 ? 44.892  -21.309 -37.386 1.00 61.16  -1 868  ASP A OD2   1 
ATOM   4222 N  N     . VAL A 1 561 ? 41.862  -25.218 -34.118 1.00 46.71  ?  869  VAL A N     1 
ATOM   4223 C  CA    . VAL A 1 561 ? 41.125  -25.599 -32.917 1.00 34.27  ?  869  VAL A CA    1 
ATOM   4224 C  C     . VAL A 1 561 ? 41.983  -26.590 -32.144 1.00 32.39  ?  869  VAL A C     1 
ATOM   4225 O  O     . VAL A 1 561 ? 42.598  -27.489 -32.730 1.00 30.94  ?  869  VAL A O     1 
ATOM   4226 C  CB    . VAL A 1 561 ? 39.750  -26.196 -33.271 1.00 38.03  ?  869  VAL A CB    1 
ATOM   4227 C  CG1   . VAL A 1 561 ? 38.969  -26.524 -32.006 1.00 31.56  ?  869  VAL A CG1   1 
ATOM   4228 C  CG2   . VAL A 1 561 ? 38.958  -25.235 -34.148 1.00 34.49  ?  869  VAL A CG2   1 
ATOM   4229 N  N     . ILE A 1 562 ? 42.035  -26.426 -30.828 1.00 27.59  ?  870  ILE A N     1 
ATOM   4230 C  CA    . ILE A 1 562 ? 42.987  -27.173 -30.013 1.00 30.73  ?  870  ILE A CA    1 
ATOM   4231 C  C     . ILE A 1 562 ? 42.466  -28.586 -29.774 1.00 37.36  ?  870  ILE A C     1 
ATOM   4232 O  O     . ILE A 1 562 ? 41.286  -28.787 -29.456 1.00 28.91  ?  870  ILE A O     1 
ATOM   4233 C  CB    . ILE A 1 562 ? 43.255  -26.445 -28.687 1.00 28.66  ?  870  ILE A CB    1 
ATOM   4234 C  CG1   . ILE A 1 562 ? 44.404  -27.117 -27.933 1.00 30.26  ?  870  ILE A CG1   1 
ATOM   4235 C  CG2   . ILE A 1 562 ? 42.001  -26.415 -27.821 1.00 29.27  ?  870  ILE A CG2   1 
ATOM   4236 C  CD1   . ILE A 1 562 ? 44.937  -26.301 -26.771 1.00 35.80  ?  870  ILE A CD1   1 
ATOM   4237 N  N     . GLU A 1 563 ? 43.352  -29.566 -29.935 1.00 30.24  ?  871  GLU A N     1 
ATOM   4238 C  CA    . GLU A 1 563 ? 43.072  -30.955 -29.611 1.00 34.00  ?  871  GLU A CA    1 
ATOM   4239 C  C     . GLU A 1 563 ? 43.323  -31.210 -28.128 1.00 39.40  ?  871  GLU A C     1 
ATOM   4240 O  O     . GLU A 1 563 ? 43.987  -30.428 -27.442 1.00 30.68  ?  871  GLU A O     1 
ATOM   4241 C  CB    . GLU A 1 563 ? 43.955  -31.889 -30.443 1.00 29.78  ?  871  GLU A CB    1 
ATOM   4242 C  CG    . GLU A 1 563 ? 43.836  -31.702 -31.945 1.00 36.56  ?  871  GLU A CG    1 
ATOM   4243 C  CD    . GLU A 1 563 ? 42.934  -32.739 -32.584 1.00 44.59  ?  871  GLU A CD    1 
ATOM   4244 O  OE1   . GLU A 1 563 ? 43.180  -33.102 -33.754 1.00 43.12  ?  871  GLU A OE1   1 
ATOM   4245 O  OE2   . GLU A 1 563 ? 41.988  -33.197 -31.908 1.00 34.88  -1 871  GLU A OE2   1 
ATOM   4246 N  N     . MET A 1 564 ? 42.785  -32.328 -27.633 1.00 33.75  ?  872  MET A N     1 
ATOM   4247 C  CA    . MET A 1 564 ? 43.061  -32.723 -26.255 1.00 28.46  ?  872  MET A CA    1 
ATOM   4248 C  C     . MET A 1 564 ? 44.560  -32.850 -26.019 1.00 36.56  ?  872  MET A C     1 
ATOM   4249 O  O     . MET A 1 564 ? 45.058  -32.531 -24.932 1.00 26.83  ?  872  MET A O     1 
ATOM   4250 C  CB    . MET A 1 564 ? 42.356  -34.040 -25.931 1.00 37.13  ?  872  MET A CB    1 
ATOM   4251 C  CG    . MET A 1 564 ? 40.856  -33.917 -25.739 1.00 38.40  ?  872  MET A CG    1 
ATOM   4252 S  SD    . MET A 1 564 ? 40.385  -32.829 -24.377 1.00 38.07  ?  872  MET A SD    1 
ATOM   4253 C  CE    . MET A 1 564 ? 41.190  -33.627 -22.990 1.00 37.91  ?  872  MET A CE    1 
ATOM   4254 N  N     . LYS A 1 565 ? 45.295  -33.324 -27.026 1.00 29.80  ?  873  LYS A N     1 
ATOM   4255 C  CA    . LYS A 1 565 ? 46.747  -33.380 -26.923 1.00 31.26  ?  873  LYS A CA    1 
ATOM   4256 C  C     . LYS A 1 565 ? 47.328  -31.992 -26.686 1.00 39.52  ?  873  LYS A C     1 
ATOM   4257 O  O     . LYS A 1 565 ? 48.285  -31.832 -25.918 1.00 30.44  ?  873  LYS A O     1 
ATOM   4258 C  CB    . LYS A 1 565 ? 47.324  -34.001 -28.194 1.00 30.91  ?  873  LYS A CB    1 
ATOM   4259 C  CG    . LYS A 1 565 ? 48.809  -34.285 -28.138 1.00 38.48  ?  873  LYS A CG    1 
ATOM   4260 C  CD    . LYS A 1 565 ? 49.301  -34.856 -29.460 1.00 36.04  ?  873  LYS A CD    1 
ATOM   4261 C  CE    . LYS A 1 565 ? 50.747  -35.301 -29.369 1.00 36.78  ?  873  LYS A CE    1 
ATOM   4262 N  NZ    . LYS A 1 565 ? 51.263  -35.782 -30.682 1.00 38.19  ?  873  LYS A NZ    1 
ATOM   4263 N  N     . GLY A 1 566 ? 46.757  -30.973 -27.334 1.00 33.78  ?  874  GLY A N     1 
ATOM   4264 C  CA    . GLY A 1 566 ? 47.225  -29.614 -27.122 1.00 34.63  ?  874  GLY A CA    1 
ATOM   4265 C  C     . GLY A 1 566 ? 46.953  -29.121 -25.715 1.00 36.06  ?  874  GLY A C     1 
ATOM   4266 O  O     . GLY A 1 566 ? 47.777  -28.417 -25.124 1.00 32.54  ?  874  GLY A O     1 
ATOM   4267 N  N     . ARG A 1 567 ? 45.791  -29.477 -25.160 1.00 25.06  ?  875  ARG A N     1 
ATOM   4268 C  CA    . ARG A 1 567 ? 45.469  -29.081 -23.794 1.00 28.84  ?  875  ARG A CA    1 
ATOM   4269 C  C     . ARG A 1 567 ? 46.437  -29.694 -22.795 1.00 30.57  ?  875  ARG A C     1 
ATOM   4270 O  O     . ARG A 1 567 ? 46.662  -29.127 -21.719 1.00 35.37  ?  875  ARG A O     1 
ATOM   4271 C  CB    . ARG A 1 567 ? 44.034  -29.483 -23.458 1.00 31.56  ?  875  ARG A CB    1 
ATOM   4272 C  CG    . ARG A 1 567 ? 43.000  -28.840 -24.366 1.00 35.03  ?  875  ARG A CG    1 
ATOM   4273 C  CD    . ARG A 1 567 ? 41.584  -29.275 -24.019 1.00 30.39  ?  875  ARG A CD    1 
ATOM   4274 N  NE    . ARG A 1 567 ? 40.620  -28.683 -24.940 1.00 35.70  ?  875  ARG A NE    1 
ATOM   4275 C  CZ    . ARG A 1 567 ? 39.963  -27.547 -24.724 1.00 31.95  ?  875  ARG A CZ    1 
ATOM   4276 N  NH1   . ARG A 1 567 ? 40.146  -26.864 -23.604 1.00 33.21  ?  875  ARG A NH1   1 
ATOM   4277 N  NH2   . ARG A 1 567 ? 39.112  -27.096 -25.635 1.00 30.88  ?  875  ARG A NH2   1 
ATOM   4278 N  N     . VAL A 1 568 ? 47.008  -30.854 -23.120 1.00 30.10  ?  876  VAL A N     1 
ATOM   4279 C  CA    . VAL A 1 568 ? 48.054  -31.419 -22.276 1.00 40.28  ?  876  VAL A CA    1 
ATOM   4280 C  C     . VAL A 1 568 ? 49.285  -30.521 -22.302 1.00 33.73  ?  876  VAL A C     1 
ATOM   4281 O  O     . VAL A 1 568 ? 49.885  -30.234 -21.259 1.00 33.18  ?  876  VAL A O     1 
ATOM   4282 C  CB    . VAL A 1 568 ? 48.376  -32.858 -22.723 1.00 37.85  ?  876  VAL A CB    1 
ATOM   4283 C  CG1   . VAL A 1 568 ? 49.524  -33.442 -21.914 1.00 39.01  ?  876  VAL A CG1   1 
ATOM   4284 C  CG2   . VAL A 1 568 ? 47.139  -33.742 -22.581 1.00 40.41  ?  876  VAL A CG2   1 
ATOM   4285 N  N     . ALA A 1 569 ? 49.671  -30.048 -23.490 1.00 33.95  ?  877  ALA A N     1 
ATOM   4286 C  CA    . ALA A 1 569 ? 50.810  -29.144 -23.596 1.00 33.91  ?  877  ALA A CA    1 
ATOM   4287 C  C     . ALA A 1 569 ? 50.559  -27.833 -22.860 1.00 35.31  ?  877  ALA A C     1 
ATOM   4288 O  O     . ALA A 1 569 ? 51.496  -27.252 -22.301 1.00 31.36  ?  877  ALA A O     1 
ATOM   4289 C  CB    . ALA A 1 569 ? 51.129  -28.875 -25.067 1.00 37.94  ?  877  ALA A CB    1 
ATOM   4290 N  N     . CYS A 1 570 ? 49.308  -27.357 -22.839 1.00 25.92  ?  878  CYS A N     1 
ATOM   4291 C  CA    . CYS A 1 570 ? 48.979  -26.129 -22.120 1.00 33.70  ?  878  CYS A CA    1 
ATOM   4292 C  C     . CYS A 1 570 ? 49.372  -26.194 -20.650 1.00 35.55  ?  878  CYS A C     1 
ATOM   4293 O  O     . CYS A 1 570 ? 49.518  -25.146 -20.013 1.00 33.55  ?  878  CYS A O     1 
ATOM   4294 C  CB    . CYS A 1 570 ? 47.480  -25.831 -22.228 1.00 24.88  ?  878  CYS A CB    1 
ATOM   4295 S  SG    . CYS A 1 570 ? 46.952  -25.190 -23.835 1.00 33.04  ?  878  CYS A SG    1 
ATOM   4296 N  N     . GLU A 1 571 ? 49.535  -27.395 -20.095 1.00 33.21  ?  879  GLU A N     1 
ATOM   4297 C  CA    . GLU A 1 571 ? 49.873  -27.555 -18.687 1.00 31.90  ?  879  GLU A CA    1 
ATOM   4298 C  C     . GLU A 1 571 ? 51.372  -27.459 -18.425 1.00 29.23  ?  879  GLU A C     1 
ATOM   4299 O  O     . GLU A 1 571 ? 51.774  -27.292 -17.268 1.00 37.09  ?  879  GLU A O     1 
ATOM   4300 C  CB    . GLU A 1 571 ? 49.355  -28.907 -18.175 1.00 35.85  ?  879  GLU A CB    1 
ATOM   4301 C  CG    . GLU A 1 571 ? 47.865  -29.167 -18.427 1.00 41.90  ?  879  GLU A CG    1 
ATOM   4302 C  CD    . GLU A 1 571 ? 46.956  -28.426 -17.459 1.00 39.45  ?  879  GLU A CD    1 
ATOM   4303 O  OE1   . GLU A 1 571 ? 47.458  -27.941 -16.423 1.00 45.39  ?  879  GLU A OE1   1 
ATOM   4304 O  OE2   . GLU A 1 571 ? 45.741  -28.330 -17.734 1.00 42.39  -1 879  GLU A OE2   1 
ATOM   4305 N  N     . ILE A 1 572 ? 52.201  -27.555 -19.461 1.00 27.52  ?  880  ILE A N     1 
ATOM   4306 C  CA    . ILE A 1 572 ? 53.651  -27.629 -19.317 1.00 35.35  ?  880  ILE A CA    1 
ATOM   4307 C  C     . ILE A 1 572 ? 54.239  -26.301 -19.775 1.00 35.70  ?  880  ILE A C     1 
ATOM   4308 O  O     . ILE A 1 572 ? 54.074  -25.907 -20.936 1.00 35.35  ?  880  ILE A O     1 
ATOM   4309 C  CB    . ILE A 1 572 ? 54.238  -28.798 -20.124 1.00 32.24  ?  880  ILE A CB    1 
ATOM   4310 C  CG1   . ILE A 1 572 ? 53.583  -30.121 -19.704 1.00 36.81  ?  880  ILE A CG1   1 
ATOM   4311 C  CG2   . ILE A 1 572 ? 55.751  -28.871 -19.938 1.00 37.10  ?  880  ILE A CG2   1 
ATOM   4312 C  CD1   . ILE A 1 572 ? 53.918  -31.285 -20.617 1.00 38.88  ?  880  ILE A CD1   1 
ATOM   4313 N  N     . SER A 1 573 ? 54.937  -25.623 -18.871 1.00 37.36  ?  881  SER A N     1 
ATOM   4314 C  CA    . SER A 1 573 ? 55.530  -24.321 -19.156 1.00 45.44  ?  881  SER A CA    1 
ATOM   4315 C  C     . SER A 1 573 ? 57.027  -24.265 -18.898 1.00 43.74  ?  881  SER A C     1 
ATOM   4316 O  O     . SER A 1 573 ? 57.751  -23.610 -19.652 1.00 50.26  ?  881  SER A O     1 
ATOM   4317 C  CB    . SER A 1 573 ? 54.829  -23.244 -18.319 1.00 37.60  ?  881  SER A CB    1 
ATOM   4318 O  OG    . SER A 1 573 ? 54.709  -23.651 -16.964 1.00 44.25  ?  881  SER A OG    1 
ATOM   4319 N  N     . SER A 1 574 ? 57.516  -24.948 -17.863 1.00 36.97  ?  882  SER A N     1 
ATOM   4320 C  CA    . SER A 1 574 ? 58.912  -24.842 -17.456 1.00 32.75  ?  882  SER A CA    1 
ATOM   4321 C  C     . SER A 1 574 ? 59.873  -25.638 -18.332 1.00 41.44  ?  882  SER A C     1 
ATOM   4322 O  O     . SER A 1 574 ? 61.088  -25.531 -18.131 1.00 41.00  ?  882  SER A O     1 
ATOM   4323 C  CB    . SER A 1 574 ? 59.062  -25.306 -16.005 1.00 37.52  ?  882  SER A CB    1 
ATOM   4324 O  OG    . SER A 1 574 ? 58.355  -24.451 -15.123 1.00 59.40  ?  882  SER A OG    1 
ATOM   4325 N  N     . ALA A 1 575 ? 59.377  -26.429 -19.284 1.00 40.80  ?  883  ALA A N     1 
ATOM   4326 C  CA    . ALA A 1 575 ? 60.236  -27.246 -20.134 1.00 36.69  ?  883  ALA A CA    1 
ATOM   4327 C  C     . ALA A 1 575 ? 59.633  -27.311 -21.532 1.00 36.52  ?  883  ALA A C     1 
ATOM   4328 O  O     . ALA A 1 575 ? 58.601  -26.695 -21.815 1.00 48.52  ?  883  ALA A O     1 
ATOM   4329 C  CB    . ALA A 1 575 ? 60.425  -28.647 -19.542 1.00 38.50  ?  883  ALA A CB    1 
ATOM   4330 N  N     . ASP A 1 576 ? 60.289  -28.064 -22.415 1.00 37.70  ?  884  ASP A N     1 
ATOM   4331 C  CA    . ASP A 1 576 ? 59.841  -28.199 -23.801 1.00 46.16  ?  884  ASP A CA    1 
ATOM   4332 C  C     . ASP A 1 576 ? 58.497  -28.915 -23.814 1.00 41.94  ?  884  ASP A C     1 
ATOM   4333 O  O     . ASP A 1 576 ? 58.434  -30.145 -23.792 1.00 38.24  ?  884  ASP A O     1 
ATOM   4334 C  CB    . ASP A 1 576 ? 60.873  -28.954 -24.629 1.00 42.23  ?  884  ASP A CB    1 
ATOM   4335 C  CG    . ASP A 1 576 ? 60.476  -29.069 -26.092 1.00 46.04  ?  884  ASP A CG    1 
ATOM   4336 O  OD1   . ASP A 1 576 ? 59.284  -29.314 -26.376 1.00 42.73  -1 884  ASP A OD1   1 
ATOM   4337 O  OD2   . ASP A 1 576 ? 61.360  -28.907 -26.959 1.00 45.48  ?  884  ASP A OD2   1 
ATOM   4338 N  N     . GLU A 1 577 ? 57.415  -28.133 -23.864 1.00 37.29  ?  885  GLU A N     1 
ATOM   4339 C  CA    . GLU A 1 577 ? 56.073  -28.697 -23.781 1.00 38.43  ?  885  GLU A CA    1 
ATOM   4340 C  C     . GLU A 1 577 ? 55.779  -29.608 -24.967 1.00 41.13  ?  885  GLU A C     1 
ATOM   4341 O  O     . GLU A 1 577 ? 55.087  -30.623 -24.823 1.00 37.35  ?  885  GLU A O     1 
ATOM   4342 C  CB    . GLU A 1 577 ? 55.033  -27.572 -23.698 1.00 34.73  ?  885  GLU A CB    1 
ATOM   4343 C  CG    . GLU A 1 577 ? 55.097  -26.526 -24.824 1.00 37.39  ?  885  GLU A CG    1 
ATOM   4344 C  CD    . GLU A 1 577 ? 56.091  -25.393 -24.543 1.00 44.96  ?  885  GLU A CD    1 
ATOM   4345 O  OE1   . GLU A 1 577 ? 56.987  -25.579 -23.693 1.00 50.42  ?  885  GLU A OE1   1 
ATOM   4346 O  OE2   . GLU A 1 577 ? 55.977  -24.314 -25.169 1.00 40.34  -1 885  GLU A OE2   1 
ATOM   4347 N  N     . LEU A 1 578 ? 56.291  -29.261 -26.148 1.00 39.11  ?  886  LEU A N     1 
ATOM   4348 C  CA    . LEU A 1 578 ? 56.025  -30.064 -27.336 1.00 38.30  ?  886  LEU A CA    1 
ATOM   4349 C  C     . LEU A 1 578 ? 56.602  -31.467 -27.186 1.00 46.40  ?  886  LEU A C     1 
ATOM   4350 O  O     . LEU A 1 578 ? 55.885  -32.467 -27.313 1.00 40.90  ?  886  LEU A O     1 
ATOM   4351 C  CB    . LEU A 1 578 ? 56.613  -29.368 -28.563 1.00 42.92  ?  886  LEU A CB    1 
ATOM   4352 C  CG    . LEU A 1 578 ? 55.979  -29.707 -29.910 1.00 49.73  ?  886  LEU A CG    1 
ATOM   4353 C  CD1   . LEU A 1 578 ? 54.656  -28.980 -30.056 1.00 41.67  ?  886  LEU A CD1   1 
ATOM   4354 C  CD2   . LEU A 1 578 ? 56.916  -29.356 -31.053 1.00 50.50  ?  886  LEU A CD2   1 
ATOM   4355 N  N     . LEU A 1 579 ? 57.900  -31.556 -26.894 1.00 45.05  ?  887  LEU A N     1 
ATOM   4356 C  CA    . LEU A 1 579 ? 58.565  -32.852 -26.819 1.00 33.15  ?  887  LEU A CA    1 
ATOM   4357 C  C     . LEU A 1 579 ? 58.014  -33.698 -25.679 1.00 38.21  ?  887  LEU A C     1 
ATOM   4358 O  O     . LEU A 1 579 ? 57.794  -34.904 -25.845 1.00 37.94  ?  887  LEU A O     1 
ATOM   4359 C  CB    . LEU A 1 579 ? 60.076  -32.643 -26.669 1.00 41.20  ?  887  LEU A CB    1 
ATOM   4360 C  CG    . LEU A 1 579 ? 60.959  -33.844 -26.317 1.00 43.29  ?  887  LEU A CG    1 
ATOM   4361 C  CD1   . LEU A 1 579 ? 60.747  -34.998 -27.282 1.00 38.15  ?  887  LEU A CD1   1 
ATOM   4362 C  CD2   . LEU A 1 579 ? 62.424  -33.418 -26.309 1.00 43.25  ?  887  LEU A CD2   1 
ATOM   4363 N  N     . LEU A 1 580 ? 57.780  -33.091 -24.514 1.00 34.43  ?  888  LEU A N     1 
ATOM   4364 C  CA    . LEU A 1 580 ? 57.316  -33.873 -23.373 1.00 43.75  ?  888  LEU A CA    1 
ATOM   4365 C  C     . LEU A 1 580 ? 55.939  -34.470 -23.636 1.00 44.82  ?  888  LEU A C     1 
ATOM   4366 O  O     . LEU A 1 580 ? 55.662  -35.608 -23.240 1.00 36.64  ?  888  LEU A O     1 
ATOM   4367 C  CB    . LEU A 1 580 ? 57.300  -33.012 -22.112 1.00 38.26  ?  888  LEU A CB    1 
ATOM   4368 C  CG    . LEU A 1 580 ? 58.690  -32.686 -21.558 1.00 45.67  ?  888  LEU A CG    1 
ATOM   4369 C  CD1   . LEU A 1 580 ? 58.614  -31.579 -20.522 1.00 42.66  ?  888  LEU A CD1   1 
ATOM   4370 C  CD2   . LEU A 1 580 ? 59.341  -33.929 -20.962 1.00 37.38  ?  888  LEU A CD2   1 
ATOM   4371 N  N     A THR A 1 581 ? 55.059  -33.719 -24.299 0.15 40.73  ?  889  THR A N     1 
ATOM   4372 N  N     B THR A 1 581 ? 55.063  -33.722 -24.309 0.85 40.68  ?  889  THR A N     1 
ATOM   4373 C  CA    A THR A 1 581 ? 53.736  -34.245 -24.618 0.15 42.08  ?  889  THR A CA    1 
ATOM   4374 C  CA    B THR A 1 581 ? 53.736  -34.245 -24.615 0.85 42.29  ?  889  THR A CA    1 
ATOM   4375 C  C     A THR A 1 581 ? 53.830  -35.376 -25.634 0.15 41.62  ?  889  THR A C     1 
ATOM   4376 C  C     B THR A 1 581 ? 53.824  -35.373 -25.636 0.85 41.66  ?  889  THR A C     1 
ATOM   4377 O  O     A THR A 1 581 ? 53.204  -36.429 -25.467 0.15 41.02  ?  889  THR A O     1 
ATOM   4378 O  O     B THR A 1 581 ? 53.195  -36.425 -25.470 0.85 40.88  ?  889  THR A O     1 
ATOM   4379 C  CB    A THR A 1 581 ? 52.839  -33.125 -25.142 0.15 39.36  ?  889  THR A CB    1 
ATOM   4380 C  CB    B THR A 1 581 ? 52.830  -33.120 -25.121 0.85 39.58  ?  889  THR A CB    1 
ATOM   4381 O  OG1   A THR A 1 581 ? 53.512  -32.424 -26.195 0.15 39.42  ?  889  THR A OG1   1 
ATOM   4382 O  OG1   B THR A 1 581 ? 52.816  -32.052 -24.167 0.85 35.02  ?  889  THR A OG1   1 
ATOM   4383 C  CG2   A THR A 1 581 ? 52.496  -32.159 -24.025 0.15 36.14  ?  889  THR A CG2   1 
ATOM   4384 C  CG2   B THR A 1 581 ? 51.403  -33.623 -25.324 0.85 35.83  ?  889  THR A CG2   1 
ATOM   4385 N  N     . GLU A 1 582 ? 54.609  -35.172 -26.698 1.00 40.91  ?  890  GLU A N     1 
ATOM   4386 C  CA    . GLU A 1 582 ? 54.823  -36.234 -27.673 1.00 44.88  ?  890  GLU A CA    1 
ATOM   4387 C  C     . GLU A 1 582 ? 55.352  -37.493 -26.997 1.00 46.80  ?  890  GLU A C     1 
ATOM   4388 O  O     . GLU A 1 582 ? 54.910  -38.606 -27.303 1.00 53.71  ?  890  GLU A O     1 
ATOM   4389 C  CB    . GLU A 1 582 ? 55.793  -35.760 -28.755 1.00 45.34  ?  890  GLU A CB    1 
ATOM   4390 C  CG    . GLU A 1 582 ? 55.905  -36.696 -29.945 1.00 51.26  ?  890  GLU A CG    1 
ATOM   4391 C  CD    . GLU A 1 582 ? 54.673  -36.663 -30.828 1.00 57.08  ?  890  GLU A CD    1 
ATOM   4392 O  OE1   . GLU A 1 582 ? 53.917  -35.672 -30.755 1.00 48.41  ?  890  GLU A OE1   1 
ATOM   4393 O  OE2   . GLU A 1 582 ? 54.460  -37.627 -31.594 1.00 66.39  -1 890  GLU A OE2   1 
ATOM   4394 N  N     . MET A 1 583 ? 56.296  -37.335 -26.067 1.00 45.28  ?  891  MET A N     1 
ATOM   4395 C  CA    . MET A 1 583 ? 56.792  -38.483 -25.318 1.00 47.24  ?  891  MET A CA    1 
ATOM   4396 C  C     . MET A 1 583 ? 55.669  -39.146 -24.537 1.00 50.11  ?  891  MET A C     1 
ATOM   4397 O  O     . MET A 1 583 ? 55.590  -40.379 -24.468 1.00 46.08  ?  891  MET A O     1 
ATOM   4398 C  CB    . MET A 1 583 ? 57.909  -38.052 -24.368 1.00 44.66  ?  891  MET A CB    1 
ATOM   4399 C  CG    . MET A 1 583 ? 59.191  -37.619 -25.062 1.00 49.75  ?  891  MET A CG    1 
ATOM   4400 S  SD    . MET A 1 583 ? 60.318  -36.740 -23.957 1.00 40.99  ?  891  MET A SD    1 
ATOM   4401 C  CE    . MET A 1 583 ? 60.475  -37.900 -22.603 1.00 37.25  ?  891  MET A CE    1 
ATOM   4402 N  N     . MET A 1 584 ? 54.789  -38.342 -23.939 1.00 37.60  ?  892  MET A N     1 
ATOM   4403 C  CA    . MET A 1 584 ? 53.687  -38.900 -23.166 1.00 44.61  ?  892  MET A CA    1 
ATOM   4404 C  C     . MET A 1 584 ? 52.731  -39.680 -24.060 1.00 45.10  ?  892  MET A C     1 
ATOM   4405 O  O     . MET A 1 584 ? 52.282  -40.772 -23.695 1.00 44.07  ?  892  MET A O     1 
ATOM   4406 C  CB    . MET A 1 584 ? 52.947  -37.782 -22.433 1.00 41.21  ?  892  MET A CB    1 
ATOM   4407 C  CG    . MET A 1 584 ? 51.846  -38.276 -21.505 1.00 52.18  ?  892  MET A CG    1 
ATOM   4408 S  SD    . MET A 1 584 ? 50.899  -36.949 -20.729 1.00 64.26  ?  892  MET A SD    1 
ATOM   4409 C  CE    . MET A 1 584 ? 52.210  -36.056 -19.893 1.00 46.18  ?  892  MET A CE    1 
ATOM   4410 N  N     . PHE A 1 585 ? 52.420  -39.141 -25.240 1.00 42.26  ?  893  PHE A N     1 
ATOM   4411 C  CA    . PHE A 1 585 ? 51.463  -39.776 -26.135 1.00 50.13  ?  893  PHE A CA    1 
ATOM   4412 C  C     . PHE A 1 585 ? 52.066  -40.936 -26.918 1.00 55.70  ?  893  PHE A C     1 
ATOM   4413 O  O     . PHE A 1 585 ? 51.313  -41.760 -27.447 1.00 57.91  ?  893  PHE A O     1 
ATOM   4414 C  CB    . PHE A 1 585 ? 50.877  -38.733 -27.094 1.00 37.04  ?  893  PHE A CB    1 
ATOM   4415 C  CG    . PHE A 1 585 ? 49.667  -38.020 -26.544 1.00 43.04  ?  893  PHE A CG    1 
ATOM   4416 C  CD1   . PHE A 1 585 ? 49.779  -37.174 -25.453 1.00 38.76  ?  893  PHE A CD1   1 
ATOM   4417 C  CD2   . PHE A 1 585 ? 48.417  -38.203 -27.114 1.00 36.87  ?  893  PHE A CD2   1 
ATOM   4418 C  CE1   . PHE A 1 585 ? 48.668  -36.524 -24.940 1.00 46.08  ?  893  PHE A CE1   1 
ATOM   4419 C  CE2   . PHE A 1 585 ? 47.301  -37.553 -26.607 1.00 32.67  ?  893  PHE A CE2   1 
ATOM   4420 C  CZ    . PHE A 1 585 ? 47.425  -36.716 -25.520 1.00 35.88  ?  893  PHE A CZ    1 
ATOM   4421 N  N     . ASN A 1 586 ? 53.395  -41.025 -27.004 1.00 53.73  ?  894  ASN A N     1 
ATOM   4422 C  CA    . ASN A 1 586 ? 54.048  -42.188 -27.591 1.00 48.93  ?  894  ASN A CA    1 
ATOM   4423 C  C     . ASN A 1 586 ? 54.288  -43.298 -26.578 1.00 52.40  ?  894  ASN A C     1 
ATOM   4424 O  O     . ASN A 1 586 ? 54.717  -44.389 -26.967 1.00 58.59  ?  894  ASN A O     1 
ATOM   4425 C  CB    . ASN A 1 586 ? 55.391  -41.803 -28.225 1.00 53.31  ?  894  ASN A CB    1 
ATOM   4426 C  CG    . ASN A 1 586 ? 55.247  -40.809 -29.370 1.00 68.35  ?  894  ASN A CG    1 
ATOM   4427 O  OD1   . ASN A 1 586 ? 56.144  -40.000 -29.609 1.00 74.00  ?  894  ASN A OD1   1 
ATOM   4428 N  ND2   . ASN A 1 586 ? 54.123  -40.862 -30.080 1.00 73.68  ?  894  ASN A ND2   1 
ATOM   4429 N  N     . GLY A 1 587 ? 54.033  -43.045 -25.298 1.00 56.62  ?  895  GLY A N     1 
ATOM   4430 C  CA    . GLY A 1 587 ? 54.133  -44.066 -24.279 1.00 47.77  ?  895  GLY A CA    1 
ATOM   4431 C  C     . GLY A 1 587 ? 55.487  -44.210 -23.624 1.00 51.99  ?  895  GLY A C     1 
ATOM   4432 O  O     . GLY A 1 587 ? 55.675  -45.153 -22.846 1.00 43.64  ?  895  GLY A O     1 
ATOM   4433 N  N     . LEU A 1 588 ? 56.431  -43.301 -23.893 1.00 51.19  ?  896  LEU A N     1 
ATOM   4434 C  CA    . LEU A 1 588 ? 57.774  -43.441 -23.338 1.00 40.52  ?  896  LEU A CA    1 
ATOM   4435 C  C     . LEU A 1 588 ? 57.758  -43.577 -21.822 1.00 38.87  ?  896  LEU A C     1 
ATOM   4436 O  O     . LEU A 1 588 ? 58.631  -44.241 -21.253 1.00 54.31  ?  896  LEU A O     1 
ATOM   4437 C  CB    . LEU A 1 588 ? 58.645  -42.253 -23.743 1.00 47.52  ?  896  LEU A CB    1 
ATOM   4438 C  CG    . LEU A 1 588 ? 59.316  -42.369 -25.113 1.00 55.01  ?  896  LEU A CG    1 
ATOM   4439 C  CD1   . LEU A 1 588 ? 58.318  -42.124 -26.236 1.00 56.04  ?  896  LEU A CD1   1 
ATOM   4440 C  CD2   . LEU A 1 588 ? 60.499  -41.415 -25.212 1.00 55.03  ?  896  LEU A CD2   1 
ATOM   4441 N  N     . PHE A 1 589 ? 56.784  -42.966 -21.148 1.00 40.49  ?  897  PHE A N     1 
ATOM   4442 C  CA    . PHE A 1 589 ? 56.750  -42.991 -19.691 1.00 48.15  ?  897  PHE A CA    1 
ATOM   4443 C  C     . PHE A 1 589 ? 56.045  -44.215 -19.124 1.00 50.52  ?  897  PHE A C     1 
ATOM   4444 O  O     . PHE A 1 589 ? 56.203  -44.507 -17.933 1.00 47.27  ?  897  PHE A O     1 
ATOM   4445 C  CB    . PHE A 1 589 ? 56.059  -41.731 -19.152 1.00 57.12  ?  897  PHE A CB    1 
ATOM   4446 C  CG    . PHE A 1 589 ? 56.822  -40.459 -19.406 1.00 51.56  ?  897  PHE A CG    1 
ATOM   4447 C  CD1   . PHE A 1 589 ? 57.923  -40.128 -18.631 1.00 50.20  ?  897  PHE A CD1   1 
ATOM   4448 C  CD2   . PHE A 1 589 ? 56.432  -39.590 -20.412 1.00 48.53  ?  897  PHE A CD2   1 
ATOM   4449 C  CE1   . PHE A 1 589 ? 58.624  -38.957 -18.860 1.00 48.82  ?  897  PHE A CE1   1 
ATOM   4450 C  CE2   . PHE A 1 589 ? 57.129  -38.417 -20.647 1.00 49.79  ?  897  PHE A CE2   1 
ATOM   4451 C  CZ    . PHE A 1 589 ? 58.225  -38.100 -19.869 1.00 44.79  ?  897  PHE A CZ    1 
ATOM   4452 N  N     . ASN A 1 590 ? 55.280  -44.942 -19.941 1.00 48.13  ?  898  ASN A N     1 
ATOM   4453 C  CA    . ASN A 1 590 ? 54.442  -46.010 -19.407 1.00 61.57  ?  898  ASN A CA    1 
ATOM   4454 C  C     . ASN A 1 590 ? 55.267  -47.182 -18.888 1.00 52.40  ?  898  ASN A C     1 
ATOM   4455 O  O     . ASN A 1 590 ? 54.880  -47.814 -17.898 1.00 50.01  ?  898  ASN A O     1 
ATOM   4456 C  CB    . ASN A 1 590 ? 53.457  -46.480 -20.475 1.00 64.81  ?  898  ASN A CB    1 
ATOM   4457 C  CG    . ASN A 1 590 ? 52.466  -45.402 -20.863 1.00 68.22  ?  898  ASN A CG    1 
ATOM   4458 O  OD1   . ASN A 1 590 ? 52.310  -45.083 -22.040 1.00 71.27  ?  898  ASN A OD1   1 
ATOM   4459 N  ND2   . ASN A 1 590 ? 51.792  -44.830 -19.870 1.00 67.72  ?  898  ASN A ND2   1 
ATOM   4460 N  N     . ASP A 1 591 ? 56.396  -47.483 -19.525 1.00 50.80  ?  899  ASP A N     1 
ATOM   4461 C  CA    . ASP A 1 591 ? 57.254  -48.579 -19.094 1.00 65.96  ?  899  ASP A CA    1 
ATOM   4462 C  C     . ASP A 1 591 ? 58.294  -48.156 -18.062 1.00 62.70  ?  899  ASP A C     1 
ATOM   4463 O  O     . ASP A 1 591 ? 59.053  -49.007 -17.586 1.00 53.54  ?  899  ASP A O     1 
ATOM   4464 C  CB    . ASP A 1 591 ? 57.963  -49.201 -20.303 1.00 84.13  ?  899  ASP A CB    1 
ATOM   4465 C  CG    . ASP A 1 591 ? 57.005  -49.924 -21.234 1.00 93.32  ?  899  ASP A CG    1 
ATOM   4466 O  OD1   . ASP A 1 591 ? 55.934  -50.366 -20.763 1.00 66.91  ?  899  ASP A OD1   1 
ATOM   4467 O  OD2   . ASP A 1 591 ? 57.326  -50.054 -22.436 1.00 80.07  ?  899  ASP A OD2   1 
ATOM   4468 N  N     . LEU A 1 592 ? 58.348  -46.876 -17.704 1.00 52.84  ?  900  LEU A N     1 
ATOM   4469 C  CA    . LEU A 1 592 ? 59.337  -46.386 -16.755 1.00 46.44  ?  900  LEU A CA    1 
ATOM   4470 C  C     . LEU A 1 592 ? 58.764  -46.372 -15.345 1.00 42.68  ?  900  LEU A C     1 
ATOM   4471 O  O     . LEU A 1 592 ? 57.578  -46.095 -15.143 1.00 46.60  ?  900  LEU A O     1 
ATOM   4472 C  CB    . LEU A 1 592 ? 59.798  -44.978 -17.137 1.00 56.25  ?  900  LEU A CB    1 
ATOM   4473 C  CG    . LEU A 1 592 ? 60.331  -44.792 -18.559 1.00 55.95  ?  900  LEU A CG    1 
ATOM   4474 C  CD1   . LEU A 1 592 ? 60.867  -43.377 -18.743 1.00 54.92  ?  900  LEU A CD1   1 
ATOM   4475 C  CD2   . LEU A 1 592 ? 61.401  -45.824 -18.887 1.00 53.26  ?  900  LEU A CD2   1 
ATOM   4476 N  N     . SER A 1 593 ? 59.613  -46.683 -14.369 1.00 41.55  ?  901  SER A N     1 
ATOM   4477 C  CA    . SER A 1 593 ? 59.257  -46.457 -12.979 1.00 49.17  ?  901  SER A CA    1 
ATOM   4478 C  C     . SER A 1 593 ? 59.321  -44.963 -12.667 1.00 46.14  ?  901  SER A C     1 
ATOM   4479 O  O     . SER A 1 593 ? 59.802  -44.152 -13.463 1.00 40.25  ?  901  SER A O     1 
ATOM   4480 C  CB    . SER A 1 593 ? 60.193  -47.226 -12.048 1.00 40.69  ?  901  SER A CB    1 
ATOM   4481 O  OG    . SER A 1 593 ? 61.523  -46.735 -12.134 1.00 45.20  ?  901  SER A OG    1 
ATOM   4482 N  N     . ALA A 1 594 ? 58.826  -44.602 -11.481 1.00 37.73  ?  902  ALA A N     1 
ATOM   4483 C  CA    . ALA A 1 594 ? 58.912  -43.214 -11.043 1.00 50.26  ?  902  ALA A CA    1 
ATOM   4484 C  C     . ALA A 1 594 ? 60.353  -42.718 -11.076 1.00 47.82  ?  902  ALA A C     1 
ATOM   4485 O  O     . ALA A 1 594 ? 60.626  -41.614 -11.562 1.00 48.87  ?  902  ALA A O     1 
ATOM   4486 C  CB    . ALA A 1 594 ? 58.324  -43.072 -9.639  1.00 44.68  ?  902  ALA A CB    1 
ATOM   4487 N  N     . GLU A 1 595 ? 61.292  -43.531 -10.582 1.00 48.90  ?  903  GLU A N     1 
ATOM   4488 C  CA    . GLU A 1 595 ? 62.691  -43.118 -10.538 1.00 40.70  ?  903  GLU A CA    1 
ATOM   4489 C  C     . GLU A 1 595 ? 63.249  -42.895 -11.937 1.00 50.54  ?  903  GLU A C     1 
ATOM   4490 O  O     . GLU A 1 595 ? 63.989  -41.932 -12.172 1.00 50.75  ?  903  GLU A O     1 
ATOM   4491 C  CB    . GLU A 1 595 ? 63.526  -44.162 -9.796  1.00 54.14  ?  903  GLU A CB    1 
ATOM   4492 C  CG    . GLU A 1 595 ? 63.150  -44.344 -8.330  1.00 62.94  ?  903  GLU A CG    1 
ATOM   4493 C  CD    . GLU A 1 595 ? 62.009  -45.328 -8.122  1.00 63.48  ?  903  GLU A CD    1 
ATOM   4494 O  OE1   . GLU A 1 595 ? 61.375  -45.743 -9.117  1.00 58.44  ?  903  GLU A OE1   1 
ATOM   4495 O  OE2   . GLU A 1 595 ? 61.749  -45.692 -6.956  1.00 54.14  -1 903  GLU A OE2   1 
ATOM   4496 N  N     . GLN A 1 596 ? 62.919  -43.780 -12.878 1.00 47.01  ?  904  GLN A N     1 
ATOM   4497 C  CA    . GLN A 1 596 ? 63.400  -43.614 -14.245 1.00 50.16  ?  904  GLN A CA    1 
ATOM   4498 C  C     . GLN A 1 596 ? 62.826  -42.353 -14.876 1.00 46.66  ?  904  GLN A C     1 
ATOM   4499 O  O     . GLN A 1 596 ? 63.549  -41.576 -15.510 1.00 44.15  ?  904  GLN A O     1 
ATOM   4500 C  CB    . GLN A 1 596 ? 63.033  -44.835 -15.083 1.00 48.91  ?  904  GLN A CB    1 
ATOM   4501 C  CG    . GLN A 1 596 ? 63.702  -46.118 -14.660 1.00 59.21  ?  904  GLN A CG    1 
ATOM   4502 C  CD    . GLN A 1 596 ? 63.276  -47.274 -15.530 1.00 56.31  ?  904  GLN A CD    1 
ATOM   4503 O  OE1   . GLN A 1 596 ? 62.228  -47.879 -15.305 1.00 51.51  ?  904  GLN A OE1   1 
ATOM   4504 N  NE2   . GLN A 1 596 ? 64.075  -47.574 -16.547 1.00 50.43  ?  904  GLN A NE2   1 
ATOM   4505 N  N     . ALA A 1 597 ? 61.515  -42.145 -14.731 1.00 42.69  ?  905  ALA A N     1 
ATOM   4506 C  CA    . ALA A 1 597 ? 60.888  -40.955 -15.294 1.00 50.10  ?  905  ALA A CA    1 
ATOM   4507 C  C     . ALA A 1 597 ? 61.486  -39.693 -14.686 1.00 42.34  ?  905  ALA A C     1 
ATOM   4508 O  O     . ALA A 1 597 ? 61.887  -38.771 -15.405 1.00 43.53  ?  905  ALA A O     1 
ATOM   4509 C  CB    . ALA A 1 597 ? 59.377  -41.003 -15.066 1.00 41.81  ?  905  ALA A CB    1 
ATOM   4510 N  N     . THR A 1 598 ? 61.553  -39.641 -13.353 1.00 37.04  ?  906  THR A N     1 
ATOM   4511 C  CA    . THR A 1 598 ? 62.173  -38.513 -12.668 1.00 38.98  ?  906  THR A CA    1 
ATOM   4512 C  C     . THR A 1 598 ? 63.582  -38.259 -13.194 1.00 46.22  ?  906  THR A C     1 
ATOM   4513 O  O     . THR A 1 598 ? 63.939  -37.123 -13.531 1.00 41.29  ?  906  THR A O     1 
ATOM   4514 C  CB    . THR A 1 598 ? 62.193  -38.782 -11.161 1.00 41.65  ?  906  THR A CB    1 
ATOM   4515 O  OG1   . THR A 1 598 ? 60.851  -38.967 -10.691 1.00 43.33  ?  906  THR A OG1   1 
ATOM   4516 C  CG2   . THR A 1 598 ? 62.827  -37.628 -10.408 1.00 45.71  ?  906  THR A CG2   1 
ATOM   4517 N  N     . ALA A 1 599 ? 64.398  -39.313 -13.278 1.00 41.19  ?  907  ALA A N     1 
ATOM   4518 C  CA    . ALA A 1 599 ? 65.756  -39.164 -13.792 1.00 40.44  ?  907  ALA A CA    1 
ATOM   4519 C  C     . ALA A 1 599 ? 65.754  -38.663 -15.231 1.00 44.95  ?  907  ALA A C     1 
ATOM   4520 O  O     . ALA A 1 599 ? 66.566  -37.805 -15.598 1.00 37.17  ?  907  ALA A O     1 
ATOM   4521 C  CB    . ALA A 1 599 ? 66.500  -40.497 -13.692 1.00 46.70  ?  907  ALA A CB    1 
ATOM   4522 N  N     . LEU A 1 600 ? 64.856  -39.191 -16.065 1.00 42.64  ?  908  LEU A N     1 
ATOM   4523 C  CA    . LEU A 1 600 ? 64.803  -38.757 -17.457 1.00 46.62  ?  908  LEU A CA    1 
ATOM   4524 C  C     . LEU A 1 600 ? 64.370  -37.300 -17.562 1.00 46.20  ?  908  LEU A C     1 
ATOM   4525 O  O     . LEU A 1 600 ? 64.839  -36.566 -18.442 1.00 36.12  ?  908  LEU A O     1 
ATOM   4526 C  CB    . LEU A 1 600 ? 63.854  -39.652 -18.254 1.00 43.82  ?  908  LEU A CB    1 
ATOM   4527 C  CG    . LEU A 1 600 ? 63.690  -39.286 -19.733 1.00 41.69  ?  908  LEU A CG    1 
ATOM   4528 C  CD1   . LEU A 1 600 ? 65.007  -39.461 -20.479 1.00 49.61  ?  908  LEU A CD1   1 
ATOM   4529 C  CD2   . LEU A 1 600 ? 62.582  -40.109 -20.382 1.00 52.34  ?  908  LEU A CD2   1 
ATOM   4530 N  N     . LEU A 1 601 ? 63.471  -36.863 -16.679 1.00 35.73  ?  909  LEU A N     1 
ATOM   4531 C  CA    . LEU A 1 601 ? 62.984  -35.492 -16.740 1.00 39.60  ?  909  LEU A CA    1 
ATOM   4532 C  C     . LEU A 1 601 ? 64.055  -34.483 -16.345 1.00 40.84  ?  909  LEU A C     1 
ATOM   4533 O  O     . LEU A 1 601 ? 63.962  -33.316 -16.739 1.00 39.64  ?  909  LEU A O     1 
ATOM   4534 C  CB    . LEU A 1 601 ? 61.748  -35.340 -15.850 1.00 35.32  ?  909  LEU A CB    1 
ATOM   4535 C  CG    . LEU A 1 601 ? 60.454  -35.987 -16.363 1.00 37.67  ?  909  LEU A CG    1 
ATOM   4536 C  CD1   . LEU A 1 601 ? 59.378  -35.961 -15.288 1.00 34.77  ?  909  LEU A CD1   1 
ATOM   4537 C  CD2   . LEU A 1 601 ? 59.948  -35.301 -17.624 1.00 35.74  ?  909  LEU A CD2   1 
ATOM   4538 N  N     . SER A 1 602 ? 65.078  -34.903 -15.593 1.00 37.91  ?  910  SER A N     1 
ATOM   4539 C  CA    . SER A 1 602 ? 66.155  -33.983 -15.241 1.00 42.28  ?  910  SER A CA    1 
ATOM   4540 C  C     . SER A 1 602 ? 66.840  -33.428 -16.483 1.00 46.50  ?  910  SER A C     1 
ATOM   4541 O  O     . SER A 1 602 ? 67.397  -32.324 -16.443 1.00 35.17  ?  910  SER A O     1 
ATOM   4542 C  CB    . SER A 1 602 ? 67.175  -34.679 -14.337 1.00 50.46  ?  910  SER A CB    1 
ATOM   4543 O  OG    . SER A 1 602 ? 68.060  -35.499 -15.083 1.00 38.26  ?  910  SER A OG    1 
ATOM   4544 N  N     . CYS A 1 603 ? 66.801  -34.167 -17.594 1.00 34.12  ?  911  CYS A N     1 
ATOM   4545 C  CA    . CYS A 1 603 ? 67.381  -33.691 -18.845 1.00 38.47  ?  911  CYS A CA    1 
ATOM   4546 C  C     . CYS A 1 603 ? 66.664  -32.468 -19.396 1.00 50.77  ?  911  CYS A C     1 
ATOM   4547 O  O     . CYS A 1 603 ? 67.198  -31.814 -20.297 1.00 46.47  ?  911  CYS A O     1 
ATOM   4548 C  CB    . CYS A 1 603 ? 67.351  -34.796 -19.905 1.00 48.08  ?  911  CYS A CB    1 
ATOM   4549 S  SG    . CYS A 1 603 ? 68.020  -36.387 -19.364 1.00 48.36  ?  911  CYS A SG    1 
ATOM   4550 N  N     . PHE A 1 604 ? 65.472  -32.153 -18.892 1.00 37.97  ?  912  PHE A N     1 
ATOM   4551 C  CA    . PHE A 1 604 ? 64.681  -31.046 -19.406 1.00 44.14  ?  912  PHE A CA    1 
ATOM   4552 C  C     . PHE A 1 604 ? 64.796  -29.787 -18.559 1.00 41.91  ?  912  PHE A C     1 
ATOM   4553 O  O     . PHE A 1 604 ? 64.250  -28.749 -18.946 1.00 34.61  ?  912  PHE A O     1 
ATOM   4554 C  CB    . PHE A 1 604 ? 63.212  -31.472 -19.514 1.00 37.01  ?  912  PHE A CB    1 
ATOM   4555 C  CG    . PHE A 1 604 ? 62.970  -32.515 -20.568 1.00 44.50  ?  912  PHE A CG    1 
ATOM   4556 C  CD1   . PHE A 1 604 ? 63.309  -33.839 -20.342 1.00 43.34  ?  912  PHE A CD1   1 
ATOM   4557 C  CD2   . PHE A 1 604 ? 62.421  -32.168 -21.791 1.00 36.14  ?  912  PHE A CD2   1 
ATOM   4558 C  CE1   . PHE A 1 604 ? 63.097  -34.797 -21.313 1.00 42.33  ?  912  PHE A CE1   1 
ATOM   4559 C  CE2   . PHE A 1 604 ? 62.207  -33.121 -22.764 1.00 44.65  ?  912  PHE A CE2   1 
ATOM   4560 C  CZ    . PHE A 1 604 ? 62.546  -34.437 -22.526 1.00 30.53  ?  912  PHE A CZ    1 
ATOM   4561 N  N     . VAL A 1 605 ? 65.493  -29.847 -17.422 1.00 37.26  ?  913  VAL A N     1 
ATOM   4562 C  CA    . VAL A 1 605 ? 65.649  -28.696 -16.542 1.00 45.85  ?  913  VAL A CA    1 
ATOM   4563 C  C     . VAL A 1 605 ? 67.090  -28.468 -16.116 1.00 40.79  ?  913  VAL A C     1 
ATOM   4564 O  O     . VAL A 1 605 ? 67.371  -27.482 -15.434 1.00 54.06  ?  913  VAL A O     1 
ATOM   4565 C  CB    . VAL A 1 605 ? 64.744  -28.821 -15.298 1.00 46.57  ?  913  VAL A CB    1 
ATOM   4566 C  CG1   . VAL A 1 605 ? 63.282  -28.756 -15.704 1.00 40.69  ?  913  VAL A CG1   1 
ATOM   4567 C  CG2   . VAL A 1 605 ? 65.037  -30.111 -14.544 1.00 42.98  ?  913  VAL A CG2   1 
ATOM   4568 N  N     . PHE A 1 606 ? 68.019  -29.344 -16.494 1.00 54.64  ?  914  PHE A N     1 
ATOM   4569 C  CA    . PHE A 1 606 ? 69.422  -29.155 -16.155 1.00 57.23  ?  914  PHE A CA    1 
ATOM   4570 C  C     . PHE A 1 606 ? 70.081  -28.235 -17.175 1.00 66.32  ?  914  PHE A C     1 
ATOM   4571 O  O     . PHE A 1 606 ? 69.968  -28.455 -18.386 1.00 58.23  ?  914  PHE A O     1 
ATOM   4572 C  CB    . PHE A 1 606 ? 70.147  -30.496 -16.107 1.00 56.73  ?  914  PHE A CB    1 
ATOM   4573 C  CG    . PHE A 1 606 ? 71.598  -30.384 -15.747 1.00 62.45  ?  914  PHE A CG    1 
ATOM   4574 C  CD1   . PHE A 1 606 ? 71.980  -29.947 -14.489 1.00 65.83  ?  914  PHE A CD1   1 
ATOM   4575 C  CD2   . PHE A 1 606 ? 72.581  -30.721 -16.662 1.00 60.79  ?  914  PHE A CD2   1 
ATOM   4576 C  CE1   . PHE A 1 606 ? 73.314  -29.843 -14.151 1.00 65.96  ?  914  PHE A CE1   1 
ATOM   4577 C  CE2   . PHE A 1 606 ? 73.918  -30.620 -16.329 1.00 71.98  ?  914  PHE A CE2   1 
ATOM   4578 C  CZ    . PHE A 1 606 ? 74.284  -30.183 -15.070 1.00 69.59  ?  914  PHE A CZ    1 
ATOM   4579 N  N     . GLN A 1 607 ? 70.784  -27.203 -16.680 1.00 81.75  ?  915  GLN A N     1 
ATOM   4580 C  CA    . GLN A 1 607 ? 71.329  -26.143 -17.523 1.00 89.33  ?  915  GLN A CA    1 
ATOM   4581 C  C     . GLN A 1 607 ? 72.754  -25.807 -17.067 1.00 101.82 ?  915  GLN A C     1 
ATOM   4582 O  O     . GLN A 1 607 ? 73.024  -24.765 -16.473 1.00 136.30 ?  915  GLN A O     1 
ATOM   4583 C  CB    . GLN A 1 607 ? 70.429  -24.904 -17.493 1.00 106.62 ?  915  GLN A CB    1 
ATOM   4584 C  CG    . GLN A 1 607 ? 70.087  -24.419 -16.085 1.00 116.80 ?  915  GLN A CG    1 
ATOM   4585 C  CD    . GLN A 1 607 ? 69.097  -23.262 -16.063 1.00 111.80 ?  915  GLN A CD    1 
ATOM   4586 O  OE1   . GLN A 1 607 ? 68.424  -23.037 -15.057 1.00 117.26 ?  915  GLN A OE1   1 
ATOM   4587 N  NE2   . GLN A 1 607 ? 69.008  -22.520 -17.164 1.00 101.75 ?  915  GLN A NE2   1 
ATOM   4588 N  N     . GLU A 1 608 ? 73.689  -26.710 -17.355 1.00 95.74  ?  916  GLU A N     1 
ATOM   4589 C  CA    . GLU A 1 608 ? 75.108  -26.463 -17.127 1.00 102.46 ?  916  GLU A CA    1 
ATOM   4590 C  C     . GLU A 1 608 ? 75.873  -26.961 -18.343 1.00 113.62 ?  916  GLU A C     1 
ATOM   4591 O  O     . GLU A 1 608 ? 75.713  -28.117 -18.748 1.00 98.45  ?  916  GLU A O     1 
ATOM   4592 C  CB    . GLU A 1 608 ? 75.610  -27.157 -15.856 1.00 111.68 ?  916  GLU A CB    1 
ATOM   4593 C  CG    . GLU A 1 608 ? 74.770  -26.878 -14.614 1.00 106.04 ?  916  GLU A CG    1 
ATOM   4594 C  CD    . GLU A 1 608 ? 74.822  -25.425 -14.177 1.00 114.40 ?  916  GLU A CD    1 
ATOM   4595 O  OE1   . GLU A 1 608 ? 75.709  -24.688 -14.657 1.00 126.01 ?  916  GLU A OE1   1 
ATOM   4596 O  OE2   . GLU A 1 608 ? 73.973  -25.021 -13.353 1.00 103.19 ?  916  GLU A OE2   1 
ATOM   4597 N  N     . ASN A 1 609 ? 76.707  -26.092 -18.914 1.00 139.93 ?  917  ASN A N     1 
ATOM   4598 C  CA    . ASN A 1 609 ? 77.319  -26.332 -20.214 1.00 149.63 ?  917  ASN A CA    1 
ATOM   4599 C  C     . ASN A 1 609 ? 78.800  -26.687 -20.117 1.00 142.04 ?  917  ASN A C     1 
ATOM   4600 O  O     . ASN A 1 609 ? 79.514  -26.614 -21.122 1.00 149.84 ?  917  ASN A O     1 
ATOM   4601 C  CB    . ASN A 1 609 ? 77.138  -25.104 -21.106 1.00 137.66 ?  917  ASN A CB    1 
ATOM   4602 C  CG    . ASN A 1 609 ? 78.092  -23.980 -20.747 1.00 131.93 ?  917  ASN A CG    1 
ATOM   4603 O  OD1   . ASN A 1 609 ? 79.091  -23.758 -21.430 1.00 143.39 ?  917  ASN A OD1   1 
ATOM   4604 N  ND2   . ASN A 1 609 ? 77.793  -23.272 -19.664 1.00 127.13 ?  917  ASN A ND2   1 
ATOM   4605 N  N     . SER A 1 610 ? 79.278  -27.067 -18.937 1.00 132.83 ?  918  SER A N     1 
ATOM   4606 C  CA    . SER A 1 610 ? 80.686  -27.406 -18.760 1.00 138.43 ?  918  SER A CA    1 
ATOM   4607 C  C     . SER A 1 610 ? 80.813  -28.504 -17.705 1.00 130.68 ?  918  SER A C     1 
ATOM   4608 O  O     . SER A 1 610 ? 81.387  -28.322 -16.633 1.00 131.57 ?  918  SER A O     1 
ATOM   4609 C  CB    . SER A 1 610 ? 81.491  -26.163 -18.386 1.00 130.82 ?  918  SER A CB    1 
ATOM   4610 O  OG    . SER A 1 610 ? 82.873  -26.460 -18.293 1.00 127.65 ?  918  SER A OG    1 
ATOM   4611 N  N     . SER A 1 611 ? 80.271  -29.681 -18.012 1.00 115.09 ?  919  SER A N     1 
ATOM   4612 C  CA    . SER A 1 611 ? 80.329  -30.828 -17.120 1.00 102.45 ?  919  SER A CA    1 
ATOM   4613 C  C     . SER A 1 611 ? 80.790  -32.051 -17.900 1.00 103.99 ?  919  SER A C     1 
ATOM   4614 O  O     . SER A 1 611 ? 80.740  -32.085 -19.132 1.00 95.52  ?  919  SER A O     1 
ATOM   4615 C  CB    . SER A 1 611 ? 78.966  -31.104 -16.468 1.00 88.98  ?  919  SER A CB    1 
ATOM   4616 O  OG    . SER A 1 611 ? 78.438  -29.929 -15.877 1.00 93.81  ?  919  SER A OG    1 
ATOM   4617 N  N     . GLU A 1 612 ? 81.243  -33.061 -17.162 1.00 110.65 ?  920  GLU A N     1 
ATOM   4618 C  CA    . GLU A 1 612 ? 81.682  -34.321 -17.745 1.00 118.78 ?  920  GLU A CA    1 
ATOM   4619 C  C     . GLU A 1 612 ? 80.548  -35.337 -17.697 1.00 104.42 ?  920  GLU A C     1 
ATOM   4620 O  O     . GLU A 1 612 ? 79.804  -35.410 -16.715 1.00 83.12  ?  920  GLU A O     1 
ATOM   4621 C  CB    . GLU A 1 612 ? 82.908  -34.866 -17.012 1.00 125.68 ?  920  GLU A CB    1 
ATOM   4622 C  CG    . GLU A 1 612 ? 84.164  -34.029 -17.204 1.00 148.93 ?  920  GLU A CG    1 
ATOM   4623 C  CD    . GLU A 1 612 ? 85.385  -34.646 -16.549 1.00 156.24 ?  920  GLU A CD    1 
ATOM   4624 O  OE1   . GLU A 1 612 ? 85.259  -35.745 -15.968 1.00 161.99 ?  920  GLU A OE1   1 
ATOM   4625 O  OE2   . GLU A 1 612 ? 86.472  -34.033 -16.617 1.00 150.76 ?  920  GLU A OE2   1 
ATOM   4626 N  N     . MET A 1 613 ? 80.427  -36.122 -18.762 1.00 99.71  ?  921  MET A N     1 
ATOM   4627 C  CA    . MET A 1 613 ? 79.336  -37.082 -18.881 1.00 89.62  ?  921  MET A CA    1 
ATOM   4628 C  C     . MET A 1 613 ? 79.620  -38.307 -18.018 1.00 88.37  ?  921  MET A C     1 
ATOM   4629 O  O     . MET A 1 613 ? 80.707  -38.885 -18.114 1.00 95.59  ?  921  MET A O     1 
ATOM   4630 C  CB    . MET A 1 613 ? 79.159  -37.507 -20.336 1.00 99.90  ?  921  MET A CB    1 
ATOM   4631 C  CG    . MET A 1 613 ? 77.965  -38.421 -20.577 1.00 98.65  ?  921  MET A CG    1 
ATOM   4632 S  SD    . MET A 1 613 ? 76.385  -37.575 -20.393 1.00 90.51  ?  921  MET A SD    1 
ATOM   4633 C  CE    . MET A 1 613 ? 76.420  -36.488 -21.819 1.00 81.96  ?  921  MET A CE    1 
ATOM   4634 N  N     . PRO A 1 614 ? 78.683  -38.733 -17.176 1.00 79.52  ?  922  PRO A N     1 
ATOM   4635 C  CA    . PRO A 1 614 ? 78.873  -39.974 -16.421 1.00 81.31  ?  922  PRO A CA    1 
ATOM   4636 C  C     . PRO A 1 614 ? 78.464  -41.186 -17.248 1.00 85.13  ?  922  PRO A C     1 
ATOM   4637 O  O     . PRO A 1 614 ? 77.895  -41.074 -18.335 1.00 75.92  ?  922  PRO A O     1 
ATOM   4638 C  CB    . PRO A 1 614 ? 77.955  -39.788 -15.212 1.00 79.64  ?  922  PRO A CB    1 
ATOM   4639 C  CG    . PRO A 1 614 ? 76.832  -38.966 -15.744 1.00 79.78  ?  922  PRO A CG    1 
ATOM   4640 C  CD    . PRO A 1 614 ? 77.428  -38.055 -16.798 1.00 78.07  ?  922  PRO A CD    1 
ATOM   4641 N  N     . LYS A 1 615 ? 78.770  -42.363 -16.710 1.00 90.56  ?  923  LYS A N     1 
ATOM   4642 C  CA    . LYS A 1 615 ? 78.366  -43.616 -17.332 1.00 89.25  ?  923  LYS A CA    1 
ATOM   4643 C  C     . LYS A 1 615 ? 77.003  -44.024 -16.792 1.00 81.76  ?  923  LYS A C     1 
ATOM   4644 O  O     . LYS A 1 615 ? 76.783  -44.025 -15.576 1.00 80.06  ?  923  LYS A O     1 
ATOM   4645 C  CB    . LYS A 1 615 ? 79.394  -44.722 -17.083 1.00 92.15  ?  923  LYS A CB    1 
ATOM   4646 C  CG    . LYS A 1 615 ? 79.880  -44.847 -15.648 1.00 120.34 ?  923  LYS A CG    1 
ATOM   4647 C  CD    . LYS A 1 615 ? 80.760  -46.080 -15.478 1.00 131.49 ?  923  LYS A CD    1 
ATOM   4648 C  CE    . LYS A 1 615 ? 81.731  -45.928 -14.317 1.00 137.12 ?  923  LYS A CE    1 
ATOM   4649 N  NZ    . LYS A 1 615 ? 82.807  -44.938 -14.612 1.00 110.98 ?  923  LYS A NZ    1 
ATOM   4650 N  N     . LEU A 1 616 ? 76.092  -44.362 -17.698 1.00 82.20  ?  924  LEU A N     1 
ATOM   4651 C  CA    . LEU A 1 616 ? 74.718  -44.688 -17.351 1.00 79.48  ?  924  LEU A CA    1 
ATOM   4652 C  C     . LEU A 1 616 ? 74.466  -46.169 -17.588 1.00 70.20  ?  924  LEU A C     1 
ATOM   4653 O  O     . LEU A 1 616 ? 74.765  -46.688 -18.669 1.00 59.40  ?  924  LEU A O     1 
ATOM   4654 C  CB    . LEU A 1 616 ? 73.736  -43.851 -18.176 1.00 77.32  ?  924  LEU A CB    1 
ATOM   4655 C  CG    . LEU A 1 616 ? 73.826  -42.333 -18.006 1.00 74.33  ?  924  LEU A CG    1 
ATOM   4656 C  CD1   . LEU A 1 616 ? 72.909  -41.633 -18.997 1.00 73.52  ?  924  LEU A CD1   1 
ATOM   4657 C  CD2   . LEU A 1 616 ? 73.484  -41.929 -16.581 1.00 81.16  ?  924  LEU A CD2   1 
ATOM   4658 N  N     . THR A 1 617 ? 73.928  -46.843 -16.576 1.00 76.71  ?  925  THR A N     1 
ATOM   4659 C  CA    . THR A 1 617 ? 73.418  -48.189 -16.772 1.00 79.05  ?  925  THR A CA    1 
ATOM   4660 C  C     . THR A 1 617 ? 72.271  -48.160 -17.778 1.00 82.79  ?  925  THR A C     1 
ATOM   4661 O  O     . THR A 1 617 ? 71.707  -47.108 -18.091 1.00 77.95  ?  925  THR A O     1 
ATOM   4662 C  CB    . THR A 1 617 ? 72.939  -48.786 -15.449 1.00 80.93  ?  925  THR A CB    1 
ATOM   4663 O  OG1   . THR A 1 617 ? 71.971  -47.916 -14.849 1.00 82.15  ?  925  THR A OG1   1 
ATOM   4664 C  CG2   . THR A 1 617 ? 74.107  -48.980 -14.497 1.00 84.45  ?  925  THR A CG2   1 
ATOM   4665 N  N     . GLU A 1 618 ? 71.923  -49.342 -18.288 1.00 82.87  ?  926  GLU A N     1 
ATOM   4666 C  CA    . GLU A 1 618 ? 70.883  -49.419 -19.308 1.00 85.64  ?  926  GLU A CA    1 
ATOM   4667 C  C     . GLU A 1 618 ? 69.557  -48.870 -18.799 1.00 80.02  ?  926  GLU A C     1 
ATOM   4668 O  O     . GLU A 1 618 ? 68.730  -48.408 -19.595 1.00 67.23  ?  926  GLU A O     1 
ATOM   4669 C  CB    . GLU A 1 618 ? 70.716  -50.865 -19.777 1.00 93.80  ?  926  GLU A CB    1 
ATOM   4670 C  CG    . GLU A 1 618 ? 69.839  -51.019 -21.010 1.00 97.76  ?  926  GLU A CG    1 
ATOM   4671 C  CD    . GLU A 1 618 ? 70.413  -50.317 -22.226 1.00 100.71 ?  926  GLU A CD    1 
ATOM   4672 O  OE1   . GLU A 1 618 ? 71.602  -49.936 -22.189 1.00 94.51  ?  926  GLU A OE1   1 
ATOM   4673 O  OE2   . GLU A 1 618 ? 69.673  -50.140 -23.217 1.00 95.56  ?  926  GLU A OE2   1 
ATOM   4674 N  N     . GLN A 1 619 ? 69.336  -48.899 -17.482 1.00 70.50  ?  927  GLN A N     1 
ATOM   4675 C  CA    . GLN A 1 619 ? 68.077  -48.403 -16.938 1.00 70.53  ?  927  GLN A CA    1 
ATOM   4676 C  C     . GLN A 1 619 ? 67.891  -46.919 -17.224 1.00 72.76  ?  927  GLN A C     1 
ATOM   4677 O  O     . GLN A 1 619 ? 66.754  -46.438 -17.294 1.00 63.88  ?  927  GLN A O     1 
ATOM   4678 C  CB    . GLN A 1 619 ? 68.015  -48.669 -15.434 1.00 53.29  ?  927  GLN A CB    1 
ATOM   4679 C  CG    . GLN A 1 619 ? 66.630  -48.489 -14.840 1.00 74.92  ?  927  GLN A CG    1 
ATOM   4680 C  CD    . GLN A 1 619 ? 66.509  -49.083 -13.451 1.00 92.83  ?  927  GLN A CD    1 
ATOM   4681 O  OE1   . GLN A 1 619 ? 67.510  -49.437 -12.826 1.00 98.86  ?  927  GLN A OE1   1 
ATOM   4682 N  NE2   . GLN A 1 619 ? 65.277  -49.201 -12.961 1.00 76.74  ?  927  GLN A NE2   1 
ATOM   4683 N  N     . LEU A 1 620 ? 68.986  -46.182 -17.397 1.00 69.15  ?  928  LEU A N     1 
ATOM   4684 C  CA    . LEU A 1 620 ? 68.941  -44.764 -17.735 1.00 58.73  ?  928  LEU A CA    1 
ATOM   4685 C  C     . LEU A 1 620 ? 69.289  -44.486 -19.187 1.00 60.96  ?  928  LEU A C     1 
ATOM   4686 O  O     . LEU A 1 620 ? 68.625  -43.671 -19.830 1.00 54.43  ?  928  LEU A O     1 
ATOM   4687 C  CB    . LEU A 1 620 ? 69.897  -43.977 -16.831 1.00 56.61  ?  928  LEU A CB    1 
ATOM   4688 C  CG    . LEU A 1 620 ? 69.706  -44.161 -15.324 1.00 65.29  ?  928  LEU A CG    1 
ATOM   4689 C  CD1   . LEU A 1 620 ? 70.733  -43.343 -14.554 1.00 65.17  ?  928  LEU A CD1   1 
ATOM   4690 C  CD2   . LEU A 1 620 ? 68.294  -43.789 -14.896 1.00 58.29  ?  928  LEU A CD2   1 
ATOM   4691 N  N     . ALA A 1 621 ? 70.317  -45.148 -19.725 1.00 63.88  ?  929  ALA A N     1 
ATOM   4692 C  CA    . ALA A 1 621 ? 70.700  -44.915 -21.113 1.00 60.12  ?  929  ALA A CA    1 
ATOM   4693 C  C     . ALA A 1 621 ? 69.601  -45.342 -22.075 1.00 60.99  ?  929  ALA A C     1 
ATOM   4694 O  O     . ALA A 1 621 ? 69.497  -44.797 -23.180 1.00 49.57  ?  929  ALA A O     1 
ATOM   4695 C  CB    . ALA A 1 621 ? 71.998  -45.657 -21.430 1.00 76.73  ?  929  ALA A CB    1 
ATOM   4696 N  N     . GLY A 1 622 ? 68.780  -46.312 -21.681 1.00 60.71  ?  930  GLY A N     1 
ATOM   4697 C  CA    . GLY A 1 622 ? 67.687  -46.765 -22.506 1.00 66.00  ?  930  GLY A CA    1 
ATOM   4698 C  C     . GLY A 1 622 ? 66.652  -45.678 -22.702 1.00 60.18  ?  930  GLY A C     1 
ATOM   4699 O  O     . GLY A 1 622 ? 66.423  -45.197 -23.817 1.00 56.14  ?  930  GLY A O     1 
ATOM   4700 N  N     . PRO A 1 623 ? 65.998  -45.271 -21.612 1.00 52.35  ?  931  PRO A N     1 
ATOM   4701 C  CA    . PRO A 1 623 ? 65.051  -44.147 -21.711 1.00 54.14  ?  931  PRO A CA    1 
ATOM   4702 C  C     . PRO A 1 623 ? 65.654  -42.918 -22.368 1.00 51.14  ?  931  PRO A C     1 
ATOM   4703 O  O     . PRO A 1 623 ? 64.963  -42.211 -23.112 1.00 51.81  ?  931  PRO A O     1 
ATOM   4704 C  CB    . PRO A 1 623 ? 64.670  -43.888 -20.247 1.00 53.88  ?  931  PRO A CB    1 
ATOM   4705 C  CG    . PRO A 1 623 ? 64.867  -45.207 -19.569 1.00 51.77  ?  931  PRO A CG    1 
ATOM   4706 C  CD    . PRO A 1 623 ? 66.043  -45.845 -20.255 1.00 50.23  ?  931  PRO A CD    1 
ATOM   4707 N  N     . LEU A 1 624 ? 66.938  -42.649 -22.122 1.00 51.67  ?  932  LEU A N     1 
ATOM   4708 C  CA    . LEU A 1 624 ? 67.583  -41.500 -22.746 1.00 47.62  ?  932  LEU A CA    1 
ATOM   4709 C  C     . LEU A 1 624 ? 67.595  -41.638 -24.263 1.00 50.97  ?  932  LEU A C     1 
ATOM   4710 O  O     . LEU A 1 624 ? 67.383  -40.657 -24.986 1.00 49.92  ?  932  LEU A O     1 
ATOM   4711 C  CB    . LEU A 1 624 ? 69.005  -41.344 -22.205 1.00 55.33  ?  932  LEU A CB    1 
ATOM   4712 C  CG    . LEU A 1 624 ? 69.875  -40.265 -22.853 1.00 57.07  ?  932  LEU A CG    1 
ATOM   4713 C  CD1   . LEU A 1 624 ? 69.205  -38.901 -22.776 1.00 51.37  ?  932  LEU A CD1   1 
ATOM   4714 C  CD2   . LEU A 1 624 ? 71.241  -40.235 -22.186 1.00 53.79  ?  932  LEU A CD2   1 
ATOM   4715 N  N     . ARG A 1 625 ? 67.834  -42.852 -24.765 1.00 64.96  ?  933  ARG A N     1 
ATOM   4716 C  CA    . ARG A 1 625 ? 67.856  -43.058 -26.209 1.00 65.23  ?  933  ARG A CA    1 
ATOM   4717 C  C     . ARG A 1 625 ? 66.462  -42.915 -26.808 1.00 46.31  ?  933  ARG A C     1 
ATOM   4718 O  O     . ARG A 1 625 ? 66.309  -42.394 -27.918 1.00 43.16  ?  933  ARG A O     1 
ATOM   4719 C  CB    . ARG A 1 625 ? 68.450  -44.430 -26.537 1.00 70.54  ?  933  ARG A CB    1 
ATOM   4720 C  CG    . ARG A 1 625 ? 69.888  -44.361 -27.039 1.00 92.39  ?  933  ARG A CG    1 
ATOM   4721 C  CD    . ARG A 1 625 ? 70.460  -45.735 -27.377 1.00 91.88  ?  933  ARG A CD    1 
ATOM   4722 N  NE    . ARG A 1 625 ? 70.837  -46.492 -26.183 1.00 90.89  ?  933  ARG A NE    1 
ATOM   4723 C  CZ    . ARG A 1 625 ? 70.132  -47.490 -25.654 1.00 82.28  ?  933  ARG A CZ    1 
ATOM   4724 N  NH1   . ARG A 1 625 ? 68.991  -47.891 -26.203 1.00 88.17  ?  933  ARG A NH1   1 
ATOM   4725 N  NH2   . ARG A 1 625 ? 70.579  -48.098 -24.564 1.00 78.25  ?  933  ARG A NH2   1 
ATOM   4726 N  N     . GLN A 1 626 ? 65.432  -43.367 -26.088 1.00 49.96  ?  934  GLN A N     1 
ATOM   4727 C  CA    . GLN A 1 626 ? 64.063  -43.200 -26.566 1.00 54.07  ?  934  GLN A CA    1 
ATOM   4728 C  C     . GLN A 1 626 ? 63.708  -41.723 -26.681 1.00 56.27  ?  934  GLN A C     1 
ATOM   4729 O  O     . GLN A 1 626 ? 63.161  -41.279 -27.698 1.00 47.97  ?  934  GLN A O     1 
ATOM   4730 C  CB    . GLN A 1 626 ? 63.088  -43.914 -25.629 1.00 56.19  ?  934  GLN A CB    1 
ATOM   4731 C  CG    . GLN A 1 626 ? 63.335  -45.407 -25.488 1.00 59.95  ?  934  GLN A CG    1 
ATOM   4732 C  CD    . GLN A 1 626 ? 62.349  -46.074 -24.546 1.00 76.31  ?  934  GLN A CD    1 
ATOM   4733 O  OE1   . GLN A 1 626 ? 61.153  -45.777 -24.567 1.00 69.79  ?  934  GLN A OE1   1 
ATOM   4734 N  NE2   . GLN A 1 626 ? 62.849  -46.977 -23.708 1.00 73.02  ?  934  GLN A NE2   1 
ATOM   4735 N  N     . MET A 1 627 ? 64.020  -40.943 -25.642 1.00 53.10  ?  935  MET A N     1 
ATOM   4736 C  CA    . MET A 1 627 ? 63.729  -39.514 -25.675 1.00 45.82  ?  935  MET A CA    1 
ATOM   4737 C  C     . MET A 1 627 ? 64.438  -38.834 -26.838 1.00 47.31  ?  935  MET A C     1 
ATOM   4738 O  O     . MET A 1 627 ? 63.864  -37.961 -27.500 1.00 43.66  ?  935  MET A O     1 
ATOM   4739 C  CB    . MET A 1 627 ? 64.131  -38.867 -24.348 1.00 45.49  ?  935  MET A CB    1 
ATOM   4740 C  CG    . MET A 1 627 ? 63.909  -37.357 -24.298 1.00 52.54  ?  935  MET A CG    1 
ATOM   4741 S  SD    . MET A 1 627 ? 65.308  -36.395 -24.914 1.00 50.52  ?  935  MET A SD    1 
ATOM   4742 C  CE    . MET A 1 627 ? 66.440  -36.556 -23.536 1.00 60.27  ?  935  MET A CE    1 
ATOM   4743 N  N     . GLN A 1 628 ? 65.689  -39.220 -27.105 1.00 48.83  ?  936  GLN A N     1 
ATOM   4744 C  CA    . GLN A 1 628 ? 66.448  -38.575 -28.171 1.00 52.02  ?  936  GLN A CA    1 
ATOM   4745 C  C     . GLN A 1 628 ? 65.872  -38.906 -29.541 1.00 56.59  ?  936  GLN A C     1 
ATOM   4746 O  O     . GLN A 1 628 ? 65.846  -38.048 -30.431 1.00 53.27  ?  936  GLN A O     1 
ATOM   4747 C  CB    . GLN A 1 628 ? 67.916  -38.988 -28.092 1.00 60.40  ?  936  GLN A CB    1 
ATOM   4748 C  CG    . GLN A 1 628 ? 68.657  -38.378 -26.918 1.00 61.50  ?  936  GLN A CG    1 
ATOM   4749 C  CD    . GLN A 1 628 ? 70.028  -38.988 -26.714 1.00 62.16  ?  936  GLN A CD    1 
ATOM   4750 O  OE1   . GLN A 1 628 ? 70.364  -40.008 -27.317 1.00 62.75  ?  936  GLN A OE1   1 
ATOM   4751 N  NE2   . GLN A 1 628 ? 70.829  -38.367 -25.859 1.00 50.38  ?  936  GLN A NE2   1 
ATOM   4752 N  N     . GLU A 1 629 ? 65.415  -40.143 -29.738 1.00 53.86  ?  937  GLU A N     1 
ATOM   4753 C  CA    . GLU A 1 629 ? 64.749  -40.487 -30.989 1.00 61.31  ?  937  GLU A CA    1 
ATOM   4754 C  C     . GLU A 1 629 ? 63.521  -39.610 -31.199 1.00 51.25  ?  937  GLU A C     1 
ATOM   4755 O  O     . GLU A 1 629 ? 63.315  -39.052 -32.282 1.00 50.87  ?  937  GLU A O     1 
ATOM   4756 C  CB    . GLU A 1 629 ? 64.362  -41.966 -30.992 1.00 66.31  ?  937  GLU A CB    1 
ATOM   4757 C  CG    . GLU A 1 629 ? 65.541  -42.932 -30.991 1.00 96.29  ?  937  GLU A CG    1 
ATOM   4758 C  CD    . GLU A 1 629 ? 66.239  -43.025 -32.339 1.00 103.39 ?  937  GLU A CD    1 
ATOM   4759 O  OE1   . GLU A 1 629 ? 66.425  -41.981 -32.997 1.00 97.71  ?  937  GLU A OE1   1 
ATOM   4760 O  OE2   . GLU A 1 629 ? 66.601  -44.151 -32.742 1.00 132.56 -1 937  GLU A OE2   1 
ATOM   4761 N  N     . CYS A 1 630 ? 62.694  -39.473 -30.162 1.00 40.01  ?  938  CYS A N     1 
ATOM   4762 C  CA    . CYS A 1 630 ? 61.528  -38.603 -30.259 1.00 53.42  ?  938  CYS A CA    1 
ATOM   4763 C  C     . CYS A 1 630 ? 61.940  -37.166 -30.559 1.00 51.69  ?  938  CYS A C     1 
ATOM   4764 O  O     . CYS A 1 630 ? 61.328  -36.499 -31.402 1.00 47.79  ?  938  CYS A O     1 
ATOM   4765 C  CB    . CYS A 1 630 ? 60.719  -38.679 -28.966 1.00 53.33  ?  938  CYS A CB    1 
ATOM   4766 S  SG    . CYS A 1 630 ? 59.164  -37.772 -29.018 1.00 60.24  ?  938  CYS A SG    1 
ATOM   4767 N  N     . ALA A 1 631 ? 62.988  -36.677 -29.889 1.00 52.15  ?  939  ALA A N     1 
ATOM   4768 C  CA    . ALA A 1 631 ? 63.460  -35.319 -30.139 1.00 49.14  ?  939  ALA A CA    1 
ATOM   4769 C  C     . ALA A 1 631 ? 63.895  -35.144 -31.587 1.00 48.44  ?  939  ALA A C     1 
ATOM   4770 O  O     . ALA A 1 631 ? 63.707  -34.072 -32.176 1.00 48.86  ?  939  ALA A O     1 
ATOM   4771 C  CB    . ALA A 1 631 ? 64.612  -34.982 -29.193 1.00 47.53  ?  939  ALA A CB    1 
ATOM   4772 N  N     . LYS A 1 632 ? 64.487  -36.185 -32.176 1.00 51.73  ?  940  LYS A N     1 
ATOM   4773 C  CA    . LYS A 1 632 ? 64.900  -36.108 -33.574 1.00 59.49  ?  940  LYS A CA    1 
ATOM   4774 C  C     . LYS A 1 632 ? 63.698  -35.902 -34.484 1.00 51.59  ?  940  LYS A C     1 
ATOM   4775 O  O     . LYS A 1 632 ? 63.730  -35.068 -35.397 1.00 47.14  ?  940  LYS A O     1 
ATOM   4776 C  CB    . LYS A 1 632 ? 65.654  -37.378 -33.970 1.00 69.74  ?  940  LYS A CB    1 
ATOM   4777 C  CG    . LYS A 1 632 ? 67.040  -37.512 -33.361 1.00 77.24  ?  940  LYS A CG    1 
ATOM   4778 C  CD    . LYS A 1 632 ? 67.669  -38.848 -33.725 1.00 84.22  ?  940  LYS A CD    1 
ATOM   4779 C  CE    . LYS A 1 632 ? 69.071  -38.988 -33.156 1.00 105.43 ?  940  LYS A CE    1 
ATOM   4780 N  NZ    . LYS A 1 632 ? 69.689  -40.292 -33.524 1.00 122.23 ?  940  LYS A NZ    1 
ATOM   4781 N  N     . ARG A 1 633 ? 62.624  -36.659 -34.251 1.00 58.19  ?  941  ARG A N     1 
ATOM   4782 C  CA    . ARG A 1 633 ? 61.441  -36.548 -35.096 1.00 60.70  ?  941  ARG A CA    1 
ATOM   4783 C  C     . ARG A 1 633 ? 60.838  -35.152 -35.013 1.00 58.04  ?  941  ARG A C     1 
ATOM   4784 O  O     . ARG A 1 633 ? 60.479  -34.559 -36.038 1.00 52.15  ?  941  ARG A O     1 
ATOM   4785 C  CB    . ARG A 1 633 ? 60.416  -37.607 -34.693 1.00 66.15  ?  941  ARG A CB    1 
ATOM   4786 C  CG    . ARG A 1 633 ? 59.207  -37.677 -35.609 1.00 75.10  ?  941  ARG A CG    1 
ATOM   4787 C  CD    . ARG A 1 633 ? 58.490  -39.007 -35.467 1.00 85.74  ?  941  ARG A CD    1 
ATOM   4788 N  NE    . ARG A 1 633 ? 58.153  -39.303 -34.077 1.00 92.37  ?  941  ARG A NE    1 
ATOM   4789 C  CZ    . ARG A 1 633 ? 57.064  -38.860 -33.455 1.00 81.98  ?  941  ARG A CZ    1 
ATOM   4790 N  NH1   . ARG A 1 633 ? 56.191  -38.087 -34.092 1.00 62.85  ?  941  ARG A NH1   1 
ATOM   4791 N  NH2   . ARG A 1 633 ? 56.849  -39.189 -32.188 1.00 72.35  ?  941  ARG A NH2   1 
ATOM   4792 N  N     . ILE A 1 634 ? 60.723  -34.607 -33.801 1.00 49.25  ?  942  ILE A N     1 
ATOM   4793 C  CA    . ILE A 1 634 ? 60.230  -33.242 -33.651 1.00 47.82  ?  942  ILE A CA    1 
ATOM   4794 C  C     . ILE A 1 634 ? 61.124  -32.271 -34.410 1.00 48.07  ?  942  ILE A C     1 
ATOM   4795 O  O     . ILE A 1 634 ? 60.637  -31.376 -35.113 1.00 40.21  ?  942  ILE A O     1 
ATOM   4796 C  CB    . ILE A 1 634 ? 60.120  -32.885 -32.158 1.00 47.12  ?  942  ILE A CB    1 
ATOM   4797 C  CG1   . ILE A 1 634 ? 58.798  -33.426 -31.612 1.00 49.98  ?  942  ILE A CG1   1 
ATOM   4798 C  CG2   . ILE A 1 634 ? 60.232  -31.378 -31.941 1.00 43.43  ?  942  ILE A CG2   1 
ATOM   4799 C  CD1   . ILE A 1 634 ? 58.736  -33.482 -30.123 1.00 59.67  ?  942  ILE A CD1   1 
ATOM   4800 N  N     . ALA A 1 635 ? 62.443  -32.440 -34.295 1.00 49.62  ?  943  ALA A N     1 
ATOM   4801 C  CA    . ALA A 1 635 ? 63.363  -31.606 -35.062 1.00 47.91  ?  943  ALA A CA    1 
ATOM   4802 C  C     . ALA A 1 635 ? 63.093  -31.725 -36.557 1.00 46.92  ?  943  ALA A C     1 
ATOM   4803 O  O     . ALA A 1 635 ? 63.120  -30.724 -37.283 1.00 50.86  ?  943  ALA A O     1 
ATOM   4804 C  CB    . ALA A 1 635 ? 64.807  -31.993 -34.742 1.00 56.17  ?  943  ALA A CB    1 
ATOM   4805 N  N     . LYS A 1 636 ? 62.827  -32.943 -37.034 1.00 53.38  ?  944  LYS A N     1 
ATOM   4806 C  CA    . LYS A 1 636 ? 62.489  -33.134 -38.441 1.00 53.55  ?  944  LYS A CA    1 
ATOM   4807 C  C     . LYS A 1 636 ? 61.210  -32.388 -38.800 1.00 53.43  ?  944  LYS A C     1 
ATOM   4808 O  O     . LYS A 1 636 ? 61.186  -31.593 -39.747 1.00 47.94  ?  944  LYS A O     1 
ATOM   4809 C  CB    . LYS A 1 636 ? 62.348  -34.628 -38.740 1.00 66.29  ?  944  LYS A CB    1 
ATOM   4810 C  CG    . LYS A 1 636 ? 62.111  -34.957 -40.207 1.00 77.03  ?  944  LYS A CG    1 
ATOM   4811 C  CD    . LYS A 1 636 ? 60.807  -35.717 -40.400 1.00 86.61  ?  944  LYS A CD    1 
ATOM   4812 C  CE    . LYS A 1 636 ? 60.646  -36.194 -41.836 1.00 109.64 ?  944  LYS A CE    1 
ATOM   4813 N  NZ    . LYS A 1 636 ? 59.317  -36.823 -42.077 1.00 103.95 ?  944  LYS A NZ    1 
ATOM   4814 N  N     . VAL A 1 637 ? 60.132  -32.629 -38.046 1.00 51.83  ?  945  VAL A N     1 
ATOM   4815 C  CA    . VAL A 1 637 ? 58.869  -31.936 -38.299 1.00 52.25  ?  945  VAL A CA    1 
ATOM   4816 C  C     . VAL A 1 637 ? 59.078  -30.429 -38.287 1.00 45.53  ?  945  VAL A C     1 
ATOM   4817 O  O     . VAL A 1 637 ? 58.550  -29.705 -39.140 1.00 48.12  ?  945  VAL A O     1 
ATOM   4818 C  CB    . VAL A 1 637 ? 57.808  -32.361 -37.265 1.00 45.69  ?  945  VAL A CB    1 
ATOM   4819 C  CG1   . VAL A 1 637 ? 56.536  -31.539 -37.435 1.00 51.15  ?  945  VAL A CG1   1 
ATOM   4820 C  CG2   . VAL A 1 637 ? 57.506  -33.842 -37.393 1.00 56.26  ?  945  VAL A CG2   1 
ATOM   4821 N  N     . SER A 1 638 ? 59.848  -29.930 -37.316 1.00 46.95  ?  946  SER A N     1 
ATOM   4822 C  CA    . SER A 1 638 ? 60.091  -28.493 -37.230 1.00 54.13  ?  946  SER A CA    1 
ATOM   4823 C  C     . SER A 1 638 ? 60.786  -27.985 -38.486 1.00 54.90  ?  946  SER A C     1 
ATOM   4824 O  O     . SER A 1 638 ? 60.381  -26.973 -39.070 1.00 49.58  ?  946  SER A O     1 
ATOM   4825 C  CB    . SER A 1 638 ? 60.925  -28.175 -35.989 1.00 52.13  ?  946  SER A CB    1 
ATOM   4826 O  OG    . SER A 1 638 ? 60.282  -28.622 -34.809 1.00 51.03  ?  946  SER A OG    1 
ATOM   4827 N  N     . ALA A 1 639 ? 61.839  -28.681 -38.918 1.00 51.19  ?  947  ALA A N     1 
ATOM   4828 C  CA    . ALA A 1 639 ? 62.549  -28.280 -40.127 1.00 55.48  ?  947  ALA A CA    1 
ATOM   4829 C  C     . ALA A 1 639 ? 61.608  -28.240 -41.326 1.00 57.89  ?  947  ALA A C     1 
ATOM   4830 O  O     . ALA A 1 639 ? 61.578  -27.256 -42.074 1.00 56.03  ?  947  ALA A O     1 
ATOM   4831 C  CB    . ALA A 1 639 ? 63.716  -29.234 -40.381 1.00 52.74  ?  947  ALA A CB    1 
ATOM   4832 N  N     . GLU A 1 640 ? 60.825  -29.305 -41.522 1.00 56.67  ?  948  GLU A N     1 
ATOM   4833 C  CA    . GLU A 1 640 ? 59.881  -29.334 -42.635 1.00 63.22  ?  948  GLU A CA    1 
ATOM   4834 C  C     . GLU A 1 640 ? 58.851  -28.219 -42.524 1.00 61.27  ?  948  GLU A C     1 
ATOM   4835 O  O     . GLU A 1 640 ? 58.355  -27.728 -43.545 1.00 62.74  ?  948  GLU A O     1 
ATOM   4836 C  CB    . GLU A 1 640 ? 59.182  -30.693 -42.699 1.00 60.73  ?  948  GLU A CB    1 
ATOM   4837 C  CG    . GLU A 1 640 ? 60.132  -31.870 -42.827 1.00 70.52  ?  948  GLU A CG    1 
ATOM   4838 C  CD    . GLU A 1 640 ? 59.408  -33.190 -43.006 1.00 86.65  ?  948  GLU A CD    1 
ATOM   4839 O  OE1   . GLU A 1 640 ? 59.575  -33.821 -44.071 1.00 101.14 ?  948  GLU A OE1   1 
ATOM   4840 O  OE2   . GLU A 1 640 ? 58.669  -33.594 -42.084 1.00 90.68  -1 948  GLU A OE2   1 
ATOM   4841 N  N     . ALA A 1 641 ? 58.506  -27.814 -41.301 1.00 55.77  ?  949  ALA A N     1 
ATOM   4842 C  CA    . ALA A 1 641 ? 57.624  -26.669 -41.110 1.00 59.19  ?  949  ALA A CA    1 
ATOM   4843 C  C     . ALA A 1 641 ? 58.320  -25.339 -41.380 1.00 64.15  ?  949  ALA A C     1 
ATOM   4844 O  O     . ALA A 1 641 ? 57.655  -24.298 -41.331 1.00 58.17  ?  949  ALA A O     1 
ATOM   4845 C  CB    . ALA A 1 641 ? 57.056  -26.681 -39.690 1.00 57.20  ?  949  ALA A CB    1 
ATOM   4846 N  N     . LYS A 1 642 ? 59.628  -25.358 -41.651 1.00 57.91  ?  950  LYS A N     1 
ATOM   4847 C  CA    . LYS A 1 642 ? 60.401  -24.181 -42.040 1.00 61.94  ?  950  LYS A CA    1 
ATOM   4848 C  C     . LYS A 1 642 ? 60.768  -23.322 -40.836 1.00 58.81  ?  950  LYS A C     1 
ATOM   4849 O  O     . LYS A 1 642 ? 60.923  -22.104 -40.960 1.00 56.37  ?  950  LYS A O     1 
ATOM   4850 C  CB    . LYS A 1 642 ? 59.643  -23.347 -43.081 1.00 56.58  ?  950  LYS A CB    1 
ATOM   4851 C  CG    . LYS A 1 642 ? 59.203  -24.137 -44.312 1.00 71.57  ?  950  LYS A CG    1 
ATOM   4852 C  CD    . LYS A 1 642 ? 60.397  -24.633 -45.124 1.00 89.52  ?  950  LYS A CD    1 
ATOM   4853 C  CE    . LYS A 1 642 ? 60.066  -25.899 -45.900 1.00 82.93  ?  950  LYS A CE    1 
ATOM   4854 N  NZ    . LYS A 1 642 ? 61.280  -26.495 -46.525 1.00 83.83  ?  950  LYS A NZ    1 
ATOM   4855 N  N     . LEU A 1 643 ? 60.916  -23.947 -39.672 1.00 56.93  ?  951  LEU A N     1 
ATOM   4856 C  CA    . LEU A 1 643 ? 61.516  -23.295 -38.518 1.00 57.58  ?  951  LEU A CA    1 
ATOM   4857 C  C     . LEU A 1 643 ? 63.019  -23.532 -38.534 1.00 69.43  ?  951  LEU A C     1 
ATOM   4858 O  O     . LEU A 1 643 ? 63.480  -24.640 -38.822 1.00 75.24  ?  951  LEU A O     1 
ATOM   4859 C  CB    . LEU A 1 643 ? 60.931  -23.828 -37.211 1.00 57.27  ?  951  LEU A CB    1 
ATOM   4860 C  CG    . LEU A 1 643 ? 59.469  -23.525 -36.896 1.00 58.56  ?  951  LEU A CG    1 
ATOM   4861 C  CD1   . LEU A 1 643 ? 59.066  -24.261 -35.628 1.00 53.88  ?  951  LEU A CD1   1 
ATOM   4862 C  CD2   . LEU A 1 643 ? 59.240  -22.028 -36.748 1.00 55.89  ?  951  LEU A CD2   1 
ATOM   4863 N  N     . GLU A 1 644 ? 63.780  -22.489 -38.225 1.00 71.65  ?  952  GLU A N     1 
ATOM   4864 C  CA    . GLU A 1 644 ? 65.226  -22.629 -38.123 1.00 79.93  ?  952  GLU A CA    1 
ATOM   4865 C  C     . GLU A 1 644 ? 65.564  -23.469 -36.897 1.00 71.66  ?  952  GLU A C     1 
ATOM   4866 O  O     . GLU A 1 644 ? 65.217  -23.100 -35.770 1.00 76.25  ?  952  GLU A O     1 
ATOM   4867 C  CB    . GLU A 1 644 ? 65.887  -21.256 -38.041 1.00 99.02  ?  952  GLU A CB    1 
ATOM   4868 C  CG    . GLU A 1 644 ? 65.592  -20.360 -39.234 1.00 113.11 ?  952  GLU A CG    1 
ATOM   4869 C  CD    . GLU A 1 644 ? 66.308  -19.024 -39.153 1.00 128.13 ?  952  GLU A CD    1 
ATOM   4870 O  OE1   . GLU A 1 644 ? 67.257  -18.903 -38.349 1.00 130.58 ?  952  GLU A OE1   1 
ATOM   4871 O  OE2   . GLU A 1 644 ? 65.920  -18.094 -39.891 1.00 120.69 -1 952  GLU A OE2   1 
ATOM   4872 N  N     . ILE A 1 645 ? 66.224  -24.603 -37.115 1.00 66.36  ?  953  ILE A N     1 
ATOM   4873 C  CA    . ILE A 1 645 ? 66.589  -25.500 -36.024 1.00 71.21  ?  953  ILE A CA    1 
ATOM   4874 C  C     . ILE A 1 645 ? 67.682  -26.433 -36.520 1.00 77.45  ?  953  ILE A C     1 
ATOM   4875 O  O     . ILE A 1 645 ? 67.682  -26.852 -37.681 1.00 88.35  ?  953  ILE A O     1 
ATOM   4876 C  CB    . ILE A 1 645 ? 65.362  -26.291 -35.509 1.00 83.78  ?  953  ILE A CB    1 
ATOM   4877 C  CG1   . ILE A 1 645 ? 65.782  -27.258 -34.397 1.00 76.04  ?  953  ILE A CG1   1 
ATOM   4878 C  CG2   . ILE A 1 645 ? 64.695  -27.045 -36.655 1.00 75.78  ?  953  ILE A CG2   1 
ATOM   4879 C  CD1   . ILE A 1 645 ? 64.625  -27.957 -33.712 1.00 67.37  ?  953  ILE A CD1   1 
ATOM   4880 N  N     . ASP A 1 646 ? 68.611  -26.760 -35.627 1.00 78.06  ?  954  ASP A N     1 
ATOM   4881 C  CA    . ASP A 1 646 ? 69.663  -27.730 -35.893 1.00 83.95  ?  954  ASP A CA    1 
ATOM   4882 C  C     . ASP A 1 646 ? 69.410  -28.969 -35.046 1.00 75.21  ?  954  ASP A C     1 
ATOM   4883 O  O     . ASP A 1 646 ? 69.282  -28.872 -33.821 1.00 75.69  ?  954  ASP A O     1 
ATOM   4884 C  CB    . ASP A 1 646 ? 71.043  -27.148 -35.586 1.00 98.22  ?  954  ASP A CB    1 
ATOM   4885 C  CG    . ASP A 1 646 ? 72.155  -28.159 -35.784 1.00 89.34  ?  954  ASP A CG    1 
ATOM   4886 O  OD1   . ASP A 1 646 ? 72.484  -28.462 -36.950 1.00 89.52  ?  954  ASP A OD1   1 
ATOM   4887 O  OD2   . ASP A 1 646 ? 72.691  -28.658 -34.771 1.00 82.40  ?  954  ASP A OD2   1 
ATOM   4888 N  N     . GLU A 1 647 ? 69.336  -30.129 -35.701 1.00 69.73  ?  955  GLU A N     1 
ATOM   4889 C  CA    . GLU A 1 647 ? 68.998  -31.362 -34.997 1.00 69.04  ?  955  GLU A CA    1 
ATOM   4890 C  C     . GLU A 1 647 ? 69.973  -31.630 -33.856 1.00 75.51  ?  955  GLU A C     1 
ATOM   4891 O  O     . GLU A 1 647 ? 69.561  -31.846 -32.710 1.00 66.34  ?  955  GLU A O     1 
ATOM   4892 C  CB    . GLU A 1 647 ? 68.982  -32.534 -35.978 1.00 76.10  ?  955  GLU A CB    1 
ATOM   4893 C  CG    . GLU A 1 647 ? 68.549  -33.856 -35.363 1.00 73.98  ?  955  GLU A CG    1 
ATOM   4894 C  CD    . GLU A 1 647 ? 68.639  -35.012 -36.341 1.00 86.84  ?  955  GLU A CD    1 
ATOM   4895 O  OE1   . GLU A 1 647 ? 69.276  -34.849 -37.403 1.00 81.95  ?  955  GLU A OE1   1 
ATOM   4896 O  OE2   . GLU A 1 647 ? 68.071  -36.086 -36.047 1.00 97.76  ?  955  GLU A OE2   1 
ATOM   4897 N  N     . GLU A 1 648 ? 71.275  -31.622 -34.153 1.00 84.71  ?  956  GLU A N     1 
ATOM   4898 C  CA    . GLU A 1 648 ? 72.271  -31.940 -33.134 1.00 79.07  ?  956  GLU A CA    1 
ATOM   4899 C  C     . GLU A 1 648 ? 72.198  -30.956 -31.972 1.00 77.84  ?  956  GLU A C     1 
ATOM   4900 O  O     . GLU A 1 648 ? 72.191  -31.358 -30.802 1.00 68.15  ?  956  GLU A O     1 
ATOM   4901 C  CB    . GLU A 1 648 ? 73.669  -31.947 -33.755 1.00 91.58  ?  956  GLU A CB    1 
ATOM   4902 C  CG    . GLU A 1 648 ? 74.774  -32.352 -32.788 1.00 105.16 ?  956  GLU A CG    1 
ATOM   4903 C  CD    . GLU A 1 648 ? 76.104  -32.590 -33.480 1.00 118.26 ?  956  GLU A CD    1 
ATOM   4904 O  OE1   . GLU A 1 648 ? 76.102  -32.922 -34.685 1.00 102.00 ?  956  GLU A OE1   1 
ATOM   4905 O  OE2   . GLU A 1 648 ? 77.152  -32.444 -32.817 1.00 120.59 -1 956  GLU A OE2   1 
ATOM   4906 N  N     . THR A 1 649 ? 72.145  -29.657 -32.277 1.00 68.87  ?  957  THR A N     1 
ATOM   4907 C  CA    . THR A 1 649 ? 72.008  -28.650 -31.230 1.00 69.34  ?  957  THR A CA    1 
ATOM   4908 C  C     . THR A 1 649 ? 70.776  -28.918 -30.373 1.00 73.97  ?  957  THR A C     1 
ATOM   4909 O  O     . THR A 1 649 ? 70.848  -28.915 -29.138 1.00 62.76  ?  957  THR A O     1 
ATOM   4910 C  CB    . THR A 1 649 ? 71.930  -27.255 -31.855 1.00 77.36  ?  957  THR A CB    1 
ATOM   4911 O  OG1   . THR A 1 649 ? 73.081  -27.030 -32.679 1.00 74.89  ?  957  THR A OG1   1 
ATOM   4912 C  CG2   . THR A 1 649 ? 71.861  -26.180 -30.777 1.00 66.92  ?  957  THR A CG2   1 
ATOM   4913 N  N     . TYR A 1 650 ? 69.631  -29.153 -31.019 1.00 66.16  ?  958  TYR A N     1 
ATOM   4914 C  CA    . TYR A 1 650 ? 68.391  -29.386 -30.286 1.00 58.94  ?  958  TYR A CA    1 
ATOM   4915 C  C     . TYR A 1 650 ? 68.512  -30.604 -29.376 1.00 55.35  ?  958  TYR A C     1 
ATOM   4916 O  O     . TYR A 1 650 ? 68.112  -30.561 -28.207 1.00 49.36  ?  958  TYR A O     1 
ATOM   4917 C  CB    . TYR A 1 650 ? 67.236  -29.550 -31.276 1.00 63.59  ?  958  TYR A CB    1 
ATOM   4918 C  CG    . TYR A 1 650 ? 65.887  -29.793 -30.640 1.00 56.40  ?  958  TYR A CG    1 
ATOM   4919 C  CD1   . TYR A 1 650 ? 65.277  -28.817 -29.870 1.00 57.85  ?  958  TYR A CD1   1 
ATOM   4920 C  CD2   . TYR A 1 650 ? 65.215  -30.991 -30.829 1.00 57.14  ?  958  TYR A CD2   1 
ATOM   4921 C  CE1   . TYR A 1 650 ? 64.041  -29.030 -29.293 1.00 60.97  ?  958  TYR A CE1   1 
ATOM   4922 C  CE2   . TYR A 1 650 ? 63.977  -31.215 -30.256 1.00 58.96  ?  958  TYR A CE2   1 
ATOM   4923 C  CZ    . TYR A 1 650 ? 63.395  -30.230 -29.490 1.00 56.64  ?  958  TYR A CZ    1 
ATOM   4924 O  OH    . TYR A 1 650 ? 62.162  -30.444 -28.917 1.00 51.83  ?  958  TYR A OH    1 
ATOM   4925 N  N     . LEU A 1 651 ? 69.070  -31.701 -29.893 1.00 52.98  ?  959  LEU A N     1 
ATOM   4926 C  CA    . LEU A 1 651 ? 69.249  -32.892 -29.067 1.00 60.93  ?  959  LEU A CA    1 
ATOM   4927 C  C     . LEU A 1 651 ? 70.232  -32.648 -27.930 1.00 60.13  ?  959  LEU A C     1 
ATOM   4928 O  O     . LEU A 1 651 ? 70.095  -33.246 -26.856 1.00 53.81  ?  959  LEU A O     1 
ATOM   4929 C  CB    . LEU A 1 651 ? 69.729  -34.065 -29.921 1.00 66.31  ?  959  LEU A CB    1 
ATOM   4930 C  CG    . LEU A 1 651 ? 68.686  -35.146 -30.203 1.00 69.26  ?  959  LEU A CG    1 
ATOM   4931 C  CD1   . LEU A 1 651 ? 67.629  -34.629 -31.169 1.00 73.18  ?  959  LEU A CD1   1 
ATOM   4932 C  CD2   . LEU A 1 651 ? 69.356  -36.404 -30.738 1.00 76.03  ?  959  LEU A CD2   1 
ATOM   4933 N  N     . SER A 1 652 ? 71.224  -31.779 -28.141 1.00 60.55  ?  960  SER A N     1 
ATOM   4934 C  CA    . SER A 1 652 ? 72.239  -31.537 -27.123 1.00 67.88  ?  960  SER A CA    1 
ATOM   4935 C  C     . SER A 1 652 ? 71.710  -30.726 -25.948 1.00 64.69  ?  960  SER A C     1 
ATOM   4936 O  O     . SER A 1 652 ? 72.271  -30.817 -24.850 1.00 56.98  ?  960  SER A O     1 
ATOM   4937 C  CB    . SER A 1 652 ? 73.440  -30.820 -27.741 1.00 65.68  ?  960  SER A CB    1 
ATOM   4938 O  OG    . SER A 1 652 ? 74.059  -31.623 -28.731 1.00 95.60  ?  960  SER A OG    1 
ATOM   4939 N  N     . SER A 1 653 ? 70.649  -29.940 -26.146 1.00 59.57  ?  961  SER A N     1 
ATOM   4940 C  CA    . SER A 1 653 ? 70.132  -29.105 -25.068 1.00 54.45  ?  961  SER A CA    1 
ATOM   4941 C  C     . SER A 1 653 ? 69.572  -29.923 -23.910 1.00 49.45  ?  961  SER A C     1 
ATOM   4942 O  O     . SER A 1 653 ? 69.451  -29.395 -22.799 1.00 55.09  ?  961  SER A O     1 
ATOM   4943 C  CB    . SER A 1 653 ? 69.053  -28.161 -25.605 1.00 56.22  ?  961  SER A CB    1 
ATOM   4944 O  OG    . SER A 1 653 ? 67.901  -28.873 -26.024 1.00 58.21  ?  961  SER A OG    1 
ATOM   4945 N  N     . PHE A 1 654 ? 69.232  -31.191 -24.133 1.00 52.15  ?  962  PHE A N     1 
ATOM   4946 C  CA    . PHE A 1 654 ? 68.653  -32.031 -23.084 1.00 57.69  ?  962  PHE A CA    1 
ATOM   4947 C  C     . PHE A 1 654 ? 69.795  -32.794 -22.426 1.00 52.87  ?  962  PHE A C     1 
ATOM   4948 O  O     . PHE A 1 654 ? 70.131  -33.916 -22.806 1.00 60.17  ?  962  PHE A O     1 
ATOM   4949 C  CB    . PHE A 1 654 ? 67.580  -32.941 -23.667 1.00 54.53  ?  962  PHE A CB    1 
ATOM   4950 C  CG    . PHE A 1 654 ? 66.528  -32.195 -24.440 1.00 49.18  ?  962  PHE A CG    1 
ATOM   4951 C  CD1   . PHE A 1 654 ? 65.486  -31.561 -23.784 1.00 45.18  ?  962  PHE A CD1   1 
ATOM   4952 C  CD2   . PHE A 1 654 ? 66.601  -32.099 -25.820 1.00 43.52  ?  962  PHE A CD2   1 
ATOM   4953 C  CE1   . PHE A 1 654 ? 64.529  -30.857 -24.490 1.00 40.25  ?  962  PHE A CE1   1 
ATOM   4954 C  CE2   . PHE A 1 654 ? 65.646  -31.397 -26.532 1.00 53.51  ?  962  PHE A CE2   1 
ATOM   4955 C  CZ    . PHE A 1 654 ? 64.610  -30.775 -25.868 1.00 44.27  ?  962  PHE A CZ    1 
ATOM   4956 N  N     . LYS A 1 655 ? 70.388  -32.170 -21.408 1.00 58.25  ?  963  LYS A N     1 
ATOM   4957 C  CA    . LYS A 1 655 ? 71.661  -32.616 -20.855 1.00 51.35  ?  963  LYS A CA    1 
ATOM   4958 C  C     . LYS A 1 655 ? 71.426  -33.648 -19.759 1.00 54.06  ?  963  LYS A C     1 
ATOM   4959 O  O     . LYS A 1 655 ? 70.778  -33.328 -18.753 1.00 44.99  ?  963  LYS A O     1 
ATOM   4960 C  CB    . LYS A 1 655 ? 72.434  -31.429 -20.308 1.00 54.26  ?  963  LYS A CB    1 
ATOM   4961 C  CG    . LYS A 1 655 ? 72.825  -30.427 -21.389 1.00 58.20  ?  963  LYS A CG    1 
ATOM   4962 C  CD    . LYS A 1 655 ? 73.199  -29.074 -20.814 1.00 85.19  ?  963  LYS A CD    1 
ATOM   4963 C  CE    . LYS A 1 655 ? 73.506  -28.078 -21.923 1.00 92.62  ?  963  LYS A CE    1 
ATOM   4964 N  NZ    . LYS A 1 655 ? 73.770  -26.710 -21.397 1.00 105.84 ?  963  LYS A NZ    1 
ATOM   4965 N  N     . PRO A 1 656 ? 71.931  -34.888 -19.902 1.00 54.50  ?  964  PRO A N     1 
ATOM   4966 C  CA    . PRO A 1 656 ? 71.629  -35.928 -18.912 1.00 57.28  ?  964  PRO A CA    1 
ATOM   4967 C  C     . PRO A 1 656 ? 72.710  -36.112 -17.859 1.00 51.82  ?  964  PRO A C     1 
ATOM   4968 O  O     . PRO A 1 656 ? 72.799  -37.180 -17.244 1.00 53.55  ?  964  PRO A O     1 
ATOM   4969 C  CB    . PRO A 1 656 ? 71.501  -37.182 -19.782 1.00 55.59  ?  964  PRO A CB    1 
ATOM   4970 C  CG    . PRO A 1 656 ? 72.534  -36.957 -20.846 1.00 54.91  ?  964  PRO A CG    1 
ATOM   4971 C  CD    . PRO A 1 656 ? 72.606  -35.458 -21.083 1.00 49.25  ?  964  PRO A CD    1 
ATOM   4972 N  N     . HIS A 1 657 ? 73.532  -35.085 -17.633 1.00 49.98  ?  965  HIS A N     1 
ATOM   4973 C  CA    . HIS A 1 657 ? 74.687  -35.237 -16.756 1.00 48.86  ?  965  HIS A CA    1 
ATOM   4974 C  C     . HIS A 1 657 ? 74.299  -35.550 -15.317 1.00 40.58  ?  965  HIS A C     1 
ATOM   4975 O  O     . HIS A 1 657 ? 75.148  -36.019 -14.551 1.00 51.41  ?  965  HIS A O     1 
ATOM   4976 C  CB    . HIS A 1 657 ? 75.544  -33.974 -16.796 1.00 50.15  ?  965  HIS A CB    1 
ATOM   4977 C  CG    . HIS A 1 657 ? 76.059  -33.642 -18.161 1.00 51.37  ?  965  HIS A CG    1 
ATOM   4978 N  ND1   . HIS A 1 657 ? 75.279  -33.037 -19.122 1.00 60.25  ?  965  HIS A ND1   1 
ATOM   4979 C  CD2   . HIS A 1 657 ? 77.272  -33.838 -18.729 1.00 67.14  ?  965  HIS A CD2   1 
ATOM   4980 C  CE1   . HIS A 1 657 ? 75.991  -32.868 -20.222 1.00 62.95  ?  965  HIS A CE1   1 
ATOM   4981 N  NE2   . HIS A 1 657 ? 77.203  -33.347 -20.010 1.00 73.30  ?  965  HIS A NE2   1 
ATOM   4982 N  N     . LEU A 1 658 ? 73.049  -35.306 -14.926 1.00 36.98  ?  966  LEU A N     1 
ATOM   4983 C  CA    . LEU A 1 658 ? 72.593  -35.602 -13.573 1.00 48.73  ?  966  LEU A CA    1 
ATOM   4984 C  C     . LEU A 1 658 ? 71.586  -36.746 -13.522 1.00 47.07  ?  966  LEU A C     1 
ATOM   4985 O  O     . LEU A 1 658 ? 71.013  -37.002 -12.457 1.00 37.85  ?  966  LEU A O     1 
ATOM   4986 C  CB    . LEU A 1 658 ? 71.988  -34.350 -12.929 1.00 48.54  ?  966  LEU A CB    1 
ATOM   4987 C  CG    . LEU A 1 658 ? 72.932  -33.175 -12.647 1.00 58.50  ?  966  LEU A CG    1 
ATOM   4988 C  CD1   . LEU A 1 658 ? 72.187  -32.082 -11.899 1.00 55.87  ?  966  LEU A CD1   1 
ATOM   4989 C  CD2   . LEU A 1 658 ? 74.169  -33.603 -11.862 1.00 49.83  ?  966  LEU A CD2   1 
ATOM   4990 N  N     . MET A 1 659 ? 71.361  -37.448 -14.637 1.00 44.91  ?  967  MET A N     1 
ATOM   4991 C  CA    . MET A 1 659 ? 70.394  -38.543 -14.638 1.00 51.67  ?  967  MET A CA    1 
ATOM   4992 C  C     . MET A 1 659 ? 70.694  -39.538 -13.523 1.00 47.82  ?  967  MET A C     1 
ATOM   4993 O  O     . MET A 1 659 ? 69.794  -39.955 -12.784 1.00 42.65  ?  967  MET A O     1 
ATOM   4994 C  CB    . MET A 1 659 ? 70.392  -39.248 -15.995 1.00 53.88  ?  967  MET A CB    1 
ATOM   4995 C  CG    . MET A 1 659 ? 69.664  -38.484 -17.094 1.00 51.51  ?  967  MET A CG    1 
ATOM   4996 S  SD    . MET A 1 659 ? 69.362  -39.476 -18.576 1.00 53.18  ?  967  MET A SD    1 
ATOM   4997 C  CE    . MET A 1 659 ? 68.181  -40.669 -17.950 1.00 49.55  ?  967  MET A CE    1 
ATOM   4998 N  N     . ASP A 1 660 ? 71.963  -39.925 -13.383 1.00 43.72  ?  968  ASP A N     1 
ATOM   4999 C  CA    . ASP A 1 660 ? 72.329  -40.873 -12.336 1.00 48.15  ?  968  ASP A CA    1 
ATOM   5000 C  C     . ASP A 1 660 ? 72.252  -40.221 -10.962 1.00 51.45  ?  968  ASP A C     1 
ATOM   5001 O  O     . ASP A 1 660 ? 71.750  -40.829 -10.007 1.00 42.28  ?  968  ASP A O     1 
ATOM   5002 C  CB    . ASP A 1 660 ? 73.731  -41.423 -12.599 1.00 69.46  ?  968  ASP A CB    1 
ATOM   5003 C  CG    . ASP A 1 660 ? 74.013  -42.698 -11.828 1.00 56.56  ?  968  ASP A CG    1 
ATOM   5004 O  OD1   . ASP A 1 660 ? 73.089  -43.215 -11.164 1.00 51.80  -1 968  ASP A OD1   1 
ATOM   5005 O  OD2   . ASP A 1 660 ? 75.161  -43.185 -11.889 1.00 58.54  ?  968  ASP A OD2   1 
ATOM   5006 N  N     . VAL A 1 661 ? 72.740  -38.982 -10.848 1.00 47.18  ?  969  VAL A N     1 
ATOM   5007 C  CA    . VAL A 1 661 ? 72.610  -38.228 -9.603  1.00 43.06  ?  969  VAL A CA    1 
ATOM   5008 C  C     . VAL A 1 661 ? 71.153  -38.191 -9.160  1.00 41.72  ?  969  VAL A C     1 
ATOM   5009 O  O     . VAL A 1 661 ? 70.828  -38.456 -7.996  1.00 42.81  ?  969  VAL A O     1 
ATOM   5010 C  CB    . VAL A 1 661 ? 73.182  -36.809 -9.782  1.00 45.87  ?  969  VAL A CB    1 
ATOM   5011 C  CG1   . VAL A 1 661 ? 72.858  -35.929 -8.582  1.00 46.85  ?  969  VAL A CG1   1 
ATOM   5012 C  CG2   . VAL A 1 661 ? 74.684  -36.871 -9.999  1.00 54.52  ?  969  VAL A CG2   1 
ATOM   5013 N  N     . VAL A 1 662 ? 70.251  -37.862 -10.087 1.00 40.02  ?  970  VAL A N     1 
ATOM   5014 C  CA    . VAL A 1 662 ? 68.833  -37.783 -9.749  1.00 45.55  ?  970  VAL A CA    1 
ATOM   5015 C  C     . VAL A 1 662 ? 68.282  -39.171 -9.449  1.00 44.86  ?  970  VAL A C     1 
ATOM   5016 O  O     . VAL A 1 662 ? 67.569  -39.374 -8.458  1.00 38.27  ?  970  VAL A O     1 
ATOM   5017 C  CB    . VAL A 1 662 ? 68.048  -37.096 -10.881 1.00 46.71  ?  970  VAL A CB    1 
ATOM   5018 C  CG1   . VAL A 1 662 ? 66.546  -37.163 -10.610 1.00 43.06  ?  970  VAL A CG1   1 
ATOM   5019 C  CG2   . VAL A 1 662 ? 68.505  -35.646 -11.046 1.00 42.98  ?  970  VAL A CG2   1 
ATOM   5020 N  N     . TYR A 1 663 ? 68.601  -40.150 -10.300 1.00 46.84  ?  971  TYR A N     1 
ATOM   5021 C  CA    . TYR A 1 663 ? 68.104  -41.504 -10.077 1.00 48.48  ?  971  TYR A CA    1 
ATOM   5022 C  C     . TYR A 1 663 ? 68.496  -42.006 -8.694  1.00 53.46  ?  971  TYR A C     1 
ATOM   5023 O  O     . TYR A 1 663 ? 67.652  -42.506 -7.939  1.00 43.56  ?  971  TYR A O     1 
ATOM   5024 C  CB    . TYR A 1 663 ? 68.628  -42.453 -11.155 1.00 59.76  ?  971  TYR A CB    1 
ATOM   5025 C  CG    . TYR A 1 663 ? 68.091  -43.859 -11.003 1.00 65.93  ?  971  TYR A CG    1 
ATOM   5026 C  CD1   . TYR A 1 663 ? 68.814  -44.831 -10.321 1.00 58.70  ?  971  TYR A CD1   1 
ATOM   5027 C  CD2   . TYR A 1 663 ? 66.850  -44.209 -11.522 1.00 62.12  ?  971  TYR A CD2   1 
ATOM   5028 C  CE1   . TYR A 1 663 ? 68.320  -46.116 -10.171 1.00 66.05  ?  971  TYR A CE1   1 
ATOM   5029 C  CE2   . TYR A 1 663 ? 66.349  -45.489 -11.377 1.00 67.49  ?  971  TYR A CE2   1 
ATOM   5030 C  CZ    . TYR A 1 663 ? 67.087  -46.439 -10.701 1.00 73.56  ?  971  TYR A CZ    1 
ATOM   5031 O  OH    . TYR A 1 663 ? 66.592  -47.714 -10.552 1.00 64.97  ?  971  TYR A OH    1 
ATOM   5032 N  N     . THR A 1 664 ? 69.778  -41.875 -8.338  1.00 44.48  ?  972  THR A N     1 
ATOM   5033 C  CA    . THR A 1 664 ? 70.225  -42.377 -7.045  1.00 45.41  ?  972  THR A CA    1 
ATOM   5034 C  C     . THR A 1 664 ? 69.611  -41.585 -5.900  1.00 53.94  ?  972  THR A C     1 
ATOM   5035 O  O     . THR A 1 664 ? 69.322  -42.153 -4.840  1.00 47.37  ?  972  THR A O     1 
ATOM   5036 C  CB    . THR A 1 664 ? 71.747  -42.339 -6.948  1.00 43.33  ?  972  THR A CB    1 
ATOM   5037 O  OG1   . THR A 1 664 ? 72.324  -42.755 -8.192  1.00 54.46  ?  972  THR A OG1   1 
ATOM   5038 C  CG2   . THR A 1 664 ? 72.212  -43.270 -5.848  1.00 59.96  ?  972  THR A CG2   1 
ATOM   5039 N  N     . TRP A 1 665 ? 69.408  -40.280 -6.090  1.00 55.13  ?  973  TRP A N     1 
ATOM   5040 C  CA    . TRP A 1 665 ? 68.705  -39.492 -5.085  1.00 45.89  ?  973  TRP A CA    1 
ATOM   5041 C  C     . TRP A 1 665 ? 67.294  -40.025 -4.876  1.00 39.58  ?  973  TRP A C     1 
ATOM   5042 O  O     . TRP A 1 665 ? 66.844  -40.192 -3.737  1.00 41.75  ?  973  TRP A O     1 
ATOM   5043 C  CB    . TRP A 1 665 ? 68.681  -38.016 -5.499  1.00 56.83  ?  973  TRP A CB    1 
ATOM   5044 C  CG    . TRP A 1 665 ? 67.892  -37.141 -4.565  1.00 48.41  ?  973  TRP A CG    1 
ATOM   5045 C  CD1   . TRP A 1 665 ? 66.674  -36.571 -4.806  1.00 53.24  ?  973  TRP A CD1   1 
ATOM   5046 C  CD2   . TRP A 1 665 ? 68.262  -36.748 -3.238  1.00 54.08  ?  973  TRP A CD2   1 
ATOM   5047 N  NE1   . TRP A 1 665 ? 66.264  -35.845 -3.711  1.00 49.08  ?  973  TRP A NE1   1 
ATOM   5048 C  CE2   . TRP A 1 665 ? 67.221  -35.939 -2.735  1.00 47.98  ?  973  TRP A CE2   1 
ATOM   5049 C  CE3   . TRP A 1 665 ? 69.372  -37.002 -2.425  1.00 50.08  ?  973  TRP A CE3   1 
ATOM   5050 C  CZ2   . TRP A 1 665 ? 67.258  -35.383 -1.459  1.00 47.86  ?  973  TRP A CZ2   1 
ATOM   5051 C  CZ3   . TRP A 1 665 ? 69.407  -36.447 -1.159  1.00 54.44  ?  973  TRP A CZ3   1 
ATOM   5052 C  CH2   . TRP A 1 665 ? 68.356  -35.647 -0.688  1.00 63.71  ?  973  TRP A CH2   1 
ATOM   5053 N  N     . ALA A 1 666 ? 66.587  -40.317 -5.971  1.00 40.66  ?  974  ALA A N     1 
ATOM   5054 C  CA    . ALA A 1 666 ? 65.219  -40.813 -5.861  1.00 55.20  ?  974  ALA A CA    1 
ATOM   5055 C  C     . ALA A 1 666 ? 65.160  -42.173 -5.175  1.00 57.98  ?  974  ALA A C     1 
ATOM   5056 O  O     . ALA A 1 666 ? 64.143  -42.510 -4.558  1.00 53.21  ?  974  ALA A O     1 
ATOM   5057 C  CB    . ALA A 1 666 ? 64.576  -40.896 -7.246  1.00 47.67  ?  974  ALA A CB    1 
ATOM   5058 N  N     . THR A 1 667 ? 66.228  -42.967 -5.269  1.00 49.48  ?  975  THR A N     1 
ATOM   5059 C  CA    . THR A 1 667 ? 66.277  -44.270 -4.619  1.00 65.80  ?  975  THR A CA    1 
ATOM   5060 C  C     . THR A 1 667 ? 66.794  -44.198 -3.182  1.00 66.70  ?  975  THR A C     1 
ATOM   5061 O  O     . THR A 1 667 ? 67.195  -45.228 -2.628  1.00 71.55  ?  975  THR A O     1 
ATOM   5062 C  CB    . THR A 1 667 ? 67.132  -45.243 -5.437  1.00 50.00  ?  975  THR A CB    1 
ATOM   5063 O  OG1   . THR A 1 667 ? 68.427  -44.679 -5.669  1.00 52.19  ?  975  THR A OG1   1 
ATOM   5064 C  CG2   . THR A 1 667 ? 66.465  -45.552 -6.774  1.00 56.50  ?  975  THR A CG2   1 
ATOM   5065 N  N     . GLY A 1 668 ? 66.805  -43.009 -2.575  1.00 58.78  ?  976  GLY A N     1 
ATOM   5066 C  CA    . GLY A 1 668 ? 66.997  -42.872 -1.145  1.00 51.98  ?  976  GLY A CA    1 
ATOM   5067 C  C     . GLY A 1 668 ? 68.397  -42.524 -0.684  1.00 50.08  ?  976  GLY A C     1 
ATOM   5068 O  O     . GLY A 1 668 ? 68.622  -42.436 0.530   1.00 49.80  ?  976  GLY A O     1 
ATOM   5069 N  N     . ALA A 1 669 ? 69.343  -42.322 -1.597  1.00 45.64  ?  977  ALA A N     1 
ATOM   5070 C  CA    . ALA A 1 669 ? 70.695  -41.971 -1.196  1.00 42.44  ?  977  ALA A CA    1 
ATOM   5071 C  C     . ALA A 1 669 ? 70.707  -40.644 -0.432  1.00 60.54  ?  977  ALA A C     1 
ATOM   5072 O  O     . ALA A 1 669 ? 69.741  -39.877 -0.436  1.00 62.62  ?  977  ALA A O     1 
ATOM   5073 C  CB    . ALA A 1 669 ? 71.607  -41.882 -2.419  1.00 48.14  ?  977  ALA A CB    1 
ATOM   5074 N  N     . THR A 1 670 ? 71.827  -40.383 0.235   1.00 56.41  ?  978  THR A N     1 
ATOM   5075 C  CA    . THR A 1 670 ? 72.039  -39.115 0.915   1.00 56.74  ?  978  THR A CA    1 
ATOM   5076 C  C     . THR A 1 670 ? 72.622  -38.092 -0.053  1.00 60.91  ?  978  THR A C     1 
ATOM   5077 O  O     . THR A 1 670 ? 73.215  -38.438 -1.079  1.00 45.47  ?  978  THR A O     1 
ATOM   5078 C  CB    . THR A 1 670 ? 72.984  -39.275 2.108   1.00 63.16  ?  978  THR A CB    1 
ATOM   5079 O  OG1   . THR A 1 670 ? 74.255  -39.754 1.650   1.00 49.85  ?  978  THR A OG1   1 
ATOM   5080 C  CG2   . THR A 1 670 ? 72.405  -40.239 3.135   1.00 54.91  ?  978  THR A CG2   1 
ATOM   5081 N  N     . PHE A 1 671 ? 72.457  -36.814 0.295   1.00 57.08  ?  979  PHE A N     1 
ATOM   5082 C  CA    . PHE A 1 671 ? 72.975  -35.753 -0.561  1.00 57.97  ?  979  PHE A CA    1 
ATOM   5083 C  C     . PHE A 1 671 ? 74.495  -35.817 -0.651  1.00 52.81  ?  979  PHE A C     1 
ATOM   5084 O  O     . PHE A 1 671 ? 75.069  -35.635 -1.731  1.00 47.89  ?  979  PHE A O     1 
ATOM   5085 C  CB    . PHE A 1 671 ? 72.520  -34.386 -0.048  1.00 59.84  ?  979  PHE A CB    1 
ATOM   5086 C  CG    . PHE A 1 671 ? 72.848  -33.260 -0.983  1.00 54.87  ?  979  PHE A CG    1 
ATOM   5087 C  CD1   . PHE A 1 671 ? 72.130  -33.088 -2.153  1.00 51.54  ?  979  PHE A CD1   1 
ATOM   5088 C  CD2   . PHE A 1 671 ? 73.879  -32.381 -0.699  1.00 53.64  ?  979  PHE A CD2   1 
ATOM   5089 C  CE1   . PHE A 1 671 ? 72.431  -32.060 -3.023  1.00 56.80  ?  979  PHE A CE1   1 
ATOM   5090 C  CE2   . PHE A 1 671 ? 74.183  -31.347 -1.563  1.00 59.49  ?  979  PHE A CE2   1 
ATOM   5091 C  CZ    . PHE A 1 671 ? 73.460  -31.187 -2.727  1.00 58.79  ?  979  PHE A CZ    1 
ATOM   5092 N  N     . ALA A 1 672 ? 75.165  -36.077 0.475   1.00 46.98  ?  980  ALA A N     1 
ATOM   5093 C  CA    . ALA A 1 672 ? 76.616  -36.230 0.449   1.00 58.23  ?  980  ALA A CA    1 
ATOM   5094 C  C     . ALA A 1 672 ? 77.037  -37.282 -0.569  1.00 61.19  ?  980  ALA A C     1 
ATOM   5095 O  O     . ALA A 1 672 ? 78.049  -37.121 -1.262  1.00 52.74  ?  980  ALA A O     1 
ATOM   5096 C  CB    . ALA A 1 672 ? 77.130  -36.600 1.841   1.00 57.54  ?  980  ALA A CB    1 
ATOM   5097 N  N     . HIS A 1 673 ? 76.262  -38.363 -0.680  1.00 62.64  ?  981  HIS A N     1 
ATOM   5098 C  CA    . HIS A 1 673 ? 76.604  -39.434 -1.608  1.00 66.46  ?  981  HIS A CA    1 
ATOM   5099 C  C     . HIS A 1 673 ? 76.548  -38.952 -3.054  1.00 66.77  ?  981  HIS A C     1 
ATOM   5100 O  O     . HIS A 1 673 ? 77.491  -39.161 -3.826  1.00 59.41  ?  981  HIS A O     1 
ATOM   5101 C  CB    . HIS A 1 673 ? 75.663  -40.622 -1.397  1.00 66.41  ?  981  HIS A CB    1 
ATOM   5102 C  CG    . HIS A 1 673 ? 75.992  -41.813 -2.244  1.00 84.48  ?  981  HIS A CG    1 
ATOM   5103 N  ND1   . HIS A 1 673 ? 75.115  -42.860 -2.429  1.00 75.39  ?  981  HIS A ND1   1 
ATOM   5104 C  CD2   . HIS A 1 673 ? 77.103  -42.124 -2.953  1.00 78.26  ?  981  HIS A CD2   1 
ATOM   5105 C  CE1   . HIS A 1 673 ? 75.670  -43.763 -3.217  1.00 86.49  ?  981  HIS A CE1   1 
ATOM   5106 N  NE2   . HIS A 1 673 ? 76.877  -43.340 -3.550  1.00 80.06  ?  981  HIS A NE2   1 
ATOM   5107 N  N     . ILE A 1 674 ? 75.447  -38.301 -3.440  1.00 60.43  ?  982  ILE A N     1 
ATOM   5108 C  CA    . ILE A 1 674 ? 75.263  -37.937 -4.840  1.00 53.25  ?  982  ILE A CA    1 
ATOM   5109 C  C     . ILE A 1 674 ? 76.214  -36.828 -5.271  1.00 61.53  ?  982  ILE A C     1 
ATOM   5110 O  O     . ILE A 1 674 ? 76.528  -36.717 -6.462  1.00 56.63  ?  982  ILE A O     1 
ATOM   5111 C  CB    . ILE A 1 674 ? 73.797  -37.542 -5.106  1.00 55.71  ?  982  ILE A CB    1 
ATOM   5112 C  CG1   . ILE A 1 674 ? 73.435  -36.241 -4.383  1.00 62.95  ?  982  ILE A CG1   1 
ATOM   5113 C  CG2   . ILE A 1 674 ? 72.864  -38.667 -4.674  1.00 58.47  ?  982  ILE A CG2   1 
ATOM   5114 C  CD1   . ILE A 1 674 ? 72.035  -35.742 -4.692  1.00 65.01  ?  982  ILE A CD1   1 
ATOM   5115 N  N     . CYS A 1 675 ? 76.688  -36.000 -4.335  1.00 55.71  ?  983  CYS A N     1 
ATOM   5116 C  CA    . CYS A 1 675 ? 77.670  -34.980 -4.690  1.00 61.46  ?  983  CYS A CA    1 
ATOM   5117 C  C     . CYS A 1 675 ? 78.981  -35.605 -5.148  1.00 61.85  ?  983  CYS A C     1 
ATOM   5118 O  O     . CYS A 1 675 ? 79.691  -35.023 -5.976  1.00 59.53  ?  983  CYS A O     1 
ATOM   5119 C  CB    . CYS A 1 675 ? 77.917  -34.048 -3.504  1.00 65.00  ?  983  CYS A CB    1 
ATOM   5120 S  SG    . CYS A 1 675 ? 76.544  -32.932 -3.136  1.00 61.09  ?  983  CYS A SG    1 
ATOM   5121 N  N     . LYS A 1 676 ? 79.317  -36.787 -4.624  1.00 65.73  ?  984  LYS A N     1 
ATOM   5122 C  CA    . LYS A 1 676 ? 80.532  -37.479 -5.038  1.00 74.97  ?  984  LYS A CA    1 
ATOM   5123 C  C     . LYS A 1 676 ? 80.448  -38.000 -6.467  1.00 68.34  ?  984  LYS A C     1 
ATOM   5124 O  O     . LYS A 1 676 ? 81.483  -38.347 -7.046  1.00 65.97  ?  984  LYS A O     1 
ATOM   5125 C  CB    . LYS A 1 676 ? 80.821  -38.640 -4.085  1.00 70.80  ?  984  LYS A CB    1 
ATOM   5126 C  CG    . LYS A 1 676 ? 81.615  -38.251 -2.843  1.00 88.97  ?  984  LYS A CG    1 
ATOM   5127 C  CD    . LYS A 1 676 ? 83.115  -38.189 -3.120  1.00 106.47 ?  984  LYS A CD    1 
ATOM   5128 C  CE    . LYS A 1 676 ? 83.723  -39.583 -3.255  1.00 123.33 ?  984  LYS A CE    1 
ATOM   5129 N  NZ    . LYS A 1 676 ? 85.197  -39.547 -3.477  1.00 93.87  ?  984  LYS A NZ    1 
ATOM   5130 N  N     . MET A 1 677 ? 79.253  -38.060 -7.050  1.00 63.37  ?  985  MET A N     1 
ATOM   5131 C  CA    . MET A 1 677 ? 79.066  -38.624 -8.379  1.00 47.91  ?  985  MET A CA    1 
ATOM   5132 C  C     . MET A 1 677 ? 79.237  -37.601 -9.493  1.00 53.98  ?  985  MET A C     1 
ATOM   5133 O  O     . MET A 1 677 ? 79.018  -37.942 -10.660 1.00 47.67  ?  985  MET A O     1 
ATOM   5134 C  CB    . MET A 1 677 ? 77.673  -39.246 -8.497  1.00 50.66  ?  985  MET A CB    1 
ATOM   5135 C  CG    . MET A 1 677 ? 77.266  -40.093 -7.314  1.00 52.48  ?  985  MET A CG    1 
ATOM   5136 S  SD    . MET A 1 677 ? 75.611  -40.778 -7.505  1.00 57.61  ?  985  MET A SD    1 
ATOM   5137 C  CE    . MET A 1 677 ? 75.406  -41.534 -5.896  1.00 80.27  ?  985  MET A CE    1 
ATOM   5138 N  N     . THR A 1 678 ? 79.613  -36.366 -9.172  1.00 53.20  ?  986  THR A N     1 
ATOM   5139 C  CA    . THR A 1 678 ? 79.643  -35.320 -10.184 1.00 56.86  ?  986  THR A CA    1 
ATOM   5140 C  C     . THR A 1 678 ? 80.505  -34.164 -9.699  1.00 55.30  ?  986  THR A C     1 
ATOM   5141 O  O     . THR A 1 678 ? 80.708  -33.970 -8.497  1.00 44.29  ?  986  THR A O     1 
ATOM   5142 C  CB    . THR A 1 678 ? 78.224  -34.833 -10.517 1.00 52.81  ?  986  THR A CB    1 
ATOM   5143 O  OG1   . THR A 1 678 ? 78.287  -33.737 -11.439 1.00 52.12  ?  986  THR A OG1   1 
ATOM   5144 C  CG2   . THR A 1 678 ? 77.488  -34.393 -9.254  1.00 47.96  ?  986  THR A CG2   1 
ATOM   5145 N  N     . ASP A 1 679 ? 81.015  -33.404 -10.664 1.00 46.14  ?  987  ASP A N     1 
ATOM   5146 C  CA    . ASP A 1 679 ? 81.716  -32.156 -10.400 1.00 62.98  ?  987  ASP A CA    1 
ATOM   5147 C  C     . ASP A 1 679 ? 80.771  -30.965 -10.292 1.00 65.25  ?  987  ASP A C     1 
ATOM   5148 O  O     . ASP A 1 679 ? 81.231  -29.846 -10.040 1.00 55.54  ?  987  ASP A O     1 
ATOM   5149 C  CB    . ASP A 1 679 ? 82.748  -31.893 -11.504 1.00 73.82  ?  987  ASP A CB    1 
ATOM   5150 C  CG    . ASP A 1 679 ? 82.137  -31.934 -12.897 1.00 84.95  ?  987  ASP A CG    1 
ATOM   5151 O  OD1   . ASP A 1 679 ? 81.177  -32.707 -13.104 1.00 79.53  ?  987  ASP A OD1   1 
ATOM   5152 O  OD2   . ASP A 1 679 ? 82.615  -31.195 -13.784 1.00 96.59  -1 987  ASP A OD2   1 
ATOM   5153 N  N     . VAL A 1 680 ? 79.466  -31.177 -10.475 1.00 56.04  ?  988  VAL A N     1 
ATOM   5154 C  CA    . VAL A 1 680 ? 78.504  -30.083 -10.426 1.00 61.96  ?  988  VAL A CA    1 
ATOM   5155 C  C     . VAL A 1 680 ? 78.398  -29.554 -9.002  1.00 51.01  ?  988  VAL A C     1 
ATOM   5156 O  O     . VAL A 1 680 ? 78.367  -30.325 -8.032  1.00 41.73  ?  988  VAL A O     1 
ATOM   5157 C  CB    . VAL A 1 680 ? 77.138  -30.558 -10.952 1.00 60.15  ?  988  VAL A CB    1 
ATOM   5158 C  CG1   . VAL A 1 680 ? 76.074  -29.485 -10.755 1.00 58.76  ?  988  VAL A CG1   1 
ATOM   5159 C  CG2   . VAL A 1 680 ? 77.242  -30.933 -12.423 1.00 61.82  ?  988  VAL A CG2   1 
ATOM   5160 N  N     . PHE A 1 681 ? 78.336  -28.229 -8.872  1.00 51.73  ?  989  PHE A N     1 
ATOM   5161 C  CA    . PHE A 1 681 ? 78.235  -27.601 -7.561  1.00 44.76  ?  989  PHE A CA    1 
ATOM   5162 C  C     . PHE A 1 681 ? 76.992  -28.081 -6.822  1.00 47.14  ?  989  PHE A C     1 
ATOM   5163 O  O     . PHE A 1 681 ? 75.943  -28.334 -7.420  1.00 50.45  ?  989  PHE A O     1 
ATOM   5164 C  CB    . PHE A 1 681 ? 78.187  -26.080 -7.699  1.00 52.04  ?  989  PHE A CB    1 
ATOM   5165 C  CG    . PHE A 1 681 ? 79.522  -25.410 -7.561  1.00 52.99  ?  989  PHE A CG    1 
ATOM   5166 C  CD1   . PHE A 1 681 ? 80.102  -25.246 -6.314  1.00 59.16  ?  989  PHE A CD1   1 
ATOM   5167 C  CD2   . PHE A 1 681 ? 80.186  -24.921 -8.674  1.00 58.21  ?  989  PHE A CD2   1 
ATOM   5168 C  CE1   . PHE A 1 681 ? 81.324  -24.620 -6.181  1.00 49.85  ?  989  PHE A CE1   1 
ATOM   5169 C  CE2   . PHE A 1 681 ? 81.410  -24.290 -8.548  1.00 50.88  ?  989  PHE A CE2   1 
ATOM   5170 C  CZ    . PHE A 1 681 ? 81.980  -24.140 -7.300  1.00 58.89  ?  989  PHE A CZ    1 
ATOM   5171 N  N     . GLU A 1 682 ? 77.116  -28.184 -5.497  1.00 47.10  ?  990  GLU A N     1 
ATOM   5172 C  CA    . GLU A 1 682 ? 75.990  -28.609 -4.671  1.00 53.95  ?  990  GLU A CA    1 
ATOM   5173 C  C     . GLU A 1 682 ? 74.754  -27.761 -4.948  1.00 55.21  ?  990  GLU A C     1 
ATOM   5174 O  O     . GLU A 1 682 ? 73.648  -28.287 -5.117  1.00 49.27  ?  990  GLU A O     1 
ATOM   5175 C  CB    . GLU A 1 682 ? 76.367  -28.533 -3.189  1.00 58.97  ?  990  GLU A CB    1 
ATOM   5176 C  CG    . GLU A 1 682 ? 77.462  -29.505 -2.770  1.00 67.02  ?  990  GLU A CG    1 
ATOM   5177 C  CD    . GLU A 1 682 ? 78.841  -28.874 -2.749  1.00 61.03  ?  990  GLU A CD    1 
ATOM   5178 O  OE1   . GLU A 1 682 ? 79.543  -29.023 -1.727  1.00 66.36  ?  990  GLU A OE1   1 
ATOM   5179 O  OE2   . GLU A 1 682 ? 79.222  -28.227 -3.749  1.00 61.12  -1 990  GLU A OE2   1 
ATOM   5180 N  N     . GLY A 1 683 ? 74.927  -26.438 -4.994  1.00 53.27  ?  991  GLY A N     1 
ATOM   5181 C  CA    . GLY A 1 683 ? 73.795  -25.560 -5.231  1.00 44.65  ?  991  GLY A CA    1 
ATOM   5182 C  C     . GLY A 1 683 ? 73.183  -25.740 -6.604  1.00 46.71  ?  991  GLY A C     1 
ATOM   5183 O  O     . GLY A 1 683 ? 71.973  -25.565 -6.776  1.00 43.00  ?  991  GLY A O     1 
ATOM   5184 N  N     . SER A 1 684 ? 74.002  -26.085 -7.600  1.00 46.63  ?  992  SER A N     1 
ATOM   5185 C  CA    . SER A 1 684 ? 73.473  -26.336 -8.935  1.00 52.74  ?  992  SER A CA    1 
ATOM   5186 C  C     . SER A 1 684 ? 72.697  -27.647 -8.987  1.00 50.99  ?  992  SER A C     1 
ATOM   5187 O  O     . SER A 1 684 ? 71.721  -27.759 -9.738  1.00 47.61  ?  992  SER A O     1 
ATOM   5188 C  CB    . SER A 1 684 ? 74.611  -26.343 -9.953  1.00 54.98  ?  992  SER A CB    1 
ATOM   5189 O  OG    . SER A 1 684 ? 75.305  -25.107 -9.945  1.00 57.23  ?  992  SER A OG    1 
ATOM   5190 N  N     . ILE A 1 685 ? 73.108  -28.642 -8.199  1.00 50.91  ?  993  ILE A N     1 
ATOM   5191 C  CA    . ILE A 1 685 ? 72.332  -29.875 -8.089  1.00 45.31  ?  993  ILE A CA    1 
ATOM   5192 C  C     . ILE A 1 685 ? 70.964  -29.579 -7.490  1.00 40.74  ?  993  ILE A C     1 
ATOM   5193 O  O     . ILE A 1 685 ? 69.931  -30.039 -7.990  1.00 42.91  ?  993  ILE A O     1 
ATOM   5194 C  CB    . ILE A 1 685 ? 73.096  -30.917 -7.250  1.00 46.19  ?  993  ILE A CB    1 
ATOM   5195 C  CG1   . ILE A 1 685 ? 74.387  -31.333 -7.960  1.00 46.69  ?  993  ILE A CG1   1 
ATOM   5196 C  CG2   . ILE A 1 685 ? 72.215  -32.133 -6.966  1.00 40.01  ?  993  ILE A CG2   1 
ATOM   5197 C  CD1   . ILE A 1 685 ? 75.336  -32.135 -7.086  1.00 51.19  ?  993  ILE A CD1   1 
ATOM   5198 N  N     . ILE A 1 686 ? 70.940  -28.803 -6.405  1.00 46.03  ?  994  ILE A N     1 
ATOM   5199 C  CA    . ILE A 1 686 ? 69.682  -28.488 -5.737  1.00 44.74  ?  994  ILE A CA    1 
ATOM   5200 C  C     . ILE A 1 686 ? 68.782  -27.661 -6.647  1.00 42.79  ?  994  ILE A C     1 
ATOM   5201 O  O     . ILE A 1 686 ? 67.558  -27.843 -6.664  1.00 38.95  ?  994  ILE A O     1 
ATOM   5202 C  CB    . ILE A 1 686 ? 69.961  -27.770 -4.403  1.00 47.91  ?  994  ILE A CB    1 
ATOM   5203 C  CG1   . ILE A 1 686 ? 70.662  -28.739 -3.444  1.00 39.81  ?  994  ILE A CG1   1 
ATOM   5204 C  CG2   . ILE A 1 686 ? 68.664  -27.216 -3.803  1.00 42.34  ?  994  ILE A CG2   1 
ATOM   5205 C  CD1   . ILE A 1 686 ? 71.090  -28.129 -2.133  1.00 49.28  ?  994  ILE A CD1   1 
ATOM   5206 N  N     . ARG A 1 687 ? 69.366  -26.739 -7.414  1.00 41.37  ?  995  ARG A N     1 
ATOM   5207 C  CA    . ARG A 1 687 ? 68.560  -25.926 -8.318  1.00 54.77  ?  995  ARG A CA    1 
ATOM   5208 C  C     . ARG A 1 687 ? 67.886  -26.796 -9.371  1.00 49.25  ?  995  ARG A C     1 
ATOM   5209 O  O     . ARG A 1 687 ? 66.706  -26.603 -9.686  1.00 44.82  ?  995  ARG A O     1 
ATOM   5210 C  CB    . ARG A 1 687 ? 69.427  -24.847 -8.971  1.00 58.71  ?  995  ARG A CB    1 
ATOM   5211 C  CG    . ARG A 1 687 ? 68.644  -23.835 -9.802  1.00 71.54  ?  995  ARG A CG    1 
ATOM   5212 C  CD    . ARG A 1 687 ? 69.338  -22.475 -9.862  1.00 86.83  ?  995  ARG A CD    1 
ATOM   5213 N  NE    . ARG A 1 687 ? 70.744  -22.578 -10.255 1.00 128.57 ?  995  ARG A NE    1 
ATOM   5214 C  CZ    . ARG A 1 687 ? 71.779  -22.517 -9.418  1.00 100.88 ?  995  ARG A CZ    1 
ATOM   5215 N  NH1   . ARG A 1 687 ? 71.595  -22.348 -8.113  1.00 83.84  ?  995  ARG A NH1   1 
ATOM   5216 N  NH2   . ARG A 1 687 ? 73.014  -22.624 -9.892  1.00 83.85  ?  995  ARG A NH2   1 
ATOM   5217 N  N     . CYS A 1 688 ? 68.617  -27.770 -9.917  1.00 43.28  ?  996  CYS A N     1 
ATOM   5218 C  CA    . CYS A 1 688 ? 68.021  -28.697 -10.872 1.00 45.50  ?  996  CYS A CA    1 
ATOM   5219 C  C     . CYS A 1 688 ? 66.948  -29.554 -10.212 1.00 39.90  ?  996  CYS A C     1 
ATOM   5220 O  O     . CYS A 1 688 ? 65.882  -29.788 -10.795 1.00 38.95  ?  996  CYS A O     1 
ATOM   5221 C  CB    . CYS A 1 688 ? 69.108  -29.577 -11.487 1.00 48.95  ?  996  CYS A CB    1 
ATOM   5222 S  SG    . CYS A 1 688 ? 68.479  -30.911 -12.527 1.00 55.14  ?  996  CYS A SG    1 
ATOM   5223 N  N     . MET A 1 689 ? 67.207  -30.025 -8.992  1.00 39.59  ?  997  MET A N     1 
ATOM   5224 C  CA    . MET A 1 689 ? 66.216  -30.831 -8.288  1.00 36.49  ?  997  MET A CA    1 
ATOM   5225 C  C     . MET A 1 689 ? 64.940  -30.038 -8.038  1.00 41.50  ?  997  MET A C     1 
ATOM   5226 O  O     . MET A 1 689 ? 63.835  -30.590 -8.103  1.00 42.48  ?  997  MET A O     1 
ATOM   5227 C  CB    . MET A 1 689 ? 66.796  -31.338 -6.968  1.00 44.94  ?  997  MET A CB    1 
ATOM   5228 C  CG    . MET A 1 689 ? 66.290  -32.720 -6.573  1.00 69.46  ?  997  MET A CG    1 
ATOM   5229 S  SD    . MET A 1 689 ? 67.044  -34.034 -7.549  1.00 67.83  ?  997  MET A SD    1 
ATOM   5230 C  CE    . MET A 1 689 ? 68.720  -34.010 -6.909  1.00 55.69  ?  997  MET A CE    1 
ATOM   5231 N  N     . ARG A 1 690 ? 65.068  -28.742 -7.748  1.00 43.75  ?  998  ARG A N     1 
ATOM   5232 C  CA    . ARG A 1 690 ? 63.890  -27.934 -7.447  1.00 42.29  ?  998  ARG A CA    1 
ATOM   5233 C  C     . ARG A 1 690 ? 63.100  -27.614 -8.710  1.00 35.18  ?  998  ARG A C     1 
ATOM   5234 O  O     . ARG A 1 690 ? 61.863  -27.610 -8.689  1.00 30.96  ?  998  ARG A O     1 
ATOM   5235 C  CB    . ARG A 1 690 ? 64.307  -26.656 -6.722  1.00 40.71  ?  998  ARG A CB    1 
ATOM   5236 C  CG    . ARG A 1 690 ? 64.757  -26.905 -5.293  1.00 48.52  ?  998  ARG A CG    1 
ATOM   5237 C  CD    . ARG A 1 690 ? 65.136  -25.624 -4.585  1.00 51.07  ?  998  ARG A CD    1 
ATOM   5238 N  NE    . ARG A 1 690 ? 65.460  -25.858 -3.182  1.00 43.53  ?  998  ARG A NE    1 
ATOM   5239 C  CZ    . ARG A 1 690 ? 65.789  -24.904 -2.318  1.00 48.14  ?  998  ARG A CZ    1 
ATOM   5240 N  NH1   . ARG A 1 690 ? 65.840  -23.635 -2.707  1.00 44.11  ?  998  ARG A NH1   1 
ATOM   5241 N  NH2   . ARG A 1 690 ? 66.067  -25.220 -1.060  1.00 46.25  ?  998  ARG A NH2   1 
ATOM   5242 N  N     . ARG A 1 691 ? 63.792  -27.345 -9.818  1.00 29.61  ?  999  ARG A N     1 
ATOM   5243 C  CA    . ARG A 1 691 ? 63.106  -27.203 -11.096 1.00 39.16  ?  999  ARG A CA    1 
ATOM   5244 C  C     . ARG A 1 691 ? 62.517  -28.530 -11.562 1.00 44.07  ?  999  ARG A C     1 
ATOM   5245 O  O     . ARG A 1 691 ? 61.459  -28.548 -12.202 1.00 35.15  ?  999  ARG A O     1 
ATOM   5246 C  CB    . ARG A 1 691 ? 64.066  -26.643 -12.147 1.00 43.31  ?  999  ARG A CB    1 
ATOM   5247 C  CG    . ARG A 1 691 ? 64.479  -25.203 -11.887 1.00 47.33  ?  999  ARG A CG    1 
ATOM   5248 C  CD    . ARG A 1 691 ? 65.206  -24.594 -13.075 1.00 57.07  ?  999  ARG A CD    1 
ATOM   5249 N  NE    . ARG A 1 691 ? 65.365  -23.148 -12.924 1.00 86.64  ?  999  ARG A NE    1 
ATOM   5250 C  CZ    . ARG A 1 691 ? 65.786  -22.331 -13.885 1.00 91.06  ?  999  ARG A CZ    1 
ATOM   5251 N  NH1   . ARG A 1 691 ? 66.094  -22.808 -15.084 1.00 115.09 ?  999  ARG A NH1   1 
ATOM   5252 N  NH2   . ARG A 1 691 ? 65.895  -21.031 -13.648 1.00 88.74  ?  999  ARG A NH2   1 
ATOM   5253 N  N     . LEU A 1 692 ? 63.180  -29.647 -11.249 1.00 43.01  ?  1000 LEU A N     1 
ATOM   5254 C  CA    . LEU A 1 692 ? 62.627  -30.956 -11.579 1.00 37.01  ?  1000 LEU A CA    1 
ATOM   5255 C  C     . LEU A 1 692 ? 61.320  -31.194 -10.833 1.00 37.00  ?  1000 LEU A C     1 
ATOM   5256 O  O     . LEU A 1 692 ? 60.325  -31.635 -11.422 1.00 38.11  ?  1000 LEU A O     1 
ATOM   5257 C  CB    . LEU A 1 692 ? 63.645  -32.051 -11.255 1.00 35.09  ?  1000 LEU A CB    1 
ATOM   5258 C  CG    . LEU A 1 692 ? 63.200  -33.495 -11.497 1.00 45.46  ?  1000 LEU A CG    1 
ATOM   5259 C  CD1   . LEU A 1 692 ? 62.810  -33.718 -12.952 1.00 39.16  ?  1000 LEU A CD1   1 
ATOM   5260 C  CD2   . LEU A 1 692 ? 64.306  -34.450 -11.092 1.00 52.04  ?  1000 LEU A CD2   1 
ATOM   5261 N  N     . GLU A 1 693 ? 61.301  -30.902 -9.530  1.00 34.83  ?  1001 GLU A N     1 
ATOM   5262 C  CA    . GLU A 1 693 ? 60.066  -31.020 -8.762  1.00 34.32  ?  1001 GLU A CA    1 
ATOM   5263 C  C     . GLU A 1 693 ? 58.972  -30.136 -9.346  1.00 45.43  ?  1001 GLU A C     1 
ATOM   5264 O  O     . GLU A 1 693 ? 57.797  -30.524 -9.375  1.00 38.28  ?  1001 GLU A O     1 
ATOM   5265 C  CB    . GLU A 1 693 ? 60.328  -30.658 -7.300  1.00 36.51  ?  1001 GLU A CB    1 
ATOM   5266 C  CG    . GLU A 1 693 ? 59.144  -30.878 -6.363  1.00 36.92  ?  1001 GLU A CG    1 
ATOM   5267 C  CD    . GLU A 1 693 ? 58.253  -29.658 -6.221  1.00 55.09  ?  1001 GLU A CD    1 
ATOM   5268 O  OE1   . GLU A 1 693 ? 58.451  -28.673 -6.961  1.00 55.00  ?  1001 GLU A OE1   1 
ATOM   5269 O  OE2   . GLU A 1 693 ? 57.349  -29.684 -5.359  1.00 67.23  -1 1001 GLU A OE2   1 
ATOM   5270 N  N     . GLU A 1 694 ? 59.339  -28.937 -9.810  1.00 43.94  ?  1002 GLU A N     1 
ATOM   5271 C  CA    . GLU A 1 694 ? 58.361  -28.048 -10.427 1.00 50.93  ?  1002 GLU A CA    1 
ATOM   5272 C  C     . GLU A 1 694 ? 57.837  -28.636 -11.730 1.00 35.69  ?  1002 GLU A C     1 
ATOM   5273 O  O     . GLU A 1 694 ? 56.630  -28.605 -11.993 1.00 33.28  ?  1002 GLU A O     1 
ATOM   5274 C  CB    . GLU A 1 694 ? 58.983  -26.669 -10.668 1.00 39.03  ?  1002 GLU A CB    1 
ATOM   5275 C  CG    . GLU A 1 694 ? 58.004  -25.616 -11.184 1.00 64.39  ?  1002 GLU A CG    1 
ATOM   5276 C  CD    . GLU A 1 694 ? 58.655  -24.259 -11.424 1.00 55.78  ?  1002 GLU A CD    1 
ATOM   5277 O  OE1   . GLU A 1 694 ? 59.897  -24.203 -11.557 1.00 49.39  ?  1002 GLU A OE1   1 
ATOM   5278 O  OE2   . GLU A 1 694 ? 57.921  -23.250 -11.479 1.00 58.83  -1 1002 GLU A OE2   1 
ATOM   5279 N  N     . LEU A 1 695 ? 58.733  -29.175 -12.560 1.00 35.16  ?  1003 LEU A N     1 
ATOM   5280 C  CA    . LEU A 1 695 ? 58.303  -29.820 -13.796 1.00 42.42  ?  1003 LEU A CA    1 
ATOM   5281 C  C     . LEU A 1 695 ? 57.398  -31.013 -13.509 1.00 39.46  ?  1003 LEU A C     1 
ATOM   5282 O  O     . LEU A 1 695 ? 56.373  -31.200 -14.175 1.00 41.07  ?  1003 LEU A O     1 
ATOM   5283 C  CB    . LEU A 1 695 ? 59.526  -30.249 -14.608 1.00 39.92  ?  1003 LEU A CB    1 
ATOM   5284 C  CG    . LEU A 1 695 ? 59.270  -31.054 -15.883 1.00 37.23  ?  1003 LEU A CG    1 
ATOM   5285 C  CD1   . LEU A 1 695 ? 58.174  -30.432 -16.733 1.00 37.29  ?  1003 LEU A CD1   1 
ATOM   5286 C  CD2   . LEU A 1 695 ? 60.557  -31.165 -16.685 1.00 30.63  ?  1003 LEU A CD2   1 
ATOM   5287 N  N     . LEU A 1 696 ? 57.752  -31.823 -12.509 1.00 37.28  ?  1004 LEU A N     1 
ATOM   5288 C  CA    . LEU A 1 696 ? 56.933  -32.983 -12.175 1.00 37.62  ?  1004 LEU A CA    1 
ATOM   5289 C  C     . LEU A 1 696 ? 55.509  -32.570 -11.826 1.00 42.18  ?  1004 LEU A C     1 
ATOM   5290 O  O     . LEU A 1 696 ? 54.545  -33.227 -12.239 1.00 32.54  ?  1004 LEU A O     1 
ATOM   5291 C  CB    . LEU A 1 696 ? 57.565  -33.757 -11.018 1.00 39.46  ?  1004 LEU A CB    1 
ATOM   5292 C  CG    . LEU A 1 696 ? 58.715  -34.697 -11.389 1.00 42.81  ?  1004 LEU A CG    1 
ATOM   5293 C  CD1   . LEU A 1 696 ? 59.440  -35.177 -10.139 1.00 48.07  ?  1004 LEU A CD1   1 
ATOM   5294 C  CD2   . LEU A 1 696 ? 58.207  -35.884 -12.198 1.00 39.03  ?  1004 LEU A CD2   1 
ATOM   5295 N  N     . ARG A 1 697 ? 55.354  -31.484 -11.066 1.00 40.85  ?  1005 ARG A N     1 
ATOM   5296 C  CA    . ARG A 1 697 ? 54.015  -30.996 -10.757 1.00 40.63  ?  1005 ARG A CA    1 
ATOM   5297 C  C     . ARG A 1 697 ? 53.258  -30.650 -12.032 1.00 37.25  ?  1005 ARG A C     1 
ATOM   5298 O  O     . ARG A 1 697 ? 52.046  -30.881 -12.128 1.00 34.34  ?  1005 ARG A O     1 
ATOM   5299 C  CB    . ARG A 1 697 ? 54.095  -29.786 -9.823  1.00 47.95  ?  1005 ARG A CB    1 
ATOM   5300 C  CG    . ARG A 1 697 ? 54.303  -30.162 -8.360  1.00 57.19  ?  1005 ARG A CG    1 
ATOM   5301 C  CD    . ARG A 1 697 ? 54.206  -28.965 -7.423  1.00 68.53  ?  1005 ARG A CD    1 
ATOM   5302 N  NE    . ARG A 1 697 ? 55.461  -28.216 -7.342  1.00 90.29  ?  1005 ARG A NE    1 
ATOM   5303 C  CZ    . ARG A 1 697 ? 55.674  -27.010 -7.866  1.00 67.96  ?  1005 ARG A CZ    1 
ATOM   5304 N  NH1   . ARG A 1 697 ? 54.718  -26.366 -8.524  1.00 82.80  ?  1005 ARG A NH1   1 
ATOM   5305 N  NH2   . ARG A 1 697 ? 56.862  -26.440 -7.724  1.00 65.89  ?  1005 ARG A NH2   1 
ATOM   5306 N  N     . GLN A 1 698 ? 53.960  -30.119 -13.034 1.00 36.36  ?  1006 GLN A N     1 
ATOM   5307 C  CA    . GLN A 1 698 ? 53.308  -29.809 -14.301 1.00 40.78  ?  1006 GLN A CA    1 
ATOM   5308 C  C     . GLN A 1 698 ? 52.974  -31.074 -15.081 1.00 39.42  ?  1006 GLN A C     1 
ATOM   5309 O  O     . GLN A 1 698 ? 51.948  -31.119 -15.771 1.00 36.11  ?  1006 GLN A O     1 
ATOM   5310 C  CB    . GLN A 1 698 ? 54.196  -28.880 -15.130 1.00 35.62  ?  1006 GLN A CB    1 
ATOM   5311 C  CG    . GLN A 1 698 ? 54.362  -27.493 -14.511 1.00 39.20  ?  1006 GLN A CG    1 
ATOM   5312 C  CD    . GLN A 1 698 ? 55.403  -26.642 -15.214 1.00 37.70  ?  1006 GLN A CD    1 
ATOM   5313 O  OE1   . GLN A 1 698 ? 55.624  -26.768 -16.419 1.00 37.05  ?  1006 GLN A OE1   1 
ATOM   5314 N  NE2   . GLN A 1 698 ? 56.054  -25.770 -14.457 1.00 48.85  ?  1006 GLN A NE2   1 
ATOM   5315 N  N     . MET A 1 699 ? 53.815  -32.107 -14.985 1.00 33.98  ?  1007 MET A N     1 
ATOM   5316 C  CA    . MET A 1 699 ? 53.515  -33.368 -15.657 1.00 36.63  ?  1007 MET A CA    1 
ATOM   5317 C  C     . MET A 1 699 ? 52.309  -34.051 -15.021 1.00 31.15  ?  1007 MET A C     1 
ATOM   5318 O  O     . MET A 1 699 ? 51.497  -34.664 -15.723 1.00 32.67  ?  1007 MET A O     1 
ATOM   5319 C  CB    . MET A 1 699 ? 54.737  -34.286 -15.628 1.00 33.03  ?  1007 MET A CB    1 
ATOM   5320 C  CG    . MET A 1 699 ? 55.963  -33.724 -16.343 1.00 33.04  ?  1007 MET A CG    1 
ATOM   5321 S  SD    . MET A 1 699 ? 55.681  -33.371 -18.092 1.00 37.61  ?  1007 MET A SD    1 
ATOM   5322 C  CE    . MET A 1 699 ? 55.544  -35.029 -18.764 1.00 52.86  ?  1007 MET A CE    1 
ATOM   5323 N  N     . CYS A 1 700 ? 52.167  -33.952 -13.696 1.00 29.81  ?  1008 CYS A N     1 
ATOM   5324 C  CA    . CYS A 1 700 ? 50.954  -34.439 -13.046 1.00 31.00  ?  1008 CYS A CA    1 
ATOM   5325 C  C     . CYS A 1 700 ? 49.720  -33.756 -13.621 1.00 41.81  ?  1008 CYS A C     1 
ATOM   5326 O  O     . CYS A 1 700 ? 48.741  -34.418 -13.984 1.00 41.55  ?  1008 CYS A O     1 
ATOM   5327 C  CB    . CYS A 1 700 ? 51.027  -34.210 -11.537 1.00 32.77  ?  1008 CYS A CB    1 
ATOM   5328 S  SG    . CYS A 1 700 ? 52.219  -35.243 -10.669 1.00 48.97  ?  1008 CYS A SG    1 
ATOM   5329 N  N     . GLN A 1 701 ? 49.748  -32.423 -13.705 1.00 40.03  ?  1009 GLN A N     1 
ATOM   5330 C  CA    . GLN A 1 701 ? 48.623  -31.698 -14.286 1.00 44.42  ?  1009 GLN A CA    1 
ATOM   5331 C  C     . GLN A 1 701 ? 48.414  -32.089 -15.742 1.00 33.45  ?  1009 GLN A C     1 
ATOM   5332 O  O     . GLN A 1 701 ? 47.275  -32.171 -16.214 1.00 41.25  ?  1009 GLN A O     1 
ATOM   5333 C  CB    . GLN A 1 701 ? 48.853  -30.191 -14.164 1.00 46.88  ?  1009 GLN A CB    1 
ATOM   5334 C  CG    . GLN A 1 701 ? 48.888  -29.681 -12.731 1.00 50.24  ?  1009 GLN A CG    1 
ATOM   5335 C  CD    . GLN A 1 701 ? 49.270  -28.215 -12.644 1.00 75.08  ?  1009 GLN A CD    1 
ATOM   5336 O  OE1   . GLN A 1 701 ? 50.286  -27.792 -13.198 1.00 62.67  ?  1009 GLN A OE1   1 
ATOM   5337 N  NE2   . GLN A 1 701 ? 48.450  -27.430 -11.952 1.00 82.22  ?  1009 GLN A NE2   1 
ATOM   5338 N  N     . ALA A 1 702 ? 49.506  -32.334 -16.470 1.00 33.20  ?  1010 ALA A N     1 
ATOM   5339 C  CA    . ALA A 1 702 ? 49.393  -32.769 -17.857 1.00 35.35  ?  1010 ALA A CA    1 
ATOM   5340 C  C     . ALA A 1 702 ? 48.648  -34.095 -17.948 1.00 43.03  ?  1010 ALA A C     1 
ATOM   5341 O  O     . ALA A 1 702 ? 47.683  -34.230 -18.710 1.00 33.28  ?  1010 ALA A O     1 
ATOM   5342 C  CB    . ALA A 1 702 ? 50.785  -32.885 -18.480 1.00 33.46  ?  1010 ALA A CB    1 
ATOM   5343 N  N     . ALA A 1 703 ? 49.085  -35.088 -17.171 1.00 40.29  ?  1011 ALA A N     1 
ATOM   5344 C  CA    . ALA A 1 703 ? 48.383  -36.366 -17.135 1.00 44.12  ?  1011 ALA A CA    1 
ATOM   5345 C  C     . ALA A 1 703 ? 46.959  -36.190 -16.628 1.00 40.62  ?  1011 ALA A C     1 
ATOM   5346 O  O     . ALA A 1 703 ? 46.024  -36.811 -17.148 1.00 40.51  ?  1011 ALA A O     1 
ATOM   5347 C  CB    . ALA A 1 703 ? 49.148  -37.356 -16.255 1.00 38.29  ?  1011 ALA A CB    1 
ATOM   5348 N  N     . LYS A 1 704 ? 46.774  -35.338 -15.617 1.00 43.91  ?  1012 LYS A N     1 
ATOM   5349 C  CA    . LYS A 1 704 ? 45.443  -35.098 -15.068 1.00 41.11  ?  1012 LYS A CA    1 
ATOM   5350 C  C     . LYS A 1 704 ? 44.491  -34.539 -16.120 1.00 46.11  ?  1012 LYS A C     1 
ATOM   5351 O  O     . LYS A 1 704 ? 43.291  -34.837 -16.093 1.00 50.29  ?  1012 LYS A O     1 
ATOM   5352 C  CB    . LYS A 1 704 ? 45.543  -34.140 -13.880 1.00 52.88  ?  1012 LYS A CB    1 
ATOM   5353 C  CG    . LYS A 1 704 ? 44.267  -33.983 -13.070 1.00 56.08  ?  1012 LYS A CG    1 
ATOM   5354 C  CD    . LYS A 1 704 ? 44.173  -32.605 -12.419 1.00 79.47  ?  1012 LYS A CD    1 
ATOM   5355 C  CE    . LYS A 1 704 ? 45.349  -32.319 -11.492 1.00 92.17  ?  1012 LYS A CE    1 
ATOM   5356 N  NZ    . LYS A 1 704 ? 45.312  -30.927 -10.952 1.00 84.32  ?  1012 LYS A NZ    1 
ATOM   5357 N  N     . ALA A 1 705 ? 45.001  -33.728 -17.050 1.00 46.25  ?  1013 ALA A N     1 
ATOM   5358 C  CA    . ALA A 1 705 ? 44.141  -33.100 -18.048 1.00 39.18  ?  1013 ALA A CA    1 
ATOM   5359 C  C     . ALA A 1 705 ? 43.413  -34.121 -18.912 1.00 43.68  ?  1013 ALA A C     1 
ATOM   5360 O  O     . ALA A 1 705 ? 42.355  -33.804 -19.468 1.00 45.01  ?  1013 ALA A O     1 
ATOM   5361 C  CB    . ALA A 1 705 ? 44.965  -32.165 -18.936 1.00 40.49  ?  1013 ALA A CB    1 
ATOM   5362 N  N     . ILE A 1 706 ? 43.968  -35.323 -19.061 1.00 47.48  ?  1014 ILE A N     1 
ATOM   5363 C  CA    . ILE A 1 706 ? 43.329  -36.415 -19.787 1.00 44.27  ?  1014 ILE A CA    1 
ATOM   5364 C  C     . ILE A 1 706 ? 42.976  -37.576 -18.853 1.00 47.12  ?  1014 ILE A C     1 
ATOM   5365 O  O     . ILE A 1 706 ? 42.837  -38.714 -19.303 1.00 53.12  ?  1014 ILE A O     1 
ATOM   5366 C  CB    . ILE A 1 706 ? 44.212  -36.891 -20.956 1.00 39.69  ?  1014 ILE A CB    1 
ATOM   5367 C  CG1   . ILE A 1 706 ? 45.645  -37.145 -20.481 1.00 38.02  ?  1014 ILE A CG1   1 
ATOM   5368 C  CG2   . ILE A 1 706 ? 44.188  -35.870 -22.084 1.00 47.65  ?  1014 ILE A CG2   1 
ATOM   5369 C  CD1   . ILE A 1 706 ? 46.553  -37.736 -21.540 1.00 41.47  ?  1014 ILE A CD1   1 
ATOM   5370 N  N     . GLY A 1 707 ? 42.821  -37.298 -17.557 1.00 56.64  ?  1015 GLY A N     1 
ATOM   5371 C  CA    . GLY A 1 707 ? 42.432  -38.314 -16.598 1.00 52.93  ?  1015 GLY A CA    1 
ATOM   5372 C  C     . GLY A 1 707 ? 43.355  -39.508 -16.522 1.00 53.89  ?  1015 GLY A C     1 
ATOM   5373 O  O     . GLY A 1 707 ? 42.967  -40.543 -15.975 1.00 53.00  ?  1015 GLY A O     1 
ATOM   5374 N  N     . ASN A 1 708 ? 44.576  -39.397 -17.045 1.00 48.69  ?  1016 ASN A N     1 
ATOM   5375 C  CA    . ASN A 1 708 ? 45.521  -40.514 -17.031 1.00 45.58  ?  1016 ASN A CA    1 
ATOM   5376 C  C     . ASN A 1 708 ? 46.083  -40.657 -15.619 1.00 50.45  ?  1016 ASN A C     1 
ATOM   5377 O  O     . ASN A 1 708 ? 47.217  -40.278 -15.315 1.00 51.79  ?  1016 ASN A O     1 
ATOM   5378 C  CB    . ASN A 1 708 ? 46.624  -40.307 -18.061 1.00 44.22  ?  1016 ASN A CB    1 
ATOM   5379 C  CG    . ASN A 1 708 ? 47.509  -41.531 -18.213 1.00 46.08  ?  1016 ASN A CG    1 
ATOM   5380 O  OD1   . ASN A 1 708 ? 47.683  -42.303 -17.271 1.00 52.28  ?  1016 ASN A OD1   1 
ATOM   5381 N  ND2   . ASN A 1 708 ? 48.070  -41.716 -19.402 1.00 51.30  ?  1016 ASN A ND2   1 
ATOM   5382 N  N     . THR A 1 709 ? 45.262  -41.239 -14.740 1.00 48.57  ?  1017 THR A N     1 
ATOM   5383 C  CA    . THR A 1 709 ? 45.645  -41.408 -13.344 1.00 49.76  ?  1017 THR A CA    1 
ATOM   5384 C  C     . THR A 1 709 ? 46.885  -42.276 -13.187 1.00 53.32  ?  1017 THR A C     1 
ATOM   5385 O  O     . THR A 1 709 ? 47.536  -42.226 -12.137 1.00 54.23  ?  1017 THR A O     1 
ATOM   5386 C  CB    . THR A 1 709 ? 44.482  -42.016 -12.557 1.00 48.82  ?  1017 THR A CB    1 
ATOM   5387 O  OG1   . THR A 1 709 ? 43.292  -41.259 -12.807 1.00 52.30  ?  1017 THR A OG1   1 
ATOM   5388 C  CG2   . THR A 1 709 ? 44.771  -42.005 -11.064 1.00 52.95  ?  1017 THR A CG2   1 
ATOM   5389 N  N     . GLU A 1 710 ? 47.228  -43.070 -14.202 1.00 54.64  ?  1018 GLU A N     1 
ATOM   5390 C  CA    . GLU A 1 710 ? 48.438  -43.882 -14.136 1.00 57.82  ?  1018 GLU A CA    1 
ATOM   5391 C  C     . GLU A 1 710 ? 49.676  -42.998 -14.051 1.00 49.67  ?  1018 GLU A C     1 
ATOM   5392 O  O     . GLU A 1 710 ? 50.458  -43.088 -13.097 1.00 47.02  ?  1018 GLU A O     1 
ATOM   5393 C  CB    . GLU A 1 710 ? 48.512  -44.806 -15.355 1.00 69.76  ?  1018 GLU A CB    1 
ATOM   5394 C  CG    . GLU A 1 710 ? 49.747  -45.697 -15.395 1.00 90.62  ?  1018 GLU A CG    1 
ATOM   5395 C  CD    . GLU A 1 710 ? 49.884  -46.446 -16.707 1.00 117.92 ?  1018 GLU A CD    1 
ATOM   5396 O  OE1   . GLU A 1 710 ? 48.949  -46.375 -17.533 1.00 114.27 ?  1018 GLU A OE1   1 
ATOM   5397 O  OE2   . GLU A 1 710 ? 50.928  -47.101 -16.915 1.00 111.21 -1 1018 GLU A OE2   1 
ATOM   5398 N  N     . LEU A 1 711 ? 49.873  -42.135 -15.050 1.00 54.11  ?  1019 LEU A N     1 
ATOM   5399 C  CA    . LEU A 1 711 ? 51.053  -41.277 -15.065 1.00 54.35  ?  1019 LEU A CA    1 
ATOM   5400 C  C     . LEU A 1 711 ? 50.999  -40.244 -13.948 1.00 39.16  ?  1019 LEU A C     1 
ATOM   5401 O  O     . LEU A 1 711 ? 52.029  -39.920 -13.347 1.00 40.61  ?  1019 LEU A O     1 
ATOM   5402 C  CB    . LEU A 1 711 ? 51.189  -40.591 -16.423 1.00 47.76  ?  1019 LEU A CB    1 
ATOM   5403 C  CG    . LEU A 1 711 ? 51.502  -41.507 -17.608 1.00 53.09  ?  1019 LEU A CG    1 
ATOM   5404 C  CD1   . LEU A 1 711 ? 51.615  -40.701 -18.891 1.00 47.72  ?  1019 LEU A CD1   1 
ATOM   5405 C  CD2   . LEU A 1 711 ? 52.779  -42.298 -17.369 1.00 69.46  ?  1019 LEU A CD2   1 
ATOM   5406 N  N     . GLU A 1 712 ? 49.809  -39.718 -13.653 1.00 40.69  ?  1020 GLU A N     1 
ATOM   5407 C  CA    . GLU A 1 712 ? 49.672  -38.769 -12.554 1.00 48.03  ?  1020 GLU A CA    1 
ATOM   5408 C  C     . GLU A 1 712 ? 50.264  -39.337 -11.269 1.00 47.81  ?  1020 GLU A C     1 
ATOM   5409 O  O     . GLU A 1 712 ? 51.098  -38.698 -10.617 1.00 48.21  ?  1020 GLU A O     1 
ATOM   5410 C  CB    . GLU A 1 712 ? 48.198  -38.409 -12.362 1.00 50.92  ?  1020 GLU A CB    1 
ATOM   5411 C  CG    . GLU A 1 712 ? 47.945  -37.352 -11.301 1.00 50.65  ?  1020 GLU A CG    1 
ATOM   5412 C  CD    . GLU A 1 712 ? 46.478  -36.984 -11.191 1.00 59.15  ?  1020 GLU A CD    1 
ATOM   5413 O  OE1   . GLU A 1 712 ? 46.166  -35.941 -10.577 1.00 69.14  ?  1020 GLU A OE1   1 
ATOM   5414 O  OE2   . GLU A 1 712 ? 45.635  -37.737 -11.723 1.00 62.63  -1 1020 GLU A OE2   1 
ATOM   5415 N  N     . ASN A 1 713 ? 49.850  -40.551 -10.895 1.00 49.60  ?  1021 ASN A N     1 
ATOM   5416 C  CA    . ASN A 1 713 ? 50.396  -41.183 -9.698  1.00 41.05  ?  1021 ASN A CA    1 
ATOM   5417 C  C     . ASN A 1 713 ? 51.884  -41.462 -9.842  1.00 39.55  ?  1021 ASN A C     1 
ATOM   5418 O  O     . ASN A 1 713 ? 52.626  -41.400 -8.855  1.00 46.44  ?  1021 ASN A O     1 
ATOM   5419 C  CB    . ASN A 1 713 ? 49.646  -42.483 -9.401  1.00 47.71  ?  1021 ASN A CB    1 
ATOM   5420 C  CG    . ASN A 1 713 ? 48.199  -42.249 -9.018  1.00 55.70  ?  1021 ASN A CG    1 
ATOM   5421 O  OD1   . ASN A 1 713 ? 47.819  -41.149 -8.617  1.00 51.14  ?  1021 ASN A OD1   1 
ATOM   5422 N  ND2   . ASN A 1 713 ? 47.381  -43.291 -9.133  1.00 59.06  ?  1021 ASN A ND2   1 
ATOM   5423 N  N     . LYS A 1 714 ? 52.338  -41.776 -11.057 1.00 37.17  ?  1022 LYS A N     1 
ATOM   5424 C  CA    . LYS A 1 714 ? 53.754  -42.046 -11.276 1.00 34.17  ?  1022 LYS A CA    1 
ATOM   5425 C  C     . LYS A 1 714 ? 54.590  -40.784 -11.087 1.00 45.26  ?  1022 LYS A C     1 
ATOM   5426 O  O     . LYS A 1 714 ? 55.585  -40.790 -10.352 1.00 40.93  ?  1022 LYS A O     1 
ATOM   5427 C  CB    . LYS A 1 714 ? 53.961  -42.624 -12.675 1.00 35.83  ?  1022 LYS A CB    1 
ATOM   5428 C  CG    . LYS A 1 714 ? 55.408  -42.985 -12.988 1.00 39.47  ?  1022 LYS A CG    1 
ATOM   5429 C  CD    . LYS A 1 714 ? 55.567  -43.500 -14.412 1.00 50.90  ?  1022 LYS A CD    1 
ATOM   5430 C  CE    . LYS A 1 714 ? 54.842  -44.828 -14.622 1.00 51.43  ?  1022 LYS A CE    1 
ATOM   5431 N  NZ    . LYS A 1 714 ? 55.063  -45.362 -15.996 1.00 56.39  ?  1022 LYS A NZ    1 
ATOM   5432 N  N     . PHE A 1 715 ? 54.211  -39.690 -11.754 1.00 41.43  ?  1023 PHE A N     1 
ATOM   5433 C  CA    . PHE A 1 715 ? 54.944  -38.439 -11.583 1.00 42.39  ?  1023 PHE A CA    1 
ATOM   5434 C  C     . PHE A 1 715 ? 54.889  -37.972 -10.134 1.00 43.65  ?  1023 PHE A C     1 
ATOM   5435 O  O     . PHE A 1 715 ? 55.878  -37.454 -9.601  1.00 43.02  ?  1023 PHE A O     1 
ATOM   5436 C  CB    . PHE A 1 715 ? 54.382  -37.368 -12.516 1.00 35.85  ?  1023 PHE A CB    1 
ATOM   5437 C  CG    . PHE A 1 715 ? 54.595  -37.657 -13.976 1.00 32.60  ?  1023 PHE A CG    1 
ATOM   5438 C  CD1   . PHE A 1 715 ? 55.822  -38.097 -14.440 1.00 33.01  ?  1023 PHE A CD1   1 
ATOM   5439 C  CD2   . PHE A 1 715 ? 53.563  -37.490 -14.885 1.00 38.05  ?  1023 PHE A CD2   1 
ATOM   5440 C  CE1   . PHE A 1 715 ? 56.020  -38.361 -15.785 1.00 37.50  ?  1023 PHE A CE1   1 
ATOM   5441 C  CE2   . PHE A 1 715 ? 53.753  -37.755 -16.230 1.00 38.17  ?  1023 PHE A CE2   1 
ATOM   5442 C  CZ    . PHE A 1 715 ? 54.982  -38.189 -16.680 1.00 37.04  ?  1023 PHE A CZ    1 
ATOM   5443 N  N     . ALA A 1 716 ? 53.743  -38.160 -9.476  1.00 41.47  ?  1024 ALA A N     1 
ATOM   5444 C  CA    . ALA A 1 716 ? 53.617  -37.761 -8.079  1.00 44.35  ?  1024 ALA A CA    1 
ATOM   5445 C  C     . ALA A 1 716 ? 54.558  -38.564 -7.188  1.00 46.55  ?  1024 ALA A C     1 
ATOM   5446 O  O     . ALA A 1 716 ? 55.098  -38.036 -6.208  1.00 47.18  ?  1024 ALA A O     1 
ATOM   5447 C  CB    . ALA A 1 716 ? 52.168  -37.927 -7.618  1.00 36.10  ?  1024 ALA A CB    1 
ATOM   5448 N  N     . GLU A 1 717 ? 54.767  -39.843 -7.511  1.00 51.16  ?  1025 GLU A N     1 
ATOM   5449 C  CA    . GLU A 1 717 ? 55.675  -40.667 -6.718  1.00 48.60  ?  1025 GLU A CA    1 
ATOM   5450 C  C     . GLU A 1 717 ? 57.114  -40.194 -6.866  1.00 38.11  ?  1025 GLU A C     1 
ATOM   5451 O  O     . GLU A 1 717 ? 57.881  -40.207 -5.895  1.00 41.91  ?  1025 GLU A O     1 
ATOM   5452 C  CB    . GLU A 1 717 ? 55.550  -42.135 -7.129  1.00 50.23  ?  1025 GLU A CB    1 
ATOM   5453 C  CG    . GLU A 1 717 ? 56.427  -43.081 -6.317  1.00 66.71  ?  1025 GLU A CG    1 
ATOM   5454 C  CD    . GLU A 1 717 ? 56.250  -44.534 -6.718  1.00 93.90  ?  1025 GLU A CD    1 
ATOM   5455 O  OE1   . GLU A 1 717 ? 55.313  -44.834 -7.488  1.00 91.46  ?  1025 GLU A OE1   1 
ATOM   5456 O  OE2   . GLU A 1 717 ? 57.052  -45.377 -6.263  1.00 94.21  -1 1025 GLU A OE2   1 
ATOM   5457 N  N     . GLY A 1 718 ? 57.509  -39.794 -8.075  1.00 43.84  ?  1026 GLY A N     1 
ATOM   5458 C  CA    . GLY A 1 718 ? 58.814  -39.176 -8.242  1.00 51.54  ?  1026 GLY A CA    1 
ATOM   5459 C  C     . GLY A 1 718 ? 58.992  -37.968 -7.342  1.00 45.35  ?  1026 GLY A C     1 
ATOM   5460 O  O     . GLY A 1 718 ? 60.042  -37.794 -6.720  1.00 41.01  ?  1026 GLY A O     1 
ATOM   5461 N  N     . ILE A 1 719 ? 57.961  -37.123 -7.252  1.00 41.13  ?  1027 ILE A N     1 
ATOM   5462 C  CA    . ILE A 1 719 ? 58.010  -35.969 -6.357  1.00 47.62  ?  1027 ILE A CA    1 
ATOM   5463 C  C     . ILE A 1 719 ? 58.266  -36.422 -4.926  1.00 43.55  ?  1027 ILE A C     1 
ATOM   5464 O  O     . ILE A 1 719 ? 59.132  -35.882 -4.229  1.00 52.67  ?  1027 ILE A O     1 
ATOM   5465 C  CB    . ILE A 1 719 ? 56.708  -35.152 -6.460  1.00 45.21  ?  1027 ILE A CB    1 
ATOM   5466 C  CG1   . ILE A 1 719 ? 56.600  -34.506 -7.843  1.00 46.11  ?  1027 ILE A CG1   1 
ATOM   5467 C  CG2   . ILE A 1 719 ? 56.642  -34.097 -5.352  1.00 42.28  ?  1027 ILE A CG2   1 
ATOM   5468 C  CD1   . ILE A 1 719 ? 55.270  -33.835 -8.104  1.00 42.11  ?  1027 ILE A CD1   1 
ATOM   5469 N  N     . THR A 1 720 ? 57.505  -37.417 -4.463  1.00 49.33  ?  1028 THR A N     1 
ATOM   5470 C  CA    . THR A 1 720 ? 57.675  -37.904 -3.098  1.00 51.67  ?  1028 THR A CA    1 
ATOM   5471 C  C     . THR A 1 720 ? 59.072  -38.466 -2.873  1.00 43.92  ?  1028 THR A C     1 
ATOM   5472 O  O     . THR A 1 720 ? 59.573  -38.448 -1.743  1.00 46.00  ?  1028 THR A O     1 
ATOM   5473 C  CB    . THR A 1 720 ? 56.622  -38.970 -2.787  1.00 51.73  ?  1028 THR A CB    1 
ATOM   5474 O  OG1   . THR A 1 720 ? 55.312  -38.413 -2.950  1.00 55.36  ?  1028 THR A OG1   1 
ATOM   5475 C  CG2   . THR A 1 720 ? 56.772  -39.483 -1.359  1.00 58.52  ?  1028 THR A CG2   1 
ATOM   5476 N  N     . LYS A 1 721 ? 59.719  -38.952 -3.930  1.00 45.90  ?  1029 LYS A N     1 
ATOM   5477 C  CA    . LYS A 1 721 ? 61.020  -39.590 -3.807  1.00 50.62  ?  1029 LYS A CA    1 
ATOM   5478 C  C     . LYS A 1 721 ? 62.191  -38.618 -3.886  1.00 50.67  ?  1029 LYS A C     1 
ATOM   5479 O  O     . LYS A 1 721 ? 63.320  -39.022 -3.591  1.00 49.37  ?  1029 LYS A O     1 
ATOM   5480 C  CB    . LYS A 1 721 ? 61.177  -40.666 -4.889  1.00 61.12  ?  1029 LYS A CB    1 
ATOM   5481 C  CG    . LYS A 1 721 ? 60.432  -41.951 -4.564  1.00 62.90  ?  1029 LYS A CG    1 
ATOM   5482 C  CD    . LYS A 1 721 ? 60.595  -43.006 -5.643  1.00 61.84  ?  1029 LYS A CD    1 
ATOM   5483 C  CE    . LYS A 1 721 ? 60.160  -44.376 -5.135  1.00 76.20  ?  1029 LYS A CE    1 
ATOM   5484 N  NZ    . LYS A 1 721 ? 58.931  -44.317 -4.297  1.00 84.43  ?  1029 LYS A NZ    1 
ATOM   5485 N  N     . ILE A 1 722 ? 61.965  -37.363 -4.270  1.00 49.67  ?  1030 ILE A N     1 
ATOM   5486 C  CA    . ILE A 1 722 ? 63.037  -36.375 -4.304  1.00 43.46  ?  1030 ILE A CA    1 
ATOM   5487 C  C     . ILE A 1 722 ? 62.815  -35.223 -3.338  1.00 41.58  ?  1030 ILE A C     1 
ATOM   5488 O  O     . ILE A 1 722 ? 63.780  -34.511 -3.018  1.00 48.23  ?  1030 ILE A O     1 
ATOM   5489 C  CB    . ILE A 1 722 ? 63.252  -35.828 -5.731  1.00 41.94  ?  1030 ILE A CB    1 
ATOM   5490 C  CG1   . ILE A 1 722 ? 62.006  -35.079 -6.226  1.00 41.03  ?  1030 ILE A CG1   1 
ATOM   5491 C  CG2   . ILE A 1 722 ? 63.609  -36.961 -6.680  1.00 43.25  ?  1030 ILE A CG2   1 
ATOM   5492 C  CD1   . ILE A 1 722 ? 62.226  -34.340 -7.538  1.00 40.67  ?  1030 ILE A CD1   1 
ATOM   5493 N  N     . LYS A 1 723 ? 61.594  -35.010 -2.850  1.00 45.19  ?  1031 LYS A N     1 
ATOM   5494 C  CA    . LYS A 1 723 ? 61.281  -33.843 -2.027  1.00 43.58  ?  1031 LYS A CA    1 
ATOM   5495 C  C     . LYS A 1 723 ? 61.543  -34.189 -0.565  1.00 46.95  ?  1031 LYS A C     1 
ATOM   5496 O  O     . LYS A 1 723 ? 60.645  -34.556 0.196   1.00 43.81  ?  1031 LYS A O     1 
ATOM   5497 C  CB    . LYS A 1 723 ? 59.843  -33.400 -2.263  1.00 46.70  ?  1031 LYS A CB    1 
ATOM   5498 C  CG    . LYS A 1 723 ? 59.460  -32.121 -1.542  1.00 59.36  ?  1031 LYS A CG    1 
ATOM   5499 C  CD    . LYS A 1 723 ? 58.092  -31.628 -1.992  1.00 67.46  ?  1031 LYS A CD    1 
ATOM   5500 C  CE    . LYS A 1 723 ? 57.531  -30.580 -1.043  1.00 90.64  ?  1031 LYS A CE    1 
ATOM   5501 N  NZ    . LYS A 1 723 ? 57.193  -31.154 0.290   1.00 100.22 ?  1031 LYS A NZ    1 
ATOM   5502 N  N     . ARG A 1 724 ? 62.808  -34.054 -0.168  1.00 49.04  ?  1032 ARG A N     1 
ATOM   5503 C  CA    . ARG A 1 724 ? 63.211  -34.368 1.195   1.00 47.54  ?  1032 ARG A CA    1 
ATOM   5504 C  C     . ARG A 1 724 ? 64.564  -33.734 1.484   1.00 42.00  ?  1032 ARG A C     1 
ATOM   5505 O  O     . ARG A 1 724 ? 65.355  -33.470 0.574   1.00 40.84  ?  1032 ARG A O     1 
ATOM   5506 C  CB    . ARG A 1 724 ? 63.286  -35.883 1.417   1.00 47.74  ?  1032 ARG A CB    1 
ATOM   5507 C  CG    . ARG A 1 724 ? 64.480  -36.537 0.723   1.00 50.45  ?  1032 ARG A CG    1 
ATOM   5508 C  CD    . ARG A 1 724 ? 64.519  -38.041 0.940   1.00 57.10  ?  1032 ARG A CD    1 
ATOM   5509 N  NE    . ARG A 1 724 ? 65.785  -38.617 0.491   1.00 40.80  ?  1032 ARG A NE    1 
ATOM   5510 C  CZ    . ARG A 1 724 ? 66.087  -38.859 -0.781  1.00 52.47  ?  1032 ARG A CZ    1 
ATOM   5511 N  NH1   . ARG A 1 724 ? 65.217  -38.571 -1.741  1.00 58.67  ?  1032 ARG A NH1   1 
ATOM   5512 N  NH2   . ARG A 1 724 ? 67.263  -39.386 -1.098  1.00 48.18  ?  1032 ARG A NH2   1 
ATOM   5513 N  N     . ASP A 1 725 ? 64.818  -33.505 2.775   1.00 41.71  ?  1033 ASP A N     1 
ATOM   5514 C  CA    . ASP A 1 725 ? 66.149  -33.166 3.275   1.00 57.12  ?  1033 ASP A CA    1 
ATOM   5515 C  C     . ASP A 1 725 ? 66.626  -31.794 2.800   1.00 51.66  ?  1033 ASP A C     1 
ATOM   5516 O  O     . ASP A 1 725 ? 65.816  -30.943 2.421   1.00 44.42  ?  1033 ASP A O     1 
ATOM   5517 C  CB    . ASP A 1 725 ? 67.147  -34.258 2.869   1.00 55.85  ?  1033 ASP A CB    1 
ATOM   5518 C  CG    . ASP A 1 725 ? 66.788  -35.618 3.446   1.00 63.36  ?  1033 ASP A CG    1 
ATOM   5519 O  OD1   . ASP A 1 725 ? 66.206  -35.663 4.551   1.00 57.08  ?  1033 ASP A OD1   1 
ATOM   5520 O  OD2   . ASP A 1 725 ? 67.091  -36.640 2.796   1.00 67.49  -1 1033 ASP A OD2   1 
ATOM   5521 N  N     . ILE A 1 726 ? 67.944  -31.570 2.827   1.00 42.93  ?  1034 ILE A N     1 
ATOM   5522 C  CA    . ILE A 1 726 ? 68.491  -30.237 2.589   1.00 56.43  ?  1034 ILE A CA    1 
ATOM   5523 C  C     . ILE A 1 726 ? 68.108  -29.717 1.211   1.00 54.25  ?  1034 ILE A C     1 
ATOM   5524 O  O     . ILE A 1 726 ? 67.975  -28.503 1.014   1.00 46.93  ?  1034 ILE A O     1 
ATOM   5525 C  CB    . ILE A 1 726 ? 70.021  -30.249 2.770   1.00 51.23  ?  1034 ILE A CB    1 
ATOM   5526 C  CG1   . ILE A 1 726 ? 70.579  -28.828 2.649   1.00 53.17  ?  1034 ILE A CG1   1 
ATOM   5527 C  CG2   . ILE A 1 726 ? 70.672  -31.164 1.739   1.00 43.50  ?  1034 ILE A CG2   1 
ATOM   5528 C  CD1   . ILE A 1 726 ? 72.045  -28.713 2.999   1.00 53.51  ?  1034 ILE A CD1   1 
ATOM   5529 N  N     . VAL A 1 727 ? 67.931  -30.612 0.236   1.00 50.07  ?  1035 VAL A N     1 
ATOM   5530 C  CA    . VAL A 1 727 ? 67.595  -30.167 -1.112  1.00 42.88  ?  1035 VAL A CA    1 
ATOM   5531 C  C     . VAL A 1 727 ? 66.291  -29.381 -1.110  1.00 45.70  ?  1035 VAL A C     1 
ATOM   5532 O  O     . VAL A 1 727 ? 66.090  -28.495 -1.949  1.00 41.92  ?  1035 VAL A O     1 
ATOM   5533 C  CB    . VAL A 1 727 ? 67.527  -31.368 -2.076  1.00 47.60  ?  1035 VAL A CB    1 
ATOM   5534 C  CG1   . VAL A 1 727 ? 67.197  -30.898 -3.483  1.00 45.28  ?  1035 VAL A CG1   1 
ATOM   5535 C  CG2   . VAL A 1 727 ? 68.844  -32.133 -2.069  1.00 46.83  ?  1035 VAL A CG2   1 
ATOM   5536 N  N     . PHE A 1 728 ? 65.392  -29.676 -0.169  1.00 38.08  ?  1036 PHE A N     1 
ATOM   5537 C  CA    . PHE A 1 728 ? 64.113  -28.984 -0.076  1.00 39.18  ?  1036 PHE A CA    1 
ATOM   5538 C  C     . PHE A 1 728 ? 63.897  -28.408 1.319   1.00 39.45  ?  1036 PHE A C     1 
ATOM   5539 O  O     . PHE A 1 728 ? 62.757  -28.252 1.763   1.00 33.01  ?  1036 PHE A O     1 
ATOM   5540 C  CB    . PHE A 1 728 ? 62.963  -29.915 -0.463  1.00 42.60  ?  1036 PHE A CB    1 
ATOM   5541 C  CG    . PHE A 1 728 ? 62.914  -30.225 -1.931  1.00 50.90  ?  1036 PHE A CG    1 
ATOM   5542 C  CD1   . PHE A 1 728 ? 63.729  -31.207 -2.473  1.00 42.18  ?  1036 PHE A CD1   1 
ATOM   5543 C  CD2   . PHE A 1 728 ? 62.067  -29.523 -2.772  1.00 40.99  ?  1036 PHE A CD2   1 
ATOM   5544 C  CE1   . PHE A 1 728 ? 63.692  -31.490 -3.830  1.00 49.73  ?  1036 PHE A CE1   1 
ATOM   5545 C  CE2   . PHE A 1 728 ? 62.025  -29.801 -4.129  1.00 45.06  ?  1036 PHE A CE2   1 
ATOM   5546 C  CZ    . PHE A 1 728 ? 62.839  -30.785 -4.659  1.00 44.00  ?  1036 PHE A CZ    1 
ATOM   5547 N  N     . ALA A 1 729 ? 64.981  -28.074 2.016   1.00 38.05  ?  1037 ALA A N     1 
ATOM   5548 C  CA    . ALA A 1 729 ? 64.856  -27.367 3.282   1.00 46.17  ?  1037 ALA A CA    1 
ATOM   5549 C  C     . ALA A 1 729 ? 64.153  -26.032 3.066   1.00 42.43  ?  1037 ALA A C     1 
ATOM   5550 O  O     . ALA A 1 729 ? 64.368  -25.351 2.059   1.00 37.45  ?  1037 ALA A O     1 
ATOM   5551 C  CB    . ALA A 1 729 ? 66.232  -27.146 3.909   1.00 45.99  ?  1037 ALA A CB    1 
ATOM   5552 N  N     . ALA A 1 730 ? 63.302  -25.664 4.019   1.00 31.92  ?  1038 ALA A N     1 
ATOM   5553 C  CA    . ALA A 1 730 ? 62.536  -24.433 3.905   1.00 50.92  ?  1038 ALA A CA    1 
ATOM   5554 C  C     . ALA A 1 730 ? 63.460  -23.221 3.919   1.00 49.86  ?  1038 ALA A C     1 
ATOM   5555 O  O     . ALA A 1 730 ? 64.553  -23.247 4.491   1.00 42.15  ?  1038 ALA A O     1 
ATOM   5556 C  CB    . ALA A 1 730 ? 61.523  -24.334 5.046   1.00 37.05  ?  1038 ALA A CB    1 
ATOM   5557 N  N     . SER A 1 731 ? 63.009  -22.149 3.272   1.00 45.36  ?  1039 SER A N     1 
ATOM   5558 C  CA    . SER A 1 731 ? 63.768  -20.907 3.272   1.00 49.53  ?  1039 SER A CA    1 
ATOM   5559 C  C     . SER A 1 731 ? 63.859  -20.352 4.689   1.00 44.01  ?  1039 SER A C     1 
ATOM   5560 O  O     . SER A 1 731 ? 62.895  -20.404 5.457   1.00 38.63  ?  1039 SER A O     1 
ATOM   5561 C  CB    . SER A 1 731 ? 63.112  -19.886 2.340   1.00 47.55  ?  1039 SER A CB    1 
ATOM   5562 O  OG    . SER A 1 731 ? 63.768  -18.629 2.404   1.00 44.86  ?  1039 SER A OG    1 
ATOM   5563 N  N     . LEU A 1 732 ? 65.037  -19.828 5.039   1.00 36.19  ?  1040 LEU A N     1 
ATOM   5564 C  CA    . LEU A 1 732 ? 65.219  -19.232 6.357   1.00 45.25  ?  1040 LEU A CA    1 
ATOM   5565 C  C     . LEU A 1 732 ? 64.362  -17.988 6.550   1.00 45.34  ?  1040 LEU A C     1 
ATOM   5566 O  O     . LEU A 1 732 ? 64.173  -17.556 7.692   1.00 50.18  ?  1040 LEU A O     1 
ATOM   5567 C  CB    . LEU A 1 732 ? 66.691  -18.878 6.587   1.00 36.04  ?  1040 LEU A CB    1 
ATOM   5568 C  CG    . LEU A 1 732 ? 67.696  -20.033 6.514   1.00 39.12  ?  1040 LEU A CG    1 
ATOM   5569 C  CD1   . LEU A 1 732 ? 69.112  -19.525 6.753   1.00 47.30  ?  1040 LEU A CD1   1 
ATOM   5570 C  CD2   . LEU A 1 732 ? 67.354  -21.134 7.507   1.00 41.11  ?  1040 LEU A CD2   1 
ATOM   5571 N  N     . TYR A 1 733 ? 63.835  -17.410 5.468   1.00 44.29  ?  1041 TYR A N     1 
ATOM   5572 C  CA    . TYR A 1 733 ? 63.024  -16.204 5.566   1.00 47.89  ?  1041 TYR A CA    1 
ATOM   5573 C  C     . TYR A 1 733 ? 61.572  -16.488 5.925   1.00 49.28  ?  1041 TYR A C     1 
ATOM   5574 O  O     . TYR A 1 733 ? 60.815  -15.540 6.161   1.00 45.71  ?  1041 TYR A O     1 
ATOM   5575 C  CB    . TYR A 1 733 ? 63.076  -15.425 4.249   1.00 37.81  ?  1041 TYR A CB    1 
ATOM   5576 C  CG    . TYR A 1 733 ? 64.446  -14.882 3.923   1.00 33.61  ?  1041 TYR A CG    1 
ATOM   5577 C  CD1   . TYR A 1 733 ? 64.931  -13.738 4.547   1.00 34.34  ?  1041 TYR A CD1   1 
ATOM   5578 C  CD2   . TYR A 1 733 ? 65.255  -15.510 2.988   1.00 36.50  ?  1041 TYR A CD2   1 
ATOM   5579 C  CE1   . TYR A 1 733 ? 66.188  -13.239 4.252   1.00 42.13  ?  1041 TYR A CE1   1 
ATOM   5580 C  CE2   . TYR A 1 733 ? 66.512  -15.020 2.685   1.00 37.46  ?  1041 TYR A CE2   1 
ATOM   5581 C  CZ    . TYR A 1 733 ? 66.975  -13.884 3.320   1.00 40.18  ?  1041 TYR A CZ    1 
ATOM   5582 O  OH    . TYR A 1 733 ? 68.227  -13.397 3.017   1.00 39.79  ?  1041 TYR A OH    1 
ATOM   5583 N  N     . LEU A 1 734 ? 61.167  -17.751 5.976   1.00 50.29  ?  1042 LEU A N     1 
ATOM   5584 C  CA    . LEU A 1 734 ? 59.792  -18.092 6.315   1.00 59.41  ?  1042 LEU A CA    1 
ATOM   5585 C  C     . LEU A 1 734 ? 59.656  -18.306 7.819   1.00 66.15  ?  1042 LEU A C     1 
ATOM   5586 O  O     . LEU A 1 734 ? 58.549  -18.433 8.345   1.00 62.16  ?  1042 LEU A O     1 
ATOM   5587 C  CB    . LEU A 1 734 ? 59.348  -19.338 5.547   1.00 52.67  ?  1042 LEU A CB    1 
ATOM   5588 C  CG    . LEU A 1 734 ? 59.613  -19.264 4.040   1.00 58.77  ?  1042 LEU A CG    1 
ATOM   5589 C  CD1   . LEU A 1 734 ? 59.205  -20.554 3.345   1.00 59.49  ?  1042 LEU A CD1   1 
ATOM   5590 C  CD2   . LEU A 1 734 ? 58.900  -18.073 3.413   1.00 65.86  ?  1042 LEU A CD2   1 
ATOM   5591 O  OXT   . LEU A 1 734 ? 60.652  -18.342 8.546   1.00 61.21  -1 1042 LEU A OXT   1 
ATOM   5592 N  N     . PRO B 2 4   ? 38.923  -6.192  -24.613 1.00 61.94  ?  659  PRO B N     1 
ATOM   5593 C  CA    . PRO B 2 4   ? 39.868  -6.909  -25.478 1.00 78.43  ?  659  PRO B CA    1 
ATOM   5594 C  C     . PRO B 2 4   ? 40.231  -8.289  -24.931 1.00 64.84  ?  659  PRO B C     1 
ATOM   5595 O  O     . PRO B 2 4   ? 40.120  -9.287  -25.644 1.00 65.13  ?  659  PRO B O     1 
ATOM   5596 C  CB    . PRO B 2 4   ? 41.089  -5.986  -25.500 1.00 71.86  ?  659  PRO B CB    1 
ATOM   5597 C  CG    . PRO B 2 4   ? 41.043  -5.268  -24.189 1.00 78.93  ?  659  PRO B CG    1 
ATOM   5598 C  CD    . PRO B 2 4   ? 39.589  -5.162  -23.793 1.00 78.47  ?  659  PRO B CD    1 
ATOM   5599 N  N     . ILE B 2 5   ? 40.655  -8.338  -23.677 1.00 59.80  ?  660  ILE B N     1 
ATOM   5600 C  CA    . ILE B 2 5   ? 40.988  -9.609  -23.032 1.00 57.36  ?  660  ILE B CA    1 
ATOM   5601 C  C     . ILE B 2 5   ? 39.695  -10.261 -22.549 1.00 62.58  ?  660  ILE B C     1 
ATOM   5602 O  O     . ILE B 2 5   ? 38.910  -9.606  -21.846 1.00 63.01  ?  660  ILE B O     1 
ATOM   5603 C  CB    . ILE B 2 5   ? 41.954  -9.382  -21.872 1.00 64.33  ?  660  ILE B CB    1 
ATOM   5604 C  CG1   . ILE B 2 5   ? 43.279  -8.803  -22.377 1.00 69.62  ?  660  ILE B CG1   1 
ATOM   5605 C  CG2   . ILE B 2 5   ? 42.194  -10.676 -21.103 1.00 58.29  ?  660  ILE B CG2   1 
ATOM   5606 C  CD1   . ILE B 2 5   ? 44.047  -9.715  -23.313 1.00 58.60  ?  660  ILE B CD1   1 
ATOM   5607 N  N     . PRO B 2 6   ? 39.429  -11.519 -22.898 1.00 56.31  ?  661  PRO B N     1 
ATOM   5608 C  CA    . PRO B 2 6   ? 38.211  -12.164 -22.398 1.00 55.35  ?  661  PRO B CA    1 
ATOM   5609 C  C     . PRO B 2 6   ? 38.227  -12.269 -20.880 1.00 56.48  ?  661  PRO B C     1 
ATOM   5610 O  O     . PRO B 2 6   ? 39.275  -12.207 -20.232 1.00 55.22  ?  661  PRO B O     1 
ATOM   5611 C  CB    . PRO B 2 6   ? 38.232  -13.548 -23.062 1.00 57.89  ?  661  PRO B CB    1 
ATOM   5612 C  CG    . PRO B 2 6   ? 39.635  -13.762 -23.497 1.00 59.93  ?  661  PRO B CG    1 
ATOM   5613 C  CD    . PRO B 2 6   ? 40.200  -12.406 -23.786 1.00 55.73  ?  661  PRO B CD    1 
ATOM   5614 N  N     . ASP B 2 7   ? 37.032  -12.417 -20.313 1.00 54.91  ?  662  ASP B N     1 
ATOM   5615 C  CA    . ASP B 2 7   ? 36.893  -12.517 -18.868 1.00 56.24  ?  662  ASP B CA    1 
ATOM   5616 C  C     . ASP B 2 7   ? 37.667  -13.719 -18.335 1.00 53.60  ?  662  ASP B C     1 
ATOM   5617 O  O     . ASP B 2 7   ? 37.885  -14.710 -19.038 1.00 44.35  ?  662  ASP B O     1 
ATOM   5618 C  CB    . ASP B 2 7   ? 35.417  -12.634 -18.482 1.00 51.21  ?  662  ASP B CB    1 
ATOM   5619 C  CG    . ASP B 2 7   ? 35.198  -12.554 -16.982 1.00 64.90  ?  662  ASP B CG    1 
ATOM   5620 O  OD1   . ASP B 2 7   ? 35.272  -11.436 -16.426 1.00 70.58  ?  662  ASP B OD1   1 
ATOM   5621 O  OD2   . ASP B 2 7   ? 34.958  -13.609 -16.356 1.00 57.79  ?  662  ASP B OD2   1 
ATOM   5622 N  N     . MET B 2 8   ? 38.078  -13.621 -17.068 1.00 57.23  ?  663  MET B N     1 
ATOM   5623 C  CA    . MET B 2 8   ? 38.838  -14.694 -16.436 1.00 56.45  ?  663  MET B CA    1 
ATOM   5624 C  C     . MET B 2 8   ? 38.135  -16.038 -16.585 1.00 61.45  ?  663  MET B C     1 
ATOM   5625 O  O     . MET B 2 8   ? 38.789  -17.077 -16.735 1.00 56.17  ?  663  MET B O     1 
ATOM   5626 C  CB    . MET B 2 8   ? 39.049  -14.375 -14.955 1.00 61.23  ?  663  MET B CB    1 
ATOM   5627 C  CG    . MET B 2 8   ? 39.852  -13.116 -14.690 1.00 74.69  ?  663  MET B CG    1 
ATOM   5628 S  SD    . MET B 2 8   ? 39.456  -12.396 -13.083 1.00 74.91  ?  663  MET B SD    1 
ATOM   5629 C  CE    . MET B 2 8   ? 39.624  -13.832 -12.030 1.00 61.33  ?  663  MET B CE    1 
ATOM   5630 N  N     . SER B 2 9   ? 36.801  -16.037 -16.540 1.00 60.05  ?  664  SER B N     1 
ATOM   5631 C  CA    . SER B 2 9   ? 36.056  -17.288 -16.635 1.00 61.25  ?  664  SER B CA    1 
ATOM   5632 C  C     . SER B 2 9   ? 36.371  -18.032 -17.925 1.00 46.11  ?  664  SER B C     1 
ATOM   5633 O  O     . SER B 2 9   ? 36.373  -19.268 -17.941 1.00 52.30  ?  664  SER B O     1 
ATOM   5634 C  CB    . SER B 2 9   ? 34.553  -17.015 -16.535 1.00 62.87  ?  664  SER B CB    1 
ATOM   5635 O  OG    . SER B 2 9   ? 34.098  -16.210 -17.611 1.00 61.02  ?  664  SER B OG    1 
ATOM   5636 N  N     . LYS B 2 10  ? 36.641  -17.307 -19.013 1.00 44.57  ?  665  LYS B N     1 
ATOM   5637 C  CA    . LYS B 2 10  ? 36.926  -17.964 -20.283 1.00 48.44  ?  665  LYS B CA    1 
ATOM   5638 C  C     . LYS B 2 10  ? 38.321  -18.574 -20.299 1.00 44.96  ?  665  LYS B C     1 
ATOM   5639 O  O     . LYS B 2 10  ? 38.553  -19.565 -21.002 1.00 45.72  ?  665  LYS B O     1 
ATOM   5640 C  CB    . LYS B 2 10  ? 36.759  -16.972 -21.433 1.00 46.90  ?  665  LYS B CB    1 
ATOM   5641 C  CG    . LYS B 2 10  ? 35.369  -16.359 -21.485 1.00 70.27  ?  665  LYS B CG    1 
ATOM   5642 C  CD    . LYS B 2 10  ? 35.114  -15.618 -22.785 1.00 80.02  ?  665  LYS B CD    1 
ATOM   5643 C  CE    . LYS B 2 10  ? 33.784  -14.882 -22.741 1.00 91.08  ?  665  LYS B CE    1 
ATOM   5644 N  NZ    . LYS B 2 10  ? 32.658  -15.783 -22.368 1.00 91.93  ?  665  LYS B NZ    1 
ATOM   5645 N  N     . PHE B 2 11  ? 39.259  -18.006 -19.537 1.00 42.26  ?  666  PHE B N     1 
ATOM   5646 C  CA    . PHE B 2 11  ? 40.568  -18.633 -19.399 1.00 49.13  ?  666  PHE B CA    1 
ATOM   5647 C  C     . PHE B 2 11  ? 40.490  -19.906 -18.566 1.00 46.62  ?  666  PHE B C     1 
ATOM   5648 O  O     . PHE B 2 11  ? 41.287  -20.828 -18.767 1.00 40.96  ?  666  PHE B O     1 
ATOM   5649 C  CB    . PHE B 2 11  ? 41.564  -17.655 -18.771 1.00 45.28  ?  666  PHE B CB    1 
ATOM   5650 C  CG    . PHE B 2 11  ? 42.066  -16.607 -19.722 1.00 42.27  ?  666  PHE B CG    1 
ATOM   5651 C  CD1   . PHE B 2 11  ? 43.183  -16.842 -20.506 1.00 32.67  ?  666  PHE B CD1   1 
ATOM   5652 C  CD2   . PHE B 2 11  ? 41.424  -15.385 -19.831 1.00 44.41  ?  666  PHE B CD2   1 
ATOM   5653 C  CE1   . PHE B 2 11  ? 43.646  -15.879 -21.387 1.00 40.91  ?  666  PHE B CE1   1 
ATOM   5654 C  CE2   . PHE B 2 11  ? 41.882  -14.420 -20.706 1.00 36.19  ?  666  PHE B CE2   1 
ATOM   5655 C  CZ    . PHE B 2 11  ? 42.994  -14.667 -21.484 1.00 43.23  ?  666  PHE B CZ    1 
ATOM   5656 N  N     . ALA B 2 12  ? 39.533  -19.979 -17.639 1.00 42.14  ?  667  ALA B N     1 
ATOM   5657 C  CA    . ALA B 2 12  ? 39.441  -21.115 -16.733 1.00 52.58  ?  667  ALA B CA    1 
ATOM   5658 C  C     . ALA B 2 12  ? 38.815  -22.345 -17.379 1.00 50.59  ?  667  ALA B C     1 
ATOM   5659 O  O     . ALA B 2 12  ? 39.018  -23.457 -16.877 1.00 47.08  ?  667  ALA B O     1 
ATOM   5660 C  CB    . ALA B 2 12  ? 38.637  -20.724 -15.489 1.00 45.49  ?  667  ALA B CB    1 
ATOM   5661 N  N     . THR B 2 13  ? 38.071  -22.180 -18.472 1.00 49.16  ?  668  THR B N     1 
ATOM   5662 C  CA    . THR B 2 13  ? 37.363  -23.297 -19.086 1.00 53.12  ?  668  THR B CA    1 
ATOM   5663 C  C     . THR B 2 13  ? 38.299  -24.094 -19.987 1.00 48.52  ?  668  THR B C     1 
ATOM   5664 O  O     . THR B 2 13  ? 38.960  -23.533 -20.867 1.00 41.48  ?  668  THR B O     1 
ATOM   5665 C  CB    . THR B 2 13  ? 36.163  -22.800 -19.897 1.00 48.22  ?  668  THR B CB    1 
ATOM   5666 O  OG1   . THR B 2 13  ? 36.609  -21.909 -20.926 1.00 64.37  ?  668  THR B OG1   1 
ATOM   5667 C  CG2   . THR B 2 13  ? 35.164  -22.080 -19.002 1.00 51.19  ?  668  THR B CG2   1 
ATOM   5668 N  N     . GLY B 2 14  ? 38.346  -25.405 -19.770 1.00 46.54  ?  669  GLY B N     1 
ATOM   5669 C  CA    . GLY B 2 14  ? 39.131  -26.285 -20.607 1.00 43.83  ?  669  GLY B CA    1 
ATOM   5670 C  C     . GLY B 2 14  ? 40.559  -26.491 -20.165 1.00 43.51  ?  669  GLY B C     1 
ATOM   5671 O  O     . GLY B 2 14  ? 41.363  -27.015 -20.947 1.00 35.98  ?  669  GLY B O     1 
ATOM   5672 N  N     . ILE B 2 15  ? 40.904  -26.098 -18.941 1.00 34.88  ?  670  ILE B N     1 
ATOM   5673 C  CA    . ILE B 2 15  ? 42.243  -26.290 -18.401 1.00 42.05  ?  670  ILE B CA    1 
ATOM   5674 C  C     . ILE B 2 15  ? 42.106  -26.589 -16.917 1.00 39.79  ?  670  ILE B C     1 
ATOM   5675 O  O     . ILE B 2 15  ? 41.156  -26.152 -16.261 1.00 40.49  ?  670  ILE B O     1 
ATOM   5676 C  CB    . ILE B 2 15  ? 43.143  -25.055 -18.642 1.00 40.56  ?  670  ILE B CB    1 
ATOM   5677 C  CG1   . ILE B 2 15  ? 44.592  -25.359 -18.251 1.00 44.26  ?  670  ILE B CG1   1 
ATOM   5678 C  CG2   . ILE B 2 15  ? 42.617  -23.848 -17.867 1.00 41.55  ?  670  ILE B CG2   1 
ATOM   5679 C  CD1   . ILE B 2 15  ? 45.600  -24.369 -18.817 1.00 44.26  ?  670  ILE B CD1   1 
ATOM   5680 N  N     . THR B 2 16  ? 43.055  -27.350 -16.390 1.00 44.08  ?  671  THR B N     1 
ATOM   5681 C  CA    . THR B 2 16  ? 43.014  -27.688 -14.977 1.00 47.96  ?  671  THR B CA    1 
ATOM   5682 C  C     . THR B 2 16  ? 43.188  -26.420 -14.143 1.00 45.21  ?  671  THR B C     1 
ATOM   5683 O  O     . THR B 2 16  ? 43.954  -25.525 -14.523 1.00 44.49  ?  671  THR B O     1 
ATOM   5684 C  CB    . THR B 2 16  ? 44.102  -28.706 -14.635 1.00 49.45  ?  671  THR B CB    1 
ATOM   5685 O  OG1   . THR B 2 16  ? 45.378  -28.218 -15.070 1.00 46.72  ?  671  THR B OG1   1 
ATOM   5686 C  CG2   . THR B 2 16  ? 43.812  -30.042 -15.315 1.00 56.76  ?  671  THR B CG2   1 
ATOM   5687 N  N     . PRO B 2 17  ? 42.495  -26.299 -13.013 1.00 56.42  ?  672  PRO B N     1 
ATOM   5688 C  CA    . PRO B 2 17  ? 42.576  -25.057 -12.238 1.00 54.45  ?  672  PRO B CA    1 
ATOM   5689 C  C     . PRO B 2 17  ? 43.962  -24.851 -11.648 1.00 53.97  ?  672  PRO B C     1 
ATOM   5690 O  O     . PRO B 2 17  ? 44.787  -25.764 -11.575 1.00 52.95  ?  672  PRO B O     1 
ATOM   5691 C  CB    . PRO B 2 17  ? 41.530  -25.248 -11.133 1.00 66.15  ?  672  PRO B CB    1 
ATOM   5692 C  CG    . PRO B 2 17  ? 40.683  -26.396 -11.571 1.00 68.83  ?  672  PRO B CG    1 
ATOM   5693 C  CD    . PRO B 2 17  ? 41.572  -27.266 -12.394 1.00 54.60  ?  672  PRO B CD    1 
ATOM   5694 N  N     . PHE B 2 18  ? 44.208  -23.614 -11.226 1.00 52.97  ?  673  PHE B N     1 
ATOM   5695 C  CA    . PHE B 2 18  ? 45.432  -23.293 -10.508 1.00 57.39  ?  673  PHE B CA    1 
ATOM   5696 C  C     . PHE B 2 18  ? 45.330  -23.821 -9.083  1.00 53.07  ?  673  PHE B C     1 
ATOM   5697 O  O     . PHE B 2 18  ? 44.334  -23.583 -8.393  1.00 53.22  ?  673  PHE B O     1 
ATOM   5698 C  CB    . PHE B 2 18  ? 45.671  -21.783 -10.504 1.00 56.38  ?  673  PHE B CB    1 
ATOM   5699 C  CG    . PHE B 2 18  ? 46.845  -21.367 -9.672  1.00 45.16  ?  673  PHE B CG    1 
ATOM   5700 C  CD1   . PHE B 2 18  ? 48.130  -21.440 -10.180 1.00 41.58  ?  673  PHE B CD1   1 
ATOM   5701 C  CD2   . PHE B 2 18  ? 46.665  -20.915 -8.376  1.00 52.97  ?  673  PHE B CD2   1 
ATOM   5702 C  CE1   . PHE B 2 18  ? 49.214  -21.066 -9.414  1.00 49.19  ?  673  PHE B CE1   1 
ATOM   5703 C  CE2   . PHE B 2 18  ? 47.743  -20.540 -7.606  1.00 48.74  ?  673  PHE B CE2   1 
ATOM   5704 C  CZ    . PHE B 2 18  ? 49.021  -20.614 -8.124  1.00 50.63  ?  673  PHE B CZ    1 
ATOM   5705 N  N     . GLU B 2 19  ? 46.360  -24.539 -8.644  1.00 56.00  ?  674  GLU B N     1 
ATOM   5706 C  CA    . GLU B 2 19  ? 46.363  -25.194 -7.344  1.00 65.85  ?  674  GLU B CA    1 
ATOM   5707 C  C     . GLU B 2 19  ? 47.380  -24.533 -6.423  1.00 64.02  ?  674  GLU B C     1 
ATOM   5708 O  O     . GLU B 2 19  ? 48.470  -24.148 -6.859  1.00 65.97  ?  674  GLU B O     1 
ATOM   5709 C  CB    . GLU B 2 19  ? 46.684  -26.687 -7.485  1.00 82.26  ?  674  GLU B CB    1 
ATOM   5710 C  CG    . GLU B 2 19  ? 45.661  -27.483 -8.291  1.00 85.14  ?  674  GLU B CG    1 
ATOM   5711 C  CD    . GLU B 2 19  ? 44.351  -27.687 -7.548  1.00 98.76  ?  674  GLU B CD    1 
ATOM   5712 O  OE1   . GLU B 2 19  ? 44.205  -27.151 -6.430  1.00 104.41 ?  674  GLU B OE1   1 
ATOM   5713 O  OE2   . GLU B 2 19  ? 43.467  -28.389 -8.083  1.00 81.91  ?  674  GLU B OE2   1 
ATOM   5714 N  N     . PHE B 2 20  ? 47.014  -24.404 -5.147  1.00 65.02  ?  675  PHE B N     1 
ATOM   5715 C  CA    . PHE B 2 20  ? 47.925  -23.914 -4.112  1.00 57.31  ?  675  PHE B CA    1 
ATOM   5716 C  C     . PHE B 2 20  ? 48.820  -25.075 -3.693  1.00 57.41  ?  675  PHE B C     1 
ATOM   5717 O  O     . PHE B 2 20  ? 48.499  -25.843 -2.786  1.00 64.78  ?  675  PHE B O     1 
ATOM   5718 C  CB    . PHE B 2 20  ? 47.148  -23.355 -2.924  1.00 60.82  ?  675  PHE B CB    1 
ATOM   5719 C  CG    . PHE B 2 20  ? 46.232  -22.210 -3.270  1.00 62.81  ?  675  PHE B CG    1 
ATOM   5720 C  CD1   . PHE B 2 20  ? 46.476  -21.408 -4.372  1.00 63.58  ?  675  PHE B CD1   1 
ATOM   5721 C  CD2   . PHE B 2 20  ? 45.125  -21.935 -2.481  1.00 73.62  ?  675  PHE B CD2   1 
ATOM   5722 C  CE1   . PHE B 2 20  ? 45.633  -20.359 -4.683  1.00 64.07  ?  675  PHE B CE1   1 
ATOM   5723 C  CE2   . PHE B 2 20  ? 44.278  -20.886 -2.788  1.00 70.04  ?  675  PHE B CE2   1 
ATOM   5724 C  CZ    . PHE B 2 20  ? 44.533  -20.097 -3.891  1.00 67.58  ?  675  PHE B CZ    1 
ATOM   5725 N  N     . GLU B 2 21  ? 49.962  -25.201 -4.358  1.00 55.19  ?  676  GLU B N     1 
ATOM   5726 C  CA    . GLU B 2 21  ? 50.856  -26.330 -4.160  1.00 55.30  ?  676  GLU B CA    1 
ATOM   5727 C  C     . GLU B 2 21  ? 51.970  -25.981 -3.179  1.00 65.76  ?  676  GLU B C     1 
ATOM   5728 O  O     . GLU B 2 21  ? 52.338  -24.815 -3.013  1.00 62.18  ?  676  GLU B O     1 
ATOM   5729 C  CB    . GLU B 2 21  ? 51.451  -26.776 -5.498  1.00 65.62  ?  676  GLU B CB    1 
ATOM   5730 C  CG    . GLU B 2 21  ? 50.417  -27.366 -6.451  1.00 87.67  ?  676  GLU B CG    1 
ATOM   5731 C  CD    . GLU B 2 21  ? 50.929  -27.505 -7.873  1.00 97.79  ?  676  GLU B CD    1 
ATOM   5732 O  OE1   . GLU B 2 21  ? 51.814  -26.717 -8.271  1.00 103.52 ?  676  GLU B OE1   1 
ATOM   5733 O  OE2   . GLU B 2 21  ? 50.444  -28.403 -8.594  1.00 90.58  ?  676  GLU B OE2   1 
ATOM   5734 N  N     . ASN B 2 22  ? 52.503  -27.017 -2.526  1.00 55.25  ?  677  ASN B N     1 
ATOM   5735 C  CA    . ASN B 2 22  ? 53.589  -26.870 -1.555  1.00 50.57  ?  677  ASN B CA    1 
ATOM   5736 C  C     . ASN B 2 22  ? 53.174  -25.987 -0.379  1.00 53.73  ?  677  ASN B C     1 
ATOM   5737 O  O     . ASN B 2 22  ? 53.944  -25.146 0.090   1.00 50.51  ?  677  ASN B O     1 
ATOM   5738 C  CB    . ASN B 2 22  ? 54.856  -26.325 -2.220  1.00 58.09  ?  677  ASN B CB    1 
ATOM   5739 C  CG    . ASN B 2 22  ? 55.562  -27.366 -3.069  1.00 70.56  ?  677  ASN B CG    1 
ATOM   5740 O  OD1   . ASN B 2 22  ? 55.591  -28.547 -2.726  1.00 67.00  ?  677  ASN B OD1   1 
ATOM   5741 N  ND2   . ASN B 2 22  ? 56.141  -26.929 -4.182  1.00 70.72  ?  677  ASN B ND2   1 
ATOM   5742 N  N     . MET B 2 23  ? 51.951  -26.187 0.114   1.00 55.31  ?  678  MET B N     1 
ATOM   5743 C  CA    . MET B 2 23  ? 51.460  -25.428 1.259   1.00 51.99  ?  678  MET B CA    1 
ATOM   5744 C  C     . MET B 2 23  ? 52.430  -25.531 2.428   1.00 55.87  ?  678  MET B C     1 
ATOM   5745 O  O     . MET B 2 23  ? 53.206  -26.488 2.518   1.00 65.88  ?  678  MET B O     1 
ATOM   5746 C  CB    . MET B 2 23  ? 50.077  -25.924 1.680   1.00 56.76  ?  678  MET B CB    1 
ATOM   5747 C  CG    . MET B 2 23  ? 48.959  -25.552 0.719   1.00 64.59  ?  678  MET B CG    1 
ATOM   5748 S  SD    . MET B 2 23  ? 48.694  -23.773 0.572   1.00 69.19  ?  678  MET B SD    1 
ATOM   5749 C  CE    . MET B 2 23  ? 48.289  -23.325 2.259   1.00 55.41  ?  678  MET B CE    1 
ATOM   5750 N  N     . ALA B 2 24  ? 52.397  -24.552 3.328   1.00 70.49  ?  679  ALA B N     1 
ATOM   5751 C  CA    . ALA B 2 24  ? 53.307  -24.530 4.465   1.00 74.22  ?  679  ALA B CA    1 
ATOM   5752 C  C     . ALA B 2 24  ? 52.855  -23.440 5.426   1.00 77.78  ?  679  ALA B C     1 
ATOM   5753 O  O     . ALA B 2 24  ? 51.918  -22.686 5.149   1.00 70.32  ?  679  ALA B O     1 
ATOM   5754 C  CB    . ALA B 2 24  ? 54.754  -24.298 4.023   1.00 68.87  ?  679  ALA B CB    1 
ATOM   5755 N  N     . GLU B 2 25  ? 53.535  -23.376 6.569   1.00 87.62  ?  680  GLU B N     1 
ATOM   5756 C  CA    . GLU B 2 25  ? 53.305  -22.337 7.560   1.00 99.91  ?  680  GLU B CA    1 
ATOM   5757 C  C     . GLU B 2 25  ? 54.650  -21.859 8.086   1.00 100.32 ?  680  GLU B C     1 
ATOM   5758 O  O     . GLU B 2 25  ? 55.681  -22.511 7.897   1.00 82.56  ?  680  GLU B O     1 
ATOM   5759 C  CB    . GLU B 2 25  ? 52.425  -22.833 8.717   1.00 106.12 ?  680  GLU B CB    1 
ATOM   5760 C  CG    . GLU B 2 25  ? 50.958  -22.999 8.354   1.00 99.76  ?  680  GLU B CG    1 
ATOM   5761 C  CD    . GLU B 2 25  ? 50.100  -23.370 9.548   1.00 96.48  ?  680  GLU B CD    1 
ATOM   5762 O  OE1   . GLU B 2 25  ? 50.664  -23.793 10.579  1.00 93.81  ?  680  GLU B OE1   1 
ATOM   5763 O  OE2   . GLU B 2 25  ? 48.861  -23.234 9.458   1.00 103.27 ?  680  GLU B OE2   1 
ATOM   5764 N  N     . SER B 2 26  ? 54.627  -20.708 8.752   1.00 109.85 ?  681  SER B N     1 
ATOM   5765 C  CA    . SER B 2 26  ? 55.854  -20.098 9.245   1.00 104.52 ?  681  SER B CA    1 
ATOM   5766 C  C     . SER B 2 26  ? 56.590  -21.055 10.172  1.00 92.33  ?  681  SER B C     1 
ATOM   5767 O  O     . SER B 2 26  ? 56.042  -21.503 11.184  1.00 89.27  ?  681  SER B O     1 
ATOM   5768 C  CB    . SER B 2 26  ? 55.534  -18.793 9.973   1.00 102.64 ?  681  SER B CB    1 
ATOM   5769 O  OG    . SER B 2 26  ? 54.661  -19.019 11.065  1.00 120.35 ?  681  SER B OG    1 
ATOM   5770 N  N     . THR B 2 27  ? 57.836  -21.372 9.817   1.00 84.95  ?  682  THR B N     1 
ATOM   5771 C  CA    . THR B 2 27  ? 58.685  -22.194 10.668  1.00 95.31  ?  682  THR B CA    1 
ATOM   5772 C  C     . THR B 2 27  ? 59.158  -21.454 11.912  1.00 96.66  ?  682  THR B C     1 
ATOM   5773 O  O     . THR B 2 27  ? 59.682  -22.095 12.830  1.00 92.68  ?  682  THR B O     1 
ATOM   5774 C  CB    . THR B 2 27  ? 59.905  -22.680 9.880   1.00 101.11 ?  682  THR B CB    1 
ATOM   5775 O  OG1   . THR B 2 27  ? 60.650  -21.551 9.401   1.00 72.35  ?  682  THR B OG1   1 
ATOM   5776 C  CG2   . THR B 2 27  ? 59.476  -23.540 8.698   1.00 105.71 ?  682  THR B CG2   1 
ATOM   5777 N  N     . GLY B 2 28  ? 58.983  -20.134 11.967  1.00 98.70  ?  683  GLY B N     1 
ATOM   5778 C  CA    . GLY B 2 28  ? 59.555  -19.347 13.039  1.00 93.83  ?  683  GLY B CA    1 
ATOM   5779 C  C     . GLY B 2 28  ? 61.058  -19.212 12.980  1.00 78.70  ?  683  GLY B C     1 
ATOM   5780 O  O     . GLY B 2 28  ? 61.657  -18.691 13.925  1.00 73.84  ?  683  GLY B O     1 
ATOM   5781 N  N     . MET B 2 29  ? 61.686  -19.664 11.892  1.00 71.44  ?  684  MET B N     1 
ATOM   5782 C  CA    . MET B 2 29  ? 63.142  -19.635 11.801  1.00 69.98  ?  684  MET B CA    1 
ATOM   5783 C  C     . MET B 2 29  ? 63.668  -18.205 11.791  1.00 71.13  ?  684  MET B C     1 
ATOM   5784 O  O     . MET B 2 29  ? 64.612  -17.875 12.519  1.00 68.62  ?  684  MET B O     1 
ATOM   5785 C  CB    . MET B 2 29  ? 63.596  -20.380 10.545  1.00 61.34  ?  684  MET B CB    1 
ATOM   5786 C  CG    . MET B 2 29  ? 65.103  -20.407 10.346  1.00 66.80  ?  684  MET B CG    1 
ATOM   5787 S  SD    . MET B 2 29  ? 65.958  -21.373 11.604  1.00 76.18  ?  684  MET B SD    1 
ATOM   5788 C  CE    . MET B 2 29  ? 65.692  -23.039 10.991  1.00 69.70  ?  684  MET B CE    1 
ATOM   5789 N  N     . TYR B 2 30  ? 63.078  -17.340 10.964  1.00 69.64  ?  685  TYR B N     1 
ATOM   5790 C  CA    . TYR B 2 30  ? 63.607  -15.988 10.821  1.00 68.83  ?  685  TYR B CA    1 
ATOM   5791 C  C     . TYR B 2 30  ? 63.555  -15.237 12.145  1.00 63.23  ?  685  TYR B C     1 
ATOM   5792 O  O     . TYR B 2 30  ? 64.573  -14.718 12.617  1.00 63.07  ?  685  TYR B O     1 
ATOM   5793 C  CB    . TYR B 2 30  ? 62.837  -15.224 9.744   1.00 59.55  ?  685  TYR B CB    1 
ATOM   5794 C  CG    . TYR B 2 30  ? 63.475  -13.898 9.404   1.00 51.70  ?  685  TYR B CG    1 
ATOM   5795 C  CD1   . TYR B 2 30  ? 64.551  -13.831 8.529   1.00 55.81  ?  685  TYR B CD1   1 
ATOM   5796 C  CD2   . TYR B 2 30  ? 63.017  -12.717 9.973   1.00 55.03  ?  685  TYR B CD2   1 
ATOM   5797 C  CE1   . TYR B 2 30  ? 65.148  -12.625 8.221   1.00 56.58  ?  685  TYR B CE1   1 
ATOM   5798 C  CE2   . TYR B 2 30  ? 63.604  -11.503 9.668   1.00 54.96  ?  685  TYR B CE2   1 
ATOM   5799 C  CZ    . TYR B 2 30  ? 64.671  -11.464 8.792   1.00 59.97  ?  685  TYR B CZ    1 
ATOM   5800 O  OH    . TYR B 2 30  ? 65.263  -10.261 8.484   1.00 58.24  ?  685  TYR B OH    1 
ATOM   5801 N  N     . LEU B 2 31  ? 62.372  -15.162 12.759  1.00 64.55  ?  686  LEU B N     1 
ATOM   5802 C  CA    . LEU B 2 31  ? 62.253  -14.473 14.039  1.00 74.15  ?  686  LEU B CA    1 
ATOM   5803 C  C     . LEU B 2 31  ? 63.124  -15.107 15.116  1.00 73.37  ?  686  LEU B C     1 
ATOM   5804 O  O     . LEU B 2 31  ? 63.496  -14.424 16.077  1.00 76.52  ?  686  LEU B O     1 
ATOM   5805 C  CB    . LEU B 2 31  ? 60.793  -14.451 14.493  1.00 75.62  ?  686  LEU B CB    1 
ATOM   5806 C  CG    . LEU B 2 31  ? 59.826  -13.691 13.581  1.00 73.19  ?  686  LEU B CG    1 
ATOM   5807 C  CD1   . LEU B 2 31  ? 58.398  -13.824 14.089  1.00 78.69  ?  686  LEU B CD1   1 
ATOM   5808 C  CD2   . LEU B 2 31  ? 60.214  -12.219 13.459  1.00 74.73  ?  686  LEU B CD2   1 
ATOM   5809 N  N     . ARG B 2 32  ? 63.454  -16.394 14.982  1.00 73.86  ?  687  ARG B N     1 
ATOM   5810 C  CA    . ARG B 2 32  ? 64.395  -17.020 15.905  1.00 75.77  ?  687  ARG B CA    1 
ATOM   5811 C  C     . ARG B 2 32  ? 65.818  -16.541 15.642  1.00 70.65  ?  687  ARG B C     1 
ATOM   5812 O  O     . ARG B 2 32  ? 66.560  -16.235 16.582  1.00 70.44  ?  687  ARG B O     1 
ATOM   5813 C  CB    . ARG B 2 32  ? 64.299  -18.543 15.786  1.00 92.03  ?  687  ARG B CB    1 
ATOM   5814 C  CG    . ARG B 2 32  ? 65.302  -19.306 16.635  1.00 81.15  ?  687  ARG B CG    1 
ATOM   5815 C  CD    . ARG B 2 32  ? 64.886  -20.762 16.851  1.00 87.00  ?  687  ARG B CD    1 
ATOM   5816 N  NE    . ARG B 2 32  ? 64.609  -21.469 15.600  1.00 85.38  ?  687  ARG B NE    1 
ATOM   5817 C  CZ    . ARG B 2 32  ? 63.394  -21.680 15.093  1.00 84.54  ?  687  ARG B CZ    1 
ATOM   5818 N  NH1   . ARG B 2 32  ? 62.308  -21.245 15.721  1.00 84.13  ?  687  ARG B NH1   1 
ATOM   5819 N  NH2   . ARG B 2 32  ? 63.265  -22.335 13.947  1.00 78.98  ?  687  ARG B NH2   1 
ATOM   5820 N  N     . ILE B 2 33  ? 66.215  -16.467 14.369  1.00 64.32  ?  688  ILE B N     1 
ATOM   5821 C  CA    . ILE B 2 33  ? 67.527  -15.925 14.029  1.00 66.41  ?  688  ILE B CA    1 
ATOM   5822 C  C     . ILE B 2 33  ? 67.598  -14.447 14.391  1.00 67.63  ?  688  ILE B C     1 
ATOM   5823 O  O     . ILE B 2 33  ? 68.647  -13.944 14.808  1.00 69.37  ?  688  ILE B O     1 
ATOM   5824 C  CB    . ILE B 2 33  ? 67.830  -16.155 12.536  1.00 63.11  ?  688  ILE B CB    1 
ATOM   5825 C  CG1   . ILE B 2 33  ? 67.957  -17.654 12.249  1.00 59.31  ?  688  ILE B CG1   1 
ATOM   5826 C  CG2   . ILE B 2 33  ? 69.103  -15.410 12.122  1.00 50.63  ?  688  ILE B CG2   1 
ATOM   5827 C  CD1   . ILE B 2 33  ? 68.054  -17.996 10.777  1.00 57.35  ?  688  ILE B CD1   1 
ATOM   5828 N  N     . ARG B 2 34  ? 66.483  -13.730 14.242  1.00 70.65  ?  689  ARG B N     1 
ATOM   5829 C  CA    . ARG B 2 34  ? 66.481  -12.295 14.503  1.00 74.80  ?  689  ARG B CA    1 
ATOM   5830 C  C     . ARG B 2 34  ? 66.739  -11.998 15.975  1.00 85.93  ?  689  ARG B C     1 
ATOM   5831 O  O     . ARG B 2 34  ? 67.419  -11.019 16.305  1.00 88.59  ?  689  ARG B O     1 
ATOM   5832 C  CB    . ARG B 2 34  ? 65.149  -11.689 14.060  1.00 86.96  ?  689  ARG B CB    1 
ATOM   5833 C  CG    . ARG B 2 34  ? 65.118  -10.171 14.078  1.00 91.19  ?  689  ARG B CG    1 
ATOM   5834 C  CD    . ARG B 2 34  ? 63.706  -9.650  13.887  1.00 100.30 ?  689  ARG B CD    1 
ATOM   5835 N  NE    . ARG B 2 34  ? 63.635  -8.199  14.025  1.00 116.70 ?  689  ARG B NE    1 
ATOM   5836 C  CZ    . ARG B 2 34  ? 62.502  -7.509  14.101  1.00 118.80 ?  689  ARG B CZ    1 
ATOM   5837 N  NH1   . ARG B 2 34  ? 61.332  -8.136  14.058  1.00 99.76  ?  689  ARG B NH1   1 
ATOM   5838 N  NH2   . ARG B 2 34  ? 62.537  -6.189  14.226  1.00 110.13 ?  689  ARG B NH2   1 
ATOM   5839 N  N     . SER B 2 35  ? 66.203  -12.827 16.875  1.00 86.32  ?  690  SER B N     1 
ATOM   5840 C  CA    . SER B 2 35  ? 66.409  -12.599 18.302  1.00 85.68  ?  690  SER B CA    1 
ATOM   5841 C  C     . SER B 2 35  ? 67.881  -12.728 18.676  1.00 93.24  ?  690  SER B C     1 
ATOM   5842 O  O     . SER B 2 35  ? 68.371  -12.009 19.554  1.00 105.16 ?  690  SER B O     1 
ATOM   5843 C  CB    . SER B 2 35  ? 65.563  -13.575 19.117  1.00 84.53  ?  690  SER B CB    1 
ATOM   5844 O  OG    . SER B 2 35  ? 64.184  -13.271 19.000  1.00 117.30 ?  690  SER B OG    1 
ATOM   5845 N  N     . LEU B 2 36  ? 68.603  -13.640 18.022  1.00 84.71  ?  691  LEU B N     1 
ATOM   5846 C  CA    . LEU B 2 36  ? 70.029  -13.791 18.290  1.00 79.52  ?  691  LEU B CA    1 
ATOM   5847 C  C     . LEU B 2 36  ? 70.830  -12.559 17.892  1.00 77.07  ?  691  LEU B C     1 
ATOM   5848 O  O     . LEU B 2 36  ? 71.983  -12.424 18.315  1.00 81.56  ?  691  LEU B O     1 
ATOM   5849 C  CB    . LEU B 2 36  ? 70.581  -15.006 17.545  1.00 68.39  ?  691  LEU B CB    1 
ATOM   5850 C  CG    . LEU B 2 36  ? 69.889  -16.342 17.800  1.00 59.50  ?  691  LEU B CG    1 
ATOM   5851 C  CD1   . LEU B 2 36  ? 70.585  -17.441 17.011  1.00 65.20  ?  691  LEU B CD1   1 
ATOM   5852 C  CD2   . LEU B 2 36  ? 69.872  -16.666 19.284  1.00 71.73  ?  691  LEU B CD2   1 
ATOM   5853 N  N     . LEU B 2 37  ? 70.252  -11.665 17.096  1.00 82.26  ?  692  LEU B N     1 
ATOM   5854 C  CA    . LEU B 2 37  ? 70.957  -10.511 16.543  1.00 92.72  ?  692  LEU B CA    1 
ATOM   5855 C  C     . LEU B 2 37  ? 70.340  -9.238  17.114  1.00 108.76 ?  692  LEU B C     1 
ATOM   5856 O  O     . LEU B 2 37  ? 69.719  -8.456  16.391  1.00 121.16 ?  692  LEU B O     1 
ATOM   5857 C  CB    . LEU B 2 37  ? 70.895  -10.537 15.011  1.00 79.07  ?  692  LEU B CB    1 
ATOM   5858 C  CG    . LEU B 2 37  ? 71.557  -11.777 14.408  1.00 75.76  ?  692  LEU B CG    1 
ATOM   5859 C  CD1   . LEU B 2 37  ? 71.202  -11.944 12.947  1.00 72.17  ?  692  LEU B CD1   1 
ATOM   5860 C  CD2   . LEU B 2 37  ? 73.066  -11.701 14.580  1.00 82.33  ?  692  LEU B CD2   1 
ATOM   5861 N  N     . LYS B 2 38  ? 70.508  -9.039  18.423  1.00 109.91 ?  693  LYS B N     1 
ATOM   5862 C  CA    . LYS B 2 38  ? 70.057  -7.823  19.089  1.00 118.51 ?  693  LYS B CA    1 
ATOM   5863 C  C     . LYS B 2 38  ? 71.115  -6.726  19.051  1.00 126.65 ?  693  LYS B C     1 
ATOM   5864 O  O     . LYS B 2 38  ? 70.782  -5.554  18.839  1.00 122.47 ?  693  LYS B O     1 
ATOM   5865 C  CB    . LYS B 2 38  ? 69.684  -8.129  20.542  1.00 111.07 ?  693  LYS B CB    1 
ATOM   5866 C  CG    . LYS B 2 38  ? 68.439  -8.984  20.700  1.00 110.14 ?  693  LYS B CG    1 
ATOM   5867 C  CD    . LYS B 2 38  ? 68.407  -9.666  22.060  1.00 113.02 ?  693  LYS B CD    1 
ATOM   5868 C  CE    . LYS B 2 38  ? 67.212  -10.597 22.195  1.00 103.10 ?  693  LYS B CE    1 
ATOM   5869 N  NZ    . LYS B 2 38  ? 67.371  -11.548 23.332  1.00 101.40 ?  693  LYS B NZ    1 
ATOM   5870 N  N     . ASN B 2 39  ? 72.384  -7.084  19.250  1.00 132.44 ?  694  ASN B N     1 
ATOM   5871 C  CA    . ASN B 2 39  ? 73.470  -6.111  19.252  1.00 132.70 ?  694  ASN B CA    1 
ATOM   5872 C  C     . ASN B 2 39  ? 74.458  -6.393  18.127  1.00 134.91 ?  694  ASN B C     1 
ATOM   5873 O  O     . ASN B 2 39  ? 75.652  -6.597  18.374  1.00 109.31 ?  694  ASN B O     1 
ATOM   5874 C  CB    . ASN B 2 39  ? 74.189  -6.117  20.604  1.00 133.46 ?  694  ASN B CB    1 
ATOM   5875 C  CG    . ASN B 2 39  ? 73.376  -5.456  21.699  1.00 137.71 ?  694  ASN B CG    1 
ATOM   5876 O  OD1   . ASN B 2 39  ? 72.956  -6.106  22.657  1.00 127.95 ?  694  ASN B OD1   1 
ATOM   5877 N  ND2   . ASN B 2 39  ? 73.153  -4.153  21.564  1.00 120.00 ?  694  ASN B ND2   1 
ATOM   5878 N  N     . SER B 2 40  ? 73.971  -6.407  16.894  1.00 139.15 ?  695  SER B N     1 
ATOM   5879 C  CA    . SER B 2 40  ? 74.824  -6.578  15.730  1.00 109.17 ?  695  SER B CA    1 
ATOM   5880 C  C     . SER B 2 40  ? 75.351  -5.229  15.260  1.00 107.04 ?  695  SER B C     1 
ATOM   5881 O  O     . SER B 2 40  ? 74.835  -4.177  15.652  1.00 107.15 ?  695  SER B O     1 
ATOM   5882 C  CB    . SER B 2 40  ? 74.046  -7.261  14.608  1.00 106.10 ?  695  SER B CB    1 
ATOM   5883 O  OG    . SER B 2 40  ? 72.884  -6.525  14.267  1.00 100.27 ?  695  SER B OG    1 
ATOM   5884 N  N     . PRO B 2 41  ? 76.390  -5.221  14.421  1.00 97.47  ?  696  PRO B N     1 
ATOM   5885 C  CA    . PRO B 2 41  ? 76.932  -3.937  13.944  1.00 95.90  ?  696  PRO B CA    1 
ATOM   5886 C  C     . PRO B 2 41  ? 75.892  -3.027  13.312  1.00 97.11  ?  696  PRO B C     1 
ATOM   5887 O  O     . PRO B 2 41  ? 76.035  -1.799  13.380  1.00 101.82 ?  696  PRO B O     1 
ATOM   5888 C  CB    . PRO B 2 41  ? 77.998  -4.369  12.927  1.00 79.42  ?  696  PRO B CB    1 
ATOM   5889 C  CG    . PRO B 2 41  ? 78.420  -5.724  13.380  1.00 76.41  ?  696  PRO B CG    1 
ATOM   5890 C  CD    . PRO B 2 41  ? 77.189  -6.368  13.952  1.00 80.91  ?  696  PRO B CD    1 
ATOM   5891 N  N     . ARG B 2 42  ? 74.848  -3.585  12.698  1.00 95.87  ?  697  ARG B N     1 
ATOM   5892 C  CA    . ARG B 2 42  ? 73.812  -2.771  12.076  1.00 103.59 ?  697  ARG B CA    1 
ATOM   5893 C  C     . ARG B 2 42  ? 72.726  -2.353  13.057  1.00 111.15 ?  697  ARG B C     1 
ATOM   5894 O  O     . ARG B 2 42  ? 72.157  -1.265  12.911  1.00 108.99 ?  697  ARG B O     1 
ATOM   5895 C  CB    . ARG B 2 42  ? 73.173  -3.526  10.908  1.00 90.95  ?  697  ARG B CB    1 
ATOM   5896 C  CG    . ARG B 2 42  ? 72.172  -2.696  10.119  1.00 107.12 ?  697  ARG B CG    1 
ATOM   5897 C  CD    . ARG B 2 42  ? 71.771  -3.383  8.825   1.00 112.44 ?  697  ARG B CD    1 
ATOM   5898 N  NE    . ARG B 2 42  ? 71.318  -2.428  7.816   1.00 143.55 ?  697  ARG B NE    1 
ATOM   5899 C  CZ    . ARG B 2 42  ? 71.020  -2.747  6.560   1.00 129.73 ?  697  ARG B CZ    1 
ATOM   5900 N  NH1   . ARG B 2 42  ? 71.121  -4.003  6.144   1.00 98.20  ?  697  ARG B NH1   1 
ATOM   5901 N  NH2   . ARG B 2 42  ? 70.619  -1.805  5.716   1.00 132.33 ?  697  ARG B NH2   1 
ATOM   5902 N  N     . ASN B 2 43  ? 72.421  -3.191  14.051  1.00 117.00 ?  698  ASN B N     1 
ATOM   5903 C  CA    . ASN B 2 43  ? 71.416  -2.823  15.041  1.00 121.06 ?  698  ASN B CA    1 
ATOM   5904 C  C     . ASN B 2 43  ? 71.931  -1.748  15.991  1.00 119.93 ?  698  ASN B C     1 
ATOM   5905 O  O     . ASN B 2 43  ? 71.139  -0.956  16.514  1.00 123.09 ?  698  ASN B O     1 
ATOM   5906 C  CB    . ASN B 2 43  ? 70.972  -4.057  15.828  1.00 112.35 ?  698  ASN B CB    1 
ATOM   5907 C  CG    . ASN B 2 43  ? 69.984  -4.916  15.060  1.00 119.41 ?  698  ASN B CG    1 
ATOM   5908 O  OD1   . ASN B 2 43  ? 70.210  -6.107  14.852  1.00 129.58 ?  698  ASN B OD1   1 
ATOM   5909 N  ND2   . ASN B 2 43  ? 68.878  -4.312  14.636  1.00 97.02  ?  698  ASN B ND2   1 
ATOM   5910 N  N     . GLN B 2 44  ? 73.244  -1.702  16.227  1.00 114.69 ?  699  GLN B N     1 
ATOM   5911 C  CA    . GLN B 2 44  ? 73.807  -0.675  17.095  1.00 112.04 ?  699  GLN B CA    1 
ATOM   5912 C  C     . GLN B 2 44  ? 73.934  0.666   16.382  1.00 113.90 ?  699  GLN B C     1 
ATOM   5913 O  O     . GLN B 2 44  ? 73.834  1.716   17.026  1.00 111.31 ?  699  GLN B O     1 
ATOM   5914 C  CB    . GLN B 2 44  ? 75.173  -1.122  17.620  1.00 120.19 ?  699  GLN B CB    1 
ATOM   5915 C  CG    . GLN B 2 44  ? 76.230  -1.302  16.540  1.00 126.42 ?  699  GLN B CG    1 
ATOM   5916 C  CD    . GLN B 2 44  ? 77.513  -1.912  17.074  1.00 121.46 ?  699  GLN B CD    1 
ATOM   5917 O  OE1   . GLN B 2 44  ? 77.500  -2.989  17.673  1.00 100.10 ?  699  GLN B OE1   1 
ATOM   5918 N  NE2   . GLN B 2 44  ? 78.628  -1.224  16.863  1.00 112.99 ?  699  GLN B NE2   1 
ATOM   5919 N  N     . GLN B 2 45  ? 74.148  0.653   15.069  1.00 117.06 ?  700  GLN B N     1 
ATOM   5920 C  CA    . GLN B 2 45  ? 74.253  1.885   14.295  1.00 120.47 ?  700  GLN B CA    1 
ATOM   5921 C  C     . GLN B 2 45  ? 72.893  2.287   13.730  1.00 104.93 ?  700  GLN B C     1 
ATOM   5922 O  O     . GLN B 2 45  ? 71.917  2.423   14.469  1.00 88.02  ?  700  GLN B O     1 
ATOM   5923 C  CB    . GLN B 2 45  ? 75.266  1.720   13.161  1.00 121.87 ?  700  GLN B CB    1 
HETATM 5924 P  PB    . ADP C 3 .   ? 65.469  0.535   -3.247  0.70 87.36  ?  1101 ADP A PB    1 
HETATM 5925 O  O1B   . ADP C 3 .   ? 64.712  1.505   -4.119  0.70 73.59  ?  1101 ADP A O1B   1 
HETATM 5926 O  O2B   . ADP C 3 .   ? 66.867  0.232   -3.728  0.70 78.93  ?  1101 ADP A O2B   1 
HETATM 5927 O  O3B   . ADP C 3 .   ? 64.650  -0.667  -2.832  0.70 72.79  ?  1101 ADP A O3B   1 
HETATM 5928 P  PA    . ADP C 3 .   ? 65.198  0.732   -0.467  0.70 104.20 ?  1101 ADP A PA    1 
HETATM 5929 O  O1A   . ADP C 3 .   ? 63.696  0.892   -0.410  0.70 77.98  ?  1101 ADP A O1A   1 
HETATM 5930 O  O2A   . ADP C 3 .   ? 65.830  -0.632  -0.322  0.70 98.07  ?  1101 ADP A O2A   1 
HETATM 5931 O  O3A   . ADP C 3 .   ? 65.722  1.328   -1.868  0.70 93.17  ?  1101 ADP A O3A   1 
HETATM 5932 O  "O5'" . ADP C 3 .   ? 65.874  1.734   0.602   0.70 95.58  ?  1101 ADP A "O5'" 1 
HETATM 5933 C  "C5'" . ADP C 3 .   ? 67.015  1.346   1.370   0.70 81.36  ?  1101 ADP A "C5'" 1 
HETATM 5934 C  "C4'" . ADP C 3 .   ? 66.965  1.986   2.751   0.70 85.45  ?  1101 ADP A "C4'" 1 
HETATM 5935 O  "O4'" . ADP C 3 .   ? 66.746  3.394   2.639   0.70 85.36  ?  1101 ADP A "O4'" 1 
HETATM 5936 C  "C3'" . ADP C 3 .   ? 65.833  1.422   3.599   0.70 94.72  ?  1101 ADP A "C3'" 1 
HETATM 5937 O  "O3'" . ADP C 3 .   ? 66.355  1.001   4.863   0.70 78.50  ?  1101 ADP A "O3'" 1 
HETATM 5938 C  "C2'" . ADP C 3 .   ? 64.840  2.559   3.769   0.70 102.69 ?  1101 ADP A "C2'" 1 
HETATM 5939 O  "O2'" . ADP C 3 .   ? 64.275  2.571   5.081   0.70 94.29  ?  1101 ADP A "O2'" 1 
HETATM 5940 C  "C1'" . ADP C 3 .   ? 65.672  3.804   3.495   0.70 97.20  ?  1101 ADP A "C1'" 1 
HETATM 5941 N  N9    . ADP C 3 .   ? 64.952  4.918   2.830   0.70 77.45  ?  1101 ADP A N9    1 
HETATM 5942 C  C8    . ADP C 3 .   ? 64.146  4.843   1.751   0.70 68.56  ?  1101 ADP A C8    1 
HETATM 5943 N  N7    . ADP C 3 .   ? 63.679  6.076   1.419   0.70 55.47  ?  1101 ADP A N7    1 
HETATM 5944 C  C5    . ADP C 3 .   ? 64.197  6.957   2.294   0.70 64.93  ?  1101 ADP A C5    1 
HETATM 5945 C  C6    . ADP C 3 .   ? 64.119  8.417   2.518   0.70 61.43  ?  1101 ADP A C6    1 
HETATM 5946 N  N6    . ADP C 3 .   ? 63.365  9.186   1.706   0.70 53.02  ?  1101 ADP A N6    1 
HETATM 5947 N  N1    . ADP C 3 .   ? 64.817  8.944   3.549   0.70 61.71  ?  1101 ADP A N1    1 
HETATM 5948 C  C2    . ADP C 3 .   ? 65.571  8.180   4.363   0.70 67.33  ?  1101 ADP A C2    1 
HETATM 5949 N  N3    . ADP C 3 .   ? 65.684  6.847   4.213   0.70 67.73  ?  1101 ADP A N3    1 
HETATM 5950 C  C4    . ADP C 3 .   ? 65.034  6.190   3.221   0.70 72.62  ?  1101 ADP A C4    1 
HETATM 5951 MG MG    . MG  D 4 .   ? 70.095  8.550   -20.047 1.00 68.81  ?  1102 MG  A MG    1 
HETATM 5952 MG MG    . MG  E 4 .   ? 41.495  -18.625 -29.034 1.00 36.31  ?  1103 MG  A MG    1 
HETATM 5953 C  C1    . MLI F 5 .   ? 62.739  -24.513 -32.045 1.00 79.53  ?  1104 MLI A C1    1 
HETATM 5954 C  C2    . MLI F 5 .   ? 62.120  -23.200 -32.522 1.00 89.77  ?  1104 MLI A C2    1 
HETATM 5955 C  C3    . MLI F 5 .   ? 61.880  -25.116 -30.935 1.00 83.79  ?  1104 MLI A C3    1 
HETATM 5956 O  O6    . MLI F 5 .   ? 62.814  -22.373 -33.172 1.00 75.22  ?  1104 MLI A O6    1 
HETATM 5957 O  O7    . MLI F 5 .   ? 60.915  -22.944 -32.266 1.00 85.58  ?  1104 MLI A O7    1 
HETATM 5958 O  O8    . MLI F 5 .   ? 61.637  -26.353 -30.930 1.00 80.27  ?  1104 MLI A O8    1 
HETATM 5959 O  O9    . MLI F 5 .   ? 61.412  -24.378 -30.027 1.00 74.29  ?  1104 MLI A O9    1 
HETATM 5960 C  C1    . MLI G 5 .   ? 64.739  -19.046 -9.112  1.00 62.24  ?  1105 MLI A C1    1 
HETATM 5961 C  C2    . MLI G 5 .   ? 65.276  -20.118 -10.063 1.00 85.53  ?  1105 MLI A C2    1 
HETATM 5962 C  C3    . MLI G 5 .   ? 65.701  -18.897 -7.935  1.00 76.36  ?  1105 MLI A C3    1 
HETATM 5963 O  O6    . MLI G 5 .   ? 65.925  -19.782 -11.089 1.00 72.60  ?  1105 MLI A O6    1 
HETATM 5964 O  O7    . MLI G 5 .   ? 65.078  -21.340 -9.824  1.00 78.44  ?  1105 MLI A O7    1 
HETATM 5965 O  O8    . MLI G 5 .   ? 66.871  -19.357 -8.018  1.00 101.97 ?  1105 MLI A O8    1 
HETATM 5966 O  O9    . MLI G 5 .   ? 65.325  -18.315 -6.884  1.00 60.07  ?  1105 MLI A O9    1 
HETATM 5967 C  C1    . MLI H 5 .   ? 76.453  -16.406 -11.251 1.00 87.90  ?  1106 MLI A C1    1 
HETATM 5968 C  C2    . MLI H 5 .   ? 77.667  -17.131 -11.833 1.00 85.55  ?  1106 MLI A C2    1 
HETATM 5969 C  C3    . MLI H 5 .   ? 75.908  -17.170 -10.044 1.00 74.14  ?  1106 MLI A C3    1 
HETATM 5970 O  O6    . MLI H 5 .   ? 78.436  -16.530 -12.632 1.00 66.60  ?  1106 MLI A O6    1 
HETATM 5971 O  O7    . MLI H 5 .   ? 77.901  -18.330 -11.521 1.00 71.59  ?  1106 MLI A O7    1 
HETATM 5972 O  O8    . MLI H 5 .   ? 74.682  -17.113 -9.759  1.00 73.85  ?  1106 MLI A O8    1 
HETATM 5973 O  O9    . MLI H 5 .   ? 76.684  -17.855 -9.327  1.00 56.62  ?  1106 MLI A O9    1 
HETATM 5974 C  C1    . MLI I 5 .   ? 34.924  -25.281 -30.828 1.00 85.31  ?  1107 MLI A C1    1 
HETATM 5975 C  C2    . MLI I 5 .   ? 35.865  -24.117 -30.516 1.00 96.07  ?  1107 MLI A C2    1 
HETATM 5976 C  C3    . MLI I 5 .   ? 33.516  -24.747 -31.090 1.00 88.55  ?  1107 MLI A C3    1 
HETATM 5977 O  O6    . MLI I 5 .   ? 36.365  -23.440 -31.454 1.00 90.47  ?  1107 MLI A O6    1 
HETATM 5978 O  O7    . MLI I 5 .   ? 36.143  -23.830 -29.322 1.00 89.49  ?  1107 MLI A O7    1 
HETATM 5979 O  O8    . MLI I 5 .   ? 33.169  -24.443 -32.261 1.00 91.04  ?  1107 MLI A O8    1 
HETATM 5980 O  O9    . MLI I 5 .   ? 32.702  -24.612 -30.137 1.00 88.58  ?  1107 MLI A O9    1 
HETATM 5981 O  O1    . TLA J 6 .   ? 61.624  9.827   -19.218 1.00 67.13  ?  1108 TLA A O1    1 
HETATM 5982 O  O11   . TLA J 6 .   ? 63.465  10.789  -18.556 1.00 70.91  ?  1108 TLA A O11   1 
HETATM 5983 C  C1    . TLA J 6 .   ? 62.875  9.962   -19.301 1.00 81.68  ?  1108 TLA A C1    1 
HETATM 5984 C  C2    . TLA J 6 .   ? 63.677  9.128   -20.305 1.00 89.59  ?  1108 TLA A C2    1 
HETATM 5985 O  O2    . TLA J 6 .   ? 64.143  7.954   -19.691 1.00 68.56  ?  1108 TLA A O2    1 
HETATM 5986 C  C3    . TLA J 6 .   ? 64.855  9.950   -20.835 1.00 83.28  ?  1108 TLA A C3    1 
HETATM 5987 O  O3    . TLA J 6 .   ? 64.501  11.304  -20.865 1.00 78.66  ?  1108 TLA A O3    1 
HETATM 5988 C  C4    . TLA J 6 .   ? 66.084  9.787   -19.942 1.00 66.64  ?  1108 TLA A C4    1 
HETATM 5989 O  O4    . TLA J 6 .   ? 67.108  9.196   -20.377 1.00 66.88  ?  1108 TLA A O4    1 
HETATM 5990 O  O41   . TLA J 6 .   ? 66.079  10.253  -18.773 1.00 67.57  ?  1108 TLA A O41   1 
HETATM 5991 O  O     . HOH K 7 .   ? 45.083  -28.632 -19.562 1.00 39.83  ?  1201 HOH A O     1 
HETATM 5992 O  O     . HOH K 7 .   ? 45.125  -17.947 3.466   1.00 55.78  ?  1202 HOH A O     1 
HETATM 5993 O  O     . HOH K 7 .   ? 72.705  -17.834 -9.483  1.00 61.57  ?  1203 HOH A O     1 
HETATM 5994 O  O     . HOH K 7 .   ? 68.448  -32.665 6.064   1.00 45.88  ?  1204 HOH A O     1 
HETATM 5995 O  O     . HOH K 7 .   ? 72.572  -21.941 -5.214  1.00 48.71  ?  1205 HOH A O     1 
HETATM 5996 O  O     . HOH K 7 .   ? 63.910  -30.918 3.580   1.00 43.88  ?  1206 HOH A O     1 
HETATM 5997 O  O     . HOH K 7 .   ? 63.915  -48.460 -11.355 1.00 61.31  ?  1207 HOH A O     1 
HETATM 5998 O  O     . HOH K 7 .   ? 59.064  16.835  -14.586 1.00 35.71  ?  1208 HOH A O     1 
HETATM 5999 O  O     . HOH K 7 .   ? 64.135  13.222  -6.076  1.00 36.01  ?  1209 HOH A O     1 
HETATM 6000 O  O     . HOH K 7 .   ? 52.273  -15.118 5.875   1.00 51.63  ?  1210 HOH A O     1 
HETATM 6001 O  O     . HOH K 7 .   ? 65.567  -17.820 -0.239  1.00 47.79  ?  1211 HOH A O     1 
HETATM 6002 O  O     . HOH K 7 .   ? 42.955  11.814  -10.249 1.00 39.35  ?  1212 HOH A O     1 
HETATM 6003 O  O     . HOH K 7 .   ? 43.666  8.914   1.213   1.00 42.71  ?  1213 HOH A O     1 
HETATM 6004 O  O     . HOH K 7 .   ? 81.601  -33.656 -5.996  1.00 61.83  ?  1214 HOH A O     1 
HETATM 6005 O  O     . HOH K 7 .   ? 60.576  5.313   -40.388 1.00 43.57  ?  1215 HOH A O     1 
HETATM 6006 O  O     . HOH K 7 .   ? 45.781  -3.258  -16.637 1.00 39.93  ?  1216 HOH A O     1 
HETATM 6007 O  O     . HOH K 7 .   ? 65.495  8.205   -0.835  1.00 60.83  ?  1217 HOH A O     1 
HETATM 6008 O  O     . HOH K 7 .   ? 43.681  5.181   -14.847 1.00 40.55  ?  1218 HOH A O     1 
HETATM 6009 O  O     . HOH K 7 .   ? 71.295  -0.739  -12.117 1.00 58.78  ?  1219 HOH A O     1 
HETATM 6010 O  O     . HOH K 7 .   ? 71.146  -5.283  -1.572  1.00 51.23  ?  1220 HOH A O     1 
HETATM 6011 O  O     . HOH K 7 .   ? 60.049  -27.662 -29.596 1.00 54.81  ?  1221 HOH A O     1 
HETATM 6012 O  O     . HOH K 7 .   ? 60.107  -19.767 -2.897  1.00 57.21  ?  1222 HOH A O     1 
HETATM 6013 O  O     . HOH K 7 .   ? 65.033  -23.380 -8.426  1.00 61.72  ?  1223 HOH A O     1 
HETATM 6014 O  O     . HOH K 7 .   ? 49.541  -3.599  -31.105 1.00 42.94  ?  1224 HOH A O     1 
HETATM 6015 O  O     . HOH K 7 .   ? 62.856  -33.962 4.246   1.00 47.89  ?  1225 HOH A O     1 
HETATM 6016 O  O     . HOH K 7 .   ? 63.135  -2.307  -6.573  1.00 41.12  ?  1226 HOH A O     1 
HETATM 6017 O  O     . HOH K 7 .   ? 84.488  -12.496 -5.547  1.00 39.19  ?  1227 HOH A O     1 
HETATM 6018 O  O     . HOH K 7 .   ? 62.295  21.283  -11.747 1.00 52.82  ?  1228 HOH A O     1 
HETATM 6019 O  O     . HOH K 7 .   ? 46.469  4.453   -15.150 1.00 33.27  ?  1229 HOH A O     1 
HETATM 6020 O  O     . HOH K 7 .   ? 59.592  -26.723 -33.081 1.00 48.83  ?  1230 HOH A O     1 
HETATM 6021 O  O     . HOH K 7 .   ? 57.102  15.859  -5.916  1.00 57.33  ?  1231 HOH A O     1 
HETATM 6022 O  O     . HOH K 7 .   ? 60.282  15.561  -19.805 1.00 50.39  ?  1232 HOH A O     1 
HETATM 6023 O  O     . HOH K 7 .   ? 83.808  -0.211  8.784   1.00 44.42  ?  1233 HOH A O     1 
HETATM 6024 O  O     . HOH K 7 .   ? 70.351  -34.391 -16.453 1.00 45.27  ?  1234 HOH A O     1 
HETATM 6025 O  O     . HOH K 7 .   ? 70.527  -23.787 -5.611  1.00 46.31  ?  1235 HOH A O     1 
HETATM 6026 O  O     . HOH K 7 .   ? 78.191  -6.588  6.220   1.00 44.87  ?  1236 HOH A O     1 
HETATM 6027 O  O     . HOH K 7 .   ? 64.131  -6.654  -27.969 1.00 52.36  ?  1237 HOH A O     1 
HETATM 6028 O  O     . HOH K 7 .   ? 63.425  18.709  -4.331  1.00 64.50  ?  1238 HOH A O     1 
HETATM 6029 O  O     . HOH K 7 .   ? 50.604  -31.164 -9.990  1.00 43.78  ?  1239 HOH A O     1 
HETATM 6030 O  O     . HOH K 7 .   ? 50.144  15.039  -14.196 1.00 39.09  ?  1240 HOH A O     1 
HETATM 6031 O  O     . HOH K 7 .   ? 53.958  9.512   -28.486 1.00 48.72  ?  1241 HOH A O     1 
HETATM 6032 O  O     . HOH K 7 .   ? 55.774  -18.409 -21.960 1.00 42.28  ?  1242 HOH A O     1 
HETATM 6033 O  O     . HOH K 7 .   ? 54.527  -45.524 -9.882  1.00 55.34  ?  1243 HOH A O     1 
HETATM 6034 O  O     . HOH K 7 .   ? 38.491  -24.789 -28.678 1.00 41.96  ?  1244 HOH A O     1 
HETATM 6035 O  O     . HOH K 7 .   ? 44.346  8.134   -1.622  1.00 45.90  ?  1245 HOH A O     1 
HETATM 6036 O  O     . HOH K 7 .   ? 61.970  18.405  -11.932 1.00 46.43  ?  1246 HOH A O     1 
HETATM 6037 O  O     . HOH K 7 .   ? 60.601  -27.111 -6.434  1.00 51.91  ?  1247 HOH A O     1 
HETATM 6038 O  O     . HOH K 7 .   ? 45.862  -18.160 -34.669 1.00 56.13  ?  1248 HOH A O     1 
HETATM 6039 O  O     . HOH K 7 .   ? 78.864  -30.073 0.589   1.00 44.21  ?  1249 HOH A O     1 
HETATM 6040 O  O     . HOH K 7 .   ? 60.980  -26.395 -13.639 1.00 48.15  ?  1250 HOH A O     1 
HETATM 6041 O  O     . HOH K 7 .   ? 66.953  -22.690 3.556   1.00 37.93  ?  1251 HOH A O     1 
HETATM 6042 O  O     . HOH K 7 .   ? 38.409  -21.240 -28.261 1.00 44.49  ?  1252 HOH A O     1 
HETATM 6043 O  O     . HOH K 7 .   ? 47.089  11.258  -16.164 1.00 34.70  ?  1253 HOH A O     1 
HETATM 6044 O  O     . HOH K 7 .   ? 44.276  12.551  -14.524 1.00 38.81  ?  1254 HOH A O     1 
HETATM 6045 O  O     . HOH K 7 .   ? 44.880  5.710   -27.767 1.00 47.01  ?  1255 HOH A O     1 
HETATM 6046 O  O     . HOH K 7 .   ? 52.632  -21.286 -4.986  1.00 35.82  ?  1256 HOH A O     1 
HETATM 6047 O  O     . HOH K 7 .   ? 37.463  -17.696 -13.601 1.00 57.65  ?  1257 HOH A O     1 
HETATM 6048 O  O     . HOH K 7 .   ? 75.376  -14.605 -5.937  1.00 44.95  ?  1258 HOH A O     1 
HETATM 6049 O  O     . HOH K 7 .   ? 67.878  7.344   -8.437  1.00 31.93  ?  1259 HOH A O     1 
HETATM 6050 O  O     . HOH K 7 .   ? 64.043  -13.724 -20.240 1.00 44.87  ?  1260 HOH A O     1 
HETATM 6051 O  O     . HOH K 7 .   ? 51.584  15.309  -9.780  1.00 33.56  ?  1261 HOH A O     1 
HETATM 6052 O  O     . HOH K 7 .   ? 55.373  -9.184  -33.272 1.00 38.86  ?  1262 HOH A O     1 
HETATM 6053 O  O     . HOH K 7 .   ? 60.601  -8.998  -22.064 1.00 34.21  ?  1263 HOH A O     1 
HETATM 6054 O  O     . HOH K 7 .   ? 42.478  -0.409  -9.762  1.00 51.64  ?  1264 HOH A O     1 
HETATM 6055 O  O     . HOH K 7 .   ? 74.139  1.657   -1.930  1.00 43.76  ?  1265 HOH A O     1 
HETATM 6056 O  O     . HOH K 7 .   ? 74.194  -38.173 -12.962 1.00 43.36  ?  1266 HOH A O     1 
HETATM 6057 O  O     . HOH K 7 .   ? 47.139  3.165   -28.686 1.00 40.05  ?  1267 HOH A O     1 
HETATM 6058 O  O     . HOH K 7 .   ? 42.055  -6.170  1.603   1.00 50.83  ?  1268 HOH A O     1 
HETATM 6059 O  O     . HOH K 7 .   ? 43.428  13.725  -12.521 1.00 45.93  ?  1269 HOH A O     1 
HETATM 6060 O  O     . HOH K 7 .   ? 42.479  -20.597 -8.409  1.00 56.13  ?  1270 HOH A O     1 
HETATM 6061 O  O     . HOH K 7 .   ? 82.106  -28.143 -1.647  1.00 66.31  ?  1271 HOH A O     1 
HETATM 6062 O  O     . HOH K 7 .   ? 55.663  2.614   -36.460 1.00 36.27  ?  1272 HOH A O     1 
HETATM 6063 O  O     . HOH K 7 .   ? 49.659  12.269  -2.856  1.00 38.95  ?  1273 HOH A O     1 
HETATM 6064 O  O     . HOH K 7 .   ? 52.678  -3.779  -28.751 1.00 28.39  ?  1274 HOH A O     1 
HETATM 6065 O  O     . HOH K 7 .   ? 47.294  1.400   -16.530 1.00 32.68  ?  1275 HOH A O     1 
HETATM 6066 O  O     . HOH K 7 .   ? 42.676  -14.523 -16.723 1.00 42.71  ?  1276 HOH A O     1 
HETATM 6067 O  O     . HOH K 7 .   ? 40.068  -30.144 -27.159 1.00 38.23  ?  1277 HOH A O     1 
HETATM 6068 O  O     . HOH K 7 .   ? 81.444  -6.386  18.647  1.00 42.62  ?  1278 HOH A O     1 
HETATM 6069 O  O     . HOH K 7 .   ? 52.363  12.499  -2.702  1.00 38.40  ?  1279 HOH A O     1 
HETATM 6070 O  O     . HOH K 7 .   ? 60.847  -3.101  -4.131  1.00 46.54  ?  1280 HOH A O     1 
HETATM 6071 O  O     . HOH K 7 .   ? 64.660  4.393   -37.534 1.00 43.55  ?  1281 HOH A O     1 
HETATM 6072 O  O     . HOH K 7 .   ? 77.916  -34.922 -13.874 1.00 54.44  ?  1282 HOH A O     1 
HETATM 6073 O  O     . HOH K 7 .   ? 41.628  -34.282 -29.422 1.00 31.99  ?  1283 HOH A O     1 
HETATM 6074 O  O     . HOH K 7 .   ? 59.150  1.995   5.138   1.00 56.37  ?  1284 HOH A O     1 
HETATM 6075 O  O     . HOH K 7 .   ? 42.246  9.418   -11.554 1.00 42.40  ?  1285 HOH A O     1 
HETATM 6076 O  O     . HOH K 7 .   ? 65.475  15.330  -12.032 1.00 52.86  ?  1286 HOH A O     1 
HETATM 6077 O  O     . HOH K 7 .   ? 62.695  -19.920 -34.390 1.00 63.41  ?  1287 HOH A O     1 
HETATM 6078 O  O     . HOH K 7 .   ? 56.177  5.101   -33.715 1.00 50.03  ?  1288 HOH A O     1 
HETATM 6079 O  O     . HOH K 7 .   ? 70.794  -36.180 2.393   1.00 62.50  ?  1289 HOH A O     1 
HETATM 6080 O  O     . HOH K 7 .   ? 75.427  4.892   -3.341  1.00 47.17  ?  1290 HOH A O     1 
HETATM 6081 O  O     . HOH K 7 .   ? 87.794  5.308   10.258  1.00 42.11  ?  1291 HOH A O     1 
HETATM 6082 O  O     . HOH K 7 .   ? 63.150  -28.751 -21.484 1.00 38.88  ?  1292 HOH A O     1 
HETATM 6083 O  O     . HOH K 7 .   ? 43.600  19.641  -20.318 1.00 41.21  ?  1293 HOH A O     1 
HETATM 6084 O  O     . HOH K 7 .   ? 43.703  -5.879  -21.345 1.00 53.23  ?  1294 HOH A O     1 
HETATM 6085 O  O     . HOH K 7 .   ? 64.037  -3.036  -0.724  1.00 64.58  ?  1295 HOH A O     1 
HETATM 6086 O  O     . HOH K 7 .   ? 42.921  17.548  -13.235 1.00 33.18  ?  1296 HOH A O     1 
HETATM 6087 O  O     . HOH K 7 .   ? 53.823  -42.115 -21.799 1.00 40.91  ?  1297 HOH A O     1 
HETATM 6088 O  O     . HOH K 7 .   ? 45.136  0.159   -16.335 1.00 45.81  ?  1298 HOH A O     1 
HETATM 6089 O  O     . HOH K 7 .   ? 57.828  14.211  2.725   1.00 53.37  ?  1299 HOH A O     1 
HETATM 6090 O  O     . HOH K 7 .   ? 55.254  -24.397 -5.119  1.00 50.38  ?  1300 HOH A O     1 
HETATM 6091 O  O     . HOH K 7 .   ? 58.993  -15.288 -31.527 1.00 43.62  ?  1301 HOH A O     1 
HETATM 6092 O  O     . HOH K 7 .   ? 70.123  2.349   -11.676 1.00 30.87  ?  1302 HOH A O     1 
HETATM 6093 O  O     . HOH K 7 .   ? 56.390  -22.386 -15.079 1.00 51.13  ?  1303 HOH A O     1 
HETATM 6094 O  O     . HOH K 7 .   ? 73.199  -6.375  -2.531  1.00 54.71  ?  1304 HOH A O     1 
HETATM 6095 O  O     . HOH K 7 .   ? 43.778  11.488  -20.064 1.00 45.21  ?  1305 HOH A O     1 
HETATM 6096 O  O     . HOH K 7 .   ? 38.874  -27.603 -28.542 1.00 37.63  ?  1306 HOH A O     1 
HETATM 6097 O  O     . HOH K 7 .   ? 42.637  -11.691 -17.106 1.00 37.26  ?  1307 HOH A O     1 
HETATM 6098 O  O     . HOH K 7 .   ? 57.582  -46.594 -9.877  1.00 50.09  ?  1308 HOH A O     1 
HETATM 6099 O  O     . HOH K 7 .   ? 76.407  1.951   -22.653 1.00 69.50  ?  1309 HOH A O     1 
HETATM 6100 O  O     . HOH K 7 .   ? 84.923  -4.788  11.210  1.00 41.96  ?  1310 HOH A O     1 
HETATM 6101 O  O     . HOH K 7 .   ? 38.329  -24.663 -23.684 1.00 56.62  ?  1311 HOH A O     1 
HETATM 6102 O  O     . HOH K 7 .   ? 67.077  -24.488 1.515   1.00 52.03  ?  1312 HOH A O     1 
HETATM 6103 O  O     . HOH K 7 .   ? 78.597  4.007   -15.739 1.00 53.91  ?  1313 HOH A O     1 
HETATM 6104 O  O     . HOH K 7 .   ? 53.756  -20.387 -15.534 1.00 41.07  ?  1314 HOH A O     1 
HETATM 6105 O  O     . HOH K 7 .   ? 72.311  3.927   -23.146 1.00 56.45  ?  1315 HOH A O     1 
HETATM 6106 O  O     . HOH K 7 .   ? 45.133  -32.433 -35.751 1.00 44.43  ?  1316 HOH A O     1 
HETATM 6107 O  O     . HOH K 7 .   ? 56.326  -16.037 8.132   1.00 66.57  ?  1317 HOH A O     1 
HETATM 6108 O  O     . HOH K 7 .   ? 60.805  -22.706 1.513   1.00 47.08  ?  1318 HOH A O     1 
HETATM 6109 O  O     . HOH K 7 .   ? 37.478  -16.955 -30.603 1.00 48.29  ?  1319 HOH A O     1 
HETATM 6110 O  O     . HOH K 7 .   ? 72.650  4.712   -0.008  1.00 50.37  ?  1320 HOH A O     1 
HETATM 6111 O  O     . HOH K 7 .   ? 50.822  -24.308 -12.593 1.00 58.77  ?  1321 HOH A O     1 
HETATM 6112 O  O     . HOH K 7 .   ? 60.152  -16.230 -20.091 1.00 41.29  ?  1322 HOH A O     1 
HETATM 6113 O  O     . HOH K 7 .   ? 42.425  -30.958 -38.953 1.00 52.66  ?  1323 HOH A O     1 
HETATM 6114 O  O     . HOH K 7 .   ? 51.538  6.828   -30.965 1.00 34.27  ?  1324 HOH A O     1 
HETATM 6115 O  O     . HOH K 7 .   ? 44.406  -14.520 5.141   1.00 55.90  ?  1325 HOH A O     1 
HETATM 6116 O  O     . HOH K 7 .   ? 64.096  -4.932  -4.653  1.00 53.21  ?  1326 HOH A O     1 
HETATM 6117 O  O     . HOH K 7 .   ? 74.170  -35.845 3.189   1.00 57.41  ?  1327 HOH A O     1 
HETATM 6118 O  O     . HOH K 7 .   ? 45.812  -6.264  -23.069 1.00 48.06  ?  1328 HOH A O     1 
HETATM 6119 O  O     . HOH K 7 .   ? 53.941  12.877  -27.482 1.00 42.19  ?  1329 HOH A O     1 
HETATM 6120 O  O     . HOH K 7 .   ? 57.504  -22.795 -23.030 1.00 58.10  ?  1330 HOH A O     1 
HETATM 6121 O  O     . HOH K 7 .   ? 62.809  -8.588  -5.891  1.00 50.76  ?  1331 HOH A O     1 
HETATM 6122 O  O     . HOH K 7 .   ? 60.775  -18.372 -30.184 1.00 44.63  ?  1332 HOH A O     1 
HETATM 6123 O  O     . HOH K 7 .   ? 44.999  -35.249 -31.440 1.00 33.16  ?  1333 HOH A O     1 
HETATM 6124 O  O     . HOH K 7 .   ? 72.552  -26.997 15.067  1.00 56.38  ?  1334 HOH A O     1 
HETATM 6125 O  O     . HOH K 7 .   ? 73.241  5.844   -2.446  1.00 45.52  ?  1335 HOH A O     1 
HETATM 6126 O  O     . HOH K 7 .   ? 57.986  -20.169 -9.460  1.00 48.02  ?  1336 HOH A O     1 
HETATM 6127 O  O     . HOH K 7 .   ? 41.881  16.996  -4.403  1.00 47.15  ?  1337 HOH A O     1 
HETATM 6128 O  O     . HOH K 7 .   ? 87.050  -9.088  20.489  1.00 48.73  ?  1338 HOH A O     1 
HETATM 6129 O  O     . HOH K 7 .   ? 56.969  18.535  -7.613  1.00 44.28  ?  1339 HOH A O     1 
HETATM 6130 O  O     . HOH K 7 .   ? 54.759  18.088  -22.841 1.00 47.85  ?  1340 HOH A O     1 
HETATM 6131 O  O     . HOH K 7 .   ? 40.744  -23.976 -29.771 1.00 36.67  ?  1341 HOH A O     1 
HETATM 6132 O  O     . HOH K 7 .   ? 62.832  -20.218 -36.566 1.00 67.59  ?  1342 HOH A O     1 
HETATM 6133 O  O     . HOH K 7 .   ? 53.073  9.533   3.325   1.00 55.68  ?  1343 HOH A O     1 
HETATM 6134 O  O     . HOH K 7 .   ? 42.883  10.499  -3.280  1.00 37.39  ?  1344 HOH A O     1 
HETATM 6135 O  O     . HOH K 7 .   ? 54.825  10.091  5.793   1.00 54.33  ?  1345 HOH A O     1 
HETATM 6136 O  O     . HOH K 7 .   ? 62.680  -50.665 -12.799 1.00 57.77  ?  1346 HOH A O     1 
HETATM 6137 O  O     . HOH K 7 .   ? 69.617  6.389   -17.979 1.00 51.87  ?  1347 HOH A O     1 
HETATM 6138 O  O     . HOH K 7 .   ? 38.118  -24.306 -26.053 1.00 50.22  ?  1348 HOH A O     1 
HETATM 6139 O  O     . HOH K 7 .   ? 52.544  4.559   -33.492 1.00 49.06  ?  1349 HOH A O     1 
HETATM 6140 O  O     . HOH K 7 .   ? 48.721  14.713  -2.558  1.00 54.01  ?  1350 HOH A O     1 
HETATM 6141 O  O     . HOH K 7 .   ? 48.255  13.221  -14.953 1.00 41.89  ?  1351 HOH A O     1 
HETATM 6142 O  O     . HOH K 7 .   ? 72.747  2.144   -8.927  1.00 49.44  ?  1352 HOH A O     1 
HETATM 6143 O  O     . HOH K 7 .   ? 63.966  -6.925  -18.637 1.00 41.35  ?  1353 HOH A O     1 
HETATM 6144 O  O     . HOH K 7 .   ? 70.698  0.088   -9.448  1.00 61.14  ?  1354 HOH A O     1 
HETATM 6145 O  O     . HOH K 7 .   ? 72.363  12.642  -6.205  1.00 56.91  ?  1355 HOH A O     1 
HETATM 6146 O  O     . HOH K 7 .   ? 39.606  -20.164 -9.596  1.00 55.23  ?  1356 HOH A O     1 
HETATM 6147 O  O     . HOH K 7 .   ? 80.093  -35.057 -0.466  1.00 46.83  ?  1357 HOH A O     1 
HETATM 6148 O  O     . HOH K 7 .   ? 38.291  -7.803  -14.341 1.00 47.23  ?  1358 HOH A O     1 
HETATM 6149 O  O     . HOH K 7 .   ? 67.123  -15.668 -0.789  1.00 45.87  ?  1359 HOH A O     1 
HETATM 6150 O  O     . HOH K 7 .   ? 55.646  24.120  -18.804 1.00 44.36  ?  1360 HOH A O     1 
HETATM 6151 O  O     . HOH K 7 .   ? 46.527  -45.313 -19.040 1.00 55.02  ?  1361 HOH A O     1 
HETATM 6152 O  O     . HOH K 7 .   ? 69.232  -25.713 1.121   1.00 39.21  ?  1362 HOH A O     1 
HETATM 6153 O  O     . HOH K 7 .   ? 65.456  -22.179 -0.044  1.00 45.10  ?  1363 HOH A O     1 
HETATM 6154 O  O     . HOH K 7 .   ? 56.265  -11.536 -39.839 1.00 49.83  ?  1364 HOH A O     1 
HETATM 6155 O  O     . HOH K 7 .   ? 45.882  17.320  -23.838 1.00 50.73  ?  1365 HOH A O     1 
HETATM 6156 O  O     . HOH K 7 .   ? 55.178  -14.527 12.761  1.00 62.58  ?  1366 HOH A O     1 
HETATM 6157 O  O     . HOH K 7 .   ? 62.753  -7.607  -20.824 1.00 39.31  ?  1367 HOH A O     1 
HETATM 6158 O  O     . HOH K 7 .   ? 63.747  15.423  -1.968  1.00 48.48  ?  1368 HOH A O     1 
HETATM 6159 O  O     . HOH K 7 .   ? 42.656  -14.843 -13.705 1.00 52.48  ?  1369 HOH A O     1 
HETATM 6160 O  O     . HOH K 7 .   ? 58.129  -23.512 -27.204 1.00 39.99  ?  1370 HOH A O     1 
HETATM 6161 O  O     . HOH K 7 .   ? 44.103  -35.360 -28.987 1.00 29.33  ?  1371 HOH A O     1 
HETATM 6162 O  O     . HOH K 7 .   ? 45.790  2.891   -37.093 1.00 51.79  ?  1372 HOH A O     1 
HETATM 6163 O  O     . HOH K 7 .   ? 40.036  0.748   -11.521 1.00 50.23  ?  1373 HOH A O     1 
HETATM 6164 O  O     . HOH K 7 .   ? 45.532  12.368  -18.062 1.00 37.68  ?  1374 HOH A O     1 
HETATM 6165 O  O     . HOH K 7 .   ? 50.807  -22.196 -16.469 1.00 42.39  ?  1375 HOH A O     1 
HETATM 6166 O  O     . HOH K 7 .   ? 63.586  -26.797 -26.447 1.00 49.73  ?  1376 HOH A O     1 
HETATM 6167 O  O     . HOH K 7 .   ? 88.474  -22.293 -6.328  1.00 50.57  ?  1377 HOH A O     1 
HETATM 6168 O  O     . HOH K 7 .   ? 55.528  -21.099 -22.062 1.00 42.20  ?  1378 HOH A O     1 
HETATM 6169 O  O     . HOH K 7 .   ? 41.974  -18.836 -31.275 1.00 35.67  ?  1379 HOH A O     1 
HETATM 6170 O  O     . HOH K 7 .   ? 68.761  -10.732 4.608   1.00 50.01  ?  1380 HOH A O     1 
HETATM 6171 O  O     . HOH K 7 .   ? 69.824  -0.509  -0.525  1.00 62.41  ?  1381 HOH A O     1 
HETATM 6172 O  O     . HOH K 7 .   ? 42.456  6.856   -3.504  1.00 51.02  ?  1382 HOH A O     1 
HETATM 6173 O  O     . HOH K 7 .   ? 52.070  -24.627 -15.490 1.00 50.97  ?  1383 HOH A O     1 
HETATM 6174 O  O     . HOH K 7 .   ? 37.019  -25.809 -37.539 1.00 46.00  ?  1384 HOH A O     1 
HETATM 6175 O  O     . HOH K 7 .   ? 50.318  16.099  -12.126 1.00 34.08  ?  1385 HOH A O     1 
HETATM 6176 O  O     . HOH K 7 .   ? 57.397  12.467  4.559   1.00 55.52  ?  1386 HOH A O     1 
HETATM 6177 O  O     . HOH K 7 .   ? 71.912  1.688   0.750   1.00 53.87  ?  1387 HOH A O     1 
HETATM 6178 O  O     . HOH K 7 .   ? 64.381  -15.937 -21.267 1.00 58.36  ?  1388 HOH A O     1 
HETATM 6179 O  O     . HOH K 7 .   ? 66.466  -28.261 -23.112 1.00 51.72  ?  1389 HOH A O     1 
HETATM 6180 O  O     . HOH K 7 .   ? 71.146  1.185   -14.024 1.00 52.30  ?  1390 HOH A O     1 
HETATM 6181 O  O     . HOH K 7 .   ? 41.787  17.200  -1.511  1.00 56.58  ?  1391 HOH A O     1 
HETATM 6182 O  O     . HOH K 7 .   ? 62.872  -3.999  -35.194 1.00 59.42  ?  1392 HOH A O     1 
HETATM 6183 O  O     . HOH K 7 .   ? 73.179  -16.823 -6.646  1.00 55.71  ?  1393 HOH A O     1 
HETATM 6184 O  O     . HOH K 7 .   ? 40.265  -5.789  -20.153 1.00 39.64  ?  1394 HOH A O     1 
HETATM 6185 O  O     . HOH K 7 .   ? 71.525  5.899   -16.083 1.00 53.42  ?  1395 HOH A O     1 
HETATM 6186 O  O     . HOH K 7 .   ? 60.356  -21.991 -27.400 1.00 52.91  ?  1396 HOH A O     1 
HETATM 6187 O  O     . HOH K 7 .   ? 55.936  14.895  -26.522 1.00 55.81  ?  1397 HOH A O     1 
HETATM 6188 O  O     . HOH K 7 .   ? 39.593  -38.207 -19.527 1.00 46.01  ?  1398 HOH A O     1 
HETATM 6189 O  O     . HOH K 7 .   ? 39.406  -18.964 -30.080 1.00 44.89  ?  1399 HOH A O     1 
HETATM 6190 O  O     . HOH K 7 .   ? 41.098  15.847  2.056   1.00 59.27  ?  1400 HOH A O     1 
HETATM 6191 O  O     . HOH K 7 .   ? 59.635  -16.605 11.188  1.00 68.93  ?  1401 HOH A O     1 
HETATM 6192 O  O     . HOH K 7 .   ? 83.008  3.506   10.660  1.00 51.47  ?  1402 HOH A O     1 
HETATM 6193 O  O     . HOH K 7 .   ? 66.090  16.374  -15.328 1.00 54.64  ?  1403 HOH A O     1 
HETATM 6194 O  O     . HOH K 7 .   ? 38.369  -20.496 -11.613 1.00 58.57  ?  1404 HOH A O     1 
HETATM 6195 O  O     . HOH K 7 .   ? 90.506  -13.601 -13.783 1.00 60.08  ?  1405 HOH A O     1 
HETATM 6196 O  O     . HOH K 7 .   ? 61.094  -11.308 -35.544 1.00 51.07  ?  1406 HOH A O     1 
HETATM 6197 O  O     . HOH K 7 .   ? 62.200  -4.706  -32.023 1.00 43.68  ?  1407 HOH A O     1 
HETATM 6198 O  O     . HOH K 7 .   ? 56.982  -15.355 11.288  1.00 55.23  ?  1408 HOH A O     1 
HETATM 6199 O  O     . HOH K 7 .   ? 40.158  -16.232 -32.930 1.00 57.92  ?  1409 HOH A O     1 
HETATM 6200 O  O     . HOH K 7 .   ? 39.546  -28.997 -39.648 1.00 56.91  ?  1410 HOH A O     1 
HETATM 6201 O  O     . HOH K 7 .   ? 66.595  -5.508  -20.472 1.00 55.04  ?  1411 HOH A O     1 
HETATM 6202 O  O     . HOH K 7 .   ? 62.978  -17.801 -21.923 1.00 54.50  ?  1412 HOH A O     1 
HETATM 6203 O  O     . HOH K 7 .   ? 62.220  6.423   -24.803 1.00 28.68  ?  1413 HOH A O     1 
HETATM 6204 O  O     . HOH K 7 .   ? 48.822  15.883  1.043   1.00 57.23  ?  1414 HOH A O     1 
HETATM 6205 O  O     . HOH K 7 .   ? 53.111  22.301  -19.586 1.00 51.02  ?  1415 HOH A O     1 
HETATM 6206 O  O     . HOH K 7 .   ? 88.145  -15.400 -15.279 1.00 66.74  ?  1416 HOH A O     1 
HETATM 6207 O  O     . HOH K 7 .   ? 60.566  -19.102 -22.325 1.00 54.57  ?  1417 HOH A O     1 
HETATM 6208 O  O     . HOH K 7 .   ? 60.741  -19.837 -17.769 1.00 52.10  ?  1418 HOH A O     1 
HETATM 6209 O  O     . HOH K 7 .   ? 47.440  19.448  -23.508 1.00 60.60  ?  1419 HOH A O     1 
HETATM 6210 O  O     . HOH K 7 .   ? 39.191  -35.678 -17.569 1.00 51.33  ?  1420 HOH A O     1 
HETATM 6211 O  O     . HOH K 7 .   ? 63.511  -2.761  -32.520 1.00 47.01  ?  1421 HOH A O     1 
HETATM 6212 O  O     . HOH K 7 .   ? 63.447  -5.105  -37.414 1.00 59.15  ?  1422 HOH A O     1 
HETATM 6213 O  O     . HOH K 7 .   ? 35.604  -20.325 -13.345 1.00 60.53  ?  1423 HOH A O     1 
HETATM 6214 O  O     . HOH K 7 .   ? 58.947  -19.081 -21.153 1.00 48.76  ?  1424 HOH A O     1 
HETATM 6215 O  O     . HOH K 7 .   ? 89.953  9.354   1.563   1.00 61.19  ?  1425 HOH A O     1 
HETATM 6216 O  O     . HOH K 7 .   ? 85.458  8.996   5.966   1.00 58.58  ?  1426 HOH A O     1 
HETATM 6217 O  O     . HOH K 7 .   ? 35.031  -18.192 -33.152 1.00 64.27  ?  1427 HOH A O     1 
HETATM 6218 O  O     . HOH L 7 .   ? 39.601  -24.598 -15.168 1.00 54.79  ?  801  HOH B O     1 
HETATM 6219 O  O     . HOH L 7 .   ? 37.659  -20.209 -23.091 1.00 38.07  ?  802  HOH B O     1 
HETATM 6220 O  O     . HOH L 7 .   ? 35.018  -20.972 -16.223 1.00 49.33  ?  803  HOH B O     1 
HETATM 6221 O  O     . HOH L 7 .   ? 42.202  -29.654 -20.281 1.00 42.12  ?  804  HOH B O     1 
HETATM 6222 O  O     . HOH L 7 .   ? 49.638  -20.956 5.084   1.00 50.73  ?  805  HOH B O     1 
HETATM 6223 O  O     . HOH L 7 .   ? 42.297  -21.343 -11.843 1.00 54.01  ?  806  HOH B O     1 
HETATM 6224 O  O     . HOH L 7 .   ? 38.194  -27.121 -17.021 1.00 52.54  ?  807  HOH B O     1 
HETATM 6225 O  O     . HOH L 7 .   ? 48.290  -20.262 10.681  1.00 62.11  ?  808  HOH B O     1 
HETATM 6226 O  O     . HOH L 7 .   ? 39.396  -28.970 -17.569 1.00 49.33  ?  809  HOH B O     1 
HETATM 6227 O  O     . HOH L 7 .   ? 51.878  -23.601 -9.966  1.00 56.40  ?  810  HOH B O     1 
HETATM 6228 O  O     . HOH L 7 .   ? 40.522  -30.686 -12.620 1.00 43.86  ?  811  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   68   ?    ?   ?   A . n 
A 1 2   GLY 2   69   ?    ?   ?   A . n 
A 1 3   ASP 3   70   ?    ?   ?   A . n 
A 1 4   THR 4   71   ?    ?   ?   A . n 
A 1 5   ASP 5   72   ?    ?   ?   A . n 
A 1 6   GLU 6   73   ?    ?   ?   A . n 
A 1 7   PRO 7   74   ?    ?   ?   A . n 
A 1 8   ILE 8   75   ?    ?   ?   A . n 
A 1 9   PHE 9   76   ?    ?   ?   A . n 
A 1 10  GLY 10  77   ?    ?   ?   A . n 
A 1 11  LYS 11  78   ?    ?   ?   A . n 
A 1 12  LYS 12  79   ?    ?   ?   A . n 
A 1 13  PRO 13  80   ?    ?   ?   A . n 
A 1 14  ARG 14  81   ?    ?   ?   A . n 
A 1 15  ILE 15  82   ?    ?   ?   A . n 
A 1 16  GLU 16  83   ?    ?   ?   A . n 
A 1 17  GLU 17  84   ?    ?   ?   A . n 
A 1 18  SER 18  85   ?    ?   ?   A . n 
A 1 19  ILE 19  86   ?    ?   ?   A . n 
A 1 20  THR 20  87   ?    ?   ?   A . n 
A 1 21  GLU 21  88   ?    ?   ?   A . n 
A 1 22  ASP 22  89   ?    ?   ?   A . n 
A 1 23  LEU 23  90   90   LEU LEU A . n 
A 1 24  SER 24  91   91   SER SER A . n 
A 1 25  LEU 25  92   92   LEU LEU A . n 
A 1 26  ALA 26  93   93   ALA ALA A . n 
A 1 27  ASP 27  94   94   ASP ASP A . n 
A 1 28  LEU 28  95   95   LEU LEU A . n 
A 1 29  MET 29  96   96   MET MET A . n 
A 1 30  PRO 30  97   97   PRO PRO A . n 
A 1 31  ARG 31  98   98   ARG ARG A . n 
A 1 32  VAL 32  99   99   VAL VAL A . n 
A 1 33  LYS 33  100  100  LYS LYS A . n 
A 1 34  VAL 34  101  101  VAL VAL A . n 
A 1 35  GLN 35  102  102  GLN GLN A . n 
A 1 36  SER 36  103  103  SER SER A . n 
A 1 37  VAL 37  104  104  VAL VAL A . n 
A 1 38  GLU 38  105  105  GLU GLU A . n 
A 1 39  THR 39  106  106  THR THR A . n 
A 1 40  VAL 40  107  107  VAL VAL A . n 
A 1 41  GLU 41  108  108  GLU GLU A . n 
A 1 42  GLY 42  109  109  GLY GLY A . n 
A 1 43  CYS 43  110  110  CYS CYS A . n 
A 1 44  THR 44  111  111  THR THR A . n 
A 1 45  HIS 45  112  112  HIS HIS A . n 
A 1 46  GLU 46  113  113  GLU GLU A . n 
A 1 47  VAL 47  114  114  VAL VAL A . n 
A 1 48  ALA 48  115  115  ALA ALA A . n 
A 1 49  LEU 49  116  116  LEU LEU A . n 
A 1 50  PRO 50  117  117  PRO PRO A . n 
A 1 51  ALA 51  118  118  ALA ALA A . n 
A 1 52  GLU 52  119  119  GLU GLU A . n 
A 1 53  GLU 53  120  120  GLU GLU A . n 
A 1 54  ASP 54  121  121  ASP ASP A . n 
A 1 55  TYR 55  122  122  TYR TYR A . n 
A 1 56  LEU 56  123  123  LEU LEU A . n 
A 1 57  PRO 57  124  124  PRO PRO A . n 
A 1 58  LEU 58  125  125  LEU LEU A . n 
A 1 59  LYS 59  126  126  LYS LYS A . n 
A 1 60  PRO 60  127  127  PRO PRO A . n 
A 1 61  ARG 61  128  128  ARG ARG A . n 
A 1 62  VAL 62  129  129  VAL VAL A . n 
A 1 63  GLY 63  130  130  GLY GLY A . n 
A 1 64  LYS 64  131  131  LYS LYS A . n 
A 1 65  ALA 65  132  132  ALA ALA A . n 
A 1 66  ALA 66  133  133  ALA ALA A . n 
A 1 67  LYS 67  134  134  LYS LYS A . n 
A 1 68  GLU 68  135  135  GLU GLU A . n 
A 1 69  TYR 69  136  136  TYR TYR A . n 
A 1 70  PRO 70  137  137  PRO PRO A . n 
A 1 71  PHE 71  138  138  PHE PHE A . n 
A 1 72  ILE 72  139  139  ILE ILE A . n 
A 1 73  LEU 73  140  140  LEU LEU A . n 
A 1 74  ASP 74  141  141  ASP ASP A . n 
A 1 75  ALA 75  142  142  ALA ALA A . n 
A 1 76  PHE 76  143  143  PHE PHE A . n 
A 1 77  GLN 77  144  144  GLN GLN A . n 
A 1 78  ARG 78  145  145  ARG ARG A . n 
A 1 79  GLU 79  146  146  GLU GLU A . n 
A 1 80  ALA 80  147  147  ALA ALA A . n 
A 1 81  ILE 81  148  148  ILE ILE A . n 
A 1 82  GLN 82  149  149  GLN GLN A . n 
A 1 83  CYS 83  150  150  CYS CYS A . n 
A 1 84  VAL 84  151  151  VAL VAL A . n 
A 1 85  ASP 85  152  152  ASP ASP A . n 
A 1 86  ASN 86  153  153  ASN ASN A . n 
A 1 87  ASN 87  154  154  ASN ASN A . n 
A 1 88  GLN 88  155  155  GLN GLN A . n 
A 1 89  SER 89  156  156  SER SER A . n 
A 1 90  VAL 90  157  157  VAL VAL A . n 
A 1 91  LEU 91  158  158  LEU LEU A . n 
A 1 92  VAL 92  159  159  VAL VAL A . n 
A 1 93  SER 93  160  160  SER SER A . n 
A 1 94  ALA 94  161  161  ALA ALA A . n 
A 1 95  HIS 95  162  162  HIS HIS A . n 
A 1 96  THR 96  163  163  THR THR A . n 
A 1 97  SER 97  164  164  SER SER A . n 
A 1 98  ALA 98  165  165  ALA ALA A . n 
A 1 99  GLY 99  166  166  GLY GLY A . n 
A 1 100 LYS 100 167  167  LYS LYS A . n 
A 1 101 THR 101 168  168  THR THR A . n 
A 1 102 VAL 102 169  169  VAL VAL A . n 
A 1 103 CYS 103 170  170  CYS CYS A . n 
A 1 104 ALA 104 171  171  ALA ALA A . n 
A 1 105 GLU 105 172  172  GLU GLU A . n 
A 1 106 TYR 106 173  173  TYR TYR A . n 
A 1 107 ALA 107 174  174  ALA ALA A . n 
A 1 108 ILE 108 175  175  ILE ILE A . n 
A 1 109 ALA 109 176  176  ALA ALA A . n 
A 1 110 LEU 110 177  177  LEU LEU A . n 
A 1 111 ALA 111 178  178  ALA ALA A . n 
A 1 112 LEU 112 179  179  LEU LEU A . n 
A 1 113 ARG 113 180  180  ARG ARG A . n 
A 1 114 GLU 114 181  181  GLU GLU A . n 
A 1 115 LYS 115 182  182  LYS LYS A . n 
A 1 116 GLN 116 183  183  GLN GLN A . n 
A 1 117 ARG 117 184  184  ARG ARG A . n 
A 1 118 VAL 118 185  185  VAL VAL A . n 
A 1 119 ILE 119 186  186  ILE ILE A . n 
A 1 120 PHE 120 187  187  PHE PHE A . n 
A 1 121 THR 121 188  188  THR THR A . n 
A 1 122 SER 122 189  189  SER SER A . n 
A 1 123 PRO 123 190  190  PRO PRO A . n 
A 1 124 ILE 124 191  191  ILE ILE A . n 
A 1 125 LYS 125 192  192  LYS LYS A . n 
A 1 126 ALA 126 193  193  ALA ALA A . n 
A 1 127 LEU 127 194  194  LEU LEU A . n 
A 1 128 SER 128 195  195  SER SER A . n 
A 1 129 ASN 129 196  196  ASN ASN A . n 
A 1 130 GLN 130 197  197  GLN GLN A . n 
A 1 131 LYS 131 198  198  LYS LYS A . n 
A 1 132 TYR 132 199  199  TYR TYR A . n 
A 1 133 ARG 133 200  200  ARG ARG A . n 
A 1 134 GLU 134 201  201  GLU GLU A . n 
A 1 135 MET 135 202  202  MET MET A . n 
A 1 136 TYR 136 203  203  TYR TYR A . n 
A 1 137 GLU 137 204  204  GLU GLU A . n 
A 1 138 GLU 138 205  205  GLU GLU A . n 
A 1 139 PHE 139 206  206  PHE PHE A . n 
A 1 140 GLN 140 207  207  GLN GLN A . n 
A 1 141 ASP 141 208  208  ASP ASP A . n 
A 1 142 VAL 142 209  209  VAL VAL A . n 
A 1 143 GLY 143 210  210  GLY GLY A . n 
A 1 144 LEU 144 211  211  LEU LEU A . n 
A 1 145 MET 145 212  212  MET MET A . n 
A 1 146 THR 146 213  213  THR THR A . n 
A 1 147 GLY 147 214  214  GLY GLY A . n 
A 1 148 ASP 148 215  215  ASP ASP A . n 
A 1 149 VAL 149 216  216  VAL VAL A . n 
A 1 150 THR 150 217  217  THR THR A . n 
A 1 151 ILE 151 218  218  ILE ILE A . n 
A 1 152 ASN 152 219  219  ASN ASN A . n 
A 1 153 PRO 153 220  220  PRO PRO A . n 
A 1 154 THR 154 221  221  THR THR A . n 
A 1 155 ALA 155 222  222  ALA ALA A . n 
A 1 156 SER 156 223  223  SER SER A . n 
A 1 157 CYS 157 224  224  CYS CYS A . n 
A 1 158 LEU 158 225  225  LEU LEU A . n 
A 1 159 VAL 159 226  226  VAL VAL A . n 
A 1 160 MET 160 227  227  MET MET A . n 
A 1 161 THR 161 228  228  THR THR A . n 
A 1 162 THR 162 229  229  THR THR A . n 
A 1 163 GLU 163 230  230  GLU GLU A . n 
A 1 164 ILE 164 231  231  ILE ILE A . n 
A 1 165 LEU 165 232  232  LEU LEU A . n 
A 1 166 ARG 166 233  233  ARG ARG A . n 
A 1 167 SER 167 234  234  SER SER A . n 
A 1 168 MET 168 235  235  MET MET A . n 
A 1 169 LEU 169 236  236  LEU LEU A . n 
A 1 170 TYR 170 237  237  TYR TYR A . n 
A 1 171 ARG 171 238  238  ARG ARG A . n 
A 1 172 GLY 172 239  239  GLY GLY A . n 
A 1 173 SER 173 240  240  SER SER A . n 
A 1 174 GLU 174 241  241  GLU GLU A . n 
A 1 175 VAL 175 242  242  VAL VAL A . n 
A 1 176 MET 176 243  243  MET MET A . n 
A 1 177 ARG 177 244  244  ARG ARG A . n 
A 1 178 GLU 178 245  245  GLU GLU A . n 
A 1 179 VAL 179 246  246  VAL VAL A . n 
A 1 180 ALA 180 247  247  ALA ALA A . n 
A 1 181 TRP 181 248  248  TRP TRP A . n 
A 1 182 VAL 182 249  249  VAL VAL A . n 
A 1 183 ILE 183 250  250  ILE ILE A . n 
A 1 184 PHE 184 251  251  PHE PHE A . n 
A 1 185 ASP 185 252  252  ASP ASP A . n 
A 1 186 GLU 186 253  253  GLU GLU A . n 
A 1 187 ILE 187 254  254  ILE ILE A . n 
A 1 188 HIS 188 255  255  HIS HIS A . n 
A 1 189 TYR 189 256  256  TYR TYR A . n 
A 1 190 MET 190 257  257  MET MET A . n 
A 1 191 ARG 191 258  258  ARG ARG A . n 
A 1 192 ASP 192 259  259  ASP ASP A . n 
A 1 193 SER 193 260  260  SER SER A . n 
A 1 194 GLU 194 261  261  GLU GLU A . n 
A 1 195 ARG 195 262  262  ARG ARG A . n 
A 1 196 GLY 196 263  263  GLY GLY A . n 
A 1 197 VAL 197 264  264  VAL VAL A . n 
A 1 198 VAL 198 265  265  VAL VAL A . n 
A 1 199 TRP 199 266  266  TRP TRP A . n 
A 1 200 GLU 200 267  267  GLU GLU A . n 
A 1 201 GLU 201 268  268  GLU GLU A . n 
A 1 202 THR 202 269  269  THR THR A . n 
A 1 203 ILE 203 270  270  ILE ILE A . n 
A 1 204 ILE 204 271  271  ILE ILE A . n 
A 1 205 LEU 205 272  272  LEU LEU A . n 
A 1 206 LEU 206 273  273  LEU LEU A . n 
A 1 207 PRO 207 274  274  PRO PRO A . n 
A 1 208 ASP 208 275  275  ASP ASP A . n 
A 1 209 ASN 209 276  276  ASN ASN A . n 
A 1 210 VAL 210 277  277  VAL VAL A . n 
A 1 211 HIS 211 278  278  HIS HIS A . n 
A 1 212 TYR 212 279  279  TYR TYR A . n 
A 1 213 VAL 213 280  280  VAL VAL A . n 
A 1 214 PHE 214 281  281  PHE PHE A . n 
A 1 215 LEU 215 282  282  LEU LEU A . n 
A 1 216 SER 216 283  283  SER SER A . n 
A 1 217 ALA 217 284  284  ALA ALA A . n 
A 1 218 THR 218 285  285  THR THR A . n 
A 1 219 ILE 219 286  286  ILE ILE A . n 
A 1 220 PRO 220 287  287  PRO PRO A . n 
A 1 221 ASN 221 288  288  ASN ASN A . n 
A 1 222 ALA 222 289  289  ALA ALA A . n 
A 1 223 ARG 223 290  290  ARG ARG A . n 
A 1 224 GLN 224 291  291  GLN GLN A . n 
A 1 225 PHE 225 292  292  PHE PHE A . n 
A 1 226 ALA 226 293  293  ALA ALA A . n 
A 1 227 GLU 227 294  294  GLU GLU A . n 
A 1 228 TRP 228 295  295  TRP TRP A . n 
A 1 229 ILE 229 296  296  ILE ILE A . n 
A 1 230 CYS 230 297  297  CYS CYS A . n 
A 1 231 HIS 231 298  298  HIS HIS A . n 
A 1 232 LEU 232 299  299  LEU LEU A . n 
A 1 233 HIS 233 300  300  HIS HIS A . n 
A 1 234 LYS 234 301  301  LYS LYS A . n 
A 1 235 GLN 235 302  302  GLN GLN A . n 
A 1 236 PRO 236 303  303  PRO PRO A . n 
A 1 237 CYS 237 304  304  CYS CYS A . n 
A 1 238 HIS 238 305  305  HIS HIS A . n 
A 1 239 VAL 239 306  306  VAL VAL A . n 
A 1 240 ILE 240 307  307  ILE ILE A . n 
A 1 241 TYR 241 308  308  TYR TYR A . n 
A 1 242 THR 242 309  309  THR THR A . n 
A 1 243 ASP 243 310  310  ASP ASP A . n 
A 1 244 TYR 244 311  311  TYR TYR A . n 
A 1 245 ARG 245 312  312  ARG ARG A . n 
A 1 246 PRO 246 313  313  PRO PRO A . n 
A 1 247 THR 247 314  314  THR THR A . n 
A 1 248 PRO 248 315  315  PRO PRO A . n 
A 1 249 LEU 249 316  316  LEU LEU A . n 
A 1 250 GLN 250 317  317  GLN GLN A . n 
A 1 251 HIS 251 318  318  HIS HIS A . n 
A 1 252 TYR 252 319  319  TYR TYR A . n 
A 1 253 ILE 253 320  320  ILE ILE A . n 
A 1 254 PHE 254 321  321  PHE PHE A . n 
A 1 255 PRO 255 322  322  PRO PRO A . n 
A 1 256 ALA 256 323  323  ALA ALA A . n 
A 1 257 GLY 257 324  324  GLY GLY A . n 
A 1 258 GLY 258 325  325  GLY GLY A . n 
A 1 259 ASP 259 326  326  ASP ASP A . n 
A 1 260 GLY 260 327  327  GLY GLY A . n 
A 1 261 LEU 261 328  328  LEU LEU A . n 
A 1 262 HIS 262 329  329  HIS HIS A . n 
A 1 263 LEU 263 330  330  LEU LEU A . n 
A 1 264 VAL 264 331  331  VAL VAL A . n 
A 1 265 VAL 265 332  332  VAL VAL A . n 
A 1 266 ASP 266 333  333  ASP ASP A . n 
A 1 267 GLU 267 334  334  GLU GLU A . n 
A 1 268 ASN 268 335  335  ASN ASN A . n 
A 1 269 GLY 269 336  336  GLY GLY A . n 
A 1 270 ASP 270 337  337  ASP ASP A . n 
A 1 271 PHE 271 338  338  PHE PHE A . n 
A 1 272 ARG 272 339  339  ARG ARG A . n 
A 1 273 GLU 273 340  340  GLU GLU A . n 
A 1 274 ASP 274 341  341  ASP ASP A . n 
A 1 275 ASN 275 342  342  ASN ASN A . n 
A 1 276 PHE 276 343  343  PHE PHE A . n 
A 1 277 ASN 277 344  344  ASN ASN A . n 
A 1 278 THR 278 345  345  THR THR A . n 
A 1 279 ALA 279 346  346  ALA ALA A . n 
A 1 280 MET 280 347  347  MET MET A . n 
A 1 281 GLN 281 348  348  GLN GLN A . n 
A 1 282 VAL 282 349  349  VAL VAL A . n 
A 1 283 LEU 283 350  350  LEU LEU A . n 
A 1 284 ARG 284 351  351  ARG ARG A . n 
A 1 285 ASP 285 352  ?    ?   ?   A . n 
A 1 286 ALA 286 353  ?    ?   ?   A . n 
A 1 287 GLY 287 354  ?    ?   ?   A . n 
A 1 288 ASP 288 355  ?    ?   ?   A . n 
A 1 289 LEU 289 356  ?    ?   ?   A . n 
A 1 290 ALA 290 357  ?    ?   ?   A . n 
A 1 291 LYS 291 358  ?    ?   ?   A . n 
A 1 292 GLY 292 359  ?    ?   ?   A . n 
A 1 293 ASP 293 360  ?    ?   ?   A . n 
A 1 294 GLN 294 361  ?    ?   ?   A . n 
A 1 295 LYS 295 362  ?    ?   ?   A . n 
A 1 296 GLY 296 363  ?    ?   ?   A . n 
A 1 297 ARG 297 364  ?    ?   ?   A . n 
A 1 298 LYS 298 365  ?    ?   ?   A . n 
A 1 299 GLY 299 366  ?    ?   ?   A . n 
A 1 300 GLY 300 367  ?    ?   ?   A . n 
A 1 301 THR 301 368  ?    ?   ?   A . n 
A 1 302 LYS 302 369  ?    ?   ?   A . n 
A 1 303 GLY 303 370  370  GLY GLY A . n 
A 1 304 PRO 304 371  371  PRO PRO A . n 
A 1 305 SER 305 372  372  SER SER A . n 
A 1 306 ASN 306 373  373  ASN ASN A . n 
A 1 307 VAL 307 374  374  VAL VAL A . n 
A 1 308 PHE 308 375  375  PHE PHE A . n 
A 1 309 LYS 309 376  376  LYS LYS A . n 
A 1 310 ILE 310 377  377  ILE ILE A . n 
A 1 311 VAL 311 378  378  VAL VAL A . n 
A 1 312 LYS 312 379  379  LYS LYS A . n 
A 1 313 MET 313 380  380  MET MET A . n 
A 1 314 ILE 314 381  381  ILE ILE A . n 
A 1 315 MET 315 382  382  MET MET A . n 
A 1 316 GLU 316 383  383  GLU GLU A . n 
A 1 317 ARG 317 384  384  ARG ARG A . n 
A 1 318 ASN 318 385  385  ASN ASN A . n 
A 1 319 PHE 319 386  386  PHE PHE A . n 
A 1 320 GLN 320 387  387  GLN GLN A . n 
A 1 321 PRO 321 388  388  PRO PRO A . n 
A 1 322 VAL 322 389  389  VAL VAL A . n 
A 1 323 ILE 323 390  390  ILE ILE A . n 
A 1 324 ILE 324 391  391  ILE ILE A . n 
A 1 325 PHE 325 392  392  PHE PHE A . n 
A 1 326 SER 326 393  393  SER SER A . n 
A 1 327 PHE 327 394  394  PHE PHE A . n 
A 1 328 SER 328 395  395  SER SER A . n 
A 1 329 LYS 329 396  396  LYS LYS A . n 
A 1 330 LYS 330 397  397  LYS LYS A . n 
A 1 331 ASP 331 398  398  ASP ASP A . n 
A 1 332 CYS 332 399  399  CYS CYS A . n 
A 1 333 GLU 333 400  400  GLU GLU A . n 
A 1 334 ALA 334 401  401  ALA ALA A . n 
A 1 335 TYR 335 402  402  TYR TYR A . n 
A 1 336 ALA 336 403  403  ALA ALA A . n 
A 1 337 LEU 337 404  404  LEU LEU A . n 
A 1 338 GLN 338 405  405  GLN GLN A . n 
A 1 339 MET 339 406  406  MET MET A . n 
A 1 340 THR 340 407  407  THR THR A . n 
A 1 341 LYS 341 408  408  LYS LYS A . n 
A 1 342 LEU 342 409  409  LEU LEU A . n 
A 1 343 ASP 343 410  410  ASP ASP A . n 
A 1 344 PHE 344 411  411  PHE PHE A . n 
A 1 345 ASN 345 412  412  ASN ASN A . n 
A 1 346 THR 346 413  413  THR THR A . n 
A 1 347 ASP 347 414  414  ASP ASP A . n 
A 1 348 GLU 348 415  415  GLU GLU A . n 
A 1 349 GLU 349 416  416  GLU GLU A . n 
A 1 350 LYS 350 417  417  LYS LYS A . n 
A 1 351 LYS 351 418  418  LYS LYS A . n 
A 1 352 MET 352 419  419  MET MET A . n 
A 1 353 VAL 353 420  420  VAL VAL A . n 
A 1 354 GLU 354 421  421  GLU GLU A . n 
A 1 355 GLU 355 422  422  GLU GLU A . n 
A 1 356 VAL 356 423  423  VAL VAL A . n 
A 1 357 PHE 357 424  424  PHE PHE A . n 
A 1 358 SER 358 425  425  SER SER A . n 
A 1 359 ASN 359 426  426  ASN ASN A . n 
A 1 360 ALA 360 427  427  ALA ALA A . n 
A 1 361 ILE 361 428  428  ILE ILE A . n 
A 1 362 ASP 362 429  429  ASP ASP A . n 
A 1 363 CYS 363 430  430  CYS CYS A . n 
A 1 364 LEU 364 431  431  LEU LEU A . n 
A 1 365 SER 365 432  432  SER SER A . n 
A 1 366 ASP 366 433  433  ASP ASP A . n 
A 1 367 GLU 367 434  434  GLU GLU A . n 
A 1 368 ASP 368 435  435  ASP ASP A . n 
A 1 369 LYS 369 436  436  LYS LYS A . n 
A 1 370 LYS 370 437  437  LYS LYS A . n 
A 1 371 LEU 371 438  438  LEU LEU A . n 
A 1 372 PRO 372 439  439  PRO PRO A . n 
A 1 373 GLN 373 440  440  GLN GLN A . n 
A 1 374 VAL 374 441  441  VAL VAL A . n 
A 1 375 GLU 375 442  442  GLU GLU A . n 
A 1 376 HIS 376 443  443  HIS HIS A . n 
A 1 377 VAL 377 444  444  VAL VAL A . n 
A 1 378 LEU 378 445  445  LEU LEU A . n 
A 1 379 PRO 379 446  446  PRO PRO A . n 
A 1 380 LEU 380 447  447  LEU LEU A . n 
A 1 381 LEU 381 448  448  LEU LEU A . n 
A 1 382 LYS 382 449  449  LYS LYS A . n 
A 1 383 ARG 383 450  450  ARG ARG A . n 
A 1 384 GLY 384 451  451  GLY GLY A . n 
A 1 385 ILE 385 452  452  ILE ILE A . n 
A 1 386 GLY 386 453  453  GLY GLY A . n 
A 1 387 ILE 387 454  454  ILE ILE A . n 
A 1 388 HIS 388 455  455  HIS HIS A . n 
A 1 389 HIS 389 456  456  HIS HIS A . n 
A 1 390 GLY 390 457  457  GLY GLY A . n 
A 1 391 GLY 391 458  458  GLY GLY A . n 
A 1 392 LEU 392 459  459  LEU LEU A . n 
A 1 393 LEU 393 460  460  LEU LEU A . n 
A 1 394 PRO 394 461  461  PRO PRO A . n 
A 1 395 ILE 395 462  462  ILE ILE A . n 
A 1 396 LEU 396 463  463  LEU LEU A . n 
A 1 397 LYS 397 464  464  LYS LYS A . n 
A 1 398 GLU 398 465  465  GLU GLU A . n 
A 1 399 THR 399 466  466  THR THR A . n 
A 1 400 ILE 400 467  467  ILE ILE A . n 
A 1 401 GLU 401 468  468  GLU GLU A . n 
A 1 402 ILE 402 469  469  ILE ILE A . n 
A 1 403 LEU 403 470  470  LEU LEU A . n 
A 1 404 PHE 404 471  471  PHE PHE A . n 
A 1 405 SER 405 472  472  SER SER A . n 
A 1 406 GLU 406 473  473  GLU GLU A . n 
A 1 407 GLY 407 474  474  GLY GLY A . n 
A 1 408 LEU 408 475  475  LEU LEU A . n 
A 1 409 ILE 409 476  476  ILE ILE A . n 
A 1 410 LYS 410 477  477  LYS LYS A . n 
A 1 411 ALA 411 478  478  ALA ALA A . n 
A 1 412 LEU 412 479  479  LEU LEU A . n 
A 1 413 PHE 413 480  480  PHE PHE A . n 
A 1 414 ALA 414 481  481  ALA ALA A . n 
A 1 415 THR 415 482  482  THR THR A . n 
A 1 416 GLU 416 483  483  GLU GLU A . n 
A 1 417 THR 417 484  484  THR THR A . n 
A 1 418 PHE 418 485  485  PHE PHE A . n 
A 1 419 ALA 419 486  486  ALA ALA A . n 
A 1 420 MET 420 487  487  MET MET A . n 
A 1 421 GLY 421 488  488  GLY GLY A . n 
A 1 422 ILE 422 489  489  ILE ILE A . n 
A 1 423 ASN 423 490  490  ASN ASN A . n 
A 1 424 MET 424 491  491  MET MET A . n 
A 1 425 PRO 425 492  492  PRO PRO A . n 
A 1 426 ALA 426 493  493  ALA ALA A . n 
A 1 427 ARG 427 494  494  ARG ARG A . n 
A 1 428 THR 428 495  495  THR THR A . n 
A 1 429 VAL 429 496  496  VAL VAL A . n 
A 1 430 LEU 430 497  497  LEU LEU A . n 
A 1 431 PHE 431 498  498  PHE PHE A . n 
A 1 432 THR 432 499  499  THR THR A . n 
A 1 433 ASN 433 500  500  ASN ASN A . n 
A 1 434 ALA 434 501  501  ALA ALA A . n 
A 1 435 ARG 435 502  502  ARG ARG A . n 
A 1 436 LYS 436 503  503  LYS LYS A . n 
A 1 437 PHE 437 504  504  PHE PHE A . n 
A 1 438 ASP 438 505  505  ASP ASP A . n 
A 1 439 GLY 439 506  506  GLY GLY A . n 
A 1 440 LYS 440 507  507  LYS LYS A . n 
A 1 441 ASP 441 508  508  ASP ASP A . n 
A 1 442 PHE 442 509  509  PHE PHE A . n 
A 1 443 ARG 443 510  510  ARG ARG A . n 
A 1 444 TRP 444 511  511  TRP TRP A . n 
A 1 445 ILE 445 512  512  ILE ILE A . n 
A 1 446 SER 446 513  513  SER SER A . n 
A 1 447 SER 447 514  514  SER SER A . n 
A 1 448 GLY 448 515  515  GLY GLY A . n 
A 1 449 GLU 449 516  516  GLU GLU A . n 
A 1 450 TYR 450 517  517  TYR TYR A . n 
A 1 451 ILE 451 518  518  ILE ILE A . n 
A 1 452 GLN 452 519  519  GLN GLN A . n 
A 1 453 MET 453 520  520  MET MET A . n 
A 1 454 SER 454 521  521  SER SER A . n 
A 1 455 GLY 455 522  522  GLY GLY A . n 
A 1 456 ARG 456 523  523  ARG ARG A . n 
A 1 457 ALA 457 524  524  ALA ALA A . n 
A 1 458 GLY 458 525  525  GLY GLY A . n 
A 1 459 ARG 459 526  526  ARG ARG A . n 
A 1 460 ARG 460 527  527  ARG ARG A . n 
A 1 461 GLY 461 528  528  GLY GLY A . n 
A 1 462 MET 462 529  529  MET MET A . n 
A 1 463 ASP 463 530  530  ASP ASP A . n 
A 1 464 ASP 464 531  531  ASP ASP A . n 
A 1 465 ARG 465 532  532  ARG ARG A . n 
A 1 466 GLY 466 533  533  GLY GLY A . n 
A 1 467 ILE 467 534  534  ILE ILE A . n 
A 1 468 VAL 468 535  535  VAL VAL A . n 
A 1 469 ILE 469 536  536  ILE ILE A . n 
A 1 470 LEU 470 537  537  LEU LEU A . n 
A 1 471 MET 471 538  538  MET MET A . n 
A 1 472 VAL 472 539  539  VAL VAL A . n 
A 1 473 ASP 473 540  540  ASP ASP A . n 
A 1 474 GLU 474 541  541  GLU GLU A . n 
A 1 475 LYS 475 542  542  LYS LYS A . n 
A 1 476 MET 476 543  543  MET MET A . n 
A 1 477 SER 477 544  544  SER SER A . n 
A 1 478 PRO 478 545  545  PRO PRO A . n 
A 1 479 THR 479 546  546  THR THR A . n 
A 1 480 ILE 480 547  547  ILE ILE A . n 
A 1 481 GLY 481 548  548  GLY GLY A . n 
A 1 482 LYS 482 549  549  LYS LYS A . n 
A 1 483 GLN 483 550  550  GLN GLN A . n 
A 1 484 LEU 484 551  551  LEU LEU A . n 
A 1 485 LEU 485 552  552  LEU LEU A . n 
A 1 486 LYS 486 553  553  LYS LYS A . n 
A 1 487 GLY 487 554  554  GLY GLY A . n 
A 1 488 SER 488 555  555  SER SER A . n 
A 1 489 ALA 489 556  556  ALA ALA A . n 
A 1 490 ASP 490 557  557  ASP ASP A . n 
A 1 491 PRO 491 558  558  PRO PRO A . n 
A 1 492 LEU 492 559  559  LEU LEU A . n 
A 1 493 ASN 493 560  560  ASN ASN A . n 
A 1 494 SER 494 561  561  SER SER A . n 
A 1 495 ALA 495 562  562  ALA ALA A . n 
A 1 496 PHE 496 563  563  PHE PHE A . n 
A 1 497 HIS 497 564  564  HIS HIS A . n 
A 1 498 LEU 498 565  565  LEU LEU A . n 
A 1 499 THR 499 566  566  THR THR A . n 
A 1 500 TYR 500 567  567  TYR TYR A . n 
A 1 501 ASN 501 568  568  ASN ASN A . n 
A 1 502 MET 502 569  569  MET MET A . n 
A 1 503 VAL 503 570  570  VAL VAL A . n 
A 1 504 LEU 504 571  571  LEU LEU A . n 
A 1 505 ASN 505 572  572  ASN ASN A . n 
A 1 506 LEU 506 573  573  LEU LEU A . n 
A 1 507 LEU 507 574  574  LEU LEU A . n 
A 1 508 ARG 508 575  575  ARG ARG A . n 
A 1 509 VAL 509 576  576  VAL VAL A . n 
A 1 510 GLU 510 577  577  GLU GLU A . n 
A 1 511 GLU 511 578  578  GLU GLU A . n 
A 1 512 ILE 512 579  579  ILE ILE A . n 
A 1 513 ASN 513 580  580  ASN ASN A . n 
A 1 514 PRO 514 581  581  PRO PRO A . n 
A 1 515 GLU 515 582  582  GLU GLU A . n 
A 1 516 TYR 516 583  583  TYR TYR A . n 
A 1 517 MET 517 584  584  MET MET A . n 
A 1 518 LEU 518 585  585  LEU LEU A . n 
A 1 519 GLU 519 586  586  GLU GLU A . n 
A 1 520 LYS 520 587  587  LYS LYS A . n 
A 1 521 SER 521 588  588  SER SER A . n 
A 1 522 PHE 522 589  589  PHE PHE A . n 
A 1 523 TYR 523 590  590  TYR TYR A . n 
A 1 524 GLN 524 591  591  GLN GLN A . n 
A 1 525 PHE 525 592  592  PHE PHE A . n 
A 1 526 GLN 526 593  593  GLN GLN A . n 
A 1 527 HIS 527 594  594  HIS HIS A . n 
A 1 528 TYR 528 595  595  TYR TYR A . n 
A 1 529 ARG 529 596  596  ARG ARG A . n 
A 1 530 ALA 530 597  597  ALA ALA A . n 
A 1 531 ILE 531 598  598  ILE ILE A . n 
A 1 532 PRO 532 599  599  PRO PRO A . n 
A 1 533 GLY 533 600  600  GLY GLY A . n 
A 1 534 SER 534 601  601  SER SER A . n 
A 1 535 ARG 535 843  843  ARG ARG A . n 
A 1 536 THR 536 844  844  THR THR A . n 
A 1 537 VAL 537 845  845  VAL VAL A . n 
A 1 538 LEU 538 846  846  LEU LEU A . n 
A 1 539 GLN 539 847  847  GLN GLN A . n 
A 1 540 MET 540 848  848  MET MET A . n 
A 1 541 ASP 541 849  849  ASP ASP A . n 
A 1 542 GLU 542 850  850  GLU GLU A . n 
A 1 543 LEU 543 851  851  LEU LEU A . n 
A 1 544 LYS 544 852  852  LYS LYS A . n 
A 1 545 CYS 545 853  853  CYS CYS A . n 
A 1 546 ARG 546 854  854  ARG ARG A . n 
A 1 547 LYS 547 855  855  LYS LYS A . n 
A 1 548 ARG 548 856  856  ARG ARG A . n 
A 1 549 VAL 549 857  857  VAL VAL A . n 
A 1 550 LEU 550 858  858  LEU LEU A . n 
A 1 551 ARG 551 859  859  ARG ARG A . n 
A 1 552 ARG 552 860  860  ARG ARG A . n 
A 1 553 LEU 553 861  861  LEU LEU A . n 
A 1 554 GLY 554 862  862  GLY GLY A . n 
A 1 555 PHE 555 863  863  PHE PHE A . n 
A 1 556 ALA 556 864  864  ALA ALA A . n 
A 1 557 THR 557 865  865  THR THR A . n 
A 1 558 SER 558 866  866  SER SER A . n 
A 1 559 SER 559 867  867  SER SER A . n 
A 1 560 ASP 560 868  868  ASP ASP A . n 
A 1 561 VAL 561 869  869  VAL VAL A . n 
A 1 562 ILE 562 870  870  ILE ILE A . n 
A 1 563 GLU 563 871  871  GLU GLU A . n 
A 1 564 MET 564 872  872  MET MET A . n 
A 1 565 LYS 565 873  873  LYS LYS A . n 
A 1 566 GLY 566 874  874  GLY GLY A . n 
A 1 567 ARG 567 875  875  ARG ARG A . n 
A 1 568 VAL 568 876  876  VAL VAL A . n 
A 1 569 ALA 569 877  877  ALA ALA A . n 
A 1 570 CYS 570 878  878  CYS CYS A . n 
A 1 571 GLU 571 879  879  GLU GLU A . n 
A 1 572 ILE 572 880  880  ILE ILE A . n 
A 1 573 SER 573 881  881  SER SER A . n 
A 1 574 SER 574 882  882  SER SER A . n 
A 1 575 ALA 575 883  883  ALA ALA A . n 
A 1 576 ASP 576 884  884  ASP ASP A . n 
A 1 577 GLU 577 885  885  GLU GLU A . n 
A 1 578 LEU 578 886  886  LEU LEU A . n 
A 1 579 LEU 579 887  887  LEU LEU A . n 
A 1 580 LEU 580 888  888  LEU LEU A . n 
A 1 581 THR 581 889  889  THR THR A . n 
A 1 582 GLU 582 890  890  GLU GLU A . n 
A 1 583 MET 583 891  891  MET MET A . n 
A 1 584 MET 584 892  892  MET MET A . n 
A 1 585 PHE 585 893  893  PHE PHE A . n 
A 1 586 ASN 586 894  894  ASN ASN A . n 
A 1 587 GLY 587 895  895  GLY GLY A . n 
A 1 588 LEU 588 896  896  LEU LEU A . n 
A 1 589 PHE 589 897  897  PHE PHE A . n 
A 1 590 ASN 590 898  898  ASN ASN A . n 
A 1 591 ASP 591 899  899  ASP ASP A . n 
A 1 592 LEU 592 900  900  LEU LEU A . n 
A 1 593 SER 593 901  901  SER SER A . n 
A 1 594 ALA 594 902  902  ALA ALA A . n 
A 1 595 GLU 595 903  903  GLU GLU A . n 
A 1 596 GLN 596 904  904  GLN GLN A . n 
A 1 597 ALA 597 905  905  ALA ALA A . n 
A 1 598 THR 598 906  906  THR THR A . n 
A 1 599 ALA 599 907  907  ALA ALA A . n 
A 1 600 LEU 600 908  908  LEU LEU A . n 
A 1 601 LEU 601 909  909  LEU LEU A . n 
A 1 602 SER 602 910  910  SER SER A . n 
A 1 603 CYS 603 911  911  CYS CYS A . n 
A 1 604 PHE 604 912  912  PHE PHE A . n 
A 1 605 VAL 605 913  913  VAL VAL A . n 
A 1 606 PHE 606 914  914  PHE PHE A . n 
A 1 607 GLN 607 915  915  GLN GLN A . n 
A 1 608 GLU 608 916  916  GLU GLU A . n 
A 1 609 ASN 609 917  917  ASN ASN A . n 
A 1 610 SER 610 918  918  SER SER A . n 
A 1 611 SER 611 919  919  SER SER A . n 
A 1 612 GLU 612 920  920  GLU GLU A . n 
A 1 613 MET 613 921  921  MET MET A . n 
A 1 614 PRO 614 922  922  PRO PRO A . n 
A 1 615 LYS 615 923  923  LYS LYS A . n 
A 1 616 LEU 616 924  924  LEU LEU A . n 
A 1 617 THR 617 925  925  THR THR A . n 
A 1 618 GLU 618 926  926  GLU GLU A . n 
A 1 619 GLN 619 927  927  GLN GLN A . n 
A 1 620 LEU 620 928  928  LEU LEU A . n 
A 1 621 ALA 621 929  929  ALA ALA A . n 
A 1 622 GLY 622 930  930  GLY GLY A . n 
A 1 623 PRO 623 931  931  PRO PRO A . n 
A 1 624 LEU 624 932  932  LEU LEU A . n 
A 1 625 ARG 625 933  933  ARG ARG A . n 
A 1 626 GLN 626 934  934  GLN GLN A . n 
A 1 627 MET 627 935  935  MET MET A . n 
A 1 628 GLN 628 936  936  GLN GLN A . n 
A 1 629 GLU 629 937  937  GLU GLU A . n 
A 1 630 CYS 630 938  938  CYS CYS A . n 
A 1 631 ALA 631 939  939  ALA ALA A . n 
A 1 632 LYS 632 940  940  LYS LYS A . n 
A 1 633 ARG 633 941  941  ARG ARG A . n 
A 1 634 ILE 634 942  942  ILE ILE A . n 
A 1 635 ALA 635 943  943  ALA ALA A . n 
A 1 636 LYS 636 944  944  LYS LYS A . n 
A 1 637 VAL 637 945  945  VAL VAL A . n 
A 1 638 SER 638 946  946  SER SER A . n 
A 1 639 ALA 639 947  947  ALA ALA A . n 
A 1 640 GLU 640 948  948  GLU GLU A . n 
A 1 641 ALA 641 949  949  ALA ALA A . n 
A 1 642 LYS 642 950  950  LYS LYS A . n 
A 1 643 LEU 643 951  951  LEU LEU A . n 
A 1 644 GLU 644 952  952  GLU GLU A . n 
A 1 645 ILE 645 953  953  ILE ILE A . n 
A 1 646 ASP 646 954  954  ASP ASP A . n 
A 1 647 GLU 647 955  955  GLU GLU A . n 
A 1 648 GLU 648 956  956  GLU GLU A . n 
A 1 649 THR 649 957  957  THR THR A . n 
A 1 650 TYR 650 958  958  TYR TYR A . n 
A 1 651 LEU 651 959  959  LEU LEU A . n 
A 1 652 SER 652 960  960  SER SER A . n 
A 1 653 SER 653 961  961  SER SER A . n 
A 1 654 PHE 654 962  962  PHE PHE A . n 
A 1 655 LYS 655 963  963  LYS LYS A . n 
A 1 656 PRO 656 964  964  PRO PRO A . n 
A 1 657 HIS 657 965  965  HIS HIS A . n 
A 1 658 LEU 658 966  966  LEU LEU A . n 
A 1 659 MET 659 967  967  MET MET A . n 
A 1 660 ASP 660 968  968  ASP ASP A . n 
A 1 661 VAL 661 969  969  VAL VAL A . n 
A 1 662 VAL 662 970  970  VAL VAL A . n 
A 1 663 TYR 663 971  971  TYR TYR A . n 
A 1 664 THR 664 972  972  THR THR A . n 
A 1 665 TRP 665 973  973  TRP TRP A . n 
A 1 666 ALA 666 974  974  ALA ALA A . n 
A 1 667 THR 667 975  975  THR THR A . n 
A 1 668 GLY 668 976  976  GLY GLY A . n 
A 1 669 ALA 669 977  977  ALA ALA A . n 
A 1 670 THR 670 978  978  THR THR A . n 
A 1 671 PHE 671 979  979  PHE PHE A . n 
A 1 672 ALA 672 980  980  ALA ALA A . n 
A 1 673 HIS 673 981  981  HIS HIS A . n 
A 1 674 ILE 674 982  982  ILE ILE A . n 
A 1 675 CYS 675 983  983  CYS CYS A . n 
A 1 676 LYS 676 984  984  LYS LYS A . n 
A 1 677 MET 677 985  985  MET MET A . n 
A 1 678 THR 678 986  986  THR THR A . n 
A 1 679 ASP 679 987  987  ASP ASP A . n 
A 1 680 VAL 680 988  988  VAL VAL A . n 
A 1 681 PHE 681 989  989  PHE PHE A . n 
A 1 682 GLU 682 990  990  GLU GLU A . n 
A 1 683 GLY 683 991  991  GLY GLY A . n 
A 1 684 SER 684 992  992  SER SER A . n 
A 1 685 ILE 685 993  993  ILE ILE A . n 
A 1 686 ILE 686 994  994  ILE ILE A . n 
A 1 687 ARG 687 995  995  ARG ARG A . n 
A 1 688 CYS 688 996  996  CYS CYS A . n 
A 1 689 MET 689 997  997  MET MET A . n 
A 1 690 ARG 690 998  998  ARG ARG A . n 
A 1 691 ARG 691 999  999  ARG ARG A . n 
A 1 692 LEU 692 1000 1000 LEU LEU A . n 
A 1 693 GLU 693 1001 1001 GLU GLU A . n 
A 1 694 GLU 694 1002 1002 GLU GLU A . n 
A 1 695 LEU 695 1003 1003 LEU LEU A . n 
A 1 696 LEU 696 1004 1004 LEU LEU A . n 
A 1 697 ARG 697 1005 1005 ARG ARG A . n 
A 1 698 GLN 698 1006 1006 GLN GLN A . n 
A 1 699 MET 699 1007 1007 MET MET A . n 
A 1 700 CYS 700 1008 1008 CYS CYS A . n 
A 1 701 GLN 701 1009 1009 GLN GLN A . n 
A 1 702 ALA 702 1010 1010 ALA ALA A . n 
A 1 703 ALA 703 1011 1011 ALA ALA A . n 
A 1 704 LYS 704 1012 1012 LYS LYS A . n 
A 1 705 ALA 705 1013 1013 ALA ALA A . n 
A 1 706 ILE 706 1014 1014 ILE ILE A . n 
A 1 707 GLY 707 1015 1015 GLY GLY A . n 
A 1 708 ASN 708 1016 1016 ASN ASN A . n 
A 1 709 THR 709 1017 1017 THR THR A . n 
A 1 710 GLU 710 1018 1018 GLU GLU A . n 
A 1 711 LEU 711 1019 1019 LEU LEU A . n 
A 1 712 GLU 712 1020 1020 GLU GLU A . n 
A 1 713 ASN 713 1021 1021 ASN ASN A . n 
A 1 714 LYS 714 1022 1022 LYS LYS A . n 
A 1 715 PHE 715 1023 1023 PHE PHE A . n 
A 1 716 ALA 716 1024 1024 ALA ALA A . n 
A 1 717 GLU 717 1025 1025 GLU GLU A . n 
A 1 718 GLY 718 1026 1026 GLY GLY A . n 
A 1 719 ILE 719 1027 1027 ILE ILE A . n 
A 1 720 THR 720 1028 1028 THR THR A . n 
A 1 721 LYS 721 1029 1029 LYS LYS A . n 
A 1 722 ILE 722 1030 1030 ILE ILE A . n 
A 1 723 LYS 723 1031 1031 LYS LYS A . n 
A 1 724 ARG 724 1032 1032 ARG ARG A . n 
A 1 725 ASP 725 1033 1033 ASP ASP A . n 
A 1 726 ILE 726 1034 1034 ILE ILE A . n 
A 1 727 VAL 727 1035 1035 VAL VAL A . n 
A 1 728 PHE 728 1036 1036 PHE PHE A . n 
A 1 729 ALA 729 1037 1037 ALA ALA A . n 
A 1 730 ALA 730 1038 1038 ALA ALA A . n 
A 1 731 SER 731 1039 1039 SER SER A . n 
A 1 732 LEU 732 1040 1040 LEU LEU A . n 
A 1 733 TYR 733 1041 1041 TYR TYR A . n 
A 1 734 LEU 734 1042 1042 LEU LEU A . n 
B 2 1   SER 1   656  ?    ?   ?   B . n 
B 2 2   GLY 2   657  ?    ?   ?   B . n 
B 2 3   ASP 3   658  ?    ?   ?   B . n 
B 2 4   PRO 4   659  659  PRO PRO B . n 
B 2 5   ILE 5   660  660  ILE ILE B . n 
B 2 6   PRO 6   661  661  PRO PRO B . n 
B 2 7   ASP 7   662  662  ASP ASP B . n 
B 2 8   MET 8   663  663  MET MET B . n 
B 2 9   SER 9   664  664  SER SER B . n 
B 2 10  LYS 10  665  665  LYS LYS B . n 
B 2 11  PHE 11  666  666  PHE PHE B . n 
B 2 12  ALA 12  667  667  ALA ALA B . n 
B 2 13  THR 13  668  668  THR THR B . n 
B 2 14  GLY 14  669  669  GLY GLY B . n 
B 2 15  ILE 15  670  670  ILE ILE B . n 
B 2 16  THR 16  671  671  THR THR B . n 
B 2 17  PRO 17  672  672  PRO PRO B . n 
B 2 18  PHE 18  673  673  PHE PHE B . n 
B 2 19  GLU 19  674  674  GLU GLU B . n 
B 2 20  PHE 20  675  675  PHE PHE B . n 
B 2 21  GLU 21  676  676  GLU GLU B . n 
B 2 22  ASN 22  677  677  ASN ASN B . n 
B 2 23  MET 23  678  678  MET MET B . n 
B 2 24  ALA 24  679  679  ALA ALA B . n 
B 2 25  GLU 25  680  680  GLU GLU B . n 
B 2 26  SER 26  681  681  SER SER B . n 
B 2 27  THR 27  682  682  THR THR B . n 
B 2 28  GLY 28  683  683  GLY GLY B . n 
B 2 29  MET 29  684  684  MET MET B . n 
B 2 30  TYR 30  685  685  TYR TYR B . n 
B 2 31  LEU 31  686  686  LEU LEU B . n 
B 2 32  ARG 32  687  687  ARG ARG B . n 
B 2 33  ILE 33  688  688  ILE ILE B . n 
B 2 34  ARG 34  689  689  ARG ARG B . n 
B 2 35  SER 35  690  690  SER SER B . n 
B 2 36  LEU 36  691  691  LEU LEU B . n 
B 2 37  LEU 37  692  692  LEU LEU B . n 
B 2 38  LYS 38  693  693  LYS LYS B . n 
B 2 39  ASN 39  694  694  ASN ASN B . n 
B 2 40  SER 40  695  695  SER SER B . n 
B 2 41  PRO 41  696  696  PRO PRO B . n 
B 2 42  ARG 42  697  697  ARG ARG B . n 
B 2 43  ASN 43  698  698  ASN ASN B . n 
B 2 44  GLN 44  699  699  GLN GLN B . n 
B 2 45  GLN 45  700  700  GLN GLN B . n 
B 2 46  LYS 46  701  ?    ?   ?   B . n 
B 2 47  ASN 47  702  ?    ?   ?   B . n 
B 2 48  LYS 48  703  ?    ?   ?   B . n 
B 2 49  LYS 49  704  ?    ?   ?   B . n 
B 2 50  ALA 50  705  ?    ?   ?   B . n 
B 2 51  SER 51  706  ?    ?   ?   B . n 
B 2 52  GLU 52  707  ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ADP 1   1101 1   ADP ADP A . 
D 4 MG  1   1102 1   MG  MG  A . 
E 4 MG  1   1103 2   MG  MG  A . 
F 5 MLI 1   1104 1   MLI MLI A . 
G 5 MLI 1   1105 2   MLI MLI A . 
H 5 MLI 1   1106 3   MLI MLI A . 
I 5 MLI 1   1107 4   MLI MLI A . 
J 6 TLA 1   1108 1   TLA TLA A . 
K 7 HOH 1   1201 276 HOH HOH A . 
K 7 HOH 2   1202 225 HOH HOH A . 
K 7 HOH 3   1203 272 HOH HOH A . 
K 7 HOH 4   1204 252 HOH HOH A . 
K 7 HOH 5   1205 248 HOH HOH A . 
K 7 HOH 6   1206 195 HOH HOH A . 
K 7 HOH 7   1207 261 HOH HOH A . 
K 7 HOH 8   1208 80  HOH HOH A . 
K 7 HOH 9   1209 2   HOH HOH A . 
K 7 HOH 10  1210 198 HOH HOH A . 
K 7 HOH 11  1211 82  HOH HOH A . 
K 7 HOH 12  1212 108 HOH HOH A . 
K 7 HOH 13  1213 45  HOH HOH A . 
K 7 HOH 14  1214 255 HOH HOH A . 
K 7 HOH 15  1215 30  HOH HOH A . 
K 7 HOH 16  1216 20  HOH HOH A . 
K 7 HOH 17  1217 269 HOH HOH A . 
K 7 HOH 18  1218 190 HOH HOH A . 
K 7 HOH 19  1219 166 HOH HOH A . 
K 7 HOH 20  1220 256 HOH HOH A . 
K 7 HOH 21  1221 245 HOH HOH A . 
K 7 HOH 22  1222 57  HOH HOH A . 
K 7 HOH 23  1223 93  HOH HOH A . 
K 7 HOH 24  1224 161 HOH HOH A . 
K 7 HOH 25  1225 91  HOH HOH A . 
K 7 HOH 26  1226 220 HOH HOH A . 
K 7 HOH 27  1227 7   HOH HOH A . 
K 7 HOH 28  1228 209 HOH HOH A . 
K 7 HOH 29  1229 19  HOH HOH A . 
K 7 HOH 30  1230 36  HOH HOH A . 
K 7 HOH 31  1231 222 HOH HOH A . 
K 7 HOH 32  1232 118 HOH HOH A . 
K 7 HOH 33  1233 154 HOH HOH A . 
K 7 HOH 34  1234 11  HOH HOH A . 
K 7 HOH 35  1235 113 HOH HOH A . 
K 7 HOH 36  1236 65  HOH HOH A . 
K 7 HOH 37  1237 122 HOH HOH A . 
K 7 HOH 38  1238 210 HOH HOH A . 
K 7 HOH 39  1239 83  HOH HOH A . 
K 7 HOH 40  1240 201 HOH HOH A . 
K 7 HOH 41  1241 169 HOH HOH A . 
K 7 HOH 42  1242 71  HOH HOH A . 
K 7 HOH 43  1243 136 HOH HOH A . 
K 7 HOH 44  1244 287 HOH HOH A . 
K 7 HOH 45  1245 141 HOH HOH A . 
K 7 HOH 46  1246 22  HOH HOH A . 
K 7 HOH 47  1247 159 HOH HOH A . 
K 7 HOH 48  1248 48  HOH HOH A . 
K 7 HOH 49  1249 38  HOH HOH A . 
K 7 HOH 50  1250 40  HOH HOH A . 
K 7 HOH 51  1251 28  HOH HOH A . 
K 7 HOH 52  1252 128 HOH HOH A . 
K 7 HOH 53  1253 66  HOH HOH A . 
K 7 HOH 54  1254 105 HOH HOH A . 
K 7 HOH 55  1255 281 HOH HOH A . 
K 7 HOH 56  1256 9   HOH HOH A . 
K 7 HOH 57  1257 237 HOH HOH A . 
K 7 HOH 58  1258 64  HOH HOH A . 
K 7 HOH 59  1259 3   HOH HOH A . 
K 7 HOH 60  1260 23  HOH HOH A . 
K 7 HOH 61  1261 61  HOH HOH A . 
K 7 HOH 62  1262 21  HOH HOH A . 
K 7 HOH 63  1263 6   HOH HOH A . 
K 7 HOH 64  1264 189 HOH HOH A . 
K 7 HOH 65  1265 217 HOH HOH A . 
K 7 HOH 66  1266 16  HOH HOH A . 
K 7 HOH 67  1267 17  HOH HOH A . 
K 7 HOH 68  1268 137 HOH HOH A . 
K 7 HOH 69  1269 151 HOH HOH A . 
K 7 HOH 70  1270 274 HOH HOH A . 
K 7 HOH 71  1271 285 HOH HOH A . 
K 7 HOH 72  1272 4   HOH HOH A . 
K 7 HOH 73  1273 68  HOH HOH A . 
K 7 HOH 74  1274 10  HOH HOH A . 
K 7 HOH 75  1275 25  HOH HOH A . 
K 7 HOH 76  1276 99  HOH HOH A . 
K 7 HOH 77  1277 8   HOH HOH A . 
K 7 HOH 78  1278 109 HOH HOH A . 
K 7 HOH 79  1279 44  HOH HOH A . 
K 7 HOH 80  1280 170 HOH HOH A . 
K 7 HOH 81  1281 86  HOH HOH A . 
K 7 HOH 82  1282 140 HOH HOH A . 
K 7 HOH 83  1283 31  HOH HOH A . 
K 7 HOH 84  1284 79  HOH HOH A . 
K 7 HOH 85  1285 32  HOH HOH A . 
K 7 HOH 86  1286 212 HOH HOH A . 
K 7 HOH 87  1287 243 HOH HOH A . 
K 7 HOH 88  1288 120 HOH HOH A . 
K 7 HOH 89  1289 253 HOH HOH A . 
K 7 HOH 90  1290 215 HOH HOH A . 
K 7 HOH 91  1291 29  HOH HOH A . 
K 7 HOH 92  1292 62  HOH HOH A . 
K 7 HOH 93  1293 67  HOH HOH A . 
K 7 HOH 94  1294 73  HOH HOH A . 
K 7 HOH 95  1295 102 HOH HOH A . 
K 7 HOH 96  1296 49  HOH HOH A . 
K 7 HOH 97  1297 33  HOH HOH A . 
K 7 HOH 98  1298 42  HOH HOH A . 
K 7 HOH 99  1299 291 HOH HOH A . 
K 7 HOH 100 1300 277 HOH HOH A . 
K 7 HOH 101 1301 41  HOH HOH A . 
K 7 HOH 102 1302 5   HOH HOH A . 
K 7 HOH 103 1303 186 HOH HOH A . 
K 7 HOH 104 1304 289 HOH HOH A . 
K 7 HOH 105 1305 76  HOH HOH A . 
K 7 HOH 106 1306 98  HOH HOH A . 
K 7 HOH 107 1307 92  HOH HOH A . 
K 7 HOH 108 1308 117 HOH HOH A . 
K 7 HOH 109 1309 247 HOH HOH A . 
K 7 HOH 110 1310 152 HOH HOH A . 
K 7 HOH 111 1311 192 HOH HOH A . 
K 7 HOH 112 1312 96  HOH HOH A . 
K 7 HOH 113 1313 59  HOH HOH A . 
K 7 HOH 114 1314 27  HOH HOH A . 
K 7 HOH 115 1315 130 HOH HOH A . 
K 7 HOH 116 1316 135 HOH HOH A . 
K 7 HOH 117 1317 116 HOH HOH A . 
K 7 HOH 118 1318 181 HOH HOH A . 
K 7 HOH 119 1319 95  HOH HOH A . 
K 7 HOH 120 1320 89  HOH HOH A . 
K 7 HOH 121 1321 226 HOH HOH A . 
K 7 HOH 122 1322 37  HOH HOH A . 
K 7 HOH 123 1323 204 HOH HOH A . 
K 7 HOH 124 1324 12  HOH HOH A . 
K 7 HOH 125 1325 224 HOH HOH A . 
K 7 HOH 126 1326 132 HOH HOH A . 
K 7 HOH 127 1327 254 HOH HOH A . 
K 7 HOH 128 1328 115 HOH HOH A . 
K 7 HOH 129 1329 51  HOH HOH A . 
K 7 HOH 130 1330 238 HOH HOH A . 
K 7 HOH 131 1331 46  HOH HOH A . 
K 7 HOH 132 1332 74  HOH HOH A . 
K 7 HOH 133 1333 43  HOH HOH A . 
K 7 HOH 134 1334 251 HOH HOH A . 
K 7 HOH 135 1335 216 HOH HOH A . 
K 7 HOH 136 1336 85  HOH HOH A . 
K 7 HOH 137 1337 112 HOH HOH A . 
K 7 HOH 138 1338 90  HOH HOH A . 
K 7 HOH 139 1339 55  HOH HOH A . 
K 7 HOH 140 1340 78  HOH HOH A . 
K 7 HOH 141 1341 26  HOH HOH A . 
K 7 HOH 142 1342 294 HOH HOH A . 
K 7 HOH 143 1343 139 HOH HOH A . 
K 7 HOH 144 1344 53  HOH HOH A . 
K 7 HOH 145 1345 114 HOH HOH A . 
K 7 HOH 146 1346 75  HOH HOH A . 
K 7 HOH 147 1347 246 HOH HOH A . 
K 7 HOH 148 1348 191 HOH HOH A . 
K 7 HOH 149 1349 126 HOH HOH A . 
K 7 HOH 150 1350 223 HOH HOH A . 
K 7 HOH 151 1351 84  HOH HOH A . 
K 7 HOH 152 1352 63  HOH HOH A . 
K 7 HOH 153 1353 34  HOH HOH A . 
K 7 HOH 154 1354 168 HOH HOH A . 
K 7 HOH 155 1355 123 HOH HOH A . 
K 7 HOH 156 1356 233 HOH HOH A . 
K 7 HOH 157 1357 143 HOH HOH A . 
K 7 HOH 158 1358 188 HOH HOH A . 
K 7 HOH 159 1359 81  HOH HOH A . 
K 7 HOH 160 1360 173 HOH HOH A . 
K 7 HOH 161 1361 164 HOH HOH A . 
K 7 HOH 162 1362 77  HOH HOH A . 
K 7 HOH 163 1363 177 HOH HOH A . 
K 7 HOH 164 1364 156 HOH HOH A . 
K 7 HOH 165 1365 202 HOH HOH A . 
K 7 HOH 166 1366 279 HOH HOH A . 
K 7 HOH 167 1367 47  HOH HOH A . 
K 7 HOH 168 1368 147 HOH HOH A . 
K 7 HOH 169 1369 230 HOH HOH A . 
K 7 HOH 170 1370 14  HOH HOH A . 
K 7 HOH 171 1371 15  HOH HOH A . 
K 7 HOH 172 1372 292 HOH HOH A . 
K 7 HOH 173 1373 174 HOH HOH A . 
K 7 HOH 174 1374 87  HOH HOH A . 
K 7 HOH 175 1375 18  HOH HOH A . 
K 7 HOH 176 1376 172 HOH HOH A . 
K 7 HOH 177 1377 138 HOH HOH A . 
K 7 HOH 178 1378 157 HOH HOH A . 
K 7 HOH 179 1379 149 HOH HOH A . 
K 7 HOH 180 1380 107 HOH HOH A . 
K 7 HOH 181 1381 218 HOH HOH A . 
K 7 HOH 182 1382 175 HOH HOH A . 
K 7 HOH 183 1383 69  HOH HOH A . 
K 7 HOH 184 1384 97  HOH HOH A . 
K 7 HOH 185 1385 39  HOH HOH A . 
K 7 HOH 186 1386 155 HOH HOH A . 
K 7 HOH 187 1387 219 HOH HOH A . 
K 7 HOH 188 1388 228 HOH HOH A . 
K 7 HOH 189 1389 240 HOH HOH A . 
K 7 HOH 190 1390 284 HOH HOH A . 
K 7 HOH 191 1391 165 HOH HOH A . 
K 7 HOH 192 1392 257 HOH HOH A . 
K 7 HOH 193 1393 163 HOH HOH A . 
K 7 HOH 194 1394 50  HOH HOH A . 
K 7 HOH 195 1395 290 HOH HOH A . 
K 7 HOH 196 1396 162 HOH HOH A . 
K 7 HOH 197 1397 180 HOH HOH A . 
K 7 HOH 198 1398 179 HOH HOH A . 
K 7 HOH 199 1399 150 HOH HOH A . 
K 7 HOH 200 1400 94  HOH HOH A . 
K 7 HOH 201 1401 278 HOH HOH A . 
K 7 HOH 202 1402 199 HOH HOH A . 
K 7 HOH 203 1403 211 HOH HOH A . 
K 7 HOH 204 1404 234 HOH HOH A . 
K 7 HOH 205 1405 250 HOH HOH A . 
K 7 HOH 206 1406 259 HOH HOH A . 
K 7 HOH 207 1407 167 HOH HOH A . 
K 7 HOH 208 1408 197 HOH HOH A . 
K 7 HOH 209 1409 288 HOH HOH A . 
K 7 HOH 210 1410 203 HOH HOH A . 
K 7 HOH 211 1411 229 HOH HOH A . 
K 7 HOH 212 1412 227 HOH HOH A . 
K 7 HOH 213 1413 293 HOH HOH A . 
K 7 HOH 214 1414 265 HOH HOH A . 
K 7 HOH 215 1415 125 HOH HOH A . 
K 7 HOH 216 1416 249 HOH HOH A . 
K 7 HOH 217 1417 268 HOH HOH A . 
K 7 HOH 218 1418 286 HOH HOH A . 
K 7 HOH 219 1419 205 HOH HOH A . 
K 7 HOH 220 1420 264 HOH HOH A . 
K 7 HOH 221 1421 148 HOH HOH A . 
K 7 HOH 222 1422 258 HOH HOH A . 
K 7 HOH 223 1423 235 HOH HOH A . 
K 7 HOH 224 1424 267 HOH HOH A . 
K 7 HOH 225 1425 270 HOH HOH A . 
K 7 HOH 226 1426 200 HOH HOH A . 
K 7 HOH 227 1427 273 HOH HOH A . 
L 7 HOH 1   801  231 HOH HOH B . 
L 7 HOH 2   802  13  HOH HOH B . 
L 7 HOH 3   803  236 HOH HOH B . 
L 7 HOH 4   804  60  HOH HOH B . 
L 7 HOH 5   805  101 HOH HOH B . 
L 7 HOH 6   806  106 HOH HOH B . 
L 7 HOH 7   807  275 HOH HOH B . 
L 7 HOH 8   808  142 HOH HOH B . 
L 7 HOH 9   809  232 HOH HOH B . 
L 7 HOH 10  810  182 HOH HOH B . 
L 7 HOH 11  811  193 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6540  ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  29080 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A LEU 506 ? A LEU 573  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A LEU 507 ? A LEU 574  ? 1_555 84.3  ? 
2  O ? A LEU 506 ? A LEU 573  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A VAL 509 ? A VAL 576  ? 1_555 87.5  ? 
3  O ? A LEU 507 ? A LEU 574  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A VAL 509 ? A VAL 576  ? 1_555 96.0  ? 
4  O ? A LEU 506 ? A LEU 573  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A ILE 512 ? A ILE 579  ? 1_555 81.5  ? 
5  O ? A LEU 507 ? A LEU 574  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A ILE 512 ? A ILE 579  ? 1_555 162.9 ? 
6  O ? A VAL 509 ? A VAL 576  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? A ILE 512 ? A ILE 579  ? 1_555 92.7  ? 
7  O ? A LEU 506 ? A LEU 573  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1399 ? 1_555 173.4 ? 
8  O ? A LEU 507 ? A LEU 574  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1399 ? 1_555 89.1  ? 
9  O ? A VAL 509 ? A VAL 576  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1399 ? 1_555 93.1  ? 
10 O ? A ILE 512 ? A ILE 579  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1399 ? 1_555 105.0 ? 
11 O ? A LEU 506 ? A LEU 573  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1379 ? 1_555 104.7 ? 
12 O ? A LEU 507 ? A LEU 574  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1379 ? 1_555 86.7  ? 
13 O ? A VAL 509 ? A VAL 576  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1379 ? 1_555 167.7 ? 
14 O ? A ILE 512 ? A ILE 579  ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1379 ? 1_555 87.8  ? 
15 O ? K HOH .   ? A HOH 1399 ? 1_555 MG ? E MG . ? A MG 1103 ? 1_555 O ? K HOH .   ? A HOH 1379 ? 1_555 74.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-05-30 
2 'Structure model' 1 1 2018-06-13 
3 'Structure model' 1 2 2018-06-20 
4 'Structure model' 1 3 2019-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Data collection'            
4 3 'Structure model' 'Database references'        
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 3 'Structure model' citation           
3 4 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'                 
2 2 'Structure model' '_citation.pdbx_database_id_DOI'           
3 2 'Structure model' '_citation.pdbx_database_id_PubMed'        
4 2 'Structure model' '_citation.title'                          
5 3 'Structure model' '_citation.journal_volume'                 
6 3 'Structure model' '_citation.page_first'                     
7 3 'Structure model' '_citation.page_last'                      
8 4 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? '(1.13_2998: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .                  4 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot      ? ? ? .                  5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 A GLU 879  ? ? O A HOH 1201 ? ? 1.97 
2 1 O   A HOH 1417 ? ? O A HOH 1424 ? ? 2.00 
3 1 OG1 A THR 221  ? ? O A HOH 1202 ? ? 2.08 
4 1 O8  A MLI 1106 ? ? O A HOH 1203 ? ? 2.12 
5 1 O   B ALA 667  ? ? O B HOH 801  ? ? 2.14 
6 1 OD2 A ASP 435  ? ? O A HOH 1204 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 164  ? ? 125.16  -22.79  
2  1 GLN A 207  ? ? 65.28   -56.50  
3  1 ASP A 208  ? ? -68.93  59.28   
4  1 GLU A 261  ? ? 83.09   -4.96   
5  1 PHE A 394  ? ? -87.44  32.80   
6  1 ASP A 505  ? ? -85.65  37.97   
7  1 LYS A 507  ? ? -127.83 -61.32  
8  1 ASP A 884  ? ? -65.49  95.94   
9  1 ASP A 1033 ? ? 67.44   -159.11 
10 1 LEU B 692  ? ? -115.13 66.80   
11 1 ASN B 694  ? ? -117.59 57.86   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 351 ? CG  ? A ARG 284 CG  
2  1 Y 1 A ARG 351 ? CD  ? A ARG 284 CD  
3  1 Y 1 A ARG 351 ? NE  ? A ARG 284 NE  
4  1 Y 1 A ARG 351 ? CZ  ? A ARG 284 CZ  
5  1 Y 1 A ARG 351 ? NH1 ? A ARG 284 NH1 
6  1 Y 1 A ARG 351 ? NH2 ? A ARG 284 NH2 
7  1 Y 1 B GLN 700 ? CG  ? B GLN 45  CG  
8  1 Y 1 B GLN 700 ? CD  ? B GLN 45  CD  
9  1 Y 1 B GLN 700 ? OE1 ? B GLN 45  OE1 
10 1 Y 1 B GLN 700 ? NE2 ? B GLN 45  NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 68  ? A SER 1   
2  1 Y 1 A GLY 69  ? A GLY 2   
3  1 Y 1 A ASP 70  ? A ASP 3   
4  1 Y 1 A THR 71  ? A THR 4   
5  1 Y 1 A ASP 72  ? A ASP 5   
6  1 Y 1 A GLU 73  ? A GLU 6   
7  1 Y 1 A PRO 74  ? A PRO 7   
8  1 Y 1 A ILE 75  ? A ILE 8   
9  1 Y 1 A PHE 76  ? A PHE 9   
10 1 Y 1 A GLY 77  ? A GLY 10  
11 1 Y 1 A LYS 78  ? A LYS 11  
12 1 Y 1 A LYS 79  ? A LYS 12  
13 1 Y 1 A PRO 80  ? A PRO 13  
14 1 Y 1 A ARG 81  ? A ARG 14  
15 1 Y 1 A ILE 82  ? A ILE 15  
16 1 Y 1 A GLU 83  ? A GLU 16  
17 1 Y 1 A GLU 84  ? A GLU 17  
18 1 Y 1 A SER 85  ? A SER 18  
19 1 Y 1 A ILE 86  ? A ILE 19  
20 1 Y 1 A THR 87  ? A THR 20  
21 1 Y 1 A GLU 88  ? A GLU 21  
22 1 Y 1 A ASP 89  ? A ASP 22  
23 1 Y 1 A ASP 352 ? A ASP 285 
24 1 Y 1 A ALA 353 ? A ALA 286 
25 1 Y 1 A GLY 354 ? A GLY 287 
26 1 Y 1 A ASP 355 ? A ASP 288 
27 1 Y 1 A LEU 356 ? A LEU 289 
28 1 Y 1 A ALA 357 ? A ALA 290 
29 1 Y 1 A LYS 358 ? A LYS 291 
30 1 Y 1 A GLY 359 ? A GLY 292 
31 1 Y 1 A ASP 360 ? A ASP 293 
32 1 Y 1 A GLN 361 ? A GLN 294 
33 1 Y 1 A LYS 362 ? A LYS 295 
34 1 Y 1 A GLY 363 ? A GLY 296 
35 1 Y 1 A ARG 364 ? A ARG 297 
36 1 Y 1 A LYS 365 ? A LYS 298 
37 1 Y 1 A GLY 366 ? A GLY 299 
38 1 Y 1 A GLY 367 ? A GLY 300 
39 1 Y 1 A THR 368 ? A THR 301 
40 1 Y 1 A LYS 369 ? A LYS 302 
41 1 Y 1 B SER 656 ? B SER 1   
42 1 Y 1 B GLY 657 ? B GLY 2   
43 1 Y 1 B ASP 658 ? B ASP 3   
44 1 Y 1 B LYS 701 ? B LYS 46  
45 1 Y 1 B ASN 702 ? B ASN 47  
46 1 Y 1 B LYS 703 ? B LYS 48  
47 1 Y 1 B LYS 704 ? B LYS 49  
48 1 Y 1 B ALA 705 ? B ALA 50  
49 1 Y 1 B SER 706 ? B SER 51  
50 1 Y 1 B GLU 707 ? B GLU 52  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM118080 1 
'Howard Hughes Medical Institute (HHMI)'                                                   'United States' ?        2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 'MAGNESIUM ION'            MG  
5 'MALONATE ION'             MLI 
6 'L(+)-TARTARIC ACID'       TLA 
7 water                      HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#