data_6CG0
# 
_entry.id   6CG0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CG0         
WWPDB D_1000232668 
EMDB  EMD-7470     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'RAG1/2 HFC complex' 
_pdbx_database_related.db_id          EMD-7470 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CG0 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chen, X.'      1 ? 
'Kim, M.'       2 ? 
'Chuenchor, W.' 3 ? 
'Cui, Y.'       4 ? 
'Zhang, X.'     5 ? 
'Zhou, Z.H.'    6 ? 
'Gellert, M.'   7 ? 
'Yang, W.'      8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            70 
_citation.language                  ? 
_citation.page_first                358 
_citation.page_last                 370.e4 
_citation.title                     'Cracking the DNA Code for V(D)J Recombination.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2018.03.008 
_citation.pdbx_database_id_PubMed   29628308 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, M.S.'     1 ? 
primary 'Chuenchor, W.' 2 ? 
primary 'Chen, X.'      3 ? 
primary 'Cui, Y.'       4 ? 
primary 'Zhang, X.'     5 ? 
primary 'Zhou, Z.H.'    6 ? 
primary 'Gellert, M.'   7 ? 
primary 'Yang, W.'      8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CG0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CG0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'V(D)J recombination-activating protein 1'                                 88523.633 2 3.1.-.-,2.3.2.27 ? ? ? 
2  polymer     man 'V(D)J recombination-activating protein 2'                                 58158.254 2 ?                ? ? ? 
3  polymer     syn 'DNA (46-MER)'                                                             14268.144 1 ?                ? ? ? 
4  polymer     syn 
;DNA (5'-D(*GP*AP*TP*CP*TP*GP*GP*CP*CP*TP*GP*TP*CP*TP*TP*A)-3')
;
4880.164  1 ?                ? ? ? 
5  polymer     syn 
;DNA (5'-D(P*CP*TP*GP*GP*AP*TP*CP*TP*GP*GP*CP*CP*TP*GP*TP*CP*TP*TP*A)-3')
;
5802.744  1 ?                ? ? ? 
6  polymer     syn 'DNA (60-MER)'                                                             18479.818 1 ?                ? ? ? 
7  polymer     syn 'DNA (30-MER)'                                                             9138.938  1 ?                ? ? ? 
8  polymer     syn 'DNA (41-MER)'                                                             12655.191 1 ?                ? ? ? 
9  polymer     man 'High mobility group protein B1'                                           14604.746 1 ?                ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                 65.409    2 ?                ? ? ? 
11 non-polymer syn 'CALCIUM ION'                                                              40.078    2 ?                ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 RAG-1                                 
2 RAG-2                                 
9 'High mobility group protein 1,HMG-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSF
LNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEG
GDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALR
NAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLD
DYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESD
HETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFH
SITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKE
ERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPE
SLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNQSGNKLFRRFRKMNARQSKCYEM
EDVLKHHWLYTSKYLQKFMNAHNALKSSGFTMNSKETLGDPLGIEDSLESQDSME
;
;NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSF
LNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEG
GDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALR
NAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLD
DYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESD
HETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFH
SITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKE
ERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPE
SLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNQSGNKLFRRFRKMNARQSKCYEM
EDVLKHHWLYTSKYLQKFMNAHNALKSSGFTMNSKETLGDPLGIEDSLESQDSME
;
A,C ? 
2 'polypeptide(L)'        no no 
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQKIVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFD
TYNEDDEDDESVTGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVQIARALQAPKRNPPLQKPPMKSLHKKGSGKVLTPAKKS
;
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQKIVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFD
TYNEDDEDDESVTGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVQIARALQAPKRNPPLQKPPMKSLHKKGSGKVLTPAKKS
;
D,B ? 
3 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DT)(DA)(DA)(DG)(DG)(DG)(DC)(DT)(DG)
(DT)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)
(DC)(DA)(DG)(DA)(DT)(DC)
;
CGGGTTTTTGTTAAGGGCTGTATCACTGTGTAAGACAGGCCAGATC F   ? 
4 polydeoxyribonucleotide no no '(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)' GATCTGGCCTGTCTTA I   ? 
5 polydeoxyribonucleotide no no '(DC)(DT)(DG)(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)' CTGGATCTGGCCTGTCTTA 
J   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DC)(DT)(DG)(DG)(DC)(DT)(DT)(DC)(DA)
(DC)(DA)(DC)(DT)(DT)(DG)(DA)(DT)(DT)(DT)(DG)(DC)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DT)
(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)(DC)(DC)(DA)(DG)
;
CGGGTTTTTGTCTGGCTTCACACTTGATTTGCATCACTGTGTAAGACAGGCCAGATCCAG G   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DA)(DG)(DT)(DG)(DA)(DT)(DA)(DC)(DA)(DG)(DC)(DC)(DC)(DT)(DT)(DA)(DA)
(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)(DG)
;
CACAGTGATACAGCCCTTAACAAAAACCCG L   ? 
8 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DA)(DG)(DT)(DG)(DA)(DT)(DG)(DC)(DA)(DA)(DA)(DT)(DC)(DA)(DA)(DG)(DT)
(DG)(DT)(DG)(DA)(DA)(DG)(DC)(DC)(DA)(DG)(DA)(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)
(DG)
;
CACAGTGATGCAAATCAAGTGTGAAGCCAGACAAAAACCCG M   ? 
9 'polypeptide(L)'        no no 
;SYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNA
PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
;
;SYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNA
PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
;
N   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   CYS n 
1 3   SER n 
1 4   LYS n 
1 5   ILE n 
1 6   HIS n 
1 7   LEU n 
1 8   SER n 
1 9   THR n 
1 10  LYS n 
1 11  LEU n 
1 12  LEU n 
1 13  ALA n 
1 14  VAL n 
1 15  ASP n 
1 16  PHE n 
1 17  PRO n 
1 18  ALA n 
1 19  HIS n 
1 20  PHE n 
1 21  VAL n 
1 22  LYS n 
1 23  SER n 
1 24  ILE n 
1 25  SER n 
1 26  CYS n 
1 27  GLN n 
1 28  ILE n 
1 29  CYS n 
1 30  GLU n 
1 31  HIS n 
1 32  ILE n 
1 33  LEU n 
1 34  ALA n 
1 35  ASP n 
1 36  PRO n 
1 37  VAL n 
1 38  GLU n 
1 39  THR n 
1 40  SER n 
1 41  CYS n 
1 42  LYS n 
1 43  HIS n 
1 44  LEU n 
1 45  PHE n 
1 46  CYS n 
1 47  ARG n 
1 48  ILE n 
1 49  CYS n 
1 50  ILE n 
1 51  LEU n 
1 52  ARG n 
1 53  CYS n 
1 54  LEU n 
1 55  LYS n 
1 56  VAL n 
1 57  MET n 
1 58  GLY n 
1 59  SER n 
1 60  TYR n 
1 61  CYS n 
1 62  PRO n 
1 63  SER n 
1 64  CYS n 
1 65  ARG n 
1 66  TYR n 
1 67  PRO n 
1 68  CYS n 
1 69  PHE n 
1 70  PRO n 
1 71  THR n 
1 72  ASP n 
1 73  LEU n 
1 74  GLU n 
1 75  SER n 
1 76  PRO n 
1 77  VAL n 
1 78  LYS n 
1 79  SER n 
1 80  PHE n 
1 81  LEU n 
1 82  ASN n 
1 83  ILE n 
1 84  LEU n 
1 85  ASN n 
1 86  SER n 
1 87  LEU n 
1 88  MET n 
1 89  VAL n 
1 90  LYS n 
1 91  CYS n 
1 92  PRO n 
1 93  ALA n 
1 94  GLN n 
1 95  ASP n 
1 96  CYS n 
1 97  ASN n 
1 98  GLU n 
1 99  GLU n 
1 100 VAL n 
1 101 SER n 
1 102 LEU n 
1 103 GLU n 
1 104 LYS n 
1 105 TYR n 
1 106 ASN n 
1 107 HIS n 
1 108 HIS n 
1 109 VAL n 
1 110 SER n 
1 111 SER n 
1 112 HIS n 
1 113 LYS n 
1 114 GLU n 
1 115 SER n 
1 116 LYS n 
1 117 GLU n 
1 118 THR n 
1 119 LEU n 
1 120 VAL n 
1 121 HIS n 
1 122 ILE n 
1 123 ASN n 
1 124 LYS n 
1 125 GLY n 
1 126 GLY n 
1 127 ARG n 
1 128 PRO n 
1 129 ARG n 
1 130 GLN n 
1 131 HIS n 
1 132 LEU n 
1 133 LEU n 
1 134 SER n 
1 135 LEU n 
1 136 THR n 
1 137 ARG n 
1 138 ARG n 
1 139 ALA n 
1 140 GLN n 
1 141 LYS n 
1 142 HIS n 
1 143 ARG n 
1 144 LEU n 
1 145 ARG n 
1 146 GLU n 
1 147 LEU n 
1 148 LYS n 
1 149 ILE n 
1 150 GLN n 
1 151 VAL n 
1 152 LYS n 
1 153 GLU n 
1 154 PHE n 
1 155 ALA n 
1 156 ASP n 
1 157 LYS n 
1 158 GLU n 
1 159 GLU n 
1 160 GLY n 
1 161 GLY n 
1 162 ASP n 
1 163 VAL n 
1 164 LYS n 
1 165 ALA n 
1 166 VAL n 
1 167 CYS n 
1 168 LEU n 
1 169 THR n 
1 170 LEU n 
1 171 PHE n 
1 172 LEU n 
1 173 LEU n 
1 174 ALA n 
1 175 LEU n 
1 176 ARG n 
1 177 ALA n 
1 178 ARG n 
1 179 ASN n 
1 180 GLU n 
1 181 HIS n 
1 182 ARG n 
1 183 GLN n 
1 184 ALA n 
1 185 ASP n 
1 186 GLU n 
1 187 LEU n 
1 188 GLU n 
1 189 ALA n 
1 190 ILE n 
1 191 MET n 
1 192 GLN n 
1 193 GLY n 
1 194 ARG n 
1 195 GLY n 
1 196 SER n 
1 197 GLY n 
1 198 LEU n 
1 199 GLN n 
1 200 PRO n 
1 201 ALA n 
1 202 VAL n 
1 203 CYS n 
1 204 LEU n 
1 205 ALA n 
1 206 ILE n 
1 207 ARG n 
1 208 VAL n 
1 209 ASN n 
1 210 THR n 
1 211 PHE n 
1 212 LEU n 
1 213 SER n 
1 214 CYS n 
1 215 SER n 
1 216 GLN n 
1 217 TYR n 
1 218 HIS n 
1 219 LYS n 
1 220 MET n 
1 221 TYR n 
1 222 ARG n 
1 223 THR n 
1 224 VAL n 
1 225 LYS n 
1 226 ALA n 
1 227 ILE n 
1 228 THR n 
1 229 GLY n 
1 230 ARG n 
1 231 GLN n 
1 232 ILE n 
1 233 PHE n 
1 234 GLN n 
1 235 PRO n 
1 236 LEU n 
1 237 HIS n 
1 238 ALA n 
1 239 LEU n 
1 240 ARG n 
1 241 ASN n 
1 242 ALA n 
1 243 GLU n 
1 244 LYS n 
1 245 VAL n 
1 246 LEU n 
1 247 LEU n 
1 248 PRO n 
1 249 GLY n 
1 250 TYR n 
1 251 HIS n 
1 252 PRO n 
1 253 PHE n 
1 254 GLU n 
1 255 TRP n 
1 256 GLN n 
1 257 PRO n 
1 258 PRO n 
1 259 LEU n 
1 260 LYS n 
1 261 ASN n 
1 262 VAL n 
1 263 SER n 
1 264 SER n 
1 265 ARG n 
1 266 THR n 
1 267 ASP n 
1 268 VAL n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ASP n 
1 273 GLY n 
1 274 LEU n 
1 275 SER n 
1 276 GLY n 
1 277 LEU n 
1 278 ALA n 
1 279 SER n 
1 280 SER n 
1 281 VAL n 
1 282 ASP n 
1 283 GLU n 
1 284 TYR n 
1 285 PRO n 
1 286 VAL n 
1 287 ASP n 
1 288 THR n 
1 289 ILE n 
1 290 ALA n 
1 291 LYS n 
1 292 ARG n 
1 293 PHE n 
1 294 ARG n 
1 295 TYR n 
1 296 ASP n 
1 297 SER n 
1 298 ALA n 
1 299 LEU n 
1 300 VAL n 
1 301 SER n 
1 302 ALA n 
1 303 LEU n 
1 304 MET n 
1 305 ASP n 
1 306 MET n 
1 307 GLU n 
1 308 GLU n 
1 309 ASP n 
1 310 ILE n 
1 311 LEU n 
1 312 GLU n 
1 313 GLY n 
1 314 MET n 
1 315 ARG n 
1 316 SER n 
1 317 GLN n 
1 318 ASP n 
1 319 LEU n 
1 320 ASP n 
1 321 ASP n 
1 322 TYR n 
1 323 LEU n 
1 324 ASN n 
1 325 GLY n 
1 326 PRO n 
1 327 PHE n 
1 328 THR n 
1 329 VAL n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 GLU n 
1 334 SER n 
1 335 CYS n 
1 336 ASP n 
1 337 GLY n 
1 338 MET n 
1 339 GLY n 
1 340 ASP n 
1 341 VAL n 
1 342 SER n 
1 343 GLU n 
1 344 LYS n 
1 345 HIS n 
1 346 GLY n 
1 347 SER n 
1 348 GLY n 
1 349 PRO n 
1 350 ALA n 
1 351 VAL n 
1 352 PRO n 
1 353 GLU n 
1 354 LYS n 
1 355 ALA n 
1 356 VAL n 
1 357 ARG n 
1 358 PHE n 
1 359 SER n 
1 360 PHE n 
1 361 THR n 
1 362 VAL n 
1 363 MET n 
1 364 ARG n 
1 365 ILE n 
1 366 THR n 
1 367 ILE n 
1 368 GLU n 
1 369 HIS n 
1 370 GLY n 
1 371 SER n 
1 372 GLN n 
1 373 ASN n 
1 374 VAL n 
1 375 LYS n 
1 376 VAL n 
1 377 PHE n 
1 378 GLU n 
1 379 GLU n 
1 380 PRO n 
1 381 LYS n 
1 382 PRO n 
1 383 ASN n 
1 384 SER n 
1 385 GLU n 
1 386 LEU n 
1 387 CYS n 
1 388 CYS n 
1 389 LYS n 
1 390 PRO n 
1 391 LEU n 
1 392 CYS n 
1 393 LEU n 
1 394 MET n 
1 395 LEU n 
1 396 ALA n 
1 397 ASP n 
1 398 GLU n 
1 399 SER n 
1 400 ASP n 
1 401 HIS n 
1 402 GLU n 
1 403 THR n 
1 404 LEU n 
1 405 THR n 
1 406 ALA n 
1 407 ILE n 
1 408 LEU n 
1 409 SER n 
1 410 PRO n 
1 411 LEU n 
1 412 ILE n 
1 413 ALA n 
1 414 GLU n 
1 415 ARG n 
1 416 GLU n 
1 417 ALA n 
1 418 MET n 
1 419 LYS n 
1 420 SER n 
1 421 SER n 
1 422 GLU n 
1 423 LEU n 
1 424 THR n 
1 425 LEU n 
1 426 GLU n 
1 427 MET n 
1 428 GLY n 
1 429 GLY n 
1 430 ILE n 
1 431 PRO n 
1 432 ARG n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 PHE n 
1 437 ILE n 
1 438 PHE n 
1 439 ARG n 
1 440 GLY n 
1 441 THR n 
1 442 GLY n 
1 443 TYR n 
1 444 ASP n 
1 445 GLU n 
1 446 LYS n 
1 447 LEU n 
1 448 VAL n 
1 449 ARG n 
1 450 GLU n 
1 451 VAL n 
1 452 GLU n 
1 453 GLY n 
1 454 LEU n 
1 455 GLU n 
1 456 ALA n 
1 457 SER n 
1 458 GLY n 
1 459 SER n 
1 460 VAL n 
1 461 TYR n 
1 462 ILE n 
1 463 CYS n 
1 464 THR n 
1 465 LEU n 
1 466 CYS n 
1 467 ASP n 
1 468 THR n 
1 469 THR n 
1 470 ARG n 
1 471 LEU n 
1 472 GLU n 
1 473 ALA n 
1 474 SER n 
1 475 GLN n 
1 476 ASN n 
1 477 LEU n 
1 478 VAL n 
1 479 PHE n 
1 480 HIS n 
1 481 SER n 
1 482 ILE n 
1 483 THR n 
1 484 ARG n 
1 485 SER n 
1 486 HIS n 
1 487 ALA n 
1 488 GLU n 
1 489 ASN n 
1 490 LEU n 
1 491 GLN n 
1 492 ARG n 
1 493 TYR n 
1 494 GLU n 
1 495 VAL n 
1 496 TRP n 
1 497 ARG n 
1 498 SER n 
1 499 ASN n 
1 500 PRO n 
1 501 TYR n 
1 502 HIS n 
1 503 GLU n 
1 504 SER n 
1 505 VAL n 
1 506 GLU n 
1 507 GLU n 
1 508 LEU n 
1 509 ARG n 
1 510 ASP n 
1 511 ARG n 
1 512 VAL n 
1 513 LYS n 
1 514 GLY n 
1 515 VAL n 
1 516 SER n 
1 517 ALA n 
1 518 LYS n 
1 519 PRO n 
1 520 PHE n 
1 521 ILE n 
1 522 GLU n 
1 523 THR n 
1 524 VAL n 
1 525 PRO n 
1 526 SER n 
1 527 ILE n 
1 528 ASP n 
1 529 ALA n 
1 530 LEU n 
1 531 HIS n 
1 532 CYS n 
1 533 ASP n 
1 534 ILE n 
1 535 GLY n 
1 536 ASN n 
1 537 ALA n 
1 538 ALA n 
1 539 GLU n 
1 540 PHE n 
1 541 TYR n 
1 542 LYS n 
1 543 ILE n 
1 544 PHE n 
1 545 GLN n 
1 546 LEU n 
1 547 GLU n 
1 548 ILE n 
1 549 GLY n 
1 550 GLU n 
1 551 VAL n 
1 552 TYR n 
1 553 LYS n 
1 554 HIS n 
1 555 PRO n 
1 556 ASN n 
1 557 ALA n 
1 558 SER n 
1 559 LYS n 
1 560 GLU n 
1 561 GLU n 
1 562 ARG n 
1 563 LYS n 
1 564 ARG n 
1 565 TRP n 
1 566 GLN n 
1 567 ALA n 
1 568 THR n 
1 569 LEU n 
1 570 ASP n 
1 571 LYS n 
1 572 HIS n 
1 573 LEU n 
1 574 ARG n 
1 575 LYS n 
1 576 ARG n 
1 577 MET n 
1 578 ASN n 
1 579 LEU n 
1 580 LYS n 
1 581 PRO n 
1 582 ILE n 
1 583 MET n 
1 584 ARG n 
1 585 MET n 
1 586 ASN n 
1 587 GLY n 
1 588 ASN n 
1 589 PHE n 
1 590 ALA n 
1 591 ARG n 
1 592 LYS n 
1 593 LEU n 
1 594 MET n 
1 595 THR n 
1 596 GLN n 
1 597 GLU n 
1 598 THR n 
1 599 VAL n 
1 600 ASP n 
1 601 ALA n 
1 602 VAL n 
1 603 CYS n 
1 604 GLU n 
1 605 LEU n 
1 606 ILE n 
1 607 PRO n 
1 608 SER n 
1 609 GLU n 
1 610 GLU n 
1 611 ARG n 
1 612 HIS n 
1 613 GLU n 
1 614 ALA n 
1 615 LEU n 
1 616 ARG n 
1 617 GLU n 
1 618 LEU n 
1 619 MET n 
1 620 ASP n 
1 621 LEU n 
1 622 TYR n 
1 623 LEU n 
1 624 LYS n 
1 625 MET n 
1 626 LYS n 
1 627 PRO n 
1 628 VAL n 
1 629 TRP n 
1 630 ARG n 
1 631 SER n 
1 632 SER n 
1 633 CYS n 
1 634 PRO n 
1 635 ALA n 
1 636 LYS n 
1 637 GLU n 
1 638 CYS n 
1 639 PRO n 
1 640 GLU n 
1 641 SER n 
1 642 LEU n 
1 643 CYS n 
1 644 GLN n 
1 645 TYR n 
1 646 SER n 
1 647 PHE n 
1 648 ASN n 
1 649 SER n 
1 650 GLN n 
1 651 ARG n 
1 652 PHE n 
1 653 ALA n 
1 654 GLU n 
1 655 LEU n 
1 656 LEU n 
1 657 SER n 
1 658 THR n 
1 659 LYS n 
1 660 PHE n 
1 661 LYS n 
1 662 TYR n 
1 663 ARG n 
1 664 TYR n 
1 665 GLU n 
1 666 GLY n 
1 667 LYS n 
1 668 ILE n 
1 669 THR n 
1 670 ASN n 
1 671 TYR n 
1 672 PHE n 
1 673 HIS n 
1 674 LYS n 
1 675 THR n 
1 676 LEU n 
1 677 ALA n 
1 678 HIS n 
1 679 VAL n 
1 680 PRO n 
1 681 GLU n 
1 682 ILE n 
1 683 ILE n 
1 684 GLU n 
1 685 ARG n 
1 686 ASP n 
1 687 GLY n 
1 688 SER n 
1 689 ILE n 
1 690 GLY n 
1 691 ALA n 
1 692 TRP n 
1 693 ALA n 
1 694 SER n 
1 695 GLU n 
1 696 GLY n 
1 697 ASN n 
1 698 GLN n 
1 699 SER n 
1 700 GLY n 
1 701 ASN n 
1 702 LYS n 
1 703 LEU n 
1 704 PHE n 
1 705 ARG n 
1 706 ARG n 
1 707 PHE n 
1 708 ARG n 
1 709 LYS n 
1 710 MET n 
1 711 ASN n 
1 712 ALA n 
1 713 ARG n 
1 714 GLN n 
1 715 SER n 
1 716 LYS n 
1 717 CYS n 
1 718 TYR n 
1 719 GLU n 
1 720 MET n 
1 721 GLU n 
1 722 ASP n 
1 723 VAL n 
1 724 LEU n 
1 725 LYS n 
1 726 HIS n 
1 727 HIS n 
1 728 TRP n 
1 729 LEU n 
1 730 TYR n 
1 731 THR n 
1 732 SER n 
1 733 LYS n 
1 734 TYR n 
1 735 LEU n 
1 736 GLN n 
1 737 LYS n 
1 738 PHE n 
1 739 MET n 
1 740 ASN n 
1 741 ALA n 
1 742 HIS n 
1 743 ASN n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 SER n 
1 748 SER n 
1 749 GLY n 
1 750 PHE n 
1 751 THR n 
1 752 MET n 
1 753 ASN n 
1 754 SER n 
1 755 LYS n 
1 756 GLU n 
1 757 THR n 
1 758 LEU n 
1 759 GLY n 
1 760 ASP n 
1 761 PRO n 
1 762 LEU n 
1 763 GLY n 
1 764 ILE n 
1 765 GLU n 
1 766 ASP n 
1 767 SER n 
1 768 LEU n 
1 769 GLU n 
1 770 SER n 
1 771 GLN n 
1 772 ASP n 
1 773 SER n 
1 774 MET n 
1 775 GLU n 
2 1   MET n 
2 2   SER n 
2 3   LEU n 
2 4   GLN n 
2 5   MET n 
2 6   VAL n 
2 7   THR n 
2 8   VAL n 
2 9   GLY n 
2 10  HIS n 
2 11  ASN n 
2 12  ILE n 
2 13  ALA n 
2 14  LEU n 
2 15  ILE n 
2 16  GLN n 
2 17  PRO n 
2 18  GLY n 
2 19  PHE n 
2 20  SER n 
2 21  LEU n 
2 22  MET n 
2 23  ASN n 
2 24  PHE n 
2 25  ASP n 
2 26  GLY n 
2 27  GLN n 
2 28  VAL n 
2 29  PHE n 
2 30  PHE n 
2 31  PHE n 
2 32  GLY n 
2 33  GLN n 
2 34  LYS n 
2 35  GLY n 
2 36  TRP n 
2 37  PRO n 
2 38  LYS n 
2 39  ARG n 
2 40  SER n 
2 41  CYS n 
2 42  PRO n 
2 43  THR n 
2 44  GLY n 
2 45  VAL n 
2 46  PHE n 
2 47  HIS n 
2 48  PHE n 
2 49  ASP n 
2 50  ILE n 
2 51  LYS n 
2 52  GLN n 
2 53  ASN n 
2 54  HIS n 
2 55  LEU n 
2 56  LYS n 
2 57  LEU n 
2 58  LYS n 
2 59  PRO n 
2 60  ALA n 
2 61  ILE n 
2 62  PHE n 
2 63  SER n 
2 64  LYS n 
2 65  ASP n 
2 66  SER n 
2 67  CYS n 
2 68  TYR n 
2 69  LEU n 
2 70  PRO n 
2 71  PRO n 
2 72  LEU n 
2 73  ARG n 
2 74  TYR n 
2 75  PRO n 
2 76  ALA n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  TYR n 
2 81  LYS n 
2 82  GLY n 
2 83  SER n 
2 84  ILE n 
2 85  ASP n 
2 86  SER n 
2 87  ASP n 
2 88  LYS n 
2 89  HIS n 
2 90  GLN n 
2 91  TYR n 
2 92  ILE n 
2 93  ILE n 
2 94  HIS n 
2 95  GLY n 
2 96  GLY n 
2 97  LYS n 
2 98  THR n 
2 99  PRO n 
2 100 ASN n 
2 101 ASN n 
2 102 GLU n 
2 103 LEU n 
2 104 SER n 
2 105 ASP n 
2 106 LYS n 
2 107 ILE n 
2 108 TYR n 
2 109 ILE n 
2 110 MET n 
2 111 SER n 
2 112 VAL n 
2 113 ALA n 
2 114 CYS n 
2 115 LYS n 
2 116 ASN n 
2 117 ASN n 
2 118 LYS n 
2 119 LYS n 
2 120 VAL n 
2 121 THR n 
2 122 PHE n 
2 123 ARG n 
2 124 CYS n 
2 125 THR n 
2 126 GLU n 
2 127 LYS n 
2 128 ASP n 
2 129 LEU n 
2 130 VAL n 
2 131 GLY n 
2 132 ASP n 
2 133 VAL n 
2 134 PRO n 
2 135 GLU n 
2 136 PRO n 
2 137 ARG n 
2 138 TYR n 
2 139 GLY n 
2 140 HIS n 
2 141 SER n 
2 142 ILE n 
2 143 ASP n 
2 144 VAL n 
2 145 VAL n 
2 146 TYR n 
2 147 SER n 
2 148 ARG n 
2 149 GLY n 
2 150 LYS n 
2 151 SER n 
2 152 MET n 
2 153 GLY n 
2 154 VAL n 
2 155 LEU n 
2 156 PHE n 
2 157 GLY n 
2 158 GLY n 
2 159 ARG n 
2 160 SER n 
2 161 TYR n 
2 162 MET n 
2 163 PRO n 
2 164 SER n 
2 165 THR n 
2 166 GLN n 
2 167 ARG n 
2 168 THR n 
2 169 THR n 
2 170 GLU n 
2 171 LYS n 
2 172 TRP n 
2 173 ASN n 
2 174 SER n 
2 175 VAL n 
2 176 ALA n 
2 177 ASP n 
2 178 CYS n 
2 179 LEU n 
2 180 PRO n 
2 181 HIS n 
2 182 VAL n 
2 183 PHE n 
2 184 LEU n 
2 185 ILE n 
2 186 ASP n 
2 187 PHE n 
2 188 GLU n 
2 189 PHE n 
2 190 GLY n 
2 191 CYS n 
2 192 ALA n 
2 193 THR n 
2 194 SER n 
2 195 TYR n 
2 196 ILE n 
2 197 LEU n 
2 198 PRO n 
2 199 GLU n 
2 200 LEU n 
2 201 GLN n 
2 202 ASP n 
2 203 GLY n 
2 204 LEU n 
2 205 SER n 
2 206 PHE n 
2 207 HIS n 
2 208 VAL n 
2 209 SER n 
2 210 ILE n 
2 211 ALA n 
2 212 ARG n 
2 213 ASN n 
2 214 ASP n 
2 215 THR n 
2 216 VAL n 
2 217 TYR n 
2 218 ILE n 
2 219 LEU n 
2 220 GLY n 
2 221 GLY n 
2 222 HIS n 
2 223 SER n 
2 224 LEU n 
2 225 ALA n 
2 226 SER n 
2 227 ASN n 
2 228 ILE n 
2 229 ARG n 
2 230 PRO n 
2 231 ALA n 
2 232 ASN n 
2 233 LEU n 
2 234 TYR n 
2 235 ARG n 
2 236 ILE n 
2 237 ARG n 
2 238 VAL n 
2 239 ASP n 
2 240 LEU n 
2 241 PRO n 
2 242 LEU n 
2 243 GLY n 
2 244 THR n 
2 245 PRO n 
2 246 ALA n 
2 247 VAL n 
2 248 ASN n 
2 249 CYS n 
2 250 THR n 
2 251 VAL n 
2 252 LEU n 
2 253 PRO n 
2 254 GLY n 
2 255 GLY n 
2 256 ILE n 
2 257 SER n 
2 258 VAL n 
2 259 SER n 
2 260 SER n 
2 261 ALA n 
2 262 ILE n 
2 263 LEU n 
2 264 THR n 
2 265 GLN n 
2 266 THR n 
2 267 ASN n 
2 268 ASN n 
2 269 ASP n 
2 270 GLU n 
2 271 PHE n 
2 272 VAL n 
2 273 ILE n 
2 274 VAL n 
2 275 GLY n 
2 276 GLY n 
2 277 TYR n 
2 278 GLN n 
2 279 LEU n 
2 280 GLU n 
2 281 ASN n 
2 282 GLN n 
2 283 LYS n 
2 284 ARG n 
2 285 MET n 
2 286 VAL n 
2 287 CYS n 
2 288 SER n 
2 289 LEU n 
2 290 VAL n 
2 291 SER n 
2 292 LEU n 
2 293 GLY n 
2 294 ASP n 
2 295 ASN n 
2 296 THR n 
2 297 ILE n 
2 298 GLU n 
2 299 ILE n 
2 300 SER n 
2 301 GLU n 
2 302 MET n 
2 303 GLU n 
2 304 THR n 
2 305 PRO n 
2 306 ASP n 
2 307 TRP n 
2 308 THR n 
2 309 SER n 
2 310 ASP n 
2 311 ILE n 
2 312 LYS n 
2 313 HIS n 
2 314 SER n 
2 315 LYS n 
2 316 ILE n 
2 317 TRP n 
2 318 PHE n 
2 319 GLY n 
2 320 SER n 
2 321 ASN n 
2 322 MET n 
2 323 GLY n 
2 324 ASN n 
2 325 GLY n 
2 326 THR n 
2 327 ILE n 
2 328 PHE n 
2 329 LEU n 
2 330 GLY n 
2 331 ILE n 
2 332 PRO n 
2 333 GLY n 
2 334 ASP n 
2 335 ASN n 
2 336 LYS n 
2 337 GLN n 
2 338 ALA n 
2 339 MET n 
2 340 SER n 
2 341 GLU n 
2 342 ALA n 
2 343 PHE n 
2 344 TYR n 
2 345 PHE n 
2 346 TYR n 
2 347 THR n 
2 348 LEU n 
2 349 ARG n 
2 350 CYS n 
2 351 SER n 
2 352 GLU n 
2 353 GLU n 
2 354 ASP n 
2 355 LEU n 
2 356 SER n 
2 357 GLU n 
2 358 ASP n 
2 359 GLN n 
2 360 LYS n 
2 361 ILE n 
2 362 VAL n 
2 363 SER n 
2 364 ASN n 
2 365 SER n 
2 366 GLN n 
2 367 THR n 
2 368 SER n 
2 369 THR n 
2 370 GLU n 
2 371 ASP n 
2 372 PRO n 
2 373 GLY n 
2 374 ASP n 
2 375 SER n 
2 376 THR n 
2 377 PRO n 
2 378 PHE n 
2 379 GLU n 
2 380 ASP n 
2 381 SER n 
2 382 GLU n 
2 383 GLU n 
2 384 PHE n 
2 385 CYS n 
2 386 PHE n 
2 387 SER n 
2 388 ALA n 
2 389 GLU n 
2 390 ALA n 
2 391 THR n 
2 392 SER n 
2 393 PHE n 
2 394 ASP n 
2 395 GLY n 
2 396 ASP n 
2 397 ASP n 
2 398 GLU n 
2 399 PHE n 
2 400 ASP n 
2 401 THR n 
2 402 TYR n 
2 403 ASN n 
2 404 GLU n 
2 405 ASP n 
2 406 ASP n 
2 407 GLU n 
2 408 ASP n 
2 409 ASP n 
2 410 GLU n 
2 411 SER n 
2 412 VAL n 
2 413 THR n 
2 414 GLY n 
2 415 TYR n 
2 416 TRP n 
2 417 ILE n 
2 418 THR n 
2 419 CYS n 
2 420 CYS n 
2 421 PRO n 
2 422 THR n 
2 423 CYS n 
2 424 ASP n 
2 425 VAL n 
2 426 ASP n 
2 427 ILE n 
2 428 ASN n 
2 429 THR n 
2 430 TRP n 
2 431 VAL n 
2 432 PRO n 
2 433 PHE n 
2 434 TYR n 
2 435 SER n 
2 436 THR n 
2 437 GLU n 
2 438 LEU n 
2 439 ASN n 
2 440 LYS n 
2 441 PRO n 
2 442 ALA n 
2 443 MET n 
2 444 ILE n 
2 445 TYR n 
2 446 CYS n 
2 447 SER n 
2 448 HIS n 
2 449 GLY n 
2 450 ASP n 
2 451 GLY n 
2 452 HIS n 
2 453 TRP n 
2 454 VAL n 
2 455 HIS n 
2 456 ALA n 
2 457 GLN n 
2 458 CYS n 
2 459 MET n 
2 460 ASP n 
2 461 LEU n 
2 462 GLU n 
2 463 GLU n 
2 464 ARG n 
2 465 THR n 
2 466 LEU n 
2 467 ILE n 
2 468 HIS n 
2 469 LEU n 
2 470 SER n 
2 471 GLU n 
2 472 GLY n 
2 473 SER n 
2 474 ASN n 
2 475 LYS n 
2 476 TYR n 
2 477 TYR n 
2 478 CYS n 
2 479 ASN n 
2 480 GLU n 
2 481 HIS n 
2 482 VAL n 
2 483 GLN n 
2 484 ILE n 
2 485 ALA n 
2 486 ARG n 
2 487 ALA n 
2 488 LEU n 
2 489 GLN n 
2 490 ALA n 
2 491 PRO n 
2 492 LYS n 
2 493 ARG n 
2 494 ASN n 
2 495 PRO n 
2 496 PRO n 
2 497 LEU n 
2 498 GLN n 
2 499 LYS n 
2 500 PRO n 
2 501 PRO n 
2 502 MET n 
2 503 LYS n 
2 504 SER n 
2 505 LEU n 
2 506 HIS n 
2 507 LYS n 
2 508 LYS n 
2 509 GLY n 
2 510 SER n 
2 511 GLY n 
2 512 LYS n 
2 513 VAL n 
2 514 LEU n 
2 515 THR n 
2 516 PRO n 
2 517 ALA n 
2 518 LYS n 
2 519 LYS n 
2 520 SER n 
3 1   DC  n 
3 2   DG  n 
3 3   DG  n 
3 4   DG  n 
3 5   DT  n 
3 6   DT  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DA  n 
3 14  DA  n 
3 15  DG  n 
3 16  DG  n 
3 17  DG  n 
3 18  DC  n 
3 19  DT  n 
3 20  DG  n 
3 21  DT  n 
3 22  DA  n 
3 23  DT  n 
3 24  DC  n 
3 25  DA  n 
3 26  DC  n 
3 27  DT  n 
3 28  DG  n 
3 29  DT  n 
3 30  DG  n 
3 31  DT  n 
3 32  DA  n 
3 33  DA  n 
3 34  DG  n 
3 35  DA  n 
3 36  DC  n 
3 37  DA  n 
3 38  DG  n 
3 39  DG  n 
3 40  DC  n 
3 41  DC  n 
3 42  DA  n 
3 43  DG  n 
3 44  DA  n 
3 45  DT  n 
3 46  DC  n 
4 1   DG  n 
4 2   DA  n 
4 3   DT  n 
4 4   DC  n 
4 5   DT  n 
4 6   DG  n 
4 7   DG  n 
4 8   DC  n 
4 9   DC  n 
4 10  DT  n 
4 11  DG  n 
4 12  DT  n 
4 13  DC  n 
4 14  DT  n 
4 15  DT  n 
4 16  DA  n 
5 1   DC  n 
5 2   DT  n 
5 3   DG  n 
5 4   DG  n 
5 5   DA  n 
5 6   DT  n 
5 7   DC  n 
5 8   DT  n 
5 9   DG  n 
5 10  DG  n 
5 11  DC  n 
5 12  DC  n 
5 13  DT  n 
5 14  DG  n 
5 15  DT  n 
5 16  DC  n 
5 17  DT  n 
5 18  DT  n 
5 19  DA  n 
6 1   DC  n 
6 2   DG  n 
6 3   DG  n 
6 4   DG  n 
6 5   DT  n 
6 6   DT  n 
6 7   DT  n 
6 8   DT  n 
6 9   DT  n 
6 10  DG  n 
6 11  DT  n 
6 12  DC  n 
6 13  DT  n 
6 14  DG  n 
6 15  DG  n 
6 16  DC  n 
6 17  DT  n 
6 18  DT  n 
6 19  DC  n 
6 20  DA  n 
6 21  DC  n 
6 22  DA  n 
6 23  DC  n 
6 24  DT  n 
6 25  DT  n 
6 26  DG  n 
6 27  DA  n 
6 28  DT  n 
6 29  DT  n 
6 30  DT  n 
6 31  DG  n 
6 32  DC  n 
6 33  DA  n 
6 34  DT  n 
6 35  DC  n 
6 36  DA  n 
6 37  DC  n 
6 38  DT  n 
6 39  DG  n 
6 40  DT  n 
6 41  DG  n 
6 42  DT  n 
6 43  DA  n 
6 44  DA  n 
6 45  DG  n 
6 46  DA  n 
6 47  DC  n 
6 48  DA  n 
6 49  DG  n 
6 50  DG  n 
6 51  DC  n 
6 52  DC  n 
6 53  DA  n 
6 54  DG  n 
6 55  DA  n 
6 56  DT  n 
6 57  DC  n 
6 58  DC  n 
6 59  DA  n 
6 60  DG  n 
7 1   DC  n 
7 2   DA  n 
7 3   DC  n 
7 4   DA  n 
7 5   DG  n 
7 6   DT  n 
7 7   DG  n 
7 8   DA  n 
7 9   DT  n 
7 10  DA  n 
7 11  DC  n 
7 12  DA  n 
7 13  DG  n 
7 14  DC  n 
7 15  DC  n 
7 16  DC  n 
7 17  DT  n 
7 18  DT  n 
7 19  DA  n 
7 20  DA  n 
7 21  DC  n 
7 22  DA  n 
7 23  DA  n 
7 24  DA  n 
7 25  DA  n 
7 26  DA  n 
7 27  DC  n 
7 28  DC  n 
7 29  DC  n 
7 30  DG  n 
8 1   DC  n 
8 2   DA  n 
8 3   DC  n 
8 4   DA  n 
8 5   DG  n 
8 6   DT  n 
8 7   DG  n 
8 8   DA  n 
8 9   DT  n 
8 10  DG  n 
8 11  DC  n 
8 12  DA  n 
8 13  DA  n 
8 14  DA  n 
8 15  DT  n 
8 16  DC  n 
8 17  DA  n 
8 18  DA  n 
8 19  DG  n 
8 20  DT  n 
8 21  DG  n 
8 22  DT  n 
8 23  DG  n 
8 24  DA  n 
8 25  DA  n 
8 26  DG  n 
8 27  DC  n 
8 28  DC  n 
8 29  DA  n 
8 30  DG  n 
8 31  DA  n 
8 32  DC  n 
8 33  DA  n 
8 34  DA  n 
8 35  DA  n 
8 36  DA  n 
8 37  DA  n 
8 38  DC  n 
8 39  DC  n 
8 40  DC  n 
8 41  DG  n 
9 1   SER n 
9 2   TYR n 
9 3   ALA n 
9 4   PHE n 
9 5   PHE n 
9 6   VAL n 
9 7   GLN n 
9 8   THR n 
9 9   CYS n 
9 10  ARG n 
9 11  GLU n 
9 12  GLU n 
9 13  HIS n 
9 14  LYS n 
9 15  LYS n 
9 16  LYS n 
9 17  HIS n 
9 18  PRO n 
9 19  ASP n 
9 20  ALA n 
9 21  SER n 
9 22  VAL n 
9 23  ASN n 
9 24  PHE n 
9 25  SER n 
9 26  GLU n 
9 27  PHE n 
9 28  SER n 
9 29  LYS n 
9 30  LYS n 
9 31  CYS n 
9 32  SER n 
9 33  GLU n 
9 34  ARG n 
9 35  TRP n 
9 36  LYS n 
9 37  THR n 
9 38  MET n 
9 39  SER n 
9 40  ALA n 
9 41  LYS n 
9 42  GLU n 
9 43  LYS n 
9 44  GLY n 
9 45  LYS n 
9 46  PHE n 
9 47  GLU n 
9 48  ASP n 
9 49  MET n 
9 50  ALA n 
9 51  LYS n 
9 52  ALA n 
9 53  ASP n 
9 54  LYS n 
9 55  ALA n 
9 56  ARG n 
9 57  TYR n 
9 58  GLU n 
9 59  ARG n 
9 60  GLU n 
9 61  MET n 
9 62  LYS n 
9 63  THR n 
9 64  TYR n 
9 65  ILE n 
9 66  PRO n 
9 67  PRO n 
9 68  LYS n 
9 69  GLY n 
9 70  GLU n 
9 71  THR n 
9 72  LYS n 
9 73  LYS n 
9 74  LYS n 
9 75  PHE n 
9 76  LYS n 
9 77  ASP n 
9 78  PRO n 
9 79  ASN n 
9 80  ALA n 
9 81  PRO n 
9 82  LYS n 
9 83  ARG n 
9 84  PRO n 
9 85  PRO n 
9 86  SER n 
9 87  ALA n 
9 88  PHE n 
9 89  PHE n 
9 90  LEU n 
9 91  PHE n 
9 92  CYS n 
9 93  SER n 
9 94  GLU n 
9 95  TYR n 
9 96  ARG n 
9 97  PRO n 
9 98  LYS n 
9 99  ILE n 
9 100 LYS n 
9 101 GLY n 
9 102 GLU n 
9 103 HIS n 
9 104 PRO n 
9 105 GLY n 
9 106 LEU n 
9 107 SER n 
9 108 ILE n 
9 109 GLY n 
9 110 ASP n 
9 111 VAL n 
9 112 ALA n 
9 113 LYS n 
9 114 LYS n 
9 115 LEU n 
9 116 GLY n 
9 117 GLU n 
9 118 MET n 
9 119 TRP n 
9 120 ASN n 
9 121 ASN n 
9 122 THR n 
9 123 ALA n 
9 124 ALA n 
9 125 ASP n 
9 126 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 775 Mouse ? Rag1          ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 520 Mouse ? 'Rag2, Rag-2' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9 1 sample 'Biological sequence' 1 126 Human ? 'HMGB1, HMG1' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 
'Escherichia coli K-12' 83333 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 46 'Escherichia coli K-12' ? 83333 ? 
4 1 sample 1 16 'Homo sapiens'          ? 9606  ? 
5 1 sample 1 19 'Escherichia coli K-12' ? 83333 ? 
6 1 sample 1 60 'Escherichia coli K-12' ? 83333 ? 
7 1 sample 1 30 'Escherichia coli K-12' ? 83333 ? 
8 1 sample 1 41 'Escherichia coli K-12' ? 83333 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAG1_MOUSE  P15919 ? 1 
;NCSKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSF
LNILNSLMVKCPAQDCNEEVSLEKYNHHVSSHKESKETLVHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEG
GDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALR
NAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLD
DYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESD
HETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFH
SITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKE
ERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPE
SLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEM
EDVLKHHWLYTSKYLQKFMNAHNALKSSGFTMNSKETLGDPLGIEDSLESQDSME
;
265 
2 UNP RAG2_MOUSE  P21784 ? 2 
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQKIVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFD
TYNEDDEDDESVTGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVQIARALQTPKRNPPLQKPPMKSLHKKGSGKVLTPAKKS
;
1   
3 PDB 6CG0        6CG0   ? 3 ? 1   
4 PDB 6CG0        6CG0   ? 4 ? 1   
5 PDB 6CG0        6CG0   ? 5 ? 1   
6 PDB 6CG0        6CG0   ? 6 ? 1   
7 PDB 6CG0        6CG0   ? 7 ? 1   
8 PDB 6CG0        6CG0   ? 8 ? 1   
9 UNP HMGB1_HUMAN P09429 ? 9 
;SYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNA
PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD
;
15  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6CG0 A 1 ? 775 ? P15919 265 ? 1039 ? 265 1039 
2  1 6CG0 C 1 ? 775 ? P15919 265 ? 1039 ? 265 1039 
3  2 6CG0 D 1 ? 520 ? P21784 1   ? 520  ? 1   520  
4  2 6CG0 B 1 ? 520 ? P21784 1   ? 520  ? 1   520  
5  3 6CG0 F 1 ? 46  ? 6CG0   1   ? 46   ? 1   46   
6  4 6CG0 I 1 ? 16  ? 6CG0   1   ? 16   ? 1   16   
7  5 6CG0 J 1 ? 19  ? 6CG0   -2  ? 16   ? -2  16   
8  6 6CG0 G 1 ? 60  ? 6CG0   1   ? 60   ? 1   60   
9  7 6CG0 L 1 ? 30  ? 6CG0   17  ? 46   ? 17  46   
10 8 6CG0 M 1 ? 41  ? 6CG0   17  ? 57   ? 17  57   
11 9 6CG0 N 1 ? 126 ? P09429 15  ? 140  ? 15  140  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CG0 GLN A 698 ? UNP P15919 GLU 962 conflict 962 1 
2 6CG0 GLN C 698 ? UNP P15919 GLU 962 conflict 962 2 
3 6CG0 ALA D 490 ? UNP P21784 THR 490 conflict 490 3 
4 6CG0 ALA B 490 ? UNP P21784 THR 490 conflict 490 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CG0 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CG0 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.003  ? 20963 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.589  ? 29247 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 19.498 ? 11833 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.135  ? 3212  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.004  ? 3029  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6CG0 
_struct.title                        'Cryo-EM structure of mouse RAG1/2 HFC complex (3.17 A)' 
_struct.pdbx_descriptor              
'V(D)J recombination-activating protein 1, V(D)J recombination-activating protein 2, High mobility group protein B1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CG0 
_struct_keywords.text            'V(D)J recombination, RAG1/2, RSS, Immunity, RECOMBINATION' 
_struct_keywords.pdbx_keywords   RECOMBINATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 2  ? 
E N N 3  ? 
F N N 4  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 11 ? 
N N N 10 ? 
O N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 140 ? GLU A 158 ? GLN A 404 GLU A 422  1 ? 19 
HELX_P HELX_P2  AA2 ASP A 162 ? ARG A 178 ? ASP A 426 ARG A 442  1 ? 17 
HELX_P HELX_P3  AA3 GLU A 180 ? MET A 191 ? GLU A 444 MET A 455  1 ? 12 
HELX_P HELX_P4  AA4 GLN A 199 ? ASN A 209 ? GLN A 463 ASN A 473  1 ? 11 
HELX_P HELX_P5  AA5 SER A 213 ? GLY A 229 ? SER A 477 GLY A 493  1 ? 17 
HELX_P HELX_P6  AA6 PRO A 235 ? LYS A 244 ? PRO A 499 LYS A 508  1 ? 10 
HELX_P HELX_P7  AA7 ARG A 294 ? MET A 306 ? ARG A 558 MET A 570  1 ? 13 
HELX_P HELX_P8  AA8 MET A 306 ? GLN A 317 ? MET A 570 GLN A 581  1 ? 12 
HELX_P HELX_P9  AA9 SER A 384 ? CYS A 388 ? SER A 648 CYS A 652  5 ? 5  
HELX_P HELX_P10 AB1 ASP A 400 ? LYS A 419 ? ASP A 664 LYS A 683  1 ? 20 
HELX_P HELX_P11 AB2 ASP A 444 ? GLY A 453 ? ASP A 708 GLY A 717  1 ? 10 
HELX_P HELX_P12 AB3 THR A 469 ? ASN A 476 ? THR A 733 ASN A 740  1 ? 8  
HELX_P HELX_P13 AB4 SER A 485 ? ASN A 499 ? SER A 749 ASN A 763  1 ? 15 
HELX_P HELX_P14 AB5 SER A 504 ? LYS A 513 ? SER A 768 LYS A 777  1 ? 10 
HELX_P HELX_P15 AB6 ASP A 528 ? GLY A 549 ? ASP A 792 GLY A 813  1 ? 22 
HELX_P HELX_P16 AB7 SER A 558 ? MET A 577 ? SER A 822 MET A 841  1 ? 20 
HELX_P HELX_P17 AB8 GLY A 587 ? MET A 594 ? GLY A 851 MET A 858  1 ? 8  
HELX_P HELX_P18 AB9 THR A 595 ? CYS A 603 ? THR A 859 CYS A 867  1 ? 9  
HELX_P HELX_P19 AC1 GLU A 609 ? SER A 631 ? GLU A 873 SER A 895  1 ? 23 
HELX_P HELX_P20 AC2 CYS A 633 ? CYS A 638 ? CYS A 897 CYS A 902  1 ? 6  
HELX_P HELX_P21 AC3 CYS A 638 ? GLN A 644 ? CYS A 902 GLN A 908  1 ? 7  
HELX_P HELX_P22 AC4 GLN A 644 ? PHE A 660 ? GLN A 908 PHE A 924  1 ? 17 
HELX_P HELX_P23 AC5 PHE A 660 ? GLU A 665 ? PHE A 924 GLU A 929  1 ? 6  
HELX_P HELX_P24 AC6 ASN A 670 ? HIS A 678 ? ASN A 934 HIS A 942  1 ? 9  
HELX_P HELX_P25 AC7 HIS A 678 ? GLY A 687 ? HIS A 942 GLY A 951  1 ? 10 
HELX_P HELX_P26 AC8 SER A 694 ? ASN A 711 ? SER A 958 ASN A 975  1 ? 18 
HELX_P HELX_P27 AC9 TYR A 718 ? THR A 731 ? TYR A 982 THR A 995  1 ? 14 
HELX_P HELX_P28 AD1 SER A 732 ? ASN A 740 ? SER A 996 ASN A 1004 1 ? 9  
HELX_P HELX_P29 AD2 THR B 136 ? ASP B 156 ? THR C 400 ASP C 420  1 ? 21 
HELX_P HELX_P30 AD3 ASP B 162 ? ARG B 178 ? ASP C 426 ARG C 442  1 ? 17 
HELX_P HELX_P31 AD4 HIS B 181 ? GLY B 193 ? HIS C 445 GLY C 457  1 ? 13 
HELX_P HELX_P32 AD5 GLN B 199 ? THR B 210 ? GLN C 463 THR C 474  1 ? 12 
HELX_P HELX_P33 AD6 SER B 213 ? GLY B 229 ? SER C 477 GLY C 493  1 ? 17 
HELX_P HELX_P34 AD7 PRO B 235 ? LEU B 247 ? PRO C 499 LEU C 511  1 ? 13 
HELX_P HELX_P35 AD8 ARG B 294 ? GLN B 317 ? ARG C 558 GLN C 581  1 ? 24 
HELX_P HELX_P36 AD9 SER B 384 ? CYS B 388 ? SER C 648 CYS C 652  5 ? 5  
HELX_P HELX_P37 AE1 ASP B 400 ? LYS B 419 ? ASP C 664 LYS C 683  1 ? 20 
HELX_P HELX_P38 AE2 ASP B 444 ? GLU B 452 ? ASP C 708 GLU C 716  1 ? 9  
HELX_P HELX_P39 AE3 THR B 469 ? SER B 474 ? THR C 733 SER C 738  1 ? 6  
HELX_P HELX_P40 AE4 SER B 485 ? ASN B 499 ? SER C 749 ASN C 763  1 ? 15 
HELX_P HELX_P41 AE5 SER B 504 ? LYS B 513 ? SER C 768 LYS C 777  1 ? 10 
HELX_P HELX_P42 AE6 ASP B 528 ? ILE B 548 ? ASP C 792 ILE C 812  1 ? 21 
HELX_P HELX_P43 AE7 SER B 558 ? ASN B 578 ? SER C 822 ASN C 842  1 ? 21 
HELX_P HELX_P44 AE8 ASN B 586 ? MET B 594 ? ASN C 850 MET C 858  1 ? 9  
HELX_P HELX_P45 AE9 THR B 595 ? GLU B 604 ? THR C 859 GLU C 868  1 ? 10 
HELX_P HELX_P46 AF1 GLU B 609 ? SER B 631 ? GLU C 873 SER C 895  1 ? 23 
HELX_P HELX_P47 AF2 CYS B 633 ? CYS B 638 ? CYS C 897 CYS C 902  1 ? 6  
HELX_P HELX_P48 AF3 CYS B 638 ? GLN B 644 ? CYS C 902 GLN C 908  1 ? 7  
HELX_P HELX_P49 AF4 GLN B 644 ? LYS B 659 ? GLN C 908 LYS C 923  1 ? 16 
HELX_P HELX_P50 AF5 PHE B 660 ? ARG B 663 ? PHE C 924 ARG C 927  5 ? 4  
HELX_P HELX_P51 AF6 THR B 669 ? HIS B 678 ? THR C 933 HIS C 942  1 ? 10 
HELX_P HELX_P52 AF7 HIS B 678 ? ASP B 686 ? HIS C 942 ASP C 950  1 ? 9  
HELX_P HELX_P53 AF8 ILE B 689 ? ALA B 693 ? ILE C 953 ALA C 957  5 ? 5  
HELX_P HELX_P54 AF9 SER B 694 ? ASN B 711 ? SER C 958 ASN C 975  1 ? 18 
HELX_P HELX_P55 AG1 TYR B 718 ? SER B 732 ? TYR C 982 SER C 996  1 ? 15 
HELX_P HELX_P56 AG2 LEU B 735 ? ASN B 740 ? LEU C 999 ASN C 1004 5 ? 6  
HELX_P HELX_P57 AG3 ASN C 11  ? ILE C 15  ? ASN D 11  ILE D 15   5 ? 5  
HELX_P HELX_P58 AG4 THR C 168 ? TRP C 172 ? THR D 168 TRP D 172  5 ? 5  
HELX_P HELX_P59 AG5 ASN D 11  ? ILE D 15  ? ASN B 11  ILE B 15   5 ? 5  
HELX_P HELX_P60 AG6 THR D 168 ? TRP D 172 ? THR B 168 TRP B 172  5 ? 5  
HELX_P HELX_P61 AG7 THR D 308 ? SER D 314 ? THR B 308 SER B 314  1 ? 7  
HELX_P HELX_P62 AG8 ALA K 3   ? HIS K 13  ? ALA N 17  HIS N 27   1 ? 11 
HELX_P HELX_P63 AG9 PHE K 27  ? ARG K 34  ? PHE N 41  ARG N 48   5 ? 8  
HELX_P HELX_P64 AH1 SER K 86  ? HIS K 103 ? SER N 100 HIS N 117  1 ? 18 
HELX_P HELX_P65 AH2 SER K 107 ? THR K 122 ? SER N 121 THR N 136  1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A ASP 336 OD2 ? ? ? 1_555 M CA .  CA ? ? A ASP 600 A CA 1102 1_555 ? ? ? ? ? ? ?               2.505 ? 
metalc2   metalc ? ? A GLY 337 O   ? ? ? 1_555 M CA .  CA ? ? A GLY 601 A CA 1102 1_555 ? ? ? ? ? ? ?               2.504 ? 
metalc3   metalc ? ? A CYS 463 SG  ? ? ? 1_555 L ZN .  ZN ? ? A CYS 727 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.184 ? 
metalc4   metalc ? ? A CYS 466 SG  ? ? ? 1_555 L ZN .  ZN ? ? A CYS 730 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.216 ? 
metalc5   metalc ? ? A HIS 673 NE2 ? ? ? 1_555 L ZN .  ZN ? ? A HIS 937 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.478 ? 
metalc6   metalc ? ? A HIS 678 NE2 ? ? ? 1_555 L ZN .  ZN ? ? A HIS 942 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.164 ? 
metalc7   metalc ? ? B ASP 336 OD1 ? ? ? 1_555 O CA .  CA ? ? C ASP 600 C CA 1102 1_555 ? ? ? ? ? ? ?               2.570 ? 
metalc8   metalc ? ? B ASP 336 OD2 ? ? ? 1_555 O CA .  CA ? ? C ASP 600 C CA 1102 1_555 ? ? ? ? ? ? ?               2.624 ? 
metalc9   metalc ? ? B GLY 337 O   ? ? ? 1_555 O CA .  CA ? ? C GLY 601 C CA 1102 1_555 ? ? ? ? ? ? ?               2.439 ? 
metalc10  metalc ? ? B CYS 463 SG  ? ? ? 1_555 N ZN .  ZN ? ? C CYS 727 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.392 ? 
metalc11  metalc ? ? B CYS 466 SG  ? ? ? 1_555 N ZN .  ZN ? ? C CYS 730 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.458 ? 
metalc12  metalc ? ? B HIS 673 NE2 ? ? ? 1_555 N ZN .  ZN ? ? C HIS 937 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.110 ? 
metalc13  metalc ? ? B HIS 678 NE2 ? ? ? 1_555 N ZN .  ZN ? ? C HIS 942 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.111 ? 
metalc14  metalc ? ? E DT  31  OP2 ? ? ? 1_555 M CA .  CA ? ? F DT  31  A CA 1102 1_555 ? ? ? ? ? ? ?               2.525 ? 
metalc15  metalc ? ? H DT  42  OP2 ? ? ? 1_555 O CA .  CA ? ? G DT  42  C CA 1102 1_555 ? ? ? ? ? ? ?               2.450 ? 
hydrog1   hydrog ? ? E DC  1   N3  ? ? ? 1_555 I DG 30 N1 ? ? F DC  1   L DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? E DC  1   N4  ? ? ? 1_555 I DG 30 O6 ? ? F DC  1   L DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? E DC  1   O2  ? ? ? 1_555 I DG 30 N2 ? ? F DC  1   L DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? E DG  2   N1  ? ? ? 1_555 I DC 29 N3 ? ? F DG  2   L DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? E DG  2   N2  ? ? ? 1_555 I DC 29 O2 ? ? F DG  2   L DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? E DG  2   O6  ? ? ? 1_555 I DC 29 N4 ? ? F DG  2   L DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? E DG  3   N1  ? ? ? 1_555 I DC 28 N3 ? ? F DG  3   L DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? E DG  3   N2  ? ? ? 1_555 I DC 28 O2 ? ? F DG  3   L DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? E DG  3   O6  ? ? ? 1_555 I DC 28 N4 ? ? F DG  3   L DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? E DG  4   N1  ? ? ? 1_555 I DC 27 N3 ? ? F DG  4   L DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? E DG  4   N2  ? ? ? 1_555 I DC 27 O2 ? ? F DG  4   L DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? E DG  4   O6  ? ? ? 1_555 I DC 27 N4 ? ? F DG  4   L DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? E DT  5   N3  ? ? ? 1_555 I DA 26 N1 ? ? F DT  5   L DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? E DT  5   O4  ? ? ? 1_555 I DA 26 N6 ? ? F DT  5   L DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? E DT  6   N3  ? ? ? 1_555 I DA 25 N1 ? ? F DT  6   L DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? E DT  6   O4  ? ? ? 1_555 I DA 25 N6 ? ? F DT  6   L DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? E DT  7   N3  ? ? ? 1_555 I DA 24 N1 ? ? F DT  7   L DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? E DT  7   O4  ? ? ? 1_555 I DA 24 N6 ? ? F DT  7   L DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? E DT  9   N3  ? ? ? 1_555 I DA 22 N1 ? ? F DT  9   L DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? E DT  9   O4  ? ? ? 1_555 I DA 22 N6 ? ? F DT  9   L DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? E DG  10  N1  ? ? ? 1_555 I DC 21 N3 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? E DG  10  N2  ? ? ? 1_555 I DC 21 O2 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? E DG  10  O6  ? ? ? 1_555 I DC 21 N4 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? E DA  13  N1  ? ? ? 1_555 I DT 18 N3 ? ? F DA  13  L DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? E DA  13  N6  ? ? ? 1_555 I DT 18 O4 ? ? F DA  13  L DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? E DA  14  N1  ? ? ? 1_555 I DT 17 N3 ? ? F DA  14  L DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? E DA  14  N6  ? ? ? 1_555 I DT 17 O4 ? ? F DA  14  L DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? E DG  15  N1  ? ? ? 1_555 I DC 16 N3 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? E DG  15  N2  ? ? ? 1_555 I DC 16 O2 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? E DG  15  O6  ? ? ? 1_555 I DC 16 N4 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? E DG  16  N1  ? ? ? 1_555 I DC 15 N3 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? E DG  16  N2  ? ? ? 1_555 I DC 15 O2 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? E DG  16  O6  ? ? ? 1_555 I DC 15 N4 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? E DG  17  N1  ? ? ? 1_555 I DC 14 N3 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? E DG  17  N2  ? ? ? 1_555 I DC 14 O2 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? E DG  17  O6  ? ? ? 1_555 I DC 14 N4 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? E DC  18  N3  ? ? ? 1_555 I DG 13 N1 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? E DC  18  N4  ? ? ? 1_555 I DG 13 O6 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? E DC  18  O2  ? ? ? 1_555 I DG 13 N2 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? E DT  19  N3  ? ? ? 1_555 I DA 12 N1 ? ? F DT  19  L DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? E DT  19  O4  ? ? ? 1_555 I DA 12 N6 ? ? F DT  19  L DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? E DG  20  N1  ? ? ? 1_555 I DC 11 N3 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? E DG  20  N2  ? ? ? 1_555 I DC 11 O2 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? E DG  20  O6  ? ? ? 1_555 I DC 11 N4 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? E DT  21  N3  ? ? ? 1_555 I DA 10 N1 ? ? F DT  21  L DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? E DT  21  O4  ? ? ? 1_555 I DA 10 N6 ? ? F DT  21  L DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? E DA  22  N1  ? ? ? 1_555 I DT 9  N3 ? ? F DA  22  L DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? E DA  22  N6  ? ? ? 1_555 I DT 9  O4 ? ? F DA  22  L DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? E DT  23  N3  ? ? ? 1_555 I DA 8  N1 ? ? F DT  23  L DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? E DT  23  O4  ? ? ? 1_555 I DA 8  N6 ? ? F DT  23  L DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? E DC  24  N3  ? ? ? 1_555 I DG 7  N1 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? E DC  24  N4  ? ? ? 1_555 I DG 7  O6 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? E DC  24  O2  ? ? ? 1_555 I DG 7  N2 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? E DA  25  N1  ? ? ? 1_555 I DG 5  N1 ? ? F DA  25  L DG 21   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog55  hydrog ? ? E DA  25  N6  ? ? ? 1_555 I DG 5  O6 ? ? F DA  25  L DG 21   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog56  hydrog ? ? E DA  25  N1  ? ? ? 1_555 I DT 6  N3 ? ? F DA  25  L DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? E DA  25  N6  ? ? ? 1_555 I DT 6  O4 ? ? F DA  25  L DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? E DC  26  N3  ? ? ? 1_555 I DG 5  N1 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? E DC  26  N4  ? ? ? 1_555 I DG 5  O6 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? E DC  26  O2  ? ? ? 1_555 I DG 5  N2 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? E DT  27  N3  ? ? ? 1_555 I DA 4  N1 ? ? F DT  27  L DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? E DT  27  O4  ? ? ? 1_555 I DA 4  N6 ? ? F DT  27  L DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? E DG  28  N1  ? ? ? 1_555 I DC 3  N3 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? E DG  28  N2  ? ? ? 1_555 I DC 3  O2 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? E DG  28  O6  ? ? ? 1_555 I DC 3  N4 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? E DT  29  N3  ? ? ? 1_555 I DA 2  N1 ? ? F DT  29  L DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? E DT  29  O4  ? ? ? 1_555 I DA 2  N6 ? ? F DT  29  L DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? E DA  32  N1  ? ? ? 1_555 F DT 15 N3 ? ? F DA  32  I DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? E DA  32  N6  ? ? ? 1_555 F DT 15 O4 ? ? F DA  32  I DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? E DA  33  N1  ? ? ? 1_555 F DT 14 N3 ? ? F DA  33  I DT 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? E DA  33  N6  ? ? ? 1_555 F DT 14 O4 ? ? F DA  33  I DT 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? E DG  34  N1  ? ? ? 1_555 F DC 13 N3 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? E DG  34  N2  ? ? ? 1_555 F DC 13 O2 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? E DG  34  O6  ? ? ? 1_555 F DC 13 N4 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? E DA  35  N1  ? ? ? 1_555 F DT 12 N3 ? ? F DA  35  I DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? E DA  35  N6  ? ? ? 1_555 F DT 12 O4 ? ? F DA  35  I DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? E DC  36  N3  ? ? ? 1_555 F DG 11 N1 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? E DC  36  N4  ? ? ? 1_555 F DG 11 O6 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? E DC  36  O2  ? ? ? 1_555 F DG 11 N2 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? E DA  37  N1  ? ? ? 1_555 F DT 10 N3 ? ? F DA  37  I DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? E DA  37  N6  ? ? ? 1_555 F DT 10 O4 ? ? F DA  37  I DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? E DG  38  N1  ? ? ? 1_555 F DC 9  N3 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? E DG  38  N2  ? ? ? 1_555 F DC 9  O2 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? E DG  38  O6  ? ? ? 1_555 F DC 9  N4 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? E DG  39  N1  ? ? ? 1_555 F DC 8  N3 ? ? F DG  39  I DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? E DG  39  N2  ? ? ? 1_555 F DC 8  O2 ? ? F DG  39  I DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? E DG  39  O6  ? ? ? 1_555 F DC 8  N4 ? ? F DG  39  I DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? E DC  40  N3  ? ? ? 1_555 F DG 7  N1 ? ? F DC  40  I DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? E DC  40  N4  ? ? ? 1_555 F DG 7  O6 ? ? F DC  40  I DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? E DC  40  O2  ? ? ? 1_555 F DG 7  N2 ? ? F DC  40  I DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? E DC  41  N3  ? ? ? 1_555 F DG 6  N1 ? ? F DC  41  I DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? E DC  41  N4  ? ? ? 1_555 F DG 6  O6 ? ? F DC  41  I DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? E DC  41  O2  ? ? ? 1_555 F DG 6  N2 ? ? F DC  41  I DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? E DA  42  N1  ? ? ? 1_555 F DT 5  N3 ? ? F DA  42  I DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? E DA  42  N6  ? ? ? 1_555 F DT 5  O4 ? ? F DA  42  I DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? E DG  43  N1  ? ? ? 1_555 F DC 4  N3 ? ? F DG  43  I DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? E DG  43  N2  ? ? ? 1_555 F DC 4  O2 ? ? F DG  43  I DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? E DG  43  O6  ? ? ? 1_555 F DC 4  N4 ? ? F DG  43  I DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? E DA  44  N1  ? ? ? 1_555 F DT 3  N3 ? ? F DA  44  I DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? E DA  44  N6  ? ? ? 1_555 F DT 3  O4 ? ? F DA  44  I DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? E DT  45  N3  ? ? ? 1_555 F DA 2  N1 ? ? F DT  45  I DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? E DT  45  O4  ? ? ? 1_555 F DA 2  N6 ? ? F DT  45  I DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? E DC  46  N3  ? ? ? 1_555 F DG 1  N1 ? ? F DC  46  I DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? E DC  46  N4  ? ? ? 1_555 F DG 1  O6 ? ? F DC  46  I DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? E DC  46  O2  ? ? ? 1_555 F DG 1  N2 ? ? F DC  46  I DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? H DC  1   O2  ? ? ? 1_555 J DG 41 N1 ? ? G DC  1   M DG 57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog107 hydrog ? ? H DG  2   N1  ? ? ? 1_555 J DC 40 N3 ? ? G DG  2   M DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? H DG  2   N2  ? ? ? 1_555 J DC 40 O2 ? ? G DG  2   M DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? H DG  2   O6  ? ? ? 1_555 J DC 40 N4 ? ? G DG  2   M DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? H DG  3   N1  ? ? ? 1_555 J DC 39 N3 ? ? G DG  3   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? H DG  3   N2  ? ? ? 1_555 J DC 39 O2 ? ? G DG  3   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? H DG  3   O6  ? ? ? 1_555 J DC 39 N4 ? ? G DG  3   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? H DG  4   N1  ? ? ? 1_555 J DC 38 N3 ? ? G DG  4   M DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? H DG  4   N2  ? ? ? 1_555 J DC 38 O2 ? ? G DG  4   M DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? H DG  4   O6  ? ? ? 1_555 J DC 38 N4 ? ? G DG  4   M DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? H DG  4   N1  ? ? ? 1_555 J DC 39 N3 ? ? G DG  4   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? H DG  4   N2  ? ? ? 1_555 J DC 39 O2 ? ? G DG  4   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? H DG  4   O6  ? ? ? 1_555 J DC 39 N4 ? ? G DG  4   M DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? H DT  5   N3  ? ? ? 1_555 J DA 37 N1 ? ? G DT  5   M DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? H DT  5   O4  ? ? ? 1_555 J DA 37 N6 ? ? G DT  5   M DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? H DT  6   N3  ? ? ? 1_555 J DA 36 N1 ? ? G DT  6   M DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? H DT  6   O4  ? ? ? 1_555 J DA 36 N6 ? ? G DT  6   M DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? H DT  7   N3  ? ? ? 1_555 J DA 35 N1 ? ? G DT  7   M DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? H DT  7   O4  ? ? ? 1_555 J DA 35 N6 ? ? G DT  7   M DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? H DT  8   N3  ? ? ? 1_555 J DA 34 N1 ? ? G DT  8   M DA 50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog126 hydrog ? ? H DT  8   N3  ? ? ? 1_555 J DA 35 N1 ? ? G DT  8   M DA 51   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog127 hydrog ? ? H DT  9   N3  ? ? ? 1_555 J DA 33 N1 ? ? G DT  9   M DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? H DT  9   O4  ? ? ? 1_555 J DA 33 N6 ? ? G DT  9   M DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? H DG  10  N1  ? ? ? 1_555 J DA 33 N1 ? ? G DG  10  M DA 49   1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog130 hydrog ? ? H DT  11  N3  ? ? ? 1_555 J DA 31 N1 ? ? G DT  11  M DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? H DT  11  O4  ? ? ? 1_555 J DA 31 N6 ? ? G DT  11  M DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? H DC  12  N3  ? ? ? 1_555 J DG 30 N1 ? ? G DC  12  M DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? H DC  12  N4  ? ? ? 1_555 J DG 30 O6 ? ? G DC  12  M DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? H DC  12  O2  ? ? ? 1_555 J DG 30 N2 ? ? G DC  12  M DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? H DT  13  O2  ? ? ? 1_555 J DA 29 N6 ? ? G DT  13  M DA 45   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog136 hydrog ? ? H DG  14  N1  ? ? ? 1_555 J DC 28 N3 ? ? G DG  14  M DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? H DG  14  N2  ? ? ? 1_555 J DC 28 O2 ? ? G DG  14  M DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? H DG  14  O6  ? ? ? 1_555 J DC 28 N4 ? ? G DG  14  M DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? H DG  15  N1  ? ? ? 1_555 J DC 27 N3 ? ? G DG  15  M DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? H DG  15  N2  ? ? ? 1_555 J DC 27 O2 ? ? G DG  15  M DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? H DG  15  O6  ? ? ? 1_555 J DC 27 N4 ? ? G DG  15  M DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? H DC  16  N3  ? ? ? 1_555 J DG 26 N1 ? ? G DC  16  M DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? H DC  16  N4  ? ? ? 1_555 J DG 26 O6 ? ? G DC  16  M DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? H DC  16  O2  ? ? ? 1_555 J DG 26 N2 ? ? G DC  16  M DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? H DT  17  N3  ? ? ? 1_555 J DA 25 N1 ? ? G DT  17  M DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? H DT  17  O4  ? ? ? 1_555 J DA 25 N6 ? ? G DT  17  M DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? H DT  18  N3  ? ? ? 1_555 J DA 24 N1 ? ? G DT  18  M DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? H DT  18  O4  ? ? ? 1_555 J DA 24 N6 ? ? G DT  18  M DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? H DC  19  N3  ? ? ? 1_555 J DG 23 N1 ? ? G DC  19  M DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? H DC  19  N4  ? ? ? 1_555 J DG 23 O6 ? ? G DC  19  M DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? H DC  19  O2  ? ? ? 1_555 J DG 23 N2 ? ? G DC  19  M DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? H DA  20  N1  ? ? ? 1_555 J DG 21 N1 ? ? G DA  20  M DG 37   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog153 hydrog ? ? H DA  20  N6  ? ? ? 1_555 J DG 21 O6 ? ? G DA  20  M DG 37   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog154 hydrog ? ? H DA  20  N1  ? ? ? 1_555 J DT 22 N3 ? ? G DA  20  M DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? H DA  20  N6  ? ? ? 1_555 J DT 22 O4 ? ? G DA  20  M DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? H DC  21  N3  ? ? ? 1_555 J DG 21 N1 ? ? G DC  21  M DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? H DC  21  N4  ? ? ? 1_555 J DG 21 O6 ? ? G DC  21  M DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? H DC  21  O2  ? ? ? 1_555 J DG 21 N2 ? ? G DC  21  M DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? H DA  22  N1  ? ? ? 1_555 J DT 20 N3 ? ? G DA  22  M DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? H DA  22  N6  ? ? ? 1_555 J DT 20 O4 ? ? G DA  22  M DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? H DC  23  N3  ? ? ? 1_555 J DG 19 N1 ? ? G DC  23  M DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? H DC  23  N4  ? ? ? 1_555 J DG 19 O6 ? ? G DC  23  M DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? H DC  23  O2  ? ? ? 1_555 J DG 19 N2 ? ? G DC  23  M DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? H DT  24  N3  ? ? ? 1_555 J DA 18 N1 ? ? G DT  24  M DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? H DT  24  O4  ? ? ? 1_555 J DA 18 N6 ? ? G DT  24  M DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? H DT  25  N3  ? ? ? 1_555 J DA 17 N1 ? ? G DT  25  M DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? H DT  25  O4  ? ? ? 1_555 J DA 17 N6 ? ? G DT  25  M DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? H DG  26  N1  ? ? ? 1_555 J DC 16 N3 ? ? G DG  26  M DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? H DG  26  N2  ? ? ? 1_555 J DC 16 O2 ? ? G DG  26  M DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? H DG  26  O6  ? ? ? 1_555 J DC 16 N4 ? ? G DG  26  M DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? H DA  27  N1  ? ? ? 1_555 J DT 15 N3 ? ? G DA  27  M DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? H DA  27  N6  ? ? ? 1_555 J DT 15 O4 ? ? G DA  27  M DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? H DT  28  N3  ? ? ? 1_555 J DA 14 N1 ? ? G DT  28  M DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? H DT  28  O4  ? ? ? 1_555 J DA 14 N6 ? ? G DT  28  M DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? H DT  29  N3  ? ? ? 1_555 J DA 13 N1 ? ? G DT  29  M DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? H DT  29  O4  ? ? ? 1_555 J DA 13 N6 ? ? G DT  29  M DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? H DT  30  N3  ? ? ? 1_555 J DA 12 N1 ? ? G DT  30  M DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? H DT  30  O4  ? ? ? 1_555 J DA 12 N6 ? ? G DT  30  M DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? H DG  31  N1  ? ? ? 1_555 J DC 11 N3 ? ? G DG  31  M DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? H DG  31  N2  ? ? ? 1_555 J DC 11 O2 ? ? G DG  31  M DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? H DG  31  O6  ? ? ? 1_555 J DC 11 N4 ? ? G DG  31  M DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? H DC  32  N3  ? ? ? 1_555 J DG 10 N1 ? ? G DC  32  M DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? H DC  32  N4  ? ? ? 1_555 J DG 10 O6 ? ? G DC  32  M DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? H DC  32  O2  ? ? ? 1_555 J DG 10 N2 ? ? G DC  32  M DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? H DA  33  N1  ? ? ? 1_555 J DT 9  N3 ? ? G DA  33  M DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? H DA  33  N6  ? ? ? 1_555 J DT 9  O4 ? ? G DA  33  M DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? H DT  34  N3  ? ? ? 1_555 J DA 8  N1 ? ? G DT  34  M DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? H DT  34  O4  ? ? ? 1_555 J DA 8  N6 ? ? G DT  34  M DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? H DC  35  N3  ? ? ? 1_555 J DG 7  N1 ? ? G DC  35  M DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? H DC  35  N4  ? ? ? 1_555 J DG 7  O6 ? ? G DC  35  M DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? H DC  35  O2  ? ? ? 1_555 J DG 7  N2 ? ? G DC  35  M DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? H DA  36  N1  ? ? ? 1_555 J DT 6  N3 ? ? G DA  36  M DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? H DA  36  N6  ? ? ? 1_555 J DT 6  O4 ? ? G DA  36  M DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? H DC  37  N3  ? ? ? 1_555 J DG 5  N1 ? ? G DC  37  M DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? H DC  37  N4  ? ? ? 1_555 J DG 5  O6 ? ? G DC  37  M DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? H DC  37  O2  ? ? ? 1_555 J DG 5  N2 ? ? G DC  37  M DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? H DT  38  N3  ? ? ? 1_555 J DA 4  N1 ? ? G DT  38  M DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? H DT  38  O4  ? ? ? 1_555 J DA 4  N6 ? ? G DT  38  M DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? H DG  39  N1  ? ? ? 1_555 J DC 3  N3 ? ? G DG  39  M DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? H DG  39  N2  ? ? ? 1_555 J DC 3  O2 ? ? G DG  39  M DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? H DG  39  O6  ? ? ? 1_555 J DC 3  N4 ? ? G DG  39  M DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? H DT  40  N3  ? ? ? 1_555 J DA 2  N1 ? ? G DT  40  M DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? H DT  40  O4  ? ? ? 1_555 J DA 2  N6 ? ? G DT  40  M DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? H DG  41  N1  ? ? ? 1_555 J DA 2  N1 ? ? G DG  41  M DA 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog205 hydrog ? ? H DG  41  O6  ? ? ? 1_555 J DA 2  N6 ? ? G DG  41  M DA 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog206 hydrog ? ? G DC  1   N3  ? ? ? 1_555 H DG 60 N1 ? ? J DC  -2  G DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? G DC  1   N4  ? ? ? 1_555 H DG 60 O6 ? ? J DC  -2  G DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? G DC  1   O2  ? ? ? 1_555 H DG 60 N2 ? ? J DC  -2  G DG 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? G DT  2   N3  ? ? ? 1_555 H DA 59 N1 ? ? J DT  -1  G DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? G DT  2   O4  ? ? ? 1_555 H DA 59 N6 ? ? J DT  -1  G DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? G DG  3   N1  ? ? ? 1_555 H DC 58 N3 ? ? J DG  0   G DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? G DG  3   N2  ? ? ? 1_555 H DC 58 O2 ? ? J DG  0   G DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? G DG  3   O6  ? ? ? 1_555 H DC 58 N4 ? ? J DG  0   G DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? G DG  4   N1  ? ? ? 1_555 H DC 57 N3 ? ? J DG  1   G DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? G DG  4   N2  ? ? ? 1_555 H DC 57 O2 ? ? J DG  1   G DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? G DG  4   O6  ? ? ? 1_555 H DC 57 N4 ? ? J DG  1   G DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? G DA  5   N1  ? ? ? 1_555 H DT 56 N3 ? ? J DA  2   G DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? G DA  5   N6  ? ? ? 1_555 H DT 56 O4 ? ? J DA  2   G DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? G DT  6   N3  ? ? ? 1_555 H DA 55 N1 ? ? J DT  3   G DA 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? G DT  6   O4  ? ? ? 1_555 H DA 55 N6 ? ? J DT  3   G DA 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? G DC  7   N3  ? ? ? 1_555 H DG 54 N1 ? ? J DC  4   G DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? G DC  7   N4  ? ? ? 1_555 H DG 54 O6 ? ? J DC  4   G DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? G DC  7   O2  ? ? ? 1_555 H DG 54 N2 ? ? J DC  4   G DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? G DT  8   N3  ? ? ? 1_555 H DA 53 N1 ? ? J DT  5   G DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? G DT  8   O4  ? ? ? 1_555 H DA 53 N6 ? ? J DT  5   G DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? G DG  9   N1  ? ? ? 1_555 H DC 52 N3 ? ? J DG  6   G DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? G DG  9   N2  ? ? ? 1_555 H DC 52 O2 ? ? J DG  6   G DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? G DG  9   O6  ? ? ? 1_555 H DC 52 N4 ? ? J DG  6   G DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? G DG  10  N1  ? ? ? 1_555 H DC 51 N3 ? ? J DG  7   G DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? G DG  10  N2  ? ? ? 1_555 H DC 51 O2 ? ? J DG  7   G DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? G DG  10  O6  ? ? ? 1_555 H DC 51 N4 ? ? J DG  7   G DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? G DC  11  N3  ? ? ? 1_555 H DG 50 N1 ? ? J DC  8   G DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? G DC  11  N4  ? ? ? 1_555 H DG 50 O6 ? ? J DC  8   G DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? G DC  11  O2  ? ? ? 1_555 H DG 50 N2 ? ? J DC  8   G DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? G DC  12  N3  ? ? ? 1_555 H DG 49 N1 ? ? J DC  9   G DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? G DC  12  N4  ? ? ? 1_555 H DG 49 O6 ? ? J DC  9   G DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? G DC  12  O2  ? ? ? 1_555 H DG 49 N2 ? ? J DC  9   G DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? G DT  13  N3  ? ? ? 1_555 H DA 48 N1 ? ? J DT  10  G DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? G DT  13  O4  ? ? ? 1_555 H DA 48 N6 ? ? J DT  10  G DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? G DG  14  N1  ? ? ? 1_555 H DC 47 N3 ? ? J DG  11  G DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? G DG  14  N2  ? ? ? 1_555 H DC 47 O2 ? ? J DG  11  G DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? G DG  14  O6  ? ? ? 1_555 H DC 47 N4 ? ? J DG  11  G DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? G DT  15  N3  ? ? ? 1_555 H DA 46 N1 ? ? J DT  12  G DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? G DT  15  O4  ? ? ? 1_555 H DA 46 N6 ? ? J DT  12  G DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? G DC  16  N3  ? ? ? 1_555 H DG 45 N1 ? ? J DC  13  G DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? G DC  16  N4  ? ? ? 1_555 H DG 45 O6 ? ? J DC  13  G DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? G DC  16  O2  ? ? ? 1_555 H DG 45 N2 ? ? J DC  13  G DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? G DT  17  N3  ? ? ? 1_555 H DA 44 N1 ? ? J DT  14  G DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? G DT  17  O4  ? ? ? 1_555 H DA 44 N6 ? ? J DT  14  G DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? G DT  18  N3  ? ? ? 1_555 H DA 43 N1 ? ? J DT  15  G DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? G DT  18  O4  ? ? ? 1_555 H DA 43 N6 ? ? J DT  15  G DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 6 ? 
AA4 ? 2 ? 
AA5 ? 8 ? 
AA6 ? 6 ? 
AA7 ? 4 ? 
AA8 ? 3 ? 
AA9 ? 3 ? 
AB1 ? 4 ? 
AB2 ? 5 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 5 ? 
AB8 ? 3 ? 
AB9 ? 4 ? 
AC1 ? 5 ? 
AC2 ? 2 ? 
AC3 ? 4 ? 
AC4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA5 6 7 ? anti-parallel 
AA5 7 8 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? parallel      
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? parallel      
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 254 ? TRP A 255 ? GLU A 518 TRP A 519 
AA1 2 LEU A 423 ? THR A 424 ? LEU A 687 THR A 688 
AA2 1 ILE A 271 ? ASP A 272 ? ILE A 535 ASP A 536 
AA2 2 ALA A 290 ? ARG A 292 ? ALA A 554 ARG A 556 
AA2 3 LYS A 389 ? MET A 394 ? LYS A 653 MET A 658 
AA2 4 VAL A 356 ? ILE A 367 ? VAL A 620 ILE A 631 
AA2 5 VAL A 374 ? GLU A 378 ? VAL A 638 GLU A 642 
AA3 1 ILE A 271 ? ASP A 272 ? ILE A 535 ASP A 536 
AA3 2 ALA A 290 ? ARG A 292 ? ALA A 554 ARG A 556 
AA3 3 LYS A 389 ? MET A 394 ? LYS A 653 MET A 658 
AA3 4 VAL A 356 ? ILE A 367 ? VAL A 620 ILE A 631 
AA3 5 PRO A 326 ? GLY A 337 ? PRO A 590 GLY A 601 
AA3 6 THR A 433 ? GLY A 442 ? THR A 697 GLY A 706 
AA4 1 GLU A 426 ? MET A 427 ? GLU A 690 MET A 691 
AA4 2 ILE A 430 ? PRO A 431 ? ILE A 694 PRO A 695 
AA5 1 GLU B 254 ? TRP B 255 ? GLU C 518 TRP C 519 
AA5 2 LEU B 423 ? GLU B 426 ? LEU C 687 GLU C 690 
AA5 3 PRO B 431 ? GLY B 442 ? PRO C 695 GLY C 706 
AA5 4 PRO B 326 ? GLY B 339 ? PRO C 590 GLY C 603 
AA5 5 LYS B 354 ? GLU B 368 ? LYS C 618 GLU C 632 
AA5 6 LYS B 389 ? MET B 394 ? LYS C 653 MET C 658 
AA5 7 ALA B 290 ? ARG B 292 ? ALA C 554 ARG C 556 
AA5 8 ILE B 271 ? ASP B 272 ? ILE C 535 ASP C 536 
AA6 1 GLU B 254 ? TRP B 255 ? GLU C 518 TRP C 519 
AA6 2 LEU B 423 ? GLU B 426 ? LEU C 687 GLU C 690 
AA6 3 PRO B 431 ? GLY B 442 ? PRO C 695 GLY C 706 
AA6 4 PRO B 326 ? GLY B 339 ? PRO C 590 GLY C 603 
AA6 5 LYS B 354 ? GLU B 368 ? LYS C 618 GLU C 632 
AA6 6 ASN B 373 ? GLU B 378 ? ASN C 637 GLU C 642 
AA7 1 SER C 2   ? MET C 5   ? SER D 2   MET D 5   
AA7 2 PHE C 343 ? ARG C 349 ? PHE D 343 ARG D 349 
AA7 3 THR C 326 ? PRO C 332 ? THR D 326 PRO D 332 
AA7 4 PHE C 318 ? ASN C 321 ? PHE D 318 ASN D 321 
AA8 1 MET C 22  ? PHE C 24  ? MET D 22  PHE D 24  
AA8 2 GLN C 27  ? PHE C 30  ? GLN D 27  PHE D 30  
AA8 3 PHE C 46  ? PHE C 48  ? PHE D 46  PHE D 48  
AA9 1 ILE C 61  ? PHE C 62  ? ILE D 61  PHE D 62  
AA9 2 LYS C 119 ? PHE C 122 ? LYS D 119 PHE D 122 
AA9 3 VAL C 112 ? ASN C 116 ? VAL D 112 ASN D 116 
AB1 1 CYS C 78  ? LYS C 81  ? CYS D 78  LYS D 81  
AB1 2 HIS C 89  ? ILE C 93  ? HIS D 89  ILE D 93  
AB1 3 ILE C 107 ? MET C 110 ? ILE D 107 MET D 110 
AB1 4 THR C 125 ? LYS C 127 ? THR D 125 LYS D 127 
AB2 1 VAL C 130 ? GLY C 131 ? VAL D 130 GLY D 131 
AB2 2 CYS C 191 ? TYR C 195 ? CYS D 191 TYR D 195 
AB2 3 VAL C 182 ? ILE C 185 ? VAL D 182 ILE D 185 
AB2 4 SER C 151 ? LEU C 155 ? SER D 151 LEU D 155 
AB2 5 ILE C 142 ? TYR C 146 ? ILE D 142 TYR D 146 
AB3 1 ARG C 159 ? TYR C 161 ? ARG D 159 TYR D 161 
AB3 2 VAL C 175 ? ASP C 177 ? VAL D 175 ASP D 177 
AB4 1 VAL C 208 ? ALA C 211 ? VAL D 208 ALA D 211 
AB4 2 THR C 215 ? LEU C 219 ? THR D 215 LEU D 219 
AB4 3 LEU C 233 ? ASP C 239 ? LEU D 233 ASP D 239 
AB4 4 ALA C 246 ? LEU C 252 ? ALA D 246 LEU D 252 
AB5 1 LEU C 263 ? ASN C 267 ? LEU D 263 ASN D 267 
AB5 2 GLU C 270 ? ILE C 273 ? GLU D 270 ILE D 273 
AB5 3 SER C 288 ? SER C 291 ? SER D 288 SER D 291 
AB5 4 ILE C 299 ? GLU C 301 ? ILE D 299 GLU D 301 
AB6 1 SER D 2   ? MET D 5   ? SER B 2   MET B 5   
AB6 2 PHE D 343 ? ARG D 349 ? PHE B 343 ARG B 349 
AB6 3 THR D 326 ? PRO D 332 ? THR B 326 PRO B 332 
AB6 4 PHE D 318 ? ASN D 321 ? PHE B 318 ASN B 321 
AB7 1 THR D 7   ? VAL D 8   ? THR B 7   VAL B 8   
AB7 2 HIS D 54  ? PRO D 59  ? HIS B 54  PRO B 59  
AB7 3 PHE D 46  ? ILE D 50  ? PHE B 46  ILE B 50  
AB7 4 VAL D 28  ? PHE D 30  ? VAL B 28  PHE B 30  
AB7 5 MET D 22  ? ASN D 23  ? MET B 22  ASN B 23  
AB8 1 ILE D 61  ? PHE D 62  ? ILE B 61  PHE B 62  
AB8 2 LYS D 119 ? PHE D 122 ? LYS B 119 PHE B 122 
AB8 3 VAL D 112 ? ASN D 116 ? VAL B 112 ASN B 116 
AB9 1 CYS D 78  ? TYR D 80  ? CYS B 78  TYR B 80  
AB9 2 GLN D 90  ? HIS D 94  ? GLN B 90  HIS B 94  
AB9 3 ILE D 107 ? MET D 110 ? ILE B 107 MET B 110 
AB9 4 THR D 125 ? LYS D 127 ? THR B 125 LYS B 127 
AC1 1 VAL D 130 ? GLY D 131 ? VAL B 130 GLY B 131 
AC1 2 CYS D 191 ? TYR D 195 ? CYS B 191 TYR B 195 
AC1 3 VAL D 182 ? ASP D 186 ? VAL B 182 ASP B 186 
AC1 4 SER D 151 ? PHE D 156 ? SER B 151 PHE B 156 
AC1 5 SER D 141 ? TYR D 146 ? SER B 141 TYR B 146 
AC2 1 ARG D 159 ? TYR D 161 ? ARG B 159 TYR B 161 
AC2 2 VAL D 175 ? ASP D 177 ? VAL B 175 ASP B 177 
AC3 1 VAL D 208 ? ALA D 211 ? VAL B 208 ALA B 211 
AC3 2 THR D 215 ? LEU D 219 ? THR B 215 LEU B 219 
AC3 3 ASN D 232 ? ASP D 239 ? ASN B 232 ASP B 239 
AC3 4 ALA D 246 ? ILE D 256 ? ALA B 246 ILE B 256 
AC4 1 ILE D 262 ? ASN D 267 ? ILE B 262 ASN B 267 
AC4 2 GLU D 270 ? VAL D 274 ? GLU B 270 VAL B 274 
AC4 3 SER D 288 ? LEU D 292 ? SER B 288 LEU B 292 
AC4 4 ILE D 297 ? SER D 300 ? ILE B 297 SER B 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 254 ? N GLU A 518 O THR A 424 ? O THR A 688 
AA2 1 2 N ILE A 271 ? N ILE A 535 O ARG A 292 ? O ARG A 556 
AA2 2 3 N LYS A 291 ? N LYS A 555 O LEU A 393 ? O LEU A 657 
AA2 3 4 O CYS A 392 ? O CYS A 656 N PHE A 358 ? N PHE A 622 
AA2 4 5 N ILE A 367 ? N ILE A 631 O VAL A 374 ? O VAL A 638 
AA3 1 2 N ILE A 271 ? N ILE A 535 O ARG A 292 ? O ARG A 556 
AA3 2 3 N LYS A 291 ? N LYS A 555 O LEU A 393 ? O LEU A 657 
AA3 3 4 O CYS A 392 ? O CYS A 656 N PHE A 358 ? N PHE A 622 
AA3 4 5 O THR A 361 ? O THR A 625 N LYS A 332 ? N LYS A 596 
AA3 5 6 N VAL A 329 ? N VAL A 593 O LYS A 435 ? O LYS A 699 
AA4 1 2 N MET A 427 ? N MET A 691 O ILE A 430 ? O ILE A 694 
AA5 1 2 N GLU B 254 ? N GLU C 518 O THR B 424 ? O THR C 688 
AA5 2 3 N LEU B 425 ? N LEU C 689 O ARG B 432 ? O ARG C 696 
AA5 3 4 O THR B 433 ? O THR C 697 N PHE B 327 ? N PHE C 591 
AA5 4 5 N MET B 338 ? N MET C 602 O ALA B 355 ? O ALA C 619 
AA5 5 6 N PHE B 358 ? N PHE C 622 O LEU B 391 ? O LEU C 655 
AA5 6 7 O LEU B 393 ? O LEU C 657 N LYS B 291 ? N LYS C 555 
AA5 7 8 O ARG B 292 ? O ARG C 556 N ILE B 271 ? N ILE C 535 
AA6 1 2 N GLU B 254 ? N GLU C 518 O THR B 424 ? O THR C 688 
AA6 2 3 N LEU B 425 ? N LEU C 689 O ARG B 432 ? O ARG C 696 
AA6 3 4 O THR B 433 ? O THR C 697 N PHE B 327 ? N PHE C 591 
AA6 4 5 N MET B 338 ? N MET C 602 O ALA B 355 ? O ALA C 619 
AA6 5 6 N ILE B 365 ? N ILE C 629 O VAL B 376 ? O VAL C 640 
AA7 1 2 N GLN C 4   ? N GLN D 4   O THR C 347 ? O THR D 347 
AA7 2 3 O TYR C 344 ? O TYR D 344 N ILE C 331 ? N ILE D 331 
AA7 3 4 O GLY C 330 ? O GLY D 330 N PHE C 318 ? N PHE D 318 
AA8 1 2 N MET C 22  ? N MET D 22  O PHE C 29  ? O PHE D 29  
AA8 2 3 N PHE C 30  ? N PHE D 30  O PHE C 46  ? O PHE D 46  
AA9 1 2 N ILE C 61  ? N ILE D 61  O PHE C 122 ? O PHE D 122 
AA9 2 3 O THR C 121 ? O THR D 121 N ALA C 113 ? N ALA D 113 
AB1 1 2 N TYR C 80  ? N TYR D 80  O GLN C 90  ? O GLN D 90  
AB1 2 3 N ILE C 93  ? N ILE D 93  O TYR C 108 ? O TYR D 108 
AB1 3 4 N ILE C 107 ? N ILE D 107 O LYS C 127 ? O LYS D 127 
AB2 1 2 N VAL C 130 ? N VAL D 130 O ALA C 192 ? O ALA D 192 
AB2 2 3 O TYR C 195 ? O TYR D 195 N VAL C 182 ? N VAL D 182 
AB2 3 4 O PHE C 183 ? O PHE D 183 N LEU C 155 ? N LEU D 155 
AB2 4 5 O VAL C 154 ? O VAL D 154 N ASP C 143 ? N ASP D 143 
AB3 1 2 N SER C 160 ? N SER D 160 O ALA C 176 ? O ALA D 176 
AB4 1 2 N ILE C 210 ? N ILE D 210 O TYR C 217 ? O TYR D 217 
AB4 2 3 N ILE C 218 ? N ILE D 218 O TYR C 234 ? O TYR D 234 
AB4 3 4 N LEU C 233 ? N LEU D 233 O LEU C 252 ? O LEU D 252 
AB5 1 2 N THR C 264 ? N THR D 264 O VAL C 272 ? O VAL D 272 
AB5 2 3 N PHE C 271 ? N PHE D 271 O VAL C 290 ? O VAL D 290 
AB5 3 4 N LEU C 289 ? N LEU D 289 O SER C 300 ? O SER D 300 
AB6 1 2 N GLN D 4   ? N GLN B 4   O THR D 347 ? O THR B 347 
AB6 2 3 O TYR D 344 ? O TYR B 344 N ILE D 331 ? N ILE B 331 
AB6 3 4 O GLY D 330 ? O GLY B 330 N PHE D 318 ? N PHE B 318 
AB7 1 2 N THR D 7   ? N THR B 7   O LEU D 55  ? O LEU B 55  
AB7 2 3 O LYS D 58  ? O LYS B 58  N HIS D 47  ? N HIS B 47  
AB7 3 4 O PHE D 46  ? O PHE B 46  N PHE D 30  ? N PHE B 30  
AB7 4 5 O PHE D 29  ? O PHE B 29  N MET D 22  ? N MET B 22  
AB8 1 2 N ILE D 61  ? N ILE B 61  O PHE D 122 ? O PHE B 122 
AB8 2 3 O THR D 121 ? O THR B 121 N ALA D 113 ? N ALA B 113 
AB9 1 2 N TYR D 80  ? N TYR B 80  O GLN D 90  ? O GLN B 90  
AB9 2 3 N ILE D 93  ? N ILE B 93  O TYR D 108 ? O TYR B 108 
AB9 3 4 N ILE D 109 ? N ILE B 109 O THR D 125 ? O THR B 125 
AC1 1 2 N VAL D 130 ? N VAL B 130 O ALA D 192 ? O ALA B 192 
AC1 2 3 O TYR D 195 ? O TYR B 195 N VAL D 182 ? N VAL B 182 
AC1 3 4 O ILE D 185 ? O ILE B 185 N GLY D 153 ? N GLY B 153 
AC1 4 5 O VAL D 154 ? O VAL B 154 N ASP D 143 ? N ASP B 143 
AC2 1 2 N SER D 160 ? N SER B 160 O ALA D 176 ? O ALA B 176 
AC3 1 2 N ILE D 210 ? N ILE B 210 O TYR D 217 ? O TYR B 217 
AC3 2 3 N VAL D 216 ? N VAL B 216 O ILE D 236 ? O ILE B 236 
AC3 3 4 N LEU D 233 ? N LEU B 233 O LEU D 252 ? O LEU B 252 
AC4 1 2 N ILE D 262 ? N ILE B 262 O VAL D 274 ? O VAL B 274 
AC4 2 3 N ILE D 273 ? N ILE B 273 O SER D 288 ? O SER B 288 
AC4 3 4 N SER D 291 ? N SER B 291 O GLU D 298 ? O GLU B 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1101 ? 4 'binding site for residue ZN A 1101' 
AC2 Software A CA 1102 ? 3 'binding site for residue CA A 1102' 
AC3 Software C ZN 1101 ? 4 'binding site for residue ZN C 1101' 
AC4 Software C CA 1102 ? 3 'binding site for residue CA C 1102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 463 ? CYS A 727 . ? 1_555 ? 
2  AC1 4 CYS A 466 ? CYS A 730 . ? 1_555 ? 
3  AC1 4 HIS A 673 ? HIS A 937 . ? 1_555 ? 
4  AC1 4 HIS A 678 ? HIS A 942 . ? 1_555 ? 
5  AC2 3 ASP A 336 ? ASP A 600 . ? 1_555 ? 
6  AC2 3 GLY A 337 ? GLY A 601 . ? 1_555 ? 
7  AC2 3 DT  E 31  ? DT  F 31  . ? 1_555 ? 
8  AC3 4 CYS B 463 ? CYS C 727 . ? 1_555 ? 
9  AC3 4 CYS B 466 ? CYS C 730 . ? 1_555 ? 
10 AC3 4 HIS B 673 ? HIS C 937 . ? 1_555 ? 
11 AC3 4 HIS B 678 ? HIS C 942 . ? 1_555 ? 
12 AC4 3 ASP B 336 ? ASP C 600 . ? 1_555 ? 
13 AC4 3 GLY B 337 ? GLY C 601 . ? 1_555 ? 
14 AC4 3 DT  H 42  ? DT  G 42  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CG0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1  131 ? 126.807 166.495 210.769 1.00 358.01 ? 395  HIS A N     1 
ATOM   2     C  CA    . HIS A 1  131 ? 126.587 165.187 211.376 1.00 358.01 ? 395  HIS A CA    1 
ATOM   3     C  C     . HIS A 1  131 ? 127.622 164.918 212.463 1.00 358.01 ? 395  HIS A C     1 
ATOM   4     O  O     . HIS A 1  131 ? 128.020 165.829 213.190 1.00 358.01 ? 395  HIS A O     1 
ATOM   5     C  CB    . HIS A 1  131 ? 126.630 164.096 210.316 1.00 358.01 ? 395  HIS A CB    1 
ATOM   6     N  N     . LEU A 1  132 ? 128.057 163.667 212.571 1.00 357.11 ? 396  LEU A N     1 
ATOM   7     C  CA    . LEU A 1  132 ? 129.061 163.277 213.548 1.00 357.11 ? 396  LEU A CA    1 
ATOM   8     C  C     . LEU A 1  132 ? 130.449 163.311 212.922 1.00 357.11 ? 396  LEU A C     1 
ATOM   9     O  O     . LEU A 1  132 ? 130.608 163.159 211.708 1.00 357.11 ? 396  LEU A O     1 
ATOM   10    C  CB    . LEU A 1  132 ? 128.784 161.878 214.108 1.00 357.11 ? 396  LEU A CB    1 
ATOM   11    C  CG    . LEU A 1  132 ? 129.095 160.681 213.204 1.00 357.11 ? 396  LEU A CG    1 
ATOM   12    C  CD1   . LEU A 1  132 ? 129.266 159.417 214.031 1.00 357.11 ? 396  LEU A CD1   1 
ATOM   13    C  CD2   . LEU A 1  132 ? 128.008 160.481 212.156 1.00 357.11 ? 396  LEU A CD2   1 
ATOM   14    N  N     . LEU A 1  133 ? 131.453 163.531 213.769 1.00 359.59 ? 397  LEU A N     1 
ATOM   15    C  CA    . LEU A 1  133 ? 132.867 163.541 213.401 1.00 359.59 ? 397  LEU A CA    1 
ATOM   16    C  C     . LEU A 1  133 ? 133.207 164.590 212.349 1.00 359.59 ? 397  LEU A C     1 
ATOM   17    O  O     . LEU A 1  133 ? 134.326 164.590 211.822 1.00 359.59 ? 397  LEU A O     1 
ATOM   18    C  CB    . LEU A 1  133 ? 133.329 162.160 212.922 1.00 359.59 ? 397  LEU A CB    1 
ATOM   19    N  N     . SER A 1  134 ? 132.276 165.485 212.027 1.00 372.06 ? 398  SER A N     1 
ATOM   20    C  CA    . SER A 1  134 ? 132.516 166.565 211.082 1.00 372.06 ? 398  SER A CA    1 
ATOM   21    C  C     . SER A 1  134 ? 132.749 167.898 211.778 1.00 372.06 ? 398  SER A C     1 
ATOM   22    O  O     . SER A 1  134 ? 132.733 168.943 211.120 1.00 372.06 ? 398  SER A O     1 
ATOM   23    C  CB    . SER A 1  134 ? 131.346 166.680 210.103 1.00 372.06 ? 398  SER A CB    1 
ATOM   24    O  OG    . SER A 1  134 ? 130.159 167.072 210.771 1.00 372.06 ? 398  SER A OG    1 
ATOM   25    N  N     . LEU A 1  135 ? 132.963 167.882 213.088 1.00 395.07 ? 399  LEU A N     1 
ATOM   26    C  CA    . LEU A 1  135 ? 133.187 169.088 213.867 1.00 395.07 ? 399  LEU A CA    1 
ATOM   27    C  C     . LEU A 1  135 ? 134.680 169.379 213.980 1.00 395.07 ? 399  LEU A C     1 
ATOM   28    O  O     . LEU A 1  135 ? 135.526 168.500 213.802 1.00 395.07 ? 399  LEU A O     1 
ATOM   29    C  CB    . LEU A 1  135 ? 132.576 168.951 215.263 1.00 395.07 ? 399  LEU A CB    1 
ATOM   30    C  CG    . LEU A 1  135 ? 131.065 169.128 215.433 1.00 395.07 ? 399  LEU A CG    1 
ATOM   31    C  CD1   . LEU A 1  135 ? 130.289 167.946 214.867 1.00 395.07 ? 399  LEU A CD1   1 
ATOM   32    C  CD2   . LEU A 1  135 ? 130.730 169.328 216.900 1.00 395.07 ? 399  LEU A CD2   1 
ATOM   33    N  N     . THR A 1  136 ? 134.995 170.635 214.284 1.00 399.03 ? 400  THR A N     1 
ATOM   34    C  CA    . THR A 1  136 ? 136.378 171.038 214.477 1.00 399.03 ? 400  THR A CA    1 
ATOM   35    C  C     . THR A 1  136 ? 136.837 170.668 215.887 1.00 399.03 ? 400  THR A C     1 
ATOM   36    O  O     . THR A 1  136 ? 136.152 169.962 216.632 1.00 399.03 ? 400  THR A O     1 
ATOM   37    C  CB    . THR A 1  136 ? 136.543 172.534 214.212 1.00 399.03 ? 400  THR A CB    1 
ATOM   38    O  OG1   . THR A 1  136 ? 137.935 172.874 214.230 1.00 399.03 ? 400  THR A OG1   1 
ATOM   39    C  CG2   . THR A 1  136 ? 135.816 173.348 215.268 1.00 399.03 ? 400  THR A CG2   1 
ATOM   40    N  N     . ARG A 1  137 ? 138.021 171.141 216.247 1.00 382.13 ? 401  ARG A N     1 
ATOM   41    C  CA    . ARG A 1  137 ? 138.575 170.846 217.556 1.00 382.13 ? 401  ARG A CA    1 
ATOM   42    C  C     . ARG A 1  137 ? 137.734 171.437 218.680 1.00 382.13 ? 401  ARG A C     1 
ATOM   43    O  O     . ARG A 1  137 ? 136.904 172.318 218.461 1.00 382.13 ? 401  ARG A O     1 
ATOM   44    C  CB    . ARG A 1  137 ? 140.017 171.351 217.654 1.00 382.13 ? 401  ARG A CB    1 
ATOM   45    C  CG    . ARG A 1  137 ? 141.044 170.255 217.889 1.00 382.13 ? 401  ARG A CG    1 
ATOM   46    C  CD    . ARG A 1  137 ? 142.195 170.353 216.902 1.00 382.13 ? 401  ARG A CD    1 
ATOM   47    N  NE    . ARG A 1  137 ? 142.777 169.047 216.609 1.00 382.13 ? 401  ARG A NE    1 
ATOM   48    C  CZ    . ARG A 1  137 ? 143.397 168.744 215.474 1.00 382.13 ? 401  ARG A CZ    1 
ATOM   49    N  NH1   . ARG A 1  137 ? 143.517 169.654 214.518 1.00 382.13 ? 401  ARG A NH1   1 
ATOM   50    N  NH2   . ARG A 1  137 ? 143.897 167.529 215.293 1.00 382.13 ? 401  ARG A NH2   1 
ATOM   51    N  N     . ARG A 1  138 ? 137.954 170.922 219.882 1.00 393.46 ? 402  ARG A N     1 
ATOM   52    C  CA    . ARG A 1  138 ? 137.267 171.381 221.088 1.00 393.46 ? 402  ARG A CA    1 
ATOM   53    C  C     . ARG A 1  138 ? 135.757 171.202 220.985 1.00 393.46 ? 402  ARG A C     1 
ATOM   54    O  O     . ARG A 1  138 ? 135.013 171.631 221.873 1.00 393.46 ? 402  ARG A O     1 
ATOM   55    C  CB    . ARG A 1  138 ? 137.613 172.843 221.390 1.00 393.46 ? 402  ARG A CB    1 
ATOM   56    C  CG    . ARG A 1  138 ? 139.090 173.096 221.663 1.00 393.46 ? 402  ARG A CG    1 
ATOM   57    C  CD    . ARG A 1  138 ? 139.505 172.650 223.063 1.00 393.46 ? 402  ARG A CD    1 
ATOM   58    N  NE    . ARG A 1  138 ? 139.630 171.199 223.180 1.00 393.46 ? 402  ARG A NE    1 
ATOM   59    C  CZ    . ARG A 1  138 ? 140.660 170.495 222.721 1.00 393.46 ? 402  ARG A CZ    1 
ATOM   60    N  NH1   . ARG A 1  138 ? 140.684 169.179 222.872 1.00 393.46 ? 402  ARG A NH1   1 
ATOM   61    N  NH2   . ARG A 1  138 ? 141.666 171.107 222.111 1.00 393.46 ? 402  ARG A NH2   1 
ATOM   62    N  N     . ALA A 1  139 ? 135.294 170.572 219.906 1.00 393.13 ? 403  ALA A N     1 
ATOM   63    C  CA    . ALA A 1  139 ? 133.887 170.230 219.750 1.00 393.13 ? 403  ALA A CA    1 
ATOM   64    C  C     . ALA A 1  139 ? 133.648 168.810 219.265 1.00 393.13 ? 403  ALA A C     1 
ATOM   65    O  O     . ALA A 1  139 ? 132.558 168.277 219.506 1.00 393.13 ? 403  ALA A O     1 
ATOM   66    C  CB    . ALA A 1  139 ? 133.199 171.206 218.786 1.00 393.13 ? 403  ALA A CB    1 
ATOM   67    N  N     . GLN A 1  140 ? 134.615 168.179 218.595 1.00 379.46 ? 404  GLN A N     1 
ATOM   68    C  CA    . GLN A 1  140 ? 134.466 166.780 218.210 1.00 379.46 ? 404  GLN A CA    1 
ATOM   69    C  C     . GLN A 1  140 ? 134.745 165.853 219.387 1.00 379.46 ? 404  GLN A C     1 
ATOM   70    O  O     . GLN A 1  140 ? 134.141 164.780 219.493 1.00 379.46 ? 404  GLN A O     1 
ATOM   71    C  CB    . GLN A 1  140 ? 135.388 166.457 217.032 1.00 379.46 ? 404  GLN A CB    1 
ATOM   72    C  CG    . GLN A 1  140 ? 136.872 166.597 217.334 1.00 379.46 ? 404  GLN A CG    1 
ATOM   73    C  CD    . GLN A 1  140 ? 137.742 166.329 216.122 1.00 379.46 ? 404  GLN A CD    1 
ATOM   74    O  OE1   . GLN A 1  140 ? 137.245 165.986 215.049 1.00 379.46 ? 404  GLN A OE1   1 
ATOM   75    N  NE2   . GLN A 1  140 ? 139.051 166.483 216.288 1.00 379.46 ? 404  GLN A NE2   1 
ATOM   76    N  N     . LYS A 1  141 ? 135.656 166.252 220.277 1.00 372.88 ? 405  LYS A N     1 
ATOM   77    C  CA    . LYS A 1  141 ? 135.881 165.492 221.501 1.00 372.88 ? 405  LYS A CA    1 
ATOM   78    C  C     . LYS A 1  141 ? 134.713 165.660 222.465 1.00 372.88 ? 405  LYS A C     1 
ATOM   79    O  O     . LYS A 1  141 ? 134.427 164.766 223.271 1.00 372.88 ? 405  LYS A O     1 
ATOM   80    C  CB    . LYS A 1  141 ? 137.192 165.935 222.152 1.00 372.88 ? 405  LYS A CB    1 
ATOM   81    C  CG    . LYS A 1  141 ? 137.579 165.152 223.395 1.00 372.88 ? 405  LYS A CG    1 
ATOM   82    C  CD    . LYS A 1  141 ? 138.913 165.626 223.947 1.00 372.88 ? 405  LYS A CD    1 
ATOM   83    C  CE    . LYS A 1  141 ? 139.337 164.799 225.149 1.00 372.88 ? 405  LYS A CE    1 
ATOM   84    N  NZ    . LYS A 1  141 ? 138.441 165.022 226.317 1.00 372.88 ? 405  LYS A NZ    1 
ATOM   85    N  N     . HIS A 1  142 ? 134.017 166.797 222.382 1.00 380.49 ? 406  HIS A N     1 
ATOM   86    C  CA    . HIS A 1  142 ? 132.891 167.076 223.266 1.00 380.49 ? 406  HIS A CA    1 
ATOM   87    C  C     . HIS A 1  142 ? 131.768 166.056 223.125 1.00 380.49 ? 406  HIS A C     1 
ATOM   88    O  O     . HIS A 1  142 ? 130.948 165.920 224.040 1.00 380.49 ? 406  HIS A O     1 
ATOM   89    C  CB    . HIS A 1  142 ? 132.359 168.484 222.985 1.00 380.49 ? 406  HIS A CB    1 
ATOM   90    C  CG    . HIS A 1  142 ? 131.303 168.939 223.943 1.00 380.49 ? 406  HIS A CG    1 
ATOM   91    N  ND1   . HIS A 1  142 ? 129.965 168.661 223.763 1.00 380.49 ? 406  HIS A ND1   1 
ATOM   92    C  CD2   . HIS A 1  142 ? 131.386 169.659 225.087 1.00 380.49 ? 406  HIS A CD2   1 
ATOM   93    C  CE1   . HIS A 1  142 ? 129.270 169.187 224.756 1.00 380.49 ? 406  HIS A CE1   1 
ATOM   94    N  NE2   . HIS A 1  142 ? 130.109 169.798 225.573 1.00 380.49 ? 406  HIS A NE2   1 
ATOM   95    N  N     . ARG A 1  143 ? 131.712 165.335 222.007 1.00 371.94 ? 407  ARG A N     1 
ATOM   96    C  CA    . ARG A 1  143 ? 130.667 164.348 221.763 1.00 371.94 ? 407  ARG A CA    1 
ATOM   97    C  C     . ARG A 1  143 ? 131.122 162.918 222.024 1.00 371.94 ? 407  ARG A C     1 
ATOM   98    O  O     . ARG A 1  143 ? 130.331 162.102 222.506 1.00 371.94 ? 407  ARG A O     1 
ATOM   99    C  CB    . ARG A 1  143 ? 130.159 164.469 220.323 1.00 371.94 ? 407  ARG A CB    1 
ATOM   100   C  CG    . ARG A 1  143 ? 129.442 165.778 220.033 1.00 371.94 ? 407  ARG A CG    1 
ATOM   101   C  CD    . ARG A 1  143 ? 128.988 165.855 218.587 1.00 371.94 ? 407  ARG A CD    1 
ATOM   102   N  NE    . ARG A 1  143 ? 127.959 164.866 218.284 1.00 371.94 ? 407  ARG A NE    1 
ATOM   103   C  CZ    . ARG A 1  143 ? 127.495 164.621 217.064 1.00 371.94 ? 407  ARG A CZ    1 
ATOM   104   N  NH1   . ARG A 1  143 ? 126.558 163.701 216.881 1.00 371.94 ? 407  ARG A NH1   1 
ATOM   105   N  NH2   . ARG A 1  143 ? 127.966 165.298 216.026 1.00 371.94 ? 407  ARG A NH2   1 
ATOM   106   N  N     . LEU A 1  144 ? 132.379 162.594 221.718 1.00 359.34 ? 408  LEU A N     1 
ATOM   107   C  CA    . LEU A 1  144 ? 132.918 161.255 221.911 1.00 359.34 ? 408  LEU A CA    1 
ATOM   108   C  C     . LEU A 1  144 ? 133.766 161.140 223.173 1.00 359.34 ? 408  LEU A C     1 
ATOM   109   O  O     . LEU A 1  144 ? 134.544 160.184 223.304 1.00 359.34 ? 408  LEU A O     1 
ATOM   110   C  CB    . LEU A 1  144 ? 133.737 160.841 220.686 1.00 359.34 ? 408  LEU A CB    1 
ATOM   111   C  CG    . LEU A 1  144 ? 132.954 160.710 219.378 1.00 359.34 ? 408  LEU A CG    1 
ATOM   112   C  CD1   . LEU A 1  144 ? 133.891 160.443 218.210 1.00 359.34 ? 408  LEU A CD1   1 
ATOM   113   C  CD2   . LEU A 1  144 ? 131.901 159.619 219.488 1.00 359.34 ? 408  LEU A CD2   1 
ATOM   114   N  N     . ARG A 1  145 ? 133.623 162.103 224.077 1.00 358.39 ? 409  ARG A N     1 
ATOM   115   C  CA    . ARG A 1  145 ? 134.391 162.123 225.315 1.00 358.39 ? 409  ARG A CA    1 
ATOM   116   C  C     . ARG A 1  145 ? 134.156 160.898 226.193 1.00 358.39 ? 409  ARG A C     1 
ATOM   117   O  O     . ARG A 1  145 ? 135.102 160.323 226.732 1.00 358.39 ? 409  ARG A O     1 
ATOM   118   C  CB    . ARG A 1  145 ? 134.080 163.391 226.111 1.00 358.39 ? 409  ARG A CB    1 
ATOM   119   C  CG    . ARG A 1  145 ? 134.116 163.195 227.617 1.00 358.39 ? 409  ARG A CG    1 
ATOM   120   C  CD    . ARG A 1  145 ? 135.529 162.917 228.102 1.00 358.39 ? 409  ARG A CD    1 
ATOM   121   N  NE    . ARG A 1  145 ? 136.286 164.147 228.311 1.00 358.39 ? 409  ARG A NE    1 
ATOM   122   C  CZ    . ARG A 1  145 ? 135.803 165.228 228.916 1.00 358.39 ? 409  ARG A CZ    1 
ATOM   123   N  NH1   . ARG A 1  145 ? 136.564 166.304 229.062 1.00 358.39 ? 409  ARG A NH1   1 
ATOM   124   N  NH2   . ARG A 1  145 ? 134.560 165.236 229.375 1.00 358.39 ? 409  ARG A NH2   1 
ATOM   125   N  N     . GLU A 1  146 ? 132.894 160.510 226.330 1.00 354.17 ? 410  GLU A N     1 
ATOM   126   C  CA    . GLU A 1  146 ? 132.542 159.359 227.145 1.00 354.17 ? 410  GLU A CA    1 
ATOM   127   C  C     . GLU A 1  146 ? 133.096 158.073 226.550 1.00 354.17 ? 410  GLU A C     1 
ATOM   128   O  O     . GLU A 1  146 ? 133.617 157.223 227.271 1.00 354.17 ? 410  GLU A O     1 
ATOM   129   C  CB    . GLU A 1  146 ? 131.024 159.253 227.292 1.00 354.17 ? 410  GLU A CB    1 
ATOM   130   C  CG    . GLU A 1  146 ? 130.247 160.031 226.245 1.00 354.17 ? 410  GLU A CG    1 
ATOM   131   C  CD    . GLU A 1  146 ? 129.836 161.404 226.733 1.00 354.17 ? 410  GLU A CD    1 
ATOM   132   O  OE1   . GLU A 1  146 ? 130.361 161.842 227.778 1.00 354.17 ? 410  GLU A OE1   1 
ATOM   133   O  OE2   . GLU A 1  146 ? 128.990 162.042 226.074 1.00 354.17 ? 410  GLU A OE2   1 
ATOM   134   N  N     . LEU A 1  147 ? 132.996 157.934 225.232 1.00 351.43 ? 411  LEU A N     1 
ATOM   135   C  CA    . LEU A 1  147 ? 133.477 156.718 224.587 1.00 351.43 ? 411  LEU A CA    1 
ATOM   136   C  C     . LEU A 1  147 ? 134.996 156.630 224.651 1.00 351.43 ? 411  LEU A C     1 
ATOM   137   O  O     . LEU A 1  147 ? 135.552 155.540 224.830 1.00 351.43 ? 411  LEU A O     1 
ATOM   138   C  CB    . LEU A 1  147 ? 132.984 156.656 223.143 1.00 351.43 ? 411  LEU A CB    1 
ATOM   139   C  CG    . LEU A 1  147 ? 133.322 155.362 222.405 1.00 351.43 ? 411  LEU A CG    1 
ATOM   140   C  CD1   . LEU A 1  147 ? 132.713 154.175 223.129 1.00 351.43 ? 411  LEU A CD1   1 
ATOM   141   C  CD2   . LEU A 1  147 ? 132.813 155.425 220.982 1.00 351.43 ? 411  LEU A CD2   1 
ATOM   142   N  N     . LYS A 1  148 ? 135.686 157.767 224.526 1.00 347.26 ? 412  LYS A N     1 
ATOM   143   C  CA    . LYS A 1  148 ? 137.131 157.763 224.728 1.00 347.26 ? 412  LYS A CA    1 
ATOM   144   C  C     . LYS A 1  148 ? 137.485 157.397 226.164 1.00 347.26 ? 412  LYS A C     1 
ATOM   145   O  O     . LYS A 1  148 ? 138.478 156.697 226.402 1.00 347.26 ? 412  LYS A O     1 
ATOM   146   C  CB    . LYS A 1  148 ? 137.718 159.126 224.363 1.00 347.26 ? 412  LYS A CB    1 
ATOM   147   C  CG    . LYS A 1  148 ? 139.230 159.200 224.481 1.00 347.26 ? 412  LYS A CG    1 
ATOM   148   C  CD    . LYS A 1  148 ? 139.903 158.310 223.452 1.00 347.26 ? 412  LYS A CD    1 
ATOM   149   C  CE    . LYS A 1  148 ? 141.415 158.377 223.572 1.00 347.26 ? 412  LYS A CE    1 
ATOM   150   N  NZ    . LYS A 1  148 ? 141.936 159.727 223.221 1.00 347.26 ? 412  LYS A NZ    1 
ATOM   151   N  N     . ILE A 1  149 ? 136.684 157.856 227.127 1.00 349.76 ? 413  ILE A N     1 
ATOM   152   C  CA    . ILE A 1  149 ? 136.895 157.477 228.522 1.00 349.76 ? 413  ILE A CA    1 
ATOM   153   C  C     . ILE A 1  149 ? 136.754 155.970 228.687 1.00 349.76 ? 413  ILE A C     1 
ATOM   154   O  O     . ILE A 1  149 ? 137.557 155.326 229.366 1.00 349.76 ? 413  ILE A O     1 
ATOM   155   C  CB    . ILE A 1  149 ? 135.928 158.243 229.443 1.00 349.76 ? 413  ILE A CB    1 
ATOM   156   C  CG1   . ILE A 1  149 ? 136.267 159.734 229.459 1.00 349.76 ? 413  ILE A CG1   1 
ATOM   157   C  CG2   . ILE A 1  149 ? 135.969 157.682 230.855 1.00 349.76 ? 413  ILE A CG2   1 
ATOM   158   C  CD1   . ILE A 1  149 ? 135.206 160.590 230.110 1.00 349.76 ? 413  ILE A CD1   1 
ATOM   159   N  N     . GLN A 1  150 ? 135.735 155.383 228.058 1.00 346.87 ? 414  GLN A N     1 
ATOM   160   C  CA    . GLN A 1  150 ? 135.558 153.934 228.151 1.00 346.87 ? 414  GLN A CA    1 
ATOM   161   C  C     . GLN A 1  150 ? 136.720 153.187 227.500 1.00 346.87 ? 414  GLN A C     1 
ATOM   162   O  O     . GLN A 1  150 ? 137.191 152.168 228.029 1.00 346.87 ? 414  GLN A O     1 
ATOM   163   C  CB    . GLN A 1  150 ? 134.234 153.527 227.511 1.00 346.87 ? 414  GLN A CB    1 
ATOM   164   C  CG    . GLN A 1  150 ? 133.914 152.051 227.643 1.00 346.87 ? 414  GLN A CG    1 
ATOM   165   C  CD    . GLN A 1  150 ? 132.578 151.705 227.029 1.00 346.87 ? 414  GLN A CD    1 
ATOM   166   O  OE1   . GLN A 1  150 ? 131.907 152.565 226.462 1.00 346.87 ? 414  GLN A OE1   1 
ATOM   167   N  NE2   . GLN A 1  150 ? 132.182 150.442 227.137 1.00 346.87 ? 414  GLN A NE2   1 
ATOM   168   N  N     . VAL A 1  151 ? 137.193 153.679 226.353 1.00 347.13 ? 415  VAL A N     1 
ATOM   169   C  CA    . VAL A 1  151 ? 138.314 153.037 225.669 1.00 347.13 ? 415  VAL A CA    1 
ATOM   170   C  C     . VAL A 1  151 ? 139.563 153.074 226.543 1.00 347.13 ? 415  VAL A C     1 
ATOM   171   O  O     . VAL A 1  151 ? 140.280 152.074 226.671 1.00 347.13 ? 415  VAL A O     1 
ATOM   172   C  CB    . VAL A 1  151 ? 138.562 153.696 224.300 1.00 347.13 ? 415  VAL A CB    1 
ATOM   173   C  CG1   . VAL A 1  151 ? 139.840 153.162 223.679 1.00 347.13 ? 415  VAL A CG1   1 
ATOM   174   C  CG2   . VAL A 1  151 ? 137.387 153.440 223.370 1.00 347.13 ? 415  VAL A CG2   1 
ATOM   175   N  N     . LYS A 1  152 ? 139.839 154.223 227.166 1.00 346.31 ? 416  LYS A N     1 
ATOM   176   C  CA    . LYS A 1  152 ? 141.024 154.308 228.016 1.00 346.31 ? 416  LYS A CA    1 
ATOM   177   C  C     . LYS A 1  152 ? 140.847 153.511 229.305 1.00 346.31 ? 416  LYS A C     1 
ATOM   178   O  O     . LYS A 1  152 ? 141.828 152.985 229.844 1.00 346.31 ? 416  LYS A O     1 
ATOM   179   C  CB    . LYS A 1  152 ? 141.369 155.769 228.319 1.00 346.31 ? 416  LYS A CB    1 
ATOM   180   C  CG    . LYS A 1  152 ? 140.367 156.506 229.186 1.00 346.31 ? 416  LYS A CG    1 
ATOM   181   C  CD    . LYS A 1  152 ? 140.802 157.940 229.436 1.00 346.31 ? 416  LYS A CD    1 
ATOM   182   C  CE    . LYS A 1  152 ? 140.629 158.791 228.190 1.00 346.31 ? 416  LYS A CE    1 
ATOM   183   N  NZ    . LYS A 1  152 ? 140.924 160.225 228.455 1.00 346.31 ? 416  LYS A NZ    1 
ATOM   184   N  N     . GLU A 1  153 ? 139.610 153.384 229.797 1.00 345.99 ? 417  GLU A N     1 
ATOM   185   C  CA    . GLU A 1  153 ? 139.352 152.505 230.933 1.00 345.99 ? 417  GLU A CA    1 
ATOM   186   C  C     . GLU A 1  153 ? 139.704 151.064 230.598 1.00 345.99 ? 417  GLU A C     1 
ATOM   187   O  O     . GLU A 1  153 ? 140.367 150.379 231.385 1.00 345.99 ? 417  GLU A O     1 
ATOM   188   C  CB    . GLU A 1  153 ? 137.889 152.605 231.366 1.00 345.99 ? 417  GLU A CB    1 
ATOM   189   C  CG    . GLU A 1  153 ? 137.516 153.901 232.062 1.00 345.99 ? 417  GLU A CG    1 
ATOM   190   C  CD    . GLU A 1  153 ? 136.044 153.959 232.421 1.00 345.99 ? 417  GLU A CD    1 
ATOM   191   O  OE1   . GLU A 1  153 ? 135.299 153.041 232.019 1.00 345.99 ? 417  GLU A OE1   1 
ATOM   192   O  OE2   . GLU A 1  153 ? 135.631 154.923 233.100 1.00 345.99 ? 417  GLU A OE2   1 
ATOM   193   N  N     . PHE A 1  154 ? 139.272 150.584 229.430 1.00 337.64 ? 418  PHE A N     1 
ATOM   194   C  CA    . PHE A 1  154 ? 139.624 149.220 229.041 1.00 337.64 ? 418  PHE A CA    1 
ATOM   195   C  C     . PHE A 1  154 ? 141.122 149.077 228.793 1.00 337.64 ? 418  PHE A C     1 
ATOM   196   O  O     . PHE A 1  154 ? 141.715 148.040 229.120 1.00 337.64 ? 418  PHE A O     1 
ATOM   197   C  CB    . PHE A 1  154 ? 138.848 148.791 227.801 1.00 337.64 ? 418  PHE A CB    1 
ATOM   198   C  CG    . PHE A 1  154 ? 139.167 147.394 227.352 1.00 337.64 ? 418  PHE A CG    1 
ATOM   199   C  CD1   . PHE A 1  154 ? 138.688 146.301 228.057 1.00 337.64 ? 418  PHE A CD1   1 
ATOM   200   C  CD2   . PHE A 1  154 ? 139.947 147.171 226.228 1.00 337.64 ? 418  PHE A CD2   1 
ATOM   201   C  CE1   . PHE A 1  154 ? 138.972 145.012 227.643 1.00 337.64 ? 418  PHE A CE1   1 
ATOM   202   C  CE2   . PHE A 1  154 ? 140.239 145.883 225.812 1.00 337.64 ? 418  PHE A CE2   1 
ATOM   203   C  CZ    . PHE A 1  154 ? 139.753 144.802 226.522 1.00 337.64 ? 418  PHE A CZ    1 
ATOM   204   N  N     . ALA A 1  155 ? 141.746 150.095 228.194 1.00 338.07 ? 419  ALA A N     1 
ATOM   205   C  CA    . ALA A 1  155 ? 143.186 150.058 227.970 1.00 338.07 ? 419  ALA A CA    1 
ATOM   206   C  C     . ALA A 1  155 ? 143.967 150.018 229.275 1.00 338.07 ? 419  ALA A C     1 
ATOM   207   O  O     . ALA A 1  155 ? 145.047 149.422 229.318 1.00 338.07 ? 419  ALA A O     1 
ATOM   208   C  CB    . ALA A 1  155 ? 143.621 151.263 227.136 1.00 338.07 ? 419  ALA A CB    1 
ATOM   209   N  N     . ASP A 1  156 ? 143.445 150.636 230.336 1.00 341.76 ? 420  ASP A N     1 
ATOM   210   C  CA    . ASP A 1  156 ? 144.063 150.518 231.650 1.00 341.76 ? 420  ASP A CA    1 
ATOM   211   C  C     . ASP A 1  156 ? 143.738 149.184 232.311 1.00 341.76 ? 420  ASP A C     1 
ATOM   212   O  O     . ASP A 1  156 ? 144.549 148.666 233.087 1.00 341.76 ? 420  ASP A O     1 
ATOM   213   C  CB    . ASP A 1  156 ? 143.609 151.669 232.549 1.00 341.76 ? 420  ASP A CB    1 
ATOM   214   C  CG    . ASP A 1  156 ? 144.141 153.010 232.090 1.00 341.76 ? 420  ASP A CG    1 
ATOM   215   O  OD1   . ASP A 1  156 ? 145.235 153.044 231.491 1.00 341.76 ? 420  ASP A OD1   1 
ATOM   216   O  OD2   . ASP A 1  156 ? 143.463 154.032 232.329 1.00 341.76 ? 420  ASP A OD2   1 
ATOM   217   N  N     . LYS A 1  157 ? 142.564 148.620 232.018 1.00 342.17 ? 421  LYS A N     1 
ATOM   218   C  CA    . LYS A 1  157 ? 142.163 147.359 232.633 1.00 342.17 ? 421  LYS A CA    1 
ATOM   219   C  C     . LYS A 1  157 ? 142.992 146.196 232.099 1.00 342.17 ? 421  LYS A C     1 
ATOM   220   O  O     . LYS A 1  157 ? 143.635 145.471 232.867 1.00 342.17 ? 421  LYS A O     1 
ATOM   221   C  CB    . LYS A 1  157 ? 140.671 147.114 232.395 1.00 342.17 ? 421  LYS A CB    1 
ATOM   222   C  CG    . LYS A 1  157 ? 140.145 145.831 233.022 1.00 342.17 ? 421  LYS A CG    1 
ATOM   223   C  CD    . LYS A 1  157 ? 138.633 145.721 232.890 1.00 342.17 ? 421  LYS A CD    1 
ATOM   224   C  CE    . LYS A 1  157 ? 138.219 145.430 231.457 1.00 342.17 ? 421  LYS A CE    1 
ATOM   225   N  NZ    . LYS A 1  157 ? 138.628 144.065 231.024 1.00 342.17 ? 421  LYS A NZ    1 
ATOM   226   N  N     . GLU A 1  158 ? 142.990 146.001 230.780 1.00 338.18 ? 422  GLU A N     1 
ATOM   227   C  CA    . GLU A 1  158 ? 143.690 144.866 230.185 1.00 338.18 ? 422  GLU A CA    1 
ATOM   228   C  C     . GLU A 1  158 ? 145.108 145.231 229.754 1.00 338.18 ? 422  GLU A C     1 
ATOM   229   O  O     . GLU A 1  158 ? 146.079 144.616 230.206 1.00 338.18 ? 422  GLU A O     1 
ATOM   230   C  CB    . GLU A 1  158 ? 142.892 144.320 228.996 1.00 338.18 ? 422  GLU A CB    1 
ATOM   231   C  CG    . GLU A 1  158 ? 141.572 143.677 229.379 1.00 338.18 ? 422  GLU A CG    1 
ATOM   232   C  CD    . GLU A 1  158 ? 141.749 142.405 230.183 1.00 338.18 ? 422  GLU A CD    1 
ATOM   233   O  OE1   . GLU A 1  158 ? 142.756 141.698 229.968 1.00 338.18 ? 422  GLU A OE1   1 
ATOM   234   O  OE2   . GLU A 1  158 ? 140.878 142.112 231.028 1.00 338.18 ? 422  GLU A OE2   1 
ATOM   235   N  N     . GLU A 1  159 ? 145.241 146.228 228.878 1.00 334.24 ? 423  GLU A N     1 
ATOM   236   C  CA    . GLU A 1  159 ? 146.558 146.593 228.368 1.00 334.24 ? 423  GLU A CA    1 
ATOM   237   C  C     . GLU A 1  159 ? 147.398 147.273 229.443 1.00 334.24 ? 423  GLU A C     1 
ATOM   238   O  O     . GLU A 1  159 ? 148.587 146.973 229.599 1.00 334.24 ? 423  GLU A O     1 
ATOM   239   C  CB    . GLU A 1  159 ? 146.412 147.494 227.142 1.00 334.24 ? 423  GLU A CB    1 
ATOM   240   C  CG    . GLU A 1  159 ? 145.781 146.813 225.938 1.00 334.24 ? 423  GLU A CG    1 
ATOM   241   C  CD    . GLU A 1  159 ? 146.663 145.728 225.353 1.00 334.24 ? 423  GLU A CD    1 
ATOM   242   O  OE1   . GLU A 1  159 ? 147.903 145.863 225.425 1.00 334.24 ? 423  GLU A OE1   1 
ATOM   243   O  OE2   . GLU A 1  159 ? 146.117 144.740 224.819 1.00 334.24 ? 423  GLU A OE2   1 
ATOM   244   N  N     . GLY A 1  160 ? 146.795 148.191 230.195 1.00 334.08 ? 424  GLY A N     1 
ATOM   245   C  CA    . GLY A 1  160 ? 147.505 148.963 231.196 1.00 334.08 ? 424  GLY A CA    1 
ATOM   246   C  C     . GLY A 1  160 ? 147.759 150.403 230.813 1.00 334.08 ? 424  GLY A C     1 
ATOM   247   O  O     . GLY A 1  160 ? 148.440 151.113 231.562 1.00 334.08 ? 424  GLY A O     1 
ATOM   248   N  N     . GLY A 1  161 ? 147.236 150.859 229.677 1.00 329.20 ? 425  GLY A N     1 
ATOM   249   C  CA    . GLY A 1  161 ? 147.464 152.215 229.221 1.00 329.20 ? 425  GLY A CA    1 
ATOM   250   C  C     . GLY A 1  161 ? 147.886 152.279 227.769 1.00 329.20 ? 425  GLY A C     1 
ATOM   251   O  O     . GLY A 1  161 ? 148.236 153.349 227.262 1.00 329.20 ? 425  GLY A O     1 
ATOM   252   N  N     . ASP A 1  162 ? 147.854 151.134 227.085 1.00 320.22 ? 426  ASP A N     1 
ATOM   253   C  CA    . ASP A 1  162 ? 148.255 151.050 225.681 1.00 320.22 ? 426  ASP A CA    1 
ATOM   254   C  C     . ASP A 1  162 ? 147.080 151.419 224.771 1.00 320.22 ? 426  ASP A C     1 
ATOM   255   O  O     . ASP A 1  162 ? 146.533 150.601 224.032 1.00 320.22 ? 426  ASP A O     1 
ATOM   256   C  CB    . ASP A 1  162 ? 148.788 149.656 225.372 1.00 320.22 ? 426  ASP A CB    1 
ATOM   257   C  CG    . ASP A 1  162 ? 149.482 149.578 224.023 1.00 320.22 ? 426  ASP A CG    1 
ATOM   258   O  OD1   . ASP A 1  162 ? 149.546 150.607 223.317 1.00 320.22 ? 426  ASP A OD1   1 
ATOM   259   O  OD2   . ASP A 1  162 ? 149.967 148.483 223.668 1.00 320.22 ? 426  ASP A OD2   1 
ATOM   260   N  N     . VAL A 1  163 ? 146.695 152.696 224.843 1.00 313.16 ? 427  VAL A N     1 
ATOM   261   C  CA    . VAL A 1  163 ? 145.600 153.199 224.019 1.00 313.16 ? 427  VAL A CA    1 
ATOM   262   C  C     . VAL A 1  163 ? 145.993 153.214 222.548 1.00 313.16 ? 427  VAL A C     1 
ATOM   263   O  O     . VAL A 1  163 ? 145.162 152.946 221.669 1.00 313.16 ? 427  VAL A O     1 
ATOM   264   C  CB    . VAL A 1  163 ? 145.179 154.600 224.510 1.00 313.16 ? 427  VAL A CB    1 
ATOM   265   C  CG1   . VAL A 1  163 ? 144.092 155.185 223.623 1.00 313.16 ? 427  VAL A CG1   1 
ATOM   266   C  CG2   . VAL A 1  163 ? 144.721 154.542 225.959 1.00 313.16 ? 427  VAL A CG2   1 
ATOM   267   N  N     . LYS A 1  164 ? 147.252 153.544 222.285 1.00 302.85 ? 428  LYS A N     1 
ATOM   268   C  CA    . LYS A 1  164 ? 147.770 153.649 220.923 1.00 302.85 ? 428  LYS A CA    1 
ATOM   269   C  C     . LYS A 1  164 ? 147.589 152.412 220.049 1.00 302.85 ? 428  LYS A C     1 
ATOM   270   O  O     . LYS A 1  164 ? 147.090 152.505 218.929 1.00 302.85 ? 428  LYS A O     1 
ATOM   271   C  CB    . LYS A 1  164 ? 149.251 154.036 220.952 1.00 302.85 ? 428  LYS A CB    1 
ATOM   272   C  CG    . LYS A 1  164 ? 150.138 153.147 220.095 1.00 302.85 ? 428  LYS A CG    1 
ATOM   273   C  CD    . LYS A 1  164 ? 151.611 153.424 220.350 1.00 302.85 ? 428  LYS A CD    1 
ATOM   274   C  CE    . LYS A 1  164 ? 152.261 154.093 219.151 1.00 302.85 ? 428  LYS A CE    1 
ATOM   275   N  NZ    . LYS A 1  164 ? 153.420 154.938 219.549 1.00 302.85 ? 428  LYS A NZ    1 
ATOM   276   N  N     . ALA A 1  165 ? 147.998 151.259 220.561 1.00 301.35 ? 429  ALA A N     1 
ATOM   277   C  CA    . ALA A 1  165 ? 147.921 150.016 219.800 1.00 301.35 ? 429  ALA A CA    1 
ATOM   278   C  C     . ALA A 1  165 ? 146.480 149.552 219.633 1.00 301.35 ? 429  ALA A C     1 
ATOM   279   O  O     . ALA A 1  165 ? 146.078 149.138 218.539 1.00 301.35 ? 429  ALA A O     1 
ATOM   280   C  CB    . ALA A 1  165 ? 148.755 148.931 220.480 1.00 301.35 ? 429  ALA A CB    1 
ATOM   281   N  N     . VAL A 1  166 ? 145.686 149.615 220.704 1.00 299.86 ? 430  VAL A N     1 
ATOM   282   C  CA    . VAL A 1  166 ? 144.316 149.120 220.628 1.00 299.86 ? 430  VAL A CA    1 
ATOM   283   C  C     . VAL A 1  166 ? 143.480 149.994 219.701 1.00 299.86 ? 430  VAL A C     1 
ATOM   284   O  O     . VAL A 1  166 ? 142.673 149.484 218.914 1.00 299.86 ? 430  VAL A O     1 
ATOM   285   C  CB    . VAL A 1  166 ? 143.699 149.007 222.037 1.00 299.86 ? 430  VAL A CB    1 
ATOM   286   C  CG1   . VAL A 1  166 ? 143.601 150.365 222.714 1.00 299.86 ? 430  VAL A CG1   1 
ATOM   287   C  CG2   . VAL A 1  166 ? 142.330 148.346 221.966 1.00 299.86 ? 430  VAL A CG2   1 
ATOM   288   N  N     . CYS A 1  167 ? 143.677 151.315 219.745 1.00 293.60 ? 431  CYS A N     1 
ATOM   289   C  CA    . CYS A 1  167 ? 142.929 152.193 218.850 1.00 293.60 ? 431  CYS A CA    1 
ATOM   290   C  C     . CYS A 1  167 ? 143.353 151.990 217.401 1.00 293.60 ? 431  CYS A C     1 
ATOM   291   O  O     . CYS A 1  167 ? 142.509 151.963 216.496 1.00 293.60 ? 431  CYS A O     1 
ATOM   292   C  CB    . CYS A 1  167 ? 143.102 153.653 219.269 1.00 293.60 ? 431  CYS A CB    1 
ATOM   293   S  SG    . CYS A 1  167 ? 142.269 154.079 220.813 1.00 293.60 ? 431  CYS A SG    1 
ATOM   294   N  N     . LEU A 1  168 ? 144.658 151.831 217.160 1.00 282.21 ? 432  LEU A N     1 
ATOM   295   C  CA    . LEU A 1  168 ? 145.126 151.596 215.798 1.00 282.21 ? 432  LEU A CA    1 
ATOM   296   C  C     . LEU A 1  168 ? 144.567 150.293 215.243 1.00 282.21 ? 432  LEU A C     1 
ATOM   297   O  O     . LEU A 1  168 ? 144.119 150.241 214.093 1.00 282.21 ? 432  LEU A O     1 
ATOM   298   C  CB    . LEU A 1  168 ? 146.655 151.587 215.760 1.00 282.21 ? 432  LEU A CB    1 
ATOM   299   C  CG    . LEU A 1  168 ? 147.309 151.421 214.386 1.00 282.21 ? 432  LEU A CG    1 
ATOM   300   C  CD1   . LEU A 1  168 ? 146.953 152.586 213.474 1.00 282.21 ? 432  LEU A CD1   1 
ATOM   301   C  CD2   . LEU A 1  168 ? 148.820 151.277 214.515 1.00 282.21 ? 432  LEU A CD2   1 
ATOM   302   N  N     . THR A 1  169 ? 144.566 149.233 216.053 1.00 284.50 ? 433  THR A N     1 
ATOM   303   C  CA    . THR A 1  169 ? 144.036 147.956 215.595 1.00 284.50 ? 433  THR A CA    1 
ATOM   304   C  C     . THR A 1  169 ? 142.526 148.011 215.385 1.00 284.50 ? 433  THR A C     1 
ATOM   305   O  O     . THR A 1  169 ? 142.022 147.453 214.403 1.00 284.50 ? 433  THR A O     1 
ATOM   306   C  CB    . THR A 1  169 ? 144.405 146.856 216.592 1.00 284.50 ? 433  THR A CB    1 
ATOM   307   O  OG1   . THR A 1  169 ? 145.827 146.838 216.765 1.00 284.50 ? 433  THR A OG1   1 
ATOM   308   C  CG2   . THR A 1  169 ? 143.960 145.496 216.078 1.00 284.50 ? 433  THR A CG2   1 
ATOM   309   N  N     . LEU A 1  170 ? 141.794 148.685 216.277 1.00 281.67 ? 434  LEU A N     1 
ATOM   310   C  CA    . LEU A 1  170 ? 140.358 148.849 216.082 1.00 281.67 ? 434  LEU A CA    1 
ATOM   311   C  C     . LEU A 1  170 ? 140.062 149.599 214.792 1.00 281.67 ? 434  LEU A C     1 
ATOM   312   O  O     . LEU A 1  170 ? 139.128 149.248 214.063 1.00 281.67 ? 434  LEU A O     1 
ATOM   313   C  CB    . LEU A 1  170 ? 139.748 149.579 217.276 1.00 281.67 ? 434  LEU A CB    1 
ATOM   314   C  CG    . LEU A 1  170 ? 138.231 149.770 217.247 1.00 281.67 ? 434  LEU A CG    1 
ATOM   315   C  CD1   . LEU A 1  170 ? 137.513 148.429 217.258 1.00 281.67 ? 434  LEU A CD1   1 
ATOM   316   C  CD2   . LEU A 1  170 ? 137.798 150.620 218.424 1.00 281.67 ? 434  LEU A CD2   1 
ATOM   317   N  N     . PHE A 1  171 ? 140.858 150.626 214.483 1.00 272.14 ? 435  PHE A N     1 
ATOM   318   C  CA    . PHE A 1  171 ? 140.642 151.368 213.246 1.00 272.14 ? 435  PHE A CA    1 
ATOM   319   C  C     . PHE A 1  171 ? 140.997 150.525 212.026 1.00 272.14 ? 435  PHE A C     1 
ATOM   320   O  O     . PHE A 1  171 ? 140.313 150.594 210.998 1.00 272.14 ? 435  PHE A O     1 
ATOM   321   C  CB    . PHE A 1  171 ? 141.446 152.668 213.269 1.00 272.14 ? 435  PHE A CB    1 
ATOM   322   C  CG    . PHE A 1  171 ? 141.229 153.535 212.063 1.00 272.14 ? 435  PHE A CG    1 
ATOM   323   C  CD1   . PHE A 1  171 ? 140.034 154.210 211.887 1.00 272.14 ? 435  PHE A CD1   1 
ATOM   324   C  CD2   . PHE A 1  171 ? 142.222 153.683 211.111 1.00 272.14 ? 435  PHE A CD2   1 
ATOM   325   C  CE1   . PHE A 1  171 ? 139.829 155.007 210.778 1.00 272.14 ? 435  PHE A CE1   1 
ATOM   326   C  CE2   . PHE A 1  171 ? 142.024 154.483 210.003 1.00 272.14 ? 435  PHE A CE2   1 
ATOM   327   C  CZ    . PHE A 1  171 ? 140.826 155.145 209.836 1.00 272.14 ? 435  PHE A CZ    1 
ATOM   328   N  N     . LEU A 1  172 ? 142.052 149.710 212.123 1.00 265.67 ? 436  LEU A N     1 
ATOM   329   C  CA    . LEU A 1  172 ? 142.398 148.816 211.021 1.00 265.67 ? 436  LEU A CA    1 
ATOM   330   C  C     . LEU A 1  172 ? 141.275 147.822 210.746 1.00 265.67 ? 436  LEU A C     1 
ATOM   331   O  O     . LEU A 1  172 ? 140.922 147.566 209.589 1.00 265.67 ? 436  LEU A O     1 
ATOM   332   C  CB    . LEU A 1  172 ? 143.704 148.079 211.328 1.00 265.67 ? 436  LEU A CB    1 
ATOM   333   C  CG    . LEU A 1  172 ? 144.996 148.898 211.360 1.00 265.67 ? 436  LEU A CG    1 
ATOM   334   C  CD1   . LEU A 1  172 ? 146.162 148.035 211.820 1.00 265.67 ? 436  LEU A CD1   1 
ATOM   335   C  CD2   . LEU A 1  172 ? 145.283 149.508 209.998 1.00 265.67 ? 436  LEU A CD2   1 
ATOM   336   N  N     . LEU A 1  173 ? 140.696 147.253 211.806 1.00 269.22 ? 437  LEU A N     1 
ATOM   337   C  CA    . LEU A 1  173 ? 139.584 146.324 211.620 1.00 269.22 ? 437  LEU A CA    1 
ATOM   338   C  C     . LEU A 1  173 ? 138.344 147.036 211.092 1.00 269.22 ? 437  LEU A C     1 
ATOM   339   O  O     . LEU A 1  173 ? 137.610 146.479 210.269 1.00 269.22 ? 437  LEU A O     1 
ATOM   340   C  CB    . LEU A 1  173 ? 139.272 145.591 212.924 1.00 269.22 ? 437  LEU A CB    1 
ATOM   341   C  CG    . LEU A 1  173 ? 140.013 144.275 213.170 1.00 269.22 ? 437  LEU A CG    1 
ATOM   342   C  CD1   . LEU A 1  173 ? 141.507 144.489 213.362 1.00 269.22 ? 437  LEU A CD1   1 
ATOM   343   C  CD2   . LEU A 1  173 ? 139.406 143.546 214.370 1.00 269.22 ? 437  LEU A CD2   1 
ATOM   344   N  N     . ALA A 1  174 ? 138.094 148.265 211.549 1.00 262.60 ? 438  ALA A N     1 
ATOM   345   C  CA    . ALA A 1  174 ? 136.969 149.027 211.020 1.00 262.60 ? 438  ALA A CA    1 
ATOM   346   C  C     . ALA A 1  174 ? 137.148 149.322 209.538 1.00 262.60 ? 438  ALA A C     1 
ATOM   347   O  O     . ALA A 1  174 ? 136.163 149.379 208.792 1.00 262.60 ? 438  ALA A O     1 
ATOM   348   C  CB    . ALA A 1  174 ? 136.796 150.327 211.805 1.00 262.60 ? 438  ALA A CB    1 
ATOM   349   N  N     . LEU A 1  175 ? 138.398 149.431 209.109 1.00 247.40 ? 439  LEU A N     1 
ATOM   350   C  CA    . LEU A 1  175 ? 138.696 149.678 207.710 1.00 247.40 ? 439  LEU A CA    1 
ATOM   351   C  C     . LEU A 1  175 ? 138.511 148.400 206.896 1.00 247.40 ? 439  LEU A C     1 
ATOM   352   O  O     . LEU A 1  175 ? 137.934 148.431 205.810 1.00 247.40 ? 439  LEU A O     1 
ATOM   353   C  CB    . LEU A 1  175 ? 140.124 150.200 207.551 1.00 247.40 ? 439  LEU A CB    1 
ATOM   354   C  CG    . LEU A 1  175 ? 140.421 150.947 206.251 1.00 247.40 ? 439  LEU A CG    1 
ATOM   355   C  CD1   . LEU A 1  175 ? 139.581 152.212 206.160 1.00 247.40 ? 439  LEU A CD1   1 
ATOM   356   C  CD2   . LEU A 1  175 ? 141.904 151.267 206.142 1.00 247.40 ? 439  LEU A CD2   1 
ATOM   357   N  N     . ARG A 1  176 ? 138.987 147.277 207.430 1.00 246.19 ? 440  ARG A N     1 
ATOM   358   C  CA    . ARG A 1  176 ? 138.884 145.998 206.731 1.00 246.19 ? 440  ARG A CA    1 
ATOM   359   C  C     . ARG A 1  176 ? 137.449 145.488 206.686 1.00 246.19 ? 440  ARG A C     1 
ATOM   360   O  O     . ARG A 1  176 ? 137.107 144.679 205.816 1.00 246.19 ? 440  ARG A O     1 
ATOM   361   C  CB    . ARG A 1  176 ? 139.792 144.957 207.386 1.00 246.19 ? 440  ARG A CB    1 
ATOM   362   C  CG    . ARG A 1  176 ? 141.271 145.305 207.348 1.00 246.19 ? 440  ARG A CG    1 
ATOM   363   C  CD    . ARG A 1  176 ? 141.802 145.289 205.924 1.00 246.19 ? 440  ARG A CD    1 
ATOM   364   N  NE    . ARG A 1  176 ? 143.215 145.652 205.859 1.00 246.19 ? 440  ARG A NE    1 
ATOM   365   C  CZ    . ARG A 1  176 ? 144.218 144.781 205.887 1.00 246.19 ? 440  ARG A CZ    1 
ATOM   366   N  NH1   . ARG A 1  176 ? 143.969 143.483 205.968 1.00 246.19 ? 440  ARG A NH1   1 
ATOM   367   N  NH2   . ARG A 1  176 ? 145.471 145.210 205.825 1.00 246.19 ? 440  ARG A NH2   1 
ATOM   368   N  N     . ALA A 1  177 ? 136.598 145.941 207.610 1.00 254.23 ? 441  ALA A N     1 
ATOM   369   C  CA    . ALA A 1  177 ? 135.208 145.499 207.609 1.00 254.23 ? 441  ALA A CA    1 
ATOM   370   C  C     . ALA A 1  177 ? 134.438 146.045 206.413 1.00 254.23 ? 441  ALA A C     1 
ATOM   371   O  O     . ALA A 1  177 ? 133.487 145.407 205.949 1.00 254.23 ? 441  ALA A O     1 
ATOM   372   C  CB    . ALA A 1  177 ? 134.523 145.914 208.911 1.00 254.23 ? 441  ALA A CB    1 
ATOM   373   N  N     . ARG A 1  178 ? 134.829 147.213 205.901 1.00 255.16 ? 442  ARG A N     1 
ATOM   374   C  CA    . ARG A 1  178 ? 134.135 147.856 204.792 1.00 255.16 ? 442  ARG A CA    1 
ATOM   375   C  C     . ARG A 1  178 ? 134.857 147.667 203.461 1.00 255.16 ? 442  ARG A C     1 
ATOM   376   O  O     . ARG A 1  178 ? 134.681 148.476 202.543 1.00 255.16 ? 442  ARG A O     1 
ATOM   377   C  CB    . ARG A 1  178 ? 133.940 149.344 205.081 1.00 255.16 ? 442  ARG A CB    1 
ATOM   378   C  CG    . ARG A 1  178 ? 132.978 149.631 206.222 1.00 255.16 ? 442  ARG A CG    1 
ATOM   379   C  CD    . ARG A 1  178 ? 132.806 151.124 206.434 1.00 255.16 ? 442  ARG A CD    1 
ATOM   380   N  NE    . ARG A 1  178 ? 131.908 151.419 207.546 1.00 255.16 ? 442  ARG A NE    1 
ATOM   381   C  CZ    . ARG A 1  178 ? 131.617 152.645 207.966 1.00 255.16 ? 442  ARG A CZ    1 
ATOM   382   N  NH1   . ARG A 1  178 ? 132.152 153.698 207.362 1.00 255.16 ? 442  ARG A NH1   1 
ATOM   383   N  NH2   . ARG A 1  178 ? 130.790 152.821 208.987 1.00 255.16 ? 442  ARG A NH2   1 
ATOM   384   N  N     . ASN A 1  179 ? 135.664 146.611 203.341 1.00 230.95 ? 443  ASN A N     1 
ATOM   385   C  CA    . ASN A 1  179 ? 136.379 146.280 202.107 1.00 230.95 ? 443  ASN A CA    1 
ATOM   386   C  C     . ASN A 1  179 ? 137.260 147.449 201.657 1.00 230.95 ? 443  ASN A C     1 
ATOM   387   O  O     . ASN A 1  179 ? 137.066 148.045 200.595 1.00 230.95 ? 443  ASN A O     1 
ATOM   388   C  CB    . ASN A 1  179 ? 135.400 145.859 201.005 1.00 230.95 ? 443  ASN A CB    1 
ATOM   389   C  CG    . ASN A 1  179 ? 136.096 145.239 199.805 1.00 230.95 ? 443  ASN A CG    1 
ATOM   390   O  OD1   . ASN A 1  179 ? 137.322 145.132 199.766 1.00 230.95 ? 443  ASN A OD1   1 
ATOM   391   N  ND2   . ASN A 1  179 ? 135.310 144.823 198.819 1.00 230.95 ? 443  ASN A ND2   1 
ATOM   392   N  N     . GLU A 1  180 ? 138.238 147.772 202.498 1.00 229.73 ? 444  GLU A N     1 
ATOM   393   C  CA    . GLU A 1  180 ? 139.166 148.870 202.247 1.00 229.73 ? 444  GLU A CA    1 
ATOM   394   C  C     . GLU A 1  180 ? 140.596 148.403 202.500 1.00 229.73 ? 444  GLU A C     1 
ATOM   395   O  O     . GLU A 1  180 ? 141.370 149.044 203.212 1.00 229.73 ? 444  GLU A O     1 
ATOM   396   C  CB    . GLU A 1  180 ? 138.820 150.088 203.100 1.00 229.73 ? 444  GLU A CB    1 
ATOM   397   C  CG    . GLU A 1  180 ? 137.507 150.753 202.720 1.00 229.73 ? 444  GLU A CG    1 
ATOM   398   C  CD    . GLU A 1  180 ? 137.195 151.962 203.578 1.00 229.73 ? 444  GLU A CD    1 
ATOM   399   O  OE1   . GLU A 1  180 ? 137.941 152.213 204.547 1.00 229.73 ? 444  GLU A OE1   1 
ATOM   400   O  OE2   . GLU A 1  180 ? 136.203 152.661 203.284 1.00 229.73 ? 444  GLU A OE2   1 
ATOM   401   N  N     . HIS A 1  181 ? 140.949 147.252 201.920 1.00 214.75 ? 445  HIS A N     1 
ATOM   402   C  CA    . HIS A 1  181 ? 142.289 146.702 202.104 1.00 214.75 ? 445  HIS A CA    1 
ATOM   403   C  C     . HIS A 1  181 ? 143.372 147.670 201.646 1.00 214.75 ? 445  HIS A C     1 
ATOM   404   O  O     . HIS A 1  181 ? 144.453 147.712 202.241 1.00 214.75 ? 445  HIS A O     1 
ATOM   405   C  CB    . HIS A 1  181 ? 142.420 145.376 201.354 1.00 214.75 ? 445  HIS A CB    1 
ATOM   406   C  CG    . HIS A 1  181 ? 141.532 144.292 201.880 1.00 214.75 ? 445  HIS A CG    1 
ATOM   407   N  ND1   . HIS A 1  181 ? 141.802 143.607 203.045 1.00 214.75 ? 445  HIS A ND1   1 
ATOM   408   C  CD2   . HIS A 1  181 ? 140.377 143.774 201.399 1.00 214.75 ? 445  HIS A CD2   1 
ATOM   409   C  CE1   . HIS A 1  181 ? 140.852 142.714 203.259 1.00 214.75 ? 445  HIS A CE1   1 
ATOM   410   N  NE2   . HIS A 1  181 ? 139.975 142.795 202.275 1.00 214.75 ? 445  HIS A NE2   1 
ATOM   411   N  N     . ARG A 1  182 ? 143.102 148.458 200.603 1.00 193.97 ? 446  ARG A N     1 
ATOM   412   C  CA    . ARG A 1  182 ? 144.109 149.379 200.081 1.00 193.97 ? 446  ARG A CA    1 
ATOM   413   C  C     . ARG A 1  182 ? 144.492 150.429 201.118 1.00 193.97 ? 446  ARG A C     1 
ATOM   414   O  O     . ARG A 1  182 ? 145.673 150.593 201.448 1.00 193.97 ? 446  ARG A O     1 
ATOM   415   C  CB    . ARG A 1  182 ? 143.595 150.048 198.805 1.00 193.97 ? 446  ARG A CB    1 
ATOM   416   C  CG    . ARG A 1  182 ? 144.601 150.979 198.151 1.00 193.97 ? 446  ARG A CG    1 
ATOM   417   C  CD    . ARG A 1  182 ? 144.034 151.608 196.890 1.00 193.97 ? 446  ARG A CD    1 
ATOM   418   N  NE    . ARG A 1  182 ? 142.931 152.519 197.180 1.00 193.97 ? 446  ARG A NE    1 
ATOM   419   C  CZ    . ARG A 1  182 ? 142.147 153.060 196.253 1.00 193.97 ? 446  ARG A CZ    1 
ATOM   420   N  NH1   . ARG A 1  182 ? 142.343 152.782 194.972 1.00 193.97 ? 446  ARG A NH1   1 
ATOM   421   N  NH2   . ARG A 1  182 ? 141.167 153.880 196.608 1.00 193.97 ? 446  ARG A NH2   1 
ATOM   422   N  N     . GLN A 1  183 ? 143.500 151.160 201.635 1.00 208.75 ? 447  GLN A N     1 
ATOM   423   C  CA    . GLN A 1  183 ? 143.787 152.225 202.589 1.00 208.75 ? 447  GLN A CA    1 
ATOM   424   C  C     . GLN A 1  183 ? 144.371 151.678 203.884 1.00 208.75 ? 447  GLN A C     1 
ATOM   425   O  O     . GLN A 1  183 ? 145.261 152.299 204.472 1.00 208.75 ? 447  GLN A O     1 
ATOM   426   C  CB    . GLN A 1  183 ? 142.520 153.030 202.876 1.00 208.75 ? 447  GLN A CB    1 
ATOM   427   C  CG    . GLN A 1  183 ? 142.012 153.826 201.685 1.00 208.75 ? 447  GLN A CG    1 
ATOM   428   C  CD    . GLN A 1  183 ? 140.752 154.606 202.001 1.00 208.75 ? 447  GLN A CD    1 
ATOM   429   O  OE1   . GLN A 1  183 ? 140.207 154.509 203.100 1.00 208.75 ? 447  GLN A OE1   1 
ATOM   430   N  NE2   . GLN A 1  183 ? 140.282 155.387 201.035 1.00 208.75 ? 447  GLN A NE2   1 
ATOM   431   N  N     . ALA A 1  184 ? 143.901 150.514 204.336 1.00 215.81 ? 448  ALA A N     1 
ATOM   432   C  CA    . ALA A 1  184 ? 144.429 149.944 205.570 1.00 215.81 ? 448  ALA A CA    1 
ATOM   433   C  C     . ALA A 1  184 ? 145.864 149.460 205.390 1.00 215.81 ? 448  ALA A C     1 
ATOM   434   O  O     . ALA A 1  184 ? 146.687 149.590 206.304 1.00 215.81 ? 448  ALA A O     1 
ATOM   435   C  CB    . ALA A 1  184 ? 143.530 148.809 206.051 1.00 215.81 ? 448  ALA A CB    1 
ATOM   436   N  N     . ASP A 1  185 ? 146.186 148.900 204.221 1.00 209.40 ? 449  ASP A N     1 
ATOM   437   C  CA    . ASP A 1  185 ? 147.570 148.525 203.948 1.00 209.40 ? 449  ASP A CA    1 
ATOM   438   C  C     . ASP A 1  185 ? 148.464 149.756 203.876 1.00 209.40 ? 449  ASP A C     1 
ATOM   439   O  O     . ASP A 1  185 ? 149.580 149.752 204.409 1.00 209.40 ? 449  ASP A O     1 
ATOM   440   C  CB    . ASP A 1  185 ? 147.659 147.720 202.651 1.00 209.40 ? 449  ASP A CB    1 
ATOM   441   C  CG    . ASP A 1  185 ? 147.073 146.327 202.787 1.00 209.40 ? 449  ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1  185 ? 146.858 145.877 203.930 1.00 209.40 ? 449  ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1  185 ? 146.831 145.680 201.746 1.00 209.40 ? 449  ASP A OD2   1 
ATOM   444   N  N     . GLU A 1  186 ? 147.986 150.824 203.231 1.00 191.49 ? 450  GLU A N     1 
ATOM   445   C  CA    . GLU A 1  186 ? 148.745 152.071 203.211 1.00 191.49 ? 450  GLU A CA    1 
ATOM   446   C  C     . GLU A 1  186 ? 148.966 152.598 204.623 1.00 191.49 ? 450  GLU A C     1 
ATOM   447   O  O     . GLU A 1  186 ? 150.052 153.093 204.950 1.00 191.49 ? 450  GLU A O     1 
ATOM   448   C  CB    . GLU A 1  186 ? 148.021 153.112 202.355 1.00 191.49 ? 450  GLU A CB    1 
ATOM   449   C  CG    . GLU A 1  186 ? 147.928 152.755 200.879 1.00 191.49 ? 450  GLU A CG    1 
ATOM   450   C  CD    . GLU A 1  186 ? 149.276 152.762 200.187 1.00 191.49 ? 450  GLU A CD    1 
ATOM   451   O  OE1   . GLU A 1  186 ? 150.137 153.579 200.572 1.00 191.49 ? 450  GLU A OE1   1 
ATOM   452   O  OE2   . GLU A 1  186 ? 149.475 151.950 199.259 1.00 191.49 ? 450  GLU A OE2   1 
ATOM   453   N  N     . LEU A 1  187 ? 147.951 152.478 205.482 1.00 209.06 ? 451  LEU A N     1 
ATOM   454   C  CA    . LEU A 1  187 ? 148.067 152.960 206.854 1.00 209.06 ? 451  LEU A CA    1 
ATOM   455   C  C     . LEU A 1  187 ? 149.089 152.146 207.638 1.00 209.06 ? 451  LEU A C     1 
ATOM   456   O  O     . LEU A 1  187 ? 149.964 152.708 208.307 1.00 209.06 ? 451  LEU A O     1 
ATOM   457   C  CB    . LEU A 1  187 ? 146.704 152.909 207.542 1.00 209.06 ? 451  LEU A CB    1 
ATOM   458   C  CG    . LEU A 1  187 ? 146.653 153.506 208.947 1.00 209.06 ? 451  LEU A CG    1 
ATOM   459   C  CD1   . LEU A 1  187 ? 146.899 155.006 208.890 1.00 209.06 ? 451  LEU A CD1   1 
ATOM   460   C  CD2   . LEU A 1  187 ? 145.331 153.192 209.620 1.00 209.06 ? 451  LEU A CD2   1 
ATOM   461   N  N     . GLU A 1  188 ? 148.993 150.817 207.572 1.00 209.24 ? 452  GLU A N     1 
ATOM   462   C  CA    . GLU A 1  188 ? 149.942 149.980 208.295 1.00 209.24 ? 452  GLU A CA    1 
ATOM   463   C  C     . GLU A 1  188 ? 151.345 150.070 207.709 1.00 209.24 ? 452  GLU A C     1 
ATOM   464   O  O     . GLU A 1  188 ? 152.311 149.710 208.390 1.00 209.24 ? 452  GLU A O     1 
ATOM   465   C  CB    . GLU A 1  188 ? 149.470 148.525 208.312 1.00 209.24 ? 452  GLU A CB    1 
ATOM   466   C  CG    . GLU A 1  188 ? 149.490 147.840 206.960 1.00 209.24 ? 452  GLU A CG    1 
ATOM   467   C  CD    . GLU A 1  188 ? 148.960 146.422 207.020 1.00 209.24 ? 452  GLU A CD    1 
ATOM   468   O  OE1   . GLU A 1  188 ? 148.545 145.986 208.114 1.00 209.24 ? 452  GLU A OE1   1 
ATOM   469   O  OE2   . GLU A 1  188 ? 148.963 145.741 205.973 1.00 209.24 ? 452  GLU A OE2   1 
ATOM   470   N  N     . ALA A 1  189 ? 151.479 150.540 206.467 1.00 198.39 ? 453  ALA A N     1 
ATOM   471   C  CA    . ALA A 1  189 ? 152.805 150.779 205.913 1.00 198.39 ? 453  ALA A CA    1 
ATOM   472   C  C     . ALA A 1  189 ? 153.374 152.113 206.380 1.00 198.39 ? 453  ALA A C     1 
ATOM   473   O  O     . ALA A 1  189 ? 154.575 152.216 206.651 1.00 198.39 ? 453  ALA A O     1 
ATOM   474   C  CB    . ALA A 1  189 ? 152.755 150.726 204.386 1.00 198.39 ? 453  ALA A CB    1 
ATOM   475   N  N     . ILE A 1  190 ? 152.532 153.145 206.482 1.00 203.52 ? 454  ILE A N     1 
ATOM   476   C  CA    . ILE A 1  190 ? 153.024 154.441 206.940 1.00 203.52 ? 454  ILE A CA    1 
ATOM   477   C  C     . ILE A 1  190 ? 153.198 154.485 208.453 1.00 203.52 ? 454  ILE A C     1 
ATOM   478   O  O     . ILE A 1  190 ? 153.860 155.398 208.962 1.00 203.52 ? 454  ILE A O     1 
ATOM   479   C  CB    . ILE A 1  190 ? 152.110 155.594 206.491 1.00 203.52 ? 454  ILE A CB    1 
ATOM   480   C  CG1   . ILE A 1  190 ? 150.721 155.464 207.116 1.00 203.52 ? 454  ILE A CG1   1 
ATOM   481   C  CG2   . ILE A 1  190 ? 152.022 155.647 204.974 1.00 203.52 ? 454  ILE A CG2   1 
ATOM   482   C  CD1   . ILE A 1  190 ? 149.841 156.678 206.909 1.00 203.52 ? 454  ILE A CD1   1 
ATOM   483   N  N     . MET A 1  191 ? 152.698 153.464 209.140 1.00 209.37 ? 455  MET A N     1 
ATOM   484   C  CA    . MET A 1  191 ? 152.853 153.370 210.582 1.00 209.37 ? 455  MET A CA    1 
ATOM   485   C  C     . MET A 1  191 ? 154.329 153.141 210.906 1.00 209.37 ? 455  MET A C     1 
ATOM   486   O  O     . MET A 1  191 ? 154.813 153.565 211.955 1.00 209.37 ? 455  MET A O     1 
ATOM   487   C  CB    . MET A 1  191 ? 152.003 152.229 211.143 1.00 209.37 ? 455  MET A CB    1 
ATOM   488   C  CG    . MET A 1  191 ? 151.538 152.449 212.574 1.00 209.37 ? 455  MET A CG    1 
ATOM   489   S  SD    . MET A 1  191 ? 151.106 150.912 213.410 1.00 209.37 ? 455  MET A SD    1 
ATOM   490   C  CE    . MET A 1  191 ? 152.683 150.464 214.132 1.00 209.37 ? 455  MET A CE    1 
ATOM   491   N  N     . GLN A 1  192 ? 155.042 152.470 210.001 1.00 188.13 ? 456  GLN A N     1 
ATOM   492   C  CA    . GLN A 1  192 ? 156.463 152.209 210.199 1.00 188.13 ? 456  GLN A CA    1 
ATOM   493   C  C     . GLN A 1  192 ? 157.280 153.483 210.023 1.00 188.13 ? 456  GLN A C     1 
ATOM   494   O  O     . GLN A 1  192 ? 158.250 153.718 210.753 1.00 188.13 ? 456  GLN A O     1 
ATOM   495   C  CB    . GLN A 1  192 ? 156.935 151.122 209.233 1.00 188.13 ? 456  GLN A CB    1 
ATOM   496   C  CG    . GLN A 1  192 ? 156.323 149.756 209.501 1.00 188.13 ? 456  GLN A CG    1 
ATOM   497   C  CD    . GLN A 1  192 ? 156.784 148.705 208.511 1.00 188.13 ? 456  GLN A CD    1 
ATOM   498   O  OE1   . GLN A 1  192 ? 157.522 149.000 207.571 1.00 188.13 ? 456  GLN A OE1   1 
ATOM   499   N  NE2   . GLN A 1  192 ? 156.346 147.468 208.716 1.00 188.13 ? 456  GLN A NE2   1 
ATOM   500   N  N     . GLY A 1  193 ? 156.899 154.319 209.061 1.00 174.55 ? 457  GLY A N     1 
ATOM   501   C  CA    . GLY A 1  193 ? 157.566 155.589 208.851 1.00 174.55 ? 457  GLY A CA    1 
ATOM   502   C  C     . GLY A 1  193 ? 158.744 155.517 207.903 1.00 174.55 ? 457  GLY A C     1 
ATOM   503   O  O     . GLY A 1  193 ? 159.783 156.137 208.150 1.00 174.55 ? 457  GLY A O     1 
ATOM   504   N  N     . ARG A 1  194 ? 158.598 154.766 206.815 1.00 151.36 ? 458  ARG A N     1 
ATOM   505   C  CA    . ARG A 1  194 ? 159.644 154.619 205.814 1.00 151.36 ? 458  ARG A CA    1 
ATOM   506   C  C     . ARG A 1  194 ? 159.130 155.093 204.462 1.00 151.36 ? 458  ARG A C     1 
ATOM   507   O  O     . ARG A 1  194 ? 157.954 154.908 204.134 1.00 151.36 ? 458  ARG A O     1 
ATOM   508   C  CB    . ARG A 1  194 ? 160.129 153.162 205.730 1.00 151.36 ? 458  ARG A CB    1 
ATOM   509   C  CG    . ARG A 1  194 ? 159.047 152.138 205.405 1.00 151.36 ? 458  ARG A CG    1 
ATOM   510   C  CD    . ARG A 1  194 ? 158.961 151.843 203.916 1.00 151.36 ? 458  ARG A CD    1 
ATOM   511   N  NE    . ARG A 1  194 ? 158.015 150.771 203.632 1.00 151.36 ? 458  ARG A NE    1 
ATOM   512   C  CZ    . ARG A 1  194 ? 157.672 150.383 202.409 1.00 151.36 ? 458  ARG A CZ    1 
ATOM   513   N  NH1   . ARG A 1  194 ? 156.801 149.398 202.243 1.00 151.36 ? 458  ARG A NH1   1 
ATOM   514   N  NH2   . ARG A 1  194 ? 158.205 150.978 201.350 1.00 151.36 ? 458  ARG A NH2   1 
ATOM   515   N  N     . GLY A 1  195 ? 160.016 155.710 203.685 1.00 135.70 ? 459  GLY A N     1 
ATOM   516   C  CA    . GLY A 1  195 ? 159.656 156.214 202.374 1.00 135.70 ? 459  GLY A CA    1 
ATOM   517   C  C     . GLY A 1  195 ? 159.646 155.152 201.294 1.00 135.70 ? 459  GLY A C     1 
ATOM   518   O  O     . GLY A 1  195 ? 160.680 154.543 201.003 1.00 135.70 ? 459  GLY A O     1 
ATOM   519   N  N     . SER A 1  196 ? 158.482 154.924 200.689 1.00 123.47 ? 460  SER A N     1 
ATOM   520   C  CA    . SER A 1  196 ? 158.340 153.930 199.626 1.00 123.47 ? 460  SER A CA    1 
ATOM   521   C  C     . SER A 1  196 ? 158.906 154.511 198.337 1.00 123.47 ? 460  SER A C     1 
ATOM   522   O  O     . SER A 1  196 ? 158.200 155.179 197.578 1.00 123.47 ? 460  SER A O     1 
ATOM   523   C  CB    . SER A 1  196 ? 156.879 153.528 199.459 1.00 123.47 ? 460  SER A CB    1 
ATOM   524   O  OG    . SER A 1  196 ? 156.099 154.615 198.988 1.00 123.47 ? 460  SER A OG    1 
ATOM   525   N  N     . GLY A 1  197 ? 160.189 154.253 198.084 1.00 104.91 ? 461  GLY A N     1 
ATOM   526   C  CA    . GLY A 1  197 ? 160.863 154.734 196.901 1.00 104.91 ? 461  GLY A CA    1 
ATOM   527   C  C     . GLY A 1  197 ? 161.296 153.595 195.989 1.00 104.91 ? 461  GLY A C     1 
ATOM   528   O  O     . GLY A 1  197 ? 161.327 152.426 196.368 1.00 104.91 ? 461  GLY A O     1 
ATOM   529   N  N     . LEU A 1  198 ? 161.635 153.968 194.760 1.00 89.01  ? 462  LEU A N     1 
ATOM   530   C  CA    . LEU A 1  198 ? 162.074 153.023 193.746 1.00 89.01  ? 462  LEU A CA    1 
ATOM   531   C  C     . LEU A 1  198 ? 163.526 153.283 193.369 1.00 89.01  ? 462  LEU A C     1 
ATOM   532   O  O     . LEU A 1  198 ? 163.980 154.430 193.325 1.00 89.01  ? 462  LEU A O     1 
ATOM   533   C  CB    . LEU A 1  198 ? 161.193 153.106 192.496 1.00 89.01  ? 462  LEU A CB    1 
ATOM   534   C  CG    . LEU A 1  198 ? 159.754 152.619 192.654 1.00 89.01  ? 462  LEU A CG    1 
ATOM   535   C  CD1   . LEU A 1  198 ? 158.959 152.889 191.391 1.00 89.01  ? 462  LEU A CD1   1 
ATOM   536   C  CD2   . LEU A 1  198 ? 159.738 151.138 192.988 1.00 89.01  ? 462  LEU A CD2   1 
ATOM   537   N  N     . GLN A 1  199 ? 164.249 152.201 193.097 1.00 83.15  ? 463  GLN A N     1 
ATOM   538   C  CA    . GLN A 1  199 ? 165.624 152.316 192.648 1.00 83.15  ? 463  GLN A CA    1 
ATOM   539   C  C     . GLN A 1  199 ? 165.668 152.904 191.238 1.00 83.15  ? 463  GLN A C     1 
ATOM   540   O  O     . GLN A 1  199 ? 164.717 152.758 190.466 1.00 83.15  ? 463  GLN A O     1 
ATOM   541   C  CB    . GLN A 1  199 ? 166.305 150.949 192.665 1.00 83.15  ? 463  GLN A CB    1 
ATOM   542   C  CG    . GLN A 1  199 ? 166.426 150.335 194.047 1.00 83.15  ? 463  GLN A CG    1 
ATOM   543   C  CD    . GLN A 1  199 ? 167.344 151.127 194.955 1.00 83.15  ? 463  GLN A CD    1 
ATOM   544   O  OE1   . GLN A 1  199 ? 168.373 151.642 194.519 1.00 83.15  ? 463  GLN A OE1   1 
ATOM   545   N  NE2   . GLN A 1  199 ? 166.975 151.230 196.226 1.00 83.15  ? 463  GLN A NE2   1 
ATOM   546   N  N     . PRO A 1  200 ? 166.761 153.582 190.878 1.00 78.04  ? 464  PRO A N     1 
ATOM   547   C  CA    . PRO A 1  200 ? 166.855 154.125 189.513 1.00 78.04  ? 464  PRO A CA    1 
ATOM   548   C  C     . PRO A 1  200 ? 166.865 153.054 188.439 1.00 78.04  ? 464  PRO A C     1 
ATOM   549   O  O     . PRO A 1  200 ? 166.370 153.297 187.331 1.00 78.04  ? 464  PRO A O     1 
ATOM   550   C  CB    . PRO A 1  200 ? 168.169 154.918 189.543 1.00 78.04  ? 464  PRO A CB    1 
ATOM   551   C  CG    . PRO A 1  200 ? 168.962 154.295 190.638 1.00 78.04  ? 464  PRO A CG    1 
ATOM   552   C  CD    . PRO A 1  200 ? 167.964 153.875 191.675 1.00 78.04  ? 464  PRO A CD    1 
ATOM   553   N  N     . ALA A 1  201 ? 167.407 151.870 188.731 1.00 75.98  ? 465  ALA A N     1 
ATOM   554   C  CA    . ALA A 1  201 ? 167.376 150.785 187.756 1.00 75.98  ? 465  ALA A CA    1 
ATOM   555   C  C     . ALA A 1  201 ? 165.948 150.330 187.486 1.00 75.98  ? 465  ALA A C     1 
ATOM   556   O  O     . ALA A 1  201 ? 165.592 150.018 186.344 1.00 75.98  ? 465  ALA A O     1 
ATOM   557   C  CB    . ALA A 1  201 ? 168.231 149.616 188.243 1.00 75.98  ? 465  ALA A CB    1 
ATOM   558   N  N     . VAL A 1  202 ? 165.112 150.295 188.525 1.00 77.17  ? 466  VAL A N     1 
ATOM   559   C  CA    . VAL A 1  202 ? 163.718 149.901 188.350 1.00 77.17  ? 466  VAL A CA    1 
ATOM   560   C  C     . VAL A 1  202 ? 162.984 150.912 187.478 1.00 77.17  ? 466  VAL A C     1 
ATOM   561   O  O     . VAL A 1  202 ? 162.238 150.543 186.563 1.00 77.17  ? 466  VAL A O     1 
ATOM   562   C  CB    . VAL A 1  202 ? 163.033 149.735 189.718 1.00 77.17  ? 466  VAL A CB    1 
ATOM   563   C  CG1   . VAL A 1  202 ? 161.550 149.468 189.538 1.00 77.17  ? 466  VAL A CG1   1 
ATOM   564   C  CG2   . VAL A 1  202 ? 163.690 148.612 190.502 1.00 77.17  ? 466  VAL A CG2   1 
ATOM   565   N  N     . CYS A 1  203 ? 163.180 152.204 187.752 1.00 77.86  ? 467  CYS A N     1 
ATOM   566   C  CA    . CYS A 1  203 ? 162.544 153.235 186.940 1.00 77.86  ? 467  CYS A CA    1 
ATOM   567   C  C     . CYS A 1  203 ? 163.034 153.179 185.500 1.00 77.86  ? 467  CYS A C     1 
ATOM   568   O  O     . CYS A 1  203 ? 162.252 153.370 184.561 1.00 77.86  ? 467  CYS A O     1 
ATOM   569   C  CB    . CYS A 1  203 ? 162.806 154.614 187.544 1.00 77.86  ? 467  CYS A CB    1 
ATOM   570   S  SG    . CYS A 1  203 ? 162.056 154.869 189.168 1.00 77.86  ? 467  CYS A SG    1 
ATOM   571   N  N     . LEU A 1  204 ? 164.327 152.908 185.306 1.00 72.00  ? 468  LEU A N     1 
ATOM   572   C  CA    . LEU A 1  204 ? 164.865 152.770 183.957 1.00 72.00  ? 468  LEU A CA    1 
ATOM   573   C  C     . LEU A 1  204 ? 164.216 151.603 183.225 1.00 72.00  ? 468  LEU A C     1 
ATOM   574   O  O     . LEU A 1  204 ? 163.837 151.721 182.053 1.00 72.00  ? 468  LEU A O     1 
ATOM   575   C  CB    . LEU A 1  204 ? 166.381 152.587 184.020 1.00 72.00  ? 468  LEU A CB    1 
ATOM   576   C  CG    . LEU A 1  204 ? 167.096 152.452 182.677 1.00 72.00  ? 468  LEU A CG    1 
ATOM   577   C  CD1   . LEU A 1  204 ? 166.929 153.718 181.857 1.00 72.00  ? 468  LEU A CD1   1 
ATOM   578   C  CD2   . LEU A 1  204 ? 168.567 152.128 182.883 1.00 72.00  ? 468  LEU A CD2   1 
ATOM   579   N  N     . ALA A 1  205 ? 164.088 150.460 183.902 1.00 70.09  ? 469  ALA A N     1 
ATOM   580   C  CA    . ALA A 1  205 ? 163.462 149.298 183.281 1.00 70.09  ? 469  ALA A CA    1 
ATOM   581   C  C     . ALA A 1  205 ? 162.004 149.573 182.942 1.00 70.09  ? 469  ALA A C     1 
ATOM   582   O  O     . ALA A 1  205 ? 161.514 149.152 181.889 1.00 70.09  ? 469  ALA A O     1 
ATOM   583   C  CB    . ALA A 1  205 ? 163.580 148.083 184.199 1.00 70.09  ? 469  ALA A CB    1 
ATOM   584   N  N     . ILE A 1  206 ? 161.296 150.283 183.822 1.00 68.79  ? 470  ILE A N     1 
ATOM   585   C  CA    . ILE A 1  206 ? 159.898 150.612 183.553 1.00 68.79  ? 470  ILE A CA    1 
ATOM   586   C  C     . ILE A 1  206 ? 159.794 151.544 182.352 1.00 68.79  ? 470  ILE A C     1 
ATOM   587   O  O     . ILE A 1  206 ? 158.923 151.382 181.491 1.00 68.79  ? 470  ILE A O     1 
ATOM   588   C  CB    . ILE A 1  206 ? 159.235 151.219 184.802 1.00 68.79  ? 470  ILE A CB    1 
ATOM   589   C  CG1   . ILE A 1  206 ? 159.160 150.182 185.923 1.00 68.79  ? 470  ILE A CG1   1 
ATOM   590   C  CG2   . ILE A 1  206 ? 157.847 151.739 184.474 1.00 68.79  ? 470  ILE A CG2   1 
ATOM   591   C  CD1   . ILE A 1  206 ? 158.760 150.761 187.260 1.00 68.79  ? 470  ILE A CD1   1 
ATOM   592   N  N     . ARG A 1  207 ? 160.697 152.511 182.280 1.00 67.20  ? 471  ARG A N     1 
ATOM   593   C  CA    . ARG A 1  207 ? 160.692 153.473 181.187 1.00 67.20  ? 471  ARG A CA    1 
ATOM   594   C  C     . ARG A 1  207 ? 161.037 152.852 179.840 1.00 67.20  ? 471  ARG A C     1 
ATOM   595   O  O     . ARG A 1  207 ? 160.495 153.248 178.813 1.00 67.20  ? 471  ARG A O     1 
ATOM   596   C  CB    . ARG A 1  207 ? 161.660 154.616 181.489 1.00 67.20  ? 471  ARG A CB    1 
ATOM   597   C  CG    . ARG A 1  207 ? 161.470 155.839 180.610 1.00 67.20  ? 471  ARG A CG    1 
ATOM   598   C  CD    . ARG A 1  207 ? 162.798 156.512 180.317 1.00 67.20  ? 471  ARG A CD    1 
ATOM   599   N  NE    . ARG A 1  207 ? 163.195 156.343 178.925 1.00 67.20  ? 471  ARG A NE    1 
ATOM   600   C  CZ    . ARG A 1  207 ? 164.454 156.249 178.515 1.00 67.20  ? 471  ARG A CZ    1 
ATOM   601   N  NH1   . ARG A 1  207 ? 164.726 156.096 177.228 1.00 67.20  ? 471  ARG A NH1   1 
ATOM   602   N  NH2   . ARG A 1  207 ? 165.443 156.307 179.394 1.00 67.20  ? 471  ARG A NH2   1 
ATOM   603   N  N     . VAL A 1  208 ? 161.935 151.875 179.845 1.00 66.14  ? 472  VAL A N     1 
ATOM   604   C  CA    . VAL A 1  208 ? 162.359 151.233 178.602 1.00 66.14  ? 472  VAL A CA    1 
ATOM   605   C  C     . VAL A 1  208 ? 161.335 150.194 178.157 1.00 66.14  ? 472  VAL A C     1 
ATOM   606   O  O     . VAL A 1  208 ? 160.857 150.217 177.017 1.00 66.14  ? 472  VAL A O     1 
ATOM   607   C  CB    . VAL A 1  208 ? 163.757 150.611 178.763 1.00 66.14  ? 472  VAL A CB    1 
ATOM   608   C  CG1   . VAL A 1  208 ? 164.112 149.800 177.533 1.00 66.14  ? 472  VAL A CG1   1 
ATOM   609   C  CG2   . VAL A 1  208 ? 164.793 151.697 178.993 1.00 66.14  ? 472  VAL A CG2   1 
ATOM   610   N  N     . ASN A 1  209 ? 160.984 149.266 179.049 1.00 64.81  ? 473  ASN A N     1 
ATOM   611   C  CA    . ASN A 1  209 ? 160.126 148.137 178.711 1.00 64.81  ? 473  ASN A CA    1 
ATOM   612   C  C     . ASN A 1  209 ? 158.656 148.525 178.543 1.00 64.81  ? 473  ASN A C     1 
ATOM   613   O  O     . ASN A 1  209 ? 157.817 147.639 178.348 1.00 64.81  ? 473  ASN A O     1 
ATOM   614   C  CB    . ASN A 1  209 ? 160.262 147.044 179.776 1.00 64.81  ? 473  ASN A CB    1 
ATOM   615   C  CG    . ASN A 1  209 ? 159.883 145.666 179.259 1.00 64.81  ? 473  ASN A CG    1 
ATOM   616   O  OD1   . ASN A 1  209 ? 160.197 144.653 179.883 1.00 64.81  ? 473  ASN A OD1   1 
ATOM   617   N  ND2   . ASN A 1  209 ? 159.214 145.620 178.114 1.00 64.81  ? 473  ASN A ND2   1 
ATOM   618   N  N     . THR A 1  210 ? 158.320 149.814 178.609 1.00 64.95  ? 474  THR A N     1 
ATOM   619   C  CA    . THR A 1  210 ? 156.954 150.263 178.374 1.00 64.95  ? 474  THR A CA    1 
ATOM   620   C  C     . THR A 1  210 ? 156.863 151.287 177.252 1.00 64.95  ? 474  THR A C     1 
ATOM   621   O  O     . THR A 1  210 ? 155.805 151.905 177.082 1.00 64.95  ? 474  THR A O     1 
ATOM   622   C  CB    . THR A 1  210 ? 156.337 150.849 179.649 1.00 64.95  ? 474  THR A CB    1 
ATOM   623   O  OG1   . THR A 1  210 ? 157.140 151.942 180.111 1.00 64.95  ? 474  THR A OG1   1 
ATOM   624   C  CG2   . THR A 1  210 ? 156.237 149.789 180.735 1.00 64.95  ? 474  THR A CG2   1 
ATOM   625   N  N     . PHE A 1  211 ? 157.942 151.492 176.495 1.00 66.02  ? 475  PHE A N     1 
ATOM   626   C  CA    . PHE A 1  211 ? 157.937 152.356 175.314 1.00 66.02  ? 475  PHE A CA    1 
ATOM   627   C  C     . PHE A 1  211 ? 157.535 153.787 175.676 1.00 66.02  ? 475  PHE A C     1 
ATOM   628   O  O     . PHE A 1  211 ? 156.543 154.331 175.187 1.00 66.02  ? 475  PHE A O     1 
ATOM   629   C  CB    . PHE A 1  211 ? 157.021 151.777 174.234 1.00 66.02  ? 475  PHE A CB    1 
ATOM   630   C  CG    . PHE A 1  211 ? 157.538 150.510 173.623 1.00 66.02  ? 475  PHE A CG    1 
ATOM   631   C  CD1   . PHE A 1  211 ? 158.883 150.194 173.686 1.00 66.02  ? 475  PHE A CD1   1 
ATOM   632   C  CD2   . PHE A 1  211 ? 156.673 149.618 173.021 1.00 66.02  ? 475  PHE A CD2   1 
ATOM   633   C  CE1   . PHE A 1  211 ? 159.356 149.028 173.131 1.00 66.02  ? 475  PHE A CE1   1 
ATOM   634   C  CE2   . PHE A 1  211 ? 157.140 148.450 172.467 1.00 66.02  ? 475  PHE A CE2   1 
ATOM   635   C  CZ    . PHE A 1  211 ? 158.482 148.153 172.523 1.00 66.02  ? 475  PHE A CZ    1 
ATOM   636   N  N     . LEU A 1  212 ? 158.336 154.393 176.548 1.00 65.59  ? 476  LEU A N     1 
ATOM   637   C  CA    . LEU A 1  212 ? 158.110 155.754 177.017 1.00 65.59  ? 476  LEU A CA    1 
ATOM   638   C  C     . LEU A 1  212 ? 159.294 156.623 176.628 1.00 65.59  ? 476  LEU A C     1 
ATOM   639   O  O     . LEU A 1  212 ? 160.445 156.276 176.915 1.00 65.59  ? 476  LEU A O     1 
ATOM   640   C  CB    . LEU A 1  212 ? 157.897 155.789 178.531 1.00 65.59  ? 476  LEU A CB    1 
ATOM   641   C  CG    . LEU A 1  212 ? 156.574 155.215 179.029 1.00 65.59  ? 476  LEU A CG    1 
ATOM   642   C  CD1   . LEU A 1  212 ? 156.548 155.159 180.546 1.00 65.59  ? 476  LEU A CD1   1 
ATOM   643   C  CD2   . LEU A 1  212 ? 155.434 156.065 178.505 1.00 65.59  ? 476  LEU A CD2   1 
ATOM   644   N  N     . SER A 1  213 ? 159.009 157.744 175.975 1.00 70.47  ? 477  SER A N     1 
ATOM   645   C  CA    . SER A 1  213 ? 160.037 158.731 175.695 1.00 70.47  ? 477  SER A CA    1 
ATOM   646   C  C     . SER A 1  213 ? 160.424 159.463 176.974 1.00 70.47  ? 477  SER A C     1 
ATOM   647   O  O     . SER A 1  213 ? 159.702 159.435 177.974 1.00 70.47  ? 477  SER A O     1 
ATOM   648   C  CB    . SER A 1  213 ? 159.543 159.729 174.651 1.00 70.47  ? 477  SER A CB    1 
ATOM   649   O  OG    . SER A 1  213 ? 158.467 160.496 175.163 1.00 70.47  ? 477  SER A OG    1 
ATOM   650   N  N     . CYS A 1  214 ? 161.580 160.128 176.935 1.00 74.99  ? 478  CYS A N     1 
ATOM   651   C  CA    . CYS A 1  214 ? 162.033 160.872 178.106 1.00 74.99  ? 478  CYS A CA    1 
ATOM   652   C  C     . CYS A 1  214 ? 161.088 162.017 178.443 1.00 74.99  ? 478  CYS A C     1 
ATOM   653   O  O     . CYS A 1  214 ? 160.915 162.352 179.620 1.00 74.99  ? 478  CYS A O     1 
ATOM   654   C  CB    . CYS A 1  214 ? 163.450 161.397 177.878 1.00 74.99  ? 478  CYS A CB    1 
ATOM   655   S  SG    . CYS A 1  214 ? 164.701 160.103 177.722 1.00 74.99  ? 478  CYS A SG    1 
ATOM   656   N  N     . SER A 1  215 ? 160.455 162.616 177.432 1.00 71.51  ? 479  SER A N     1 
ATOM   657   C  CA    . SER A 1  215 ? 159.544 163.729 177.682 1.00 71.51  ? 479  SER A CA    1 
ATOM   658   C  C     . SER A 1  215 ? 158.287 163.261 178.407 1.00 71.51  ? 479  SER A C     1 
ATOM   659   O  O     . SER A 1  215 ? 157.843 163.894 179.373 1.00 71.51  ? 479  SER A O     1 
ATOM   660   C  CB    . SER A 1  215 ? 159.185 164.416 176.365 1.00 71.51  ? 479  SER A CB    1 
ATOM   661   O  OG    . SER A 1  215 ? 158.275 165.481 176.579 1.00 71.51  ? 479  SER A OG    1 
ATOM   662   N  N     . GLN A 1  216 ? 157.697 162.152 177.955 1.00 69.94  ? 480  GLN A N     1 
ATOM   663   C  CA    . GLN A 1  216 ? 156.499 161.642 178.613 1.00 69.94  ? 480  GLN A CA    1 
ATOM   664   C  C     . GLN A 1  216 ? 156.812 161.155 180.021 1.00 69.94  ? 480  GLN A C     1 
ATOM   665   O  O     . GLN A 1  216 ? 156.020 161.359 180.951 1.00 69.94  ? 480  GLN A O     1 
ATOM   666   C  CB    . GLN A 1  216 ? 155.879 160.520 177.781 1.00 69.94  ? 480  GLN A CB    1 
ATOM   667   C  CG    . GLN A 1  216 ? 155.412 160.956 176.403 1.00 69.94  ? 480  GLN A CG    1 
ATOM   668   C  CD    . GLN A 1  216 ? 154.307 161.991 176.463 1.00 69.94  ? 480  GLN A CD    1 
ATOM   669   O  OE1   . GLN A 1  216 ? 153.442 161.943 177.335 1.00 69.94  ? 480  GLN A OE1   1 
ATOM   670   N  NE2   . GLN A 1  216 ? 154.328 162.932 175.527 1.00 69.94  ? 480  GLN A NE2   1 
ATOM   671   N  N     . TYR A 1  217 ? 157.966 160.508 180.198 1.00 69.70  ? 481  TYR A N     1 
ATOM   672   C  CA    . TYR A 1  217 ? 158.371 160.083 181.533 1.00 69.70  ? 481  TYR A CA    1 
ATOM   673   C  C     . TYR A 1  217 ? 158.577 161.281 182.448 1.00 69.70  ? 481  TYR A C     1 
ATOM   674   O  O     . TYR A 1  217 ? 158.209 161.239 183.626 1.00 69.70  ? 481  TYR A O     1 
ATOM   675   C  CB    . TYR A 1  217 ? 159.643 159.240 181.458 1.00 69.70  ? 481  TYR A CB    1 
ATOM   676   C  CG    . TYR A 1  217 ? 160.104 158.732 182.804 1.00 69.70  ? 481  TYR A CG    1 
ATOM   677   C  CD1   . TYR A 1  217 ? 159.467 157.664 183.419 1.00 69.70  ? 481  TYR A CD1   1 
ATOM   678   C  CD2   . TYR A 1  217 ? 161.169 159.328 183.465 1.00 69.70  ? 481  TYR A CD2   1 
ATOM   679   C  CE1   . TYR A 1  217 ? 159.883 157.199 184.651 1.00 69.70  ? 481  TYR A CE1   1 
ATOM   680   C  CE2   . TYR A 1  217 ? 161.591 158.871 184.697 1.00 69.70  ? 481  TYR A CE2   1 
ATOM   681   C  CZ    . TYR A 1  217 ? 160.945 157.807 185.285 1.00 69.70  ? 481  TYR A CZ    1 
ATOM   682   O  OH    . TYR A 1  217 ? 161.363 157.349 186.512 1.00 69.70  ? 481  TYR A OH    1 
ATOM   683   N  N     . HIS A 1  218 ? 159.159 162.362 181.923 1.00 70.56  ? 482  HIS A N     1 
ATOM   684   C  CA    . HIS A 1  218 ? 159.334 163.567 182.727 1.00 70.56  ? 482  HIS A CA    1 
ATOM   685   C  C     . HIS A 1  218 ? 157.992 164.184 183.093 1.00 70.56  ? 482  HIS A C     1 
ATOM   686   O  O     . HIS A 1  218 ? 157.807 164.662 184.219 1.00 70.56  ? 482  HIS A O     1 
ATOM   687   C  CB    . HIS A 1  218 ? 160.201 164.578 181.978 1.00 70.56  ? 482  HIS A CB    1 
ATOM   688   C  CG    . HIS A 1  218 ? 160.456 165.837 182.746 1.00 70.56  ? 482  HIS A CG    1 
ATOM   689   N  ND1   . HIS A 1  218 ? 161.326 165.894 183.814 1.00 70.56  ? 482  HIS A ND1   1 
ATOM   690   C  CD2   . HIS A 1  218 ? 159.953 167.085 182.604 1.00 70.56  ? 482  HIS A CD2   1 
ATOM   691   C  CE1   . HIS A 1  218 ? 161.349 167.124 184.295 1.00 70.56  ? 482  HIS A CE1   1 
ATOM   692   N  NE2   . HIS A 1  218 ? 160.524 167.866 183.579 1.00 70.56  ? 482  HIS A NE2   1 
ATOM   693   N  N     . LYS A 1  219 ? 157.044 164.189 182.153 1.00 71.65  ? 483  LYS A N     1 
ATOM   694   C  CA    . LYS A 1  219 ? 155.709 164.703 182.448 1.00 71.65  ? 483  LYS A CA    1 
ATOM   695   C  C     . LYS A 1  219 ? 155.050 163.901 183.562 1.00 71.65  ? 483  LYS A C     1 
ATOM   696   O  O     . LYS A 1  219 ? 154.491 164.469 184.509 1.00 71.65  ? 483  LYS A O     1 
ATOM   697   C  CB    . LYS A 1  219 ? 154.845 164.674 181.188 1.00 71.65  ? 483  LYS A CB    1 
ATOM   698   C  CG    . LYS A 1  219 ? 155.233 165.689 180.129 1.00 71.65  ? 483  LYS A CG    1 
ATOM   699   C  CD    . LYS A 1  219 ? 154.413 165.486 178.867 1.00 71.65  ? 483  LYS A CD    1 
ATOM   700   C  CE    . LYS A 1  219 ? 152.961 165.872 179.094 1.00 71.65  ? 483  LYS A CE    1 
ATOM   701   N  NZ    . LYS A 1  219 ? 152.153 165.771 177.850 1.00 71.65  ? 483  LYS A NZ    1 
ATOM   702   N  N     . MET A 1  220 ? 155.109 162.571 183.463 1.00 72.94  ? 484  MET A N     1 
ATOM   703   C  CA    . MET A 1  220 ? 154.516 161.714 184.485 1.00 72.94  ? 484  MET A CA    1 
ATOM   704   C  C     . MET A 1  220 ? 155.202 161.906 185.834 1.00 72.94  ? 484  MET A C     1 
ATOM   705   O  O     . MET A 1  220 ? 154.540 161.965 186.877 1.00 72.94  ? 484  MET A O     1 
ATOM   706   C  CB    . MET A 1  220 ? 154.586 160.255 184.035 1.00 72.94  ? 484  MET A CB    1 
ATOM   707   C  CG    . MET A 1  220 ? 154.031 159.252 185.028 1.00 72.94  ? 484  MET A CG    1 
ATOM   708   S  SD    . MET A 1  220 ? 154.027 157.578 184.355 1.00 72.94  ? 484  MET A SD    1 
ATOM   709   C  CE    . MET A 1  220 ? 155.782 157.239 184.262 1.00 72.94  ? 484  MET A CE    1 
ATOM   710   N  N     . TYR A 1  221 ? 156.521 162.039 185.808 1.00 75.19  ? 485  TYR A N     1 
ATOM   711   C  CA    . TYR A 1  221 ? 157.282 162.248 187.028 1.00 75.19  ? 485  TYR A CA    1 
ATOM   712   C  C     . TYR A 1  221 ? 156.849 163.546 187.700 1.00 75.19  ? 485  TYR A C     1 
ATOM   713   O  O     . TYR A 1  221 ? 156.552 163.563 188.890 1.00 75.19  ? 485  TYR A O     1 
ATOM   714   C  CB    . TYR A 1  221 ? 158.777 162.274 186.721 1.00 75.19  ? 485  TYR A CB    1 
ATOM   715   C  CG    . TYR A 1  221 ? 159.594 163.079 187.700 1.00 75.19  ? 485  TYR A CG    1 
ATOM   716   C  CD1   . TYR A 1  221 ? 160.063 162.510 188.874 1.00 75.19  ? 485  TYR A CD1   1 
ATOM   717   C  CD2   . TYR A 1  221 ? 159.902 164.406 187.446 1.00 75.19  ? 485  TYR A CD2   1 
ATOM   718   C  CE1   . TYR A 1  221 ? 160.812 163.243 189.771 1.00 75.19  ? 485  TYR A CE1   1 
ATOM   719   C  CE2   . TYR A 1  221 ? 160.651 165.146 188.338 1.00 75.19  ? 485  TYR A CE2   1 
ATOM   720   C  CZ    . TYR A 1  221 ? 161.103 164.560 189.497 1.00 75.19  ? 485  TYR A CZ    1 
ATOM   721   O  OH    . TYR A 1  221 ? 161.849 165.296 190.386 1.00 75.19  ? 485  TYR A OH    1 
ATOM   722   N  N     . ARG A 1  222 ? 156.798 164.621 186.925 1.00 74.50  ? 486  ARG A N     1 
ATOM   723   C  CA    . ARG A 1  222 ? 156.399 165.915 187.454 1.00 74.50  ? 486  ARG A CA    1 
ATOM   724   C  C     . ARG A 1  222 ? 154.983 165.877 188.014 1.00 74.50  ? 486  ARG A C     1 
ATOM   725   O  O     . ARG A 1  222 ? 154.726 166.413 189.088 1.00 74.50  ? 486  ARG A O     1 
ATOM   726   C  CB    . ARG A 1  222 ? 156.516 166.994 186.379 1.00 74.50  ? 486  ARG A CB    1 
ATOM   727   C  CG    . ARG A 1  222 ? 155.185 167.432 185.793 1.00 74.50  ? 486  ARG A CG    1 
ATOM   728   C  CD    . ARG A 1  222 ? 155.024 166.929 184.369 1.00 74.50  ? 486  ARG A CD    1 
ATOM   729   N  NE    . ARG A 1  222 ? 155.222 167.987 183.382 1.00 74.50  ? 486  ARG A NE    1 
ATOM   730   C  CZ    . ARG A 1  222 ? 156.194 168.891 183.438 1.00 74.50  ? 486  ARG A CZ    1 
ATOM   731   N  NH1   . ARG A 1  222 ? 157.064 168.873 184.437 1.00 74.50  ? 486  ARG A NH1   1 
ATOM   732   N  NH2   . ARG A 1  222 ? 156.296 169.813 182.493 1.00 74.50  ? 486  ARG A NH2   1 
ATOM   733   N  N     . THR A 1  223 ? 154.067 165.240 187.291 1.00 75.26  ? 487  THR A N     1 
ATOM   734   C  CA    . THR A 1  223 ? 152.681 165.156 187.741 1.00 75.26  ? 487  THR A CA    1 
ATOM   735   C  C     . THR A 1  223 ? 152.575 164.409 189.065 1.00 75.26  ? 487  THR A C     1 
ATOM   736   O  O     . THR A 1  223 ? 151.914 164.876 190.004 1.00 75.26  ? 487  THR A O     1 
ATOM   737   C  CB    . THR A 1  223 ? 151.828 164.475 186.670 1.00 75.26  ? 487  THR A CB    1 
ATOM   738   O  OG1   . THR A 1  223 ? 151.891 165.231 185.455 1.00 75.26  ? 487  THR A OG1   1 
ATOM   739   C  CG2   . THR A 1  223 ? 150.383 164.377 187.122 1.00 75.26  ? 487  THR A CG2   1 
ATOM   740   N  N     . VAL A 1  224 ? 153.224 163.246 189.161 1.00 75.18  ? 488  VAL A N     1 
ATOM   741   C  CA    . VAL A 1  224 ? 153.152 162.451 190.385 1.00 75.18  ? 488  VAL A CA    1 
ATOM   742   C  C     . VAL A 1  224 ? 153.775 163.209 191.550 1.00 75.18  ? 488  VAL A C     1 
ATOM   743   O  O     . VAL A 1  224 ? 153.202 163.281 192.643 1.00 75.18  ? 488  VAL A O     1 
ATOM   744   C  CB    . VAL A 1  224 ? 153.822 161.081 190.179 1.00 75.18  ? 488  VAL A CB    1 
ATOM   745   C  CG1   . VAL A 1  224 ? 153.899 160.328 191.495 1.00 75.18  ? 488  VAL A CG1   1 
ATOM   746   C  CG2   . VAL A 1  224 ? 153.050 160.269 189.154 1.00 75.18  ? 488  VAL A CG2   1 
ATOM   747   N  N     . LYS A 1  225 ? 154.958 163.793 191.334 1.00 80.52  ? 489  LYS A N     1 
ATOM   748   C  CA    . LYS A 1  225 ? 155.634 164.494 192.419 1.00 80.52  ? 489  LYS A CA    1 
ATOM   749   C  C     . LYS A 1  225 ? 154.856 165.723 192.869 1.00 80.52  ? 489  LYS A C     1 
ATOM   750   O  O     . LYS A 1  225 ? 154.895 166.082 194.051 1.00 80.52  ? 489  LYS A O     1 
ATOM   751   C  CB    . LYS A 1  225 ? 157.048 164.888 191.992 1.00 80.52  ? 489  LYS A CB    1 
ATOM   752   C  CG    . LYS A 1  225 ? 157.870 165.522 193.103 1.00 80.52  ? 489  LYS A CG    1 
ATOM   753   C  CD    . LYS A 1  225 ? 159.285 165.829 192.651 1.00 80.52  ? 489  LYS A CD    1 
ATOM   754   C  CE    . LYS A 1  225 ? 160.081 166.480 193.770 1.00 80.52  ? 489  LYS A CE    1 
ATOM   755   N  NZ    . LYS A 1  225 ? 161.471 166.799 193.353 1.00 80.52  ? 489  LYS A NZ    1 
ATOM   756   N  N     . ALA A 1  226 ? 154.135 166.374 191.954 1.00 77.76  ? 490  ALA A N     1 
ATOM   757   C  CA    . ALA A 1  226 ? 153.395 167.571 192.327 1.00 77.76  ? 490  ALA A CA    1 
ATOM   758   C  C     . ALA A 1  226 ? 152.067 167.243 192.994 1.00 77.76  ? 490  ALA A C     1 
ATOM   759   O  O     . ALA A 1  226 ? 151.608 168.008 193.849 1.00 77.76  ? 490  ALA A O     1 
ATOM   760   C  CB    . ALA A 1  226 ? 153.162 168.449 191.098 1.00 77.76  ? 490  ALA A CB    1 
ATOM   761   N  N     . ILE A 1  227 ? 151.436 166.128 192.629 1.00 80.11  ? 491  ILE A N     1 
ATOM   762   C  CA    . ILE A 1  227 ? 150.158 165.775 193.242 1.00 80.11  ? 491  ILE A CA    1 
ATOM   763   C  C     . ILE A 1  227 ? 150.373 165.066 194.573 1.00 80.11  ? 491  ILE A C     1 
ATOM   764   O  O     . ILE A 1  227 ? 149.861 165.497 195.613 1.00 80.11  ? 491  ILE A O     1 
ATOM   765   C  CB    . ILE A 1  227 ? 149.309 164.929 192.277 1.00 80.11  ? 491  ILE A CB    1 
ATOM   766   C  CG1   . ILE A 1  227 ? 148.905 165.772 191.068 1.00 80.11  ? 491  ILE A CG1   1 
ATOM   767   C  CG2   . ILE A 1  227 ? 148.081 164.386 192.986 1.00 80.11  ? 491  ILE A CG2   1 
ATOM   768   C  CD1   . ILE A 1  227 ? 148.262 164.981 189.968 1.00 80.11  ? 491  ILE A CD1   1 
ATOM   769   N  N     . THR A 1  228 ? 151.131 163.967 194.564 1.00 86.86  ? 492  THR A N     1 
ATOM   770   C  CA    . THR A 1  228 ? 151.367 163.228 195.800 1.00 86.86  ? 492  THR A CA    1 
ATOM   771   C  C     . THR A 1  228 ? 152.245 163.998 196.776 1.00 86.86  ? 492  THR A C     1 
ATOM   772   O  O     . THR A 1  228 ? 152.204 163.721 197.980 1.00 86.86  ? 492  THR A O     1 
ATOM   773   C  CB    . THR A 1  228 ? 152.006 161.873 195.497 1.00 86.86  ? 492  THR A CB    1 
ATOM   774   O  OG1   . THR A 1  228 ? 153.274 162.071 194.860 1.00 86.86  ? 492  THR A OG1   1 
ATOM   775   C  CG2   . THR A 1  228 ? 151.109 161.057 194.584 1.00 86.86  ? 492  THR A CG2   1 
ATOM   776   N  N     . GLY A 1  229 ? 153.035 164.953 196.292 1.00 89.59  ? 493  GLY A N     1 
ATOM   777   C  CA    . GLY A 1  229 ? 153.911 165.707 197.165 1.00 89.59  ? 493  GLY A CA    1 
ATOM   778   C  C     . GLY A 1  229 ? 155.111 164.939 197.664 1.00 89.59  ? 493  GLY A C     1 
ATOM   779   O  O     . GLY A 1  229 ? 155.623 165.240 198.747 1.00 89.59  ? 493  GLY A O     1 
ATOM   780   N  N     . ARG A 1  230 ? 155.580 163.955 196.901 1.00 100.27 ? 494  ARG A N     1 
ATOM   781   C  CA    . ARG A 1  230 ? 156.718 163.135 197.293 1.00 100.27 ? 494  ARG A CA    1 
ATOM   782   C  C     . ARG A 1  230 ? 157.230 162.405 196.061 1.00 100.27 ? 494  ARG A C     1 
ATOM   783   O  O     . ARG A 1  230 ? 156.525 162.281 195.056 1.00 100.27 ? 494  ARG A O     1 
ATOM   784   C  CB    . ARG A 1  230 ? 156.345 162.141 198.397 1.00 100.27 ? 494  ARG A CB    1 
ATOM   785   C  CG    . ARG A 1  230 ? 155.288 161.131 197.988 1.00 100.27 ? 494  ARG A CG    1 
ATOM   786   C  CD    . ARG A 1  230 ? 154.947 160.199 199.138 1.00 100.27 ? 494  ARG A CD    1 
ATOM   787   N  NE    . ARG A 1  230 ? 156.069 159.333 199.486 1.00 100.27 ? 494  ARG A NE    1 
ATOM   788   C  CZ    . ARG A 1  230 ? 156.154 158.638 200.615 1.00 100.27 ? 494  ARG A CZ    1 
ATOM   789   N  NH1   . ARG A 1  230 ? 155.181 158.708 201.514 1.00 100.27 ? 494  ARG A NH1   1 
ATOM   790   N  NH2   . ARG A 1  230 ? 157.212 157.875 200.847 1.00 100.27 ? 494  ARG A NH2   1 
ATOM   791   N  N     . GLN A 1  231 ? 158.467 161.925 196.152 1.00 95.55  ? 495  GLN A N     1 
ATOM   792   C  CA    . GLN A 1  231 ? 159.117 161.249 195.038 1.00 95.55  ? 495  GLN A CA    1 
ATOM   793   C  C     . GLN A 1  231 ? 158.866 159.749 195.109 1.00 95.55  ? 495  GLN A C     1 
ATOM   794   O  O     . GLN A 1  231 ? 159.250 159.091 196.082 1.00 95.55  ? 495  GLN A O     1 
ATOM   795   C  CB    . GLN A 1  231 ? 160.621 161.524 195.037 1.00 95.55  ? 495  GLN A CB    1 
ATOM   796   C  CG    . GLN A 1  231 ? 161.003 162.964 194.742 1.00 95.55  ? 495  GLN A CG    1 
ATOM   797   C  CD    . GLN A 1  231 ? 162.505 163.174 194.742 1.00 95.55  ? 495  GLN A CD    1 
ATOM   798   O  OE1   . GLN A 1  231 ? 163.272 162.251 195.017 1.00 95.55  ? 495  GLN A OE1   1 
ATOM   799   N  NE2   . GLN A 1  231 ? 162.933 164.391 194.431 1.00 95.55  ? 495  GLN A NE2   1 
ATOM   800   N  N     . ILE A 1  232 ? 158.223 159.215 194.075 1.00 86.82  ? 496  ILE A N     1 
ATOM   801   C  CA    . ILE A 1  232 ? 158.098 157.774 193.908 1.00 86.82  ? 496  ILE A CA    1 
ATOM   802   C  C     . ILE A 1  232 ? 158.975 157.244 192.783 1.00 86.82  ? 496  ILE A C     1 
ATOM   803   O  O     . ILE A 1  232 ? 159.480 156.113 192.886 1.00 86.82  ? 496  ILE A O     1 
ATOM   804   C  CB    . ILE A 1  232 ? 156.624 157.369 193.675 1.00 86.82  ? 496  ILE A CB    1 
ATOM   805   C  CG1   . ILE A 1  232 ? 155.767 157.716 194.896 1.00 86.82  ? 496  ILE A CG1   1 
ATOM   806   C  CG2   . ILE A 1  232 ? 156.495 155.885 193.369 1.00 86.82  ? 496  ILE A CG2   1 
ATOM   807   C  CD1   . ILE A 1  232 ? 155.121 159.085 194.840 1.00 86.82  ? 496  ILE A CD1   1 
ATOM   808   N  N     . PHE A 1  233 ? 159.219 158.030 191.739 1.00 81.60  ? 497  PHE A N     1 
ATOM   809   C  CA    . PHE A 1  233 ? 160.109 157.669 190.646 1.00 81.60  ? 497  PHE A CA    1 
ATOM   810   C  C     . PHE A 1  233 ? 161.401 158.459 190.791 1.00 81.60  ? 497  PHE A C     1 
ATOM   811   O  O     . PHE A 1  233 ? 161.469 159.398 191.592 1.00 81.60  ? 497  PHE A O     1 
ATOM   812   C  CB    . PHE A 1  233 ? 159.458 157.957 189.291 1.00 81.60  ? 497  PHE A CB    1 
ATOM   813   C  CG    . PHE A 1  233 ? 158.228 157.137 189.017 1.00 81.60  ? 497  PHE A CG    1 
ATOM   814   C  CD1   . PHE A 1  233 ? 158.328 155.849 188.518 1.00 81.60  ? 497  PHE A CD1   1 
ATOM   815   C  CD2   . PHE A 1  233 ? 156.970 157.653 189.273 1.00 81.60  ? 497  PHE A CD2   1 
ATOM   816   C  CE1   . PHE A 1  233 ? 157.194 155.098 188.271 1.00 81.60  ? 497  PHE A CE1   1 
ATOM   817   C  CE2   . PHE A 1  233 ? 155.836 156.905 189.030 1.00 81.60  ? 497  PHE A CE2   1 
ATOM   818   C  CZ    . PHE A 1  233 ? 155.947 155.628 188.527 1.00 81.60  ? 497  PHE A CZ    1 
ATOM   819   N  N     . GLN A 1  234 ? 162.424 158.068 190.040 1.00 79.61  ? 498  GLN A N     1 
ATOM   820   C  CA    . GLN A 1  234 ? 163.664 158.825 190.037 1.00 79.61  ? 498  GLN A CA    1 
ATOM   821   C  C     . GLN A 1  234 ? 163.668 159.833 188.887 1.00 79.61  ? 498  GLN A C     1 
ATOM   822   O  O     . GLN A 1  234 ? 163.096 159.577 187.824 1.00 79.61  ? 498  GLN A O     1 
ATOM   823   C  CB    . GLN A 1  234 ? 164.860 157.886 189.917 1.00 79.61  ? 498  GLN A CB    1 
ATOM   824   C  CG    . GLN A 1  234 ? 165.019 156.949 191.102 1.00 79.61  ? 498  GLN A CG    1 
ATOM   825   C  CD    . GLN A 1  234 ? 165.339 157.688 192.385 1.00 79.61  ? 498  GLN A CD    1 
ATOM   826   O  OE1   . GLN A 1  234 ? 166.099 158.656 192.385 1.00 79.61  ? 498  GLN A OE1   1 
ATOM   827   N  NE2   . GLN A 1  234 ? 164.754 157.238 193.489 1.00 79.61  ? 498  GLN A NE2   1 
ATOM   828   N  N     . PRO A 1  235 ? 164.309 160.995 189.074 1.00 76.45  ? 499  PRO A N     1 
ATOM   829   C  CA    . PRO A 1  235 ? 164.377 161.981 187.986 1.00 76.45  ? 499  PRO A CA    1 
ATOM   830   C  C     . PRO A 1  235 ? 165.240 161.512 186.825 1.00 76.45  ? 499  PRO A C     1 
ATOM   831   O  O     . PRO A 1  235 ? 165.893 160.469 186.912 1.00 76.45  ? 499  PRO A O     1 
ATOM   832   C  CB    . PRO A 1  235 ? 164.974 163.218 188.669 1.00 76.45  ? 499  PRO A CB    1 
ATOM   833   C  CG    . PRO A 1  235 ? 165.725 162.679 189.833 1.00 76.45  ? 499  PRO A CG    1 
ATOM   834   C  CD    . PRO A 1  235 ? 164.960 161.478 190.303 1.00 76.45  ? 499  PRO A CD    1 
ATOM   835   N  N     . LEU A 1  236 ? 165.265 162.292 185.741 1.00 72.77  ? 500  LEU A N     1 
ATOM   836   C  CA    . LEU A 1  236 ? 165.886 161.832 184.502 1.00 72.77  ? 500  LEU A CA    1 
ATOM   837   C  C     . LEU A 1  236 ? 167.392 161.646 184.652 1.00 72.77  ? 500  LEU A C     1 
ATOM   838   O  O     . LEU A 1  236 ? 167.970 160.727 184.057 1.00 72.77  ? 500  LEU A O     1 
ATOM   839   C  CB    . LEU A 1  236 ? 165.581 162.812 183.370 1.00 72.77  ? 500  LEU A CB    1 
ATOM   840   C  CG    . LEU A 1  236 ? 164.123 162.911 182.925 1.00 72.77  ? 500  LEU A CG    1 
ATOM   841   C  CD1   . LEU A 1  236 ? 163.956 164.033 181.916 1.00 72.77  ? 500  LEU A CD1   1 
ATOM   842   C  CD2   . LEU A 1  236 ? 163.655 161.592 182.339 1.00 72.77  ? 500  LEU A CD2   1 
ATOM   843   N  N     . HIS A 1  237 ? 168.050 162.515 185.425 1.00 78.37  ? 501  HIS A N     1 
ATOM   844   C  CA    . HIS A 1  237 ? 169.499 162.408 185.560 1.00 78.37  ? 501  HIS A CA    1 
ATOM   845   C  C     . HIS A 1  237 ? 169.901 161.124 186.273 1.00 78.37  ? 501  HIS A C     1 
ATOM   846   O  O     . HIS A 1  237 ? 170.920 160.518 185.927 1.00 78.37  ? 501  HIS A O     1 
ATOM   847   C  CB    . HIS A 1  237 ? 170.062 163.632 186.284 1.00 78.37  ? 501  HIS A CB    1 
ATOM   848   C  CG    . HIS A 1  237 ? 169.574 163.789 187.690 1.00 78.37  ? 501  HIS A CG    1 
ATOM   849   N  ND1   . HIS A 1  237 ? 170.181 163.172 188.762 1.00 78.37  ? 501  HIS A ND1   1 
ATOM   850   C  CD2   . HIS A 1  237 ? 168.547 164.508 188.202 1.00 78.37  ? 501  HIS A CD2   1 
ATOM   851   C  CE1   . HIS A 1  237 ? 169.544 163.497 189.873 1.00 78.37  ? 501  HIS A CE1   1 
ATOM   852   N  NE2   . HIS A 1  237 ? 168.549 164.307 189.561 1.00 78.37  ? 501  HIS A NE2   1 
ATOM   853   N  N     . ALA A 1  238 ? 169.105 160.676 187.247 1.00 73.74  ? 502  ALA A N     1 
ATOM   854   C  CA    . ALA A 1  238 ? 169.396 159.408 187.908 1.00 73.74  ? 502  ALA A CA    1 
ATOM   855   C  C     . ALA A 1  238 ? 169.306 158.244 186.929 1.00 73.74  ? 502  ALA A C     1 
ATOM   856   O  O     . ALA A 1  238 ? 170.156 157.344 186.939 1.00 73.74  ? 502  ALA A O     1 
ATOM   857   C  CB    . ALA A 1  238 ? 168.443 159.197 189.084 1.00 73.74  ? 502  ALA A CB    1 
ATOM   858   N  N     . LEU A 1  239 ? 168.287 158.249 186.067 1.00 72.93  ? 503  LEU A N     1 
ATOM   859   C  CA    . LEU A 1  239 ? 168.149 157.188 185.074 1.00 72.93  ? 503  LEU A CA    1 
ATOM   860   C  C     . LEU A 1  239 ? 169.308 157.202 184.086 1.00 72.93  ? 503  LEU A C     1 
ATOM   861   O  O     . LEU A 1  239 ? 169.887 156.153 183.782 1.00 72.93  ? 503  LEU A O     1 
ATOM   862   C  CB    . LEU A 1  239 ? 166.814 157.316 184.338 1.00 72.93  ? 503  LEU A CB    1 
ATOM   863   C  CG    . LEU A 1  239 ? 165.576 156.686 184.980 1.00 72.93  ? 503  LEU A CG    1 
ATOM   864   C  CD1   . LEU A 1  239 ? 165.139 157.437 186.227 1.00 72.93  ? 503  LEU A CD1   1 
ATOM   865   C  CD2   . LEU A 1  239 ? 164.440 156.612 183.965 1.00 72.93  ? 503  LEU A CD2   1 
ATOM   866   N  N     . ARG A 1  240 ? 169.656 158.392 183.610 1.00 73.88  ? 504  ARG A N     1 
ATOM   867   C  CA    . ARG A 1  240 ? 170.752 158.544 182.668 1.00 73.88  ? 504  ARG A CA    1 
ATOM   868   C  C     . ARG A 1  240 ? 172.052 158.062 183.290 1.00 73.88  ? 504  ARG A C     1 
ATOM   869   O  O     . ARG A 1  240 ? 172.887 157.469 182.613 1.00 73.88  ? 504  ARG A O     1 
ATOM   870   C  CB    . ARG A 1  240 ? 170.891 160.002 182.236 1.00 73.88  ? 504  ARG A CB    1 
ATOM   871   C  CG    . ARG A 1  240 ? 171.653 160.190 180.936 1.00 73.88  ? 504  ARG A CG    1 
ATOM   872   C  CD    . ARG A 1  240 ? 172.152 161.617 180.791 1.00 73.88  ? 504  ARG A CD    1 
ATOM   873   N  NE    . ARG A 1  240 ? 171.123 162.593 181.132 1.00 73.88  ? 504  ARG A NE    1 
ATOM   874   C  CZ    . ARG A 1  240 ? 169.912 162.621 180.588 1.00 73.88  ? 504  ARG A CZ    1 
ATOM   875   N  NH1   . ARG A 1  240 ? 169.574 161.724 179.672 1.00 73.88  ? 504  ARG A NH1   1 
ATOM   876   N  NH2   . ARG A 1  240 ? 169.038 163.545 180.957 1.00 73.88  ? 504  ARG A NH2   1 
ATOM   877   N  N     . ASN A 1  241 ? 172.221 158.317 184.582 1.00 73.25  ? 505  ASN A N     1 
ATOM   878   C  CA    . ASN A 1  241 ? 173.430 157.893 185.276 1.00 73.25  ? 505  ASN A CA    1 
ATOM   879   C  C     . ASN A 1  241 ? 173.462 156.378 185.432 1.00 73.25  ? 505  ASN A C     1 
ATOM   880   O  O     . ASN A 1  241 ? 174.514 155.750 185.270 1.00 73.25  ? 505  ASN A O     1 
ATOM   881   C  CB    . ASN A 1  241 ? 173.519 158.577 186.642 1.00 73.25  ? 505  ASN A CB    1 
ATOM   882   C  CG    . ASN A 1  241 ? 174.934 158.614 187.192 1.00 73.25  ? 505  ASN A CG    1 
ATOM   883   O  OD1   . ASN A 1  241 ? 175.227 159.362 188.124 1.00 73.25  ? 505  ASN A OD1   1 
ATOM   884   N  ND2   . ASN A 1  241 ? 175.822 157.812 186.614 1.00 73.25  ? 505  ASN A ND2   1 
ATOM   885   N  N     . ALA A 1  242 ? 172.314 155.774 185.748 1.00 71.03  ? 506  ALA A N     1 
ATOM   886   C  CA    . ALA A 1  242 ? 172.253 154.323 185.882 1.00 71.03  ? 506  ALA A CA    1 
ATOM   887   C  C     . ALA A 1  242 ? 172.396 153.614 184.542 1.00 71.03  ? 506  ALA A C     1 
ATOM   888   O  O     . ALA A 1  242 ? 172.753 152.431 184.514 1.00 71.03  ? 506  ALA A O     1 
ATOM   889   C  CB    . ALA A 1  242 ? 170.943 153.910 186.553 1.00 71.03  ? 506  ALA A CB    1 
ATOM   890   N  N     . GLU A 1  243 ? 172.114 154.306 183.435 1.00 74.26  ? 507  GLU A N     1 
ATOM   891   C  CA    . GLU A 1  243 ? 172.258 153.690 182.118 1.00 74.26  ? 507  GLU A CA    1 
ATOM   892   C  C     . GLU A 1  243 ? 173.699 153.279 181.844 1.00 74.26  ? 507  GLU A C     1 
ATOM   893   O  O     . GLU A 1  243 ? 173.947 152.287 181.148 1.00 74.26  ? 507  GLU A O     1 
ATOM   894   C  CB    . GLU A 1  243 ? 171.773 154.647 181.028 1.00 74.26  ? 507  GLU A CB    1 
ATOM   895   C  CG    . GLU A 1  243 ? 170.277 154.879 181.004 1.00 74.26  ? 507  GLU A CG    1 
ATOM   896   C  CD    . GLU A 1  243 ? 169.862 155.867 179.932 1.00 74.26  ? 507  GLU A CD    1 
ATOM   897   O  OE1   . GLU A 1  243 ? 170.755 156.457 179.290 1.00 74.26  ? 507  GLU A OE1   1 
ATOM   898   O  OE2   . GLU A 1  243 ? 168.643 156.055 179.734 1.00 74.26  ? 507  GLU A OE2   1 
ATOM   899   N  N     . LYS A 1  244 ? 174.664 154.030 182.380 1.00 69.03  ? 508  LYS A N     1 
ATOM   900   C  CA    . LYS A 1  244 ? 176.065 153.812 182.037 1.00 69.03  ? 508  LYS A CA    1 
ATOM   901   C  C     . LYS A 1  244 ? 176.586 152.459 182.504 1.00 69.03  ? 508  LYS A C     1 
ATOM   902   O  O     . LYS A 1  244 ? 177.614 151.998 181.999 1.00 69.03  ? 508  LYS A O     1 
ATOM   903   C  CB    . LYS A 1  244 ? 176.925 154.930 182.626 1.00 69.03  ? 508  LYS A CB    1 
ATOM   904   C  CG    . LYS A 1  244 ? 176.683 156.288 181.993 1.00 69.03  ? 508  LYS A CG    1 
ATOM   905   C  CD    . LYS A 1  244 ? 177.583 157.351 182.596 1.00 69.03  ? 508  LYS A CD    1 
ATOM   906   C  CE    . LYS A 1  244 ? 177.316 158.711 181.972 1.00 69.03  ? 508  LYS A CE    1 
ATOM   907   N  NZ    . LYS A 1  244 ? 178.179 159.773 182.558 1.00 69.03  ? 508  LYS A NZ    1 
ATOM   908   N  N     . VAL A 1  245 ? 175.907 151.814 183.455 1.00 68.77  ? 509  VAL A N     1 
ATOM   909   C  CA    . VAL A 1  245 ? 176.353 150.509 183.926 1.00 68.77  ? 509  VAL A CA    1 
ATOM   910   C  C     . VAL A 1  245 ? 176.088 149.420 182.895 1.00 68.77  ? 509  VAL A C     1 
ATOM   911   O  O     . VAL A 1  245 ? 176.869 148.468 182.785 1.00 68.77  ? 509  VAL A O     1 
ATOM   912   C  CB    . VAL A 1  245 ? 175.673 150.174 185.268 1.00 68.77  ? 509  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1  245 ? 176.072 148.786 185.750 1.00 68.77  ? 509  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1  245 ? 176.015 151.225 186.312 1.00 68.77  ? 509  VAL A CG2   1 
ATOM   915   N  N     . LEU A 1  246 ? 175.017 149.548 182.114 1.00 66.59  ? 510  LEU A N     1 
ATOM   916   C  CA    . LEU A 1  246 ? 174.602 148.517 181.170 1.00 66.59  ? 510  LEU A CA    1 
ATOM   917   C  C     . LEU A 1  246 ? 175.260 148.650 179.804 1.00 66.59  ? 510  LEU A C     1 
ATOM   918   O  O     . LEU A 1  246 ? 175.411 147.650 179.097 1.00 66.59  ? 510  LEU A O     1 
ATOM   919   C  CB    . LEU A 1  246 ? 173.080 148.547 181.002 1.00 66.59  ? 510  LEU A CB    1 
ATOM   920   C  CG    . LEU A 1  246 ? 172.270 148.196 182.250 1.00 66.59  ? 510  LEU A CG    1 
ATOM   921   C  CD1   . LEU A 1  246 ? 170.789 148.416 182.005 1.00 66.59  ? 510  LEU A CD1   1 
ATOM   922   C  CD2   . LEU A 1  246 ? 172.538 146.763 182.676 1.00 66.59  ? 510  LEU A CD2   1 
ATOM   923   N  N     . LEU A 1  247 ? 175.651 149.859 179.414 1.00 65.38  ? 511  LEU A N     1 
ATOM   924   C  CA    . LEU A 1  247 ? 176.234 150.063 178.099 1.00 65.38  ? 511  LEU A CA    1 
ATOM   925   C  C     . LEU A 1  247 ? 177.636 149.458 178.031 1.00 65.38  ? 511  LEU A C     1 
ATOM   926   O  O     . LEU A 1  247 ? 178.344 149.397 179.040 1.00 65.38  ? 511  LEU A O     1 
ATOM   927   C  CB    . LEU A 1  247 ? 176.294 151.551 177.770 1.00 65.38  ? 511  LEU A CB    1 
ATOM   928   C  CG    . LEU A 1  247 ? 174.938 152.239 177.619 1.00 65.38  ? 511  LEU A CG    1 
ATOM   929   C  CD1   . LEU A 1  247 ? 175.114 153.735 177.424 1.00 65.38  ? 511  LEU A CD1   1 
ATOM   930   C  CD2   . LEU A 1  247 ? 174.164 151.629 176.464 1.00 65.38  ? 511  LEU A CD2   1 
ATOM   931   N  N     . PRO A 1  248 ? 178.055 148.994 176.854 1.00 66.07  ? 512  PRO A N     1 
ATOM   932   C  CA    . PRO A 1  248 ? 179.398 148.420 176.724 1.00 66.07  ? 512  PRO A CA    1 
ATOM   933   C  C     . PRO A 1  248 ? 180.479 149.454 177.000 1.00 66.07  ? 512  PRO A C     1 
ATOM   934   O  O     . PRO A 1  248 ? 180.292 150.655 176.796 1.00 66.07  ? 512  PRO A O     1 
ATOM   935   C  CB    . PRO A 1  248 ? 179.441 147.944 175.268 1.00 66.07  ? 512  PRO A CB    1 
ATOM   936   C  CG    . PRO A 1  248 ? 178.009 147.762 174.888 1.00 66.07  ? 512  PRO A CG    1 
ATOM   937   C  CD    . PRO A 1  248 ? 177.270 148.841 175.618 1.00 66.07  ? 512  PRO A CD    1 
ATOM   938   N  N     . GLY A 1  249 ? 181.626 148.967 177.467 1.00 70.45  ? 513  GLY A N     1 
ATOM   939   C  CA    . GLY A 1  249 ? 182.742 149.833 177.787 1.00 70.45  ? 513  GLY A CA    1 
ATOM   940   C  C     . GLY A 1  249 ? 182.723 150.311 179.223 1.00 70.45  ? 513  GLY A C     1 
ATOM   941   O  O     . GLY A 1  249 ? 183.079 151.459 179.507 1.00 70.45  ? 513  GLY A O     1 
ATOM   942   N  N     . TYR A 1  250 ? 182.308 149.439 180.140 1.00 68.80  ? 514  TYR A N     1 
ATOM   943   C  CA    . TYR A 1  250 ? 182.214 149.803 181.548 1.00 68.80  ? 514  TYR A CA    1 
ATOM   944   C  C     . TYR A 1  250 ? 182.901 148.768 182.430 1.00 68.80  ? 514  TYR A C     1 
ATOM   945   O  O     . TYR A 1  250 ? 183.332 149.081 183.544 1.00 68.80  ? 514  TYR A O     1 
ATOM   946   C  CB    . TYR A 1  250 ? 180.748 149.966 181.957 1.00 68.80  ? 514  TYR A CB    1 
ATOM   947   C  CG    . TYR A 1  250 ? 180.552 150.393 183.393 1.00 68.80  ? 514  TYR A CG    1 
ATOM   948   C  CD1   . TYR A 1  250 ? 180.805 151.698 183.790 1.00 68.80  ? 514  TYR A CD1   1 
ATOM   949   C  CD2   . TYR A 1  250 ? 180.105 149.493 184.350 1.00 68.80  ? 514  TYR A CD2   1 
ATOM   950   C  CE1   . TYR A 1  250 ? 180.626 152.093 185.102 1.00 68.80  ? 514  TYR A CE1   1 
ATOM   951   C  CE2   . TYR A 1  250 ? 179.922 149.878 185.663 1.00 68.80  ? 514  TYR A CE2   1 
ATOM   952   C  CZ    . TYR A 1  250 ? 180.184 151.179 186.034 1.00 68.80  ? 514  TYR A CZ    1 
ATOM   953   O  OH    . TYR A 1  250 ? 180.002 151.567 187.341 1.00 68.80  ? 514  TYR A OH    1 
ATOM   954   N  N     . HIS A 1  251 ? 183.010 147.539 181.942 1.00 71.93  ? 515  HIS A N     1 
ATOM   955   C  CA    . HIS A 1  251 ? 183.614 146.453 182.695 1.00 71.93  ? 515  HIS A CA    1 
ATOM   956   C  C     . HIS A 1  251 ? 184.985 146.104 182.139 1.00 71.93  ? 515  HIS A C     1 
ATOM   957   O  O     . HIS A 1  251 ? 185.193 146.086 180.922 1.00 71.93  ? 515  HIS A O     1 
ATOM   958   C  CB    . HIS A 1  251 ? 182.715 145.214 182.658 1.00 71.93  ? 515  HIS A CB    1 
ATOM   959   C  CG    . HIS A 1  251 ? 181.440 145.371 183.426 1.00 71.93  ? 515  HIS A CG    1 
ATOM   960   N  ND1   . HIS A 1  251 ? 180.409 144.458 183.353 1.00 71.93  ? 515  HIS A ND1   1 
ATOM   961   C  CD2   . HIS A 1  251 ? 181.030 146.331 184.287 1.00 71.93  ? 515  HIS A CD2   1 
ATOM   962   C  CE1   . HIS A 1  251 ? 179.419 144.852 184.132 1.00 71.93  ? 515  HIS A CE1   1 
ATOM   963   N  NE2   . HIS A 1  251 ? 179.770 145.986 184.711 1.00 71.93  ? 515  HIS A NE2   1 
ATOM   964   N  N     . PRO A 1  252 ? 185.950 145.818 183.009 1.00 69.44  ? 516  PRO A N     1 
ATOM   965   C  CA    . PRO A 1  252 ? 187.284 145.432 182.549 1.00 69.44  ? 516  PRO A CA    1 
ATOM   966   C  C     . PRO A 1  252 ? 187.342 143.971 182.121 1.00 69.44  ? 516  PRO A C     1 
ATOM   967   O  O     . PRO A 1  252 ? 186.568 143.125 182.574 1.00 69.44  ? 516  PRO A O     1 
ATOM   968   C  CB    . PRO A 1  252 ? 188.159 145.668 183.788 1.00 69.44  ? 516  PRO A CB    1 
ATOM   969   C  CG    . PRO A 1  252 ? 187.230 145.458 184.930 1.00 69.44  ? 516  PRO A CG    1 
ATOM   970   C  CD    . PRO A 1  252 ? 185.889 145.968 184.473 1.00 69.44  ? 516  PRO A CD    1 
ATOM   971   N  N     . PHE A 1  253 ? 188.293 143.692 181.235 1.00 71.35  ? 517  PHE A N     1 
ATOM   972   C  CA    . PHE A 1  253 ? 188.507 142.357 180.690 1.00 71.35  ? 517  PHE A CA    1 
ATOM   973   C  C     . PHE A 1  253 ? 189.820 142.382 179.920 1.00 71.35  ? 517  PHE A C     1 
ATOM   974   O  O     . PHE A 1  253 ? 190.383 143.447 179.651 1.00 71.35  ? 517  PHE A O     1 
ATOM   975   C  CB    . PHE A 1  253 ? 187.353 141.913 179.787 1.00 71.35  ? 517  PHE A CB    1 
ATOM   976   C  CG    . PHE A 1  253 ? 187.178 142.764 178.561 1.00 71.35  ? 517  PHE A CG    1 
ATOM   977   C  CD1   . PHE A 1  253 ? 186.384 143.898 178.597 1.00 71.35  ? 517  PHE A CD1   1 
ATOM   978   C  CD2   . PHE A 1  253 ? 187.798 142.425 177.370 1.00 71.35  ? 517  PHE A CD2   1 
ATOM   979   C  CE1   . PHE A 1  253 ? 186.220 144.682 177.471 1.00 71.35  ? 517  PHE A CE1   1 
ATOM   980   C  CE2   . PHE A 1  253 ? 187.639 143.205 176.243 1.00 71.35  ? 517  PHE A CE2   1 
ATOM   981   C  CZ    . PHE A 1  253 ? 186.848 144.334 176.293 1.00 71.35  ? 517  PHE A CZ    1 
ATOM   982   N  N     . GLU A 1  254 ? 190.304 141.192 179.568 1.00 75.30  ? 518  GLU A N     1 
ATOM   983   C  CA    . GLU A 1  254 ? 191.507 141.082 178.754 1.00 75.30  ? 518  GLU A CA    1 
ATOM   984   C  C     . GLU A 1  254 ? 191.545 139.711 178.098 1.00 75.30  ? 518  GLU A C     1 
ATOM   985   O  O     . GLU A 1  254 ? 191.231 138.704 178.738 1.00 75.30  ? 518  GLU A O     1 
ATOM   986   C  CB    . GLU A 1  254 ? 192.771 141.329 179.592 1.00 75.30  ? 518  GLU A CB    1 
ATOM   987   C  CG    . GLU A 1  254 ? 193.002 140.361 180.745 1.00 75.30  ? 518  GLU A CG    1 
ATOM   988   C  CD    . GLU A 1  254 ? 193.818 139.149 180.339 1.00 75.30  ? 518  GLU A CD    1 
ATOM   989   O  OE1   . GLU A 1  254 ? 194.482 139.207 179.282 1.00 75.30  ? 518  GLU A OE1   1 
ATOM   990   O  OE2   . GLU A 1  254 ? 193.809 138.147 181.084 1.00 75.30  ? 518  GLU A OE2   1 
ATOM   991   N  N     . TRP A 1  255 ? 191.907 139.686 176.819 1.00 70.22  ? 519  TRP A N     1 
ATOM   992   C  CA    . TRP A 1  255 ? 192.083 138.438 176.090 1.00 70.22  ? 519  TRP A CA    1 
ATOM   993   C  C     . TRP A 1  255 ? 193.468 137.876 176.382 1.00 70.22  ? 519  TRP A C     1 
ATOM   994   O  O     . TRP A 1  255 ? 194.465 138.601 176.302 1.00 70.22  ? 519  TRP A O     1 
ATOM   995   C  CB    . TRP A 1  255 ? 191.905 138.682 174.593 1.00 70.22  ? 519  TRP A CB    1 
ATOM   996   C  CG    . TRP A 1  255 ? 190.509 139.078 174.217 1.00 70.22  ? 519  TRP A CG    1 
ATOM   997   C  CD1   . TRP A 1  255 ? 190.007 140.345 174.151 1.00 70.22  ? 519  TRP A CD1   1 
ATOM   998   C  CD2   . TRP A 1  255 ? 189.445 138.205 173.820 1.00 70.22  ? 519  TRP A CD2   1 
ATOM   999   N  NE1   . TRP A 1  255 ? 188.691 140.314 173.759 1.00 70.22  ? 519  TRP A NE1   1 
ATOM   1000  C  CE2   . TRP A 1  255 ? 188.323 139.011 173.547 1.00 70.22  ? 519  TRP A CE2   1 
ATOM   1001  C  CE3   . TRP A 1  255 ? 189.331 136.820 173.677 1.00 70.22  ? 519  TRP A CE3   1 
ATOM   1002  C  CZ2   . TRP A 1  255 ? 187.104 138.478 173.141 1.00 70.22  ? 519  TRP A CZ2   1 
ATOM   1003  C  CZ3   . TRP A 1  255 ? 188.119 136.293 173.273 1.00 70.22  ? 519  TRP A CZ3   1 
ATOM   1004  C  CH2   . TRP A 1  255 ? 187.022 137.120 173.010 1.00 70.22  ? 519  TRP A CH2   1 
ATOM   1005  N  N     . GLN A 1  256 ? 193.533 136.581 176.729 1.00 74.04  ? 520  GLN A N     1 
ATOM   1006  C  CA    . GLN A 1  256 ? 194.823 136.000 177.102 1.00 74.04  ? 520  GLN A CA    1 
ATOM   1007  C  C     . GLN A 1  256 ? 195.790 135.998 175.921 1.00 74.04  ? 520  GLN A C     1 
ATOM   1008  O  O     . GLN A 1  256 ? 196.943 136.429 176.088 1.00 74.04  ? 520  GLN A O     1 
ATOM   1009  C  CB    . GLN A 1  256 ? 194.621 134.614 177.719 1.00 74.04  ? 520  GLN A CB    1 
ATOM   1010  C  CG    . GLN A 1  256 ? 195.904 133.963 178.197 1.00 74.04  ? 520  GLN A CG    1 
ATOM   1011  C  CD    . GLN A 1  256 ? 196.585 134.765 179.287 1.00 74.04  ? 520  GLN A CD    1 
ATOM   1012  O  OE1   . GLN A 1  256 ? 197.593 135.431 179.048 1.00 74.04  ? 520  GLN A OE1   1 
ATOM   1013  N  NE2   . GLN A 1  256 ? 196.034 134.708 180.493 1.00 74.04  ? 520  GLN A NE2   1 
ATOM   1014  N  N     . PRO A 1  257 ? 195.411 135.537 174.729 1.00 70.43  ? 521  PRO A N     1 
ATOM   1015  C  CA    . PRO A 1  257 ? 196.164 135.917 173.532 1.00 70.43  ? 521  PRO A CA    1 
ATOM   1016  C  C     . PRO A 1  257 ? 195.719 137.286 173.051 1.00 70.43  ? 521  PRO A C     1 
ATOM   1017  O  O     . PRO A 1  257 ? 194.542 137.472 172.708 1.00 70.43  ? 521  PRO A O     1 
ATOM   1018  C  CB    . PRO A 1  257 ? 195.793 134.827 172.513 1.00 70.43  ? 521  PRO A CB    1 
ATOM   1019  C  CG    . PRO A 1  257 ? 195.245 133.709 173.322 1.00 70.43  ? 521  PRO A CG    1 
ATOM   1020  C  CD    . PRO A 1  257 ? 194.536 134.388 174.449 1.00 70.43  ? 521  PRO A CD    1 
ATOM   1021  N  N     . PRO A 1  258 ? 196.617 138.271 173.029 1.00 67.68  ? 522  PRO A N     1 
ATOM   1022  C  CA    . PRO A 1  258 ? 196.218 139.618 172.606 1.00 67.68  ? 522  PRO A CA    1 
ATOM   1023  C  C     . PRO A 1  258 ? 195.664 139.618 171.190 1.00 67.68  ? 522  PRO A C     1 
ATOM   1024  O  O     . PRO A 1  258 ? 196.189 138.957 170.291 1.00 67.68  ? 522  PRO A O     1 
ATOM   1025  C  CB    . PRO A 1  258 ? 197.521 140.421 172.697 1.00 67.68  ? 522  PRO A CB    1 
ATOM   1026  C  CG    . PRO A 1  258 ? 198.349 139.674 173.686 1.00 67.68  ? 522  PRO A CG    1 
ATOM   1027  C  CD    . PRO A 1  258 ? 198.022 138.226 173.464 1.00 67.68  ? 522  PRO A CD    1 
ATOM   1028  N  N     . LEU A 1  259 ? 194.582 140.370 171.003 1.00 69.36  ? 523  LEU A N     1 
ATOM   1029  C  CA    . LEU A 1  259 ? 193.911 140.410 169.712 1.00 69.36  ? 523  LEU A CA    1 
ATOM   1030  C  C     . LEU A 1  259 ? 194.767 141.144 168.688 1.00 69.36  ? 523  LEU A C     1 
ATOM   1031  O  O     . LEU A 1  259 ? 195.224 142.265 168.932 1.00 69.36  ? 523  LEU A O     1 
ATOM   1032  C  CB    . LEU A 1  259 ? 192.549 141.089 169.841 1.00 69.36  ? 523  LEU A CB    1 
ATOM   1033  C  CG    . LEU A 1  259 ? 191.498 140.373 170.687 1.00 69.36  ? 523  LEU A CG    1 
ATOM   1034  C  CD1   . LEU A 1  259 ? 190.228 141.205 170.766 1.00 69.36  ? 523  LEU A CD1   1 
ATOM   1035  C  CD2   . LEU A 1  259 ? 191.212 138.992 170.129 1.00 69.36  ? 523  LEU A CD2   1 
ATOM   1036  N  N     . LYS A 1  260 ? 194.984 140.507 167.542 1.00 71.31  ? 524  LYS A N     1 
ATOM   1037  C  CA    . LYS A 1  260 ? 195.753 141.131 166.477 1.00 71.31  ? 524  LYS A CA    1 
ATOM   1038  C  C     . LYS A 1  260 ? 194.948 142.248 165.825 1.00 71.31  ? 524  LYS A C     1 
ATOM   1039  O  O     . LYS A 1  260 ? 193.757 142.094 165.543 1.00 71.31  ? 524  LYS A O     1 
ATOM   1040  C  CB    . LYS A 1  260 ? 196.155 140.092 165.431 1.00 71.31  ? 524  LYS A CB    1 
ATOM   1041  N  N     . ASN A 1  261 ? 195.607 143.383 165.602 1.00 73.13  ? 525  ASN A N     1 
ATOM   1042  C  CA    . ASN A 1  261 ? 195.038 144.561 164.952 1.00 73.13  ? 525  ASN A CA    1 
ATOM   1043  C  C     . ASN A 1  261 ? 193.844 145.138 165.702 1.00 73.13  ? 525  ASN A C     1 
ATOM   1044  O  O     . ASN A 1  261 ? 193.078 145.921 165.127 1.00 73.13  ? 525  ASN A O     1 
ATOM   1045  C  CB    . ASN A 1  261 ? 194.642 144.262 163.500 1.00 73.13  ? 525  ASN A CB    1 
ATOM   1046  C  CG    . ASN A 1  261 ? 195.831 143.893 162.636 1.00 73.13  ? 525  ASN A CG    1 
ATOM   1047  O  OD1   . ASN A 1  261 ? 195.936 142.766 162.152 1.00 73.13  ? 525  ASN A OD1   1 
ATOM   1048  N  ND2   . ASN A 1  261 ? 196.736 144.844 162.439 1.00 73.13  ? 525  ASN A ND2   1 
ATOM   1049  N  N     . VAL A 1  262 ? 193.661 144.776 166.969 1.00 71.73  ? 526  VAL A N     1 
ATOM   1050  C  CA    . VAL A 1  262 ? 192.575 145.290 167.793 1.00 71.73  ? 526  VAL A CA    1 
ATOM   1051  C  C     . VAL A 1  262 ? 193.175 145.911 169.045 1.00 71.73  ? 526  VAL A C     1 
ATOM   1052  O  O     . VAL A 1  262 ? 194.059 145.322 169.678 1.00 71.73  ? 526  VAL A O     1 
ATOM   1053  C  CB    . VAL A 1  262 ? 191.562 144.184 168.158 1.00 71.73  ? 526  VAL A CB    1 
ATOM   1054  C  CG1   . VAL A 1  262 ? 190.489 144.725 169.089 1.00 71.73  ? 526  VAL A CG1   1 
ATOM   1055  C  CG2   . VAL A 1  262 ? 190.939 143.599 166.900 1.00 71.73  ? 526  VAL A CG2   1 
ATOM   1056  N  N     . SER A 1  263 ? 192.697 147.102 169.397 1.00 75.86  ? 527  SER A N     1 
ATOM   1057  C  CA    . SER A 1  263 ? 193.218 147.807 170.557 1.00 75.86  ? 527  SER A CA    1 
ATOM   1058  C  C     . SER A 1  263 ? 192.903 147.045 171.842 1.00 75.86  ? 527  SER A C     1 
ATOM   1059  O  O     . SER A 1  263 ? 191.990 146.217 171.902 1.00 75.86  ? 527  SER A O     1 
ATOM   1060  C  CB    . SER A 1  263 ? 192.637 149.218 170.631 1.00 75.86  ? 527  SER A CB    1 
ATOM   1061  O  OG    . SER A 1  263 ? 193.105 149.903 171.779 1.00 75.86  ? 527  SER A OG    1 
ATOM   1062  N  N     . SER A 1  264 ? 193.682 147.339 172.883 1.00 75.69  ? 528  SER A N     1 
ATOM   1063  C  CA    . SER A 1  264 ? 193.497 146.729 174.192 1.00 75.69  ? 528  SER A CA    1 
ATOM   1064  C  C     . SER A 1  264 ? 192.751 147.628 175.167 1.00 75.69  ? 528  SER A C     1 
ATOM   1065  O  O     . SER A 1  264 ? 192.454 147.191 176.284 1.00 75.69  ? 528  SER A O     1 
ATOM   1066  C  CB    . SER A 1  264 ? 194.854 146.345 174.794 1.00 75.69  ? 528  SER A CB    1 
ATOM   1067  O  OG    . SER A 1  264 ? 195.630 147.496 175.076 1.00 75.69  ? 528  SER A OG    1 
ATOM   1068  N  N     . ARG A 1  265 ? 192.449 148.864 174.778 1.00 77.85  ? 529  ARG A N     1 
ATOM   1069  C  CA    . ARG A 1  265 ? 191.677 149.757 175.629 1.00 77.85  ? 529  ARG A CA    1 
ATOM   1070  C  C     . ARG A 1  265 ? 190.255 149.231 175.782 1.00 77.85  ? 529  ARG A C     1 
ATOM   1071  O  O     . ARG A 1  265 ? 189.646 148.761 174.819 1.00 77.85  ? 529  ARG A O     1 
ATOM   1072  C  CB    . ARG A 1  265 ? 191.669 151.163 175.034 1.00 77.85  ? 529  ARG A CB    1 
ATOM   1073  C  CG    . ARG A 1  265 ? 191.001 152.210 175.897 1.00 77.85  ? 529  ARG A CG    1 
ATOM   1074  C  CD    . ARG A 1  265 ? 191.128 153.589 175.270 1.00 77.85  ? 529  ARG A CD    1 
ATOM   1075  N  NE    . ARG A 1  265 ? 190.404 154.604 176.028 1.00 77.85  ? 529  ARG A NE    1 
ATOM   1076  C  CZ    . ARG A 1  265 ? 190.912 155.272 177.058 1.00 77.85  ? 529  ARG A CZ    1 
ATOM   1077  N  NH1   . ARG A 1  265 ? 192.153 155.032 177.460 1.00 77.85  ? 529  ARG A NH1   1 
ATOM   1078  N  NH2   . ARG A 1  265 ? 190.179 156.179 177.689 1.00 77.85  ? 529  ARG A NH2   1 
ATOM   1079  N  N     . THR A 1  266 ? 189.725 149.308 177.001 1.00 77.23  ? 530  THR A N     1 
ATOM   1080  C  CA    . THR A 1  266 ? 188.453 148.675 177.344 1.00 77.23  ? 530  THR A CA    1 
ATOM   1081  C  C     . THR A 1  266 ? 187.482 149.684 177.946 1.00 77.23  ? 530  THR A C     1 
ATOM   1082  O  O     . THR A 1  266 ? 186.842 149.431 178.969 1.00 77.23  ? 530  THR A O     1 
ATOM   1083  C  CB    . THR A 1  266 ? 188.660 147.511 178.310 1.00 77.23  ? 530  THR A CB    1 
ATOM   1084  O  OG1   . THR A 1  266 ? 189.252 147.993 179.522 1.00 77.23  ? 530  THR A OG1   1 
ATOM   1085  C  CG2   . THR A 1  266 ? 189.564 146.455 177.694 1.00 77.23  ? 530  THR A CG2   1 
ATOM   1086  N  N     . ASP A 1  267 ? 187.356 150.856 177.316 1.00 77.53  ? 531  ASP A N     1 
ATOM   1087  C  CA    . ASP A 1  267 ? 186.328 151.801 177.737 1.00 77.53  ? 531  ASP A CA    1 
ATOM   1088  C  C     . ASP A 1  267 ? 185.662 152.502 176.555 1.00 77.53  ? 531  ASP A C     1 
ATOM   1089  O  O     . ASP A 1  267 ? 185.013 153.537 176.748 1.00 77.53  ? 531  ASP A O     1 
ATOM   1090  C  CB    . ASP A 1  267 ? 186.895 152.846 178.710 1.00 77.53  ? 531  ASP A CB    1 
ATOM   1091  C  CG    . ASP A 1  267 ? 187.969 153.717 178.084 1.00 77.53  ? 531  ASP A CG    1 
ATOM   1092  O  OD1   . ASP A 1  267 ? 188.330 153.490 176.912 1.00 77.53  ? 531  ASP A OD1   1 
ATOM   1093  O  OD2   . ASP A 1  267 ? 188.453 154.638 178.774 1.00 77.53  ? 531  ASP A OD2   1 
ATOM   1094  N  N     . VAL A 1  268 ? 185.808 151.972 175.340 1.00 73.63  ? 532  VAL A N     1 
ATOM   1095  C  CA    . VAL A 1  268 ? 185.206 152.606 174.175 1.00 73.63  ? 532  VAL A CA    1 
ATOM   1096  C  C     . VAL A 1  268 ? 183.700 152.388 174.195 1.00 73.63  ? 532  VAL A C     1 
ATOM   1097  O  O     . VAL A 1  268 ? 183.204 151.367 174.691 1.00 73.63  ? 532  VAL A O     1 
ATOM   1098  C  CB    . VAL A 1  268 ? 185.832 152.063 172.879 1.00 73.63  ? 532  VAL A CB    1 
ATOM   1099  C  CG1   . VAL A 1  268 ? 187.322 152.364 172.845 1.00 73.63  ? 532  VAL A CG1   1 
ATOM   1100  C  CG2   . VAL A 1  268 ? 185.582 150.571 172.749 1.00 73.63  ? 532  VAL A CG2   1 
ATOM   1101  N  N     . GLY A 1  269 ? 182.961 153.358 173.663 1.00 72.26  ? 533  GLY A N     1 
ATOM   1102  C  CA    . GLY A 1  269 ? 181.515 153.274 173.635 1.00 72.26  ? 533  GLY A CA    1 
ATOM   1103  C  C     . GLY A 1  269 ? 180.957 153.061 172.244 1.00 72.26  ? 533  GLY A C     1 
ATOM   1104  O  O     . GLY A 1  269 ? 181.004 151.949 171.712 1.00 72.26  ? 533  GLY A O     1 
ATOM   1105  N  N     . ILE A 1  270 ? 180.428 154.123 171.646 1.00 71.53  ? 534  ILE A N     1 
ATOM   1106  C  CA    . ILE A 1  270 ? 179.841 154.060 170.310 1.00 71.53  ? 534  ILE A CA    1 
ATOM   1107  C  C     . ILE A 1  270 ? 180.914 154.547 169.343 1.00 71.53  ? 534  ILE A C     1 
ATOM   1108  O  O     . ILE A 1  270 ? 181.114 155.747 169.146 1.00 71.53  ? 534  ILE A O     1 
ATOM   1109  C  CB    . ILE A 1  270 ? 178.555 154.878 170.213 1.00 71.53  ? 534  ILE A CB    1 
ATOM   1110  C  CG1   . ILE A 1  270 ? 177.497 154.313 171.163 1.00 71.53  ? 534  ILE A CG1   1 
ATOM   1111  C  CG2   . ILE A 1  270 ? 178.032 154.882 168.786 1.00 71.53  ? 534  ILE A CG2   1 
ATOM   1112  C  CD1   . ILE A 1  270 ? 176.287 155.202 171.326 1.00 71.53  ? 534  ILE A CD1   1 
ATOM   1113  N  N     . ILE A 1  271 ? 181.622 153.594 168.733 1.00 71.78  ? 535  ILE A N     1 
ATOM   1114  C  CA    . ILE A 1  271 ? 182.637 153.942 167.750 1.00 71.78  ? 535  ILE A CA    1 
ATOM   1115  C  C     . ILE A 1  271 ? 181.960 154.394 166.459 1.00 71.78  ? 535  ILE A C     1 
ATOM   1116  O  O     . ILE A 1  271 ? 180.886 153.905 166.087 1.00 71.78  ? 535  ILE A O     1 
ATOM   1117  C  CB    . ILE A 1  271 ? 183.573 152.745 167.504 1.00 71.78  ? 535  ILE A CB    1 
ATOM   1118  C  CG1   . ILE A 1  271 ? 184.225 152.305 168.814 1.00 71.78  ? 535  ILE A CG1   1 
ATOM   1119  C  CG2   . ILE A 1  271 ? 184.650 153.089 166.486 1.00 71.78  ? 535  ILE A CG2   1 
ATOM   1120  C  CD1   . ILE A 1  271 ? 185.082 153.373 169.455 1.00 71.78  ? 535  ILE A CD1   1 
ATOM   1121  N  N     . ASP A 1  272 ? 182.587 155.350 165.777 1.00 74.23  ? 536  ASP A N     1 
ATOM   1122  C  CA    . ASP A 1  272 ? 182.059 155.823 164.505 1.00 74.23  ? 536  ASP A CA    1 
ATOM   1123  C  C     . ASP A 1  272 ? 182.032 154.690 163.485 1.00 74.23  ? 536  ASP A C     1 
ATOM   1124  O  O     . ASP A 1  272 ? 182.917 153.831 163.451 1.00 74.23  ? 536  ASP A O     1 
ATOM   1125  C  CB    . ASP A 1  272 ? 182.898 156.986 163.979 1.00 74.23  ? 536  ASP A CB    1 
ATOM   1126  C  CG    . ASP A 1  272 ? 182.309 157.609 162.731 1.00 74.23  ? 536  ASP A CG    1 
ATOM   1127  O  OD1   . ASP A 1  272 ? 181.294 158.326 162.846 1.00 74.23  ? 536  ASP A OD1   1 
ATOM   1128  O  OD2   . ASP A 1  272 ? 182.862 157.382 161.635 1.00 74.23  ? 536  ASP A OD2   1 
ATOM   1129  N  N     . GLY A 1  273 ? 180.996 154.696 162.645 1.00 73.87  ? 537  GLY A N     1 
ATOM   1130  C  CA    . GLY A 1  273 ? 180.823 153.608 161.698 1.00 73.87  ? 537  GLY A CA    1 
ATOM   1131  C  C     . GLY A 1  273 ? 181.798 153.668 160.538 1.00 73.87  ? 537  GLY A C     1 
ATOM   1132  O  O     . GLY A 1  273 ? 182.224 152.632 160.020 1.00 73.87  ? 537  GLY A O     1 
ATOM   1133  N  N     . LEU A 1  274 ? 182.163 154.878 160.110 1.00 75.05  ? 538  LEU A N     1 
ATOM   1134  C  CA    . LEU A 1  274 ? 183.056 155.025 158.966 1.00 75.05  ? 538  LEU A CA    1 
ATOM   1135  C  C     . LEU A 1  274 ? 184.464 154.521 159.258 1.00 75.05  ? 538  LEU A C     1 
ATOM   1136  O  O     . LEU A 1  274 ? 185.197 154.203 158.316 1.00 75.05  ? 538  LEU A O     1 
ATOM   1137  C  CB    . LEU A 1  274 ? 183.111 156.488 158.519 1.00 75.05  ? 538  LEU A CB    1 
ATOM   1138  C  CG    . LEU A 1  274 ? 181.958 157.021 157.663 1.00 75.05  ? 538  LEU A CG    1 
ATOM   1139  C  CD1   . LEU A 1  274 ? 180.691 157.223 158.484 1.00 75.05  ? 538  LEU A CD1   1 
ATOM   1140  C  CD2   . LEU A 1  274 ? 182.362 158.315 156.972 1.00 75.05  ? 538  LEU A CD2   1 
ATOM   1141  N  N     . SER A 1  275 ? 184.852 154.446 160.532 1.00 75.30  ? 539  SER A N     1 
ATOM   1142  C  CA    . SER A 1  275 ? 186.162 153.943 160.947 1.00 75.30  ? 539  SER A CA    1 
ATOM   1143  C  C     . SER A 1  275 ? 187.292 154.758 160.314 1.00 75.30  ? 539  SER A C     1 
ATOM   1144  O  O     . SER A 1  275 ? 188.227 154.223 159.716 1.00 75.30  ? 539  SER A O     1 
ATOM   1145  C  CB    . SER A 1  275 ? 186.304 152.452 160.621 1.00 75.30  ? 539  SER A CB    1 
ATOM   1146  O  OG    . SER A 1  275 ? 185.373 151.679 161.358 1.00 75.30  ? 539  SER A OG    1 
ATOM   1147  N  N     . GLY A 1  276 ? 187.186 156.077 160.461 1.00 76.15  ? 540  GLY A N     1 
ATOM   1148  C  CA    . GLY A 1  276 ? 188.214 156.970 159.953 1.00 76.15  ? 540  GLY A CA    1 
ATOM   1149  C  C     . GLY A 1  276 ? 188.345 156.976 158.447 1.00 76.15  ? 540  GLY A C     1 
ATOM   1150  O  O     . GLY A 1  276 ? 189.448 157.175 157.928 1.00 76.15  ? 540  GLY A O     1 
ATOM   1151  N  N     . LEU A 1  277 ? 187.248 156.760 157.728 1.00 75.97  ? 541  LEU A N     1 
ATOM   1152  C  CA    . LEU A 1  277 ? 187.297 156.756 156.274 1.00 75.97  ? 541  LEU A CA    1 
ATOM   1153  C  C     . LEU A 1  277 ? 187.522 158.167 155.745 1.00 75.97  ? 541  LEU A C     1 
ATOM   1154  O  O     . LEU A 1  277 ? 187.007 159.144 156.296 1.00 75.97  ? 541  LEU A O     1 
ATOM   1155  C  CB    . LEU A 1  277 ? 186.004 156.174 155.702 1.00 75.97  ? 541  LEU A CB    1 
ATOM   1156  C  CG    . LEU A 1  277 ? 185.917 156.026 154.183 1.00 75.97  ? 541  LEU A CG    1 
ATOM   1157  C  CD1   . LEU A 1  277 ? 186.989 155.078 153.677 1.00 75.97  ? 541  LEU A CD1   1 
ATOM   1158  C  CD2   . LEU A 1  277 ? 184.536 155.540 153.776 1.00 75.97  ? 541  LEU A CD2   1 
ATOM   1159  N  N     . ALA A 1  278 ? 188.304 158.269 154.673 1.00 78.84  ? 542  ALA A N     1 
ATOM   1160  C  CA    . ALA A 1  278 ? 188.596 159.564 154.075 1.00 78.84  ? 542  ALA A CA    1 
ATOM   1161  C  C     . ALA A 1  278 ? 187.325 160.187 153.514 1.00 78.84  ? 542  ALA A C     1 
ATOM   1162  O  O     . ALA A 1  278 ? 186.589 159.549 152.755 1.00 78.84  ? 542  ALA A O     1 
ATOM   1163  C  CB    . ALA A 1  278 ? 189.645 159.416 152.975 1.00 78.84  ? 542  ALA A CB    1 
ATOM   1164  N  N     . SER A 1  279 ? 187.067 161.441 153.890 1.00 80.50  ? 543  SER A N     1 
ATOM   1165  C  CA    . SER A 1  279 ? 185.858 162.146 153.480 1.00 80.50  ? 543  SER A CA    1 
ATOM   1166  C  C     . SER A 1  279 ? 186.168 163.457 152.767 1.00 80.50  ? 543  SER A C     1 
ATOM   1167  O  O     . SER A 1  279 ? 185.324 164.358 152.742 1.00 80.50  ? 543  SER A O     1 
ATOM   1168  C  CB    . SER A 1  279 ? 184.954 162.401 154.687 1.00 80.50  ? 543  SER A CB    1 
ATOM   1169  O  OG    . SER A 1  279 ? 185.563 163.302 155.597 1.00 80.50  ? 543  SER A OG    1 
ATOM   1170  N  N     . SER A 1  280 ? 187.350 163.550 152.164 1.00 78.24  ? 544  SER A N     1 
ATOM   1171  C  CA    . SER A 1  280 ? 187.752 164.751 151.436 1.00 78.24  ? 544  SER A CA    1 
ATOM   1172  C  C     . SER A 1  280 ? 187.086 164.792 150.068 1.00 78.24  ? 544  SER A C     1 
ATOM   1173  O  O     . SER A 1  280 ? 186.156 164.033 149.804 1.00 78.24  ? 544  SER A O     1 
ATOM   1174  C  CB    . SER A 1  280 ? 189.270 164.798 151.270 1.00 78.24  ? 544  SER A CB    1 
ATOM   1175  O  OG    . SER A 1  280 ? 189.670 165.934 150.526 1.00 78.24  ? 544  SER A OG    1 
ATOM   1176  N  N     . VAL A 1  281 ? 187.561 165.678 149.198 1.00 78.52  ? 545  VAL A N     1 
ATOM   1177  C  CA    . VAL A 1  281 ? 186.996 165.793 147.856 1.00 78.52  ? 545  VAL A CA    1 
ATOM   1178  C  C     . VAL A 1  281 ? 187.723 164.931 146.831 1.00 78.52  ? 545  VAL A C     1 
ATOM   1179  O  O     . VAL A 1  281 ? 187.155 164.635 145.769 1.00 78.52  ? 545  VAL A O     1 
ATOM   1180  C  CB    . VAL A 1  281 ? 187.000 167.271 147.413 1.00 78.52  ? 545  VAL A CB    1 
ATOM   1181  C  CG1   . VAL A 1  281 ? 188.425 167.759 147.184 1.00 78.52  ? 545  VAL A CG1   1 
ATOM   1182  C  CG2   . VAL A 1  281 ? 186.128 167.486 146.180 1.00 78.52  ? 545  VAL A CG2   1 
ATOM   1183  N  N     . ASP A 1  282 ? 188.948 164.495 147.122 1.00 78.23  ? 546  ASP A N     1 
ATOM   1184  C  CA    . ASP A 1  282 ? 189.746 163.764 146.145 1.00 78.23  ? 546  ASP A CA    1 
ATOM   1185  C  C     . ASP A 1  282 ? 189.404 162.279 146.086 1.00 78.23  ? 546  ASP A C     1 
ATOM   1186  O  O     . ASP A 1  282 ? 189.420 161.687 145.002 1.00 78.23  ? 546  ASP A O     1 
ATOM   1187  C  CB    . ASP A 1  282 ? 191.236 163.937 146.452 1.00 78.23  ? 546  ASP A CB    1 
ATOM   1188  C  CG    . ASP A 1  282 ? 191.722 165.350 146.197 1.00 78.23  ? 546  ASP A CG    1 
ATOM   1189  O  OD1   . ASP A 1  282 ? 191.153 166.025 145.314 1.00 78.23  ? 546  ASP A OD1   1 
ATOM   1190  O  OD2   . ASP A 1  282 ? 192.674 165.785 146.878 1.00 78.23  ? 546  ASP A OD2   1 
ATOM   1191  N  N     . GLU A 1  283 ? 189.096 161.663 147.224 1.00 78.29  ? 547  GLU A N     1 
ATOM   1192  C  CA    . GLU A 1  283 ? 188.850 160.229 147.257 1.00 78.29  ? 547  GLU A CA    1 
ATOM   1193  C  C     . GLU A 1  283 ? 187.457 159.911 146.717 1.00 78.29  ? 547  GLU A C     1 
ATOM   1194  O  O     . GLU A 1  283 ? 186.733 160.776 146.216 1.00 78.29  ? 547  GLU A O     1 
ATOM   1195  C  CB    . GLU A 1  283 ? 189.001 159.690 148.677 1.00 78.29  ? 547  GLU A CB    1 
ATOM   1196  C  CG    . GLU A 1  283 ? 190.407 159.764 149.241 1.00 78.29  ? 547  GLU A CG    1 
ATOM   1197  C  CD    . GLU A 1  283 ? 190.709 161.114 149.852 1.00 78.29  ? 547  GLU A CD    1 
ATOM   1198  O  OE1   . GLU A 1  283 ? 189.807 161.976 149.856 1.00 78.29  ? 547  GLU A OE1   1 
ATOM   1199  O  OE2   . GLU A 1  283 ? 191.841 161.309 150.339 1.00 78.29  ? 547  GLU A OE2   1 
ATOM   1200  N  N     . TYR A 1  284 ? 187.061 158.653 146.871 1.00 71.56  ? 548  TYR A N     1 
ATOM   1201  C  CA    . TYR A 1  284 ? 185.739 158.215 146.458 1.00 71.56  ? 548  TYR A CA    1 
ATOM   1202  C  C     . TYR A 1  284 ? 184.749 158.967 147.332 1.00 71.56  ? 548  TYR A C     1 
ATOM   1203  O  O     . TYR A 1  284 ? 184.992 159.152 148.521 1.00 71.56  ? 548  TYR A O     1 
ATOM   1204  C  CB    . TYR A 1  284 ? 185.599 156.715 146.685 1.00 71.56  ? 548  TYR A CB    1 
ATOM   1205  C  CG    . TYR A 1  284 ? 184.536 156.053 145.847 1.00 71.56  ? 548  TYR A CG    1 
ATOM   1206  C  CD1   . TYR A 1  284 ? 184.812 155.620 144.561 1.00 71.56  ? 548  TYR A CD1   1 
ATOM   1207  C  CD2   . TYR A 1  284 ? 183.261 155.850 146.347 1.00 71.56  ? 548  TYR A CD2   1 
ATOM   1208  C  CE1   . TYR A 1  284 ? 183.844 155.009 143.792 1.00 71.56  ? 548  TYR A CE1   1 
ATOM   1209  C  CE2   . TYR A 1  284 ? 182.286 155.239 145.586 1.00 71.56  ? 548  TYR A CE2   1 
ATOM   1210  C  CZ    . TYR A 1  284 ? 182.584 154.821 144.309 1.00 71.56  ? 548  TYR A CZ    1 
ATOM   1211  O  OH    . TYR A 1  284 ? 181.618 154.213 143.546 1.00 71.56  ? 548  TYR A OH    1 
ATOM   1212  N  N     . PRO A 1  285 ? 183.626 159.409 146.754 1.00 72.69  ? 549  PRO A N     1 
ATOM   1213  C  CA    . PRO A 1  285 ? 182.655 160.162 147.554 1.00 72.69  ? 549  PRO A CA    1 
ATOM   1214  C  C     . PRO A 1  285 ? 181.953 159.281 148.574 1.00 72.69  ? 549  PRO A C     1 
ATOM   1215  O  O     . PRO A 1  285 ? 181.639 158.116 148.321 1.00 72.69  ? 549  PRO A O     1 
ATOM   1216  C  CB    . PRO A 1  285 ? 181.669 160.694 146.507 1.00 72.69  ? 549  PRO A CB    1 
ATOM   1217  C  CG    . PRO A 1  285 ? 181.780 159.738 145.373 1.00 72.69  ? 549  PRO A CG    1 
ATOM   1218  C  CD    . PRO A 1  285 ? 183.216 159.301 145.344 1.00 72.69  ? 549  PRO A CD    1 
ATOM   1219  N  N     . VAL A 1  286 ? 181.711 159.862 149.746 1.00 78.58  ? 550  VAL A N     1 
ATOM   1220  C  CA    . VAL A 1  286 ? 181.041 159.190 150.852 1.00 78.58  ? 550  VAL A CA    1 
ATOM   1221  C  C     . VAL A 1  286 ? 179.707 159.881 151.086 1.00 78.58  ? 550  VAL A C     1 
ATOM   1222  O  O     . VAL A 1  286 ? 179.657 161.105 151.250 1.00 78.58  ? 550  VAL A O     1 
ATOM   1223  C  CB    . VAL A 1  286 ? 181.897 159.211 152.132 1.00 78.58  ? 550  VAL A CB    1 
ATOM   1224  C  CG1   . VAL A 1  286 ? 181.135 158.586 153.290 1.00 78.58  ? 550  VAL A CG1   1 
ATOM   1225  C  CG2   . VAL A 1  286 ? 183.215 158.492 151.899 1.00 78.58  ? 550  VAL A CG2   1 
ATOM   1226  N  N     . ASP A 1  287 ? 178.631 159.098 151.104 1.00 85.40  ? 551  ASP A N     1 
ATOM   1227  C  CA    . ASP A 1  287 ? 177.285 159.635 151.268 1.00 85.40  ? 551  ASP A CA    1 
ATOM   1228  C  C     . ASP A 1  287 ? 176.496 158.807 152.272 1.00 85.40  ? 551  ASP A C     1 
ATOM   1229  O  O     . ASP A 1  287 ? 175.273 158.667 152.164 1.00 85.40  ? 551  ASP A O     1 
ATOM   1230  C  CB    . ASP A 1  287 ? 176.555 159.702 149.927 1.00 85.40  ? 551  ASP A CB    1 
ATOM   1231  C  CG    . ASP A 1  287 ? 176.425 158.344 149.258 1.00 85.40  ? 551  ASP A CG    1 
ATOM   1232  O  OD1   . ASP A 1  287 ? 176.970 157.353 149.789 1.00 85.40  ? 551  ASP A OD1   1 
ATOM   1233  O  OD2   . ASP A 1  287 ? 175.772 158.266 148.197 1.00 85.40  ? 551  ASP A OD2   1 
ATOM   1234  N  N     . THR A 1  288 ? 177.183 158.243 153.263 1.00 80.58  ? 552  THR A N     1 
ATOM   1235  C  CA    . THR A 1  288 ? 176.546 157.395 154.259 1.00 80.58  ? 552  THR A CA    1 
ATOM   1236  C  C     . THR A 1  288 ? 177.006 157.810 155.648 1.00 80.58  ? 552  THR A C     1 
ATOM   1237  O  O     . THR A 1  288 ? 178.035 158.468 155.819 1.00 80.58  ? 552  THR A O     1 
ATOM   1238  C  CB    . THR A 1  288 ? 176.859 155.911 154.026 1.00 80.58  ? 552  THR A CB    1 
ATOM   1239  O  OG1   . THR A 1  288 ? 178.271 155.697 154.136 1.00 80.58  ? 552  THR A OG1   1 
ATOM   1240  C  CG2   . THR A 1  288 ? 176.390 155.470 152.647 1.00 80.58  ? 552  THR A CG2   1 
ATOM   1241  N  N     . ILE A 1  289 ? 176.220 157.414 156.651 1.00 73.96  ? 553  ILE A N     1 
ATOM   1242  C  CA    . ILE A 1  289 ? 176.562 157.609 158.054 1.00 73.96  ? 553  ILE A CA    1 
ATOM   1243  C  C     . ILE A 1  289 ? 176.296 156.303 158.788 1.00 73.96  ? 553  ILE A C     1 
ATOM   1244  O  O     . ILE A 1  289 ? 175.445 155.503 158.393 1.00 73.96  ? 553  ILE A O     1 
ATOM   1245  C  CB    . ILE A 1  289 ? 175.768 158.763 158.708 1.00 73.96  ? 553  ILE A CB    1 
ATOM   1246  C  CG1   . ILE A 1  289 ? 174.268 158.472 158.670 1.00 73.96  ? 553  ILE A CG1   1 
ATOM   1247  C  CG2   . ILE A 1  289 ? 176.077 160.086 158.024 1.00 73.96  ? 553  ILE A CG2   1 
ATOM   1248  C  CD1   . ILE A 1  289 ? 173.445 159.432 159.494 1.00 73.96  ? 553  ILE A CD1   1 
ATOM   1249  N  N     . ALA A 1  290 ? 177.040 156.090 159.872 1.00 73.81  ? 554  ALA A N     1 
ATOM   1250  C  CA    . ALA A 1  290 ? 176.921 154.845 160.617 1.00 73.81  ? 554  ALA A CA    1 
ATOM   1251  C  C     . ALA A 1  290 ? 177.478 155.029 162.020 1.00 73.81  ? 554  ALA A C     1 
ATOM   1252  O  O     . ALA A 1  290 ? 178.384 155.834 162.253 1.00 73.81  ? 554  ALA A O     1 
ATOM   1253  C  CB    . ALA A 1  290 ? 177.640 153.696 159.904 1.00 73.81  ? 554  ALA A CB    1 
ATOM   1254  N  N     . LYS A 1  291 ? 176.913 154.262 162.952 1.00 68.41  ? 555  LYS A N     1 
ATOM   1255  C  CA    . LYS A 1  291 ? 177.378 154.205 164.330 1.00 68.41  ? 555  LYS A CA    1 
ATOM   1256  C  C     . LYS A 1  291 ? 177.360 152.752 164.779 1.00 68.41  ? 555  LYS A C     1 
ATOM   1257  O  O     . LYS A 1  291 ? 176.506 151.967 164.354 1.00 68.41  ? 555  LYS A O     1 
ATOM   1258  C  CB    . LYS A 1  291 ? 176.517 155.062 165.266 1.00 68.41  ? 555  LYS A CB    1 
ATOM   1259  C  CG    . LYS A 1  291 ? 176.512 156.545 164.933 1.00 68.41  ? 555  LYS A CG    1 
ATOM   1260  C  CD    . LYS A 1  291 ? 177.869 157.175 165.186 1.00 68.41  ? 555  LYS A CD    1 
ATOM   1261  C  CE    . LYS A 1  291 ? 177.841 158.671 164.928 1.00 68.41  ? 555  LYS A CE    1 
ATOM   1262  N  NZ    . LYS A 1  291 ? 179.182 159.287 165.127 1.00 68.41  ? 555  LYS A NZ    1 
ATOM   1263  N  N     . ARG A 1  292 ? 178.312 152.388 165.623 1.00 69.14  ? 556  ARG A N     1 
ATOM   1264  C  CA    . ARG A 1  292 ? 178.385 151.022 166.096 1.00 69.14  ? 556  ARG A CA    1 
ATOM   1265  C  C     . ARG A 1  292 ? 179.311 150.879 167.283 1.00 69.14  ? 556  ARG A C     1 
ATOM   1266  O  O     . ARG A 1  292 ? 180.174 151.717 167.525 1.00 69.14  ? 556  ARG A O     1 
ATOM   1267  C  CB    . ARG A 1  292 ? 178.862 150.107 164.970 1.00 69.14  ? 556  ARG A CB    1 
ATOM   1268  C  CG    . ARG A 1  292 ? 180.255 150.434 164.463 1.00 69.14  ? 556  ARG A CG    1 
ATOM   1269  C  CD    . ARG A 1  292 ? 181.237 149.323 164.791 1.00 69.14  ? 556  ARG A CD    1 
ATOM   1270  N  NE    . ARG A 1  292 ? 182.610 149.691 164.460 1.00 69.14  ? 556  ARG A NE    1 
ATOM   1271  C  CZ    . ARG A 1  292 ? 183.647 148.866 164.557 1.00 69.14  ? 556  ARG A CZ    1 
ATOM   1272  N  NH1   . ARG A 1  292 ? 183.470 147.622 164.973 1.00 69.14  ? 556  ARG A NH1   1 
ATOM   1273  N  NH2   . ARG A 1  292 ? 184.862 149.284 164.236 1.00 69.14  ? 556  ARG A NH2   1 
ATOM   1274  N  N     . PHE A 1  293 ? 179.105 149.806 168.029 1.00 69.19  ? 557  PHE A N     1 
ATOM   1275  C  CA    . PHE A 1  293 ? 179.924 149.493 169.183 1.00 69.19  ? 557  PHE A CA    1 
ATOM   1276  C  C     . PHE A 1  293 ? 181.181 148.752 168.738 1.00 69.19  ? 557  PHE A C     1 
ATOM   1277  O  O     . PHE A 1  293 ? 181.383 148.454 167.555 1.00 69.19  ? 557  PHE A O     1 
ATOM   1278  C  CB    . PHE A 1  293 ? 179.144 148.648 170.197 1.00 69.19  ? 557  PHE A CB    1 
ATOM   1279  C  CG    . PHE A 1  293 ? 178.007 149.385 170.869 1.00 69.19  ? 557  PHE A CG    1 
ATOM   1280  C  CD1   . PHE A 1  293 ? 178.245 150.269 171.914 1.00 69.19  ? 557  PHE A CD1   1 
ATOM   1281  C  CD2   . PHE A 1  293 ? 176.699 149.181 170.465 1.00 69.19  ? 557  PHE A CD2   1 
ATOM   1282  C  CE1   . PHE A 1  293 ? 177.192 150.949 172.529 1.00 69.19  ? 557  PHE A CE1   1 
ATOM   1283  C  CE2   . PHE A 1  293 ? 175.648 149.854 171.075 1.00 69.19  ? 557  PHE A CE2   1 
ATOM   1284  C  CZ    . PHE A 1  293 ? 175.894 150.738 172.106 1.00 69.19  ? 557  PHE A CZ    1 
ATOM   1285  N  N     . ARG A 1  294 ? 182.006 148.379 169.707 1.00 73.47  ? 558  ARG A N     1 
ATOM   1286  C  CA    . ARG A 1  294 ? 183.180 147.577 169.407 1.00 73.47  ? 558  ARG A CA    1 
ATOM   1287  C  C     . ARG A 1  294 ? 182.718 146.145 169.644 1.00 73.47  ? 558  ARG A C     1 
ATOM   1288  O  O     . ARG A 1  294 ? 181.956 145.887 170.572 1.00 73.47  ? 558  ARG A O     1 
ATOM   1289  C  CB    . ARG A 1  294 ? 184.352 147.936 170.311 1.00 73.47  ? 558  ARG A CB    1 
ATOM   1290  C  CG    . ARG A 1  294 ? 185.665 148.087 169.560 1.00 73.47  ? 558  ARG A CG    1 
ATOM   1291  C  CD    . ARG A 1  294 ? 186.790 148.512 170.486 1.00 73.47  ? 558  ARG A CD    1 
ATOM   1292  N  NE    . ARG A 1  294 ? 187.397 147.368 171.152 1.00 73.47  ? 558  ARG A NE    1 
ATOM   1293  C  CZ    . ARG A 1  294 ? 188.129 147.451 172.256 1.00 73.47  ? 558  ARG A CZ    1 
ATOM   1294  N  NH1   . ARG A 1  294 ? 188.348 148.630 172.820 1.00 73.47  ? 558  ARG A NH1   1 
ATOM   1295  N  NH2   . ARG A 1  294 ? 188.642 146.356 172.796 1.00 73.47  ? 558  ARG A NH2   1 
ATOM   1296  N  N     . TYR A 1  295 ? 183.166 145.212 168.816 1.00 71.59  ? 559  TYR A N     1 
ATOM   1297  C  CA    . TYR A 1  295 ? 182.726 143.822 168.937 1.00 71.59  ? 559  TYR A CA    1 
ATOM   1298  C  C     . TYR A 1  295 ? 183.005 143.095 170.258 1.00 71.59  ? 559  TYR A C     1 
ATOM   1299  O  O     . TYR A 1  295 ? 182.111 142.462 170.812 1.00 71.59  ? 559  TYR A O     1 
ATOM   1300  C  CB    . TYR A 1  295 ? 183.248 142.990 167.765 1.00 71.59  ? 559  TYR A CB    1 
ATOM   1301  C  CG    . TYR A 1  295 ? 182.279 141.929 167.303 1.00 71.59  ? 559  TYR A CG    1 
ATOM   1302  C  CD1   . TYR A 1  295 ? 181.243 141.507 168.121 1.00 71.59  ? 559  TYR A CD1   1 
ATOM   1303  C  CD2   . TYR A 1  295 ? 182.399 141.350 166.049 1.00 71.59  ? 559  TYR A CD2   1 
ATOM   1304  C  CE1   . TYR A 1  295 ? 180.355 140.537 167.703 1.00 71.59  ? 559  TYR A CE1   1 
ATOM   1305  C  CE2   . TYR A 1  295 ? 181.516 140.380 165.624 1.00 71.59  ? 559  TYR A CE2   1 
ATOM   1306  C  CZ    . TYR A 1  295 ? 180.497 139.977 166.455 1.00 71.59  ? 559  TYR A CZ    1 
ATOM   1307  O  OH    . TYR A 1  295 ? 179.616 139.011 166.034 1.00 71.59  ? 559  TYR A OH    1 
ATOM   1308  N  N     . ASP A 1  296 ? 184.231 143.181 170.760 1.00 74.22  ? 560  ASP A N     1 
ATOM   1309  C  CA    . ASP A 1  296 ? 184.600 142.483 171.983 1.00 74.22  ? 560  ASP A CA    1 
ATOM   1310  C  C     . ASP A 1  296 ? 183.917 143.101 173.195 1.00 74.22  ? 560  ASP A C     1 
ATOM   1311  O  O     . ASP A 1  296 ? 183.451 142.380 174.083 1.00 74.22  ? 560  ASP A O     1 
ATOM   1312  C  CB    . ASP A 1  296 ? 186.120 142.469 172.157 1.00 74.22  ? 560  ASP A CB    1 
ATOM   1313  C  CG    . ASP A 1  296 ? 186.721 143.858 172.253 1.00 74.22  ? 560  ASP A CG    1 
ATOM   1314  O  OD1   . ASP A 1  296 ? 185.976 144.848 172.121 1.00 74.22  ? 560  ASP A OD1   1 
ATOM   1315  O  OD2   . ASP A 1  296 ? 187.950 143.957 172.457 1.00 74.22  ? 560  ASP A OD2   1 
ATOM   1316  N  N     . SER A 1  297 ? 183.857 144.434 173.250 1.00 70.31  ? 561  SER A N     1 
ATOM   1317  C  CA    . SER A 1  297 ? 183.156 145.099 174.341 1.00 70.31  ? 561  SER A CA    1 
ATOM   1318  C  C     . SER A 1  297 ? 181.674 144.748 174.335 1.00 70.31  ? 561  SER A C     1 
ATOM   1319  O  O     . SER A 1  297 ? 181.065 144.574 175.397 1.00 70.31  ? 561  SER A O     1 
ATOM   1320  C  CB    . SER A 1  297 ? 183.352 146.610 174.242 1.00 70.31  ? 561  SER A CB    1 
ATOM   1321  O  OG    . SER A 1  297 ? 182.656 147.272 175.280 1.00 70.31  ? 561  SER A OG    1 
ATOM   1322  N  N     . ALA A 1  298 ? 181.080 144.631 173.145 1.00 67.56  ? 562  ALA A N     1 
ATOM   1323  C  CA    . ALA A 1  298 ? 179.680 144.230 173.056 1.00 67.56  ? 562  ALA A CA    1 
ATOM   1324  C  C     . ALA A 1  298 ? 179.478 142.815 173.582 1.00 67.56  ? 562  ALA A C     1 
ATOM   1325  O  O     . ALA A 1  298 ? 178.510 142.549 174.305 1.00 67.56  ? 562  ALA A O     1 
ATOM   1326  C  CB    . ALA A 1  298 ? 179.188 144.339 171.613 1.00 67.56  ? 562  ALA A CB    1 
ATOM   1327  N  N     . LEU A 1  299 ? 180.381 141.894 173.235 1.00 68.47  ? 563  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1  299 ? 180.266 140.535 173.756 1.00 68.47  ? 563  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1  299 ? 180.432 140.507 175.270 1.00 68.47  ? 563  LEU A C     1 
ATOM   1330  O  O     . LEU A 1  299 ? 179.723 139.769 175.965 1.00 68.47  ? 563  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1  299 ? 181.292 139.621 173.088 1.00 68.47  ? 563  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1  299 ? 181.087 139.335 171.601 1.00 68.47  ? 563  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1  299 ? 182.237 138.500 171.063 1.00 68.47  ? 563  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1  299 ? 179.755 138.642 171.360 1.00 68.47  ? 563  LEU A CD2   1 
ATOM   1335  N  N     . VAL A 1  300 ? 181.362 141.304 175.800 1.00 68.29  ? 564  VAL A N     1 
ATOM   1336  C  CA    . VAL A 1  300 ? 181.563 141.354 177.248 1.00 68.29  ? 564  VAL A CA    1 
ATOM   1337  C  C     . VAL A 1  300 ? 180.312 141.878 177.941 1.00 68.29  ? 564  VAL A C     1 
ATOM   1338  O  O     . VAL A 1  300 ? 179.876 141.340 178.966 1.00 68.29  ? 564  VAL A O     1 
ATOM   1339  C  CB    . VAL A 1  300 ? 182.799 142.204 177.593 1.00 68.29  ? 564  VAL A CB    1 
ATOM   1340  C  CG1   . VAL A 1  300 ? 182.890 142.416 179.092 1.00 68.29  ? 564  VAL A CG1   1 
ATOM   1341  C  CG2   . VAL A 1  300 ? 184.059 141.530 177.086 1.00 68.29  ? 564  VAL A CG2   1 
ATOM   1342  N  N     . SER A 1  301 ? 179.715 142.938 177.391 1.00 68.72  ? 565  SER A N     1 
ATOM   1343  C  CA    . SER A 1  301 ? 178.500 143.487 177.985 1.00 68.72  ? 565  SER A CA    1 
ATOM   1344  C  C     . SER A 1  301 ? 177.353 142.487 177.917 1.00 68.72  ? 565  SER A C     1 
ATOM   1345  O  O     . SER A 1  301 ? 176.571 142.362 178.868 1.00 68.72  ? 565  SER A O     1 
ATOM   1346  C  CB    . SER A 1  301 ? 178.117 144.791 177.287 1.00 68.72  ? 565  SER A CB    1 
ATOM   1347  O  OG    . SER A 1  301 ? 176.918 145.322 177.826 1.00 68.72  ? 565  SER A OG    1 
ATOM   1348  N  N     . ALA A 1  302 ? 177.241 141.757 176.805 1.00 70.15  ? 566  ALA A N     1 
ATOM   1349  C  CA    . ALA A 1  302 ? 176.186 140.758 176.678 1.00 70.15  ? 566  ALA A CA    1 
ATOM   1350  C  C     . ALA A 1  302 ? 176.369 139.636 177.692 1.00 70.15  ? 566  ALA A C     1 
ATOM   1351  O  O     . ALA A 1  302 ? 175.400 139.164 178.297 1.00 70.15  ? 566  ALA A O     1 
ATOM   1352  C  CB    . ALA A 1  302 ? 176.158 140.202 175.255 1.00 70.15  ? 566  ALA A CB    1 
ATOM   1353  N  N     . LEU A 1  303 ? 177.613 139.191 177.889 1.00 70.10  ? 567  LEU A N     1 
ATOM   1354  C  CA    . LEU A 1  303 ? 177.870 138.137 178.865 1.00 70.10  ? 567  LEU A CA    1 
ATOM   1355  C  C     . LEU A 1  303 ? 177.627 138.617 180.289 1.00 70.10  ? 567  LEU A C     1 
ATOM   1356  O  O     . LEU A 1  303 ? 177.134 137.851 181.126 1.00 70.10  ? 567  LEU A O     1 
ATOM   1357  C  CB    . LEU A 1  303 ? 179.299 137.617 178.720 1.00 70.10  ? 567  LEU A CB    1 
ATOM   1358  C  CG    . LEU A 1  303 ? 179.620 136.862 177.431 1.00 70.10  ? 567  LEU A CG    1 
ATOM   1359  C  CD1   . LEU A 1  303 ? 181.100 136.528 177.368 1.00 70.10  ? 567  LEU A CD1   1 
ATOM   1360  C  CD2   . LEU A 1  303 ? 178.777 135.603 177.329 1.00 70.10  ? 567  LEU A CD2   1 
ATOM   1361  N  N     . MET A 1  304 ? 177.966 139.872 180.587 1.00 74.74  ? 568  MET A N     1 
ATOM   1362  C  CA    . MET A 1  304 ? 177.738 140.399 181.927 1.00 74.74  ? 568  MET A CA    1 
ATOM   1363  C  C     . MET A 1  304 ? 176.262 140.653 182.196 1.00 74.74  ? 568  MET A C     1 
ATOM   1364  O  O     . MET A 1  304 ? 175.832 140.610 183.354 1.00 74.74  ? 568  MET A O     1 
ATOM   1365  C  CB    . MET A 1  304 ? 178.541 141.683 182.132 1.00 74.74  ? 568  MET A CB    1 
ATOM   1366  C  CG    . MET A 1  304 ? 180.041 141.465 182.149 1.00 74.74  ? 568  MET A CG    1 
ATOM   1367  S  SD    . MET A 1  304 ? 180.551 140.371 183.486 1.00 74.74  ? 568  MET A SD    1 
ATOM   1368  C  CE    . MET A 1  304 ? 180.238 141.408 184.912 1.00 74.74  ? 568  MET A CE    1 
ATOM   1369  N  N     . ASP A 1  305 ? 175.475 140.918 181.152 1.00 76.86  ? 569  ASP A N     1 
ATOM   1370  C  CA    . ASP A 1  305 ? 174.037 141.076 181.323 1.00 76.86  ? 569  ASP A CA    1 
ATOM   1371  C  C     . ASP A 1  305 ? 173.344 139.769 181.688 1.00 76.86  ? 569  ASP A C     1 
ATOM   1372  O  O     . ASP A 1  305 ? 172.214 139.805 182.186 1.00 76.86  ? 569  ASP A O     1 
ATOM   1373  C  CB    . ASP A 1  305 ? 173.424 141.653 180.045 1.00 76.86  ? 569  ASP A CB    1 
ATOM   1374  C  CG    . ASP A 1  305 ? 171.961 142.012 180.208 1.00 76.86  ? 569  ASP A CG    1 
ATOM   1375  O  OD1   . ASP A 1  305 ? 171.669 143.032 180.866 1.00 76.86  ? 569  ASP A OD1   1 
ATOM   1376  O  OD2   . ASP A 1  305 ? 171.103 141.276 179.678 1.00 76.86  ? 569  ASP A OD2   1 
ATOM   1377  N  N     . MET A 1  306 ? 173.991 138.628 181.466 1.00 81.41  ? 570  MET A N     1 
ATOM   1378  C  CA    . MET A 1  306 ? 173.416 137.315 181.727 1.00 81.41  ? 570  MET A CA    1 
ATOM   1379  C  C     . MET A 1  306 ? 174.193 136.580 182.813 1.00 81.41  ? 570  MET A C     1 
ATOM   1380  O  O     . MET A 1  306 ? 174.440 135.377 182.718 1.00 81.41  ? 570  MET A O     1 
ATOM   1381  C  CB    . MET A 1  306 ? 173.372 136.479 180.451 1.00 81.41  ? 570  MET A CB    1 
ATOM   1382  C  CG    . MET A 1  306 ? 172.453 137.026 179.377 1.00 81.41  ? 570  MET A CG    1 
ATOM   1383  S  SD    . MET A 1  306 ? 172.393 135.955 177.929 1.00 81.41  ? 570  MET A SD    1 
ATOM   1384  C  CE    . MET A 1  306 ? 173.999 136.277 177.209 1.00 81.41  ? 570  MET A CE    1 
ATOM   1385  N  N     . GLU A 1  307 ? 174.591 137.299 183.863 1.00 88.47  ? 571  GLU A N     1 
ATOM   1386  C  CA    . GLU A 1  307 ? 175.336 136.665 184.946 1.00 88.47  ? 571  GLU A CA    1 
ATOM   1387  C  C     . GLU A 1  307 ? 174.429 135.778 185.789 1.00 88.47  ? 571  GLU A C     1 
ATOM   1388  O  O     . GLU A 1  307 ? 174.744 134.607 186.038 1.00 88.47  ? 571  GLU A O     1 
ATOM   1389  C  CB    . GLU A 1  307 ? 176.007 137.729 185.813 1.00 88.47  ? 571  GLU A CB    1 
ATOM   1390  C  CG    . GLU A 1  307 ? 176.863 137.162 186.932 1.00 88.47  ? 571  GLU A CG    1 
ATOM   1391  C  CD    . GLU A 1  307 ? 177.550 138.241 187.744 1.00 88.47  ? 571  GLU A CD    1 
ATOM   1392  O  OE1   . GLU A 1  307 ? 177.341 139.435 187.446 1.00 88.47  ? 571  GLU A OE1   1 
ATOM   1393  O  OE2   . GLU A 1  307 ? 178.300 137.895 188.681 1.00 88.47  ? 571  GLU A OE2   1 
ATOM   1394  N  N     . GLU A 1  308 ? 173.295 136.322 186.238 1.00 90.17  ? 572  GLU A N     1 
ATOM   1395  C  CA    . GLU A 1  308 ? 172.390 135.558 187.089 1.00 90.17  ? 572  GLU A CA    1 
ATOM   1396  C  C     . GLU A 1  308 ? 171.841 134.340 186.359 1.00 90.17  ? 572  GLU A C     1 
ATOM   1397  O  O     . GLU A 1  308 ? 171.637 133.284 186.968 1.00 90.17  ? 572  GLU A O     1 
ATOM   1398  C  CB    . GLU A 1  308 ? 171.248 136.450 187.577 1.00 90.17  ? 572  GLU A CB    1 
ATOM   1399  C  CG    . GLU A 1  308 ? 171.681 137.555 188.527 1.00 90.17  ? 572  GLU A CG    1 
ATOM   1400  C  CD    . GLU A 1  308 ? 172.199 138.781 187.800 1.00 90.17  ? 572  GLU A CD    1 
ATOM   1401  O  OE1   . GLU A 1  308 ? 172.160 138.795 186.552 1.00 90.17  ? 572  GLU A OE1   1 
ATOM   1402  O  OE2   . GLU A 1  308 ? 172.644 139.731 188.478 1.00 90.17  ? 572  GLU A OE2   1 
ATOM   1403  N  N     . ASP A 1  309 ? 171.601 134.466 185.053 1.00 89.24  ? 573  ASP A N     1 
ATOM   1404  C  CA    . ASP A 1  309 ? 171.105 133.333 184.278 1.00 89.24  ? 573  ASP A CA    1 
ATOM   1405  C  C     . ASP A 1  309 ? 172.107 132.185 184.282 1.00 89.24  ? 573  ASP A C     1 
ATOM   1406  O  O     . ASP A 1  309 ? 171.745 131.031 184.542 1.00 89.24  ? 573  ASP A O     1 
ATOM   1407  C  CB    . ASP A 1  309 ? 170.794 133.773 182.847 1.00 89.24  ? 573  ASP A CB    1 
ATOM   1408  C  CG    . ASP A 1  309 ? 169.600 134.703 182.770 1.00 89.24  ? 573  ASP A CG    1 
ATOM   1409  O  OD1   . ASP A 1  309 ? 168.704 134.593 183.632 1.00 89.24  ? 573  ASP A OD1   1 
ATOM   1410  O  OD2   . ASP A 1  309 ? 169.557 135.542 181.847 1.00 89.24  ? 573  ASP A OD2   1 
ATOM   1411  N  N     . ILE A 1  310 ? 173.376 132.485 184.003 1.00 86.58  ? 574  ILE A N     1 
ATOM   1412  C  CA    . ILE A 1  310 ? 174.400 131.444 183.971 1.00 86.58  ? 574  ILE A CA    1 
ATOM   1413  C  C     . ILE A 1  310 ? 174.606 130.856 185.363 1.00 86.58  ? 574  ILE A C     1 
ATOM   1414  O  O     . ILE A 1  310 ? 174.791 129.643 185.520 1.00 86.58  ? 574  ILE A O     1 
ATOM   1415  C  CB    . ILE A 1  310 ? 175.712 132.002 183.391 1.00 86.58  ? 574  ILE A CB    1 
ATOM   1416  C  CG1   . ILE A 1  310 ? 175.503 132.457 181.947 1.00 86.58  ? 574  ILE A CG1   1 
ATOM   1417  C  CG2   . ILE A 1  310 ? 176.813 130.958 183.452 1.00 86.58  ? 574  ILE A CG2   1 
ATOM   1418  C  CD1   . ILE A 1  310 ? 176.659 133.253 181.387 1.00 86.58  ? 574  ILE A CD1   1 
ATOM   1419  N  N     . LEU A 1  311 ? 174.570 131.705 186.394 1.00 90.10  ? 575  LEU A N     1 
ATOM   1420  C  CA    . LEU A 1  311 ? 174.737 131.209 187.757 1.00 90.10  ? 575  LEU A CA    1 
ATOM   1421  C  C     . LEU A 1  311 ? 173.614 130.254 188.140 1.00 90.10  ? 575  LEU A C     1 
ATOM   1422  O  O     . LEU A 1  311 ? 173.867 129.169 188.678 1.00 90.10  ? 575  LEU A O     1 
ATOM   1423  C  CB    . LEU A 1  311 ? 174.808 132.379 188.738 1.00 90.10  ? 575  LEU A CB    1 
ATOM   1424  C  CG    . LEU A 1  311 ? 176.035 133.288 188.637 1.00 90.10  ? 575  LEU A CG    1 
ATOM   1425  C  CD1   . LEU A 1  311 ? 175.895 134.483 189.567 1.00 90.10  ? 575  LEU A CD1   1 
ATOM   1426  C  CD2   . LEU A 1  311 ? 177.307 132.515 188.944 1.00 90.10  ? 575  LEU A CD2   1 
ATOM   1427  N  N     . GLU A 1  312 ? 172.364 130.633 187.860 1.00 93.84  ? 576  GLU A N     1 
ATOM   1428  C  CA    . GLU A 1  312 ? 171.239 129.762 188.175 1.00 93.84  ? 576  GLU A CA    1 
ATOM   1429  C  C     . GLU A 1  312 ? 171.262 128.493 187.333 1.00 93.84  ? 576  GLU A C     1 
ATOM   1430  O  O     . GLU A 1  312 ? 170.862 127.426 187.812 1.00 93.84  ? 576  GLU A O     1 
ATOM   1431  C  CB    . GLU A 1  312 ? 169.924 130.518 187.978 1.00 93.84  ? 576  GLU A CB    1 
ATOM   1432  C  CG    . GLU A 1  312 ? 168.696 129.816 188.539 1.00 93.84  ? 576  GLU A CG    1 
ATOM   1433  C  CD    . GLU A 1  312 ? 168.091 128.821 187.568 1.00 93.84  ? 576  GLU A CD    1 
ATOM   1434  O  OE1   . GLU A 1  312 ? 168.228 129.026 186.344 1.00 93.84  ? 576  GLU A OE1   1 
ATOM   1435  O  OE2   . GLU A 1  312 ? 167.480 127.834 188.031 1.00 93.84  ? 576  GLU A OE2   1 
ATOM   1436  N  N     . GLY A 1  313 ? 171.735 128.581 186.088 1.00 89.50  ? 577  GLY A N     1 
ATOM   1437  C  CA    . GLY A 1  313 ? 171.851 127.383 185.272 1.00 89.50  ? 577  GLY A CA    1 
ATOM   1438  C  C     . GLY A 1  313 ? 172.878 126.413 185.823 1.00 89.50  ? 577  GLY A C     1 
ATOM   1439  O  O     . GLY A 1  313 ? 172.652 125.200 185.852 1.00 89.50  ? 577  GLY A O     1 
ATOM   1440  N  N     . MET A 1  314 ? 174.023 126.935 186.268 1.00 90.01  ? 578  MET A N     1 
ATOM   1441  C  CA    . MET A 1  314 ? 175.030 126.076 186.883 1.00 90.01  ? 578  MET A CA    1 
ATOM   1442  C  C     . MET A 1  314 ? 174.522 125.482 188.190 1.00 90.01  ? 578  MET A C     1 
ATOM   1443  O  O     . MET A 1  314 ? 174.813 124.323 188.508 1.00 90.01  ? 578  MET A O     1 
ATOM   1444  C  CB    . MET A 1  314 ? 176.323 126.857 187.118 1.00 90.01  ? 578  MET A CB    1 
ATOM   1445  C  CG    . MET A 1  314 ? 177.047 127.254 185.845 1.00 90.01  ? 578  MET A CG    1 
ATOM   1446  S  SD    . MET A 1  314 ? 178.612 128.084 186.175 1.00 90.01  ? 578  MET A SD    1 
ATOM   1447  C  CE    . MET A 1  314 ? 178.029 129.680 186.734 1.00 90.01  ? 578  MET A CE    1 
ATOM   1448  N  N     . ARG A 1  315 ? 173.725 126.250 188.924 1.00 91.71  ? 579  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1  315 ? 173.173 125.777 190.189 1.00 91.71  ? 579  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1  315 ? 172.092 124.719 189.974 1.00 91.71  ? 579  ARG A C     1 
ATOM   1451  O  O     . ARG A 1  315 ? 171.859 123.876 190.838 1.00 91.71  ? 579  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1  315 ? 172.613 126.944 191.001 1.00 91.71  ? 579  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1  315 ? 173.677 127.758 191.717 1.00 91.71  ? 579  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1  315 ? 173.062 128.695 192.741 1.00 91.71  ? 579  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1  315 ? 172.082 129.595 192.141 1.00 91.71  ? 579  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1  315 ? 172.227 130.914 192.067 1.00 91.71  ? 579  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1  315 ? 171.284 131.655 191.503 1.00 91.71  ? 579  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1  315 ? 173.315 131.492 192.555 1.00 91.71  ? 579  ARG A NH2   1 
ATOM   1459  N  N     . SER A 1  316 ? 171.436 124.767 188.820 1.00 91.45  ? 580  SER A N     1 
ATOM   1460  C  CA    . SER A 1  316 ? 170.383 123.813 188.495 1.00 91.45  ? 580  SER A CA    1 
ATOM   1461  C  C     . SER A 1  316 ? 170.903 122.551 187.820 1.00 91.45  ? 580  SER A C     1 
ATOM   1462  O  O     . SER A 1  316 ? 170.117 121.627 187.585 1.00 91.45  ? 580  SER A O     1 
ATOM   1463  C  CB    . SER A 1  316 ? 169.334 124.477 187.600 1.00 91.45  ? 580  SER A CB    1 
ATOM   1464  O  OG    . SER A 1  316 ? 169.883 124.817 186.339 1.00 91.45  ? 580  SER A OG    1 
ATOM   1465  N  N     . GLN A 1  317 ? 172.194 122.486 187.498 1.00 93.99  ? 581  GLN A N     1 
ATOM   1466  C  CA    . GLN A 1  317 ? 172.784 121.321 186.853 1.00 93.99  ? 581  GLN A CA    1 
ATOM   1467  C  C     . GLN A 1  317 ? 173.703 120.537 187.780 1.00 93.99  ? 581  GLN A C     1 
ATOM   1468  O  O     . GLN A 1  317 ? 174.601 119.838 187.296 1.00 93.99  ? 581  GLN A O     1 
ATOM   1469  C  CB    . GLN A 1  317 ? 173.544 121.744 185.594 1.00 93.99  ? 581  GLN A CB    1 
ATOM   1470  C  CG    . GLN A 1  317 ? 172.661 122.321 184.501 1.00 93.99  ? 581  GLN A CG    1 
ATOM   1471  C  CD    . GLN A 1  317 ? 171.714 121.294 183.921 1.00 93.99  ? 581  GLN A CD    1 
ATOM   1472  O  OE1   . GLN A 1  317 ? 172.075 120.130 183.750 1.00 93.99  ? 581  GLN A OE1   1 
ATOM   1473  N  NE2   . GLN A 1  317 ? 170.494 121.719 183.610 1.00 93.99  ? 581  GLN A NE2   1 
ATOM   1474  N  N     . ASP A 1  318 ? 173.501 120.636 189.096 1.00 97.87  ? 582  ASP A N     1 
ATOM   1475  C  CA    . ASP A 1  318 ? 174.318 119.938 190.092 1.00 97.87  ? 582  ASP A CA    1 
ATOM   1476  C  C     . ASP A 1  318 ? 175.793 120.315 189.964 1.00 97.87  ? 582  ASP A C     1 
ATOM   1477  O  O     . ASP A 1  318 ? 176.685 119.493 190.185 1.00 97.87  ? 582  ASP A O     1 
ATOM   1478  C  CB    . ASP A 1  318 ? 174.130 118.418 189.998 1.00 97.87  ? 582  ASP A CB    1 
ATOM   1479  C  CG    . ASP A 1  318 ? 174.625 117.683 191.235 1.00 97.87  ? 582  ASP A CG    1 
ATOM   1480  O  OD1   . ASP A 1  318 ? 175.093 118.345 192.185 1.00 97.87  ? 582  ASP A OD1   1 
ATOM   1481  O  OD2   . ASP A 1  318 ? 174.550 116.436 191.251 1.00 97.87  ? 582  ASP A OD2   1 
ATOM   1482  N  N     . LEU A 1  319 ? 176.058 121.563 189.593 1.00 98.40  ? 583  LEU A N     1 
ATOM   1483  C  CA    . LEU A 1  319 ? 177.411 122.082 189.474 1.00 98.40  ? 583  LEU A CA    1 
ATOM   1484  C  C     . LEU A 1  319 ? 177.610 123.216 190.468 1.00 98.40  ? 583  LEU A C     1 
ATOM   1485  O  O     . LEU A 1  319 ? 176.702 124.021 190.695 1.00 98.40  ? 583  LEU A O     1 
ATOM   1486  C  CB    . LEU A 1  319 ? 177.687 122.582 188.056 1.00 98.40  ? 583  LEU A CB    1 
ATOM   1487  C  CG    . LEU A 1  319 ? 177.669 121.526 186.952 1.00 98.40  ? 583  LEU A CG    1 
ATOM   1488  C  CD1   . LEU A 1  319 ? 177.806 122.181 185.590 1.00 98.40  ? 583  LEU A CD1   1 
ATOM   1489  C  CD2   . LEU A 1  319 ? 178.770 120.501 187.168 1.00 98.40  ? 583  LEU A CD2   1 
ATOM   1490  N  N     . ASP A 1  320 ? 178.800 123.275 191.058 1.00 104.43 ? 584  ASP A N     1 
ATOM   1491  C  CA    . ASP A 1  320 ? 179.121 124.354 191.982 1.00 104.43 ? 584  ASP A CA    1 
ATOM   1492  C  C     . ASP A 1  320 ? 179.165 125.691 191.252 1.00 104.43 ? 584  ASP A C     1 
ATOM   1493  O  O     . ASP A 1  320 ? 179.545 125.765 190.080 1.00 104.43 ? 584  ASP A O     1 
ATOM   1494  C  CB    . ASP A 1  320 ? 180.452 124.071 192.679 1.00 104.43 ? 584  ASP A CB    1 
ATOM   1495  C  CG    . ASP A 1  320 ? 181.597 123.852 191.701 1.00 104.43 ? 584  ASP A CG    1 
ATOM   1496  O  OD1   . ASP A 1  320 ? 181.351 123.803 190.478 1.00 104.43 ? 584  ASP A OD1   1 
ATOM   1497  O  OD2   . ASP A 1  320 ? 182.753 123.730 192.157 1.00 104.43 ? 584  ASP A OD2   1 
ATOM   1498  N  N     . ASP A 1  321 ? 178.769 126.756 191.950 1.00 106.58 ? 585  ASP A N     1 
ATOM   1499  C  CA    . ASP A 1  321 ? 178.675 128.084 191.358 1.00 106.58 ? 585  ASP A CA    1 
ATOM   1500  C  C     . ASP A 1  321 ? 179.976 128.873 191.454 1.00 106.58 ? 585  ASP A C     1 
ATOM   1501  O  O     . ASP A 1  321 ? 179.963 130.102 191.302 1.00 106.58 ? 585  ASP A O     1 
ATOM   1502  C  CB    . ASP A 1  321 ? 177.525 128.863 192.000 1.00 106.58 ? 585  ASP A CB    1 
ATOM   1503  C  CG    . ASP A 1  321 ? 177.694 129.025 193.499 1.00 106.58 ? 585  ASP A CG    1 
ATOM   1504  O  OD1   . ASP A 1  321 ? 178.669 128.480 194.057 1.00 106.58 ? 585  ASP A OD1   1 
ATOM   1505  O  OD2   . ASP A 1  321 ? 176.848 129.699 194.123 1.00 106.58 ? 585  ASP A OD2   1 
ATOM   1506  N  N     . TYR A 1  322 ? 181.102 128.205 191.709 1.00 101.23 ? 586  TYR A N     1 
ATOM   1507  C  CA    . TYR A 1  322 ? 182.399 128.869 191.743 1.00 101.23 ? 586  TYR A CA    1 
ATOM   1508  C  C     . TYR A 1  322 ? 183.397 128.248 190.774 1.00 101.23 ? 586  TYR A C     1 
ATOM   1509  O  O     . TYR A 1  322 ? 184.588 128.576 190.833 1.00 101.23 ? 586  TYR A O     1 
ATOM   1510  C  CB    . TYR A 1  322 ? 182.973 128.866 193.164 1.00 101.23 ? 586  TYR A CB    1 
ATOM   1511  C  CG    . TYR A 1  322 ? 183.283 127.495 193.724 1.00 101.23 ? 586  TYR A CG    1 
ATOM   1512  C  CD1   . TYR A 1  322 ? 182.330 126.786 194.442 1.00 101.23 ? 586  TYR A CD1   1 
ATOM   1513  C  CD2   . TYR A 1  322 ? 184.534 126.915 193.548 1.00 101.23 ? 586  TYR A CD2   1 
ATOM   1514  C  CE1   . TYR A 1  322 ? 182.610 125.537 194.963 1.00 101.23 ? 586  TYR A CE1   1 
ATOM   1515  C  CE2   . TYR A 1  322 ? 184.822 125.666 194.062 1.00 101.23 ? 586  TYR A CE2   1 
ATOM   1516  C  CZ    . TYR A 1  322 ? 183.857 124.981 194.769 1.00 101.23 ? 586  TYR A CZ    1 
ATOM   1517  O  OH    . TYR A 1  322 ? 184.136 123.737 195.285 1.00 101.23 ? 586  TYR A OH    1 
ATOM   1518  N  N     . LEU A 1  323 ? 182.948 127.363 189.890 1.00 91.31  ? 587  LEU A N     1 
ATOM   1519  C  CA    . LEU A 1  323 ? 183.838 126.772 188.902 1.00 91.31  ? 587  LEU A CA    1 
ATOM   1520  C  C     . LEU A 1  323 ? 184.179 127.789 187.819 1.00 91.31  ? 587  LEU A C     1 
ATOM   1521  O  O     . LEU A 1  323 ? 183.379 128.665 187.482 1.00 91.31  ? 587  LEU A O     1 
ATOM   1522  C  CB    . LEU A 1  323 ? 183.192 125.531 188.285 1.00 91.31  ? 587  LEU A CB    1 
ATOM   1523  C  CG    . LEU A 1  323 ? 184.010 124.706 187.290 1.00 91.31  ? 587  LEU A CG    1 
ATOM   1524  C  CD1   . LEU A 1  323 ? 185.250 124.131 187.956 1.00 91.31  ? 587  LEU A CD1   1 
ATOM   1525  C  CD2   . LEU A 1  323 ? 183.156 123.597 186.698 1.00 91.31  ? 587  LEU A CD2   1 
ATOM   1526  N  N     . ASN A 1  324 ? 185.388 127.667 187.273 1.00 86.61  ? 588  ASN A N     1 
ATOM   1527  C  CA    . ASN A 1  324 ? 185.885 128.588 186.256 1.00 86.61  ? 588  ASN A CA    1 
ATOM   1528  C  C     . ASN A 1  324 ? 186.327 127.828 185.014 1.00 86.61  ? 588  ASN A C     1 
ATOM   1529  O  O     . ASN A 1  324 ? 187.390 128.095 184.444 1.00 86.61  ? 588  ASN A O     1 
ATOM   1530  C  CB    . ASN A 1  324 ? 187.023 129.451 186.803 1.00 86.61  ? 588  ASN A CB    1 
ATOM   1531  C  CG    . ASN A 1  324 ? 188.200 128.629 187.302 1.00 86.61  ? 588  ASN A CG    1 
ATOM   1532  O  OD1   . ASN A 1  324 ? 188.223 127.405 187.177 1.00 86.61  ? 588  ASN A OD1   1 
ATOM   1533  N  ND2   . ASN A 1  324 ? 189.190 129.307 187.870 1.00 86.61  ? 588  ASN A ND2   1 
ATOM   1534  N  N     . GLY A 1  325 ? 185.513 126.872 184.575 1.00 82.94  ? 589  GLY A N     1 
ATOM   1535  C  CA    . GLY A 1  325 ? 185.832 126.074 183.417 1.00 82.94  ? 589  GLY A CA    1 
ATOM   1536  C  C     . GLY A 1  325 ? 185.793 126.873 182.131 1.00 82.94  ? 589  GLY A C     1 
ATOM   1537  O  O     . GLY A 1  325 ? 185.246 127.979 182.072 1.00 82.94  ? 589  GLY A O     1 
ATOM   1538  N  N     . PRO A 1  326 ? 186.377 126.321 181.070 1.00 77.63  ? 590  PRO A N     1 
ATOM   1539  C  CA    . PRO A 1  326 ? 186.383 127.021 179.779 1.00 77.63  ? 590  PRO A CA    1 
ATOM   1540  C  C     . PRO A 1  326 ? 185.036 126.964 179.076 1.00 77.63  ? 590  PRO A C     1 
ATOM   1541  O  O     . PRO A 1  326 ? 184.801 126.080 178.246 1.00 77.63  ? 590  PRO A O     1 
ATOM   1542  C  CB    . PRO A 1  326 ? 187.464 126.276 178.986 1.00 77.63  ? 590  PRO A CB    1 
ATOM   1543  C  CG    . PRO A 1  326 ? 187.473 124.906 179.574 1.00 77.63  ? 590  PRO A CG    1 
ATOM   1544  C  CD    . PRO A 1  326 ? 187.164 125.076 181.034 1.00 77.63  ? 590  PRO A CD    1 
ATOM   1545  N  N     . PHE A 1  327 ? 184.144 127.892 179.415 1.00 75.34  ? 591  PHE A N     1 
ATOM   1546  C  CA    . PHE A 1  327 ? 182.829 127.950 178.794 1.00 75.34  ? 591  PHE A CA    1 
ATOM   1547  C  C     . PHE A 1  327 ? 182.946 128.097 177.278 1.00 75.34  ? 591  PHE A C     1 
ATOM   1548  O  O     . PHE A 1  327 ? 183.953 128.569 176.745 1.00 75.34  ? 591  PHE A O     1 
ATOM   1549  C  CB    . PHE A 1  327 ? 182.019 129.113 179.364 1.00 75.34  ? 591  PHE A CB    1 
ATOM   1550  C  CG    . PHE A 1  327 ? 181.657 128.951 180.811 1.00 75.34  ? 591  PHE A CG    1 
ATOM   1551  C  CD1   . PHE A 1  327 ? 180.577 128.170 181.184 1.00 75.34  ? 591  PHE A CD1   1 
ATOM   1552  C  CD2   . PHE A 1  327 ? 182.393 129.584 181.797 1.00 75.34  ? 591  PHE A CD2   1 
ATOM   1553  C  CE1   . PHE A 1  327 ? 180.240 128.022 182.515 1.00 75.34  ? 591  PHE A CE1   1 
ATOM   1554  C  CE2   . PHE A 1  327 ? 182.060 129.438 183.129 1.00 75.34  ? 591  PHE A CE2   1 
ATOM   1555  C  CZ    . PHE A 1  327 ? 180.983 128.656 183.488 1.00 75.34  ? 591  PHE A CZ    1 
ATOM   1556  N  N     . THR A 1  328 ? 181.888 127.685 176.581 1.00 69.88  ? 592  THR A N     1 
ATOM   1557  C  CA    . THR A 1  328 ? 181.841 127.734 175.119 1.00 69.88  ? 592  THR A CA    1 
ATOM   1558  C  C     . THR A 1  328 ? 180.552 128.445 174.718 1.00 69.88  ? 592  THR A C     1 
ATOM   1559  O  O     . THR A 1  328 ? 179.460 127.888 174.860 1.00 69.88  ? 592  THR A O     1 
ATOM   1560  C  CB    . THR A 1  328 ? 181.915 126.337 174.514 1.00 69.88  ? 592  THR A CB    1 
ATOM   1561  O  OG1   . THR A 1  328 ? 183.140 125.709 174.911 1.00 69.88  ? 592  THR A OG1   1 
ATOM   1562  C  CG2   . THR A 1  328 ? 181.860 126.413 172.998 1.00 69.88  ? 592  THR A CG2   1 
ATOM   1563  N  N     . VAL A 1  329 ? 180.683 129.668 174.220 1.00 66.98  ? 593  VAL A N     1 
ATOM   1564  C  CA    . VAL A 1  329 ? 179.538 130.492 173.852 1.00 66.98  ? 593  VAL A CA    1 
ATOM   1565  C  C     . VAL A 1  329 ? 179.303 130.387 172.352 1.00 66.98  ? 593  VAL A C     1 
ATOM   1566  O  O     . VAL A 1  329 ? 180.243 130.457 171.553 1.00 66.98  ? 593  VAL A O     1 
ATOM   1567  C  CB    . VAL A 1  329 ? 179.761 131.954 174.282 1.00 66.98  ? 593  VAL A CB    1 
ATOM   1568  C  CG1   . VAL A 1  329 ? 178.609 132.831 173.820 1.00 66.98  ? 593  VAL A CG1   1 
ATOM   1569  C  CG2   . VAL A 1  329 ? 179.932 132.040 175.788 1.00 66.98  ? 593  VAL A CG2   1 
ATOM   1570  N  N     . VAL A 1  330 ? 178.040 130.216 171.968 1.00 66.72  ? 594  VAL A N     1 
ATOM   1571  C  CA    . VAL A 1  330 ? 177.630 130.150 170.570 1.00 66.72  ? 594  VAL A CA    1 
ATOM   1572  C  C     . VAL A 1  330 ? 176.746 131.355 170.282 1.00 66.72  ? 594  VAL A C     1 
ATOM   1573  O  O     . VAL A 1  330 ? 175.784 131.612 171.015 1.00 66.72  ? 594  VAL A O     1 
ATOM   1574  C  CB    . VAL A 1  330 ? 176.889 128.837 170.258 1.00 66.72  ? 594  VAL A CB    1 
ATOM   1575  C  CG1   . VAL A 1  330 ? 176.420 128.824 168.816 1.00 66.72  ? 594  VAL A CG1   1 
ATOM   1576  C  CG2   . VAL A 1  330 ? 177.782 127.642 170.546 1.00 66.72  ? 594  VAL A CG2   1 
ATOM   1577  N  N     . VAL A 1  331 ? 177.071 132.092 169.222 1.00 68.52  ? 595  VAL A N     1 
ATOM   1578  C  CA    . VAL A 1  331 ? 176.389 133.337 168.892 1.00 68.52  ? 595  VAL A CA    1 
ATOM   1579  C  C     . VAL A 1  331 ? 175.882 133.269 167.458 1.00 68.52  ? 595  VAL A C     1 
ATOM   1580  O  O     . VAL A 1  331 ? 176.590 132.802 166.559 1.00 68.52  ? 595  VAL A O     1 
ATOM   1581  C  CB    . VAL A 1  331 ? 177.316 134.557 169.087 1.00 68.52  ? 595  VAL A CB    1 
ATOM   1582  C  CG1   . VAL A 1  331 ? 176.621 135.840 168.658 1.00 68.52  ? 595  VAL A CG1   1 
ATOM   1583  C  CG2   . VAL A 1  331 ? 177.773 134.653 170.534 1.00 68.52  ? 595  VAL A CG2   1 
ATOM   1584  N  N     . LYS A 1  332 ? 174.676 133.785 167.247 1.00 70.83  ? 596  LYS A N     1 
ATOM   1585  C  CA    . LYS A 1  332 ? 174.072 133.834 165.925 1.00 70.83  ? 596  LYS A CA    1 
ATOM   1586  C  C     . LYS A 1  332 ? 174.192 135.258 165.397 1.00 70.83  ? 596  LYS A C     1 
ATOM   1587  O  O     . LYS A 1  332 ? 174.099 136.219 166.157 1.00 70.83  ? 596  LYS A O     1 
ATOM   1588  C  CB    . LYS A 1  332 ? 172.607 133.413 165.982 1.00 70.83  ? 596  LYS A CB    1 
ATOM   1589  C  CG    . LYS A 1  332 ? 171.824 133.733 164.721 1.00 70.83  ? 596  LYS A CG    1 
ATOM   1590  C  CD    . LYS A 1  332 ? 170.435 133.119 164.765 1.00 70.83  ? 596  LYS A CD    1 
ATOM   1591  C  CE    . LYS A 1  332 ? 169.563 133.808 165.799 1.00 70.83  ? 596  LYS A CE    1 
ATOM   1592  N  NZ    . LYS A 1  332 ? 168.115 133.659 165.492 1.00 70.83  ? 596  LYS A NZ    1 
ATOM   1593  N  N     . GLU A 1  333 ? 174.394 135.386 164.092 1.00 75.87  ? 597  GLU A N     1 
ATOM   1594  C  CA    . GLU A 1  333 ? 174.556 136.678 163.444 1.00 75.87  ? 597  GLU A CA    1 
ATOM   1595  C  C     . GLU A 1  333 ? 173.470 136.870 162.395 1.00 75.87  ? 597  GLU A C     1 
ATOM   1596  O  O     . GLU A 1  333 ? 173.005 135.910 161.776 1.00 75.87  ? 597  GLU A O     1 
ATOM   1597  C  CB    . GLU A 1  333 ? 175.940 136.810 162.798 1.00 75.87  ? 597  GLU A CB    1 
ATOM   1598  C  CG    . GLU A 1  333 ? 177.077 136.851 163.802 1.00 75.87  ? 597  GLU A CG    1 
ATOM   1599  C  CD    . GLU A 1  333 ? 178.435 136.970 163.143 1.00 75.87  ? 597  GLU A CD    1 
ATOM   1600  O  OE1   . GLU A 1  333 ? 178.504 136.896 161.898 1.00 75.87  ? 597  GLU A OE1   1 
ATOM   1601  O  OE2   . GLU A 1  333 ? 179.434 137.137 163.872 1.00 75.87  ? 597  GLU A OE2   1 
ATOM   1602  N  N     . SER A 1  334 ? 173.071 138.125 162.202 1.00 74.75  ? 598  SER A N     1 
ATOM   1603  C  CA    . SER A 1  334 ? 172.016 138.456 161.256 1.00 74.75  ? 598  SER A CA    1 
ATOM   1604  C  C     . SER A 1  334 ? 172.267 139.843 160.686 1.00 74.75  ? 598  SER A C     1 
ATOM   1605  O  O     . SER A 1  334 ? 172.861 140.703 161.342 1.00 74.75  ? 598  SER A O     1 
ATOM   1606  C  CB    . SER A 1  334 ? 170.632 138.398 161.914 1.00 74.75  ? 598  SER A CB    1 
ATOM   1607  O  OG    . SER A 1  334 ? 170.327 137.082 162.342 1.00 74.75  ? 598  SER A OG    1 
ATOM   1608  N  N     . CYS A 1  335 ? 171.802 140.051 159.455 1.00 75.90  ? 599  CYS A N     1 
ATOM   1609  C  CA    . CYS A 1  335 ? 171.950 141.334 158.778 1.00 75.90  ? 599  CYS A CA    1 
ATOM   1610  C  C     . CYS A 1  335 ? 170.969 141.387 157.619 1.00 75.90  ? 599  CYS A C     1 
ATOM   1611  O  O     . CYS A 1  335 ? 170.817 140.402 156.891 1.00 75.90  ? 599  CYS A O     1 
ATOM   1612  C  CB    . CYS A 1  335 ? 173.383 141.534 158.274 1.00 75.90  ? 599  CYS A CB    1 
ATOM   1613  S  SG    . CYS A 1  335 ? 173.675 143.117 157.454 1.00 75.90  ? 599  CYS A SG    1 
ATOM   1614  N  N     . ASP A 1  336 ? 170.310 142.531 157.453 1.00 77.54  ? 600  ASP A N     1 
ATOM   1615  C  CA    . ASP A 1  336 ? 169.359 142.713 156.367 1.00 77.54  ? 600  ASP A CA    1 
ATOM   1616  C  C     . ASP A 1  336 ? 169.138 144.201 156.149 1.00 77.54  ? 600  ASP A C     1 
ATOM   1617  O  O     . ASP A 1  336 ? 169.068 144.970 157.110 1.00 77.54  ? 600  ASP A O     1 
ATOM   1618  C  CB    . ASP A 1  336 ? 168.027 142.016 156.662 1.00 77.54  ? 600  ASP A CB    1 
ATOM   1619  C  CG    . ASP A 1  336 ? 167.066 142.079 155.491 1.00 77.54  ? 600  ASP A CG    1 
ATOM   1620  O  OD1   . ASP A 1  336 ? 167.284 141.347 154.503 1.00 77.54  ? 600  ASP A OD1   1 
ATOM   1621  O  OD2   . ASP A 1  336 ? 166.096 142.861 155.558 1.00 77.54  ? 600  ASP A OD2   1 
ATOM   1622  N  N     . GLY A 1  337 ? 169.026 144.594 154.883 1.00 76.02  ? 601  GLY A N     1 
ATOM   1623  C  CA    . GLY A 1  337 ? 168.781 145.982 154.537 1.00 76.02  ? 601  GLY A CA    1 
ATOM   1624  C  C     . GLY A 1  337 ? 167.292 146.286 154.498 1.00 76.02  ? 601  GLY A C     1 
ATOM   1625  O  O     . GLY A 1  337 ? 166.498 145.511 153.970 1.00 76.02  ? 601  GLY A O     1 
ATOM   1626  N  N     . MET A 1  338 ? 166.928 147.429 155.067 1.00 75.83  ? 602  MET A N     1 
ATOM   1627  C  CA    . MET A 1  338 ? 165.537 147.844 155.140 1.00 75.83  ? 602  MET A CA    1 
ATOM   1628  C  C     . MET A 1  338 ? 165.191 148.695 153.919 1.00 75.83  ? 602  MET A C     1 
ATOM   1629  O  O     . MET A 1  338 ? 165.988 148.842 152.988 1.00 75.83  ? 602  MET A O     1 
ATOM   1630  C  CB    . MET A 1  338 ? 165.280 148.583 156.450 1.00 75.83  ? 602  MET A CB    1 
ATOM   1631  C  CG    . MET A 1  338 ? 165.448 147.714 157.684 1.00 75.83  ? 602  MET A CG    1 
ATOM   1632  S  SD    . MET A 1  338 ? 165.224 148.634 159.215 1.00 75.83  ? 602  MET A SD    1 
ATOM   1633  C  CE    . MET A 1  338 ? 163.461 148.933 159.160 1.00 75.83  ? 602  MET A CE    1 
ATOM   1634  N  N     . GLY A 1  339 ? 163.991 149.268 153.912 1.00 73.23  ? 603  GLY A N     1 
ATOM   1635  C  CA    . GLY A 1  339 ? 163.553 150.080 152.792 1.00 73.23  ? 603  GLY A CA    1 
ATOM   1636  C  C     . GLY A 1  339 ? 162.509 151.081 153.231 1.00 73.23  ? 603  GLY A C     1 
ATOM   1637  O  O     . GLY A 1  339 ? 161.968 151.008 154.336 1.00 73.23  ? 603  GLY A O     1 
ATOM   1638  N  N     . ASP A 1  340 ? 162.233 152.028 152.332 1.00 77.74  ? 604  ASP A N     1 
ATOM   1639  C  CA    . ASP A 1  340 ? 161.273 153.104 152.581 1.00 77.74  ? 604  ASP A CA    1 
ATOM   1640  C  C     . ASP A 1  340 ? 161.643 153.881 153.843 1.00 77.74  ? 604  ASP A C     1 
ATOM   1641  O  O     . ASP A 1  340 ? 160.800 154.182 154.690 1.00 77.74  ? 604  ASP A O     1 
ATOM   1642  C  CB    . ASP A 1  340 ? 159.843 152.562 152.663 1.00 77.74  ? 604  ASP A CB    1 
ATOM   1643  C  CG    . ASP A 1  340 ? 159.330 152.066 151.325 1.00 77.74  ? 604  ASP A CG    1 
ATOM   1644  O  OD1   . ASP A 1  340 ? 159.767 152.602 150.285 1.00 77.74  ? 604  ASP A OD1   1 
ATOM   1645  O  OD2   . ASP A 1  340 ? 158.491 151.141 151.312 1.00 77.74  ? 604  ASP A OD2   1 
ATOM   1646  N  N     . VAL A 1  341 ? 162.927 154.201 153.962 1.00 74.76  ? 605  VAL A N     1 
ATOM   1647  C  CA    . VAL A 1  341 ? 163.470 154.911 155.114 1.00 74.76  ? 605  VAL A CA    1 
ATOM   1648  C  C     . VAL A 1  341 ? 163.535 156.387 154.740 1.00 74.76  ? 605  VAL A C     1 
ATOM   1649  O  O     . VAL A 1  341 ? 164.377 156.802 153.941 1.00 74.76  ? 605  VAL A O     1 
ATOM   1650  C  CB    . VAL A 1  341 ? 164.841 154.365 155.518 1.00 74.76  ? 605  VAL A CB    1 
ATOM   1651  C  CG1   . VAL A 1  341 ? 165.437 155.211 156.618 1.00 74.76  ? 605  VAL A CG1   1 
ATOM   1652  C  CG2   . VAL A 1  341 ? 164.723 152.914 155.960 1.00 74.76  ? 605  VAL A CG2   1 
ATOM   1653  N  N     . SER A 1  342 ? 162.643 157.185 155.323 1.00 74.03  ? 606  SER A N     1 
ATOM   1654  C  CA    . SER A 1  342 ? 162.563 158.596 154.975 1.00 74.03  ? 606  SER A CA    1 
ATOM   1655  C  C     . SER A 1  342 ? 163.819 159.341 155.413 1.00 74.03  ? 606  SER A C     1 
ATOM   1656  O  O     . SER A 1  342 ? 164.474 158.983 156.396 1.00 74.03  ? 606  SER A O     1 
ATOM   1657  C  CB    . SER A 1  342 ? 161.329 159.232 155.617 1.00 74.03  ? 606  SER A CB    1 
ATOM   1658  O  OG    . SER A 1  342 ? 160.138 158.662 155.105 1.00 74.03  ? 606  SER A OG    1 
ATOM   1659  N  N     . GLU A 1  343 ? 164.148 160.390 154.668 1.00 79.19  ? 607  GLU A N     1 
ATOM   1660  C  CA    . GLU A 1  343 ? 165.297 161.238 154.947 1.00 79.19  ? 607  GLU A CA    1 
ATOM   1661  C  C     . GLU A 1  343 ? 164.836 162.548 155.575 1.00 79.19  ? 607  GLU A C     1 
ATOM   1662  O  O     . GLU A 1  343 ? 163.729 163.027 155.316 1.00 79.19  ? 607  GLU A O     1 
ATOM   1663  C  CB    . GLU A 1  343 ? 166.087 161.514 153.665 1.00 79.19  ? 607  GLU A CB    1 
ATOM   1664  C  CG    . GLU A 1  343 ? 167.374 162.300 153.863 1.00 79.19  ? 607  GLU A CG    1 
ATOM   1665  C  CD    . GLU A 1  343 ? 168.138 162.503 152.571 1.00 79.19  ? 607  GLU A CD    1 
ATOM   1666  O  OE1   . GLU A 1  343 ? 167.653 162.046 151.514 1.00 79.19  ? 607  GLU A OE1   1 
ATOM   1667  O  OE2   . GLU A 1  343 ? 169.223 163.119 152.610 1.00 79.19  ? 607  GLU A OE2   1 
ATOM   1668  N  N     . LYS A 1  344 ? 165.695 163.123 156.409 1.00 76.50  ? 608  LYS A N     1 
ATOM   1669  C  CA    . LYS A 1  344 ? 165.396 164.364 157.105 1.00 76.50  ? 608  LYS A CA    1 
ATOM   1670  C  C     . LYS A 1  344 ? 166.018 165.555 156.385 1.00 76.50  ? 608  LYS A C     1 
ATOM   1671  O  O     . LYS A 1  344 ? 166.964 165.420 155.606 1.00 76.50  ? 608  LYS A O     1 
ATOM   1672  C  CB    . LYS A 1  344 ? 165.899 164.308 158.549 1.00 76.50  ? 608  LYS A CB    1 
ATOM   1673  C  CG    . LYS A 1  344 ? 165.168 163.305 159.422 1.00 76.50  ? 608  LYS A CG    1 
ATOM   1674  C  CD    . LYS A 1  344 ? 165.714 163.307 160.839 1.00 76.50  ? 608  LYS A CD    1 
ATOM   1675  C  CE    . LYS A 1  344 ? 164.908 162.387 161.739 1.00 76.50  ? 608  LYS A CE    1 
ATOM   1676  N  NZ    . LYS A 1  344 ? 165.050 160.961 161.340 1.00 76.50  ? 608  LYS A NZ    1 
ATOM   1677  N  N     . HIS A 1  345 ? 165.468 166.733 156.661 1.00 74.55  ? 609  HIS A N     1 
ATOM   1678  C  CA    . HIS A 1  345 ? 166.004 167.977 156.125 1.00 74.55  ? 609  HIS A CA    1 
ATOM   1679  C  C     . HIS A 1  345 ? 167.257 168.360 156.911 1.00 74.55  ? 609  HIS A C     1 
ATOM   1680  O  O     . HIS A 1  345 ? 167.739 167.622 157.774 1.00 74.55  ? 609  HIS A O     1 
ATOM   1681  C  CB    . HIS A 1  345 ? 164.948 169.077 156.176 1.00 74.55  ? 609  HIS A CB    1 
ATOM   1682  C  CG    . HIS A 1  345 ? 163.764 168.825 155.295 1.00 74.55  ? 609  HIS A CG    1 
ATOM   1683  N  ND1   . HIS A 1  345 ? 163.810 168.975 153.926 1.00 74.55  ? 609  HIS A ND1   1 
ATOM   1684  C  CD2   . HIS A 1  345 ? 162.499 168.442 155.588 1.00 74.55  ? 609  HIS A CD2   1 
ATOM   1685  C  CE1   . HIS A 1  345 ? 162.627 168.689 153.413 1.00 74.55  ? 609  HIS A CE1   1 
ATOM   1686  N  NE2   . HIS A 1  345 ? 161.813 168.363 154.401 1.00 74.55  ? 609  HIS A NE2   1 
ATOM   1687  N  N     . GLY A 1  346 ? 167.800 169.536 156.614 1.00 78.41  ? 610  GLY A N     1 
ATOM   1688  C  CA    . GLY A 1  346 ? 168.936 170.056 157.341 1.00 78.41  ? 610  GLY A CA    1 
ATOM   1689  C  C     . GLY A 1  346 ? 170.262 169.799 156.647 1.00 78.41  ? 610  GLY A C     1 
ATOM   1690  O  O     . GLY A 1  346 ? 170.348 169.168 155.591 1.00 78.41  ? 610  GLY A O     1 
ATOM   1691  N  N     . SER A 1  347 ? 171.320 170.307 157.272 1.00 80.80  ? 611  SER A N     1 
ATOM   1692  C  CA    . SER A 1  347 ? 172.660 170.198 156.718 1.00 80.80  ? 611  SER A CA    1 
ATOM   1693  C  C     . SER A 1  347 ? 173.183 168.770 156.864 1.00 80.80  ? 611  SER A C     1 
ATOM   1694  O  O     . SER A 1  347 ? 172.540 167.892 157.446 1.00 80.80  ? 611  SER A O     1 
ATOM   1695  C  CB    . SER A 1  347 ? 173.596 171.192 157.400 1.00 80.80  ? 611  SER A CB    1 
ATOM   1696  O  OG    . SER A 1  347 ? 173.772 170.868 158.768 1.00 80.80  ? 611  SER A OG    1 
ATOM   1697  N  N     . GLY A 1  348 ? 174.376 168.542 156.324 1.00 82.63  ? 612  GLY A N     1 
ATOM   1698  C  CA    . GLY A 1  348 ? 174.996 167.240 156.362 1.00 82.63  ? 612  GLY A CA    1 
ATOM   1699  C  C     . GLY A 1  348 ? 175.133 166.637 154.980 1.00 82.63  ? 612  GLY A C     1 
ATOM   1700  O  O     . GLY A 1  348 ? 174.867 167.286 153.964 1.00 82.63  ? 612  GLY A O     1 
ATOM   1701  N  N     . PRO A 1  349 ? 175.554 165.378 154.916 1.00 85.60  ? 613  PRO A N     1 
ATOM   1702  C  CA    . PRO A 1  349 ? 175.691 164.700 153.626 1.00 85.60  ? 613  PRO A CA    1 
ATOM   1703  C  C     . PRO A 1  349 ? 174.350 164.213 153.092 1.00 85.60  ? 613  PRO A C     1 
ATOM   1704  O  O     . PRO A 1  349 ? 173.369 164.061 153.824 1.00 85.60  ? 613  PRO A O     1 
ATOM   1705  C  CB    . PRO A 1  349 ? 176.608 163.514 153.954 1.00 85.60  ? 613  PRO A CB    1 
ATOM   1706  C  CG    . PRO A 1  349 ? 176.320 163.220 155.385 1.00 85.60  ? 613  PRO A CG    1 
ATOM   1707  C  CD    . PRO A 1  349 ? 176.036 164.548 156.034 1.00 85.60  ? 613  PRO A CD    1 
ATOM   1708  N  N     . ALA A 1  350 ? 174.328 163.969 151.784 1.00 84.42  ? 614  ALA A N     1 
ATOM   1709  C  CA    . ALA A 1  350 ? 173.140 163.463 151.105 1.00 84.42  ? 614  ALA A CA    1 
ATOM   1710  C  C     . ALA A 1  350 ? 173.124 161.944 151.227 1.00 84.42  ? 614  ALA A C     1 
ATOM   1711  O  O     . ALA A 1  350 ? 173.814 161.246 150.477 1.00 84.42  ? 614  ALA A O     1 
ATOM   1712  C  CB    . ALA A 1  350 ? 173.125 163.900 149.643 1.00 84.42  ? 614  ALA A CB    1 
ATOM   1713  N  N     . VAL A 1  351 ? 172.334 161.433 152.165 1.00 79.88  ? 615  VAL A N     1 
ATOM   1714  C  CA    . VAL A 1  351 ? 172.287 160.000 152.444 1.00 79.88  ? 615  VAL A CA    1 
ATOM   1715  C  C     . VAL A 1  351 ? 171.130 159.372 151.677 1.00 79.88  ? 615  VAL A C     1 
ATOM   1716  O  O     . VAL A 1  351 ? 170.130 160.050 151.399 1.00 79.88  ? 615  VAL A O     1 
ATOM   1717  C  CB    . VAL A 1  351 ? 172.164 159.735 153.953 1.00 79.88  ? 615  VAL A CB    1 
ATOM   1718  C  CG1   . VAL A 1  351 ? 173.389 160.261 154.682 1.00 79.88  ? 615  VAL A CG1   1 
ATOM   1719  C  CG2   . VAL A 1  351 ? 170.900 160.373 154.505 1.00 79.88  ? 615  VAL A CG2   1 
ATOM   1720  N  N     . PRO A 1  352 ? 171.219 158.101 151.306 1.00 76.84  ? 616  PRO A N     1 
ATOM   1721  C  CA    . PRO A 1  352 ? 170.118 157.440 150.600 1.00 76.84  ? 616  PRO A CA    1 
ATOM   1722  C  C     . PRO A 1  352 ? 168.968 157.136 151.556 1.00 76.84  ? 616  PRO A C     1 
ATOM   1723  O  O     . PRO A 1  352 ? 169.012 157.442 152.745 1.00 76.84  ? 616  PRO A O     1 
ATOM   1724  C  CB    . PRO A 1  352 ? 170.763 156.159 150.067 1.00 76.84  ? 616  PRO A CB    1 
ATOM   1725  C  CG    . PRO A 1  352 ? 171.871 155.881 151.015 1.00 76.84  ? 616  PRO A CG    1 
ATOM   1726  C  CD    . PRO A 1  352 ? 172.394 157.222 151.441 1.00 76.84  ? 616  PRO A CD    1 
ATOM   1727  N  N     . GLU A 1  353 ? 167.928 156.513 151.007 1.00 80.08  ? 617  GLU A N     1 
ATOM   1728  C  CA    . GLU A 1  353 ? 166.711 156.196 151.745 1.00 80.08  ? 617  GLU A CA    1 
ATOM   1729  C  C     . GLU A 1  353 ? 166.636 154.714 152.098 1.00 80.08  ? 617  GLU A C     1 
ATOM   1730  O  O     . GLU A 1  353 ? 165.561 154.111 152.098 1.00 80.08  ? 617  GLU A O     1 
ATOM   1731  C  CB    . GLU A 1  353 ? 165.478 156.619 150.951 1.00 80.08  ? 617  GLU A CB    1 
ATOM   1732  C  CG    . GLU A 1  353 ? 165.333 158.123 150.798 1.00 80.08  ? 617  GLU A CG    1 
ATOM   1733  C  CD    . GLU A 1  353 ? 164.105 158.512 149.999 1.00 80.08  ? 617  GLU A CD    1 
ATOM   1734  O  OE1   . GLU A 1  353 ? 163.434 157.607 149.461 1.00 80.08  ? 617  GLU A OE1   1 
ATOM   1735  O  OE2   . GLU A 1  353 ? 163.812 159.722 149.910 1.00 80.08  ? 617  GLU A OE2   1 
ATOM   1736  N  N     . LYS A 1  354 ? 167.782 154.110 152.404 1.00 76.04  ? 618  LYS A N     1 
ATOM   1737  C  CA    . LYS A 1  354 ? 167.841 152.708 152.788 1.00 76.04  ? 618  LYS A CA    1 
ATOM   1738  C  C     . LYS A 1  354 ? 168.748 152.560 154.000 1.00 76.04  ? 618  LYS A C     1 
ATOM   1739  O  O     . LYS A 1  354 ? 169.744 153.273 154.140 1.00 76.04  ? 618  LYS A O     1 
ATOM   1740  C  CB    . LYS A 1  354 ? 168.346 151.828 151.638 1.00 76.04  ? 618  LYS A CB    1 
ATOM   1741  C  CG    . LYS A 1  354 ? 167.387 151.738 150.464 1.00 76.04  ? 618  LYS A CG    1 
ATOM   1742  C  CD    . LYS A 1  354 ? 167.929 150.830 149.376 1.00 76.04  ? 618  LYS A CD    1 
ATOM   1743  C  CE    . LYS A 1  354 ? 166.978 150.761 148.194 1.00 76.04  ? 618  LYS A CE    1 
ATOM   1744  N  NZ    . LYS A 1  354 ? 167.501 149.882 147.112 1.00 76.04  ? 618  LYS A NZ    1 
ATOM   1745  N  N     . ALA A 1  355 ? 168.393 151.623 154.876 1.00 73.47  ? 619  ALA A N     1 
ATOM   1746  C  CA    . ALA A 1  355 ? 169.125 151.393 156.114 1.00 73.47  ? 619  ALA A CA    1 
ATOM   1747  C  C     . ALA A 1  355 ? 169.466 149.917 156.237 1.00 73.47  ? 619  ALA A C     1 
ATOM   1748  O  O     . ALA A 1  355 ? 168.618 149.056 155.983 1.00 73.47  ? 619  ALA A O     1 
ATOM   1749  C  CB    . ALA A 1  355 ? 168.313 151.849 157.330 1.00 73.47  ? 619  ALA A CB    1 
ATOM   1750  N  N     . VAL A 1  356 ? 170.706 149.630 156.625 1.00 72.49  ? 620  VAL A N     1 
ATOM   1751  C  CA    . VAL A 1  356 ? 171.181 148.271 156.853 1.00 72.49  ? 620  VAL A CA    1 
ATOM   1752  C  C     . VAL A 1  356 ? 171.613 148.161 158.308 1.00 72.49  ? 620  VAL A C     1 
ATOM   1753  O  O     . VAL A 1  356 ? 172.322 149.036 158.818 1.00 72.49  ? 620  VAL A O     1 
ATOM   1754  C  CB    . VAL A 1  356 ? 172.339 147.910 155.907 1.00 72.49  ? 620  VAL A CB    1 
ATOM   1755  C  CG1   . VAL A 1  356 ? 172.881 146.527 156.230 1.00 72.49  ? 620  VAL A CG1   1 
ATOM   1756  C  CG2   . VAL A 1  356 ? 171.886 147.985 154.459 1.00 72.49  ? 620  VAL A CG2   1 
ATOM   1757  N  N     . ARG A 1  357 ? 171.183 147.095 158.977 1.00 71.53  ? 621  ARG A N     1 
ATOM   1758  C  CA    . ARG A 1  357 ? 171.528 146.866 160.370 1.00 71.53  ? 621  ARG A CA    1 
ATOM   1759  C  C     . ARG A 1  357 ? 172.194 145.507 160.522 1.00 71.53  ? 621  ARG A C     1 
ATOM   1760  O  O     . ARG A 1  357 ? 171.949 144.584 159.741 1.00 71.53  ? 621  ARG A O     1 
ATOM   1761  C  CB    . ARG A 1  357 ? 170.297 146.950 161.277 1.00 71.53  ? 621  ARG A CB    1 
ATOM   1762  C  CG    . ARG A 1  357 ? 169.247 145.894 161.000 1.00 71.53  ? 621  ARG A CG    1 
ATOM   1763  C  CD    . ARG A 1  357 ? 168.068 146.050 161.940 1.00 71.53  ? 621  ARG A CD    1 
ATOM   1764  N  NE    . ARG A 1  357 ? 168.438 145.768 163.322 1.00 71.53  ? 621  ARG A NE    1 
ATOM   1765  C  CZ    . ARG A 1  357 ? 167.693 146.092 164.373 1.00 71.53  ? 621  ARG A CZ    1 
ATOM   1766  N  NH1   . ARG A 1  357 ? 166.533 146.710 164.198 1.00 71.53  ? 621  ARG A NH1   1 
ATOM   1767  N  NH2   . ARG A 1  357 ? 168.106 145.798 165.597 1.00 71.53  ? 621  ARG A NH2   1 
ATOM   1768  N  N     . PHE A 1  358 ? 173.041 145.396 161.542 1.00 69.75  ? 622  PHE A N     1 
ATOM   1769  C  CA    . PHE A 1  358 ? 173.763 144.168 161.835 1.00 69.75  ? 622  PHE A CA    1 
ATOM   1770  C  C     . PHE A 1  358 ? 173.632 143.870 163.319 1.00 69.75  ? 622  PHE A C     1 
ATOM   1771  O  O     . PHE A 1  358 ? 173.878 144.743 164.156 1.00 69.75  ? 622  PHE A O     1 
ATOM   1772  C  CB    . PHE A 1  358 ? 175.240 144.284 161.439 1.00 69.75  ? 622  PHE A CB    1 
ATOM   1773  C  CG    . PHE A 1  358 ? 176.023 143.018 161.629 1.00 69.75  ? 622  PHE A CG    1 
ATOM   1774  C  CD1   . PHE A 1  358 ? 175.893 141.968 160.736 1.00 69.75  ? 622  PHE A CD1   1 
ATOM   1775  C  CD2   . PHE A 1  358 ? 176.894 142.879 162.694 1.00 69.75  ? 622  PHE A CD2   1 
ATOM   1776  C  CE1   . PHE A 1  358 ? 176.614 140.803 160.906 1.00 69.75  ? 622  PHE A CE1   1 
ATOM   1777  C  CE2   . PHE A 1  358 ? 177.618 141.716 162.868 1.00 69.75  ? 622  PHE A CE2   1 
ATOM   1778  C  CZ    . PHE A 1  358 ? 177.478 140.678 161.974 1.00 69.75  ? 622  PHE A CZ    1 
ATOM   1779  N  N     . SER A 1  359 ? 173.248 142.638 163.644 1.00 71.13  ? 623  SER A N     1 
ATOM   1780  C  CA    . SER A 1  359 ? 172.956 142.277 165.023 1.00 71.13  ? 623  SER A CA    1 
ATOM   1781  C  C     . SER A 1  359 ? 173.536 140.904 165.324 1.00 71.13  ? 623  SER A C     1 
ATOM   1782  O  O     . SER A 1  359 ? 173.999 140.188 164.432 1.00 71.13  ? 623  SER A O     1 
ATOM   1783  C  CB    . SER A 1  359 ? 171.449 142.297 165.293 1.00 71.13  ? 623  SER A CB    1 
ATOM   1784  O  OG    . SER A 1  359 ? 170.921 143.603 165.144 1.00 71.13  ? 623  SER A OG    1 
ATOM   1785  N  N     . PHE A 1  360 ? 173.500 140.546 166.603 1.00 67.80  ? 624  PHE A N     1 
ATOM   1786  C  CA    . PHE A 1  360 ? 173.984 139.256 167.071 1.00 67.80  ? 624  PHE A CA    1 
ATOM   1787  C  C     . PHE A 1  360 ? 173.088 138.771 168.205 1.00 67.80  ? 624  PHE A C     1 
ATOM   1788  O  O     . PHE A 1  360 ? 172.294 139.536 168.747 1.00 67.80  ? 624  PHE A O     1 
ATOM   1789  C  CB    . PHE A 1  360 ? 175.446 139.333 167.506 1.00 67.80  ? 624  PHE A CB    1 
ATOM   1790  C  CG    . PHE A 1  360 ? 175.649 139.970 168.846 1.00 67.80  ? 624  PHE A CG    1 
ATOM   1791  C  CD1   . PHE A 1  360 ? 176.087 141.277 168.944 1.00 67.80  ? 624  PHE A CD1   1 
ATOM   1792  C  CD2   . PHE A 1  360 ? 175.414 139.258 170.006 1.00 67.80  ? 624  PHE A CD2   1 
ATOM   1793  C  CE1   . PHE A 1  360 ? 176.281 141.866 170.175 1.00 67.80  ? 624  PHE A CE1   1 
ATOM   1794  C  CE2   . PHE A 1  360 ? 175.606 139.841 171.242 1.00 67.80  ? 624  PHE A CE2   1 
ATOM   1795  C  CZ    . PHE A 1  360 ? 176.040 141.147 171.327 1.00 67.80  ? 624  PHE A CZ    1 
ATOM   1796  N  N     . THR A 1  361 ? 173.222 137.502 168.565 1.00 69.65  ? 625  THR A N     1 
ATOM   1797  C  CA    . THR A 1  361 ? 172.387 136.902 169.604 1.00 69.65  ? 625  THR A CA    1 
ATOM   1798  C  C     . THR A 1  361 ? 173.140 135.745 170.236 1.00 69.65  ? 625  THR A C     1 
ATOM   1799  O  O     . THR A 1  361 ? 173.572 134.830 169.528 1.00 69.65  ? 625  THR A O     1 
ATOM   1800  C  CB    . THR A 1  361 ? 171.056 136.419 169.027 1.00 69.65  ? 625  THR A CB    1 
ATOM   1801  O  OG1   . THR A 1  361 ? 170.308 137.537 168.532 1.00 69.65  ? 625  THR A OG1   1 
ATOM   1802  C  CG2   . THR A 1  361 ? 170.246 135.690 170.089 1.00 69.65  ? 625  THR A CG2   1 
ATOM   1803  N  N     . VAL A 1  362 ? 173.290 135.778 171.558 1.00 66.53  ? 626  VAL A N     1 
ATOM   1804  C  CA    . VAL A 1  362 ? 173.896 134.667 172.286 1.00 66.53  ? 626  VAL A CA    1 
ATOM   1805  C  C     . VAL A 1  362 ? 172.875 133.536 172.347 1.00 66.53  ? 626  VAL A C     1 
ATOM   1806  O  O     . VAL A 1  362 ? 171.835 133.661 173.000 1.00 66.53  ? 626  VAL A O     1 
ATOM   1807  C  CB    . VAL A 1  362 ? 174.346 135.088 173.688 1.00 66.53  ? 626  VAL A CB    1 
ATOM   1808  C  CG1   . VAL A 1  362 ? 174.872 133.886 174.456 1.00 66.53  ? 626  VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A 1  362 ? 175.405 136.174 173.600 1.00 66.53  ? 626  VAL A CG2   1 
ATOM   1810  N  N     . MET A 1  363 ? 173.168 132.427 171.670 1.00 73.09  ? 627  MET A N     1 
ATOM   1811  C  CA    . MET A 1  363 ? 172.207 131.340 171.540 1.00 73.09  ? 627  MET A CA    1 
ATOM   1812  C  C     . MET A 1  363 ? 172.362 130.265 172.605 1.00 73.09  ? 627  MET A C     1 
ATOM   1813  O  O     . MET A 1  363 ? 171.353 129.754 173.104 1.00 73.09  ? 627  MET A O     1 
ATOM   1814  C  CB    . MET A 1  363 ? 172.327 130.695 170.157 1.00 73.09  ? 627  MET A CB    1 
ATOM   1815  C  CG    . MET A 1  363 ? 171.926 131.606 169.013 1.00 73.09  ? 627  MET A CG    1 
ATOM   1816  S  SD    . MET A 1  363 ? 170.204 132.122 169.120 1.00 73.09  ? 627  MET A SD    1 
ATOM   1817  C  CE    . MET A 1  363 ? 169.377 130.569 168.795 1.00 73.09  ? 627  MET A CE    1 
ATOM   1818  N  N     . ARG A 1  364 ? 173.590 129.906 172.968 1.00 70.10  ? 628  ARG A N     1 
ATOM   1819  C  CA    . ARG A 1  364 ? 173.793 128.765 173.848 1.00 70.10  ? 628  ARG A CA    1 
ATOM   1820  C  C     . ARG A 1  364 ? 175.166 128.867 174.494 1.00 70.10  ? 628  ARG A C     1 
ATOM   1821  O  O     . ARG A 1  364 ? 176.131 129.305 173.863 1.00 70.10  ? 628  ARG A O     1 
ATOM   1822  C  CB    . ARG A 1  364 ? 173.660 127.448 173.074 1.00 70.10  ? 628  ARG A CB    1 
ATOM   1823  C  CG    . ARG A 1  364 ? 173.747 126.196 173.920 1.00 70.10  ? 628  ARG A CG    1 
ATOM   1824  C  CD    . ARG A 1  364 ? 173.577 124.959 173.054 1.00 70.10  ? 628  ARG A CD    1 
ATOM   1825  N  NE    . ARG A 1  364 ? 174.687 124.785 172.123 1.00 70.10  ? 628  ARG A NE    1 
ATOM   1826  C  CZ    . ARG A 1  364 ? 174.701 123.894 171.137 1.00 70.10  ? 628  ARG A CZ    1 
ATOM   1827  N  NH1   . ARG A 1  364 ? 173.661 123.094 170.950 1.00 70.10  ? 628  ARG A NH1   1 
ATOM   1828  N  NH2   . ARG A 1  364 ? 175.754 123.804 170.336 1.00 70.10  ? 628  ARG A NH2   1 
ATOM   1829  N  N     . ILE A 1  365 ? 175.236 128.462 175.761 1.00 70.11  ? 629  ILE A N     1 
ATOM   1830  C  CA    . ILE A 1  365 ? 176.480 128.429 176.521 1.00 70.11  ? 629  ILE A CA    1 
ATOM   1831  C  C     . ILE A 1  365 ? 176.588 127.069 177.194 1.00 70.11  ? 629  ILE A C     1 
ATOM   1832  O  O     . ILE A 1  365 ? 175.636 126.613 177.835 1.00 70.11  ? 629  ILE A O     1 
ATOM   1833  C  CB    . ILE A 1  365 ? 176.545 129.557 177.570 1.00 70.11  ? 629  ILE A CB    1 
ATOM   1834  C  CG1   . ILE A 1  365 ? 176.532 130.925 176.888 1.00 70.11  ? 629  ILE A CG1   1 
ATOM   1835  C  CG2   . ILE A 1  365 ? 177.783 129.408 178.439 1.00 70.11  ? 629  ILE A CG2   1 
ATOM   1836  C  CD1   . ILE A 1  365 ? 176.339 132.078 177.843 1.00 70.11  ? 629  ILE A CD1   1 
ATOM   1837  N  N     . THR A 1  366 ? 177.738 126.417 177.041 1.00 76.52  ? 630  THR A N     1 
ATOM   1838  C  CA    . THR A 1  366 ? 177.974 125.110 177.638 1.00 76.52  ? 630  THR A CA    1 
ATOM   1839  C  C     . THR A 1  366 ? 179.348 125.095 178.293 1.00 76.52  ? 630  THR A C     1 
ATOM   1840  O  O     . THR A 1  366 ? 180.246 125.854 177.921 1.00 76.52  ? 630  THR A O     1 
ATOM   1841  C  CB    . THR A 1  366 ? 177.882 123.977 176.604 1.00 76.52  ? 630  THR A CB    1 
ATOM   1842  O  OG1   . THR A 1  366 ? 178.867 124.177 175.582 1.00 76.52  ? 630  THR A OG1   1 
ATOM   1843  C  CG2   . THR A 1  366 ? 176.499 123.929 175.971 1.00 76.52  ? 630  THR A CG2   1 
ATOM   1844  N  N     . ILE A 1  367 ? 179.500 124.214 179.279 1.00 85.66  ? 631  ILE A N     1 
ATOM   1845  C  CA    . ILE A 1  367 ? 180.762 124.026 179.981 1.00 85.66  ? 631  ILE A CA    1 
ATOM   1846  C  C     . ILE A 1  367 ? 181.188 122.573 179.827 1.00 85.66  ? 631  ILE A C     1 
ATOM   1847  O  O     . ILE A 1  367 ? 180.353 121.667 179.728 1.00 85.66  ? 631  ILE A O     1 
ATOM   1848  C  CB    . ILE A 1  367 ? 180.656 124.420 181.473 1.00 85.66  ? 631  ILE A CB    1 
ATOM   1849  C  CG1   . ILE A 1  367 ? 182.040 124.462 182.123 1.00 85.66  ? 631  ILE A CG1   1 
ATOM   1850  C  CG2   . ILE A 1  367 ? 179.734 123.469 182.221 1.00 85.66  ? 631  ILE A CG2   1 
ATOM   1851  C  CD1   . ILE A 1  367 ? 182.059 125.131 183.478 1.00 85.66  ? 631  ILE A CD1   1 
ATOM   1852  N  N     . GLU A 1  368 ? 182.500 122.354 179.794 1.00 98.89  ? 632  GLU A N     1 
ATOM   1853  C  CA    . GLU A 1  368 ? 183.072 121.017 179.641 1.00 98.89  ? 632  GLU A CA    1 
ATOM   1854  C  C     . GLU A 1  368 ? 183.460 120.508 181.025 1.00 98.89  ? 632  GLU A C     1 
ATOM   1855  O  O     . GLU A 1  368 ? 184.572 120.735 181.504 1.00 98.89  ? 632  GLU A O     1 
ATOM   1856  C  CB    . GLU A 1  368 ? 184.264 121.039 178.691 1.00 98.89  ? 632  GLU A CB    1 
ATOM   1857  C  CG    . GLU A 1  368 ? 184.858 119.667 178.415 1.00 98.89  ? 632  GLU A CG    1 
ATOM   1858  C  CD    . GLU A 1  368 ? 186.003 119.715 177.424 1.00 98.89  ? 632  GLU A CD    1 
ATOM   1859  O  OE1   . GLU A 1  368 ? 186.349 120.825 176.965 1.00 98.89  ? 632  GLU A OE1   1 
ATOM   1860  O  OE2   . GLU A 1  368 ? 186.559 118.644 177.102 1.00 98.89  ? 632  GLU A OE2   1 
ATOM   1861  N  N     . HIS A 1  369 ? 182.529 119.814 181.671 1.00 100.70 ? 633  HIS A N     1 
ATOM   1862  C  CA    . HIS A 1  369 ? 182.751 119.229 182.986 1.00 100.70 ? 633  HIS A CA    1 
ATOM   1863  C  C     . HIS A 1  369 ? 183.040 117.742 182.834 1.00 100.70 ? 633  HIS A C     1 
ATOM   1864  O  O     . HIS A 1  369 ? 182.198 116.990 182.333 1.00 100.70 ? 633  HIS A O     1 
ATOM   1865  C  CB    . HIS A 1  369 ? 181.538 119.445 183.892 1.00 100.70 ? 633  HIS A CB    1 
ATOM   1866  C  CG    . HIS A 1  369 ? 181.755 119.006 185.307 1.00 100.70 ? 633  HIS A CG    1 
ATOM   1867  N  ND1   . HIS A 1  369 ? 181.533 117.713 185.727 1.00 100.70 ? 633  HIS A ND1   1 
ATOM   1868  C  CD2   . HIS A 1  369 ? 182.171 119.691 186.399 1.00 100.70 ? 633  HIS A CD2   1 
ATOM   1869  C  CE1   . HIS A 1  369 ? 181.804 117.619 187.017 1.00 100.70 ? 633  HIS A CE1   1 
ATOM   1870  N  NE2   . HIS A 1  369 ? 182.193 118.805 187.448 1.00 100.70 ? 633  HIS A NE2   1 
ATOM   1871  N  N     . GLY A 1  370 ? 184.225 117.325 183.269 1.00 102.53 ? 634  GLY A N     1 
ATOM   1872  C  CA    . GLY A 1  370 ? 184.606 115.932 183.107 1.00 102.53 ? 634  GLY A CA    1 
ATOM   1873  C  C     . GLY A 1  370 ? 184.868 115.617 181.649 1.00 102.53 ? 634  GLY A C     1 
ATOM   1874  O  O     . GLY A 1  370 ? 185.768 116.181 181.018 1.00 102.53 ? 634  GLY A O     1 
ATOM   1875  N  N     . SER A 1  371 ? 184.071 114.701 181.098 1.00 104.75 ? 635  SER A N     1 
ATOM   1876  C  CA    . SER A 1  371 ? 184.173 114.312 179.697 1.00 104.75 ? 635  SER A CA    1 
ATOM   1877  C  C     . SER A 1  371 ? 182.890 114.598 178.924 1.00 104.75 ? 635  SER A C     1 
ATOM   1878  O  O     . SER A 1  371 ? 182.640 113.972 177.889 1.00 104.75 ? 635  SER A O     1 
ATOM   1879  C  CB    . SER A 1  371 ? 184.542 112.833 179.582 1.00 104.75 ? 635  SER A CB    1 
ATOM   1880  O  OG    . SER A 1  371 ? 185.829 112.585 180.120 1.00 104.75 ? 635  SER A OG    1 
ATOM   1881  N  N     . GLN A 1  372 ? 182.073 115.527 179.406 1.00 100.66 ? 636  GLN A N     1 
ATOM   1882  C  CA    . GLN A 1  372 ? 180.810 115.884 178.776 1.00 100.66 ? 636  GLN A CA    1 
ATOM   1883  C  C     . GLN A 1  372 ? 180.752 117.393 178.562 1.00 100.66 ? 636  GLN A C     1 
ATOM   1884  O  O     . GLN A 1  372 ? 181.688 118.128 178.885 1.00 100.66 ? 636  GLN A O     1 
ATOM   1885  C  CB    . GLN A 1  372 ? 179.625 115.405 179.620 1.00 100.66 ? 636  GLN A CB    1 
ATOM   1886  C  CG    . GLN A 1  372 ? 179.491 113.893 179.709 1.00 100.66 ? 636  GLN A CG    1 
ATOM   1887  C  CD    . GLN A 1  372 ? 180.398 113.289 180.762 1.00 100.66 ? 636  GLN A CD    1 
ATOM   1888  O  OE1   . GLN A 1  372 ? 180.899 113.989 181.642 1.00 100.66 ? 636  GLN A OE1   1 
ATOM   1889  N  NE2   . GLN A 1  372 ? 180.616 111.982 180.677 1.00 100.66 ? 636  GLN A NE2   1 
ATOM   1890  N  N     . ASN A 1  373 ? 179.630 117.853 178.009 1.00 91.04  ? 637  ASN A N     1 
ATOM   1891  C  CA    . ASN A 1  373 ? 179.386 119.272 177.750 1.00 91.04  ? 637  ASN A CA    1 
ATOM   1892  C  C     . ASN A 1  373 ? 178.050 119.630 178.394 1.00 91.04  ? 637  ASN A C     1 
ATOM   1893  O  O     . ASN A 1  373 ? 176.998 119.536 177.757 1.00 91.04  ? 637  ASN A O     1 
ATOM   1894  C  CB    . ASN A 1  373 ? 179.396 119.570 176.255 1.00 91.04  ? 637  ASN A CB    1 
ATOM   1895  C  CG    . ASN A 1  373 ? 180.780 119.451 175.648 1.00 91.04  ? 637  ASN A CG    1 
ATOM   1896  O  OD1   . ASN A 1  373 ? 181.768 119.888 176.238 1.00 91.04  ? 637  ASN A OD1   1 
ATOM   1897  N  ND2   . ASN A 1  373 ? 180.858 118.856 174.463 1.00 91.04  ? 637  ASN A ND2   1 
ATOM   1898  N  N     . VAL A 1  374 ? 178.098 120.042 179.661 1.00 84.20  ? 638  VAL A N     1 
ATOM   1899  C  CA    . VAL A 1  374 ? 176.880 120.348 180.399 1.00 84.20  ? 638  VAL A CA    1 
ATOM   1900  C  C     . VAL A 1  374 ? 176.268 121.635 179.864 1.00 84.20  ? 638  VAL A C     1 
ATOM   1901  O  O     . VAL A 1  374 ? 176.954 122.654 179.710 1.00 84.20  ? 638  VAL A O     1 
ATOM   1902  C  CB    . VAL A 1  374 ? 177.176 120.451 181.902 1.00 84.20  ? 638  VAL A CB    1 
ATOM   1903  C  CG1   . VAL A 1  374 ? 175.923 120.850 182.664 1.00 84.20  ? 638  VAL A CG1   1 
ATOM   1904  C  CG2   . VAL A 1  374 ? 177.728 119.134 182.424 1.00 84.20  ? 638  VAL A CG2   1 
ATOM   1905  N  N     . LYS A 1  375 ? 174.968 121.593 179.579 1.00 80.15  ? 639  LYS A N     1 
ATOM   1906  C  CA    . LYS A 1  375 ? 174.236 122.755 179.088 1.00 80.15  ? 639  LYS A CA    1 
ATOM   1907  C  C     . LYS A 1  375 ? 173.873 123.646 180.270 1.00 80.15  ? 639  LYS A C     1 
ATOM   1908  O  O     . LYS A 1  375 ? 173.067 123.260 181.122 1.00 80.15  ? 639  LYS A O     1 
ATOM   1909  C  CB    . LYS A 1  375 ? 172.985 122.311 178.337 1.00 80.15  ? 639  LYS A CB    1 
ATOM   1910  C  CG    . LYS A 1  375 ? 172.239 123.433 177.638 1.00 80.15  ? 639  LYS A CG    1 
ATOM   1911  C  CD    . LYS A 1  375 ? 170.964 122.916 176.993 1.00 80.15  ? 639  LYS A CD    1 
ATOM   1912  C  CE    . LYS A 1  375 ? 171.263 121.990 175.826 1.00 80.15  ? 639  LYS A CE    1 
ATOM   1913  N  NZ    . LYS A 1  375 ? 171.894 122.709 174.689 1.00 80.15  ? 639  LYS A NZ    1 
ATOM   1914  N  N     . VAL A 1  376 ? 174.462 124.840 180.327 1.00 77.26  ? 640  VAL A N     1 
ATOM   1915  C  CA    . VAL A 1  376 ? 174.189 125.762 181.424 1.00 77.26  ? 640  VAL A CA    1 
ATOM   1916  C  C     . VAL A 1  376 ? 173.257 126.902 181.025 1.00 77.26  ? 640  VAL A C     1 
ATOM   1917  O  O     . VAL A 1  376 ? 172.676 127.546 181.912 1.00 77.26  ? 640  VAL A O     1 
ATOM   1918  C  CB    . VAL A 1  376 ? 175.499 126.331 182.007 1.00 77.26  ? 640  VAL A CB    1 
ATOM   1919  C  CG1   . VAL A 1  376 ? 176.365 125.208 182.558 1.00 77.26  ? 640  VAL A CG1   1 
ATOM   1920  C  CG2   . VAL A 1  376 ? 176.248 127.131 180.957 1.00 77.26  ? 640  VAL A CG2   1 
ATOM   1921  N  N     . PHE A 1  377 ? 173.095 127.173 179.732 1.00 74.89  ? 641  PHE A N     1 
ATOM   1922  C  CA    . PHE A 1  377 ? 172.215 128.243 179.289 1.00 74.89  ? 641  PHE A CA    1 
ATOM   1923  C  C     . PHE A 1  377 ? 171.714 127.941 177.885 1.00 74.89  ? 641  PHE A C     1 
ATOM   1924  O  O     . PHE A 1  377 ? 172.419 127.335 177.074 1.00 74.89  ? 641  PHE A O     1 
ATOM   1925  C  CB    . PHE A 1  377 ? 172.922 129.604 179.312 1.00 74.89  ? 641  PHE A CB    1 
ATOM   1926  C  CG    . PHE A 1  377 ? 172.043 130.747 178.897 1.00 74.89  ? 641  PHE A CG    1 
ATOM   1927  C  CD1   . PHE A 1  377 ? 171.089 131.254 179.763 1.00 74.89  ? 641  PHE A CD1   1 
ATOM   1928  C  CD2   . PHE A 1  377 ? 172.164 131.311 177.638 1.00 74.89  ? 641  PHE A CD2   1 
ATOM   1929  C  CE1   . PHE A 1  377 ? 170.276 132.304 179.383 1.00 74.89  ? 641  PHE A CE1   1 
ATOM   1930  C  CE2   . PHE A 1  377 ? 171.354 132.360 177.253 1.00 74.89  ? 641  PHE A CE2   1 
ATOM   1931  C  CZ    . PHE A 1  377 ? 170.409 132.858 178.127 1.00 74.89  ? 641  PHE A CZ    1 
ATOM   1932  N  N     . GLU A 1  378 ? 170.484 128.373 177.610 1.00 78.68  ? 642  GLU A N     1 
ATOM   1933  C  CA    . GLU A 1  378 ? 169.892 128.228 176.287 1.00 78.68  ? 642  GLU A CA    1 
ATOM   1934  C  C     . GLU A 1  378 ? 168.739 129.212 176.165 1.00 78.68  ? 642  GLU A C     1 
ATOM   1935  O  O     . GLU A 1  378 ? 167.916 129.318 177.079 1.00 78.68  ? 642  GLU A O     1 
ATOM   1936  C  CB    . GLU A 1  378 ? 169.400 126.797 176.046 1.00 78.68  ? 642  GLU A CB    1 
ATOM   1937  C  CG    . GLU A 1  378 ? 168.854 126.564 174.647 1.00 78.68  ? 642  GLU A CG    1 
ATOM   1938  C  CD    . GLU A 1  378 ? 168.418 125.130 174.421 1.00 78.68  ? 642  GLU A CD    1 
ATOM   1939  O  OE1   . GLU A 1  378 ? 168.518 124.321 175.366 1.00 78.68  ? 642  GLU A OE1   1 
ATOM   1940  O  OE2   . GLU A 1  378 ? 167.975 124.813 173.298 1.00 78.68  ? 642  GLU A OE2   1 
ATOM   1941  N  N     . GLU A 1  379 ? 168.687 129.926 175.048 1.00 78.50  ? 643  GLU A N     1 
ATOM   1942  C  CA    . GLU A 1  379 ? 167.634 130.905 174.825 1.00 78.50  ? 643  GLU A CA    1 
ATOM   1943  C  C     . GLU A 1  379 ? 166.287 130.206 174.675 1.00 78.50  ? 643  GLU A C     1 
ATOM   1944  O  O     . GLU A 1  379 ? 166.135 129.356 173.785 1.00 78.50  ? 643  GLU A O     1 
ATOM   1945  C  CB    . GLU A 1  379 ? 167.936 131.739 173.583 1.00 78.50  ? 643  GLU A CB    1 
ATOM   1946  C  CG    . GLU A 1  379 ? 166.902 132.813 173.289 1.00 78.50  ? 643  GLU A CG    1 
ATOM   1947  C  CD    . GLU A 1  379 ? 166.861 133.897 174.348 1.00 78.50  ? 643  GLU A CD    1 
ATOM   1948  O  OE1   . GLU A 1  379 ? 167.896 134.128 175.008 1.00 78.50  ? 643  GLU A OE1   1 
ATOM   1949  O  OE2   . GLU A 1  379 ? 165.792 134.519 174.521 1.00 78.50  ? 643  GLU A OE2   1 
ATOM   1950  N  N     . PRO A 1  380 ? 165.295 130.523 175.508 1.00 75.73  ? 644  PRO A N     1 
ATOM   1951  C  CA    . PRO A 1  380 ? 163.994 129.850 175.398 1.00 75.73  ? 644  PRO A CA    1 
ATOM   1952  C  C     . PRO A 1  380 ? 163.197 130.309 174.187 1.00 75.73  ? 644  PRO A C     1 
ATOM   1953  O  O     . PRO A 1  380 ? 162.452 129.525 173.592 1.00 75.73  ? 644  PRO A O     1 
ATOM   1954  C  CB    . PRO A 1  380 ? 163.294 130.231 176.707 1.00 75.73  ? 644  PRO A CB    1 
ATOM   1955  C  CG    . PRO A 1  380 ? 163.904 131.538 177.083 1.00 75.73  ? 644  PRO A CG    1 
ATOM   1956  C  CD    . PRO A 1  380 ? 165.337 131.473 176.633 1.00 75.73  ? 644  PRO A CD    1 
ATOM   1957  N  N     . LYS A 1  381 ? 163.346 131.578 173.816 1.00 75.81  ? 645  LYS A N     1 
ATOM   1958  C  CA    . LYS A 1  381 ? 162.629 132.172 172.688 1.00 75.81  ? 645  LYS A CA    1 
ATOM   1959  C  C     . LYS A 1  381 ? 163.653 132.806 171.757 1.00 75.81  ? 645  LYS A C     1 
ATOM   1960  O  O     . LYS A 1  381 ? 163.945 134.005 171.855 1.00 75.81  ? 645  LYS A O     1 
ATOM   1961  C  CB    . LYS A 1  381 ? 161.596 133.192 173.166 1.00 75.81  ? 645  LYS A CB    1 
ATOM   1962  C  CG    . LYS A 1  381 ? 160.444 132.578 173.944 1.00 75.81  ? 645  LYS A CG    1 
ATOM   1963  C  CD    . LYS A 1  381 ? 159.386 133.615 174.282 1.00 75.81  ? 645  LYS A CD    1 
ATOM   1964  C  CE    . LYS A 1  381 ? 159.856 134.532 175.398 1.00 75.81  ? 645  LYS A CE    1 
ATOM   1965  N  NZ    . LYS A 1  381 ? 158.791 135.483 175.820 1.00 75.81  ? 645  LYS A NZ    1 
ATOM   1966  N  N     . PRO A 1  382 ? 164.222 132.023 170.836 1.00 73.79  ? 646  PRO A N     1 
ATOM   1967  C  CA    . PRO A 1  382 ? 165.290 132.572 169.985 1.00 73.79  ? 646  PRO A CA    1 
ATOM   1968  C  C     . PRO A 1  382 ? 164.794 133.579 168.965 1.00 73.79  ? 646  PRO A C     1 
ATOM   1969  O  O     . PRO A 1  382 ? 165.470 134.585 168.717 1.00 73.79  ? 646  PRO A O     1 
ATOM   1970  C  CB    . PRO A 1  382 ? 165.874 131.321 169.317 1.00 73.79  ? 646  PRO A CB    1 
ATOM   1971  C  CG    . PRO A 1  382 ? 164.744 130.349 169.299 1.00 73.79  ? 646  PRO A CG    1 
ATOM   1972  C  CD    . PRO A 1  382 ? 163.955 130.603 170.552 1.00 73.79  ? 646  PRO A CD    1 
ATOM   1973  N  N     . ASN A 1  383 ? 163.631 133.343 168.364 1.00 77.14  ? 647  ASN A N     1 
ATOM   1974  C  CA    . ASN A 1  383 ? 163.111 134.211 167.317 1.00 77.14  ? 647  ASN A CA    1 
ATOM   1975  C  C     . ASN A 1  383 ? 162.445 135.470 167.859 1.00 77.14  ? 647  ASN A C     1 
ATOM   1976  O  O     . ASN A 1  383 ? 161.854 136.223 167.078 1.00 77.14  ? 647  ASN A O     1 
ATOM   1977  C  CB    . ASN A 1  383 ? 162.123 133.439 166.440 1.00 77.14  ? 647  ASN A CB    1 
ATOM   1978  C  CG    . ASN A 1  383 ? 162.802 132.388 165.587 1.00 77.14  ? 647  ASN A CG    1 
ATOM   1979  O  OD1   . ASN A 1  383 ? 163.863 132.629 165.013 1.00 77.14  ? 647  ASN A OD1   1 
ATOM   1980  N  ND2   . ASN A 1  383 ? 162.193 131.211 165.501 1.00 77.14  ? 647  ASN A ND2   1 
ATOM   1981  N  N     . SER A 1  384 ? 162.524 135.716 169.162 1.00 74.80  ? 648  SER A N     1 
ATOM   1982  C  CA    . SER A 1  384 ? 161.919 136.904 169.739 1.00 74.80  ? 648  SER A CA    1 
ATOM   1983  C  C     . SER A 1  384 ? 162.806 138.124 169.511 1.00 74.80  ? 648  SER A C     1 
ATOM   1984  O  O     . SER A 1  384 ? 164.019 138.019 169.312 1.00 74.80  ? 648  SER A O     1 
ATOM   1985  C  CB    . SER A 1  384 ? 161.672 136.710 171.235 1.00 74.80  ? 648  SER A CB    1 
ATOM   1986  O  OG    . SER A 1  384 ? 161.118 137.878 171.814 1.00 74.80  ? 648  SER A OG    1 
ATOM   1987  N  N     . GLU A 1  385 ? 162.177 139.299 169.539 1.00 74.88  ? 649  GLU A N     1 
ATOM   1988  C  CA    . GLU A 1  385 ? 162.910 140.547 169.383 1.00 74.88  ? 649  GLU A CA    1 
ATOM   1989  C  C     . GLU A 1  385 ? 163.558 141.010 170.680 1.00 74.88  ? 649  GLU A C     1 
ATOM   1990  O  O     . GLU A 1  385 ? 164.408 141.906 170.647 1.00 74.88  ? 649  GLU A O     1 
ATOM   1991  C  CB    . GLU A 1  385 ? 161.981 141.642 168.855 1.00 74.88  ? 649  GLU A CB    1 
ATOM   1992  C  CG    . GLU A 1  385 ? 160.921 142.093 169.847 1.00 74.88  ? 649  GLU A CG    1 
ATOM   1993  C  CD    . GLU A 1  385 ? 159.672 141.233 169.805 1.00 74.88  ? 649  GLU A CD    1 
ATOM   1994  O  OE1   . GLU A 1  385 ? 159.727 140.123 169.237 1.00 74.88  ? 649  GLU A OE1   1 
ATOM   1995  O  OE2   . GLU A 1  385 ? 158.633 141.671 170.340 1.00 74.88  ? 649  GLU A OE2   1 
ATOM   1996  N  N     . LEU A 1  386 ? 163.181 140.421 171.815 1.00 71.79  ? 650  LEU A N     1 
ATOM   1997  C  CA    . LEU A 1  386 ? 163.740 140.809 173.104 1.00 71.79  ? 650  LEU A CA    1 
ATOM   1998  C  C     . LEU A 1  386 ? 165.164 140.316 173.311 1.00 71.79  ? 650  LEU A C     1 
ATOM   1999  O  O     . LEU A 1  386 ? 165.773 140.664 174.328 1.00 71.79  ? 650  LEU A O     1 
ATOM   2000  C  CB    . LEU A 1  386 ? 162.851 140.293 174.236 1.00 71.79  ? 650  LEU A CB    1 
ATOM   2001  C  CG    . LEU A 1  386 ? 161.449 140.894 174.340 1.00 71.79  ? 650  LEU A CG    1 
ATOM   2002  C  CD1   . LEU A 1  386 ? 160.651 140.193 175.427 1.00 71.79  ? 650  LEU A CD1   1 
ATOM   2003  C  CD2   . LEU A 1  386 ? 161.524 142.387 174.606 1.00 71.79  ? 650  LEU A CD2   1 
ATOM   2004  N  N     . CYS A 1  387 ? 165.711 139.521 172.389 1.00 73.47  ? 651  CYS A N     1 
ATOM   2005  C  CA    . CYS A 1  387 ? 167.055 138.983 172.556 1.00 73.47  ? 651  CYS A CA    1 
ATOM   2006  C  C     . CYS A 1  387 ? 167.888 139.149 171.291 1.00 73.47  ? 651  CYS A C     1 
ATOM   2007  O  O     . CYS A 1  387 ? 168.837 138.391 171.066 1.00 73.47  ? 651  CYS A O     1 
ATOM   2008  C  CB    . CYS A 1  387 ? 167.008 137.509 172.960 1.00 73.47  ? 651  CYS A CB    1 
ATOM   2009  S  SG    . CYS A 1  387 ? 166.288 136.416 171.715 1.00 73.47  ? 651  CYS A SG    1 
ATOM   2010  N  N     . CYS A 1  388 ? 167.556 140.132 170.461 1.00 74.70  ? 652  CYS A N     1 
ATOM   2011  C  CA    . CYS A 1  388 ? 168.303 140.432 169.241 1.00 74.70  ? 652  CYS A CA    1 
ATOM   2012  C  C     . CYS A 1  388 ? 169.089 141.714 169.501 1.00 74.70  ? 652  CYS A C     1 
ATOM   2013  O  O     . CYS A 1  388 ? 168.624 142.817 169.211 1.00 74.70  ? 652  CYS A O     1 
ATOM   2014  C  CB    . CYS A 1  388 ? 167.370 140.570 168.042 1.00 74.70  ? 652  CYS A CB    1 
ATOM   2015  S  SG    . CYS A 1  388 ? 168.210 140.853 166.467 1.00 74.70  ? 652  CYS A SG    1 
ATOM   2016  N  N     . LYS A 1  389 ? 170.288 141.559 170.051 1.00 67.14  ? 653  LYS A N     1 
ATOM   2017  C  CA    . LYS A 1  389 ? 171.077 142.714 170.444 1.00 67.14  ? 653  LYS A CA    1 
ATOM   2018  C  C     . LYS A 1  389 ? 171.680 143.393 169.216 1.00 67.14  ? 653  LYS A C     1 
ATOM   2019  O  O     . LYS A 1  389 ? 172.255 142.722 168.353 1.00 67.14  ? 653  LYS A O     1 
ATOM   2020  C  CB    . LYS A 1  389 ? 172.183 142.299 171.410 1.00 67.14  ? 653  LYS A CB    1 
ATOM   2021  C  CG    . LYS A 1  389 ? 171.670 141.830 172.759 1.00 67.14  ? 653  LYS A CG    1 
ATOM   2022  C  CD    . LYS A 1  389 ? 172.812 141.483 173.695 1.00 67.14  ? 653  LYS A CD    1 
ATOM   2023  C  CE    . LYS A 1  389 ? 172.289 140.960 175.020 1.00 67.14  ? 653  LYS A CE    1 
ATOM   2024  N  NZ    . LYS A 1  389 ? 171.575 142.023 175.780 1.00 67.14  ? 653  LYS A NZ    1 
ATOM   2025  N  N     . PRO A 1  390 ? 171.566 144.713 169.110 1.00 66.55  ? 654  PRO A N     1 
ATOM   2026  C  CA    . PRO A 1  390 ? 172.103 145.417 167.944 1.00 66.55  ? 654  PRO A CA    1 
ATOM   2027  C  C     . PRO A 1  390 ? 173.614 145.565 168.020 1.00 66.55  ? 654  PRO A C     1 
ATOM   2028  O  O     . PRO A 1  390 ? 174.216 145.578 169.095 1.00 66.55  ? 654  PRO A O     1 
ATOM   2029  C  CB    . PRO A 1  390 ? 171.423 146.787 168.023 1.00 66.55  ? 654  PRO A CB    1 
ATOM   2030  C  CG    . PRO A 1  390 ? 171.222 146.993 169.487 1.00 66.55  ? 654  PRO A CG    1 
ATOM   2031  C  CD    . PRO A 1  390 ? 170.918 145.632 170.061 1.00 66.55  ? 654  PRO A CD    1 
ATOM   2032  N  N     . LEU A 1  391 ? 174.226 145.680 166.842 1.00 67.28  ? 655  LEU A N     1 
ATOM   2033  C  CA    . LEU A 1  391 ? 175.666 145.909 166.772 1.00 67.28  ? 655  LEU A CA    1 
ATOM   2034  C  C     . LEU A 1  391 ? 176.085 147.015 165.815 1.00 67.28  ? 655  LEU A C     1 
ATOM   2035  O  O     . LEU A 1  391 ? 177.126 147.637 166.054 1.00 67.28  ? 655  LEU A O     1 
ATOM   2036  C  CB    . LEU A 1  391 ? 176.387 144.615 166.382 1.00 67.28  ? 655  LEU A CB    1 
ATOM   2037  C  CG    . LEU A 1  391 ? 177.912 144.652 166.390 1.00 67.28  ? 655  LEU A CG    1 
ATOM   2038  C  CD1   . LEU A 1  391 ? 178.421 144.970 167.788 1.00 67.28  ? 655  LEU A CD1   1 
ATOM   2039  C  CD2   . LEU A 1  391 ? 178.449 143.328 165.906 1.00 67.28  ? 655  LEU A CD2   1 
ATOM   2040  N  N     . CYS A 1  392 ? 175.326 147.311 164.763 1.00 68.55  ? 656  CYS A N     1 
ATOM   2041  C  CA    . CYS A 1  392 ? 175.742 148.324 163.801 1.00 68.55  ? 656  CYS A CA    1 
ATOM   2042  C  C     . CYS A 1  392 ? 174.519 148.845 163.065 1.00 68.55  ? 656  CYS A C     1 
ATOM   2043  O  O     . CYS A 1  392 ? 173.651 148.061 162.670 1.00 68.55  ? 656  CYS A O     1 
ATOM   2044  C  CB    . CYS A 1  392 ? 176.763 147.757 162.809 1.00 68.55  ? 656  CYS A CB    1 
ATOM   2045  S  SG    . CYS A 1  392 ? 177.399 148.965 161.626 1.00 68.55  ? 656  CYS A SG    1 
ATOM   2046  N  N     . LEU A 1  393 ? 174.456 150.162 162.888 1.00 70.75  ? 657  LEU A N     1 
ATOM   2047  C  CA    . LEU A 1  393 ? 173.376 150.815 162.161 1.00 70.75  ? 657  LEU A CA    1 
ATOM   2048  C  C     . LEU A 1  393 ? 173.986 151.737 161.119 1.00 70.75  ? 657  LEU A C     1 
ATOM   2049  O  O     . LEU A 1  393 ? 174.874 152.534 161.438 1.00 70.75  ? 657  LEU A O     1 
ATOM   2050  C  CB    . LEU A 1  393 ? 172.469 151.608 163.106 1.00 70.75  ? 657  LEU A CB    1 
ATOM   2051  C  CG    . LEU A 1  393 ? 171.711 150.794 164.156 1.00 70.75  ? 657  LEU A CG    1 
ATOM   2052  C  CD1   . LEU A 1  393 ? 170.947 151.711 165.097 1.00 70.75  ? 657  LEU A CD1   1 
ATOM   2053  C  CD2   . LEU A 1  393 ? 170.776 149.800 163.494 1.00 70.75  ? 657  LEU A CD2   1 
ATOM   2054  N  N     . MET A 1  394 ? 173.514 151.630 159.879 1.00 77.68  ? 658  MET A N     1 
ATOM   2055  C  CA    . MET A 1  394 ? 174.064 152.423 158.791 1.00 77.68  ? 658  MET A CA    1 
ATOM   2056  C  C     . MET A 1  394 ? 172.946 152.791 157.828 1.00 77.68  ? 658  MET A C     1 
ATOM   2057  O  O     . MET A 1  394 ? 171.906 152.130 157.771 1.00 77.68  ? 658  MET A O     1 
ATOM   2058  C  CB    . MET A 1  394 ? 175.174 151.668 158.051 1.00 77.68  ? 658  MET A CB    1 
ATOM   2059  C  CG    . MET A 1  394 ? 174.673 150.483 157.247 1.00 77.68  ? 658  MET A CG    1 
ATOM   2060  S  SD    . MET A 1  394 ? 175.998 149.479 156.555 1.00 77.68  ? 658  MET A SD    1 
ATOM   2061  C  CE    . MET A 1  394 ? 176.529 148.581 158.011 1.00 77.68  ? 658  MET A CE    1 
ATOM   2062  N  N     . LEU A 1  395 ? 173.175 153.857 157.070 1.00 75.39  ? 659  LEU A N     1 
ATOM   2063  C  CA    . LEU A 1  395 ? 172.247 154.317 156.040 1.00 75.39  ? 659  LEU A CA    1 
ATOM   2064  C  C     . LEU A 1  395 ? 172.931 154.129 154.688 1.00 75.39  ? 659  LEU A C     1 
ATOM   2065  O  O     . LEU A 1  395 ? 173.569 155.043 154.165 1.00 75.39  ? 659  LEU A O     1 
ATOM   2066  C  CB    . LEU A 1  395 ? 171.845 155.771 156.266 1.00 75.39  ? 659  LEU A CB    1 
ATOM   2067  C  CG    . LEU A 1  395 ? 171.017 156.068 157.516 1.00 75.39  ? 659  LEU A CG    1 
ATOM   2068  C  CD1   . LEU A 1  395 ? 170.799 157.564 157.666 1.00 75.39  ? 659  LEU A CD1   1 
ATOM   2069  C  CD2   . LEU A 1  395 ? 169.689 155.333 157.465 1.00 75.39  ? 659  LEU A CD2   1 
ATOM   2070  N  N     . ALA A 1  396 ? 172.788 152.933 154.122 1.00 77.30  ? 660  ALA A N     1 
ATOM   2071  C  CA    . ALA A 1  396 ? 173.423 152.610 152.854 1.00 77.30  ? 660  ALA A CA    1 
ATOM   2072  C  C     . ALA A 1  396 ? 172.588 151.570 152.124 1.00 77.30  ? 660  ALA A C     1 
ATOM   2073  O  O     . ALA A 1  396 ? 171.831 150.815 152.739 1.00 77.30  ? 660  ALA A O     1 
ATOM   2074  C  CB    . ALA A 1  396 ? 174.853 152.095 153.055 1.00 77.30  ? 660  ALA A CB    1 
ATOM   2075  N  N     . ASP A 1  397 ? 172.736 151.541 150.803 1.00 82.79  ? 661  ASP A N     1 
ATOM   2076  C  CA    . ASP A 1  397 ? 172.018 150.573 149.986 1.00 82.79  ? 661  ASP A CA    1 
ATOM   2077  C  C     . ASP A 1  397 ? 172.590 149.179 150.202 1.00 82.79  ? 661  ASP A C     1 
ATOM   2078  O  O     . ASP A 1  397 ? 173.811 148.999 150.248 1.00 82.79  ? 661  ASP A O     1 
ATOM   2079  C  CB    . ASP A 1  397 ? 172.105 150.967 148.512 1.00 82.79  ? 661  ASP A CB    1 
ATOM   2080  C  CG    . ASP A 1  397 ? 171.184 150.143 147.628 1.00 82.79  ? 661  ASP A CG    1 
ATOM   2081  O  OD1   . ASP A 1  397 ? 170.487 149.248 148.149 1.00 82.79  ? 661  ASP A OD1   1 
ATOM   2082  O  OD2   . ASP A 1  397 ? 171.159 150.392 146.404 1.00 82.79  ? 661  ASP A OD2   1 
ATOM   2083  N  N     . GLU A 1  398 ? 171.702 148.192 150.343 1.00 84.38  ? 662  GLU A N     1 
ATOM   2084  C  CA    . GLU A 1  398 ? 172.146 146.811 150.497 1.00 84.38  ? 662  GLU A CA    1 
ATOM   2085  C  C     . GLU A 1  398 ? 172.883 146.328 149.255 1.00 84.38  ? 662  GLU A C     1 
ATOM   2086  O  O     . GLU A 1  398 ? 173.853 145.567 149.353 1.00 84.38  ? 662  GLU A O     1 
ATOM   2087  C  CB    . GLU A 1  398 ? 170.949 145.908 150.796 1.00 84.38  ? 662  GLU A CB    1 
ATOM   2088  C  CG    . GLU A 1  398 ? 171.311 144.454 151.047 1.00 84.38  ? 662  GLU A CG    1 
ATOM   2089  C  CD    . GLU A 1  398 ? 170.100 143.603 151.375 1.00 84.38  ? 662  GLU A CD    1 
ATOM   2090  O  OE1   . GLU A 1  398 ? 168.975 144.145 151.380 1.00 84.38  ? 662  GLU A OE1   1 
ATOM   2091  O  OE2   . GLU A 1  398 ? 170.274 142.393 151.630 1.00 84.38  ? 662  GLU A OE2   1 
ATOM   2092  N  N     . SER A 1  399 ? 172.439 146.763 148.075 1.00 81.90  ? 663  SER A N     1 
ATOM   2093  C  CA    . SER A 1  399 ? 173.094 146.379 146.832 1.00 81.90  ? 663  SER A CA    1 
ATOM   2094  C  C     . SER A 1  399 ? 174.415 147.102 146.618 1.00 81.90  ? 663  SER A C     1 
ATOM   2095  O  O     . SER A 1  399 ? 175.247 146.625 145.838 1.00 81.90  ? 663  SER A O     1 
ATOM   2096  C  CB    . SER A 1  399 ? 172.165 146.642 145.645 1.00 81.90  ? 663  SER A CB    1 
ATOM   2097  O  OG    . SER A 1  399 ? 171.003 145.835 145.719 1.00 81.90  ? 663  SER A OG    1 
ATOM   2098  N  N     . ASP A 1  400 ? 174.627 148.234 147.284 1.00 79.84  ? 664  ASP A N     1 
ATOM   2099  C  CA    . ASP A 1  400 ? 175.883 148.974 147.182 1.00 79.84  ? 664  ASP A CA    1 
ATOM   2100  C  C     . ASP A 1  400 ? 176.981 148.149 147.838 1.00 79.84  ? 664  ASP A C     1 
ATOM   2101  O  O     . ASP A 1  400 ? 177.034 148.020 149.063 1.00 79.84  ? 664  ASP A O     1 
ATOM   2102  C  CB    . ASP A 1  400 ? 175.749 150.344 147.836 1.00 79.84  ? 664  ASP A CB    1 
ATOM   2103  C  CG    . ASP A 1  400 ? 176.924 151.254 147.535 1.00 79.84  ? 664  ASP A CG    1 
ATOM   2104  O  OD1   . ASP A 1  400 ? 177.855 150.818 146.825 1.00 79.84  ? 664  ASP A OD1   1 
ATOM   2105  O  OD2   . ASP A 1  400 ? 176.917 152.408 148.010 1.00 79.84  ? 664  ASP A OD2   1 
ATOM   2106  N  N     . HIS A 1  401 ? 177.869 147.586 147.019 1.00 73.07  ? 665  HIS A N     1 
ATOM   2107  C  CA    . HIS A 1  401 ? 178.879 146.666 147.528 1.00 73.07  ? 665  HIS A CA    1 
ATOM   2108  C  C     . HIS A 1  401 ? 180.042 147.402 148.183 1.00 73.07  ? 665  HIS A C     1 
ATOM   2109  O  O     . HIS A 1  401 ? 180.518 146.990 149.248 1.00 73.07  ? 665  HIS A O     1 
ATOM   2110  C  CB    . HIS A 1  401 ? 179.383 145.776 146.393 1.00 73.07  ? 665  HIS A CB    1 
ATOM   2111  C  CG    . HIS A 1  401 ? 180.383 144.751 146.826 1.00 73.07  ? 665  HIS A CG    1 
ATOM   2112  N  ND1   . HIS A 1  401 ? 180.029 143.613 147.518 1.00 73.07  ? 665  HIS A ND1   1 
ATOM   2113  C  CD2   . HIS A 1  401 ? 181.725 144.692 146.664 1.00 73.07  ? 665  HIS A CD2   1 
ATOM   2114  C  CE1   . HIS A 1  401 ? 181.111 142.896 147.763 1.00 73.07  ? 665  HIS A CE1   1 
ATOM   2115  N  NE2   . HIS A 1  401 ? 182.154 143.529 147.257 1.00 73.07  ? 665  HIS A NE2   1 
ATOM   2116  N  N     . GLU A 1  402 ? 180.508 148.489 147.564 1.00 74.26  ? 666  GLU A N     1 
ATOM   2117  C  CA    . GLU A 1  402 ? 181.701 149.174 148.052 1.00 74.26  ? 666  GLU A CA    1 
ATOM   2118  C  C     . GLU A 1  402 ? 181.486 149.730 149.454 1.00 74.26  ? 666  GLU A C     1 
ATOM   2119  O  O     . GLU A 1  402 ? 182.290 149.484 150.361 1.00 74.26  ? 666  GLU A O     1 
ATOM   2120  C  CB    . GLU A 1  402 ? 182.096 150.290 147.084 1.00 74.26  ? 666  GLU A CB    1 
ATOM   2121  C  CG    . GLU A 1  402 ? 182.584 149.800 145.729 1.00 74.26  ? 666  GLU A CG    1 
ATOM   2122  C  CD    . GLU A 1  402 ? 181.449 149.512 144.764 1.00 74.26  ? 666  GLU A CD    1 
ATOM   2123  O  OE1   . GLU A 1  402 ? 180.279 149.755 145.129 1.00 74.26  ? 666  GLU A OE1   1 
ATOM   2124  O  OE2   . GLU A 1  402 ? 181.727 149.043 143.641 1.00 74.26  ? 666  GLU A OE2   1 
ATOM   2125  N  N     . THR A 1  403 ? 180.404 150.488 149.650 1.00 71.86  ? 667  THR A N     1 
ATOM   2126  C  CA    . THR A 1  403 ? 180.126 151.058 150.964 1.00 71.86  ? 667  THR A CA    1 
ATOM   2127  C  C     . THR A 1  403 ? 179.883 149.967 151.999 1.00 71.86  ? 667  THR A C     1 
ATOM   2128  O  O     . THR A 1  403 ? 180.352 150.066 153.141 1.00 71.86  ? 667  THR A O     1 
ATOM   2129  C  CB    . THR A 1  403 ? 178.921 151.997 150.884 1.00 71.86  ? 667  THR A CB    1 
ATOM   2130  O  OG1   . THR A 1  403 ? 179.197 153.053 149.956 1.00 71.86  ? 667  THR A OG1   1 
ATOM   2131  C  CG2   . THR A 1  403 ? 178.619 152.596 152.247 1.00 71.86  ? 667  THR A CG2   1 
ATOM   2132  N  N     . LEU A 1  404 ? 179.156 148.916 151.616 1.00 70.91  ? 668  LEU A N     1 
ATOM   2133  C  CA    . LEU A 1  404 ? 178.873 147.825 152.544 1.00 70.91  ? 668  LEU A CA    1 
ATOM   2134  C  C     . LEU A 1  404 ? 180.163 147.187 153.044 1.00 70.91  ? 668  LEU A C     1 
ATOM   2135  O  O     . LEU A 1  404 ? 180.347 146.996 154.252 1.00 70.91  ? 668  LEU A O     1 
ATOM   2136  C  CB    . LEU A 1  404 ? 177.982 146.784 151.866 1.00 70.91  ? 668  LEU A CB    1 
ATOM   2137  C  CG    . LEU A 1  404 ? 177.457 145.642 152.735 1.00 70.91  ? 668  LEU A CG    1 
ATOM   2138  C  CD1   . LEU A 1  404 ? 176.527 146.185 153.806 1.00 70.91  ? 668  LEU A CD1   1 
ATOM   2139  C  CD2   . LEU A 1  404 ? 176.752 144.597 151.884 1.00 70.91  ? 668  LEU A CD2   1 
ATOM   2140  N  N     . THR A 1  405 ? 181.073 146.857 152.123 1.00 69.28  ? 669  THR A N     1 
ATOM   2141  C  CA    . THR A 1  405 ? 182.345 146.268 152.529 1.00 69.28  ? 669  THR A CA    1 
ATOM   2142  C  C     . THR A 1  405 ? 183.177 147.249 153.344 1.00 69.28  ? 669  THR A C     1 
ATOM   2143  O  O     . THR A 1  405 ? 183.807 146.860 154.334 1.00 69.28  ? 669  THR A O     1 
ATOM   2144  C  CB    . THR A 1  405 ? 183.129 145.798 151.305 1.00 69.28  ? 669  THR A CB    1 
ATOM   2145  O  OG1   . THR A 1  405 ? 183.373 146.910 150.435 1.00 69.28  ? 669  THR A OG1   1 
ATOM   2146  C  CG2   . THR A 1  405 ? 182.360 144.725 150.556 1.00 69.28  ? 669  THR A CG2   1 
ATOM   2147  N  N     . ALA A 1  406 ? 183.190 148.525 152.949 1.00 67.81  ? 670  ALA A N     1 
ATOM   2148  C  CA    . ALA A 1  406 ? 183.991 149.511 153.667 1.00 67.81  ? 670  ALA A CA    1 
ATOM   2149  C  C     . ALA A 1  406 ? 183.515 149.673 155.103 1.00 67.81  ? 670  ALA A C     1 
ATOM   2150  O  O     . ALA A 1  406 ? 184.318 149.935 156.006 1.00 67.81  ? 670  ALA A O     1 
ATOM   2151  C  CB    . ALA A 1  406 ? 183.953 150.851 152.935 1.00 67.81  ? 670  ALA A CB    1 
ATOM   2152  N  N     . ILE A 1  407 ? 182.212 149.520 155.337 1.00 68.72  ? 671  ILE A N     1 
ATOM   2153  C  CA    . ILE A 1  407 ? 181.702 149.680 156.694 1.00 68.72  ? 671  ILE A CA    1 
ATOM   2154  C  C     . ILE A 1  407 ? 181.864 148.389 157.489 1.00 68.72  ? 671  ILE A C     1 
ATOM   2155  O  O     . ILE A 1  407 ? 182.169 148.419 158.687 1.00 68.72  ? 671  ILE A O     1 
ATOM   2156  C  CB    . ILE A 1  407 ? 180.238 150.155 156.668 1.00 68.72  ? 671  ILE A CB    1 
ATOM   2157  C  CG1   . ILE A 1  407 ? 180.127 151.479 155.912 1.00 68.72  ? 671  ILE A CG1   1 
ATOM   2158  C  CG2   . ILE A 1  407 ? 179.705 150.313 158.083 1.00 68.72  ? 671  ILE A CG2   1 
ATOM   2159  C  CD1   . ILE A 1  407 ? 180.939 152.600 156.517 1.00 68.72  ? 671  ILE A CD1   1 
ATOM   2160  N  N     . LEU A 1  408 ? 181.679 147.238 156.845 1.00 67.21  ? 672  LEU A N     1 
ATOM   2161  C  CA    . LEU A 1  408 ? 181.699 145.969 157.561 1.00 67.21  ? 672  LEU A CA    1 
ATOM   2162  C  C     . LEU A 1  408 ? 183.083 145.341 157.662 1.00 67.21  ? 672  LEU A C     1 
ATOM   2163  O  O     . LEU A 1  408 ? 183.213 144.275 158.272 1.00 67.21  ? 672  LEU A O     1 
ATOM   2164  C  CB    . LEU A 1  408 ? 180.741 144.973 156.902 1.00 67.21  ? 672  LEU A CB    1 
ATOM   2165  C  CG    . LEU A 1  408 ? 179.248 145.285 156.992 1.00 67.21  ? 672  LEU A CG    1 
ATOM   2166  C  CD1   . LEU A 1  408 ? 178.448 144.239 156.231 1.00 67.21  ? 672  LEU A CD1   1 
ATOM   2167  C  CD2   . LEU A 1  408 ? 178.801 145.363 158.442 1.00 67.21  ? 672  LEU A CD2   1 
ATOM   2168  N  N     . SER A 1  409 ? 184.112 145.956 157.080 1.00 70.75  ? 673  SER A N     1 
ATOM   2169  C  CA    . SER A 1  409 ? 185.460 145.402 157.206 1.00 70.75  ? 673  SER A CA    1 
ATOM   2170  C  C     . SER A 1  409 ? 185.951 145.326 158.648 1.00 70.75  ? 673  SER A C     1 
ATOM   2171  O  O     . SER A 1  409 ? 186.488 144.272 159.035 1.00 70.75  ? 673  SER A O     1 
ATOM   2172  C  CB    . SER A 1  409 ? 186.427 146.204 156.329 1.00 70.75  ? 673  SER A CB    1 
ATOM   2173  O  OG    . SER A 1  409 ? 186.098 146.074 154.957 1.00 70.75  ? 673  SER A OG    1 
ATOM   2174  N  N     . PRO A 1  410 ? 185.824 146.367 159.485 1.00 72.95  ? 674  PRO A N     1 
ATOM   2175  C  CA    . PRO A 1  410 ? 186.340 146.242 160.860 1.00 72.95  ? 674  PRO A CA    1 
ATOM   2176  C  C     . PRO A 1  410 ? 185.649 145.162 161.674 1.00 72.95  ? 674  PRO A C     1 
ATOM   2177  O  O     . PRO A 1  410 ? 186.304 144.480 162.474 1.00 72.95  ? 674  PRO A O     1 
ATOM   2178  C  CB    . PRO A 1  410 ? 186.096 147.637 161.452 1.00 72.95  ? 674  PRO A CB    1 
ATOM   2179  C  CG    . PRO A 1  410 ? 186.014 148.540 160.281 1.00 72.95  ? 674  PRO A CG    1 
ATOM   2180  C  CD    . PRO A 1  410 ? 185.349 147.736 159.213 1.00 72.95  ? 674  PRO A CD    1 
ATOM   2181  N  N     . LEU A 1  411 ? 184.338 144.986 161.494 1.00 71.38  ? 675  LEU A N     1 
ATOM   2182  C  CA    . LEU A 1  411 ? 183.622 143.969 162.257 1.00 71.38  ? 675  LEU A CA    1 
ATOM   2183  C  C     . LEU A 1  411 ? 184.110 142.572 161.900 1.00 71.38  ? 675  LEU A C     1 
ATOM   2184  O  O     . LEU A 1  411 ? 184.379 141.754 162.787 1.00 71.38  ? 675  LEU A O     1 
ATOM   2185  C  CB    . LEU A 1  411 ? 182.116 144.088 162.016 1.00 71.38  ? 675  LEU A CB    1 
ATOM   2186  C  CG    . LEU A 1  411 ? 181.350 145.190 162.754 1.00 71.38  ? 675  LEU A CG    1 
ATOM   2187  C  CD1   . LEU A 1  411 ? 181.637 146.559 162.159 1.00 71.38  ? 675  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU A 1  411 ? 179.858 144.902 162.742 1.00 71.38  ? 675  LEU A CD2   1 
ATOM   2189  N  N     . ILE A 1  412 ? 184.237 142.285 160.602 1.00 71.63  ? 676  ILE A N     1 
ATOM   2190  C  CA    . ILE A 1  412 ? 184.733 140.981 160.173 1.00 71.63  ? 676  ILE A CA    1 
ATOM   2191  C  C     . ILE A 1  412 ? 186.174 140.786 160.626 1.00 71.63  ? 676  ILE A C     1 
ATOM   2192  O  O     . ILE A 1  412 ? 186.579 139.678 160.999 1.00 71.63  ? 676  ILE A O     1 
ATOM   2193  C  CB    . ILE A 1  412 ? 184.589 140.830 158.647 1.00 71.63  ? 676  ILE A CB    1 
ATOM   2194  C  CG1   . ILE A 1  412 ? 183.126 140.996 158.234 1.00 71.63  ? 676  ILE A CG1   1 
ATOM   2195  C  CG2   . ILE A 1  412 ? 185.119 139.481 158.187 1.00 71.63  ? 676  ILE A CG2   1 
ATOM   2196  C  CD1   . ILE A 1  412 ? 182.201 139.973 158.853 1.00 71.63  ? 676  ILE A CD1   1 
ATOM   2197  N  N     . ALA A 1  413 ? 186.967 141.860 160.613 1.00 74.45  ? 677  ALA A N     1 
ATOM   2198  C  CA    . ALA A 1  413 ? 188.348 141.765 161.076 1.00 74.45  ? 677  ALA A CA    1 
ATOM   2199  C  C     . ALA A 1  413 ? 188.409 141.370 162.547 1.00 74.45  ? 677  ALA A C     1 
ATOM   2200  O  O     . ALA A 1  413 ? 189.139 140.447 162.924 1.00 74.45  ? 677  ALA A O     1 
ATOM   2201  C  CB    . ALA A 1  413 ? 189.071 143.091 160.839 1.00 74.45  ? 677  ALA A CB    1 
ATOM   2202  N  N     . GLU A 1  414 ? 187.636 142.056 163.393 1.00 75.40  ? 678  GLU A N     1 
ATOM   2203  C  CA    . GLU A 1  414 ? 187.635 141.740 164.820 1.00 75.40  ? 678  GLU A CA    1 
ATOM   2204  C  C     . GLU A 1  414 ? 187.093 140.339 165.076 1.00 75.40  ? 678  GLU A C     1 
ATOM   2205  O  O     . GLU A 1  414 ? 187.592 139.617 165.952 1.00 75.40  ? 678  GLU A O     1 
ATOM   2206  C  CB    . GLU A 1  414 ? 186.819 142.785 165.583 1.00 75.40  ? 678  GLU A CB    1 
ATOM   2207  C  CG    . GLU A 1  414 ? 187.446 144.172 165.576 1.00 75.40  ? 678  GLU A CG    1 
ATOM   2208  C  CD    . GLU A 1  414 ? 186.596 145.217 166.272 1.00 75.40  ? 678  GLU A CD    1 
ATOM   2209  O  OE1   . GLU A 1  414 ? 185.445 144.905 166.639 1.00 75.40  ? 678  GLU A OE1   1 
ATOM   2210  O  OE2   . GLU A 1  414 ? 187.080 146.355 166.454 1.00 75.40  ? 678  GLU A OE2   1 
ATOM   2211  N  N     . ARG A 1  415 ? 186.073 139.936 164.314 1.00 75.19  ? 679  ARG A N     1 
ATOM   2212  C  CA    . ARG A 1  415 ? 185.520 138.593 164.445 1.00 75.19  ? 679  ARG A CA    1 
ATOM   2213  C  C     . ARG A 1  415 ? 186.570 137.535 164.134 1.00 75.19  ? 679  ARG A C     1 
ATOM   2214  O  O     . ARG A 1  415 ? 186.795 136.613 164.927 1.00 75.19  ? 679  ARG A O     1 
ATOM   2215  C  CB    . ARG A 1  415 ? 184.313 138.445 163.520 1.00 75.19  ? 679  ARG A CB    1 
ATOM   2216  C  CG    . ARG A 1  415 ? 183.615 137.102 163.590 1.00 75.19  ? 679  ARG A CG    1 
ATOM   2217  C  CD    . ARG A 1  415 ? 182.417 137.084 162.657 1.00 75.19  ? 679  ARG A CD    1 
ATOM   2218  N  NE    . ARG A 1  415 ? 181.678 135.828 162.722 1.00 75.19  ? 679  ARG A NE    1 
ATOM   2219  C  CZ    . ARG A 1  415 ? 181.919 134.779 161.945 1.00 75.19  ? 679  ARG A CZ    1 
ATOM   2220  N  NH1   . ARG A 1  415 ? 182.883 134.830 161.037 1.00 75.19  ? 679  ARG A NH1   1 
ATOM   2221  N  NH2   . ARG A 1  415 ? 181.193 133.677 162.075 1.00 75.19  ? 679  ARG A NH2   1 
ATOM   2222  N  N     . GLU A 1  416 ? 187.219 137.649 162.972 1.00 78.96  ? 680  GLU A N     1 
ATOM   2223  C  CA    . GLU A 1  416 ? 188.252 136.689 162.601 1.00 78.96  ? 680  GLU A CA    1 
ATOM   2224  C  C     . GLU A 1  416 ? 189.427 136.734 163.566 1.00 78.96  ? 680  GLU A C     1 
ATOM   2225  O  O     . GLU A 1  416 ? 190.106 135.720 163.766 1.00 78.96  ? 680  GLU A O     1 
ATOM   2226  C  CB    . GLU A 1  416 ? 188.721 136.955 161.169 1.00 78.96  ? 680  GLU A CB    1 
ATOM   2227  C  CG    . GLU A 1  416 ? 189.776 135.984 160.653 1.00 78.96  ? 680  GLU A CG    1 
ATOM   2228  C  CD    . GLU A 1  416 ? 189.259 134.562 160.531 1.00 78.96  ? 680  GLU A CD    1 
ATOM   2229  O  OE1   . GLU A 1  416 ? 188.038 134.381 160.345 1.00 78.96  ? 680  GLU A OE1   1 
ATOM   2230  O  OE2   . GLU A 1  416 ? 190.078 133.623 160.625 1.00 78.96  ? 680  GLU A OE2   1 
ATOM   2231  N  N     . ALA A 1  417 ? 189.678 137.890 164.182 1.00 77.92  ? 681  ALA A N     1 
ATOM   2232  C  CA    . ALA A 1  417 ? 190.776 137.994 165.134 1.00 77.92  ? 681  ALA A CA    1 
ATOM   2233  C  C     . ALA A 1  417 ? 190.474 137.206 166.401 1.00 77.92  ? 681  ALA A C     1 
ATOM   2234  O  O     . ALA A 1  417 ? 191.291 136.398 166.857 1.00 77.92  ? 681  ALA A O     1 
ATOM   2235  C  CB    . ALA A 1  417 ? 191.049 139.463 165.461 1.00 77.92  ? 681  ALA A CB    1 
ATOM   2236  N  N     . MET A 1  418 ? 189.298 137.429 166.986 1.00 75.32  ? 682  MET A N     1 
ATOM   2237  C  CA    . MET A 1  418 ? 188.983 136.760 168.242 1.00 75.32  ? 682  MET A CA    1 
ATOM   2238  C  C     . MET A 1  418 ? 188.414 135.358 168.058 1.00 75.32  ? 682  MET A C     1 
ATOM   2239  O  O     . MET A 1  418 ? 188.143 134.689 169.060 1.00 75.32  ? 682  MET A O     1 
ATOM   2240  C  CB    . MET A 1  418 ? 188.028 137.616 169.069 1.00 75.32  ? 682  MET A CB    1 
ATOM   2241  C  CG    . MET A 1  418 ? 186.685 137.855 168.442 1.00 75.32  ? 682  MET A CG    1 
ATOM   2242  S  SD    . MET A 1  418 ? 185.725 138.920 169.524 1.00 75.32  ? 682  MET A SD    1 
ATOM   2243  C  CE    . MET A 1  418 ? 186.493 140.506 169.207 1.00 75.32  ? 682  MET A CE    1 
ATOM   2244  N  N     . LYS A 1  419 ? 188.230 134.888 166.821 1.00 73.83  ? 683  LYS A N     1 
ATOM   2245  C  CA    . LYS A 1  419 ? 187.871 133.481 166.653 1.00 73.83  ? 683  LYS A CA    1 
ATOM   2246  C  C     . LYS A 1  419 ? 189.015 132.523 166.965 1.00 73.83  ? 683  LYS A C     1 
ATOM   2247  O  O     . LYS A 1  419 ? 188.853 131.315 166.756 1.00 73.83  ? 683  LYS A O     1 
ATOM   2248  C  CB    . LYS A 1  419 ? 187.366 133.218 165.232 1.00 73.83  ? 683  LYS A CB    1 
ATOM   2249  C  CG    . LYS A 1  419 ? 185.947 133.693 164.977 1.00 73.83  ? 683  LYS A CG    1 
ATOM   2250  C  CD    . LYS A 1  419 ? 185.571 133.583 163.504 1.00 73.83  ? 683  LYS A CD    1 
ATOM   2251  C  CE    . LYS A 1  419 ? 185.396 132.136 163.065 1.00 73.83  ? 683  LYS A CE    1 
ATOM   2252  N  NZ    . LYS A 1  419 ? 184.927 132.039 161.652 1.00 73.83  ? 683  LYS A NZ    1 
ATOM   2253  N  N     . SER A 1  420 ? 190.153 133.014 167.451 1.00 75.64  ? 684  SER A N     1 
ATOM   2254  C  CA    . SER A 1  420 ? 191.286 132.168 167.809 1.00 75.64  ? 684  SER A CA    1 
ATOM   2255  C  C     . SER A 1  420 ? 191.877 132.612 169.138 1.00 75.64  ? 684  SER A C     1 
ATOM   2256  O  O     . SER A 1  420 ? 193.098 132.673 169.306 1.00 75.64  ? 684  SER A O     1 
ATOM   2257  C  CB    . SER A 1  420 ? 192.354 132.182 166.717 1.00 75.64  ? 684  SER A CB    1 
ATOM   2258  O  OG    . SER A 1  420 ? 191.858 131.632 165.511 1.00 75.64  ? 684  SER A OG    1 
ATOM   2259  N  N     . SER A 1  421 ? 191.017 132.936 170.100 1.00 73.82  ? 685  SER A N     1 
ATOM   2260  C  CA    . SER A 1  421 ? 191.461 133.395 171.408 1.00 73.82  ? 685  SER A CA    1 
ATOM   2261  C  C     . SER A 1  421 ? 190.432 132.973 172.448 1.00 73.82  ? 685  SER A C     1 
ATOM   2262  O  O     . SER A 1  421 ? 189.418 132.345 172.129 1.00 73.82  ? 685  SER A O     1 
ATOM   2263  C  CB    . SER A 1  421 ? 191.675 134.912 171.413 1.00 73.82  ? 685  SER A CB    1 
ATOM   2264  O  OG    . SER A 1  421 ? 192.056 135.370 172.698 1.00 73.82  ? 685  SER A OG    1 
ATOM   2265  N  N     . GLU A 1  422 ? 190.698 133.327 173.703 1.00 73.13  ? 686  GLU A N     1 
ATOM   2266  C  CA    . GLU A 1  422 ? 189.787 133.035 174.799 1.00 73.13  ? 686  GLU A CA    1 
ATOM   2267  C  C     . GLU A 1  422 ? 189.699 134.246 175.715 1.00 73.13  ? 686  GLU A C     1 
ATOM   2268  O  O     . GLU A 1  422 ? 190.690 134.941 175.950 1.00 73.13  ? 686  GLU A O     1 
ATOM   2269  C  CB    . GLU A 1  422 ? 190.226 131.795 175.590 1.00 73.13  ? 686  GLU A CB    1 
ATOM   2270  C  CG    . GLU A 1  422 ? 191.552 131.945 176.314 1.00 73.13  ? 686  GLU A CG    1 
ATOM   2271  C  CD    . GLU A 1  422 ? 191.966 130.676 177.031 1.00 73.13  ? 686  GLU A CD    1 
ATOM   2272  O  OE1   . GLU A 1  422 ? 191.229 129.673 176.935 1.00 73.13  ? 686  GLU A OE1   1 
ATOM   2273  O  OE2   . GLU A 1  422 ? 193.026 130.682 177.691 1.00 73.13  ? 686  GLU A OE2   1 
ATOM   2274  N  N     . LEU A 1  423 ? 188.497 134.495 176.223 1.00 73.24  ? 687  LEU A N     1 
ATOM   2275  C  CA    . LEU A 1  423 ? 188.218 135.661 177.048 1.00 73.24  ? 687  LEU A CA    1 
ATOM   2276  C  C     . LEU A 1  423 ? 188.143 135.264 178.514 1.00 73.24  ? 687  LEU A C     1 
ATOM   2277  O  O     . LEU A 1  423 ? 187.613 134.202 178.855 1.00 73.24  ? 687  LEU A O     1 
ATOM   2278  C  CB    . LEU A 1  423 ? 186.905 136.324 176.629 1.00 73.24  ? 687  LEU A CB    1 
ATOM   2279  C  CG    . LEU A 1  423 ? 186.503 137.596 177.376 1.00 73.24  ? 687  LEU A CG    1 
ATOM   2280  C  CD1   . LEU A 1  423 ? 187.523 138.693 177.138 1.00 73.24  ? 687  LEU A CD1   1 
ATOM   2281  C  CD2   . LEU A 1  423 ? 185.117 138.046 176.950 1.00 73.24  ? 687  LEU A CD2   1 
ATOM   2282  N  N     . THR A 1  424 ? 188.667 136.126 179.380 1.00 76.01  ? 688  THR A N     1 
ATOM   2283  C  CA    . THR A 1  424 ? 188.578 135.937 180.819 1.00 76.01  ? 688  THR A CA    1 
ATOM   2284  C  C     . THR A 1  424 ? 188.038 137.204 181.467 1.00 76.01  ? 688  THR A C     1 
ATOM   2285  O  O     . THR A 1  424 ? 188.355 138.318 181.039 1.00 76.01  ? 688  THR A O     1 
ATOM   2286  C  CB    . THR A 1  424 ? 189.940 135.561 181.426 1.00 76.01  ? 688  THR A CB    1 
ATOM   2287  O  OG1   . THR A 1  424 ? 189.779 135.268 182.820 1.00 76.01  ? 688  THR A OG1   1 
ATOM   2288  C  CG2   . THR A 1  424 ? 190.946 136.686 181.258 1.00 76.01  ? 688  THR A CG2   1 
ATOM   2289  N  N     . LEU A 1  425 ? 187.204 137.023 182.487 1.00 77.22  ? 689  LEU A N     1 
ATOM   2290  C  CA    . LEU A 1  425 ? 186.625 138.137 183.225 1.00 77.22  ? 689  LEU A CA    1 
ATOM   2291  C  C     . LEU A 1  425 ? 186.071 137.601 184.535 1.00 77.22  ? 689  LEU A C     1 
ATOM   2292  O  O     . LEU A 1  425 ? 185.771 136.411 184.661 1.00 77.22  ? 689  LEU A O     1 
ATOM   2293  C  CB    . LEU A 1  425 ? 185.542 138.856 182.408 1.00 77.22  ? 689  LEU A CB    1 
ATOM   2294  C  CG    . LEU A 1  425 ? 184.317 138.073 181.928 1.00 77.22  ? 689  LEU A CG    1 
ATOM   2295  C  CD1   . LEU A 1  425 ? 183.215 138.066 182.974 1.00 77.22  ? 689  LEU A CD1   1 
ATOM   2296  C  CD2   . LEU A 1  425 ? 183.808 138.646 180.615 1.00 77.22  ? 689  LEU A CD2   1 
ATOM   2297  N  N     . GLU A 1  426 ? 185.930 138.497 185.507 1.00 80.97  ? 690  GLU A N     1 
ATOM   2298  C  CA    . GLU A 1  426 ? 185.539 138.137 186.868 1.00 80.97  ? 690  GLU A CA    1 
ATOM   2299  C  C     . GLU A 1  426 ? 184.076 138.508 187.088 1.00 80.97  ? 690  GLU A C     1 
ATOM   2300  O  O     . GLU A 1  426 ? 183.749 139.677 187.312 1.00 80.97  ? 690  GLU A O     1 
ATOM   2301  C  CB    . GLU A 1  426 ? 186.440 138.828 187.888 1.00 80.97  ? 690  GLU A CB    1 
ATOM   2302  N  N     . MET A 1  427 ? 183.199 137.510 187.023 1.00 85.94  ? 691  MET A N     1 
ATOM   2303  C  CA    . MET A 1  427 ? 181.809 137.659 187.426 1.00 85.94  ? 691  MET A CA    1 
ATOM   2304  C  C     . MET A 1  427 ? 181.594 136.931 188.745 1.00 85.94  ? 691  MET A C     1 
ATOM   2305  O  O     . MET A 1  427 ? 182.125 135.836 188.955 1.00 85.94  ? 691  MET A O     1 
ATOM   2306  C  CB    . MET A 1  427 ? 180.844 137.123 186.362 1.00 85.94  ? 691  MET A CB    1 
ATOM   2307  C  CG    . MET A 1  427 ? 180.949 135.632 186.090 1.00 85.94  ? 691  MET A CG    1 
ATOM   2308  S  SD    . MET A 1  427 ? 179.741 135.069 184.876 1.00 85.94  ? 691  MET A SD    1 
ATOM   2309  C  CE    . MET A 1  427 ? 180.395 135.788 183.374 1.00 85.94  ? 691  MET A CE    1 
ATOM   2310  N  N     . GLY A 1  428 ? 180.825 137.549 189.637 1.00 85.24  ? 692  GLY A N     1 
ATOM   2311  C  CA    . GLY A 1  428 ? 180.634 136.982 190.960 1.00 85.24  ? 692  GLY A CA    1 
ATOM   2312  C  C     . GLY A 1  428 ? 181.907 136.884 191.770 1.00 85.24  ? 692  GLY A C     1 
ATOM   2313  O  O     . GLY A 1  428 ? 182.014 136.018 192.644 1.00 85.24  ? 692  GLY A O     1 
ATOM   2314  N  N     . GLY A 1  429 ? 182.881 137.750 191.498 1.00 86.82  ? 693  GLY A N     1 
ATOM   2315  C  CA    . GLY A 1  429 ? 184.139 137.727 192.215 1.00 86.82  ? 693  GLY A CA    1 
ATOM   2316  C  C     . GLY A 1  429 ? 185.095 136.627 191.816 1.00 86.82  ? 693  GLY A C     1 
ATOM   2317  O  O     . GLY A 1  429 ? 186.142 136.479 192.453 1.00 86.82  ? 693  GLY A O     1 
ATOM   2318  N  N     . ILE A 1  430 ? 184.777 135.854 190.782 1.00 84.68  ? 694  ILE A N     1 
ATOM   2319  C  CA    . ILE A 1  430 ? 185.635 134.757 190.341 1.00 84.68  ? 694  ILE A CA    1 
ATOM   2320  C  C     . ILE A 1  430 ? 185.929 134.916 188.854 1.00 84.68  ? 694  ILE A C     1 
ATOM   2321  O  O     . ILE A 1  430 ? 184.995 135.051 188.050 1.00 84.68  ? 694  ILE A O     1 
ATOM   2322  C  CB    . ILE A 1  430 ? 184.991 133.392 190.629 1.00 84.68  ? 694  ILE A CB    1 
ATOM   2323  C  CG1   . ILE A 1  430 ? 184.726 133.227 192.126 1.00 84.68  ? 694  ILE A CG1   1 
ATOM   2324  C  CG2   . ILE A 1  430 ? 185.877 132.268 190.119 1.00 84.68  ? 694  ILE A CG2   1 
ATOM   2325  C  CD1   . ILE A 1  430 ? 185.976 133.260 192.975 1.00 84.68  ? 694  ILE A CD1   1 
ATOM   2326  N  N     . PRO A 1  431 ? 187.196 134.909 188.442 1.00 81.40  ? 695  PRO A N     1 
ATOM   2327  C  CA    . PRO A 1  431 ? 187.502 135.002 187.010 1.00 81.40  ? 695  PRO A CA    1 
ATOM   2328  C  C     . PRO A 1  431 ? 187.122 133.722 186.283 1.00 81.40  ? 695  PRO A C     1 
ATOM   2329  O  O     . PRO A 1  431 ? 187.298 132.616 186.798 1.00 81.40  ? 695  PRO A O     1 
ATOM   2330  C  CB    . PRO A 1  431 ? 189.016 135.235 186.986 1.00 81.40  ? 695  PRO A CB    1 
ATOM   2331  C  CG    . PRO A 1  431 ? 189.503 134.625 188.255 1.00 81.40  ? 695  PRO A CG    1 
ATOM   2332  C  CD    . PRO A 1  431 ? 188.414 134.848 189.268 1.00 81.40  ? 695  PRO A CD    1 
ATOM   2333  N  N     . ARG A 1  432 ? 186.596 133.883 185.073 1.00 82.08  ? 696  ARG A N     1 
ATOM   2334  C  CA    . ARG A 1  432 ? 186.113 132.771 184.267 1.00 82.08  ? 696  ARG A CA    1 
ATOM   2335  C  C     . ARG A 1  432 ? 186.905 132.696 182.961 1.00 82.08  ? 696  ARG A C     1 
ATOM   2336  O  O     . ARG A 1  432 ? 187.881 133.421 182.757 1.00 82.08  ? 696  ARG A O     1 
ATOM   2337  C  CB    . ARG A 1  432 ? 184.612 132.914 184.012 1.00 82.08  ? 696  ARG A CB    1 
ATOM   2338  C  CG    . ARG A 1  432 ? 183.776 132.945 185.278 1.00 82.08  ? 696  ARG A CG    1 
ATOM   2339  C  CD    . ARG A 1  432 ? 183.810 131.604 185.986 1.00 82.08  ? 696  ARG A CD    1 
ATOM   2340  N  NE    . ARG A 1  432 ? 183.031 131.617 187.220 1.00 82.08  ? 696  ARG A NE    1 
ATOM   2341  C  CZ    . ARG A 1  432 ? 181.742 131.306 187.291 1.00 82.08  ? 696  ARG A CZ    1 
ATOM   2342  N  NH1   . ARG A 1  432 ? 181.111 131.345 188.456 1.00 82.08  ? 696  ARG A NH1   1 
ATOM   2343  N  NH2   . ARG A 1  432 ? 181.084 130.955 186.195 1.00 82.08  ? 696  ARG A NH2   1 
ATOM   2344  N  N     . THR A 1  433 ? 186.475 131.800 182.074 1.00 76.35  ? 697  THR A N     1 
ATOM   2345  C  CA    . THR A 1  433 ? 187.104 131.617 180.774 1.00 76.35  ? 697  THR A CA    1 
ATOM   2346  C  C     . THR A 1  433 ? 186.025 131.311 179.747 1.00 76.35  ? 697  THR A C     1 
ATOM   2347  O  O     . THR A 1  433 ? 185.116 130.520 180.011 1.00 76.35  ? 697  THR A O     1 
ATOM   2348  C  CB    . THR A 1  433 ? 188.143 130.488 180.806 1.00 76.35  ? 697  THR A CB    1 
ATOM   2349  O  OG1   . THR A 1  433 ? 189.151 130.792 181.777 1.00 76.35  ? 697  THR A OG1   1 
ATOM   2350  C  CG2   . THR A 1  433 ? 188.800 130.324 179.444 1.00 76.35  ? 697  THR A CG2   1 
ATOM   2351  N  N     . PHE A 1  434 ? 186.127 131.937 178.576 1.00 71.75  ? 698  PHE A N     1 
ATOM   2352  C  CA    . PHE A 1  434 ? 185.102 131.810 177.553 1.00 71.75  ? 698  PHE A CA    1 
ATOM   2353  C  C     . PHE A 1  434 ? 185.739 131.553 176.196 1.00 71.75  ? 698  PHE A C     1 
ATOM   2354  O  O     . PHE A 1  434 ? 186.833 132.041 175.899 1.00 71.75  ? 698  PHE A O     1 
ATOM   2355  C  CB    . PHE A 1  434 ? 184.224 133.065 177.481 1.00 71.75  ? 698  PHE A CB    1 
ATOM   2356  C  CG    . PHE A 1  434 ? 183.371 133.273 178.695 1.00 71.75  ? 698  PHE A CG    1 
ATOM   2357  C  CD1   . PHE A 1  434 ? 182.174 132.596 178.839 1.00 71.75  ? 698  PHE A CD1   1 
ATOM   2358  C  CD2   . PHE A 1  434 ? 183.769 134.142 179.695 1.00 71.75  ? 698  PHE A CD2   1 
ATOM   2359  C  CE1   . PHE A 1  434 ? 181.388 132.782 179.957 1.00 71.75  ? 698  PHE A CE1   1 
ATOM   2360  C  CE2   . PHE A 1  434 ? 182.986 134.333 180.814 1.00 71.75  ? 698  PHE A CE2   1 
ATOM   2361  C  CZ    . PHE A 1  434 ? 181.795 133.652 180.945 1.00 71.75  ? 698  PHE A CZ    1 
ATOM   2362  N  N     . LYS A 1  435 ? 185.034 130.778 175.375 1.00 71.53  ? 699  LYS A N     1 
ATOM   2363  C  CA    . LYS A 1  435 ? 185.421 130.519 173.997 1.00 71.53  ? 699  LYS A CA    1 
ATOM   2364  C  C     . LYS A 1  435 ? 184.194 130.680 173.115 1.00 71.53  ? 699  LYS A C     1 
ATOM   2365  O  O     . LYS A 1  435 ? 183.084 130.315 173.513 1.00 71.53  ? 699  LYS A O     1 
ATOM   2366  C  CB    . LYS A 1  435 ? 186.019 129.118 173.830 1.00 71.53  ? 699  LYS A CB    1 
ATOM   2367  C  CG    . LYS A 1  435 ? 187.364 128.942 174.510 1.00 71.53  ? 699  LYS A CG    1 
ATOM   2368  C  CD    . LYS A 1  435 ? 187.921 127.548 174.286 1.00 71.53  ? 699  LYS A CD    1 
ATOM   2369  C  CE    . LYS A 1  435 ? 189.255 127.374 174.993 1.00 71.53  ? 699  LYS A CE    1 
ATOM   2370  N  NZ    . LYS A 1  435 ? 189.822 126.012 174.793 1.00 71.53  ? 699  LYS A NZ    1 
ATOM   2371  N  N     . PHE A 1  436 ? 184.395 131.227 171.921 1.00 67.66  ? 700  PHE A N     1 
ATOM   2372  C  CA    . PHE A 1  436 ? 183.299 131.579 171.034 1.00 67.66  ? 700  PHE A CA    1 
ATOM   2373  C  C     . PHE A 1  436 ? 183.323 130.731 169.766 1.00 67.66  ? 700  PHE A C     1 
ATOM   2374  O  O     . PHE A 1  436 ? 184.383 130.389 169.234 1.00 67.66  ? 700  PHE A O     1 
ATOM   2375  C  CB    . PHE A 1  436 ? 183.357 133.067 170.669 1.00 67.66  ? 700  PHE A CB    1 
ATOM   2376  C  CG    . PHE A 1  436 ? 183.114 133.992 171.832 1.00 67.66  ? 700  PHE A CG    1 
ATOM   2377  C  CD1   . PHE A 1  436 ? 181.828 134.271 172.262 1.00 67.66  ? 700  PHE A CD1   1 
ATOM   2378  C  CD2   . PHE A 1  436 ? 184.177 134.591 172.487 1.00 67.66  ? 700  PHE A CD2   1 
ATOM   2379  C  CE1   . PHE A 1  436 ? 181.608 135.125 173.326 1.00 67.66  ? 700  PHE A CE1   1 
ATOM   2380  C  CE2   . PHE A 1  436 ? 183.963 135.444 173.550 1.00 67.66  ? 700  PHE A CE2   1 
ATOM   2381  C  CZ    . PHE A 1  436 ? 182.678 135.712 173.970 1.00 67.66  ? 700  PHE A CZ    1 
ATOM   2382  N  N     . ILE A 1  437 ? 182.123 130.389 169.298 1.00 67.28  ? 701  ILE A N     1 
ATOM   2383  C  CA    . ILE A 1  437 ? 181.904 129.684 168.037 1.00 67.28  ? 701  ILE A CA    1 
ATOM   2384  C  C     . ILE A 1  437 ? 180.756 130.408 167.345 1.00 67.28  ? 701  ILE A C     1 
ATOM   2385  O  O     . ILE A 1  437 ? 179.590 130.210 167.706 1.00 67.28  ? 701  ILE A O     1 
ATOM   2386  C  CB    . ILE A 1  437 ? 181.565 128.197 168.234 1.00 67.28  ? 701  ILE A CB    1 
ATOM   2387  C  CG1   . ILE A 1  437 ? 182.724 127.461 168.912 1.00 67.28  ? 701  ILE A CG1   1 
ATOM   2388  C  CG2   . ILE A 1  437 ? 181.236 127.546 166.901 1.00 67.28  ? 701  ILE A CG2   1 
ATOM   2389  C  CD1   . ILE A 1  437 ? 182.386 126.053 169.356 1.00 67.28  ? 701  ILE A CD1   1 
ATOM   2390  N  N     . PHE A 1  438 ? 181.079 131.266 166.381 1.00 70.73  ? 702  PHE A N     1 
ATOM   2391  C  CA    . PHE A 1  438 ? 180.083 132.119 165.748 1.00 70.73  ? 702  PHE A CA    1 
ATOM   2392  C  C     . PHE A 1  438 ? 179.504 131.449 164.510 1.00 70.73  ? 702  PHE A C     1 
ATOM   2393  O  O     . PHE A 1  438 ? 180.203 130.747 163.776 1.00 70.73  ? 702  PHE A O     1 
ATOM   2394  C  CB    . PHE A 1  438 ? 180.688 133.473 165.371 1.00 70.73  ? 702  PHE A CB    1 
ATOM   2395  C  CG    . PHE A 1  438 ? 181.238 134.230 166.542 1.00 70.73  ? 702  PHE A CG    1 
ATOM   2396  C  CD1   . PHE A 1  438 ? 180.384 134.789 167.472 1.00 70.73  ? 702  PHE A CD1   1 
ATOM   2397  C  CD2   . PHE A 1  438 ? 182.602 134.404 166.703 1.00 70.73  ? 702  PHE A CD2   1 
ATOM   2398  C  CE1   . PHE A 1  438 ? 180.866 135.473 168.553 1.00 70.73  ? 702  PHE A CE1   1 
ATOM   2399  C  CE2   . PHE A 1  438 ? 183.092 135.108 167.781 1.00 70.73  ? 702  PHE A CE2   1 
ATOM   2400  C  CZ    . PHE A 1  438 ? 182.222 135.646 168.708 1.00 70.73  ? 702  PHE A CZ    1 
ATOM   2401  N  N     . ARG A 1  439 ? 178.215 131.695 164.272 1.00 75.82  ? 703  ARG A N     1 
ATOM   2402  C  CA    . ARG A 1  439 ? 177.484 131.061 163.172 1.00 75.82  ? 703  ARG A CA    1 
ATOM   2403  C  C     . ARG A 1  439 ? 176.591 132.109 162.514 1.00 75.82  ? 703  ARG A C     1 
ATOM   2404  O  O     . ARG A 1  439 ? 175.615 132.563 163.117 1.00 75.82  ? 703  ARG A O     1 
ATOM   2405  C  CB    . ARG A 1  439 ? 176.657 129.885 163.673 1.00 75.82  ? 703  ARG A CB    1 
ATOM   2406  C  CG    . ARG A 1  439 ? 177.464 128.749 164.266 1.00 75.82  ? 703  ARG A CG    1 
ATOM   2407  C  CD    . ARG A 1  439 ? 176.552 127.665 164.812 1.00 75.82  ? 703  ARG A CD    1 
ATOM   2408  N  NE    . ARG A 1  439 ? 175.765 127.055 163.749 1.00 75.82  ? 703  ARG A NE    1 
ATOM   2409  C  CZ    . ARG A 1  439 ? 176.194 126.053 162.989 1.00 75.82  ? 703  ARG A CZ    1 
ATOM   2410  N  NH1   . ARG A 1  439 ? 175.415 125.560 162.039 1.00 75.82  ? 703  ARG A NH1   1 
ATOM   2411  N  NH2   . ARG A 1  439 ? 177.408 125.552 163.175 1.00 75.82  ? 703  ARG A NH2   1 
ATOM   2412  N  N     . GLY A 1  440 ? 176.912 132.474 161.275 1.00 77.70  ? 704  GLY A N     1 
ATOM   2413  C  CA    . GLY A 1  440 ? 176.093 133.417 160.538 1.00 77.70  ? 704  GLY A CA    1 
ATOM   2414  C  C     . GLY A 1  440 ? 175.017 132.739 159.716 1.00 77.70  ? 704  GLY A C     1 
ATOM   2415  O  O     . GLY A 1  440 ? 175.293 132.221 158.630 1.00 77.70  ? 704  GLY A O     1 
ATOM   2416  N  N     . THR A 1  441 ? 173.784 132.733 160.222 1.00 78.37  ? 705  THR A N     1 
ATOM   2417  C  CA    . THR A 1  441 ? 172.679 132.058 159.552 1.00 78.37  ? 705  THR A CA    1 
ATOM   2418  C  C     . THR A 1  441 ? 171.472 132.943 159.284 1.00 78.37  ? 705  THR A C     1 
ATOM   2419  O  O     . THR A 1  441 ? 170.601 132.537 158.506 1.00 78.37  ? 705  THR A O     1 
ATOM   2420  C  CB    . THR A 1  441 ? 172.213 130.841 160.368 1.00 78.37  ? 705  THR A CB    1 
ATOM   2421  O  OG1   . THR A 1  441 ? 171.759 131.273 161.656 1.00 78.37  ? 705  THR A OG1   1 
ATOM   2422  C  CG2   . THR A 1  441 ? 173.349 129.843 160.543 1.00 78.37  ? 705  THR A CG2   1 
ATOM   2423  N  N     . GLY A 1  442 ? 171.385 134.126 159.887 1.00 75.32  ? 706  GLY A N     1 
ATOM   2424  C  CA    . GLY A 1  442 ? 170.243 134.994 159.686 1.00 75.32  ? 706  GLY A CA    1 
ATOM   2425  C  C     . GLY A 1  442 ? 170.343 135.861 158.448 1.00 75.32  ? 706  GLY A C     1 
ATOM   2426  O  O     . GLY A 1  442 ? 170.056 137.061 158.499 1.00 75.32  ? 706  GLY A O     1 
ATOM   2427  N  N     . TYR A 1  443 ? 170.748 135.266 157.329 1.00 76.90  ? 707  TYR A N     1 
ATOM   2428  C  CA    . TYR A 1  443 ? 170.918 135.976 156.068 1.00 76.90  ? 707  TYR A CA    1 
ATOM   2429  C  C     . TYR A 1  443 ? 169.947 135.402 155.047 1.00 76.90  ? 707  TYR A C     1 
ATOM   2430  O  O     . TYR A 1  443 ? 169.858 134.179 154.893 1.00 76.90  ? 707  TYR A O     1 
ATOM   2431  C  CB    . TYR A 1  443 ? 172.355 135.854 155.553 1.00 76.90  ? 707  TYR A CB    1 
ATOM   2432  C  CG    . TYR A 1  443 ? 173.397 136.548 156.400 1.00 76.90  ? 707  TYR A CG    1 
ATOM   2433  C  CD1   . TYR A 1  443 ? 173.037 137.481 157.362 1.00 76.90  ? 707  TYR A CD1   1 
ATOM   2434  C  CD2   . TYR A 1  443 ? 174.747 136.269 156.234 1.00 76.90  ? 707  TYR A CD2   1 
ATOM   2435  C  CE1   . TYR A 1  443 ? 173.991 138.113 158.135 1.00 76.90  ? 707  TYR A CE1   1 
ATOM   2436  C  CE2   . TYR A 1  443 ? 175.707 136.897 157.002 1.00 76.90  ? 707  TYR A CE2   1 
ATOM   2437  C  CZ    . TYR A 1  443 ? 175.324 137.819 157.950 1.00 76.90  ? 707  TYR A CZ    1 
ATOM   2438  O  OH    . TYR A 1  443 ? 176.276 138.447 158.718 1.00 76.90  ? 707  TYR A OH    1 
ATOM   2439  N  N     . ASP A 1  444 ? 169.221 136.277 154.356 1.00 82.86  ? 708  ASP A N     1 
ATOM   2440  C  CA    . ASP A 1  444 ? 168.406 135.825 153.240 1.00 82.86  ? 708  ASP A CA    1 
ATOM   2441  C  C     . ASP A 1  444 ? 169.297 135.456 152.056 1.00 82.86  ? 708  ASP A C     1 
ATOM   2442  O  O     . ASP A 1  444 ? 170.485 135.788 152.012 1.00 82.86  ? 708  ASP A O     1 
ATOM   2443  C  CB    . ASP A 1  444 ? 167.384 136.893 152.841 1.00 82.86  ? 708  ASP A CB    1 
ATOM   2444  C  CG    . ASP A 1  444 ? 168.026 138.208 152.435 1.00 82.86  ? 708  ASP A CG    1 
ATOM   2445  O  OD1   . ASP A 1  444 ? 169.262 138.339 152.544 1.00 82.86  ? 708  ASP A OD1   1 
ATOM   2446  O  OD2   . ASP A 1  444 ? 167.288 139.117 152.001 1.00 82.86  ? 708  ASP A OD2   1 
ATOM   2447  N  N     . GLU A 1  445 ? 168.703 134.762 151.082 1.00 82.01  ? 709  GLU A N     1 
ATOM   2448  C  CA    . GLU A 1  445 ? 169.494 134.181 150.001 1.00 82.01  ? 709  GLU A CA    1 
ATOM   2449  C  C     . GLU A 1  445 ? 170.193 135.244 149.160 1.00 82.01  ? 709  GLU A C     1 
ATOM   2450  O  O     . GLU A 1  445 ? 171.304 135.008 148.673 1.00 82.01  ? 709  GLU A O     1 
ATOM   2451  C  CB    . GLU A 1  445 ? 168.611 133.301 149.117 1.00 82.01  ? 709  GLU A CB    1 
ATOM   2452  C  CG    . GLU A 1  445 ? 169.373 132.555 148.032 1.00 82.01  ? 709  GLU A CG    1 
ATOM   2453  C  CD    . GLU A 1  445 ? 168.488 131.630 147.221 1.00 82.01  ? 709  GLU A CD    1 
ATOM   2454  O  OE1   . GLU A 1  445 ? 167.269 131.583 147.489 1.00 82.01  ? 709  GLU A OE1   1 
ATOM   2455  O  OE2   . GLU A 1  445 ? 169.012 130.949 146.314 1.00 82.01  ? 709  GLU A OE2   1 
ATOM   2456  N  N     . LYS A 1  446 ? 169.575 136.413 148.986 1.00 77.23  ? 710  LYS A N     1 
ATOM   2457  C  CA    . LYS A 1  446 ? 170.195 137.459 148.177 1.00 77.23  ? 710  LYS A CA    1 
ATOM   2458  C  C     . LYS A 1  446 ? 171.484 137.957 148.820 1.00 77.23  ? 710  LYS A C     1 
ATOM   2459  O  O     . LYS A 1  446 ? 172.525 138.064 148.158 1.00 77.23  ? 710  LYS A O     1 
ATOM   2460  C  CB    . LYS A 1  446 ? 169.215 138.613 147.966 1.00 77.23  ? 710  LYS A CB    1 
ATOM   2461  C  CG    . LYS A 1  446 ? 169.750 139.712 147.065 1.00 77.23  ? 710  LYS A CG    1 
ATOM   2462  C  CD    . LYS A 1  446 ? 168.698 140.771 146.785 1.00 77.23  ? 710  LYS A CD    1 
ATOM   2463  C  CE    . LYS A 1  446 ? 168.478 141.662 147.994 1.00 77.23  ? 710  LYS A CE    1 
ATOM   2464  N  NZ    . LYS A 1  446 ? 167.537 142.777 147.696 1.00 77.23  ? 710  LYS A NZ    1 
ATOM   2465  N  N     . LEU A 1  447 ? 171.436 138.265 150.118 1.00 76.65  ? 711  LEU A N     1 
ATOM   2466  C  CA    . LEU A 1  447 ? 172.641 138.711 150.808 1.00 76.65  ? 711  LEU A CA    1 
ATOM   2467  C  C     . LEU A 1  447 ? 173.688 137.608 150.867 1.00 76.65  ? 711  LEU A C     1 
ATOM   2468  O  O     . LEU A 1  447 ? 174.890 137.894 150.849 1.00 76.65  ? 711  LEU A O     1 
ATOM   2469  C  CB    . LEU A 1  447 ? 172.294 139.196 152.215 1.00 76.65  ? 711  LEU A CB    1 
ATOM   2470  C  CG    . LEU A 1  447 ? 173.443 139.787 153.033 1.00 76.65  ? 711  LEU A CG    1 
ATOM   2471  C  CD1   . LEU A 1  447 ? 173.986 141.037 152.360 1.00 76.65  ? 711  LEU A CD1   1 
ATOM   2472  C  CD2   . LEU A 1  447 ? 172.995 140.089 154.453 1.00 76.65  ? 711  LEU A CD2   1 
ATOM   2473  N  N     . VAL A 1  448 ? 173.256 136.346 150.931 1.00 73.95  ? 712  VAL A N     1 
ATOM   2474  C  CA    . VAL A 1  448 ? 174.201 135.233 150.882 1.00 73.95  ? 712  VAL A CA    1 
ATOM   2475  C  C     . VAL A 1  448 ? 174.929 135.218 149.545 1.00 73.95  ? 712  VAL A C     1 
ATOM   2476  O  O     . VAL A 1  448 ? 176.157 135.081 149.488 1.00 73.95  ? 712  VAL A O     1 
ATOM   2477  C  CB    . VAL A 1  448 ? 173.480 133.900 151.148 1.00 73.95  ? 712  VAL A CB    1 
ATOM   2478  C  CG1   . VAL A 1  448 ? 174.423 132.735 150.914 1.00 73.95  ? 712  VAL A CG1   1 
ATOM   2479  C  CG2   . VAL A 1  448 ? 172.951 133.863 152.568 1.00 73.95  ? 712  VAL A CG2   1 
ATOM   2480  N  N     . ARG A 1  449 ? 174.181 135.358 148.447 1.00 75.92  ? 713  ARG A N     1 
ATOM   2481  C  CA    . ARG A 1  449 ? 174.808 135.432 147.131 1.00 75.92  ? 713  ARG A CA    1 
ATOM   2482  C  C     . ARG A 1  449 ? 175.762 136.616 147.043 1.00 75.92  ? 713  ARG A C     1 
ATOM   2483  O  O     . ARG A 1  449 ? 176.820 136.528 146.409 1.00 75.92  ? 713  ARG A O     1 
ATOM   2484  C  CB    . ARG A 1  449 ? 173.742 135.536 146.040 1.00 75.92  ? 713  ARG A CB    1 
ATOM   2485  C  CG    . ARG A 1  449 ? 172.775 134.371 145.980 1.00 75.92  ? 713  ARG A CG    1 
ATOM   2486  C  CD    . ARG A 1  449 ? 173.465 133.094 145.546 1.00 75.92  ? 713  ARG A CD    1 
ATOM   2487  N  NE    . ARG A 1  449 ? 172.521 131.988 145.444 1.00 75.92  ? 713  ARG A NE    1 
ATOM   2488  C  CZ    . ARG A 1  449 ? 171.871 131.666 144.332 1.00 75.92  ? 713  ARG A CZ    1 
ATOM   2489  N  NH1   . ARG A 1  449 ? 172.069 132.364 143.224 1.00 75.92  ? 713  ARG A NH1   1 
ATOM   2490  N  NH2   . ARG A 1  449 ? 171.026 130.645 144.327 1.00 75.92  ? 713  ARG A NH2   1 
ATOM   2491  N  N     . GLU A 1  450 ? 175.400 137.733 147.674 1.00 77.74  ? 714  GLU A N     1 
ATOM   2492  C  CA    . GLU A 1  450 ? 176.234 138.929 147.594 1.00 77.74  ? 714  GLU A CA    1 
ATOM   2493  C  C     . GLU A 1  450 ? 177.546 138.749 148.351 1.00 77.74  ? 714  GLU A C     1 
ATOM   2494  O  O     . GLU A 1  450 ? 178.621 139.061 147.828 1.00 77.74  ? 714  GLU A O     1 
ATOM   2495  C  CB    . GLU A 1  450 ? 175.467 140.141 148.125 1.00 77.74  ? 714  GLU A CB    1 
ATOM   2496  C  CG    . GLU A 1  450 ? 174.298 140.570 147.253 1.00 77.74  ? 714  GLU A CG    1 
ATOM   2497  C  CD    . GLU A 1  450 ? 173.555 141.764 147.821 1.00 77.74  ? 714  GLU A CD    1 
ATOM   2498  O  OE1   . GLU A 1  450 ? 173.876 142.178 148.955 1.00 77.74  ? 714  GLU A OE1   1 
ATOM   2499  O  OE2   . GLU A 1  450 ? 172.650 142.288 147.137 1.00 77.74  ? 714  GLU A OE2   1 
ATOM   2500  N  N     . VAL A 1  451 ? 177.480 138.245 149.585 1.00 74.71  ? 715  VAL A N     1 
ATOM   2501  C  CA    . VAL A 1  451 ? 178.671 138.224 150.431 1.00 74.71  ? 715  VAL A CA    1 
ATOM   2502  C  C     . VAL A 1  451 ? 179.535 137.001 150.142 1.00 74.71  ? 715  VAL A C     1 
ATOM   2503  O  O     . VAL A 1  451 ? 180.763 137.054 150.276 1.00 74.71  ? 715  VAL A O     1 
ATOM   2504  C  CB    . VAL A 1  451 ? 178.278 138.303 151.919 1.00 74.71  ? 715  VAL A CB    1 
ATOM   2505  C  CG1   . VAL A 1  451 ? 177.481 139.570 152.194 1.00 74.71  ? 715  VAL A CG1   1 
ATOM   2506  C  CG2   . VAL A 1  451 ? 177.510 137.062 152.352 1.00 74.71  ? 715  VAL A CG2   1 
ATOM   2507  N  N     . GLU A 1  452 ? 178.925 135.886 149.742 1.00 78.21  ? 716  GLU A N     1 
ATOM   2508  C  CA    . GLU A 1  452 ? 179.665 134.652 149.514 1.00 78.21  ? 716  GLU A CA    1 
ATOM   2509  C  C     . GLU A 1  452 ? 180.359 134.628 148.157 1.00 78.21  ? 716  GLU A C     1 
ATOM   2510  O  O     . GLU A 1  452 ? 181.148 133.715 147.892 1.00 78.21  ? 716  GLU A O     1 
ATOM   2511  C  CB    . GLU A 1  452 ? 178.717 133.453 149.652 1.00 78.21  ? 716  GLU A CB    1 
ATOM   2512  C  CG    . GLU A 1  452 ? 179.395 132.090 149.670 1.00 78.21  ? 716  GLU A CG    1 
ATOM   2513  C  CD    . GLU A 1  452 ? 178.413 130.954 149.855 1.00 78.21  ? 716  GLU A CD    1 
ATOM   2514  O  OE1   . GLU A 1  452 ? 177.199 131.228 149.950 1.00 78.21  ? 716  GLU A OE1   1 
ATOM   2515  O  OE2   . GLU A 1  452 ? 178.854 129.787 149.906 1.00 78.21  ? 716  GLU A OE2   1 
ATOM   2516  N  N     . GLY A 1  453 ? 180.101 135.610 147.301 1.00 74.64  ? 717  GLY A N     1 
ATOM   2517  C  CA    . GLY A 1  453 ? 180.758 135.676 146.013 1.00 74.64  ? 717  GLY A CA    1 
ATOM   2518  C  C     . GLY A 1  453 ? 180.038 134.983 144.882 1.00 74.64  ? 717  GLY A C     1 
ATOM   2519  O  O     . GLY A 1  453 ? 180.656 134.726 143.842 1.00 74.64  ? 717  GLY A O     1 
ATOM   2520  N  N     . LEU A 1  454 ? 178.757 134.671 145.043 1.00 76.39  ? 718  LEU A N     1 
ATOM   2521  C  CA    . LEU A 1  454 ? 177.982 134.037 143.989 1.00 76.39  ? 718  LEU A CA    1 
ATOM   2522  C  C     . LEU A 1  454 ? 177.266 135.109 143.171 1.00 76.39  ? 718  LEU A C     1 
ATOM   2523  O  O     . LEU A 1  454 ? 177.486 136.310 143.348 1.00 76.39  ? 718  LEU A O     1 
ATOM   2524  C  CB    . LEU A 1  454 ? 177.002 133.024 144.578 1.00 76.39  ? 718  LEU A CB    1 
ATOM   2525  C  CG    . LEU A 1  454 ? 177.539 131.642 144.961 1.00 76.39  ? 718  LEU A CG    1 
ATOM   2526  C  CD1   . LEU A 1  454 ? 178.409 131.710 146.204 1.00 76.39  ? 718  LEU A CD1   1 
ATOM   2527  C  CD2   . LEU A 1  454 ? 176.390 130.665 145.162 1.00 76.39  ? 718  LEU A CD2   1 
ATOM   2528  N  N     . GLU A 1  455 ? 176.404 134.640 142.272 1.00 78.30  ? 719  GLU A N     1 
ATOM   2529  C  CA    . GLU A 1  455 ? 175.628 135.500 141.389 1.00 78.30  ? 719  GLU A CA    1 
ATOM   2530  C  C     . GLU A 1  455 ? 174.161 135.544 141.801 1.00 78.30  ? 719  GLU A C     1 
ATOM   2531  O  O     . GLU A 1  455 ? 173.772 134.945 142.800 1.00 78.30  ? 719  GLU A O     1 
ATOM   2532  C  CB    . GLU A 1  455 ? 175.743 135.011 139.948 1.00 78.30  ? 719  GLU A CB    1 
ATOM   2533  C  CG    . GLU A 1  455 ? 176.093 133.539 139.825 1.00 78.30  ? 719  GLU A CG    1 
ATOM   2534  C  CD    . GLU A 1  455 ? 176.814 133.220 138.531 1.00 78.30  ? 719  GLU A CD    1 
ATOM   2535  O  OE1   . GLU A 1  455 ? 177.905 133.783 138.304 1.00 78.30  ? 719  GLU A OE1   1 
ATOM   2536  O  OE2   . GLU A 1  455 ? 176.291 132.409 137.739 1.00 78.30  ? 719  GLU A OE2   1 
ATOM   2537  N  N     . ALA A 1  456 ? 173.348 136.245 141.019 1.00 80.29  ? 720  ALA A N     1 
ATOM   2538  C  CA    . ALA A 1  456 ? 171.932 136.377 141.320 1.00 80.29  ? 720  ALA A CA    1 
ATOM   2539  C  C     . ALA A 1  456 ? 171.247 135.009 141.338 1.00 80.29  ? 720  ALA A C     1 
ATOM   2540  O  O     . ALA A 1  456 ? 171.790 133.997 140.891 1.00 80.29  ? 720  ALA A O     1 
ATOM   2541  C  CB    . ALA A 1  456 ? 171.255 137.296 140.306 1.00 80.29  ? 720  ALA A CB    1 
ATOM   2542  N  N     . SER A 1  457 ? 170.020 134.997 141.866 1.00 80.49  ? 721  SER A N     1 
ATOM   2543  C  CA    . SER A 1  457 ? 169.289 133.744 142.018 1.00 80.49  ? 721  SER A CA    1 
ATOM   2544  C  C     . SER A 1  457 ? 168.801 133.204 140.680 1.00 80.49  ? 721  SER A C     1 
ATOM   2545  O  O     . SER A 1  457 ? 168.521 132.005 140.561 1.00 80.49  ? 721  SER A O     1 
ATOM   2546  C  CB    . SER A 1  457 ? 168.112 133.938 142.972 1.00 80.49  ? 721  SER A CB    1 
ATOM   2547  O  OG    . SER A 1  457 ? 168.563 134.272 144.272 1.00 80.49  ? 721  SER A OG    1 
ATOM   2548  N  N     . GLY A 1  458 ? 168.692 134.060 139.668 1.00 81.65  ? 722  GLY A N     1 
ATOM   2549  C  CA    . GLY A 1  458 ? 168.172 133.645 138.379 1.00 81.65  ? 722  GLY A CA    1 
ATOM   2550  C  C     . GLY A 1  458 ? 169.138 132.832 137.543 1.00 81.65  ? 722  GLY A C     1 
ATOM   2551  O  O     . GLY A 1  458 ? 168.863 132.543 136.375 1.00 81.65  ? 722  GLY A O     1 
ATOM   2552  N  N     . SER A 1  459 ? 170.270 132.453 138.125 1.00 77.43  ? 723  SER A N     1 
ATOM   2553  C  CA    . SER A 1  459 ? 171.285 131.695 137.407 1.00 77.43  ? 723  SER A CA    1 
ATOM   2554  C  C     . SER A 1  459 ? 170.925 130.210 137.419 1.00 77.43  ? 723  SER A C     1 
ATOM   2555  O  O     . SER A 1  459 ? 169.841 129.802 137.846 1.00 77.43  ? 723  SER A O     1 
ATOM   2556  C  CB    . SER A 1  459 ? 172.659 131.949 138.015 1.00 77.43  ? 723  SER A CB    1 
ATOM   2557  O  OG    . SER A 1  459 ? 173.655 131.187 137.358 1.00 77.43  ? 723  SER A OG    1 
ATOM   2558  N  N     . VAL A 1  460 ? 171.851 129.379 136.942 1.00 72.08  ? 724  VAL A N     1 
ATOM   2559  C  CA    . VAL A 1  460 ? 171.639 127.937 136.914 1.00 72.08  ? 724  VAL A CA    1 
ATOM   2560  C  C     . VAL A 1  460 ? 172.210 127.234 138.143 1.00 72.08  ? 724  VAL A C     1 
ATOM   2561  O  O     . VAL A 1  460 ? 171.667 126.197 138.553 1.00 72.08  ? 724  VAL A O     1 
ATOM   2562  C  CB    . VAL A 1  460 ? 172.225 127.318 135.627 1.00 72.08  ? 724  VAL A CB    1 
ATOM   2563  C  CG1   . VAL A 1  460 ? 171.513 127.873 134.406 1.00 72.08  ? 724  VAL A CG1   1 
ATOM   2564  C  CG2   . VAL A 1  460 ? 173.718 127.580 135.538 1.00 72.08  ? 724  VAL A CG2   1 
ATOM   2565  N  N     . TYR A 1  461 ? 173.280 127.759 138.723 1.00 73.49  ? 725  TYR A N     1 
ATOM   2566  C  CA    . TYR A 1  461 ? 173.806 127.178 139.948 1.00 73.49  ? 725  TYR A CA    1 
ATOM   2567  C  C     . TYR A 1  461 ? 172.891 127.839 140.961 1.00 73.49  ? 725  TYR A C     1 
ATOM   2568  O  O     . TYR A 1  461 ? 173.078 128.999 141.315 1.00 73.49  ? 725  TYR A O     1 
ATOM   2569  C  CB    . TYR A 1  461 ? 175.268 127.554 140.127 1.00 73.49  ? 725  TYR A CB    1 
ATOM   2570  C  CG    . TYR A 1  461 ? 176.102 127.116 138.948 1.00 73.49  ? 725  TYR A CG    1 
ATOM   2571  C  CD1   . TYR A 1  461 ? 176.549 125.808 138.840 1.00 73.49  ? 725  TYR A CD1   1 
ATOM   2572  C  CD2   . TYR A 1  461 ? 176.410 127.998 137.926 1.00 73.49  ? 725  TYR A CD2   1 
ATOM   2573  C  CE1   . TYR A 1  461 ? 177.298 125.396 137.757 1.00 73.49  ? 725  TYR A CE1   1 
ATOM   2574  C  CE2   . TYR A 1  461 ? 177.159 127.595 136.839 1.00 73.49  ? 725  TYR A CE2   1 
ATOM   2575  C  CZ    . TYR A 1  461 ? 177.599 126.293 136.761 1.00 73.49  ? 725  TYR A CZ    1 
ATOM   2576  O  OH    . TYR A 1  461 ? 178.344 125.889 135.681 1.00 73.49  ? 725  TYR A OH    1 
ATOM   2577  N  N     . ILE A 1  462 ? 171.893 127.094 141.423 1.00 74.19  ? 726  ILE A N     1 
ATOM   2578  C  CA    . ILE A 1  462 ? 170.862 127.672 142.276 1.00 74.19  ? 726  ILE A CA    1 
ATOM   2579  C  C     . ILE A 1  462 ? 171.189 127.477 143.751 1.00 74.19  ? 726  ILE A C     1 
ATOM   2580  O  O     . ILE A 1  462 ? 170.976 128.377 144.571 1.00 74.19  ? 726  ILE A O     1 
ATOM   2581  C  CB    . ILE A 1  462 ? 169.487 127.082 141.911 1.00 74.19  ? 726  ILE A CB    1 
ATOM   2582  C  CG1   . ILE A 1  462 ? 169.473 125.562 142.084 1.00 74.19  ? 726  ILE A CG1   1 
ATOM   2583  C  CG2   . ILE A 1  462 ? 169.127 127.448 140.490 1.00 74.19  ? 726  ILE A CG2   1 
ATOM   2584  C  CD1   . ILE A 1  462 ? 168.095 124.951 141.974 1.00 74.19  ? 726  ILE A CD1   1 
ATOM   2585  N  N     . CYS A 1  463 ? 171.704 126.310 144.117 1.00 75.71  ? 727  CYS A N     1 
ATOM   2586  C  CA    . CYS A 1  463 ? 171.896 126.007 145.526 1.00 75.71  ? 727  CYS A CA    1 
ATOM   2587  C  C     . CYS A 1  463 ? 173.203 126.601 146.033 1.00 75.71  ? 727  CYS A C     1 
ATOM   2588  O  O     . CYS A 1  463 ? 174.235 126.548 145.358 1.00 75.71  ? 727  CYS A O     1 
ATOM   2589  C  CB    . CYS A 1  463 ? 171.879 124.497 145.749 1.00 75.71  ? 727  CYS A CB    1 
ATOM   2590  S  SG    . CYS A 1  463 ? 171.986 124.005 147.480 1.00 75.71  ? 727  CYS A SG    1 
ATOM   2591  N  N     . THR A 1  464 ? 173.151 127.177 147.231 1.00 72.03  ? 728  THR A N     1 
ATOM   2592  C  CA    . THR A 1  464 ? 174.340 127.666 147.912 1.00 72.03  ? 728  THR A CA    1 
ATOM   2593  C  C     . THR A 1  464 ? 174.984 126.603 148.789 1.00 72.03  ? 728  THR A C     1 
ATOM   2594  O  O     . THR A 1  464 ? 176.039 126.858 149.378 1.00 72.03  ? 728  THR A O     1 
ATOM   2595  C  CB    . THR A 1  464 ? 174.000 128.890 148.767 1.00 72.03  ? 728  THR A CB    1 
ATOM   2596  O  OG1   . THR A 1  464 ? 173.057 128.519 149.779 1.00 72.03  ? 728  THR A OG1   1 
ATOM   2597  C  CG2   . THR A 1  464 ? 173.401 129.987 147.909 1.00 72.03  ? 728  THR A CG2   1 
ATOM   2598  N  N     . LEU A 1  465 ? 174.372 125.425 148.889 1.00 72.37  ? 729  LEU A N     1 
ATOM   2599  C  CA    . LEU A 1  465 ? 174.880 124.326 149.699 1.00 72.37  ? 729  LEU A CA    1 
ATOM   2600  C  C     . LEU A 1  465 ? 175.538 123.244 148.859 1.00 72.37  ? 729  LEU A C     1 
ATOM   2601  O  O     . LEU A 1  465 ? 176.554 122.674 149.268 1.00 72.37  ? 729  LEU A O     1 
ATOM   2602  C  CB    . LEU A 1  465 ? 173.743 123.725 150.538 1.00 72.37  ? 729  LEU A CB    1 
ATOM   2603  C  CG    . LEU A 1  465 ? 173.311 124.476 151.800 1.00 72.37  ? 729  LEU A CG    1 
ATOM   2604  C  CD1   . LEU A 1  465 ? 172.528 125.740 151.471 1.00 72.37  ? 729  LEU A CD1   1 
ATOM   2605  C  CD2   . LEU A 1  465 ? 172.494 123.563 152.693 1.00 72.37  ? 729  LEU A CD2   1 
ATOM   2606  N  N     . CYS A 1  466 ? 174.976 122.935 147.695 1.00 74.45  ? 730  CYS A N     1 
ATOM   2607  C  CA    . CYS A 1  466 ? 175.604 122.062 146.716 1.00 74.45  ? 730  CYS A CA    1 
ATOM   2608  C  C     . CYS A 1  466 ? 175.860 122.840 145.432 1.00 74.45  ? 730  CYS A C     1 
ATOM   2609  O  O     . CYS A 1  466 ? 175.451 123.995 145.287 1.00 74.45  ? 730  CYS A O     1 
ATOM   2610  C  CB    . CYS A 1  466 ? 174.738 120.830 146.430 1.00 74.45  ? 730  CYS A CB    1 
ATOM   2611  S  SG    . CYS A 1  466 ? 173.149 121.178 145.654 1.00 74.45  ? 730  CYS A SG    1 
ATOM   2612  N  N     . ASP A 1  467 ? 176.546 122.192 144.492 1.00 74.93  ? 731  ASP A N     1 
ATOM   2613  C  CA    . ASP A 1  467 ? 176.934 122.862 143.256 1.00 74.93  ? 731  ASP A CA    1 
ATOM   2614  C  C     . ASP A 1  467 ? 176.260 122.241 142.038 1.00 74.93  ? 731  ASP A C     1 
ATOM   2615  O  O     . ASP A 1  467 ? 176.899 122.047 140.999 1.00 74.93  ? 731  ASP A O     1 
ATOM   2616  C  CB    . ASP A 1  467 ? 178.457 122.844 143.098 1.00 74.93  ? 731  ASP A CB    1 
ATOM   2617  C  CG    . ASP A 1  467 ? 179.032 121.439 143.080 1.00 74.93  ? 731  ASP A CG    1 
ATOM   2618  O  OD1   . ASP A 1  467 ? 178.267 120.470 143.265 1.00 74.93  ? 731  ASP A OD1   1 
ATOM   2619  O  OD2   . ASP A 1  467 ? 180.257 121.305 142.879 1.00 74.93  ? 731  ASP A OD2   1 
ATOM   2620  N  N     . THR A 1  468 ? 174.974 121.934 142.153 1.00 73.45  ? 732  THR A N     1 
ATOM   2621  C  CA    . THR A 1  468 ? 174.220 121.379 141.042 1.00 73.45  ? 732  THR A CA    1 
ATOM   2622  C  C     . THR A 1  468 ? 173.604 122.498 140.205 1.00 73.45  ? 732  THR A C     1 
ATOM   2623  O  O     . THR A 1  468 ? 173.539 123.658 140.618 1.00 73.45  ? 732  THR A O     1 
ATOM   2624  C  CB    . THR A 1  468 ? 173.129 120.436 141.546 1.00 73.45  ? 732  THR A CB    1 
ATOM   2625  O  OG1   . THR A 1  468 ? 172.548 119.742 140.437 1.00 73.45  ? 732  THR A OG1   1 
ATOM   2626  C  CG2   . THR A 1  468 ? 172.043 121.222 142.259 1.00 73.45  ? 732  THR A CG2   1 
ATOM   2627  N  N     . THR A 1  469 ? 173.145 122.134 139.014 1.00 73.32  ? 733  THR A N     1 
ATOM   2628  C  CA    . THR A 1  469 ? 172.541 123.080 138.089 1.00 73.32  ? 733  THR A CA    1 
ATOM   2629  C  C     . THR A 1  469 ? 171.020 122.980 138.140 1.00 73.32  ? 733  THR A C     1 
ATOM   2630  O  O     . THR A 1  469 ? 170.445 122.163 138.861 1.00 73.32  ? 733  THR A O     1 
ATOM   2631  C  CB    . THR A 1  469 ? 173.040 122.837 136.662 1.00 73.32  ? 733  THR A CB    1 
ATOM   2632  O  OG1   . THR A 1  469 ? 172.570 123.886 135.807 1.00 73.32  ? 733  THR A OG1   1 
ATOM   2633  C  CG2   . THR A 1  469 ? 172.530 121.505 136.142 1.00 73.32  ? 733  THR A CG2   1 
ATOM   2634  N  N     . ARG A 1  470 ? 170.362 123.833 137.364 1.00 72.46  ? 734  ARG A N     1 
ATOM   2635  C  CA    . ARG A 1  470 ? 168.905 123.863 137.335 1.00 72.46  ? 734  ARG A CA    1 
ATOM   2636  C  C     . ARG A 1  470 ? 168.282 122.619 136.708 1.00 72.46  ? 734  ARG A C     1 
ATOM   2637  O  O     . ARG A 1  470 ? 167.228 122.170 137.146 1.00 72.46  ? 734  ARG A O     1 
ATOM   2638  C  CB    . ARG A 1  470 ? 168.405 125.122 136.627 1.00 72.46  ? 734  ARG A CB    1 
ATOM   2639  C  CG    . ARG A 1  470 ? 166.892 125.243 136.586 1.00 72.46  ? 734  ARG A CG    1 
ATOM   2640  C  CD    . ARG A 1  470 ? 166.365 126.020 137.779 1.00 72.46  ? 734  ARG A CD    1 
ATOM   2641  N  NE    . ARG A 1  470 ? 167.180 127.194 138.069 1.00 72.46  ? 734  ARG A NE    1 
ATOM   2642  C  CZ    . ARG A 1  470 ? 166.757 128.238 138.772 1.00 72.46  ? 734  ARG A CZ    1 
ATOM   2643  N  NH1   . ARG A 1  470 ? 167.565 129.264 138.992 1.00 72.46  ? 734  ARG A NH1   1 
ATOM   2644  N  NH2   . ARG A 1  470 ? 165.524 128.256 139.256 1.00 72.46  ? 734  ARG A NH2   1 
ATOM   2645  N  N     . LEU A 1  471 ? 168.923 122.062 135.686 1.00 73.74  ? 735  LEU A N     1 
ATOM   2646  C  CA    . LEU A 1  471 ? 168.385 120.869 135.040 1.00 73.74  ? 735  LEU A CA    1 
ATOM   2647  C  C     . LEU A 1  471 ? 168.551 119.639 135.925 1.00 73.74  ? 735  LEU A C     1 
ATOM   2648  O  O     . LEU A 1  471 ? 167.633 118.822 136.052 1.00 73.74  ? 735  LEU A O     1 
ATOM   2649  C  CB    . LEU A 1  471 ? 169.063 120.661 133.686 1.00 73.74  ? 735  LEU A CB    1 
ATOM   2650  C  CG    . LEU A 1  471 ? 168.517 119.519 132.830 1.00 73.74  ? 735  LEU A CG    1 
ATOM   2651  C  CD1   . LEU A 1  471 ? 167.067 119.787 132.461 1.00 73.74  ? 735  LEU A CD1   1 
ATOM   2652  C  CD2   . LEU A 1  471 ? 169.364 119.331 131.584 1.00 73.74  ? 735  LEU A CD2   1 
ATOM   2653  N  N     . GLU A 1  472 ? 169.720 119.490 136.550 1.00 76.53  ? 736  GLU A N     1 
ATOM   2654  C  CA    . GLU A 1  472 ? 169.928 118.356 137.443 1.00 76.53  ? 736  GLU A CA    1 
ATOM   2655  C  C     . GLU A 1  472 ? 169.044 118.460 138.679 1.00 76.53  ? 736  GLU A C     1 
ATOM   2656  O  O     . GLU A 1  472 ? 168.509 117.452 139.158 1.00 76.53  ? 736  GLU A O     1 
ATOM   2657  C  CB    . GLU A 1  472 ? 171.401 118.262 137.839 1.00 76.53  ? 736  GLU A CB    1 
ATOM   2658  C  CG    . GLU A 1  472 ? 172.325 117.903 136.690 1.00 76.53  ? 736  GLU A CG    1 
ATOM   2659  C  CD    . GLU A 1  472 ? 173.781 117.860 137.107 1.00 76.53  ? 736  GLU A CD    1 
ATOM   2660  O  OE1   . GLU A 1  472 ? 174.080 118.228 138.262 1.00 76.53  ? 736  GLU A OE1   1 
ATOM   2661  O  OE2   . GLU A 1  472 ? 174.626 117.460 136.280 1.00 76.53  ? 736  GLU A OE2   1 
ATOM   2662  N  N     . ALA A 1  473 ? 168.873 119.674 139.208 1.00 77.68  ? 737  ALA A N     1 
ATOM   2663  C  CA    . ALA A 1  473 ? 167.992 119.875 140.350 1.00 77.68  ? 737  ALA A CA    1 
ATOM   2664  C  C     . ALA A 1  473 ? 166.527 119.653 140.005 1.00 77.68  ? 737  ALA A C     1 
ATOM   2665  O  O     . ALA A 1  473 ? 165.731 119.388 140.912 1.00 77.68  ? 737  ALA A O     1 
ATOM   2666  C  CB    . ALA A 1  473 ? 168.178 121.281 140.923 1.00 77.68  ? 737  ALA A CB    1 
ATOM   2667  N  N     . SER A 1  474 ? 166.154 119.762 138.731 1.00 76.40  ? 738  SER A N     1 
ATOM   2668  C  CA    . SER A 1  474 ? 164.798 119.459 138.295 1.00 76.40  ? 738  SER A CA    1 
ATOM   2669  C  C     . SER A 1  474 ? 164.624 118.014 137.850 1.00 76.40  ? 738  SER A C     1 
ATOM   2670  O  O     . SER A 1  474 ? 163.485 117.557 137.715 1.00 76.40  ? 738  SER A O     1 
ATOM   2671  C  CB    . SER A 1  474 ? 164.388 120.394 137.151 1.00 76.40  ? 738  SER A CB    1 
ATOM   2672  O  OG    . SER A 1  474 ? 165.166 120.155 135.992 1.00 76.40  ? 738  SER A OG    1 
ATOM   2673  N  N     . GLN A 1  475 ? 165.717 117.291 137.610 1.00 75.16  ? 739  GLN A N     1 
ATOM   2674  C  CA    . GLN A 1  475 ? 165.638 115.890 137.218 1.00 75.16  ? 739  GLN A CA    1 
ATOM   2675  C  C     . GLN A 1  475 ? 165.931 114.917 138.354 1.00 75.16  ? 739  GLN A C     1 
ATOM   2676  O  O     . GLN A 1  475 ? 165.652 113.723 138.204 1.00 75.16  ? 739  GLN A O     1 
ATOM   2677  C  CB    . GLN A 1  475 ? 166.599 115.608 136.057 1.00 75.16  ? 739  GLN A CB    1 
ATOM   2678  C  CG    . GLN A 1  475 ? 166.194 116.255 134.745 1.00 75.16  ? 739  GLN A CG    1 
ATOM   2679  C  CD    . GLN A 1  475 ? 167.180 115.974 133.633 1.00 75.16  ? 739  GLN A CD    1 
ATOM   2680  O  OE1   . GLN A 1  475 ? 168.221 115.355 133.852 1.00 75.16  ? 739  GLN A OE1   1 
ATOM   2681  N  NE2   . GLN A 1  475 ? 166.857 116.424 132.427 1.00 75.16  ? 739  GLN A NE2   1 
ATOM   2682  N  N     . ASN A 1  476 ? 166.482 115.381 139.476 1.00 77.11  ? 740  ASN A N     1 
ATOM   2683  C  CA    . ASN A 1  476 ? 166.801 114.487 140.585 1.00 77.11  ? 740  ASN A CA    1 
ATOM   2684  C  C     . ASN A 1  476 ? 165.939 114.742 141.811 1.00 77.11  ? 740  ASN A C     1 
ATOM   2685  O  O     . ASN A 1  476 ? 165.250 113.826 142.277 1.00 77.11  ? 740  ASN A O     1 
ATOM   2686  C  CB    . ASN A 1  476 ? 168.289 114.621 140.951 1.00 77.11  ? 740  ASN A CB    1 
ATOM   2687  C  CG    . ASN A 1  476 ? 168.761 113.532 141.897 1.00 77.11  ? 740  ASN A CG    1 
ATOM   2688  O  OD1   . ASN A 1  476 ? 167.988 112.665 142.305 1.00 77.11  ? 740  ASN A OD1   1 
ATOM   2689  N  ND2   . ASN A 1  476 ? 170.040 113.572 142.248 1.00 77.11  ? 740  ASN A ND2   1 
ATOM   2690  N  N     . LEU A 1  477 ? 165.972 115.956 142.358 1.00 77.57  ? 741  LEU A N     1 
ATOM   2691  C  CA    . LEU A 1  477 ? 165.146 116.478 143.441 1.00 77.57  ? 741  LEU A CA    1 
ATOM   2692  C  C     . LEU A 1  477 ? 165.489 115.880 144.806 1.00 77.57  ? 741  LEU A C     1 
ATOM   2693  O  O     . LEU A 1  477 ? 164.956 116.353 145.809 1.00 77.57  ? 741  LEU A O     1 
ATOM   2694  C  CB    . LEU A 1  477 ? 163.634 116.285 143.205 1.00 77.57  ? 741  LEU A CB    1 
ATOM   2695  C  CG    . LEU A 1  477 ? 162.852 117.275 142.340 1.00 77.57  ? 741  LEU A CG    1 
ATOM   2696  C  CD1   . LEU A 1  477 ? 162.928 118.683 142.916 1.00 77.57  ? 741  LEU A CD1   1 
ATOM   2697  C  CD2   . LEU A 1  477 ? 163.322 117.239 140.901 1.00 77.57  ? 741  LEU A CD2   1 
ATOM   2698  N  N     . VAL A 1  478 ? 166.351 114.867 144.893 1.00 77.62  ? 742  VAL A N     1 
ATOM   2699  C  CA    . VAL A 1  478 ? 166.519 114.161 146.160 1.00 77.62  ? 742  VAL A CA    1 
ATOM   2700  C  C     . VAL A 1  478 ? 167.974 114.133 146.613 1.00 77.62  ? 742  VAL A C     1 
ATOM   2701  O  O     . VAL A 1  478 ? 168.315 114.672 147.672 1.00 77.62  ? 742  VAL A O     1 
ATOM   2702  C  CB    . VAL A 1  478 ? 165.960 112.729 146.065 1.00 77.62  ? 742  VAL A CB    1 
ATOM   2703  C  CG1   . VAL A 1  478 ? 166.244 111.965 147.349 1.00 77.62  ? 742  VAL A CG1   1 
ATOM   2704  C  CG2   . VAL A 1  478 ? 164.467 112.757 145.779 1.00 77.62  ? 742  VAL A CG2   1 
ATOM   2705  N  N     . PHE A 1  479 ? 168.788 113.399 145.869 1.00 77.07  ? 743  PHE A N     1 
ATOM   2706  C  CA    . PHE A 1  479 ? 170.181 113.202 146.229 1.00 77.07  ? 743  PHE A CA    1 
ATOM   2707  C  C     . PHE A 1  479 ? 171.110 114.363 145.934 1.00 77.07  ? 743  PHE A C     1 
ATOM   2708  O  O     . PHE A 1  479 ? 171.536 114.567 144.799 1.00 77.07  ? 743  PHE A O     1 
ATOM   2709  C  CB    . PHE A 1  479 ? 170.699 111.914 145.591 1.00 77.07  ? 743  PHE A CB    1 
ATOM   2710  C  CG    . PHE A 1  479 ? 169.759 110.756 145.743 1.00 77.07  ? 743  PHE A CG    1 
ATOM   2711  C  CD1   . PHE A 1  479 ? 169.855 109.908 146.831 1.00 77.07  ? 743  PHE A CD1   1 
ATOM   2712  C  CD2   . PHE A 1  479 ? 168.764 110.529 144.810 1.00 77.07  ? 743  PHE A CD2   1 
ATOM   2713  C  CE1   . PHE A 1  479 ? 168.985 108.846 146.979 1.00 77.07  ? 743  PHE A CE1   1 
ATOM   2714  C  CE2   . PHE A 1  479 ? 167.891 109.468 144.951 1.00 77.07  ? 743  PHE A CE2   1 
ATOM   2715  C  CZ    . PHE A 1  479 ? 168.001 108.626 146.037 1.00 77.07  ? 743  PHE A CZ    1 
ATOM   2716  N  N     . HIS A 1  480 ? 171.415 115.127 146.973 1.00 75.83  ? 744  HIS A N     1 
ATOM   2717  C  CA    . HIS A 1  480 ? 172.340 116.252 146.828 1.00 75.83  ? 744  HIS A CA    1 
ATOM   2718  C  C     . HIS A 1  480 ? 172.969 116.511 148.195 1.00 75.83  ? 744  HIS A C     1 
ATOM   2719  O  O     . HIS A 1  480 ? 172.311 117.053 149.089 1.00 75.83  ? 744  HIS A O     1 
ATOM   2720  C  CB    . HIS A 1  480 ? 171.629 117.491 146.298 1.00 75.83  ? 744  HIS A CB    1 
ATOM   2721  C  CG    . HIS A 1  480 ? 171.124 117.350 144.895 1.00 75.83  ? 744  HIS A CG    1 
ATOM   2722  N  ND1   . HIS A 1  480 ? 169.870 116.858 144.601 1.00 75.83  ? 744  HIS A ND1   1 
ATOM   2723  C  CD2   . HIS A 1  480 ? 171.704 117.634 143.705 1.00 75.83  ? 744  HIS A CD2   1 
ATOM   2724  C  CE1   . HIS A 1  480 ? 169.699 116.846 143.292 1.00 75.83  ? 744  HIS A CE1   1 
ATOM   2725  N  NE2   . HIS A 1  480 ? 170.797 117.312 142.724 1.00 75.83  ? 744  HIS A NE2   1 
ATOM   2726  N  N     . SER A 1  481 ? 174.227 116.107 148.355 1.00 75.52  ? 745  SER A N     1 
ATOM   2727  C  CA    . SER A 1  481 ? 174.975 116.426 149.562 1.00 75.52  ? 745  SER A CA    1 
ATOM   2728  C  C     . SER A 1  481 ? 175.544 117.840 149.470 1.00 75.52  ? 745  SER A C     1 
ATOM   2729  O  O     . SER A 1  481 ? 175.614 118.439 148.394 1.00 75.52  ? 745  SER A O     1 
ATOM   2730  C  CB    . SER A 1  481 ? 176.101 115.415 149.780 1.00 75.52  ? 745  SER A CB    1 
ATOM   2731  O  OG    . SER A 1  481 ? 177.077 115.507 148.757 1.00 75.52  ? 745  SER A OG    1 
ATOM   2732  N  N     . ILE A 1  482 ? 175.958 118.376 150.614 1.00 72.71  ? 746  ILE A N     1 
ATOM   2733  C  CA    . ILE A 1  482 ? 176.454 119.747 150.676 1.00 72.71  ? 746  ILE A CA    1 
ATOM   2734  C  C     . ILE A 1  482 ? 177.977 119.730 150.602 1.00 72.71  ? 746  ILE A C     1 
ATOM   2735  O  O     . ILE A 1  482 ? 178.646 119.074 151.407 1.00 72.71  ? 746  ILE A O     1 
ATOM   2736  C  CB    . ILE A 1  482 ? 175.944 120.474 151.934 1.00 72.71  ? 746  ILE A CB    1 
ATOM   2737  C  CG1   . ILE A 1  482 ? 176.378 119.802 153.241 1.00 72.71  ? 746  ILE A CG1   1 
ATOM   2738  C  CG2   . ILE A 1  482 ? 174.437 120.514 151.927 1.00 72.71  ? 746  ILE A CG2   1 
ATOM   2739  C  CD1   . ILE A 1  482 ? 177.623 120.390 153.893 1.00 72.71  ? 746  ILE A CD1   1 
ATOM   2740  N  N     . THR A 1  483 ? 178.524 120.387 149.579 1.00 76.10  ? 747  THR A N     1 
ATOM   2741  C  CA    . THR A 1  483 ? 179.960 120.667 149.506 1.00 76.10  ? 747  THR A CA    1 
ATOM   2742  C  C     . THR A 1  483 ? 180.115 122.107 149.025 1.00 76.10  ? 747  THR A C     1 
ATOM   2743  O  O     . THR A 1  483 ? 180.348 122.343 147.837 1.00 76.10  ? 747  THR A O     1 
ATOM   2744  C  CB    . THR A 1  483 ? 180.678 119.690 148.580 1.00 76.10  ? 747  THR A CB    1 
ATOM   2745  O  OG1   . THR A 1  483 ? 180.118 119.778 147.263 1.00 76.10  ? 747  THR A OG1   1 
ATOM   2746  C  CG2   . THR A 1  483 ? 180.563 118.258 149.087 1.00 76.10  ? 747  THR A CG2   1 
ATOM   2747  N  N     . ARG A 1  484 ? 180.055 123.045 149.965 1.00 72.97  ? 748  ARG A N     1 
ATOM   2748  C  CA    . ARG A 1  484 ? 180.224 124.466 149.683 1.00 72.97  ? 748  ARG A CA    1 
ATOM   2749  C  C     . ARG A 1  484 ? 180.700 125.161 150.957 1.00 72.97  ? 748  ARG A C     1 
ATOM   2750  O  O     . ARG A 1  484 ? 179.917 125.382 151.877 1.00 72.97  ? 748  ARG A O     1 
ATOM   2751  C  CB    . ARG A 1  484 ? 178.916 125.081 149.192 1.00 72.97  ? 748  ARG A CB    1 
ATOM   2752  C  CG    . ARG A 1  484 ? 178.718 124.984 147.689 1.00 72.97  ? 748  ARG A CG    1 
ATOM   2753  C  CD    . ARG A 1  484 ? 178.556 126.358 147.064 1.00 72.97  ? 748  ARG A CD    1 
ATOM   2754  N  NE    . ARG A 1  484 ? 177.626 126.341 145.940 1.00 72.97  ? 748  ARG A NE    1 
ATOM   2755  C  CZ    . ARG A 1  484 ? 177.979 126.551 144.678 1.00 72.97  ? 748  ARG A CZ    1 
ATOM   2756  N  NH1   . ARG A 1  484 ? 179.245 126.793 144.375 1.00 72.97  ? 748  ARG A NH1   1 
ATOM   2757  N  NH2   . ARG A 1  484 ? 177.068 126.518 143.717 1.00 72.97  ? 748  ARG A NH2   1 
ATOM   2758  N  N     . SER A 1  485 ? 181.984 125.506 151.009 1.00 75.13  ? 749  SER A N     1 
ATOM   2759  C  CA    . SER A 1  485 ? 182.556 126.136 152.188 1.00 75.13  ? 749  SER A CA    1 
ATOM   2760  C  C     . SER A 1  485 ? 183.219 127.452 151.804 1.00 75.13  ? 749  SER A C     1 
ATOM   2761  O  O     . SER A 1  485 ? 183.470 127.731 150.629 1.00 75.13  ? 749  SER A O     1 
ATOM   2762  C  CB    . SER A 1  485 ? 183.565 125.208 152.876 1.00 75.13  ? 749  SER A CB    1 
ATOM   2763  O  OG    . SER A 1  485 ? 184.693 124.979 152.050 1.00 75.13  ? 749  SER A OG    1 
ATOM   2764  N  N     . HIS A 1  486 ? 183.503 128.264 152.825 1.00 71.70  ? 750  HIS A N     1 
ATOM   2765  C  CA    . HIS A 1  486 ? 184.107 129.573 152.596 1.00 71.70  ? 750  HIS A CA    1 
ATOM   2766  C  C     . HIS A 1  486 ? 185.484 129.439 151.956 1.00 71.70  ? 750  HIS A C     1 
ATOM   2767  O  O     . HIS A 1  486 ? 185.808 130.149 150.995 1.00 71.70  ? 750  HIS A O     1 
ATOM   2768  C  CB    . HIS A 1  486 ? 184.193 130.340 153.916 1.00 71.70  ? 750  HIS A CB    1 
ATOM   2769  C  CG    . HIS A 1  486 ? 184.765 131.716 153.782 1.00 71.70  ? 750  HIS A CG    1 
ATOM   2770  N  ND1   . HIS A 1  486 ? 184.063 132.765 153.229 1.00 71.70  ? 750  HIS A ND1   1 
ATOM   2771  C  CD2   . HIS A 1  486 ? 185.972 132.218 154.137 1.00 71.70  ? 750  HIS A CD2   1 
ATOM   2772  C  CE1   . HIS A 1  486 ? 184.813 133.852 153.246 1.00 71.70  ? 750  HIS A CE1   1 
ATOM   2773  N  NE2   . HIS A 1  486 ? 185.976 133.548 153.792 1.00 71.70  ? 750  HIS A NE2   1 
ATOM   2774  N  N     . ALA A 1  487 ? 186.310 128.529 152.477 1.00 72.42  ? 751  ALA A N     1 
ATOM   2775  C  CA    . ALA A 1  487 ? 187.615 128.288 151.871 1.00 72.42  ? 751  ALA A CA    1 
ATOM   2776  C  C     . ALA A 1  487 ? 187.470 127.748 150.455 1.00 72.42  ? 751  ALA A C     1 
ATOM   2777  O  O     . ALA A 1  487 ? 188.265 128.085 149.568 1.00 72.42  ? 751  ALA A O     1 
ATOM   2778  C  CB    . ALA A 1  487 ? 188.426 127.323 152.735 1.00 72.42  ? 751  ALA A CB    1 
ATOM   2779  N  N     . GLU A 1  488 ? 186.453 126.914 150.222 1.00 74.96  ? 752  GLU A N     1 
ATOM   2780  C  CA    . GLU A 1  488 ? 186.204 126.423 148.872 1.00 74.96  ? 752  GLU A CA    1 
ATOM   2781  C  C     . GLU A 1  488 ? 185.853 127.565 147.930 1.00 74.96  ? 752  GLU A C     1 
ATOM   2782  O  O     . GLU A 1  488 ? 186.342 127.612 146.797 1.00 74.96  ? 752  GLU A O     1 
ATOM   2783  C  CB    . GLU A 1  488 ? 185.090 125.378 148.886 1.00 74.96  ? 752  GLU A CB    1 
ATOM   2784  C  CG    . GLU A 1  488 ? 184.815 124.760 147.526 1.00 74.96  ? 752  GLU A CG    1 
ATOM   2785  C  CD    . GLU A 1  488 ? 183.743 123.691 147.577 1.00 74.96  ? 752  GLU A CD    1 
ATOM   2786  O  OE1   . GLU A 1  488 ? 183.203 123.442 148.675 1.00 74.96  ? 752  GLU A OE1   1 
ATOM   2787  O  OE2   . GLU A 1  488 ? 183.438 123.102 146.519 1.00 74.96  ? 752  GLU A OE2   1 
ATOM   2788  N  N     . ASN A 1  489 ? 185.012 128.500 148.379 1.00 71.88  ? 753  ASN A N     1 
ATOM   2789  C  CA    . ASN A 1  489 ? 184.673 129.644 147.538 1.00 71.88  ? 753  ASN A CA    1 
ATOM   2790  C  C     . ASN A 1  489 ? 185.892 130.521 147.280 1.00 71.88  ? 753  ASN A C     1 
ATOM   2791  O  O     . ASN A 1  489 ? 186.059 131.049 146.174 1.00 71.88  ? 753  ASN A O     1 
ATOM   2792  C  CB    . ASN A 1  489 ? 183.550 130.462 148.177 1.00 71.88  ? 753  ASN A CB    1 
ATOM   2793  C  CG    . ASN A 1  489 ? 182.241 129.701 148.251 1.00 71.88  ? 753  ASN A CG    1 
ATOM   2794  O  OD1   . ASN A 1  489 ? 181.728 129.428 149.334 1.00 71.88  ? 753  ASN A OD1   1 
ATOM   2795  N  ND2   . ASN A 1  489 ? 181.695 129.353 147.092 1.00 71.88  ? 753  ASN A ND2   1 
ATOM   2796  N  N     . LEU A 1  490 ? 186.754 130.686 148.286 1.00 67.70  ? 754  LEU A N     1 
ATOM   2797  C  CA    . LEU A 1  490 ? 187.988 131.439 148.080 1.00 67.70  ? 754  LEU A CA    1 
ATOM   2798  C  C     . LEU A 1  490 ? 188.862 130.778 147.021 1.00 67.70  ? 754  LEU A C     1 
ATOM   2799  O  O     . LEU A 1  490 ? 189.403 131.456 146.138 1.00 67.70  ? 754  LEU A O     1 
ATOM   2800  C  CB    . LEU A 1  490 ? 188.749 131.574 149.398 1.00 67.70  ? 754  LEU A CB    1 
ATOM   2801  C  CG    . LEU A 1  490 ? 188.099 132.433 150.483 1.00 67.70  ? 754  LEU A CG    1 
ATOM   2802  C  CD1   . LEU A 1  490 ? 188.889 132.348 151.778 1.00 67.70  ? 754  LEU A CD1   1 
ATOM   2803  C  CD2   . LEU A 1  490 ? 187.982 133.874 150.021 1.00 67.70  ? 754  LEU A CD2   1 
ATOM   2804  N  N     . GLN A 1  491 ? 189.007 129.453 147.089 1.00 69.49  ? 755  GLN A N     1 
ATOM   2805  C  CA    . GLN A 1  491 ? 189.807 128.748 146.091 1.00 69.49  ? 755  GLN A CA    1 
ATOM   2806  C  C     . GLN A 1  491 ? 189.181 128.845 144.705 1.00 69.49  ? 755  GLN A C     1 
ATOM   2807  O  O     . GLN A 1  491 ? 189.893 129.000 143.704 1.00 69.49  ? 755  GLN A O     1 
ATOM   2808  C  CB    . GLN A 1  491 ? 189.985 127.287 146.501 1.00 69.49  ? 755  GLN A CB    1 
ATOM   2809  C  CG    . GLN A 1  491 ? 190.825 127.098 147.751 1.00 69.49  ? 755  GLN A CG    1 
ATOM   2810  C  CD    . GLN A 1  491 ? 190.960 125.642 148.142 1.00 69.49  ? 755  GLN A CD    1 
ATOM   2811  O  OE1   . GLN A 1  491 ? 190.368 124.762 147.518 1.00 69.49  ? 755  GLN A OE1   1 
ATOM   2812  N  NE2   . GLN A 1  491 ? 191.743 125.378 149.182 1.00 69.49  ? 755  GLN A NE2   1 
ATOM   2813  N  N     . ARG A 1  492 ? 187.858 128.785 144.650 1.00 68.89  ? 756  ARG A N     1 
ATOM   2814  C  CA    . ARG A 1  492 ? 187.166 128.890 143.380 1.00 68.89  ? 756  ARG A CA    1 
ATOM   2815  C  C     . ARG A 1  492 ? 187.442 130.252 142.761 1.00 68.89  ? 756  ARG A C     1 
ATOM   2816  O  O     . ARG A 1  492 ? 187.784 130.343 141.587 1.00 68.89  ? 756  ARG A O     1 
ATOM   2817  C  CB    . ARG A 1  492 ? 185.666 128.683 143.565 1.00 68.89  ? 756  ARG A CB    1 
ATOM   2818  C  CG    . ARG A 1  492 ? 185.317 127.418 144.327 1.00 68.89  ? 756  ARG A CG    1 
ATOM   2819  C  CD    . ARG A 1  492 ? 185.104 126.250 143.382 1.00 68.89  ? 756  ARG A CD    1 
ATOM   2820  N  NE    . ARG A 1  492 ? 183.725 125.776 143.414 1.00 68.89  ? 756  ARG A NE    1 
ATOM   2821  C  CZ    . ARG A 1  492 ? 183.379 124.501 143.549 1.00 68.89  ? 756  ARG A CZ    1 
ATOM   2822  N  NH1   . ARG A 1  492 ? 182.100 124.158 143.568 1.00 68.89  ? 756  ARG A NH1   1 
ATOM   2823  N  NH2   . ARG A 1  492 ? 184.314 123.570 143.663 1.00 68.89  ? 756  ARG A NH2   1 
ATOM   2824  N  N     . TYR A 1  493 ? 187.307 131.312 143.551 1.00 67.03  ? 757  TYR A N     1 
ATOM   2825  C  CA    . TYR A 1  493 ? 187.552 132.654 143.035 1.00 67.03  ? 757  TYR A CA    1 
ATOM   2826  C  C     . TYR A 1  493 ? 189.009 132.838 142.640 1.00 67.03  ? 757  TYR A C     1 
ATOM   2827  O  O     . TYR A 1  493 ? 189.311 133.549 141.675 1.00 67.03  ? 757  TYR A O     1 
ATOM   2828  C  CB    . TYR A 1  493 ? 187.147 133.718 144.052 1.00 67.03  ? 757  TYR A CB    1 
ATOM   2829  C  CG    . TYR A 1  493 ? 187.444 135.110 143.546 1.00 67.03  ? 757  TYR A CG    1 
ATOM   2830  C  CD1   . TYR A 1  493 ? 186.667 135.686 142.551 1.00 67.03  ? 757  TYR A CD1   1 
ATOM   2831  C  CD2   . TYR A 1  493 ? 188.518 135.837 144.042 1.00 67.03  ? 757  TYR A CD2   1 
ATOM   2832  C  CE1   . TYR A 1  493 ? 186.942 136.952 142.075 1.00 67.03  ? 757  TYR A CE1   1 
ATOM   2833  C  CE2   . TYR A 1  493 ? 188.800 137.103 143.572 1.00 67.03  ? 757  TYR A CE2   1 
ATOM   2834  C  CZ    . TYR A 1  493 ? 188.009 137.655 142.590 1.00 67.03  ? 757  TYR A CZ    1 
ATOM   2835  O  OH    . TYR A 1  493 ? 188.290 138.917 142.122 1.00 67.03  ? 757  TYR A OH    1 
ATOM   2836  N  N     . GLU A 1  494 ? 189.932 132.216 143.376 1.00 70.00  ? 758  GLU A N     1 
ATOM   2837  C  CA    . GLU A 1  494 ? 191.337 132.305 142.994 1.00 70.00  ? 758  GLU A CA    1 
ATOM   2838  C  C     . GLU A 1  494 ? 191.578 131.640 141.645 1.00 70.00  ? 758  GLU A C     1 
ATOM   2839  O  O     . GLU A 1  494 ? 192.320 132.168 140.809 1.00 70.00  ? 758  GLU A O     1 
ATOM   2840  C  CB    . GLU A 1  494 ? 192.220 131.679 144.071 1.00 70.00  ? 758  GLU A CB    1 
ATOM   2841  C  CG    . GLU A 1  494 ? 193.707 131.765 143.771 1.00 70.00  ? 758  GLU A CG    1 
ATOM   2842  C  CD    . GLU A 1  494 ? 194.218 133.194 143.747 1.00 70.00  ? 758  GLU A CD    1 
ATOM   2843  O  OE1   . GLU A 1  494 ? 193.620 134.055 144.426 1.00 70.00  ? 758  GLU A OE1   1 
ATOM   2844  O  OE2   . GLU A 1  494 ? 195.218 133.456 143.046 1.00 70.00  ? 758  GLU A OE2   1 
ATOM   2845  N  N     . VAL A 1  495 ? 190.950 130.486 141.414 1.00 66.33  ? 759  VAL A N     1 
ATOM   2846  C  CA    . VAL A 1  495 ? 191.075 129.816 140.121 1.00 66.33  ? 759  VAL A CA    1 
ATOM   2847  C  C     . VAL A 1  495 ? 190.452 130.663 139.018 1.00 66.33  ? 759  VAL A C     1 
ATOM   2848  O  O     . VAL A 1  495 ? 190.991 130.758 137.908 1.00 66.33  ? 759  VAL A O     1 
ATOM   2849  C  CB    . VAL A 1  495 ? 190.447 128.411 140.185 1.00 66.33  ? 759  VAL A CB    1 
ATOM   2850  C  CG1   . VAL A 1  495 ? 190.443 127.767 138.811 1.00 66.33  ? 759  VAL A CG1   1 
ATOM   2851  C  CG2   . VAL A 1  495 ? 191.205 127.541 141.172 1.00 66.33  ? 759  VAL A CG2   1 
ATOM   2852  N  N     . TRP A 1  496 ? 189.342 131.320 139.324 1.00 66.37  ? 760  TRP A N     1 
ATOM   2853  C  CA    . TRP A 1  496 ? 188.684 132.159 138.333 1.00 66.37  ? 760  TRP A CA    1 
ATOM   2854  C  C     . TRP A 1  496 ? 189.530 133.366 137.958 1.00 66.37  ? 760  TRP A C     1 
ATOM   2855  O  O     . TRP A 1  496 ? 189.641 133.710 136.786 1.00 66.37  ? 760  TRP A O     1 
ATOM   2856  C  CB    . TRP A 1  496 ? 187.325 132.634 138.836 1.00 66.37  ? 760  TRP A CB    1 
ATOM   2857  C  CG    . TRP A 1  496 ? 186.832 133.841 138.108 1.00 66.37  ? 760  TRP A CG    1 
ATOM   2858  C  CD1   . TRP A 1  496 ? 187.099 135.142 138.408 1.00 66.37  ? 760  TRP A CD1   1 
ATOM   2859  C  CD2   . TRP A 1  496 ? 185.989 133.861 136.951 1.00 66.37  ? 760  TRP A CD2   1 
ATOM   2860  N  NE1   . TRP A 1  496 ? 186.471 135.972 137.514 1.00 66.37  ? 760  TRP A NE1   1 
ATOM   2861  C  CE2   . TRP A 1  496 ? 185.783 135.209 136.609 1.00 66.37  ? 760  TRP A CE2   1 
ATOM   2862  C  CE3   . TRP A 1  496 ? 185.386 132.869 136.174 1.00 66.37  ? 760  TRP A CE3   1 
ATOM   2863  C  CZ2   . TRP A 1  496 ? 185.002 135.590 135.525 1.00 66.37  ? 760  TRP A CZ2   1 
ATOM   2864  C  CZ3   . TRP A 1  496 ? 184.612 133.251 135.099 1.00 66.37  ? 760  TRP A CZ3   1 
ATOM   2865  C  CH2   . TRP A 1  496 ? 184.427 134.598 134.783 1.00 66.37  ? 760  TRP A CH2   1 
ATOM   2866  N  N     . ARG A 1  497 ? 190.131 134.001 138.955 1.00 66.71  ? 761  ARG A N     1 
ATOM   2867  C  CA    . ARG A 1  497 ? 190.951 135.182 138.723 1.00 66.71  ? 761  ARG A CA    1 
ATOM   2868  C  C     . ARG A 1  497 ? 192.291 134.872 138.067 1.00 66.71  ? 761  ARG A C     1 
ATOM   2869  O  O     . ARG A 1  497 ? 192.773 135.643 137.242 1.00 66.71  ? 761  ARG A O     1 
ATOM   2870  C  CB    . ARG A 1  497 ? 191.186 135.926 140.037 1.00 66.71  ? 761  ARG A CB    1 
ATOM   2871  C  CG    . ARG A 1  497 ? 191.646 137.362 139.861 1.00 66.71  ? 761  ARG A CG    1 
ATOM   2872  C  CD    . ARG A 1  497 ? 192.656 137.751 140.927 1.00 66.71  ? 761  ARG A CD    1 
ATOM   2873  N  NE    . ARG A 1  497 ? 194.021 137.729 140.413 1.00 66.71  ? 761  ARG A NE    1 
ATOM   2874  C  CZ    . ARG A 1  497 ? 194.975 136.924 140.866 1.00 66.71  ? 761  ARG A CZ    1 
ATOM   2875  N  NH1   . ARG A 1  497 ? 194.716 136.073 141.848 1.00 66.71  ? 761  ARG A NH1   1 
ATOM   2876  N  NH2   . ARG A 1  497 ? 196.188 136.971 140.337 1.00 66.71  ? 761  ARG A NH2   1 
ATOM   2877  N  N     . SER A 1  498 ? 192.890 133.744 138.431 1.00 70.66  ? 762  SER A N     1 
ATOM   2878  C  CA    . SER A 1  498 ? 194.190 133.375 137.887 1.00 70.66  ? 762  SER A CA    1 
ATOM   2879  C  C     . SER A 1  498 ? 194.096 132.695 136.530 1.00 70.66  ? 762  SER A C     1 
ATOM   2880  O  O     . SER A 1  498 ? 194.936 132.957 135.660 1.00 70.66  ? 762  SER A O     1 
ATOM   2881  C  CB    . SER A 1  498 ? 194.929 132.457 138.863 1.00 70.66  ? 762  SER A CB    1 
ATOM   2882  O  OG    . SER A 1  498 ? 194.264 131.213 138.991 1.00 70.66  ? 762  SER A OG    1 
ATOM   2883  N  N     . ASN A 1  499 ? 193.094 131.835 136.329 1.00 73.22  ? 763  ASN A N     1 
ATOM   2884  C  CA    . ASN A 1  499 ? 192.918 131.062 135.103 1.00 73.22  ? 763  ASN A CA    1 
ATOM   2885  C  C     . ASN A 1  499 ? 194.192 130.288 134.781 1.00 73.22  ? 763  ASN A C     1 
ATOM   2886  O  O     . ASN A 1  499 ? 194.873 130.596 133.794 1.00 73.22  ? 763  ASN A O     1 
ATOM   2887  C  CB    . ASN A 1  499 ? 192.534 131.978 133.938 1.00 73.22  ? 763  ASN A CB    1 
ATOM   2888  C  CG    . ASN A 1  499 ? 192.098 131.208 132.707 1.00 73.22  ? 763  ASN A CG    1 
ATOM   2889  O  OD1   . ASN A 1  499 ? 192.087 129.977 132.699 1.00 73.22  ? 763  ASN A OD1   1 
ATOM   2890  N  ND2   . ASN A 1  499 ? 191.737 131.933 131.655 1.00 73.22  ? 763  ASN A ND2   1 
ATOM   2891  N  N     . PRO A 1  500 ? 194.548 129.280 135.584 1.00 76.24  ? 764  PRO A N     1 
ATOM   2892  C  CA    . PRO A 1  500 ? 195.805 128.557 135.349 1.00 76.24  ? 764  PRO A CA    1 
ATOM   2893  C  C     . PRO A 1  500 ? 195.746 127.562 134.205 1.00 76.24  ? 764  PRO A C     1 
ATOM   2894  O  O     . PRO A 1  500 ? 196.807 127.131 133.731 1.00 76.24  ? 764  PRO A O     1 
ATOM   2895  C  CB    . PRO A 1  500 ? 196.036 127.834 136.681 1.00 76.24  ? 764  PRO A CB    1 
ATOM   2896  C  CG    . PRO A 1  500 ? 194.662 127.598 137.204 1.00 76.24  ? 764  PRO A CG    1 
ATOM   2897  C  CD    . PRO A 1  500 ? 193.842 128.788 136.781 1.00 76.24  ? 764  PRO A CD    1 
ATOM   2898  N  N     . TYR A 1  501 ? 194.553 127.166 133.774 1.00 79.72  ? 765  TYR A N     1 
ATOM   2899  C  CA    . TYR A 1  501 ? 194.433 126.164 132.712 1.00 79.72  ? 765  TYR A CA    1 
ATOM   2900  C  C     . TYR A 1  501 ? 194.240 126.714 131.302 1.00 79.72  ? 765  TYR A C     1 
ATOM   2901  O  O     . TYR A 1  501 ? 194.306 125.972 130.324 1.00 79.72  ? 765  TYR A O     1 
ATOM   2902  C  CB    . TYR A 1  501 ? 193.327 125.167 133.051 1.00 79.72  ? 765  TYR A CB    1 
ATOM   2903  C  CG    . TYR A 1  501 ? 193.595 124.403 134.323 1.00 79.72  ? 765  TYR A CG    1 
ATOM   2904  C  CD1   . TYR A 1  501 ? 194.202 123.157 134.292 1.00 79.72  ? 765  TYR A CD1   1 
ATOM   2905  C  CD2   . TYR A 1  501 ? 193.255 124.935 135.558 1.00 79.72  ? 765  TYR A CD2   1 
ATOM   2906  C  CE1   . TYR A 1  501 ? 194.456 122.458 135.454 1.00 79.72  ? 765  TYR A CE1   1 
ATOM   2907  C  CE2   . TYR A 1  501 ? 193.504 124.243 136.726 1.00 79.72  ? 765  TYR A CE2   1 
ATOM   2908  C  CZ    . TYR A 1  501 ? 194.105 123.006 136.668 1.00 79.72  ? 765  TYR A CZ    1 
ATOM   2909  O  OH    . TYR A 1  501 ? 194.355 122.314 137.829 1.00 79.72  ? 765  TYR A OH    1 
ATOM   2910  N  N     . HIS A 1  502 ? 194.000 128.012 131.203 1.00 80.88  ? 766  HIS A N     1 
ATOM   2911  C  CA    . HIS A 1  502 ? 193.814 128.670 129.909 1.00 80.88  ? 766  HIS A CA    1 
ATOM   2912  C  C     . HIS A 1  502 ? 192.551 128.155 129.210 1.00 80.88  ? 766  HIS A C     1 
ATOM   2913  O  O     . HIS A 1  502 ? 192.591 127.541 128.142 1.00 80.88  ? 766  HIS A O     1 
ATOM   2914  C  CB    . HIS A 1  502 ? 195.054 128.485 129.025 1.00 80.88  ? 766  HIS A CB    1 
ATOM   2915  C  CG    . HIS A 1  502 ? 196.296 129.099 129.592 1.00 80.88  ? 766  HIS A CG    1 
ATOM   2916  N  ND1   . HIS A 1  502 ? 196.523 130.458 129.589 1.00 80.88  ? 766  HIS A ND1   1 
ATOM   2917  C  CD2   . HIS A 1  502 ? 197.378 128.538 130.181 1.00 80.88  ? 766  HIS A CD2   1 
ATOM   2918  C  CE1   . HIS A 1  502 ? 197.691 130.708 130.151 1.00 80.88  ? 766  HIS A CE1   1 
ATOM   2919  N  NE2   . HIS A 1  502 ? 198.231 129.561 130.519 1.00 80.88  ? 766  HIS A NE2   1 
ATOM   2920  N  N     . GLU A 1  503 ? 191.420 128.426 129.853 1.00 81.17  ? 767  GLU A N     1 
ATOM   2921  C  CA    . GLU A 1  503 ? 190.119 128.007 129.357 1.00 81.17  ? 767  GLU A CA    1 
ATOM   2922  C  C     . GLU A 1  503 ? 189.282 129.224 128.984 1.00 81.17  ? 767  GLU A C     1 
ATOM   2923  O  O     . GLU A 1  503 ? 189.584 130.357 129.366 1.00 81.17  ? 767  GLU A O     1 
ATOM   2924  C  CB    . GLU A 1  503 ? 189.376 127.157 130.395 1.00 81.17  ? 767  GLU A CB    1 
ATOM   2925  C  CG    . GLU A 1  503 ? 190.019 125.807 130.657 1.00 81.17  ? 767  GLU A CG    1 
ATOM   2926  C  CD    . GLU A 1  503 ? 189.274 125.001 131.701 1.00 81.17  ? 767  GLU A CD    1 
ATOM   2927  O  OE1   . GLU A 1  503 ? 188.333 125.545 132.314 1.00 81.17  ? 767  GLU A OE1   1 
ATOM   2928  O  OE2   . GLU A 1  503 ? 189.630 123.822 131.907 1.00 81.17  ? 767  GLU A OE2   1 
ATOM   2929  N  N     . SER A 1  504 ? 188.218 128.971 128.226 1.00 77.27  ? 768  SER A N     1 
ATOM   2930  C  CA    . SER A 1  504 ? 187.324 130.033 127.795 1.00 77.27  ? 768  SER A CA    1 
ATOM   2931  C  C     . SER A 1  504 ? 186.417 130.459 128.948 1.00 77.27  ? 768  SER A C     1 
ATOM   2932  O  O     . SER A 1  504 ? 186.565 130.021 130.092 1.00 77.27  ? 768  SER A O     1 
ATOM   2933  C  CB    . SER A 1  504 ? 186.501 129.577 126.593 1.00 77.27  ? 768  SER A CB    1 
ATOM   2934  O  OG    . SER A 1  504 ? 187.335 129.314 125.478 1.00 77.27  ? 768  SER A OG    1 
ATOM   2935  N  N     . VAL A 1  505 ? 185.459 131.334 128.635 1.00 73.21  ? 769  VAL A N     1 
ATOM   2936  C  CA    . VAL A 1  505 ? 184.543 131.828 129.659 1.00 73.21  ? 769  VAL A CA    1 
ATOM   2937  C  C     . VAL A 1  505 ? 183.669 130.697 130.185 1.00 73.21  ? 769  VAL A C     1 
ATOM   2938  O  O     . VAL A 1  505 ? 183.551 130.497 131.400 1.00 73.21  ? 769  VAL A O     1 
ATOM   2939  C  CB    . VAL A 1  505 ? 183.691 132.983 129.101 1.00 73.21  ? 769  VAL A CB    1 
ATOM   2940  C  CG1   . VAL A 1  505 ? 182.691 133.455 130.143 1.00 73.21  ? 769  VAL A CG1   1 
ATOM   2941  C  CG2   . VAL A 1  505 ? 184.578 134.126 128.639 1.00 73.21  ? 769  VAL A CG2   1 
ATOM   2942  N  N     . GLU A 1  506 ? 183.052 129.934 129.280 1.00 79.81  ? 770  GLU A N     1 
ATOM   2943  C  CA    . GLU A 1  506 ? 182.113 128.896 129.693 1.00 79.81  ? 770  GLU A CA    1 
ATOM   2944  C  C     . GLU A 1  506 ? 182.821 127.767 130.432 1.00 79.81  ? 770  GLU A C     1 
ATOM   2945  O  O     . GLU A 1  506 ? 182.328 127.277 131.455 1.00 79.81  ? 770  GLU A O     1 
ATOM   2946  C  CB    . GLU A 1  506 ? 181.365 128.355 128.474 1.00 79.81  ? 770  GLU A CB    1 
ATOM   2947  C  CG    . GLU A 1  506 ? 180.437 129.360 127.812 1.00 79.81  ? 770  GLU A CG    1 
ATOM   2948  C  CD    . GLU A 1  506 ? 181.157 130.272 126.837 1.00 79.81  ? 770  GLU A CD    1 
ATOM   2949  O  OE1   . GLU A 1  506 ? 182.373 130.079 126.625 1.00 79.81  ? 770  GLU A OE1   1 
ATOM   2950  O  OE2   . GLU A 1  506 ? 180.506 131.183 126.284 1.00 79.81  ? 770  GLU A OE2   1 
ATOM   2951  N  N     . GLU A 1  507 ? 183.982 127.340 129.930 1.00 80.68  ? 771  GLU A N     1 
ATOM   2952  C  CA    . GLU A 1  507 ? 184.701 126.244 130.571 1.00 80.68  ? 771  GLU A CA    1 
ATOM   2953  C  C     . GLU A 1  507 ? 185.183 126.637 131.961 1.00 80.68  ? 771  GLU A C     1 
ATOM   2954  O  O     . GLU A 1  507 ? 185.060 125.859 132.915 1.00 80.68  ? 771  GLU A O     1 
ATOM   2955  C  CB    . GLU A 1  507 ? 185.876 125.808 129.698 1.00 80.68  ? 771  GLU A CB    1 
ATOM   2956  C  CG    . GLU A 1  507 ? 185.465 125.168 128.383 1.00 80.68  ? 771  GLU A CG    1 
ATOM   2957  C  CD    . GLU A 1  507 ? 186.653 124.773 127.529 1.00 80.68  ? 771  GLU A CD    1 
ATOM   2958  O  OE1   . GLU A 1  507 ? 187.796 125.114 127.901 1.00 80.68  ? 771  GLU A OE1   1 
ATOM   2959  O  OE2   . GLU A 1  507 ? 186.444 124.120 126.486 1.00 80.68  ? 771  GLU A OE2   1 
ATOM   2960  N  N     . LEU A 1  508 ? 185.724 127.848 132.101 1.00 74.76  ? 772  LEU A N     1 
ATOM   2961  C  CA    . LEU A 1  508 ? 186.199 128.294 133.405 1.00 74.76  ? 772  LEU A CA    1 
ATOM   2962  C  C     . LEU A 1  508 ? 185.033 128.511 134.363 1.00 74.76  ? 772  LEU A C     1 
ATOM   2963  O  O     . LEU A 1  508 ? 185.152 128.259 135.568 1.00 74.76  ? 772  LEU A O     1 
ATOM   2964  C  CB    . LEU A 1  508 ? 187.028 129.568 133.249 1.00 74.76  ? 772  LEU A CB    1 
ATOM   2965  C  CG    . LEU A 1  508 ? 187.731 130.091 134.501 1.00 74.76  ? 772  LEU A CG    1 
ATOM   2966  C  CD1   . LEU A 1  508 ? 188.742 129.078 135.003 1.00 74.76  ? 772  LEU A CD1   1 
ATOM   2967  C  CD2   . LEU A 1  508 ? 188.403 131.422 134.216 1.00 74.76  ? 772  LEU A CD2   1 
ATOM   2968  N  N     . ARG A 1  509 ? 183.891 128.970 133.843 1.00 73.66  ? 773  ARG A N     1 
ATOM   2969  C  CA    . ARG A 1  509 ? 182.703 129.113 134.678 1.00 73.66  ? 773  ARG A CA    1 
ATOM   2970  C  C     . ARG A 1  509 ? 182.215 127.758 135.172 1.00 73.66  ? 773  ARG A C     1 
ATOM   2971  O  O     . ARG A 1  509 ? 181.808 127.620 136.332 1.00 73.66  ? 773  ARG A O     1 
ATOM   2972  C  CB    . ARG A 1  509 ? 181.599 129.829 133.901 1.00 73.66  ? 773  ARG A CB    1 
ATOM   2973  C  CG    . ARG A 1  509 ? 180.343 130.094 134.709 1.00 73.66  ? 773  ARG A CG    1 
ATOM   2974  C  CD    . ARG A 1  509 ? 179.316 130.847 133.886 1.00 73.66  ? 773  ARG A CD    1 
ATOM   2975  N  NE    . ARG A 1  509 ? 178.123 131.172 134.661 1.00 73.66  ? 773  ARG A NE    1 
ATOM   2976  C  CZ    . ARG A 1  509 ? 177.052 130.389 134.747 1.00 73.66  ? 773  ARG A CZ    1 
ATOM   2977  N  NH1   . ARG A 1  509 ? 176.012 130.767 135.476 1.00 73.66  ? 773  ARG A NH1   1 
ATOM   2978  N  NH2   . ARG A 1  509 ? 177.021 129.230 134.104 1.00 73.66  ? 773  ARG A NH2   1 
ATOM   2979  N  N     . ASP A 1  510 ? 182.249 126.745 134.306 1.00 75.25  ? 774  ASP A N     1 
ATOM   2980  C  CA    . ASP A 1  510 ? 181.886 125.397 134.727 1.00 75.25  ? 774  ASP A CA    1 
ATOM   2981  C  C     . ASP A 1  510 ? 182.869 124.873 135.767 1.00 75.25  ? 774  ASP A C     1 
ATOM   2982  O  O     . ASP A 1  510 ? 182.477 124.192 136.721 1.00 75.25  ? 774  ASP A O     1 
ATOM   2983  C  CB    . ASP A 1  510 ? 181.834 124.468 133.512 1.00 75.25  ? 774  ASP A CB    1 
ATOM   2984  C  CG    . ASP A 1  510 ? 181.184 123.129 133.821 1.00 75.25  ? 774  ASP A CG    1 
ATOM   2985  O  OD1   . ASP A 1  510 ? 180.755 122.917 134.974 1.00 75.25  ? 774  ASP A OD1   1 
ATOM   2986  O  OD2   . ASP A 1  510 ? 181.108 122.283 132.906 1.00 75.25  ? 774  ASP A OD2   1 
ATOM   2987  N  N     . ARG A 1  511 ? 184.142 125.206 135.597 1.00 72.99  ? 775  ARG A N     1 
ATOM   2988  C  CA    . ARG A 1  511 ? 185.173 124.760 136.524 1.00 72.99  ? 775  ARG A CA    1 
ATOM   2989  C  C     . ARG A 1  511 ? 184.996 125.370 137.908 1.00 72.99  ? 775  ARG A C     1 
ATOM   2990  O  O     . ARG A 1  511 ? 185.144 124.687 138.917 1.00 72.99  ? 775  ARG A O     1 
ATOM   2991  C  CB    . ARG A 1  511 ? 186.562 125.091 135.983 1.00 72.99  ? 775  ARG A CB    1 
ATOM   2992  C  CG    . ARG A 1  511 ? 187.694 124.680 136.906 1.00 72.99  ? 775  ARG A CG    1 
ATOM   2993  C  CD    . ARG A 1  511 ? 189.034 125.153 136.370 1.00 72.99  ? 775  ARG A CD    1 
ATOM   2994  N  NE    . ARG A 1  511 ? 189.572 124.235 135.373 1.00 72.99  ? 775  ARG A NE    1 
ATOM   2995  C  CZ    . ARG A 1  511 ? 189.691 122.925 135.554 1.00 72.99  ? 775  ARG A CZ    1 
ATOM   2996  N  NH1   . ARG A 1  511 ? 189.308 122.377 136.697 1.00 72.99  ? 775  ARG A NH1   1 
ATOM   2997  N  NH2   . ARG A 1  511 ? 190.193 122.164 134.592 1.00 72.99  ? 775  ARG A NH2   1 
ATOM   2998  N  N     . VAL A 1  512 ? 184.684 126.660 137.954 1.00 70.06  ? 776  VAL A N     1 
ATOM   2999  C  CA    . VAL A 1  512 ? 184.493 127.344 139.232 1.00 70.06  ? 776  VAL A CA    1 
ATOM   3000  C  C     . VAL A 1  512 ? 183.080 127.200 139.770 1.00 70.06  ? 776  VAL A C     1 
ATOM   3001  O  O     . VAL A 1  512 ? 182.819 127.620 140.905 1.00 70.06  ? 776  VAL A O     1 
ATOM   3002  C  CB    . VAL A 1  512 ? 184.815 128.849 139.132 1.00 70.06  ? 776  VAL A CB    1 
ATOM   3003  C  CG1   . VAL A 1  512 ? 186.247 129.057 138.665 1.00 70.06  ? 776  VAL A CG1   1 
ATOM   3004  C  CG2   . VAL A 1  512 ? 183.826 129.546 138.217 1.00 70.06  ? 776  VAL A CG2   1 
ATOM   3005  N  N     . LYS A 1  513 ? 182.165 126.621 138.991 1.00 70.29  ? 777  LYS A N     1 
ATOM   3006  C  CA    . LYS A 1  513 ? 180.772 126.436 139.401 1.00 70.29  ? 777  LYS A CA    1 
ATOM   3007  C  C     . LYS A 1  513 ? 180.121 127.764 139.779 1.00 70.29  ? 777  LYS A C     1 
ATOM   3008  O  O     . LYS A 1  513 ? 179.393 127.868 140.768 1.00 70.29  ? 777  LYS A O     1 
ATOM   3009  C  CB    . LYS A 1  513 ? 180.663 125.427 140.545 1.00 70.29  ? 777  LYS A CB    1 
ATOM   3010  C  CG    . LYS A 1  513 ? 181.189 124.042 140.203 1.00 70.29  ? 777  LYS A CG    1 
ATOM   3011  C  CD    . LYS A 1  513 ? 180.344 123.379 139.130 1.00 70.29  ? 777  LYS A CD    1 
ATOM   3012  C  CE    . LYS A 1  513 ? 180.766 121.937 138.907 1.00 70.29  ? 777  LYS A CE    1 
ATOM   3013  N  NZ    . LYS A 1  513 ? 182.110 121.846 138.273 1.00 70.29  ? 777  LYS A NZ    1 
ATOM   3014  N  N     . GLY A 1  514 ? 180.391 128.793 138.980 1.00 71.87  ? 778  GLY A N     1 
ATOM   3015  C  CA    . GLY A 1  514 ? 179.756 130.084 139.161 1.00 71.87  ? 778  GLY A CA    1 
ATOM   3016  C  C     . GLY A 1  514 ? 180.255 130.870 140.355 1.00 71.87  ? 778  GLY A C     1 
ATOM   3017  O  O     . GLY A 1  514 ? 179.485 131.170 141.272 1.00 71.87  ? 778  GLY A O     1 
ATOM   3018  N  N     . VAL A 1  515 ? 181.541 131.210 140.358 1.00 69.08  ? 779  VAL A N     1 
ATOM   3019  C  CA    . VAL A 1  515 ? 182.148 132.027 141.404 1.00 69.08  ? 779  VAL A CA    1 
ATOM   3020  C  C     . VAL A 1  515 ? 182.948 133.123 140.713 1.00 69.08  ? 779  VAL A C     1 
ATOM   3021  O  O     . VAL A 1  515 ? 183.997 132.849 140.117 1.00 69.08  ? 779  VAL A O     1 
ATOM   3022  C  CB    . VAL A 1  515 ? 183.043 131.207 142.343 1.00 69.08  ? 779  VAL A CB    1 
ATOM   3023  C  CG1   . VAL A 1  515 ? 183.743 132.121 143.336 1.00 69.08  ? 779  VAL A CG1   1 
ATOM   3024  C  CG2   . VAL A 1  515 ? 182.226 130.152 143.073 1.00 69.08  ? 779  VAL A CG2   1 
ATOM   3025  N  N     . SER A 1  516 ? 182.460 134.360 140.791 1.00 69.84  ? 780  SER A N     1 
ATOM   3026  C  CA    . SER A 1  516 ? 183.105 135.491 140.134 1.00 69.84  ? 780  SER A CA    1 
ATOM   3027  C  C     . SER A 1  516 ? 183.175 136.688 141.071 1.00 69.84  ? 780  SER A C     1 
ATOM   3028  O  O     . SER A 1  516 ? 183.005 137.838 140.653 1.00 69.84  ? 780  SER A O     1 
ATOM   3029  C  CB    . SER A 1  516 ? 182.381 135.863 138.841 1.00 69.84  ? 780  SER A CB    1 
ATOM   3030  O  OG    . SER A 1  516 ? 182.988 136.984 138.224 1.00 69.84  ? 780  SER A OG    1 
ATOM   3031  N  N     . ALA A 1  517 ? 183.430 136.433 142.351 1.00 68.56  ? 781  ALA A N     1 
ATOM   3032  C  CA    . ALA A 1  517 ? 183.569 137.492 143.341 1.00 68.56  ? 781  ALA A CA    1 
ATOM   3033  C  C     . ALA A 1  517 ? 184.284 136.923 144.555 1.00 68.56  ? 781  ALA A C     1 
ATOM   3034  O  O     . ALA A 1  517 ? 184.129 135.743 144.882 1.00 68.56  ? 781  ALA A O     1 
ATOM   3035  C  CB    . ALA A 1  517 ? 182.210 138.077 143.742 1.00 68.56  ? 781  ALA A CB    1 
ATOM   3036  N  N     . LYS A 1  518 ? 185.064 137.773 145.217 1.00 66.57  ? 782  LYS A N     1 
ATOM   3037  C  CA    . LYS A 1  518 ? 185.864 137.338 146.353 1.00 66.57  ? 782  LYS A CA    1 
ATOM   3038  C  C     . LYS A 1  518 ? 185.025 137.379 147.622 1.00 66.57  ? 782  LYS A C     1 
ATOM   3039  O  O     . LYS A 1  518 ? 184.539 138.456 147.993 1.00 66.57  ? 782  LYS A O     1 
ATOM   3040  C  CB    . LYS A 1  518 ? 187.091 138.216 146.513 1.00 66.57  ? 782  LYS A CB    1 
ATOM   3041  C  CG    . LYS A 1  518 ? 188.033 137.756 147.609 1.00 66.57  ? 782  LYS A CG    1 
ATOM   3042  C  CD    . LYS A 1  518 ? 189.277 138.624 147.673 1.00 66.57  ? 782  LYS A CD    1 
ATOM   3043  C  CE    . LYS A 1  518 ? 190.206 138.163 148.782 1.00 66.57  ? 782  LYS A CE    1 
ATOM   3044  N  NZ    . LYS A 1  518 ? 191.428 139.005 148.868 1.00 66.57  ? 782  LYS A NZ    1 
ATOM   3045  N  N     . PRO A 1  519 ? 184.824 136.255 148.305 1.00 67.26  ? 783  PRO A N     1 
ATOM   3046  C  CA    . PRO A 1  519 ? 184.052 136.276 149.553 1.00 67.26  ? 783  PRO A CA    1 
ATOM   3047  C  C     . PRO A 1  519 ? 184.771 137.075 150.629 1.00 67.26  ? 783  PRO A C     1 
ATOM   3048  O  O     . PRO A 1  519 ? 185.999 137.057 150.727 1.00 67.26  ? 783  PRO A O     1 
ATOM   3049  C  CB    . PRO A 1  519 ? 183.950 134.795 149.930 1.00 67.26  ? 783  PRO A CB    1 
ATOM   3050  C  CG    . PRO A 1  519 ? 184.185 134.058 148.654 1.00 67.26  ? 783  PRO A CG    1 
ATOM   3051  C  CD    . PRO A 1  519 ? 185.171 134.886 147.894 1.00 67.26  ? 783  PRO A CD    1 
ATOM   3052  N  N     . PHE A 1  520 ? 183.987 137.751 151.464 1.00 68.42  ? 784  PHE A N     1 
ATOM   3053  C  CA    . PHE A 1  520 ? 184.545 138.525 152.565 1.00 68.42  ? 784  PHE A CA    1 
ATOM   3054  C  C     . PHE A 1  520 ? 183.876 138.195 153.899 1.00 68.42  ? 784  PHE A C     1 
ATOM   3055  O  O     . PHE A 1  520 ? 184.378 138.568 154.956 1.00 68.42  ? 784  PHE A O     1 
ATOM   3056  C  CB    . PHE A 1  520 ? 184.527 140.028 152.270 1.00 68.42  ? 784  PHE A CB    1 
ATOM   3057  C  CG    . PHE A 1  520 ? 183.162 140.644 152.295 1.00 68.42  ? 784  PHE A CG    1 
ATOM   3058  C  CD1   . PHE A 1  520 ? 182.120 140.084 151.583 1.00 68.42  ? 784  PHE A CD1   1 
ATOM   3059  C  CD2   . PHE A 1  520 ? 182.929 141.800 153.019 1.00 68.42  ? 784  PHE A CD2   1 
ATOM   3060  C  CE1   . PHE A 1  520 ? 180.864 140.660 151.600 1.00 68.42  ? 784  PHE A CE1   1 
ATOM   3061  C  CE2   . PHE A 1  520 ? 181.678 142.380 153.042 1.00 68.42  ? 784  PHE A CE2   1 
ATOM   3062  C  CZ    . PHE A 1  520 ? 180.643 141.810 152.330 1.00 68.42  ? 784  PHE A CZ    1 
ATOM   3063  N  N     . ILE A 1  521 ? 182.750 137.488 153.849 1.00 69.61  ? 785  ILE A N     1 
ATOM   3064  C  CA    . ILE A 1  521 ? 182.046 137.086 155.061 1.00 69.61  ? 785  ILE A CA    1 
ATOM   3065  C  C     . ILE A 1  521 ? 181.873 135.575 155.034 1.00 69.61  ? 785  ILE A C     1 
ATOM   3066  O  O     . ILE A 1  521 ? 181.415 135.010 154.035 1.00 69.61  ? 785  ILE A O     1 
ATOM   3067  C  CB    . ILE A 1  521 ? 180.679 137.787 155.201 1.00 69.61  ? 785  ILE A CB    1 
ATOM   3068  C  CG1   . ILE A 1  521 ? 180.859 139.290 155.410 1.00 69.61  ? 785  ILE A CG1   1 
ATOM   3069  C  CG2   . ILE A 1  521 ? 179.881 137.184 156.346 1.00 69.61  ? 785  ILE A CG2   1 
ATOM   3070  C  CD1   . ILE A 1  521 ? 179.570 140.070 155.324 1.00 69.61  ? 785  ILE A CD1   1 
ATOM   3071  N  N     . GLU A 1  522 ? 182.250 134.921 156.128 1.00 78.53  ? 786  GLU A N     1 
ATOM   3072  C  CA    . GLU A 1  522 ? 182.080 133.481 156.268 1.00 78.53  ? 786  GLU A CA    1 
ATOM   3073  C  C     . GLU A 1  522 ? 180.688 133.197 156.816 1.00 78.53  ? 786  GLU A C     1 
ATOM   3074  O  O     . GLU A 1  522 ? 180.344 133.646 157.915 1.00 78.53  ? 786  GLU A O     1 
ATOM   3075  C  CB    . GLU A 1  522 ? 183.150 132.893 157.185 1.00 78.53  ? 786  GLU A CB    1 
ATOM   3076  C  CG    . GLU A 1  522 ? 183.076 131.382 157.324 1.00 78.53  ? 786  GLU A CG    1 
ATOM   3077  C  CD    . GLU A 1  522 ? 184.178 130.822 158.199 1.00 78.53  ? 786  GLU A CD    1 
ATOM   3078  O  OE1   . GLU A 1  522 ? 184.990 131.618 158.716 1.00 78.53  ? 786  GLU A OE1   1 
ATOM   3079  O  OE2   . GLU A 1  522 ? 184.232 129.586 158.369 1.00 78.53  ? 786  GLU A OE2   1 
ATOM   3080  N  N     . THR A 1  523 ? 179.890 132.457 156.052 1.00 79.55  ? 787  THR A N     1 
ATOM   3081  C  CA    . THR A 1  523 ? 178.532 132.112 156.438 1.00 79.55  ? 787  THR A CA    1 
ATOM   3082  C  C     . THR A 1  523 ? 178.395 130.601 156.563 1.00 79.55  ? 787  THR A C     1 
ATOM   3083  O  O     . THR A 1  523 ? 179.222 129.835 156.061 1.00 79.55  ? 787  THR A O     1 
ATOM   3084  C  CB    . THR A 1  523 ? 177.508 132.644 155.427 1.00 79.55  ? 787  THR A CB    1 
ATOM   3085  O  OG1   . THR A 1  523 ? 177.748 132.052 154.144 1.00 79.55  ? 787  THR A OG1   1 
ATOM   3086  C  CG2   . THR A 1  523 ? 177.611 134.156 155.309 1.00 79.55  ? 787  THR A CG2   1 
ATOM   3087  N  N     . VAL A 1  524 ? 177.335 130.182 157.245 1.00 77.21  ? 788  VAL A N     1 
ATOM   3088  C  CA    . VAL A 1  524 ? 177.047 128.765 157.446 1.00 77.21  ? 788  VAL A CA    1 
ATOM   3089  C  C     . VAL A 1  524 ? 176.073 128.311 156.364 1.00 77.21  ? 788  VAL A C     1 
ATOM   3090  O  O     . VAL A 1  524 ? 175.064 128.987 156.119 1.00 77.21  ? 788  VAL A O     1 
ATOM   3091  C  CB    . VAL A 1  524 ? 176.484 128.506 158.852 1.00 77.21  ? 788  VAL A CB    1 
ATOM   3092  C  CG1   . VAL A 1  524 ? 176.092 127.046 159.015 1.00 77.21  ? 788  VAL A CG1   1 
ATOM   3093  C  CG2   . VAL A 1  524 ? 177.499 128.911 159.909 1.00 77.21  ? 788  VAL A CG2   1 
ATOM   3094  N  N     . PRO A 1  525 ? 176.327 127.185 155.696 1.00 74.90  ? 789  PRO A N     1 
ATOM   3095  C  CA    . PRO A 1  525 ? 175.400 126.725 154.653 1.00 74.90  ? 789  PRO A CA    1 
ATOM   3096  C  C     . PRO A 1  525 ? 174.117 126.155 155.235 1.00 74.90  ? 789  PRO A C     1 
ATOM   3097  O  O     . PRO A 1  525 ? 173.976 124.937 155.383 1.00 74.90  ? 789  PRO A O     1 
ATOM   3098  C  CB    . PRO A 1  525 ? 176.211 125.654 153.913 1.00 74.90  ? 789  PRO A CB    1 
ATOM   3099  C  CG    . PRO A 1  525 ? 177.181 125.156 154.928 1.00 74.90  ? 789  PRO A CG    1 
ATOM   3100  C  CD    . PRO A 1  525 ? 177.530 126.339 155.784 1.00 74.90  ? 789  PRO A CD    1 
ATOM   3101  N  N     . SER A 1  526 ? 173.174 127.034 155.570 1.00 74.48  ? 790  SER A N     1 
ATOM   3102  C  CA    . SER A 1  526 ? 171.909 126.615 156.160 1.00 74.48  ? 790  SER A CA    1 
ATOM   3103  C  C     . SER A 1  526 ? 170.730 127.141 155.351 1.00 74.48  ? 790  SER A C     1 
ATOM   3104  O  O     . SER A 1  526 ? 170.910 127.667 154.249 1.00 74.48  ? 790  SER A O     1 
ATOM   3105  C  CB    . SER A 1  526 ? 171.812 127.089 157.611 1.00 74.48  ? 790  SER A CB    1 
ATOM   3106  O  OG    . SER A 1  526 ? 170.572 126.717 158.185 1.00 74.48  ? 790  SER A OG    1 
ATOM   3107  N  N     . ILE A 1  527 ? 169.521 126.997 155.889 1.00 72.45  ? 791  ILE A N     1 
ATOM   3108  C  CA    . ILE A 1  527 ? 168.299 127.413 155.214 1.00 72.45  ? 791  ILE A CA    1 
ATOM   3109  C  C     . ILE A 1  527 ? 167.569 128.422 156.088 1.00 72.45  ? 791  ILE A C     1 
ATOM   3110  O  O     . ILE A 1  527 ? 167.483 128.268 157.310 1.00 72.45  ? 791  ILE A O     1 
ATOM   3111  C  CB    . ILE A 1  527 ? 167.387 126.206 154.900 1.00 72.45  ? 791  ILE A CB    1 
ATOM   3112  C  CG1   . ILE A 1  527 ? 168.096 125.229 153.965 1.00 72.45  ? 791  ILE A CG1   1 
ATOM   3113  C  CG2   . ILE A 1  527 ? 166.076 126.662 154.280 1.00 72.45  ? 791  ILE A CG2   1 
ATOM   3114  C  CD1   . ILE A 1  527 ? 167.382 123.907 153.818 1.00 72.45  ? 791  ILE A CD1   1 
ATOM   3115  N  N     . ASP A 1  528 ? 167.034 129.462 155.449 1.00 78.60  ? 792  ASP A N     1 
ATOM   3116  C  CA    . ASP A 1  528 ? 166.199 130.454 156.116 1.00 78.60  ? 792  ASP A CA    1 
ATOM   3117  C  C     . ASP A 1  528 ? 164.757 129.966 156.044 1.00 78.60  ? 792  ASP A C     1 
ATOM   3118  O  O     . ASP A 1  528 ? 164.160 129.929 154.963 1.00 78.60  ? 792  ASP A O     1 
ATOM   3119  C  CB    . ASP A 1  528 ? 166.355 131.828 155.469 1.00 78.60  ? 792  ASP A CB    1 
ATOM   3120  C  CG    . ASP A 1  528 ? 165.707 132.934 156.281 1.00 78.60  ? 792  ASP A CG    1 
ATOM   3121  O  OD1   . ASP A 1  528 ? 165.120 132.638 157.343 1.00 78.60  ? 792  ASP A OD1   1 
ATOM   3122  O  OD2   . ASP A 1  528 ? 165.783 134.105 155.854 1.00 78.60  ? 792  ASP A OD2   1 
ATOM   3123  N  N     . ALA A 1  529 ? 164.201 129.594 157.197 1.00 75.46  ? 793  ALA A N     1 
ATOM   3124  C  CA    . ALA A 1  529 ? 162.892 128.951 157.213 1.00 75.46  ? 793  ALA A CA    1 
ATOM   3125  C  C     . ALA A 1  529 ? 161.777 129.925 156.846 1.00 75.46  ? 793  ALA A C     1 
ATOM   3126  O  O     . ALA A 1  529 ? 160.804 129.538 156.190 1.00 75.46  ? 793  ALA A O     1 
ATOM   3127  C  CB    . ALA A 1  529 ? 162.638 128.327 158.584 1.00 75.46  ? 793  ALA A CB    1 
ATOM   3128  N  N     . LEU A 1  530 ? 161.898 131.188 157.260 1.00 73.51  ? 794  LEU A N     1 
ATOM   3129  C  CA    . LEU A 1  530 ? 160.856 132.172 156.979 1.00 73.51  ? 794  LEU A CA    1 
ATOM   3130  C  C     . LEU A 1  530 ? 160.683 132.377 155.478 1.00 73.51  ? 794  LEU A C     1 
ATOM   3131  O  O     . LEU A 1  530 ? 159.578 132.235 154.935 1.00 73.51  ? 794  LEU A O     1 
ATOM   3132  C  CB    . LEU A 1  530 ? 161.195 133.494 157.667 1.00 73.51  ? 794  LEU A CB    1 
ATOM   3133  C  CG    . LEU A 1  530 ? 160.175 134.618 157.489 1.00 73.51  ? 794  LEU A CG    1 
ATOM   3134  C  CD1   . LEU A 1  530 ? 158.844 134.232 158.108 1.00 73.51  ? 794  LEU A CD1   1 
ATOM   3135  C  CD2   . LEU A 1  530 ? 160.695 135.910 158.092 1.00 73.51  ? 794  LEU A CD2   1 
ATOM   3136  N  N     . HIS A 1  531 ? 161.774 132.717 154.790 1.00 75.15  ? 795  HIS A N     1 
ATOM   3137  C  CA    . HIS A 1  531 ? 161.699 132.925 153.351 1.00 75.15  ? 795  HIS A CA    1 
ATOM   3138  C  C     . HIS A 1  531 ? 161.379 131.633 152.615 1.00 75.15  ? 795  HIS A C     1 
ATOM   3139  O  O     . HIS A 1  531 ? 160.741 131.669 151.559 1.00 75.15  ? 795  HIS A O     1 
ATOM   3140  C  CB    . HIS A 1  531 ? 163.005 133.529 152.839 1.00 75.15  ? 795  HIS A CB    1 
ATOM   3141  C  CG    . HIS A 1  531 ? 163.266 134.912 153.347 1.00 75.15  ? 795  HIS A CG    1 
ATOM   3142  N  ND1   . HIS A 1  531 ? 163.937 135.158 154.525 1.00 75.15  ? 795  HIS A ND1   1 
ATOM   3143  C  CD2   . HIS A 1  531 ? 162.937 136.124 152.842 1.00 75.15  ? 795  HIS A CD2   1 
ATOM   3144  C  CE1   . HIS A 1  531 ? 164.015 136.462 154.721 1.00 75.15  ? 795  HIS A CE1   1 
ATOM   3145  N  NE2   . HIS A 1  531 ? 163.416 137.071 153.714 1.00 75.15  ? 795  HIS A NE2   1 
ATOM   3146  N  N     . CYS A 1  532 ? 161.794 130.487 153.159 1.00 76.05  ? 796  CYS A N     1 
ATOM   3147  C  CA    . CYS A 1  532 ? 161.416 129.209 152.565 1.00 76.05  ? 796  CYS A CA    1 
ATOM   3148  C  C     . CYS A 1  532 ? 159.904 129.024 152.592 1.00 76.05  ? 796  CYS A C     1 
ATOM   3149  O  O     . CYS A 1  532 ? 159.292 128.651 151.583 1.00 76.05  ? 796  CYS A O     1 
ATOM   3150  C  CB    . CYS A 1  532 ? 162.114 128.063 153.298 1.00 76.05  ? 796  CYS A CB    1 
ATOM   3151  S  SG    . CYS A 1  532 ? 161.768 126.425 152.622 1.00 76.05  ? 796  CYS A SG    1 
ATOM   3152  N  N     . ASP A 1  533 ? 159.286 129.289 153.744 1.00 76.09  ? 797  ASP A N     1 
ATOM   3153  C  CA    . ASP A 1  533 ? 157.836 129.181 153.860 1.00 76.09  ? 797  ASP A CA    1 
ATOM   3154  C  C     . ASP A 1  533 ? 157.145 130.166 152.926 1.00 76.09  ? 797  ASP A C     1 
ATOM   3155  O  O     . ASP A 1  533 ? 156.155 129.828 152.267 1.00 76.09  ? 797  ASP A O     1 
ATOM   3156  C  CB    . ASP A 1  533 ? 157.413 129.421 155.310 1.00 76.09  ? 797  ASP A CB    1 
ATOM   3157  C  CG    . ASP A 1  533 ? 155.966 129.044 155.572 1.00 76.09  ? 797  ASP A CG    1 
ATOM   3158  O  OD1   . ASP A 1  533 ? 155.282 128.583 154.635 1.00 76.09  ? 797  ASP A OD1   1 
ATOM   3159  O  OD2   . ASP A 1  533 ? 155.510 129.214 156.723 1.00 76.09  ? 797  ASP A OD2   1 
ATOM   3160  N  N     . ILE A 1  534 ? 157.668 131.392 152.847 1.00 73.51  ? 798  ILE A N     1 
ATOM   3161  C  CA    . ILE A 1  534 ? 157.063 132.402 151.982 1.00 73.51  ? 798  ILE A CA    1 
ATOM   3162  C  C     . ILE A 1  534 ? 157.123 131.968 150.521 1.00 73.51  ? 798  ILE A C     1 
ATOM   3163  O  O     . ILE A 1  534 ? 156.130 132.062 149.787 1.00 73.51  ? 798  ILE A O     1 
ATOM   3164  C  CB    . ILE A 1  534 ? 157.743 133.766 152.198 1.00 73.51  ? 798  ILE A CB    1 
ATOM   3165  C  CG1   . ILE A 1  534 ? 157.495 134.260 153.623 1.00 73.51  ? 798  ILE A CG1   1 
ATOM   3166  C  CG2   . ILE A 1  534 ? 157.238 134.781 151.190 1.00 73.51  ? 798  ILE A CG2   1 
ATOM   3167  C  CD1   . ILE A 1  534 ? 158.342 135.446 154.004 1.00 73.51  ? 798  ILE A CD1   1 
ATOM   3168  N  N     . GLY A 1  535 ? 158.283 131.481 150.077 1.00 73.38  ? 799  GLY A N     1 
ATOM   3169  C  CA    . GLY A 1  535 ? 158.416 131.060 148.693 1.00 73.38  ? 799  GLY A CA    1 
ATOM   3170  C  C     . GLY A 1  535 ? 157.563 129.851 148.364 1.00 73.38  ? 799  GLY A C     1 
ATOM   3171  O  O     . GLY A 1  535 ? 156.967 129.776 147.286 1.00 73.38  ? 799  GLY A O     1 
ATOM   3172  N  N     . ASN A 1  536 ? 157.487 128.890 149.288 1.00 70.78  ? 800  ASN A N     1 
ATOM   3173  C  CA    . ASN A 1  536 ? 156.639 127.726 149.058 1.00 70.78  ? 800  ASN A CA    1 
ATOM   3174  C  C     . ASN A 1  536 ? 155.171 128.125 148.976 1.00 70.78  ? 800  ASN A C     1 
ATOM   3175  O  O     . ASN A 1  536 ? 154.431 127.617 148.124 1.00 70.78  ? 800  ASN A O     1 
ATOM   3176  C  CB    . ASN A 1  536 ? 156.859 126.691 150.158 1.00 70.78  ? 800  ASN A CB    1 
ATOM   3177  C  CG    . ASN A 1  536 ? 158.221 126.035 150.073 1.00 70.78  ? 800  ASN A CG    1 
ATOM   3178  O  OD1   . ASN A 1  536 ? 158.695 125.703 148.987 1.00 70.78  ? 800  ASN A OD1   1 
ATOM   3179  N  ND2   . ASN A 1  536 ? 158.860 125.847 151.220 1.00 70.78  ? 800  ASN A ND2   1 
ATOM   3180  N  N     . ALA A 1  537 ? 154.734 129.042 149.843 1.00 70.50  ? 801  ALA A N     1 
ATOM   3181  C  CA    . ALA A 1  537 ? 153.356 129.513 149.780 1.00 70.50  ? 801  ALA A CA    1 
ATOM   3182  C  C     . ALA A 1  537 ? 153.081 130.238 148.469 1.00 70.50  ? 801  ALA A C     1 
ATOM   3183  O  O     . ALA A 1  537 ? 152.020 130.054 147.863 1.00 70.50  ? 801  ALA A O     1 
ATOM   3184  C  CB    . ALA A 1  537 ? 153.055 130.421 150.970 1.00 70.50  ? 801  ALA A CB    1 
ATOM   3185  N  N     . ALA A 1  538 ? 154.030 131.058 148.008 1.00 71.58  ? 802  ALA A N     1 
ATOM   3186  C  CA    . ALA A 1  538 ? 153.842 131.758 146.739 1.00 71.58  ? 802  ALA A CA    1 
ATOM   3187  C  C     . ALA A 1  538 ? 153.743 130.777 145.577 1.00 71.58  ? 802  ALA A C     1 
ATOM   3188  O  O     . ALA A 1  538 ? 152.879 130.920 144.699 1.00 71.58  ? 802  ALA A O     1 
ATOM   3189  C  CB    . ALA A 1  538 ? 154.983 132.748 146.511 1.00 71.58  ? 802  ALA A CB    1 
ATOM   3190  N  N     . GLU A 1  539 ? 154.611 129.773 145.592 1.00 74.87  ? 803  GLU A N     1 
ATOM   3191  C  CA    . GLU A 1  539 ? 154.626 128.760 144.549 1.00 74.87  ? 803  GLU A CA    1 
ATOM   3192  C  C     . GLU A 1  539 ? 153.316 127.990 144.511 1.00 74.87  ? 803  GLU A C     1 
ATOM   3193  O  O     . GLU A 1  539 ? 152.759 127.754 143.442 1.00 74.87  ? 803  GLU A O     1 
ATOM   3194  C  CB    . GLU A 1  539 ? 155.787 127.791 144.759 1.00 74.87  ? 803  GLU A CB    1 
ATOM   3195  C  CG    . GLU A 1  539 ? 156.123 126.967 143.530 1.00 74.87  ? 803  GLU A CG    1 
ATOM   3196  C  CD    . GLU A 1  539 ? 156.157 127.801 142.266 1.00 74.87  ? 803  GLU A CD    1 
ATOM   3197  O  OE1   . GLU A 1  539 ? 156.114 127.217 141.162 1.00 74.87  ? 803  GLU A OE1   1 
ATOM   3198  O  OE2   . GLU A 1  539 ? 156.226 129.042 142.378 1.00 74.87  ? 803  GLU A OE2   1 
ATOM   3199  N  N     . PHE A 1  540 ? 152.831 127.607 145.685 1.00 71.07  ? 804  PHE A N     1 
ATOM   3200  C  CA    . PHE A 1  540 ? 151.577 126.884 145.775 1.00 71.07  ? 804  PHE A CA    1 
ATOM   3201  C  C     . PHE A 1  540 ? 150.470 127.768 145.234 1.00 71.07  ? 804  PHE A C     1 
ATOM   3202  O  O     . PHE A 1  540 ? 149.662 127.337 144.416 1.00 71.07  ? 804  PHE A O     1 
ATOM   3203  C  CB    . PHE A 1  540 ? 151.281 126.498 147.220 1.00 71.07  ? 804  PHE A CB    1 
ATOM   3204  C  CG    . PHE A 1  540 ? 151.630 125.077 147.547 1.00 71.07  ? 804  PHE A CG    1 
ATOM   3205  C  CD1   . PHE A 1  540 ? 152.931 124.724 147.852 1.00 71.07  ? 804  PHE A CD1   1 
ATOM   3206  C  CD2   . PHE A 1  540 ? 150.658 124.095 147.543 1.00 71.07  ? 804  PHE A CD2   1 
ATOM   3207  C  CE1   . PHE A 1  540 ? 153.256 123.417 148.151 1.00 71.07  ? 804  PHE A CE1   1 
ATOM   3208  C  CE2   . PHE A 1  540 ? 150.976 122.786 147.840 1.00 71.07  ? 804  PHE A CE2   1 
ATOM   3209  C  CZ    . PHE A 1  540 ? 152.277 122.446 148.145 1.00 71.07  ? 804  PHE A CZ    1 
ATOM   3210  N  N     . TYR A 1  541 ? 150.445 129.017 145.683 1.00 70.88  ? 805  TYR A N     1 
ATOM   3211  C  CA    . TYR A 1  541 ? 149.417 129.947 145.227 1.00 70.88  ? 805  TYR A CA    1 
ATOM   3212  C  C     . TYR A 1  541 ? 149.380 130.006 143.704 1.00 70.88  ? 805  TYR A C     1 
ATOM   3213  O  O     . TYR A 1  541 ? 148.305 129.976 143.087 1.00 70.88  ? 805  TYR A O     1 
ATOM   3214  C  CB    . TYR A 1  541 ? 149.690 131.324 145.837 1.00 70.88  ? 805  TYR A CB    1 
ATOM   3215  C  CG    . TYR A 1  541 ? 148.693 132.408 145.505 1.00 70.88  ? 805  TYR A CG    1 
ATOM   3216  C  CD1   . TYR A 1  541 ? 147.420 132.405 146.060 1.00 70.88  ? 805  TYR A CD1   1 
ATOM   3217  C  CD2   . TYR A 1  541 ? 149.043 133.464 144.677 1.00 70.88  ? 805  TYR A CD2   1 
ATOM   3218  C  CE1   . TYR A 1  541 ? 146.514 133.408 145.771 1.00 70.88  ? 805  TYR A CE1   1 
ATOM   3219  C  CE2   . TYR A 1  541 ? 148.148 134.471 144.387 1.00 70.88  ? 805  TYR A CE2   1 
ATOM   3220  C  CZ    . TYR A 1  541 ? 146.884 134.438 144.933 1.00 70.88  ? 805  TYR A CZ    1 
ATOM   3221  O  OH    . TYR A 1  541 ? 145.991 135.442 144.640 1.00 70.88  ? 805  TYR A OH    1 
ATOM   3222  N  N     . LYS A 1  542 ? 150.561 130.008 143.098 1.00 73.62  ? 806  LYS A N     1 
ATOM   3223  C  CA    . LYS A 1  542 ? 150.669 130.021 141.649 1.00 73.62  ? 806  LYS A CA    1 
ATOM   3224  C  C     . LYS A 1  542 ? 150.100 128.723 141.091 1.00 73.62  ? 806  LYS A C     1 
ATOM   3225  O  O     . LYS A 1  542 ? 149.413 128.725 140.073 1.00 73.62  ? 806  LYS A O     1 
ATOM   3226  C  CB    . LYS A 1  542 ? 152.126 130.180 141.222 1.00 73.62  ? 806  LYS A CB    1 
ATOM   3227  C  CG    . LYS A 1  542 ? 152.304 130.794 139.845 1.00 73.62  ? 806  LYS A CG    1 
ATOM   3228  C  CD    . LYS A 1  542 ? 152.661 132.267 139.943 1.00 73.62  ? 806  LYS A CD    1 
ATOM   3229  C  CE    . LYS A 1  542 ? 154.167 132.468 139.996 1.00 73.62  ? 806  LYS A CE    1 
ATOM   3230  N  NZ    . LYS A 1  542 ? 154.577 133.289 141.168 1.00 73.62  ? 806  LYS A NZ    1 
ATOM   3231  N  N     . ILE A 1  543 ? 150.390 127.611 141.760 1.00 71.29  ? 807  ILE A N     1 
ATOM   3232  C  CA    . ILE A 1  543 ? 149.890 126.310 141.325 1.00 71.29  ? 807  ILE A CA    1 
ATOM   3233  C  C     . ILE A 1  543 ? 148.370 126.265 141.413 1.00 71.29  ? 807  ILE A C     1 
ATOM   3234  O  O     . ILE A 1  543 ? 147.703 125.706 140.537 1.00 71.29  ? 807  ILE A O     1 
ATOM   3235  C  CB    . ILE A 1  543 ? 150.537 125.178 142.144 1.00 71.29  ? 807  ILE A CB    1 
ATOM   3236  C  CG1   . ILE A 1  543 ? 152.031 125.079 141.840 1.00 71.29  ? 807  ILE A CG1   1 
ATOM   3237  C  CG2   . ILE A 1  543 ? 149.858 123.849 141.860 1.00 71.29  ? 807  ILE A CG2   1 
ATOM   3238  C  CD1   . ILE A 1  543 ? 152.773 124.162 142.779 1.00 71.29  ? 807  ILE A CD1   1 
ATOM   3239  N  N     . PHE A 1  544 ? 147.820 126.894 142.444 1.00 73.23  ? 808  PHE A N     1 
ATOM   3240  C  CA    . PHE A 1  544 ? 146.377 126.953 142.587 1.00 73.23  ? 808  PHE A CA    1 
ATOM   3241  C  C     . PHE A 1  544 ? 145.845 127.686 141.367 1.00 73.23  ? 808  PHE A C     1 
ATOM   3242  O  O     . PHE A 1  544 ? 144.973 127.184 140.663 1.00 73.23  ? 808  PHE A O     1 
ATOM   3243  C  CB    . PHE A 1  544 ? 145.982 127.695 143.860 1.00 73.23  ? 808  PHE A CB    1 
ATOM   3244  C  CG    . PHE A 1  544 ? 146.162 126.889 145.111 1.00 73.23  ? 808  PHE A CG    1 
ATOM   3245  C  CD1   . PHE A 1  544 ? 146.329 125.519 145.049 1.00 73.23  ? 808  PHE A CD1   1 
ATOM   3246  C  CD2   . PHE A 1  544 ? 146.167 127.503 146.350 1.00 73.23  ? 808  PHE A CD2   1 
ATOM   3247  C  CE1   . PHE A 1  544 ? 146.497 124.774 146.199 1.00 73.23  ? 808  PHE A CE1   1 
ATOM   3248  C  CE2   . PHE A 1  544 ? 146.334 126.766 147.504 1.00 73.23  ? 808  PHE A CE2   1 
ATOM   3249  C  CZ    . PHE A 1  544 ? 146.500 125.399 147.429 1.00 73.23  ? 808  PHE A CZ    1 
ATOM   3250  N  N     . GLN A 1  545 ? 146.385 128.875 141.111 1.00 74.68  ? 809  GLN A N     1 
ATOM   3251  C  CA    . GLN A 1  545 ? 145.960 129.664 139.956 1.00 74.68  ? 809  GLN A CA    1 
ATOM   3252  C  C     . GLN A 1  545 ? 145.965 128.827 138.684 1.00 74.68  ? 809  GLN A C     1 
ATOM   3253  O  O     . GLN A 1  545 ? 145.003 128.848 137.908 1.00 74.68  ? 809  GLN A O     1 
ATOM   3254  C  CB    . GLN A 1  545 ? 146.861 130.887 139.782 1.00 74.68  ? 809  GLN A CB    1 
ATOM   3255  C  CG    . GLN A 1  545 ? 146.682 131.978 140.816 1.00 74.68  ? 809  GLN A CG    1 
ATOM   3256  C  CD    . GLN A 1  545 ? 147.603 133.155 140.566 1.00 74.68  ? 809  GLN A CD    1 
ATOM   3257  O  OE1   . GLN A 1  545 ? 148.449 133.115 139.673 1.00 74.68  ? 809  GLN A OE1   1 
ATOM   3258  N  NE2   . GLN A 1  545 ? 147.434 134.215 141.344 1.00 74.68  ? 809  GLN A NE2   1 
ATOM   3259  N  N     . LEU A 1  546 ? 147.047 128.081 138.453 1.00 77.22  ? 810  LEU A N     1 
ATOM   3260  C  CA    . LEU A 1  546 ? 147.148 127.294 137.227 1.00 77.22  ? 810  LEU A CA    1 
ATOM   3261  C  C     . LEU A 1  546 ? 146.152 126.140 137.209 1.00 77.22  ? 810  LEU A C     1 
ATOM   3262  O  O     . LEU A 1  546 ? 145.679 125.749 136.136 1.00 77.22  ? 810  LEU A O     1 
ATOM   3263  C  CB    . LEU A 1  546 ? 148.573 126.767 137.058 1.00 77.22  ? 810  LEU A CB    1 
ATOM   3264  C  CG    . LEU A 1  546 ? 149.665 127.821 136.865 1.00 77.22  ? 810  LEU A CG    1 
ATOM   3265  C  CD1   . LEU A 1  546 ? 151.036 127.167 136.831 1.00 77.22  ? 810  LEU A CD1   1 
ATOM   3266  C  CD2   . LEU A 1  546 ? 149.425 128.638 135.606 1.00 77.22  ? 810  LEU A CD2   1 
ATOM   3267  N  N     . GLU A 1  547 ? 145.822 125.585 138.376 1.00 79.13  ? 811  GLU A N     1 
ATOM   3268  C  CA    . GLU A 1  547 ? 144.872 124.480 138.435 1.00 79.13  ? 811  GLU A CA    1 
ATOM   3269  C  C     . GLU A 1  547 ? 143.436 124.944 138.236 1.00 79.13  ? 811  GLU A C     1 
ATOM   3270  O  O     . GLU A 1  547 ? 142.615 124.183 137.713 1.00 79.13  ? 811  GLU A O     1 
ATOM   3271  C  CB    . GLU A 1  547 ? 144.994 123.741 139.768 1.00 79.13  ? 811  GLU A CB    1 
ATOM   3272  C  CG    . GLU A 1  547 ? 146.278 122.946 139.935 1.00 79.13  ? 811  GLU A CG    1 
ATOM   3273  C  CD    . GLU A 1  547 ? 146.362 121.772 138.983 1.00 79.13  ? 811  GLU A CD    1 
ATOM   3274  O  OE1   . GLU A 1  547 ? 145.301 121.224 138.618 1.00 79.13  ? 811  GLU A OE1   1 
ATOM   3275  O  OE2   . GLU A 1  547 ? 147.490 121.388 138.610 1.00 79.13  ? 811  GLU A OE2   1 
ATOM   3276  N  N     . ILE A 1  548 ? 143.111 126.172 138.647 1.00 79.25  ? 812  ILE A N     1 
ATOM   3277  C  CA    . ILE A 1  548 ? 141.764 126.688 138.408 1.00 79.25  ? 812  ILE A CA    1 
ATOM   3278  C  C     . ILE A 1  548 ? 141.497 126.786 136.912 1.00 79.25  ? 812  ILE A C     1 
ATOM   3279  O  O     . ILE A 1  548 ? 140.400 126.473 136.434 1.00 79.25  ? 812  ILE A O     1 
ATOM   3280  C  CB    . ILE A 1  548 ? 141.573 128.047 139.104 1.00 79.25  ? 812  ILE A CB    1 
ATOM   3281  C  CG1   . ILE A 1  548 ? 141.641 127.881 140.619 1.00 79.25  ? 812  ILE A CG1   1 
ATOM   3282  C  CG2   . ILE A 1  548 ? 140.246 128.674 138.706 1.00 79.25  ? 812  ILE A CG2   1 
ATOM   3283  C  CD1   . ILE A 1  548 ? 141.698 129.185 141.358 1.00 79.25  ? 812  ILE A CD1   1 
ATOM   3284  N  N     . GLY A 1  549 ? 142.502 127.204 136.150 1.00 84.30  ? 813  GLY A N     1 
ATOM   3285  C  CA    . GLY A 1  549 ? 142.350 127.415 134.729 1.00 84.30  ? 813  GLY A CA    1 
ATOM   3286  C  C     . GLY A 1  549 ? 142.615 126.226 133.835 1.00 84.30  ? 813  GLY A C     1 
ATOM   3287  O  O     . GLY A 1  549 ? 142.496 126.359 132.612 1.00 84.30  ? 813  GLY A O     1 
ATOM   3288  N  N     . GLU A 1  550 ? 142.978 125.072 134.398 1.00 90.29  ? 814  GLU A N     1 
ATOM   3289  C  CA    . GLU A 1  550 ? 143.213 123.847 133.632 1.00 90.29  ? 814  GLU A CA    1 
ATOM   3290  C  C     . GLU A 1  550 ? 144.300 124.054 132.574 1.00 90.29  ? 814  GLU A C     1 
ATOM   3291  O  O     . GLU A 1  550 ? 144.066 123.948 131.368 1.00 90.29  ? 814  GLU A O     1 
ATOM   3292  C  CB    . GLU A 1  550 ? 141.914 123.343 132.995 1.00 90.29  ? 814  GLU A CB    1 
ATOM   3293  C  CG    . GLU A 1  550 ? 140.878 122.855 133.991 1.00 90.29  ? 814  GLU A CG    1 
ATOM   3294  C  CD    . GLU A 1  550 ? 139.597 122.402 133.320 1.00 90.29  ? 814  GLU A CD    1 
ATOM   3295  O  OE1   . GLU A 1  550 ? 139.475 122.580 132.090 1.00 90.29  ? 814  GLU A OE1   1 
ATOM   3296  O  OE2   . GLU A 1  550 ? 138.712 121.870 134.021 1.00 90.29  ? 814  GLU A OE2   1 
ATOM   3297  N  N     . VAL A 1  551 ? 145.508 124.357 133.054 1.00 89.73  ? 815  VAL A N     1 
ATOM   3298  C  CA    . VAL A 1  551 ? 146.637 124.525 132.147 1.00 89.73  ? 815  VAL A CA    1 
ATOM   3299  C  C     . VAL A 1  551 ? 147.053 123.184 131.555 1.00 89.73  ? 815  VAL A C     1 
ATOM   3300  O  O     . VAL A 1  551 ? 147.545 123.122 130.421 1.00 89.73  ? 815  VAL A O     1 
ATOM   3301  C  CB    . VAL A 1  551 ? 147.802 125.217 132.879 1.00 89.73  ? 815  VAL A CB    1 
ATOM   3302  C  CG1   . VAL A 1  551 ? 149.020 125.339 131.975 1.00 89.73  ? 815  VAL A CG1   1 
ATOM   3303  C  CG2   . VAL A 1  551 ? 147.369 126.584 133.377 1.00 89.73  ? 815  VAL A CG2   1 
ATOM   3304  N  N     . TYR A 1  552 ? 146.810 122.106 132.293 1.00 91.73  ? 816  TYR A N     1 
ATOM   3305  C  CA    . TYR A 1  552 ? 147.152 120.770 131.816 1.00 91.73  ? 816  TYR A CA    1 
ATOM   3306  C  C     . TYR A 1  552 ? 146.281 120.374 130.623 1.00 91.73  ? 816  TYR A C     1 
ATOM   3307  O  O     . TYR A 1  552 ? 146.565 119.400 129.928 1.00 91.73  ? 816  TYR A O     1 
ATOM   3308  C  CB    . TYR A 1  552 ? 147.016 119.745 132.940 1.00 91.73  ? 816  TYR A CB    1 
ATOM   3309  C  CG    . TYR A 1  552 ? 145.590 119.377 133.260 1.00 91.73  ? 816  TYR A CG    1 
ATOM   3310  C  CD1   . TYR A 1  552 ? 144.613 120.353 133.378 1.00 91.73  ? 816  TYR A CD1   1 
ATOM   3311  C  CD2   . TYR A 1  552 ? 145.221 118.053 133.446 1.00 91.73  ? 816  TYR A CD2   1 
ATOM   3312  C  CE1   . TYR A 1  552 ? 143.306 120.020 133.671 1.00 91.73  ? 816  TYR A CE1   1 
ATOM   3313  C  CE2   . TYR A 1  552 ? 143.917 117.711 133.739 1.00 91.73  ? 816  TYR A CE2   1 
ATOM   3314  C  CZ    . TYR A 1  552 ? 142.964 118.698 133.850 1.00 91.73  ? 816  TYR A CZ    1 
ATOM   3315  O  OH    . TYR A 1  552 ? 141.664 118.361 134.142 1.00 91.73  ? 816  TYR A OH    1 
ATOM   3316  N  N     . LYS A 1  553 ? 145.215 121.136 130.402 1.00 97.99  ? 817  LYS A N     1 
ATOM   3317  C  CA    . LYS A 1  553 ? 144.302 120.911 129.292 1.00 97.99  ? 817  LYS A CA    1 
ATOM   3318  C  C     . LYS A 1  553 ? 144.448 121.933 128.176 1.00 97.99  ? 817  LYS A C     1 
ATOM   3319  O  O     . LYS A 1  553 ? 144.226 121.589 127.013 1.00 97.99  ? 817  LYS A O     1 
ATOM   3320  C  CB    . LYS A 1  553 ? 142.848 120.917 129.793 1.00 97.99  ? 817  LYS A CB    1 
ATOM   3321  C  CG    . LYS A 1  553 ? 141.813 120.538 128.746 1.00 97.99  ? 817  LYS A CG    1 
ATOM   3322  C  CD    . LYS A 1  553 ? 140.420 120.478 129.350 1.00 97.99  ? 817  LYS A CD    1 
ATOM   3323  C  CE    . LYS A 1  553 ? 139.382 120.097 128.309 1.00 97.99  ? 817  LYS A CE    1 
ATOM   3324  N  NZ    . LYS A 1  553 ? 138.013 120.032 128.891 1.00 97.99  ? 817  LYS A NZ    1 
ATOM   3325  N  N     . HIS A 1  554 ? 144.831 123.168 128.493 1.00 100.19 ? 818  HIS A N     1 
ATOM   3326  C  CA    . HIS A 1  554 ? 145.042 124.224 127.504 1.00 100.19 ? 818  HIS A CA    1 
ATOM   3327  C  C     . HIS A 1  554 ? 146.403 124.850 127.771 1.00 100.19 ? 818  HIS A C     1 
ATOM   3328  O  O     . HIS A 1  554 ? 146.529 125.766 128.595 1.00 100.19 ? 818  HIS A O     1 
ATOM   3329  C  CB    . HIS A 1  554 ? 143.925 125.266 127.558 1.00 100.19 ? 818  HIS A CB    1 
ATOM   3330  C  CG    . HIS A 1  554 ? 142.582 124.734 127.167 1.00 100.19 ? 818  HIS A CG    1 
ATOM   3331  N  ND1   . HIS A 1  554 ? 141.720 124.151 128.071 1.00 100.19 ? 818  HIS A ND1   1 
ATOM   3332  C  CD2   . HIS A 1  554 ? 141.951 124.698 125.969 1.00 100.19 ? 818  HIS A CD2   1 
ATOM   3333  C  CE1   . HIS A 1  554 ? 140.617 123.778 127.447 1.00 100.19 ? 818  HIS A CE1   1 
ATOM   3334  N  NE2   . HIS A 1  554 ? 140.731 124.098 126.171 1.00 100.19 ? 818  HIS A NE2   1 
ATOM   3335  N  N     . PRO A 1  555 ? 147.450 124.370 127.096 1.00 99.47  ? 819  PRO A N     1 
ATOM   3336  C  CA    . PRO A 1  555 ? 148.801 124.896 127.360 1.00 99.47  ? 819  PRO A CA    1 
ATOM   3337  C  C     . PRO A 1  555 ? 148.953 126.379 127.074 1.00 99.47  ? 819  PRO A C     1 
ATOM   3338  O  O     . PRO A 1  555 ? 149.826 127.021 127.671 1.00 99.47  ? 819  PRO A O     1 
ATOM   3339  C  CB    . PRO A 1  555 ? 149.690 124.056 126.432 1.00 99.47  ? 819  PRO A CB    1 
ATOM   3340  C  CG    . PRO A 1  555 ? 148.905 122.807 126.185 1.00 99.47  ? 819  PRO A CG    1 
ATOM   3341  C  CD    . PRO A 1  555 ? 147.471 123.243 126.151 1.00 99.47  ? 819  PRO A CD    1 
ATOM   3342  N  N     . ASN A 1  556 ? 148.141 126.944 126.188 1.00 102.33 ? 820  ASN A N     1 
ATOM   3343  C  CA    . ASN A 1  556 ? 148.211 128.357 125.853 1.00 102.33 ? 820  ASN A CA    1 
ATOM   3344  C  C     . ASN A 1  556 ? 147.119 129.127 126.585 1.00 102.33 ? 820  ASN A C     1 
ATOM   3345  O  O     . ASN A 1  556 ? 146.038 128.603 126.868 1.00 102.33 ? 820  ASN A O     1 
ATOM   3346  C  CB    . ASN A 1  556 ? 148.083 128.571 124.341 1.00 102.33 ? 820  ASN A CB    1 
ATOM   3347  C  CG    . ASN A 1  556 ? 149.230 127.953 123.569 1.00 102.33 ? 820  ASN A CG    1 
ATOM   3348  O  OD1   . ASN A 1  556 ? 149.039 127.016 122.794 1.00 102.33 ? 820  ASN A OD1   1 
ATOM   3349  N  ND2   . ASN A 1  556 ? 150.433 128.475 123.779 1.00 102.33 ? 820  ASN A ND2   1 
ATOM   3350  N  N     . ALA A 1  557 ? 147.418 130.387 126.886 1.00 103.11 ? 821  ALA A N     1 
ATOM   3351  C  CA    . ALA A 1  557 ? 146.493 131.248 127.608 1.00 103.11 ? 821  ALA A CA    1 
ATOM   3352  C  C     . ALA A 1  557 ? 146.916 132.695 127.417 1.00 103.11 ? 821  ALA A C     1 
ATOM   3353  O  O     . ALA A 1  557 ? 148.110 133.000 127.347 1.00 103.11 ? 821  ALA A O     1 
ATOM   3354  C  CB    . ALA A 1  557 ? 146.450 130.899 129.101 1.00 103.11 ? 821  ALA A CB    1 
ATOM   3355  N  N     . SER A 1  558 ? 145.927 133.577 127.337 1.00 100.70 ? 822  SER A N     1 
ATOM   3356  C  CA    . SER A 1  558 ? 146.186 135.004 127.204 1.00 100.70 ? 822  SER A CA    1 
ATOM   3357  C  C     . SER A 1  558 ? 146.443 135.597 128.589 1.00 100.70 ? 822  SER A C     1 
ATOM   3358  O  O     . SER A 1  558 ? 146.505 134.893 129.600 1.00 100.70 ? 822  SER A O     1 
ATOM   3359  C  CB    . SER A 1  558 ? 145.022 135.688 126.495 1.00 100.70 ? 822  SER A CB    1 
ATOM   3360  O  OG    . SER A 1  558 ? 143.848 135.647 127.287 1.00 100.70 ? 822  SER A OG    1 
ATOM   3361  N  N     . LYS A 1  559 ? 146.598 136.919 128.645 1.00 98.65  ? 823  LYS A N     1 
ATOM   3362  C  CA    . LYS A 1  559 ? 146.823 137.597 129.914 1.00 98.65  ? 823  LYS A CA    1 
ATOM   3363  C  C     . LYS A 1  559 ? 145.531 137.881 130.664 1.00 98.65  ? 823  LYS A C     1 
ATOM   3364  O  O     . LYS A 1  559 ? 145.507 137.790 131.898 1.00 98.65  ? 823  LYS A O     1 
ATOM   3365  C  CB    . LYS A 1  559 ? 147.583 138.906 129.687 1.00 98.65  ? 823  LYS A CB    1 
ATOM   3366  C  CG    . LYS A 1  559 ? 148.956 138.745 129.036 1.00 98.65  ? 823  LYS A CG    1 
ATOM   3367  C  CD    . LYS A 1  559 ? 149.989 138.142 129.986 1.00 98.65  ? 823  LYS A CD    1 
ATOM   3368  C  CE    . LYS A 1  559 ? 150.152 136.640 129.777 1.00 98.65  ? 823  LYS A CE    1 
ATOM   3369  N  NZ    . LYS A 1  559 ? 151.240 136.065 130.617 1.00 98.65  ? 823  LYS A NZ    1 
ATOM   3370  N  N     . GLU A 1  560 ? 144.458 138.223 129.947 1.00 99.80  ? 824  GLU A N     1 
ATOM   3371  C  CA    . GLU A 1  560 ? 143.177 138.456 130.604 1.00 99.80  ? 824  GLU A CA    1 
ATOM   3372  C  C     . GLU A 1  560 ? 142.663 137.196 131.284 1.00 99.80  ? 824  GLU A C     1 
ATOM   3373  O  O     . GLU A 1  560 ? 142.014 137.281 132.333 1.00 99.80  ? 824  GLU A O     1 
ATOM   3374  C  CB    . GLU A 1  560 ? 142.152 138.973 129.596 1.00 99.80  ? 824  GLU A CB    1 
ATOM   3375  C  CG    . GLU A 1  560 ? 142.451 140.363 129.061 1.00 99.80  ? 824  GLU A CG    1 
ATOM   3376  C  CD    . GLU A 1  560 ? 143.435 140.345 127.909 1.00 99.80  ? 824  GLU A CD    1 
ATOM   3377  O  OE1   . GLU A 1  560 ? 143.834 139.240 127.484 1.00 99.80  ? 824  GLU A OE1   1 
ATOM   3378  O  OE2   . GLU A 1  560 ? 143.810 141.435 127.429 1.00 99.80  ? 824  GLU A OE2   1 
ATOM   3379  N  N     . GLU A 1  561 ? 142.948 136.024 130.713 1.00 97.57  ? 825  GLU A N     1 
ATOM   3380  C  CA    . GLU A 1  561 ? 142.571 134.776 131.367 1.00 97.57  ? 825  GLU A CA    1 
ATOM   3381  C  C     . GLU A 1  561 ? 143.287 134.620 132.702 1.00 97.57  ? 825  GLU A C     1 
ATOM   3382  O  O     . GLU A 1  561 ? 142.671 134.241 133.705 1.00 97.57  ? 825  GLU A O     1 
ATOM   3383  C  CB    . GLU A 1  561 ? 142.873 133.590 130.451 1.00 97.57  ? 825  GLU A CB    1 
ATOM   3384  C  CG    . GLU A 1  561 ? 142.021 133.548 129.193 1.00 97.57  ? 825  GLU A CG    1 
ATOM   3385  C  CD    . GLU A 1  561 ? 142.346 132.365 128.304 1.00 97.57  ? 825  GLU A CD    1 
ATOM   3386  O  OE1   . GLU A 1  561 ? 143.318 131.641 128.605 1.00 97.57  ? 825  GLU A OE1   1 
ATOM   3387  O  OE2   . GLU A 1  561 ? 141.630 132.159 127.302 1.00 97.57  ? 825  GLU A OE2   1 
ATOM   3388  N  N     . ARG A 1  562 ? 144.569 134.958 132.719 1.00 95.39  ? 826  ARG A N     1 
ATOM   3389  C  CA    . ARG A 1  562 ? 145.348 134.888 133.941 1.00 95.39  ? 826  ARG A CA    1 
ATOM   3390  C  C     . ARG A 1  562 ? 144.758 135.848 134.966 1.00 95.39  ? 826  ARG A C     1 
ATOM   3391  O  O     . ARG A 1  562 ? 144.558 135.488 136.124 1.00 95.39  ? 826  ARG A O     1 
ATOM   3392  C  CB    . ARG A 1  562 ? 146.802 135.257 133.663 1.00 95.39  ? 826  ARG A CB    1 
ATOM   3393  C  CG    . ARG A 1  562 ? 147.636 134.114 133.113 1.00 95.39  ? 826  ARG A CG    1 
ATOM   3394  C  CD    . ARG A 1  562 ? 147.100 133.632 131.777 1.00 95.39  ? 826  ARG A CD    1 
ATOM   3395  N  NE    . ARG A 1  562 ? 147.572 132.287 131.459 1.00 95.39  ? 826  ARG A NE    1 
ATOM   3396  C  CZ    . ARG A 1  562 ? 148.825 131.877 131.620 1.00 95.39  ? 826  ARG A CZ    1 
ATOM   3397  N  NH1   . ARG A 1  562 ? 149.742 132.707 132.096 1.00 95.39  ? 826  ARG A NH1   1 
ATOM   3398  N  NH2   . ARG A 1  562 ? 149.163 130.635 131.305 1.00 95.39  ? 826  ARG A NH2   1 
ATOM   3399  N  N     . LYS A 1  563 ? 144.467 137.070 134.531 1.00 92.51  ? 827  LYS A N     1 
ATOM   3400  C  CA    . LYS A 1  563 ? 143.909 138.083 135.420 1.00 92.51  ? 827  LYS A CA    1 
ATOM   3401  C  C     . LYS A 1  563 ? 142.598 137.610 136.034 1.00 92.51  ? 827  LYS A C     1 
ATOM   3402  O  O     . LYS A 1  563 ? 142.377 137.748 137.242 1.00 92.51  ? 827  LYS A O     1 
ATOM   3403  C  CB    . LYS A 1  563 ? 143.700 139.395 134.661 1.00 92.51  ? 827  LYS A CB    1 
ATOM   3404  C  CG    . LYS A 1  563 ? 144.968 139.997 134.083 1.00 92.51  ? 827  LYS A CG    1 
ATOM   3405  C  CD    . LYS A 1  563 ? 145.929 140.430 135.174 1.00 92.51  ? 827  LYS A CD    1 
ATOM   3406  C  CE    . LYS A 1  563 ? 147.111 141.186 134.591 1.00 92.51  ? 827  LYS A CE    1 
ATOM   3407  N  NZ    . LYS A 1  563 ? 147.991 140.297 133.783 1.00 92.51  ? 827  LYS A NZ    1 
ATOM   3408  N  N     . ARG A 1  564 ? 141.742 137.030 135.201 1.00 90.64  ? 828  ARG A N     1 
ATOM   3409  C  CA    . ARG A 1  564 ? 140.456 136.525 135.659 1.00 90.64  ? 828  ARG A CA    1 
ATOM   3410  C  C     . ARG A 1  564 ? 140.647 135.408 136.675 1.00 90.64  ? 828  ARG A C     1 
ATOM   3411  O  O     . ARG A 1  564 ? 139.985 135.380 137.710 1.00 90.64  ? 828  ARG A O     1 
ATOM   3412  C  CB    . ARG A 1  564 ? 139.631 136.022 134.478 1.00 90.64  ? 828  ARG A CB    1 
ATOM   3413  C  CG    . ARG A 1  564 ? 139.457 137.047 133.371 1.00 90.64  ? 828  ARG A CG    1 
ATOM   3414  C  CD    . ARG A 1  564 ? 138.741 138.287 133.880 1.00 90.64  ? 828  ARG A CD    1 
ATOM   3415  N  NE    . ARG A 1  564 ? 137.622 138.662 133.020 1.00 90.64  ? 828  ARG A NE    1 
ATOM   3416  C  CZ    . ARG A 1  564 ? 136.738 137.800 132.529 1.00 90.64  ? 828  ARG A CZ    1 
ATOM   3417  N  NH1   . ARG A 1  564 ? 135.751 138.228 131.755 1.00 90.64  ? 828  ARG A NH1   1 
ATOM   3418  N  NH2   . ARG A 1  564 ? 136.839 136.510 132.813 1.00 90.64  ? 828  ARG A NH2   1 
ATOM   3419  N  N     . TRP A 1  565 ? 141.554 134.487 136.376 1.00 88.45  ? 829  TRP A N     1 
ATOM   3420  C  CA    . TRP A 1  565 ? 141.818 133.372 137.281 1.00 88.45  ? 829  TRP A CA    1 
ATOM   3421  C  C     . TRP A 1  565 ? 142.284 133.878 138.640 1.00 88.45  ? 829  TRP A C     1 
ATOM   3422  O  O     . TRP A 1  565 ? 141.793 133.435 139.688 1.00 88.45  ? 829  TRP A O     1 
ATOM   3423  C  CB    . TRP A 1  565 ? 142.866 132.441 136.670 1.00 88.45  ? 829  TRP A CB    1 
ATOM   3424  C  CG    . TRP A 1  565 ? 142.427 131.785 135.403 1.00 88.45  ? 829  TRP A CG    1 
ATOM   3425  C  CD1   . TRP A 1  565 ? 141.174 131.791 134.866 1.00 88.45  ? 829  TRP A CD1   1 
ATOM   3426  C  CD2   . TRP A 1  565 ? 143.250 131.047 134.492 1.00 88.45  ? 829  TRP A CD2   1 
ATOM   3427  N  NE1   . TRP A 1  565 ? 141.161 131.092 133.684 1.00 88.45  ? 829  TRP A NE1   1 
ATOM   3428  C  CE2   . TRP A 1  565 ? 142.425 130.627 133.431 1.00 88.45  ? 829  TRP A CE2   1 
ATOM   3429  C  CE3   . TRP A 1  565 ? 144.603 130.697 134.474 1.00 88.45  ? 829  TRP A CE3   1 
ATOM   3430  C  CZ2   . TRP A 1  565 ? 142.908 129.875 132.363 1.00 88.45  ? 829  TRP A CZ2   1 
ATOM   3431  C  CZ3   . TRP A 1  565 ? 145.080 129.949 133.414 1.00 88.45  ? 829  TRP A CZ3   1 
ATOM   3432  C  CH2   . TRP A 1  565 ? 144.235 129.545 132.374 1.00 88.45  ? 829  TRP A CH2   1 
ATOM   3433  N  N     . GLN A 1  566 ? 143.242 134.809 138.637 1.00 83.53  ? 830  GLN A N     1 
ATOM   3434  C  CA    . GLN A 1  566 ? 143.738 135.369 139.889 1.00 83.53  ? 830  GLN A CA    1 
ATOM   3435  C  C     . GLN A 1  566 ? 142.633 136.089 140.649 1.00 83.53  ? 830  GLN A C     1 
ATOM   3436  O  O     . GLN A 1  566 ? 142.522 135.952 141.873 1.00 83.53  ? 830  GLN A O     1 
ATOM   3437  C  CB    . GLN A 1  566 ? 144.905 136.316 139.614 1.00 83.53  ? 830  GLN A CB    1 
ATOM   3438  C  CG    . GLN A 1  566 ? 145.544 136.893 140.864 1.00 83.53  ? 830  GLN A CG    1 
ATOM   3439  C  CD    . GLN A 1  566 ? 146.738 137.773 140.555 1.00 83.53  ? 830  GLN A CD    1 
ATOM   3440  O  OE1   . GLN A 1  566 ? 147.072 137.998 139.392 1.00 83.53  ? 830  GLN A OE1   1 
ATOM   3441  N  NE2   . GLN A 1  566 ? 147.390 138.272 141.597 1.00 83.53  ? 830  GLN A NE2   1 
ATOM   3442  N  N     . ALA A 1  567 ? 141.798 136.854 139.941 1.00 83.76  ? 831  ALA A N     1 
ATOM   3443  C  CA    . ALA A 1  567 ? 140.717 137.577 140.602 1.00 83.76  ? 831  ALA A CA    1 
ATOM   3444  C  C     . ALA A 1  567 ? 139.701 136.619 141.210 1.00 83.76  ? 831  ALA A C     1 
ATOM   3445  O  O     . ALA A 1  567 ? 139.220 136.844 142.327 1.00 83.76  ? 831  ALA A O     1 
ATOM   3446  C  CB    . ALA A 1  567 ? 140.039 138.526 139.616 1.00 83.76  ? 831  ALA A CB    1 
ATOM   3447  N  N     . THR A 1  568 ? 139.368 135.543 140.495 1.00 81.79  ? 832  THR A N     1 
ATOM   3448  C  CA    . THR A 1  568 ? 138.417 134.569 141.019 1.00 81.79  ? 832  THR A CA    1 
ATOM   3449  C  C     . THR A 1  568 ? 138.975 133.873 142.253 1.00 81.79  ? 832  THR A C     1 
ATOM   3450  O  O     . THR A 1  568 ? 138.267 133.692 143.252 1.00 81.79  ? 832  THR A O     1 
ATOM   3451  C  CB    . THR A 1  568 ? 138.063 133.549 139.936 1.00 81.79  ? 832  THR A CB    1 
ATOM   3452  O  OG1   . THR A 1  568 ? 137.510 134.227 138.801 1.00 81.79  ? 832  THR A OG1   1 
ATOM   3453  C  CG2   . THR A 1  568 ? 137.047 132.550 140.459 1.00 81.79  ? 832  THR A CG2   1 
ATOM   3454  N  N     . LEU A 1  569 ? 140.251 133.480 142.204 1.00 77.40  ? 833  LEU A N     1 
ATOM   3455  C  CA    . LEU A 1  569 ? 140.869 132.852 143.367 1.00 77.40  ? 833  LEU A CA    1 
ATOM   3456  C  C     . LEU A 1  569 ? 140.890 133.801 144.558 1.00 77.40  ? 833  LEU A C     1 
ATOM   3457  O  O     . LEU A 1  569 ? 140.589 133.403 145.690 1.00 77.40  ? 833  LEU A O     1 
ATOM   3458  C  CB    . LEU A 1  569 ? 142.283 132.383 143.026 1.00 77.40  ? 833  LEU A CB    1 
ATOM   3459  C  CG    . LEU A 1  569 ? 143.049 131.727 144.176 1.00 77.40  ? 833  LEU A CG    1 
ATOM   3460  C  CD1   . LEU A 1  569 ? 142.312 130.504 144.693 1.00 77.40  ? 833  LEU A CD1   1 
ATOM   3461  C  CD2   . LEU A 1  569 ? 144.450 131.353 143.727 1.00 77.40  ? 833  LEU A CD2   1 
ATOM   3462  N  N     . ASP A 1  570 ? 141.238 135.068 144.319 1.00 79.63  ? 834  ASP A N     1 
ATOM   3463  C  CA    . ASP A 1  570 ? 141.286 136.042 145.403 1.00 79.63  ? 834  ASP A CA    1 
ATOM   3464  C  C     . ASP A 1  570 ? 139.906 136.252 146.012 1.00 79.63  ? 834  ASP A C     1 
ATOM   3465  O  O     . ASP A 1  570 ? 139.757 136.302 147.238 1.00 79.63  ? 834  ASP A O     1 
ATOM   3466  C  CB    . ASP A 1  570 ? 141.859 137.364 144.893 1.00 79.63  ? 834  ASP A CB    1 
ATOM   3467  C  CG    . ASP A 1  570 ? 143.332 137.267 144.552 1.00 79.63  ? 834  ASP A CG    1 
ATOM   3468  O  OD1   . ASP A 1  570 ? 144.033 136.443 145.176 1.00 79.63  ? 834  ASP A OD1   1 
ATOM   3469  O  OD2   . ASP A 1  570 ? 143.789 138.013 143.661 1.00 79.63  ? 834  ASP A OD2   1 
ATOM   3470  N  N     . LYS A 1  571 ? 138.898 136.345 145.152 1.00 78.18  ? 835  LYS A N     1 
ATOM   3471  C  CA    . LYS A 1  571 ? 137.526 136.544 145.594 1.00 78.18  ? 835  LYS A CA    1 
ATOM   3472  C  C     . LYS A 1  571 ? 137.026 135.370 146.425 1.00 78.18  ? 835  LYS A C     1 
ATOM   3473  O  O     . LYS A 1  571 ? 136.372 135.560 147.447 1.00 78.18  ? 835  LYS A O     1 
ATOM   3474  C  CB    . LYS A 1  571 ? 136.607 136.764 144.394 1.00 78.18  ? 835  LYS A CB    1 
ATOM   3475  C  CG    . LYS A 1  571 ? 136.266 138.221 144.138 1.00 78.18  ? 835  LYS A CG    1 
ATOM   3476  C  CD    . LYS A 1  571 ? 134.803 138.386 143.765 1.00 78.18  ? 835  LYS A CD    1 
ATOM   3477  C  CE    . LYS A 1  571 ? 134.550 137.961 142.328 1.00 78.18  ? 835  LYS A CE    1 
ATOM   3478  N  NZ    . LYS A 1  571 ? 133.238 137.273 142.178 1.00 78.18  ? 835  LYS A NZ    1 
ATOM   3479  N  N     . HIS A 1  572 ? 137.345 134.162 145.980 1.00 77.40  ? 836  HIS A N     1 
ATOM   3480  C  CA    . HIS A 1  572 ? 136.933 132.971 146.698 1.00 77.40  ? 836  HIS A CA    1 
ATOM   3481  C  C     . HIS A 1  572 ? 137.610 132.928 148.056 1.00 77.40  ? 836  HIS A C     1 
ATOM   3482  O  O     . HIS A 1  572 ? 136.950 132.744 149.076 1.00 77.40  ? 836  HIS A O     1 
ATOM   3483  C  CB    . HIS A 1  572 ? 137.269 131.712 145.905 1.00 77.40  ? 836  HIS A CB    1 
ATOM   3484  C  CG    . HIS A 1  572 ? 136.487 130.510 146.329 1.00 77.40  ? 836  HIS A CG    1 
ATOM   3485  N  ND1   . HIS A 1  572 ? 135.143 130.566 146.628 1.00 77.40  ? 836  HIS A ND1   1 
ATOM   3486  C  CD2   . HIS A 1  572 ? 136.858 129.221 146.508 1.00 77.40  ? 836  HIS A CD2   1 
ATOM   3487  C  CE1   . HIS A 1  572 ? 134.720 129.364 146.971 1.00 77.40  ? 836  HIS A CE1   1 
ATOM   3488  N  NE2   . HIS A 1  572 ? 135.741 128.529 146.907 1.00 77.40  ? 836  HIS A NE2   1 
ATOM   3489  N  N     . LEU A 1  573 ? 138.926 133.106 148.075 1.00 74.82  ? 837  LEU A N     1 
ATOM   3490  C  CA    . LEU A 1  573 ? 139.647 133.074 149.342 1.00 74.82  ? 837  LEU A CA    1 
ATOM   3491  C  C     . LEU A 1  573 ? 139.138 134.143 150.297 1.00 74.82  ? 837  LEU A C     1 
ATOM   3492  O  O     . LEU A 1  573 ? 139.039 133.897 151.503 1.00 74.82  ? 837  LEU A O     1 
ATOM   3493  C  CB    . LEU A 1  573 ? 141.147 133.243 149.105 1.00 74.82  ? 837  LEU A CB    1 
ATOM   3494  C  CG    . LEU A 1  573 ? 141.850 132.096 148.379 1.00 74.82  ? 837  LEU A CG    1 
ATOM   3495  C  CD1   . LEU A 1  573 ? 143.301 132.450 148.102 1.00 74.82  ? 837  LEU A CD1   1 
ATOM   3496  C  CD2   . LEU A 1  573 ? 141.749 130.811 149.183 1.00 74.82  ? 837  LEU A CD2   1 
ATOM   3497  N  N     . ARG A 1  574 ? 138.788 135.321 149.779 1.00 75.20  ? 838  ARG A N     1 
ATOM   3498  C  CA    . ARG A 1  574 ? 138.272 136.382 150.636 1.00 75.20  ? 838  ARG A CA    1 
ATOM   3499  C  C     . ARG A 1  574 ? 136.916 136.012 151.218 1.00 75.20  ? 838  ARG A C     1 
ATOM   3500  O  O     . ARG A 1  574 ? 136.629 136.313 152.383 1.00 75.20  ? 838  ARG A O     1 
ATOM   3501  C  CB    . ARG A 1  574 ? 138.180 137.688 149.848 1.00 75.20  ? 838  ARG A CB    1 
ATOM   3502  C  CG    . ARG A 1  574 ? 137.748 138.885 150.673 1.00 75.20  ? 838  ARG A CG    1 
ATOM   3503  C  CD    . ARG A 1  574 ? 137.763 140.153 149.839 1.00 75.20  ? 838  ARG A CD    1 
ATOM   3504  N  NE    . ARG A 1  574 ? 137.276 141.304 150.590 1.00 75.20  ? 838  ARG A NE    1 
ATOM   3505  C  CZ    . ARG A 1  574 ? 138.041 142.070 151.360 1.00 75.20  ? 838  ARG A CZ    1 
ATOM   3506  N  NH1   . ARG A 1  574 ? 139.335 141.807 151.482 1.00 75.20  ? 838  ARG A NH1   1 
ATOM   3507  N  NH2   . ARG A 1  574 ? 137.514 143.098 152.009 1.00 75.20  ? 838  ARG A NH2   1 
ATOM   3508  N  N     . LYS A 1  575 ? 136.079 135.362 150.420 1.00 76.06  ? 839  LYS A N     1 
ATOM   3509  C  CA    . LYS A 1  575 ? 134.739 134.995 150.864 1.00 76.06  ? 839  LYS A CA    1 
ATOM   3510  C  C     . LYS A 1  575 ? 134.671 133.747 151.737 1.00 76.06  ? 839  LYS A C     1 
ATOM   3511  O  O     . LYS A 1  575 ? 133.705 133.555 152.470 1.00 76.06  ? 839  LYS A O     1 
ATOM   3512  C  CB    . LYS A 1  575 ? 133.814 134.817 149.661 1.00 76.06  ? 839  LYS A CB    1 
ATOM   3513  C  CG    . LYS A 1  575 ? 133.162 133.447 149.589 1.00 76.06  ? 839  LYS A CG    1 
ATOM   3514  C  CD    . LYS A 1  575 ? 131.709 133.551 149.162 1.00 76.06  ? 839  LYS A CD    1 
ATOM   3515  C  CE    . LYS A 1  575 ? 131.592 133.877 147.683 1.00 76.06  ? 839  LYS A CE    1 
ATOM   3516  N  NZ    . LYS A 1  575 ? 130.182 133.792 147.210 1.00 76.06  ? 839  LYS A NZ    1 
ATOM   3517  N  N     . ARG A 1  576 ? 135.689 132.900 151.661 1.00 78.09  ? 840  ARG A N     1 
ATOM   3518  C  CA    . ARG A 1  576 ? 135.690 131.667 152.441 1.00 78.09  ? 840  ARG A CA    1 
ATOM   3519  C  C     . ARG A 1  576 ? 136.723 131.640 153.556 1.00 78.09  ? 840  ARG A C     1 
ATOM   3520  O  O     . ARG A 1  576 ? 136.360 131.424 154.714 1.00 78.09  ? 840  ARG A O     1 
ATOM   3521  C  CB    . ARG A 1  576 ? 135.914 130.462 151.522 1.00 78.09  ? 840  ARG A CB    1 
ATOM   3522  C  CG    . ARG A 1  576 ? 134.833 130.293 150.472 1.00 78.09  ? 840  ARG A CG    1 
ATOM   3523  C  CD    . ARG A 1  576 ? 133.499 129.957 151.118 1.00 78.09  ? 840  ARG A CD    1 
ATOM   3524  N  NE    . ARG A 1  576 ? 132.434 129.811 150.132 1.00 78.09  ? 840  ARG A NE    1 
ATOM   3525  C  CZ    . ARG A 1  576 ? 132.109 128.662 149.550 1.00 78.09  ? 840  ARG A CZ    1 
ATOM   3526  N  NH1   . ARG A 1  576 ? 132.768 127.555 149.858 1.00 78.09  ? 840  ARG A NH1   1 
ATOM   3527  N  NH2   . ARG A 1  576 ? 131.125 128.620 148.663 1.00 78.09  ? 840  ARG A NH2   1 
ATOM   3528  N  N     . MET A 1  577 ? 138.000 131.851 153.247 1.00 78.49  ? 841  MET A N     1 
ATOM   3529  C  CA    . MET A 1  577 ? 139.061 131.793 154.241 1.00 78.49  ? 841  MET A CA    1 
ATOM   3530  C  C     . MET A 1  577 ? 139.292 133.123 154.943 1.00 78.49  ? 841  MET A C     1 
ATOM   3531  O  O     . MET A 1  577 ? 140.144 133.194 155.835 1.00 78.49  ? 841  MET A O     1 
ATOM   3532  C  CB    . MET A 1  577 ? 140.365 131.323 153.592 1.00 78.49  ? 841  MET A CB    1 
ATOM   3533  C  CG    . MET A 1  577 ? 140.325 129.892 153.093 1.00 78.49  ? 841  MET A CG    1 
ATOM   3534  S  SD    . MET A 1  577 ? 140.001 128.729 154.428 1.00 78.49  ? 841  MET A SD    1 
ATOM   3535  C  CE    . MET A 1  577 ? 141.509 128.891 155.379 1.00 78.49  ? 841  MET A CE    1 
ATOM   3536  N  N     . ASN A 1  578 ? 138.559 134.172 154.565 1.00 78.38  ? 842  ASN A N     1 
ATOM   3537  C  CA    . ASN A 1  578 ? 138.682 135.502 155.161 1.00 78.38  ? 842  ASN A CA    1 
ATOM   3538  C  C     . ASN A 1  578 ? 140.119 136.022 155.038 1.00 78.38  ? 842  ASN A C     1 
ATOM   3539  O  O     . ASN A 1  578 ? 140.822 136.256 156.022 1.00 78.38  ? 842  ASN A O     1 
ATOM   3540  C  CB    . ASN A 1  578 ? 138.221 135.491 156.623 1.00 78.38  ? 842  ASN A CB    1 
ATOM   3541  C  CG    . ASN A 1  578 ? 136.760 135.120 156.769 1.00 78.38  ? 842  ASN A CG    1 
ATOM   3542  O  OD1   . ASN A 1  578 ? 136.425 134.092 157.355 1.00 78.38  ? 842  ASN A OD1   1 
ATOM   3543  N  ND2   . ASN A 1  578 ? 135.881 135.956 156.230 1.00 78.38  ? 842  ASN A ND2   1 
ATOM   3544  N  N     . LEU A 1  579 ? 140.534 136.189 153.784 1.00 74.63  ? 843  LEU A N     1 
ATOM   3545  C  CA    . LEU A 1  579 ? 141.875 136.657 153.452 1.00 74.63  ? 843  LEU A CA    1 
ATOM   3546  C  C     . LEU A 1  579 ? 141.772 137.740 152.390 1.00 74.63  ? 843  LEU A C     1 
ATOM   3547  O  O     . LEU A 1  579 ? 141.225 137.502 151.309 1.00 74.63  ? 843  LEU A O     1 
ATOM   3548  C  CB    . LEU A 1  579 ? 142.754 135.503 152.962 1.00 74.63  ? 843  LEU A CB    1 
ATOM   3549  C  CG    . LEU A 1  579 ? 143.130 134.469 154.022 1.00 74.63  ? 843  LEU A CG    1 
ATOM   3550  C  CD1   . LEU A 1  579 ? 143.821 133.272 153.394 1.00 74.63  ? 843  LEU A CD1   1 
ATOM   3551  C  CD2   . LEU A 1  579 ? 144.024 135.112 155.066 1.00 74.63  ? 843  LEU A CD2   1 
ATOM   3552  N  N     . LYS A 1  580 ? 142.300 138.923 152.696 1.00 74.44  ? 844  LYS A N     1 
ATOM   3553  C  CA    . LYS A 1  580 ? 142.279 140.016 151.740 1.00 74.44  ? 844  LYS A CA    1 
ATOM   3554  C  C     . LYS A 1  580 ? 143.341 139.803 150.662 1.00 74.44  ? 844  LYS A C     1 
ATOM   3555  O  O     . LYS A 1  580 ? 144.374 139.177 150.913 1.00 74.44  ? 844  LYS A O     1 
ATOM   3556  C  CB    . LYS A 1  580 ? 142.526 141.346 152.445 1.00 74.44  ? 844  LYS A CB    1 
ATOM   3557  C  CG    . LYS A 1  580 ? 143.924 141.478 153.019 1.00 74.44  ? 844  LYS A CG    1 
ATOM   3558  C  CD    . LYS A 1  580 ? 144.132 142.795 153.741 1.00 74.44  ? 844  LYS A CD    1 
ATOM   3559  C  CE    . LYS A 1  580 ? 145.554 142.893 154.271 1.00 74.44  ? 844  LYS A CE    1 
ATOM   3560  N  NZ    . LYS A 1  580 ? 145.807 144.171 154.987 1.00 74.44  ? 844  LYS A NZ    1 
ATOM   3561  N  N     . PRO A 1  581 ? 143.102 140.299 149.450 1.00 74.17  ? 845  PRO A N     1 
ATOM   3562  C  CA    . PRO A 1  581 ? 144.132 140.213 148.409 1.00 74.17  ? 845  PRO A CA    1 
ATOM   3563  C  C     . PRO A 1  581 ? 145.331 141.080 148.756 1.00 74.17  ? 845  PRO A C     1 
ATOM   3564  O  O     . PRO A 1  581 ? 145.192 142.245 149.135 1.00 74.17  ? 845  PRO A O     1 
ATOM   3565  C  CB    . PRO A 1  581 ? 143.414 140.727 147.156 1.00 74.17  ? 845  PRO A CB    1 
ATOM   3566  C  CG    . PRO A 1  581 ? 141.961 140.528 147.443 1.00 74.17  ? 845  PRO A CG    1 
ATOM   3567  C  CD    . PRO A 1  581 ? 141.818 140.777 148.914 1.00 74.17  ? 845  PRO A CD    1 
ATOM   3568  N  N     . ILE A 1  582 ? 146.522 140.497 148.620 1.00 79.20  ? 846  ILE A N     1 
ATOM   3569  C  CA    . ILE A 1  582 ? 147.768 141.177 148.939 1.00 79.20  ? 846  ILE A CA    1 
ATOM   3570  C  C     . ILE A 1  582 ? 148.668 141.171 147.712 1.00 79.20  ? 846  ILE A C     1 
ATOM   3571  O  O     . ILE A 1  582 ? 148.573 140.301 146.843 1.00 79.20  ? 846  ILE A O     1 
ATOM   3572  C  CB    . ILE A 1  582 ? 148.490 140.537 150.145 1.00 79.20  ? 846  ILE A CB    1 
ATOM   3573  C  CG1   . ILE A 1  582 ? 148.825 139.074 149.851 1.00 79.20  ? 846  ILE A CG1   1 
ATOM   3574  C  CG2   . ILE A 1  582 ? 147.637 140.651 151.398 1.00 79.20  ? 846  ILE A CG2   1 
ATOM   3575  C  CD1   . ILE A 1  582 ? 149.705 138.431 150.897 1.00 79.20  ? 846  ILE A CD1   1 
ATOM   3576  N  N     . MET A 1  583 ? 149.549 142.170 147.648 1.00 85.34  ? 847  MET A N     1 
ATOM   3577  C  CA    . MET A 1  583 ? 150.465 142.294 146.519 1.00 85.34  ? 847  MET A CA    1 
ATOM   3578  C  C     . MET A 1  583 ? 151.612 141.295 146.628 1.00 85.34  ? 847  MET A C     1 
ATOM   3579  O  O     . MET A 1  583 ? 151.799 140.448 145.749 1.00 85.34  ? 847  MET A O     1 
ATOM   3580  C  CB    . MET A 1  583 ? 151.001 143.726 146.435 1.00 85.34  ? 847  MET A CB    1 
ATOM   3581  C  CG    . MET A 1  583 ? 149.940 144.769 146.124 1.00 85.34  ? 847  MET A CG    1 
ATOM   3582  S  SD    . MET A 1  583 ? 149.138 144.500 144.532 1.00 85.34  ? 847  MET A SD    1 
ATOM   3583  C  CE    . MET A 1  583 ? 150.476 144.887 143.408 1.00 85.34  ? 847  MET A CE    1 
ATOM   3584  N  N     . ARG A 1  584 ? 152.390 141.381 147.704 1.00 83.55  ? 848  ARG A N     1 
ATOM   3585  C  CA    . ARG A 1  584 ? 153.516 140.489 147.939 1.00 83.55  ? 848  ARG A CA    1 
ATOM   3586  C  C     . ARG A 1  584 ? 153.152 139.494 149.032 1.00 83.55  ? 848  ARG A C     1 
ATOM   3587  O  O     . ARG A 1  584 ? 152.430 139.833 149.975 1.00 83.55  ? 848  ARG A O     1 
ATOM   3588  C  CB    . ARG A 1  584 ? 154.770 141.276 148.335 1.00 83.55  ? 848  ARG A CB    1 
ATOM   3589  C  CG    . ARG A 1  584 ? 156.015 140.424 148.501 1.00 83.55  ? 848  ARG A CG    1 
ATOM   3590  C  CD    . ARG A 1  584 ? 157.222 141.275 148.849 1.00 83.55  ? 848  ARG A CD    1 
ATOM   3591  N  NE    . ARG A 1  584 ? 158.434 140.474 148.987 1.00 83.55  ? 848  ARG A NE    1 
ATOM   3592  C  CZ    . ARG A 1  584 ? 158.834 139.917 150.126 1.00 83.55  ? 848  ARG A CZ    1 
ATOM   3593  N  NH1   . ARG A 1  584 ? 159.951 139.204 150.162 1.00 83.55  ? 848  ARG A NH1   1 
ATOM   3594  N  NH2   . ARG A 1  584 ? 158.114 140.071 151.229 1.00 83.55  ? 848  ARG A NH2   1 
ATOM   3595  N  N     . MET A 1  585 ? 153.653 138.266 148.897 1.00 76.94  ? 849  MET A N     1 
ATOM   3596  C  CA    . MET A 1  585 ? 153.323 137.202 149.838 1.00 76.94  ? 849  MET A CA    1 
ATOM   3597  C  C     . MET A 1  585 ? 153.747 137.567 151.255 1.00 76.94  ? 849  MET A C     1 
ATOM   3598  O  O     . MET A 1  585 ? 154.891 137.961 151.494 1.00 76.94  ? 849  MET A O     1 
ATOM   3599  C  CB    . MET A 1  585 ? 153.990 135.896 149.406 1.00 76.94  ? 849  MET A CB    1 
ATOM   3600  C  CG    . MET A 1  585 ? 153.659 134.720 150.302 1.00 76.94  ? 849  MET A CG    1 
ATOM   3601  S  SD    . MET A 1  585 ? 151.889 134.411 150.384 1.00 76.94  ? 849  MET A SD    1 
ATOM   3602  C  CE    . MET A 1  585 ? 151.569 133.802 148.733 1.00 76.94  ? 849  MET A CE    1 
ATOM   3603  N  N     . ASN A 1  586 ? 152.814 137.424 152.193 1.00 76.96  ? 850  ASN A N     1 
ATOM   3604  C  CA    . ASN A 1  586 ? 153.040 137.801 153.579 1.00 76.96  ? 850  ASN A CA    1 
ATOM   3605  C  C     . ASN A 1  586 ? 153.562 136.589 154.351 1.00 76.96  ? 850  ASN A C     1 
ATOM   3606  O  O     . ASN A 1  586 ? 153.906 135.554 153.774 1.00 76.96  ? 850  ASN A O     1 
ATOM   3607  C  CB    . ASN A 1  586 ? 151.750 138.351 154.186 1.00 76.96  ? 850  ASN A CB    1 
ATOM   3608  C  CG    . ASN A 1  586 ? 152.004 139.382 155.272 1.00 76.96  ? 850  ASN A CG    1 
ATOM   3609  O  OD1   . ASN A 1  586 ? 151.084 140.072 155.713 1.00 76.96  ? 850  ASN A OD1   1 
ATOM   3610  N  ND2   . ASN A 1  586 ? 153.258 139.522 155.678 1.00 76.96  ? 850  ASN A ND2   1 
ATOM   3611  N  N     . GLY A 1  587 ? 153.631 136.708 155.673 1.00 73.02  ? 851  GLY A N     1 
ATOM   3612  C  CA    . GLY A 1  587 ? 154.028 135.598 156.513 1.00 73.02  ? 851  GLY A CA    1 
ATOM   3613  C  C     . GLY A 1  587 ? 152.839 134.950 157.187 1.00 73.02  ? 851  GLY A C     1 
ATOM   3614  O  O     . GLY A 1  587 ? 152.731 133.721 157.222 1.00 73.02  ? 851  GLY A O     1 
ATOM   3615  N  N     . ASN A 1  588 ? 151.929 135.771 157.719 1.00 70.68  ? 852  ASN A N     1 
ATOM   3616  C  CA    . ASN A 1  588 ? 150.713 135.234 158.321 1.00 70.68  ? 852  ASN A CA    1 
ATOM   3617  C  C     . ASN A 1  588 ? 149.763 134.709 157.254 1.00 70.68  ? 852  ASN A C     1 
ATOM   3618  O  O     . ASN A 1  588 ? 149.086 133.693 157.459 1.00 70.68  ? 852  ASN A O     1 
ATOM   3619  C  CB    . ASN A 1  588 ? 150.026 136.304 159.169 1.00 70.68  ? 852  ASN A CB    1 
ATOM   3620  C  CG    . ASN A 1  588 ? 150.805 136.641 160.423 1.00 70.68  ? 852  ASN A CG    1 
ATOM   3621  O  OD1   . ASN A 1  588 ? 151.329 135.756 161.097 1.00 70.68  ? 852  ASN A OD1   1 
ATOM   3622  N  ND2   . ASN A 1  588 ? 150.888 137.928 160.741 1.00 70.68  ? 852  ASN A ND2   1 
ATOM   3623  N  N     . PHE A 1  589 ? 149.692 135.398 156.113 1.00 70.24  ? 853  PHE A N     1 
ATOM   3624  C  CA    . PHE A 1  589 ? 148.922 134.890 154.984 1.00 70.24  ? 853  PHE A CA    1 
ATOM   3625  C  C     . PHE A 1  589 ? 149.454 133.537 154.535 1.00 70.24  ? 853  PHE A C     1 
ATOM   3626  O  O     . PHE A 1  589 ? 148.680 132.635 154.196 1.00 70.24  ? 853  PHE A O     1 
ATOM   3627  C  CB    . PHE A 1  589 ? 148.963 135.897 153.834 1.00 70.24  ? 853  PHE A CB    1 
ATOM   3628  C  CG    . PHE A 1  589 ? 148.160 135.486 152.633 1.00 70.24  ? 853  PHE A CG    1 
ATOM   3629  C  CD1   . PHE A 1  589 ? 146.783 135.611 152.625 1.00 70.24  ? 853  PHE A CD1   1 
ATOM   3630  C  CD2   . PHE A 1  589 ? 148.786 134.979 151.510 1.00 70.24  ? 853  PHE A CD2   1 
ATOM   3631  C  CE1   . PHE A 1  589 ? 146.047 135.237 151.516 1.00 70.24  ? 853  PHE A CE1   1 
ATOM   3632  C  CE2   . PHE A 1  589 ? 148.057 134.603 150.400 1.00 70.24  ? 853  PHE A CE2   1 
ATOM   3633  C  CZ    . PHE A 1  589 ? 146.686 134.732 150.403 1.00 70.24  ? 853  PHE A CZ    1 
ATOM   3634  N  N     . ALA A 1  590 ? 150.778 133.374 154.545 1.00 70.07  ? 854  ALA A N     1 
ATOM   3635  C  CA    . ALA A 1  590 ? 151.372 132.087 154.200 1.00 70.07  ? 854  ALA A CA    1 
ATOM   3636  C  C     . ALA A 1  590 ? 151.005 131.018 155.221 1.00 70.07  ? 854  ALA A C     1 
ATOM   3637  O  O     . ALA A 1  590 ? 150.749 129.865 154.857 1.00 70.07  ? 854  ALA A O     1 
ATOM   3638  C  CB    . ALA A 1  590 ? 152.890 132.223 154.090 1.00 70.07  ? 854  ALA A CB    1 
ATOM   3639  N  N     . ARG A 1  591 ? 150.978 131.379 156.505 1.00 71.03  ? 855  ARG A N     1 
ATOM   3640  C  CA    . ARG A 1  591 ? 150.652 130.403 157.540 1.00 71.03  ? 855  ARG A CA    1 
ATOM   3641  C  C     . ARG A 1  591 ? 149.204 129.945 157.427 1.00 71.03  ? 855  ARG A C     1 
ATOM   3642  O  O     . ARG A 1  591 ? 148.913 128.745 157.488 1.00 71.03  ? 855  ARG A O     1 
ATOM   3643  C  CB    . ARG A 1  591 ? 150.923 130.991 158.924 1.00 71.03  ? 855  ARG A CB    1 
ATOM   3644  C  CG    . ARG A 1  591 ? 152.392 131.209 159.227 1.00 71.03  ? 855  ARG A CG    1 
ATOM   3645  C  CD    . ARG A 1  591 ? 152.584 131.783 160.617 1.00 71.03  ? 855  ARG A CD    1 
ATOM   3646  N  NE    . ARG A 1  591 ? 153.994 131.990 160.924 1.00 71.03  ? 855  ARG A NE    1 
ATOM   3647  C  CZ    . ARG A 1  591 ? 154.653 133.115 160.670 1.00 71.03  ? 855  ARG A CZ    1 
ATOM   3648  N  NH1   . ARG A 1  591 ? 154.027 134.138 160.105 1.00 71.03  ? 855  ARG A NH1   1 
ATOM   3649  N  NH2   . ARG A 1  591 ? 155.937 133.219 160.981 1.00 71.03  ? 855  ARG A NH2   1 
ATOM   3650  N  N     . LYS A 1  592 ? 148.297 130.898 157.247 1.00 72.54  ? 856  LYS A N     1 
ATOM   3651  C  CA    . LYS A 1  592 ? 146.873 130.598 157.142 1.00 72.54  ? 856  LYS A CA    1 
ATOM   3652  C  C     . LYS A 1  592 ? 146.482 129.937 155.825 1.00 72.54  ? 856  LYS A C     1 
ATOM   3653  O  O     . LYS A 1  592 ? 145.485 129.224 155.755 1.00 72.54  ? 856  LYS A O     1 
ATOM   3654  C  CB    . LYS A 1  592 ? 146.052 131.872 157.333 1.00 72.54  ? 856  LYS A CB    1 
ATOM   3655  C  CG    . LYS A 1  592 ? 145.428 132.005 158.710 1.00 72.54  ? 856  LYS A CG    1 
ATOM   3656  C  CD    . LYS A 1  592 ? 144.136 132.801 158.655 1.00 72.54  ? 856  LYS A CD    1 
ATOM   3657  C  CE    . LYS A 1  592 ? 144.143 133.932 159.669 1.00 72.54  ? 856  LYS A CE    1 
ATOM   3658  N  NZ    . LYS A 1  592 ? 143.335 135.094 159.207 1.00 72.54  ? 856  LYS A NZ    1 
ATOM   3659  N  N     . LEU A 1  593 ? 147.267 130.174 154.783 1.00 71.07  ? 857  LEU A N     1 
ATOM   3660  C  CA    . LEU A 1  593 ? 146.972 129.611 153.473 1.00 71.07  ? 857  LEU A CA    1 
ATOM   3661  C  C     . LEU A 1  593 ? 147.267 128.121 153.397 1.00 71.07  ? 857  LEU A C     1 
ATOM   3662  O  O     . LEU A 1  593 ? 146.686 127.426 152.556 1.00 71.07  ? 857  LEU A O     1 
ATOM   3663  C  CB    . LEU A 1  593 ? 147.777 130.349 152.400 1.00 71.07  ? 857  LEU A CB    1 
ATOM   3664  C  CG    . LEU A 1  593 ? 147.557 129.965 150.936 1.00 71.07  ? 857  LEU A CG    1 
ATOM   3665  C  CD1   . LEU A 1  593 ? 146.127 130.259 150.519 1.00 71.07  ? 857  LEU A CD1   1 
ATOM   3666  C  CD2   . LEU A 1  593 ? 148.542 130.690 150.031 1.00 71.07  ? 857  LEU A CD2   1 
ATOM   3667  N  N     . MET A 1  594 ? 148.143 127.614 154.258 1.00 76.10  ? 858  MET A N     1 
ATOM   3668  C  CA    . MET A 1  594 ? 148.616 126.237 154.154 1.00 76.10  ? 858  MET A CA    1 
ATOM   3669  C  C     . MET A 1  594 ? 147.843 125.347 155.127 1.00 76.10  ? 858  MET A C     1 
ATOM   3670  O  O     . MET A 1  594 ? 148.346 124.906 156.161 1.00 76.10  ? 858  MET A O     1 
ATOM   3671  C  CB    . MET A 1  594 ? 150.116 126.181 154.408 1.00 76.10  ? 858  MET A CB    1 
ATOM   3672  C  CG    . MET A 1  594 ? 150.914 127.051 153.460 1.00 76.10  ? 858  MET A CG    1 
ATOM   3673  S  SD    . MET A 1  594 ? 150.537 126.687 151.741 1.00 76.10  ? 858  MET A SD    1 
ATOM   3674  C  CE    . MET A 1  594 ? 151.149 125.016 151.665 1.00 76.10  ? 858  MET A CE    1 
ATOM   3675  N  N     . THR A 1  595 ? 146.587 125.088 154.766 1.00 76.42  ? 859  THR A N     1 
ATOM   3676  C  CA    . THR A 1  595 ? 145.694 124.269 155.572 1.00 76.42  ? 859  THR A CA    1 
ATOM   3677  C  C     . THR A 1  595 ? 144.908 123.337 154.663 1.00 76.42  ? 859  THR A C     1 
ATOM   3678  O  O     . THR A 1  595 ? 144.814 123.549 153.452 1.00 76.42  ? 859  THR A O     1 
ATOM   3679  C  CB    . THR A 1  595 ? 144.720 125.122 156.403 1.00 76.42  ? 859  THR A CB    1 
ATOM   3680  O  OG1   . THR A 1  595 ? 143.939 125.947 155.530 1.00 76.42  ? 859  THR A OG1   1 
ATOM   3681  C  CG2   . THR A 1  595 ? 145.469 126.002 157.394 1.00 76.42  ? 859  THR A CG2   1 
ATOM   3682  N  N     . GLN A 1  596 ? 144.342 122.288 155.266 1.00 76.25  ? 860  GLN A N     1 
ATOM   3683  C  CA    . GLN A 1  596 ? 143.486 121.376 154.513 1.00 76.25  ? 860  GLN A CA    1 
ATOM   3684  C  C     . GLN A 1  596 ? 142.198 122.065 154.082 1.00 76.25  ? 860  GLN A C     1 
ATOM   3685  O  O     . GLN A 1  596 ? 141.688 121.816 152.982 1.00 76.25  ? 860  GLN A O     1 
ATOM   3686  C  CB    . GLN A 1  596 ? 143.171 120.137 155.350 1.00 76.25  ? 860  GLN A CB    1 
ATOM   3687  C  CG    . GLN A 1  596 ? 144.367 119.251 155.659 1.00 76.25  ? 860  GLN A CG    1 
ATOM   3688  C  CD    . GLN A 1  596 ? 144.972 118.631 154.418 1.00 76.25  ? 860  GLN A CD    1 
ATOM   3689  O  OE1   . GLN A 1  596 ? 146.085 118.970 154.020 1.00 76.25  ? 860  GLN A OE1   1 
ATOM   3690  N  NE2   . GLN A 1  596 ? 144.238 117.717 153.795 1.00 76.25  ? 860  GLN A NE2   1 
ATOM   3691  N  N     . GLU A 1  597 ? 141.688 122.940 154.941 1.00 79.85  ? 861  GLU A N     1 
ATOM   3692  C  CA    . GLU A 1  597 ? 140.472 123.674 154.640 1.00 79.85  ? 861  GLU A CA    1 
ATOM   3693  C  C     . GLU A 1  597 ? 140.677 124.503 153.386 1.00 79.85  ? 861  GLU A C     1 
ATOM   3694  O  O     . GLU A 1  597 ? 139.792 124.586 152.538 1.00 79.85  ? 861  GLU A O     1 
ATOM   3695  C  CB    . GLU A 1  597 ? 140.088 124.580 155.805 1.00 79.85  ? 861  GLU A CB    1 
ATOM   3696  C  CG    . GLU A 1  597 ? 141.228 124.868 156.764 1.00 79.85  ? 861  GLU A CG    1 
ATOM   3697  C  CD    . GLU A 1  597 ? 140.862 124.570 158.202 1.00 79.85  ? 861  GLU A CD    1 
ATOM   3698  O  OE1   . GLU A 1  597 ? 141.434 125.211 159.108 1.00 79.85  ? 861  GLU A OE1   1 
ATOM   3699  O  OE2   . GLU A 1  597 ? 140.000 123.695 158.426 1.00 79.85  ? 861  GLU A OE2   1 
ATOM   3700  N  N     . THR A 1  598 ? 141.848 125.117 153.266 1.00 76.18  ? 862  THR A N     1 
ATOM   3701  C  CA    . THR A 1  598 ? 142.138 125.932 152.092 1.00 76.18  ? 862  THR A CA    1 
ATOM   3702  C  C     . THR A 1  598 ? 142.015 125.111 150.816 1.00 76.18  ? 862  THR A C     1 
ATOM   3703  O  O     . THR A 1  598 ? 141.415 125.561 149.833 1.00 76.18  ? 862  THR A O     1 
ATOM   3704  C  CB    . THR A 1  598 ? 143.535 126.541 152.203 1.00 76.18  ? 862  THR A CB    1 
ATOM   3705  O  OG1   . THR A 1  598 ? 143.606 127.367 153.372 1.00 76.18  ? 862  THR A OG1   1 
ATOM   3706  C  CG2   . THR A 1  598 ? 143.846 127.381 150.976 1.00 76.18  ? 862  THR A CG2   1 
ATOM   3707  N  N     . VAL A 1  599 ? 142.574 123.899 150.816 1.00 76.70  ? 863  VAL A N     1 
ATOM   3708  C  CA    . VAL A 1  599 ? 142.428 123.012 149.665 1.00 76.70  ? 863  VAL A CA    1 
ATOM   3709  C  C     . VAL A 1  599 ? 140.962 122.661 149.451 1.00 76.70  ? 863  VAL A C     1 
ATOM   3710  O  O     . VAL A 1  599 ? 140.489 122.575 148.312 1.00 76.70  ? 863  VAL A O     1 
ATOM   3711  C  CB    . VAL A 1  599 ? 143.292 121.751 149.849 1.00 76.70  ? 863  VAL A CB    1 
ATOM   3712  C  CG1   . VAL A 1  599 ? 143.078 120.783 148.698 1.00 76.70  ? 863  VAL A CG1   1 
ATOM   3713  C  CG2   . VAL A 1  599 ? 144.755 122.128 149.964 1.00 76.70  ? 863  VAL A CG2   1 
ATOM   3714  N  N     . ASP A 1  600 ? 140.221 122.452 150.541 1.00 77.70  ? 864  ASP A N     1 
ATOM   3715  C  CA    . ASP A 1  600 ? 138.798 122.149 150.423 1.00 77.70  ? 864  ASP A CA    1 
ATOM   3716  C  C     . ASP A 1  600 ? 138.051 123.291 149.745 1.00 77.70  ? 864  ASP A C     1 
ATOM   3717  O  O     . ASP A 1  600 ? 137.189 123.065 148.888 1.00 77.70  ? 864  ASP A O     1 
ATOM   3718  C  CB    . ASP A 1  600 ? 138.209 121.864 151.804 1.00 77.70  ? 864  ASP A CB    1 
ATOM   3719  C  CG    . ASP A 1  600 ? 138.748 120.588 152.413 1.00 77.70  ? 864  ASP A CG    1 
ATOM   3720  O  OD1   . ASP A 1  600 ? 139.107 119.671 151.648 1.00 77.70  ? 864  ASP A OD1   1 
ATOM   3721  O  OD2   . ASP A 1  600 ? 138.815 120.504 153.657 1.00 77.70  ? 864  ASP A OD2   1 
ATOM   3722  N  N     . ALA A 1  601 ? 138.373 124.530 150.120 1.00 77.06  ? 865  ALA A N     1 
ATOM   3723  C  CA    . ALA A 1  601 ? 137.711 125.682 149.519 1.00 77.06  ? 865  ALA A CA    1 
ATOM   3724  C  C     . ALA A 1  601 ? 138.123 125.862 148.063 1.00 77.06  ? 865  ALA A C     1 
ATOM   3725  O  O     . ALA A 1  601 ? 137.307 126.261 147.224 1.00 77.06  ? 865  ALA A O     1 
ATOM   3726  C  CB    . ALA A 1  601 ? 138.019 126.944 150.324 1.00 77.06  ? 865  ALA A CB    1 
ATOM   3727  N  N     . VAL A 1  602 ? 139.385 125.577 147.743 1.00 78.40  ? 866  VAL A N     1 
ATOM   3728  C  CA    . VAL A 1  602 ? 139.858 125.754 146.373 1.00 78.40  ? 866  VAL A CA    1 
ATOM   3729  C  C     . VAL A 1  602 ? 139.264 124.697 145.448 1.00 78.40  ? 866  VAL A C     1 
ATOM   3730  O  O     . VAL A 1  602 ? 138.942 124.983 144.289 1.00 78.40  ? 866  VAL A O     1 
ATOM   3731  C  CB    . VAL A 1  602 ? 141.397 125.748 146.336 1.00 78.40  ? 866  VAL A CB    1 
ATOM   3732  C  CG1   . VAL A 1  602 ? 141.898 125.736 144.902 1.00 78.40  ? 866  VAL A CG1   1 
ATOM   3733  C  CG2   . VAL A 1  602 ? 141.941 126.967 147.060 1.00 78.40  ? 866  VAL A CG2   1 
ATOM   3734  N  N     . CYS A 1  603 ? 139.090 123.467 145.941 1.00 82.02  ? 867  CYS A N     1 
ATOM   3735  C  CA    . CYS A 1  603 ? 138.551 122.399 145.105 1.00 82.02  ? 867  CYS A CA    1 
ATOM   3736  C  C     . CYS A 1  603 ? 137.126 122.676 144.642 1.00 82.02  ? 867  CYS A C     1 
ATOM   3737  O  O     . CYS A 1  603 ? 136.647 122.007 143.721 1.00 82.02  ? 867  CYS A O     1 
ATOM   3738  C  CB    . CYS A 1  603 ? 138.602 121.063 145.849 1.00 82.02  ? 867  CYS A CB    1 
ATOM   3739  S  SG    . CYS A 1  603 ? 140.266 120.405 146.099 1.00 82.02  ? 867  CYS A SG    1 
ATOM   3740  N  N     . GLU A 1  604 ? 136.439 123.642 145.255 1.00 81.07  ? 868  GLU A N     1 
ATOM   3741  C  CA    . GLU A 1  604 ? 135.112 124.022 144.785 1.00 81.07  ? 868  GLU A CA    1 
ATOM   3742  C  C     . GLU A 1  604 ? 135.153 124.760 143.455 1.00 81.07  ? 868  GLU A C     1 
ATOM   3743  O  O     . GLU A 1  604 ? 134.092 125.024 142.880 1.00 81.07  ? 868  GLU A O     1 
ATOM   3744  C  CB    . GLU A 1  604 ? 134.413 124.885 145.835 1.00 81.07  ? 868  GLU A CB    1 
ATOM   3745  C  CG    . GLU A 1  604 ? 134.073 124.142 147.115 1.00 81.07  ? 868  GLU A CG    1 
ATOM   3746  C  CD    . GLU A 1  604 ? 133.400 125.031 148.139 1.00 81.07  ? 868  GLU A CD    1 
ATOM   3747  O  OE1   . GLU A 1  604 ? 133.307 126.252 147.896 1.00 81.07  ? 868  GLU A OE1   1 
ATOM   3748  O  OE2   . GLU A 1  604 ? 132.966 124.510 149.188 1.00 81.07  ? 868  GLU A OE2   1 
ATOM   3749  N  N     . LEU A 1  605 ? 136.342 125.097 142.956 1.00 79.09  ? 869  LEU A N     1 
ATOM   3750  C  CA    . LEU A 1  605 ? 136.497 125.774 141.676 1.00 79.09  ? 869  LEU A CA    1 
ATOM   3751  C  C     . LEU A 1  605 ? 136.999 124.866 140.567 1.00 79.09  ? 869  LEU A C     1 
ATOM   3752  O  O     . LEU A 1  605 ? 136.775 125.166 139.393 1.00 79.09  ? 869  LEU A O     1 
ATOM   3753  C  CB    . LEU A 1  605 ? 137.459 126.962 141.813 1.00 79.09  ? 869  LEU A CB    1 
ATOM   3754  C  CG    . LEU A 1  605 ? 136.924 128.264 142.418 1.00 79.09  ? 869  LEU A CG    1 
ATOM   3755  C  CD1   . LEU A 1  605 ? 136.680 128.129 143.912 1.00 79.09  ? 869  LEU A CD1   1 
ATOM   3756  C  CD2   . LEU A 1  605 ? 137.887 129.405 142.139 1.00 79.09  ? 869  LEU A CD2   1 
ATOM   3757  N  N     . ILE A 1  606 ? 137.669 123.770 140.907 1.00 81.29  ? 870  ILE A N     1 
ATOM   3758  C  CA    . ILE A 1  606 ? 138.184 122.831 139.914 1.00 81.29  ? 870  ILE A CA    1 
ATOM   3759  C  C     . ILE A 1  606 ? 137.104 121.805 139.597 1.00 81.29  ? 870  ILE A C     1 
ATOM   3760  O  O     . ILE A 1  606 ? 136.686 121.050 140.487 1.00 81.29  ? 870  ILE A O     1 
ATOM   3761  C  CB    . ILE A 1  606 ? 139.470 122.150 140.405 1.00 81.29  ? 870  ILE A CB    1 
ATOM   3762  C  CG1   . ILE A 1  606 ? 140.575 123.188 140.603 1.00 81.29  ? 870  ILE A CG1   1 
ATOM   3763  C  CG2   . ILE A 1  606 ? 139.912 121.077 139.425 1.00 81.29  ? 870  ILE A CG2   1 
ATOM   3764  C  CD1   . ILE A 1  606 ? 141.785 122.657 141.327 1.00 81.29  ? 870  ILE A CD1   1 
ATOM   3765  N  N     . PRO A 1  607 ? 136.623 121.739 138.353 1.00 83.27  ? 871  PRO A N     1 
ATOM   3766  C  CA    . PRO A 1  607 ? 135.560 120.769 138.044 1.00 83.27  ? 871  PRO A CA    1 
ATOM   3767  C  C     . PRO A 1  607 ? 136.049 119.333 138.013 1.00 83.27  ? 871  PRO A C     1 
ATOM   3768  O  O     . PRO A 1  607 ? 135.245 118.409 138.187 1.00 83.27  ? 871  PRO A O     1 
ATOM   3769  C  CB    . PRO A 1  607 ? 135.058 121.233 136.671 1.00 83.27  ? 871  PRO A CB    1 
ATOM   3770  C  CG    . PRO A 1  607 ? 136.236 121.909 136.059 1.00 83.27  ? 871  PRO A CG    1 
ATOM   3771  C  CD    . PRO A 1  607 ? 136.975 122.570 137.189 1.00 83.27  ? 871  PRO A CD    1 
ATOM   3772  N  N     . SER A 1  608 ? 137.343 119.114 137.793 1.00 84.44  ? 872  SER A N     1 
ATOM   3773  C  CA    . SER A 1  608 ? 137.876 117.762 137.743 1.00 84.44  ? 872  SER A CA    1 
ATOM   3774  C  C     . SER A 1  608 ? 137.821 117.114 139.126 1.00 84.44  ? 872  SER A C     1 
ATOM   3775  O  O     . SER A 1  608 ? 137.618 117.773 140.149 1.00 84.44  ? 872  SER A O     1 
ATOM   3776  C  CB    . SER A 1  608 ? 139.309 117.770 137.215 1.00 84.44  ? 872  SER A CB    1 
ATOM   3777  O  OG    . SER A 1  608 ? 139.849 116.460 137.194 1.00 84.44  ? 872  SER A OG    1 
ATOM   3778  N  N     . GLU A 1  609 ? 138.009 115.797 139.147 1.00 88.61  ? 873  GLU A N     1 
ATOM   3779  C  CA    . GLU A 1  609 ? 137.951 115.027 140.381 1.00 88.61  ? 873  GLU A CA    1 
ATOM   3780  C  C     . GLU A 1  609 ? 139.286 114.434 140.805 1.00 88.61  ? 873  GLU A C     1 
ATOM   3781  O  O     . GLU A 1  609 ? 139.518 114.285 142.006 1.00 88.61  ? 873  GLU A O     1 
ATOM   3782  C  CB    . GLU A 1  609 ? 136.916 113.896 140.260 1.00 88.61  ? 873  GLU A CB    1 
ATOM   3783  C  CG    . GLU A 1  609 ? 137.249 112.844 139.216 1.00 88.61  ? 873  GLU A CG    1 
ATOM   3784  C  CD    . GLU A 1  609 ? 136.163 111.794 139.084 1.00 88.61  ? 873  GLU A CD    1 
ATOM   3785  O  OE1   . GLU A 1  609 ? 135.139 111.905 139.790 1.00 88.61  ? 873  GLU A OE1   1 
ATOM   3786  O  OE2   . GLU A 1  609 ? 136.334 110.858 138.275 1.00 88.61  ? 873  GLU A OE2   1 
ATOM   3787  N  N     . GLU A 1  610 ? 140.155 114.138 139.848 1.00 88.25  ? 874  GLU A N     1 
ATOM   3788  C  CA    . GLU A 1  610 ? 141.463 113.589 140.165 1.00 88.25  ? 874  GLU A CA    1 
ATOM   3789  C  C     . GLU A 1  610 ? 142.392 114.693 140.658 1.00 88.25  ? 874  GLU A C     1 
ATOM   3790  O  O     . GLU A 1  610 ? 143.263 114.457 141.493 1.00 88.25  ? 874  GLU A O     1 
ATOM   3791  C  CB    . GLU A 1  610 ? 142.067 112.903 138.943 1.00 88.25  ? 874  GLU A CB    1 
ATOM   3792  C  CG    . GLU A 1  610 ? 142.712 111.563 139.245 1.00 88.25  ? 874  GLU A CG    1 
ATOM   3793  C  CD    . GLU A 1  610 ? 142.799 110.674 138.021 1.00 88.25  ? 874  GLU A CD    1 
ATOM   3794  O  OE1   . GLU A 1  610 ? 143.650 110.946 137.149 1.00 88.25  ? 874  GLU A OE1   1 
ATOM   3795  O  OE2   . GLU A 1  610 ? 142.015 109.707 137.932 1.00 88.25  ? 874  GLU A OE2   1 
ATOM   3796  N  N     . ARG A 1  611 ? 142.196 115.900 140.136 1.00 83.72  ? 875  ARG A N     1 
ATOM   3797  C  CA    . ARG A 1  611 ? 143.007 117.040 140.513 1.00 83.72  ? 875  ARG A CA    1 
ATOM   3798  C  C     . ARG A 1  611 ? 142.817 117.215 142.014 1.00 83.72  ? 875  ARG A C     1 
ATOM   3799  O  O     . ARG A 1  611 ? 143.770 117.474 142.747 1.00 83.72  ? 875  ARG A O     1 
ATOM   3800  C  CB    . ARG A 1  611 ? 142.551 118.291 139.771 1.00 83.72  ? 875  ARG A CB    1 
ATOM   3801  C  CG    . ARG A 1  611 ? 142.487 118.119 138.264 1.00 83.72  ? 875  ARG A CG    1 
ATOM   3802  C  CD    . ARG A 1  611 ? 143.761 118.613 137.601 1.00 83.72  ? 875  ARG A CD    1 
ATOM   3803  N  NE    . ARG A 1  611 ? 144.703 117.528 137.349 1.00 83.72  ? 875  ARG A NE    1 
ATOM   3804  C  CZ    . ARG A 1  611 ? 146.023 117.673 137.355 1.00 83.72  ? 875  ARG A CZ    1 
ATOM   3805  N  NH1   . ARG A 1  611 ? 146.560 118.859 137.601 1.00 83.72  ? 875  ARG A NH1   1 
ATOM   3806  N  NH2   . ARG A 1  611 ? 146.807 116.632 137.115 1.00 83.72  ? 875  ARG A NH2   1 
ATOM   3807  N  N     . HIS A 1  612 ? 141.577 117.062 142.470 1.00 83.07  ? 876  HIS A N     1 
ATOM   3808  C  CA    . HIS A 1  612 ? 141.272 117.182 143.891 1.00 83.07  ? 876  HIS A CA    1 
ATOM   3809  C  C     . HIS A 1  612 ? 142.169 116.273 144.719 1.00 83.07  ? 876  HIS A C     1 
ATOM   3810  O  O     . HIS A 1  612 ? 142.825 116.726 145.663 1.00 83.07  ? 876  HIS A O     1 
ATOM   3811  C  CB    . HIS A 1  612 ? 139.800 116.854 144.143 1.00 83.07  ? 876  HIS A CB    1 
ATOM   3812  C  CG    . HIS A 1  612 ? 138.850 117.864 143.579 1.00 83.07  ? 876  HIS A CG    1 
ATOM   3813  N  ND1   . HIS A 1  612 ? 137.486 117.668 143.554 1.00 83.07  ? 876  HIS A ND1   1 
ATOM   3814  C  CD2   . HIS A 1  612 ? 139.066 119.077 143.019 1.00 83.07  ? 876  HIS A CD2   1 
ATOM   3815  C  CE1   . HIS A 1  612 ? 136.902 118.717 143.004 1.00 83.07  ? 876  HIS A CE1   1 
ATOM   3816  N  NE2   . HIS A 1  612 ? 137.839 119.587 142.670 1.00 83.07  ? 876  HIS A NE2   1 
ATOM   3817  N  N     . GLU A 1  613 ? 142.209 114.998 144.351 1.00 82.18  ? 877  GLU A N     1 
ATOM   3818  C  CA    . GLU A 1  613 ? 143.027 114.018 145.053 1.00 82.18  ? 877  GLU A CA    1 
ATOM   3819  C  C     . GLU A 1  613 ? 144.502 114.400 145.009 1.00 82.18  ? 877  GLU A C     1 
ATOM   3820  O  O     . GLU A 1  613 ? 145.217 114.273 146.000 1.00 82.18  ? 877  GLU A O     1 
ATOM   3821  C  CB    . GLU A 1  613 ? 142.821 112.629 144.452 1.00 82.18  ? 877  GLU A CB    1 
ATOM   3822  C  CG    . GLU A 1  613 ? 144.082 111.788 144.380 1.00 82.18  ? 877  GLU A CG    1 
ATOM   3823  C  CD    . GLU A 1  613 ? 143.806 110.379 143.893 1.00 82.18  ? 877  GLU A CD    1 
ATOM   3824  O  OE1   . GLU A 1  613 ? 142.657 110.104 143.489 1.00 82.18  ? 877  GLU A OE1   1 
ATOM   3825  O  OE2   . GLU A 1  613 ? 144.738 109.548 143.913 1.00 82.18  ? 877  GLU A OE2   1 
ATOM   3826  N  N     . ALA A 1  614 ? 144.955 114.862 143.851 1.00 78.22  ? 878  ALA A N     1 
ATOM   3827  C  CA    . ALA A 1  614 ? 146.342 115.279 143.685 1.00 78.22  ? 878  ALA A CA    1 
ATOM   3828  C  C     . ALA A 1  614 ? 146.691 116.403 144.653 1.00 78.22  ? 878  ALA A C     1 
ATOM   3829  O  O     . ALA A 1  614 ? 147.708 116.347 145.354 1.00 78.22  ? 878  ALA A O     1 
ATOM   3830  C  CB    . ALA A 1  614 ? 146.587 115.711 142.238 1.00 78.22  ? 878  ALA A CB    1 
ATOM   3831  N  N     . LEU A 1  615 ? 145.844 117.434 144.709 1.00 76.56  ? 879  LEU A N     1 
ATOM   3832  C  CA    . LEU A 1  615 ? 146.104 118.553 145.609 1.00 76.56  ? 879  LEU A CA    1 
ATOM   3833  C  C     . LEU A 1  615 ? 146.020 118.125 147.068 1.00 76.56  ? 879  LEU A C     1 
ATOM   3834  O  O     . LEU A 1  615 ? 146.790 118.608 147.908 1.00 76.56  ? 879  LEU A O     1 
ATOM   3835  C  CB    . LEU A 1  615 ? 145.129 119.694 145.328 1.00 76.56  ? 879  LEU A CB    1 
ATOM   3836  C  CG    . LEU A 1  615 ? 145.286 120.390 143.977 1.00 76.56  ? 879  LEU A CG    1 
ATOM   3837  C  CD1   . LEU A 1  615 ? 144.192 121.422 143.789 1.00 76.56  ? 879  LEU A CD1   1 
ATOM   3838  C  CD2   . LEU A 1  615 ? 146.658 121.030 143.865 1.00 76.56  ? 879  LEU A CD2   1 
ATOM   3839  N  N     . ARG A 1  616 ? 145.086 117.227 147.393 1.00 78.35  ? 880  ARG A N     1 
ATOM   3840  C  CA    . ARG A 1  616 ? 144.981 116.738 148.764 1.00 78.35  ? 880  ARG A CA    1 
ATOM   3841  C  C     . ARG A 1  616 ? 146.272 116.060 149.195 1.00 78.35  ? 880  ARG A C     1 
ATOM   3842  O  O     . ARG A 1  616 ? 146.819 116.362 150.262 1.00 78.35  ? 880  ARG A O     1 
ATOM   3843  C  CB    . ARG A 1  616 ? 143.803 115.772 148.905 1.00 78.35  ? 880  ARG A CB    1 
ATOM   3844  C  CG    . ARG A 1  616 ? 142.442 116.372 148.612 1.00 78.35  ? 880  ARG A CG    1 
ATOM   3845  C  CD    . ARG A 1  616 ? 142.004 117.371 149.663 1.00 78.35  ? 880  ARG A CD    1 
ATOM   3846  N  NE    . ARG A 1  616 ? 140.712 117.957 149.319 1.00 78.35  ? 880  ARG A NE    1 
ATOM   3847  C  CZ    . ARG A 1  616 ? 139.540 117.434 149.663 1.00 78.35  ? 880  ARG A CZ    1 
ATOM   3848  N  NH1   . ARG A 1  616 ? 139.495 116.310 150.365 1.00 78.35  ? 880  ARG A NH1   1 
ATOM   3849  N  NH2   . ARG A 1  616 ? 138.413 118.033 149.306 1.00 78.35  ? 880  ARG A NH2   1 
ATOM   3850  N  N     . GLU A 1  617 ? 146.783 115.144 148.368 1.00 78.01  ? 881  GLU A N     1 
ATOM   3851  C  CA    . GLU A 1  617 ? 148.016 114.450 148.724 1.00 78.01  ? 881  GLU A CA    1 
ATOM   3852  C  C     . GLU A 1  617 ? 149.211 115.396 148.733 1.00 78.01  ? 881  GLU A C     1 
ATOM   3853  O  O     . GLU A 1  617 ? 150.110 115.248 149.570 1.00 78.01  ? 881  GLU A O     1 
ATOM   3854  C  CB    . GLU A 1  617 ? 148.262 113.283 147.767 1.00 78.01  ? 881  GLU A CB    1 
ATOM   3855  C  CG    . GLU A 1  617 ? 149.439 112.405 148.161 1.00 78.01  ? 881  GLU A CG    1 
ATOM   3856  C  CD    . GLU A 1  617 ? 149.623 111.220 147.236 1.00 78.01  ? 881  GLU A CD    1 
ATOM   3857  O  OE1   . GLU A 1  617 ? 148.864 111.107 146.250 1.00 78.01  ? 881  GLU A OE1   1 
ATOM   3858  O  OE2   . GLU A 1  617 ? 150.523 110.396 147.500 1.00 78.01  ? 881  GLU A OE2   1 
ATOM   3859  N  N     . LEU A 1  618 ? 149.233 116.377 147.828 1.00 75.49  ? 882  LEU A N     1 
ATOM   3860  C  CA    . LEU A 1  618 ? 150.302 117.371 147.815 1.00 75.49  ? 882  LEU A CA    1 
ATOM   3861  C  C     . LEU A 1  618 ? 150.347 118.135 149.134 1.00 75.49  ? 882  LEU A C     1 
ATOM   3862  O  O     . LEU A 1  618 ? 151.396 118.228 149.787 1.00 75.49  ? 882  LEU A O     1 
ATOM   3863  C  CB    . LEU A 1  618 ? 150.089 118.328 146.640 1.00 75.49  ? 882  LEU A CB    1 
ATOM   3864  C  CG    . LEU A 1  618 ? 151.165 119.353 146.279 1.00 75.49  ? 882  LEU A CG    1 
ATOM   3865  C  CD1   . LEU A 1  618 ? 152.398 118.659 145.728 1.00 75.49  ? 882  LEU A CD1   1 
ATOM   3866  C  CD2   . LEU A 1  618 ? 150.629 120.380 145.289 1.00 75.49  ? 882  LEU A CD2   1 
ATOM   3867  N  N     . MET A 1  619 ? 149.203 118.692 149.539 1.00 75.47  ? 883  MET A N     1 
ATOM   3868  C  CA    . MET A 1  619 ? 149.134 119.429 150.795 1.00 75.47  ? 883  MET A CA    1 
ATOM   3869  C  C     . MET A 1  619 ? 149.429 118.529 151.986 1.00 75.47  ? 883  MET A C     1 
ATOM   3870  O  O     . MET A 1  619 ? 150.065 118.967 152.950 1.00 75.47  ? 883  MET A O     1 
ATOM   3871  C  CB    . MET A 1  619 ? 147.758 120.080 150.940 1.00 75.47  ? 883  MET A CB    1 
ATOM   3872  C  CG    . MET A 1  619 ? 147.616 120.989 152.148 1.00 75.47  ? 883  MET A CG    1 
ATOM   3873  S  SD    . MET A 1  619 ? 148.735 122.399 152.111 1.00 75.47  ? 883  MET A SD    1 
ATOM   3874  C  CE    . MET A 1  619 ? 147.999 123.388 150.813 1.00 75.47  ? 883  MET A CE    1 
ATOM   3875  N  N     . ASP A 1  620 ? 148.995 117.269 151.932 1.00 76.21  ? 884  ASP A N     1 
ATOM   3876  C  CA    . ASP A 1  620 ? 149.254 116.340 153.025 1.00 76.21  ? 884  ASP A CA    1 
ATOM   3877  C  C     . ASP A 1  620 ? 150.750 116.096 153.194 1.00 76.21  ? 884  ASP A C     1 
ATOM   3878  O  O     . ASP A 1  620 ? 151.283 116.152 154.310 1.00 76.21  ? 884  ASP A O     1 
ATOM   3879  C  CB    . ASP A 1  620 ? 148.504 115.032 152.767 1.00 76.21  ? 884  ASP A CB    1 
ATOM   3880  C  CG    . ASP A 1  620 ? 148.640 114.048 153.903 1.00 76.21  ? 884  ASP A CG    1 
ATOM   3881  O  OD1   . ASP A 1  620 ? 148.043 114.286 154.974 1.00 76.21  ? 884  ASP A OD1   1 
ATOM   3882  O  OD2   . ASP A 1  620 ? 149.335 113.029 153.719 1.00 76.21  ? 884  ASP A OD2   1 
ATOM   3883  N  N     . LEU A 1  621 ? 151.448 115.837 152.085 1.00 71.94  ? 885  LEU A N     1 
ATOM   3884  C  CA    . LEU A 1  621 ? 152.893 115.641 152.150 1.00 71.94  ? 885  LEU A CA    1 
ATOM   3885  C  C     . LEU A 1  621 ? 153.602 116.900 152.636 1.00 71.94  ? 885  LEU A C     1 
ATOM   3886  O  O     . LEU A 1  621 ? 154.528 116.823 153.455 1.00 71.94  ? 885  LEU A O     1 
ATOM   3887  C  CB    . LEU A 1  621 ? 153.428 115.215 150.782 1.00 71.94  ? 885  LEU A CB    1 
ATOM   3888  C  CG    . LEU A 1  621 ? 152.982 113.845 150.266 1.00 71.94  ? 885  LEU A CG    1 
ATOM   3889  C  CD1   . LEU A 1  621 ? 153.465 113.636 148.843 1.00 71.94  ? 885  LEU A CD1   1 
ATOM   3890  C  CD2   . LEU A 1  621 ? 153.480 112.730 151.173 1.00 71.94  ? 885  LEU A CD2   1 
ATOM   3891  N  N     . TYR A 1  622 ? 153.173 118.072 152.158 1.00 70.37  ? 886  TYR A N     1 
ATOM   3892  C  CA    . TYR A 1  622 ? 153.831 119.302 152.591 1.00 70.37  ? 886  TYR A CA    1 
ATOM   3893  C  C     . TYR A 1  622 ? 153.625 119.545 154.082 1.00 70.37  ? 886  TYR A C     1 
ATOM   3894  O  O     . TYR A 1  622 ? 154.545 119.991 154.778 1.00 70.37  ? 886  TYR A O     1 
ATOM   3895  C  CB    . TYR A 1  622 ? 153.328 120.500 151.790 1.00 70.37  ? 886  TYR A CB    1 
ATOM   3896  C  CG    . TYR A 1  622 ? 154.071 121.768 152.137 1.00 70.37  ? 886  TYR A CG    1 
ATOM   3897  C  CD1   . TYR A 1  622 ? 155.346 122.009 151.627 1.00 70.37  ? 886  TYR A CD1   1 
ATOM   3898  C  CD2   . TYR A 1  622 ? 153.521 122.707 153.001 1.00 70.37  ? 886  TYR A CD2   1 
ATOM   3899  C  CE1   . TYR A 1  622 ? 156.041 123.159 151.948 1.00 70.37  ? 886  TYR A CE1   1 
ATOM   3900  C  CE2   . TYR A 1  622 ? 154.211 123.865 153.328 1.00 70.37  ? 886  TYR A CE2   1 
ATOM   3901  C  CZ    . TYR A 1  622 ? 155.466 124.085 152.800 1.00 70.37  ? 886  TYR A CZ    1 
ATOM   3902  O  OH    . TYR A 1  622 ? 156.156 125.231 153.122 1.00 70.37  ? 886  TYR A OH    1 
ATOM   3903  N  N     . LEU A 1  623 ? 152.422 119.270 154.591 1.00 71.03  ? 887  LEU A N     1 
ATOM   3904  C  CA    . LEU A 1  623 ? 152.161 119.451 156.014 1.00 71.03  ? 887  LEU A CA    1 
ATOM   3905  C  C     . LEU A 1  623 ? 152.854 118.397 156.867 1.00 71.03  ? 887  LEU A C     1 
ATOM   3906  O  O     . LEU A 1  623 ? 153.116 118.651 158.046 1.00 71.03  ? 887  LEU A O     1 
ATOM   3907  C  CB    . LEU A 1  623 ? 150.656 119.442 156.282 1.00 71.03  ? 887  LEU A CB    1 
ATOM   3908  C  CG    . LEU A 1  623 ? 149.860 120.617 155.712 1.00 71.03  ? 887  LEU A CG    1 
ATOM   3909  C  CD1   . LEU A 1  623 ? 148.377 120.410 155.955 1.00 71.03  ? 887  LEU A CD1   1 
ATOM   3910  C  CD2   . LEU A 1  623 ? 150.328 121.931 156.313 1.00 71.03  ? 887  LEU A CD2   1 
ATOM   3911  N  N     . LYS A 1  624 ? 153.244 117.291 156.246 1.00 70.00  ? 888  LYS A N     1 
ATOM   3912  C  CA    . LYS A 1  624 ? 153.967 116.243 156.946 1.00 70.00  ? 888  LYS A CA    1 
ATOM   3913  C  C     . LYS A 1  624 ? 155.457 116.586 156.970 1.00 70.00  ? 888  LYS A C     1 
ATOM   3914  O  O     . LYS A 1  624 ? 156.191 116.121 157.837 1.00 70.00  ? 888  LYS A O     1 
ATOM   3915  C  CB    . LYS A 1  624 ? 153.744 114.893 156.272 1.00 70.00  ? 888  LYS A CB    1 
ATOM   3916  C  CG    . LYS A 1  624 ? 152.698 114.031 156.956 1.00 70.00  ? 888  LYS A CG    1 
ATOM   3917  C  CD    . LYS A 1  624 ? 153.004 112.555 156.782 1.00 70.00  ? 888  LYS A CD    1 
ATOM   3918  C  CE    . LYS A 1  624 ? 152.312 111.993 155.554 1.00 70.00  ? 888  LYS A CE    1 
ATOM   3919  N  NZ    . LYS A 1  624 ? 153.059 110.837 154.987 1.00 70.00  ? 888  LYS A NZ    1 
ATOM   3920  N  N     . MET A 1  625 ? 155.892 117.426 156.040 1.00 71.20  ? 889  MET A N     1 
ATOM   3921  C  CA    . MET A 1  625 ? 157.296 117.809 155.968 1.00 71.20  ? 889  MET A CA    1 
ATOM   3922  C  C     . MET A 1  625 ? 157.598 119.136 156.654 1.00 71.20  ? 889  MET A C     1 
ATOM   3923  O  O     . MET A 1  625 ? 158.746 119.413 156.989 1.00 71.20  ? 889  MET A O     1 
ATOM   3924  C  CB    . MET A 1  625 ? 157.754 117.871 154.512 1.00 71.20  ? 889  MET A CB    1 
ATOM   3925  C  CG    . MET A 1  625 ? 157.524 116.590 153.732 1.00 71.20  ? 889  MET A CG    1 
ATOM   3926  S  SD    . MET A 1  625 ? 158.385 116.612 152.152 1.00 71.20  ? 889  MET A SD    1 
ATOM   3927  C  CE    . MET A 1  625 ? 158.380 118.365 151.796 1.00 71.20  ? 889  MET A CE    1 
ATOM   3928  N  N     . LYS A 1  626 ? 156.575 119.957 156.861 1.00 71.75  ? 890  LYS A N     1 
ATOM   3929  C  CA    . LYS A 1  626 ? 156.773 121.258 157.496 1.00 71.75  ? 890  LYS A CA    1 
ATOM   3930  C  C     . LYS A 1  626 ? 157.379 121.276 158.901 1.00 71.75  ? 890  LYS A C     1 
ATOM   3931  O  O     . LYS A 1  626 ? 158.320 122.022 159.156 1.00 71.75  ? 890  LYS A O     1 
ATOM   3932  C  CB    . LYS A 1  626 ? 155.468 122.057 157.492 1.00 71.75  ? 890  LYS A CB    1 
ATOM   3933  C  CG    . LYS A 1  626 ? 155.659 123.539 157.219 1.00 71.75  ? 890  LYS A CG    1 
ATOM   3934  C  CD    . LYS A 1  626 ? 154.833 124.384 158.171 1.00 71.75  ? 890  LYS A CD    1 
ATOM   3935  C  CE    . LYS A 1  626 ? 154.000 125.405 157.417 1.00 71.75  ? 890  LYS A CE    1 
ATOM   3936  N  NZ    . LYS A 1  626 ? 152.885 125.929 158.251 1.00 71.75  ? 890  LYS A NZ    1 
ATOM   3937  N  N     . PRO A 1  627 ? 156.847 120.462 159.819 1.00 71.84  ? 891  PRO A N     1 
ATOM   3938  C  CA    . PRO A 1  627 ? 157.377 120.523 161.193 1.00 71.84  ? 891  PRO A CA    1 
ATOM   3939  C  C     . PRO A 1  627 ? 158.830 120.098 161.313 1.00 71.84  ? 891  PRO A C     1 
ATOM   3940  O  O     . PRO A 1  627 ? 159.483 120.448 162.303 1.00 71.84  ? 891  PRO A O     1 
ATOM   3941  C  CB    . PRO A 1  627 ? 156.451 119.575 161.968 1.00 71.84  ? 891  PRO A CB    1 
ATOM   3942  C  CG    . PRO A 1  627 ? 155.208 119.519 161.164 1.00 71.84  ? 891  PRO A CG    1 
ATOM   3943  C  CD    . PRO A 1  627 ? 155.661 119.591 159.744 1.00 71.84  ? 891  PRO A CD    1 
ATOM   3944  N  N     . VAL A 1  628 ? 159.356 119.350 160.342 1.00 70.73  ? 892  VAL A N     1 
ATOM   3945  C  CA    . VAL A 1  628 ? 160.755 118.936 160.404 1.00 70.73  ? 892  VAL A CA    1 
ATOM   3946  C  C     . VAL A 1  628 ? 161.674 120.148 160.332 1.00 70.73  ? 892  VAL A C     1 
ATOM   3947  O  O     . VAL A 1  628 ? 162.662 120.243 161.071 1.00 70.73  ? 892  VAL A O     1 
ATOM   3948  C  CB    . VAL A 1  628 ? 161.062 117.924 159.285 1.00 70.73  ? 892  VAL A CB    1 
ATOM   3949  C  CG1   . VAL A 1  628 ? 162.540 117.568 159.276 1.00 70.73  ? 892  VAL A CG1   1 
ATOM   3950  C  CG2   . VAL A 1  628 ? 160.212 116.677 159.455 1.00 70.73  ? 892  VAL A CG2   1 
ATOM   3951  N  N     . TRP A 1  629 ? 161.358 121.087 159.446 1.00 72.13  ? 893  TRP A N     1 
ATOM   3952  C  CA    . TRP A 1  629 ? 162.189 122.279 159.312 1.00 72.13  ? 893  TRP A CA    1 
ATOM   3953  C  C     . TRP A 1  629 ? 161.648 123.499 160.053 1.00 72.13  ? 893  TRP A C     1 
ATOM   3954  O  O     . TRP A 1  629 ? 162.278 124.553 160.054 1.00 72.13  ? 893  TRP A O     1 
ATOM   3955  C  CB    . TRP A 1  629 ? 162.506 122.606 157.846 1.00 72.13  ? 893  TRP A CB    1 
ATOM   3956  C  CG    . TRP A 1  629 ? 161.333 122.623 156.923 1.00 72.13  ? 893  TRP A CG    1 
ATOM   3957  C  CD1   . TRP A 1  629 ? 160.801 121.562 156.255 1.00 72.13  ? 893  TRP A CD1   1 
ATOM   3958  C  CD2   . TRP A 1  629 ? 160.562 123.765 156.542 1.00 72.13  ? 893  TRP A CD2   1 
ATOM   3959  N  NE1   . TRP A 1  629 ? 159.738 121.969 155.489 1.00 72.13  ? 893  TRP A NE1   1 
ATOM   3960  C  CE2   . TRP A 1  629 ? 159.570 123.318 155.649 1.00 72.13  ? 893  TRP A CE2   1 
ATOM   3961  C  CE3   . TRP A 1  629 ? 160.608 125.120 156.875 1.00 72.13  ? 893  TRP A CE3   1 
ATOM   3962  C  CZ2   . TRP A 1  629 ? 158.634 124.178 155.086 1.00 72.13  ? 893  TRP A CZ2   1 
ATOM   3963  C  CZ3   . TRP A 1  629 ? 159.679 125.971 156.314 1.00 72.13  ? 893  TRP A CZ3   1 
ATOM   3964  C  CH2   . TRP A 1  629 ? 158.705 125.498 155.430 1.00 72.13  ? 893  TRP A CH2   1 
ATOM   3965  N  N     . ARG A 1  630 ? 160.514 123.345 160.723 1.00 73.59  ? 894  ARG A N     1 
ATOM   3966  C  CA    . ARG A 1  630 ? 159.931 124.463 161.449 1.00 73.59  ? 894  ARG A CA    1 
ATOM   3967  C  C     . ARG A 1  630 ? 159.998 124.316 162.966 1.00 73.59  ? 894  ARG A C     1 
ATOM   3968  O  O     . ARG A 1  630 ? 159.884 125.305 163.685 1.00 73.59  ? 894  ARG A O     1 
ATOM   3969  C  CB    . ARG A 1  630 ? 158.481 124.678 161.017 1.00 73.59  ? 894  ARG A CB    1 
ATOM   3970  C  CG    . ARG A 1  630 ? 158.251 125.963 160.242 1.00 73.59  ? 894  ARG A CG    1 
ATOM   3971  C  CD    . ARG A 1  630 ? 158.946 127.139 160.902 1.00 73.59  ? 894  ARG A CD    1 
ATOM   3972  N  NE    . ARG A 1  630 ? 158.476 128.410 160.365 1.00 73.59  ? 894  ARG A NE    1 
ATOM   3973  C  CZ    . ARG A 1  630 ? 159.013 129.589 160.658 1.00 73.59  ? 894  ARG A CZ    1 
ATOM   3974  N  NH1   . ARG A 1  630 ? 160.041 129.662 161.490 1.00 73.59  ? 894  ARG A NH1   1 
ATOM   3975  N  NH2   . ARG A 1  630 ? 158.519 130.696 160.122 1.00 73.59  ? 894  ARG A NH2   1 
ATOM   3976  N  N     . SER A 1  631 ? 160.186 123.096 163.459 1.00 75.32  ? 895  SER A N     1 
ATOM   3977  C  CA    . SER A 1  631 ? 160.229 122.896 164.901 1.00 75.32  ? 895  SER A CA    1 
ATOM   3978  C  C     . SER A 1  631 ? 161.586 123.299 165.468 1.00 75.32  ? 895  SER A C     1 
ATOM   3979  O  O     . SER A 1  631 ? 162.613 123.243 164.787 1.00 75.32  ? 895  SER A O     1 
ATOM   3980  C  CB    . SER A 1  631 ? 159.931 121.439 165.254 1.00 75.32  ? 895  SER A CB    1 
ATOM   3981  O  OG    . SER A 1  631 ? 160.957 120.579 164.789 1.00 75.32  ? 895  SER A OG    1 
ATOM   3982  N  N     . SER A 1  632 ? 161.579 123.707 166.738 1.00 78.01  ? 896  SER A N     1 
ATOM   3983  C  CA    . SER A 1  632 ? 162.809 124.100 167.414 1.00 78.01  ? 896  SER A CA    1 
ATOM   3984  C  C     . SER A 1  632 ? 163.612 122.906 167.909 1.00 78.01  ? 896  SER A C     1 
ATOM   3985  O  O     . SER A 1  632 ? 164.786 123.069 168.259 1.00 78.01  ? 896  SER A O     1 
ATOM   3986  C  CB    . SER A 1  632 ? 162.493 125.027 168.589 1.00 78.01  ? 896  SER A CB    1 
ATOM   3987  O  OG    . SER A 1  632 ? 161.912 126.238 168.141 1.00 78.01  ? 896  SER A OG    1 
ATOM   3988  N  N     . CYS A 1  633 ? 163.011 121.720 167.950 1.00 80.42  ? 897  CYS A N     1 
ATOM   3989  C  CA    . CYS A 1  633 ? 163.705 120.508 168.364 1.00 80.42  ? 897  CYS A CA    1 
ATOM   3990  C  C     . CYS A 1  633 ? 162.983 119.293 167.796 1.00 80.42  ? 897  CYS A C     1 
ATOM   3991  O  O     . CYS A 1  633 ? 162.191 118.654 168.500 1.00 80.42  ? 897  CYS A O     1 
ATOM   3992  C  CB    . CYS A 1  633 ? 163.787 120.422 169.888 1.00 80.42  ? 897  CYS A CB    1 
ATOM   3993  S  SG    . CYS A 1  633 ? 164.715 118.999 170.506 1.00 80.42  ? 897  CYS A SG    1 
ATOM   3994  N  N     . PRO A 1  634 ? 163.225 118.945 166.531 1.00 77.14  ? 898  PRO A N     1 
ATOM   3995  C  CA    . PRO A 1  634 ? 162.492 117.818 165.932 1.00 77.14  ? 898  PRO A CA    1 
ATOM   3996  C  C     . PRO A 1  634 ? 162.825 116.477 166.557 1.00 77.14  ? 898  PRO A C     1 
ATOM   3997  O  O     . PRO A 1  634 ? 161.997 115.558 166.506 1.00 77.14  ? 898  PRO A O     1 
ATOM   3998  C  CB    . PRO A 1  634 ? 162.911 117.877 164.458 1.00 77.14  ? 898  PRO A CB    1 
ATOM   3999  C  CG    . PRO A 1  634 ? 164.245 118.541 164.476 1.00 77.14  ? 898  PRO A CG    1 
ATOM   4000  C  CD    . PRO A 1  634 ? 164.196 119.539 165.596 1.00 77.14  ? 898  PRO A CD    1 
ATOM   4001  N  N     . ALA A 1  635 ? 164.012 116.331 167.148 1.00 77.02  ? 899  ALA A N     1 
ATOM   4002  C  CA    . ALA A 1  635 ? 164.383 115.071 167.778 1.00 77.02  ? 899  ALA A CA    1 
ATOM   4003  C  C     . ALA A 1  635 ? 163.588 114.791 169.046 1.00 77.02  ? 899  ALA A C     1 
ATOM   4004  O  O     . ALA A 1  635 ? 163.585 113.647 169.514 1.00 77.02  ? 899  ALA A O     1 
ATOM   4005  C  CB    . ALA A 1  635 ? 165.879 115.062 168.093 1.00 77.02  ? 899  ALA A CB    1 
ATOM   4006  N  N     . LYS A 1  636 ? 162.915 115.798 169.609 1.00 79.69  ? 900  LYS A N     1 
ATOM   4007  C  CA    . LYS A 1  636 ? 162.134 115.600 170.823 1.00 79.69  ? 900  LYS A CA    1 
ATOM   4008  C  C     . LYS A 1  636 ? 160.717 116.151 170.708 1.00 79.69  ? 900  LYS A C     1 
ATOM   4009  O  O     . LYS A 1  636 ? 159.982 116.132 171.703 1.00 79.69  ? 900  LYS A O     1 
ATOM   4010  C  CB    . LYS A 1  636 ? 162.840 116.236 172.026 1.00 79.69  ? 900  LYS A CB    1 
ATOM   4011  C  CG    . LYS A 1  636 ? 164.157 115.570 172.387 1.00 79.69  ? 900  LYS A CG    1 
ATOM   4012  C  CD    . LYS A 1  636 ? 164.808 116.237 173.585 1.00 79.69  ? 900  LYS A CD    1 
ATOM   4013  C  CE    . LYS A 1  636 ? 166.077 115.506 173.995 1.00 79.69  ? 900  LYS A CE    1 
ATOM   4014  N  NZ    . LYS A 1  636 ? 167.139 115.614 172.956 1.00 79.69  ? 900  LYS A NZ    1 
ATOM   4015  N  N     . GLU A 1  637 ? 160.311 116.638 169.537 1.00 82.72  ? 901  GLU A N     1 
ATOM   4016  C  CA    . GLU A 1  637 ? 158.958 117.140 169.333 1.00 82.72  ? 901  GLU A CA    1 
ATOM   4017  C  C     . GLU A 1  637 ? 158.217 116.475 168.185 1.00 82.72  ? 901  GLU A C     1 
ATOM   4018  O  O     . GLU A 1  637 ? 156.981 116.532 168.164 1.00 82.72  ? 901  GLU A O     1 
ATOM   4019  C  CB    . GLU A 1  637 ? 158.976 118.657 169.089 1.00 82.72  ? 901  GLU A CB    1 
ATOM   4020  C  CG    . GLU A 1  637 ? 159.414 119.467 170.294 1.00 82.72  ? 901  GLU A CG    1 
ATOM   4021  C  CD    . GLU A 1  637 ? 159.433 120.956 170.019 1.00 82.72  ? 901  GLU A CD    1 
ATOM   4022  O  OE1   . GLU A 1  637 ? 159.227 121.350 168.851 1.00 82.72  ? 901  GLU A OE1   1 
ATOM   4023  O  OE2   . GLU A 1  637 ? 159.652 121.734 170.971 1.00 82.72  ? 901  GLU A OE2   1 
ATOM   4024  N  N     . CYS A 1  638 ? 158.914 115.854 167.239 1.00 84.19  ? 902  CYS A N     1 
ATOM   4025  C  CA    . CYS A 1  638 ? 158.281 115.173 166.117 1.00 84.19  ? 902  CYS A CA    1 
ATOM   4026  C  C     . CYS A 1  638 ? 159.218 114.110 165.553 1.00 84.19  ? 902  CYS A C     1 
ATOM   4027  O  O     . CYS A 1  638 ? 159.678 114.223 164.410 1.00 84.19  ? 902  CYS A O     1 
ATOM   4028  C  CB    . CYS A 1  638 ? 157.872 116.187 165.044 1.00 84.19  ? 902  CYS A CB    1 
ATOM   4029  S  SG    . CYS A 1  638 ? 159.217 117.197 164.369 1.00 84.19  ? 902  CYS A SG    1 
ATOM   4030  N  N     . PRO A 1  639 ? 159.516 113.056 166.317 1.00 83.35  ? 903  PRO A N     1 
ATOM   4031  C  CA    . PRO A 1  639 ? 160.468 112.047 165.824 1.00 83.35  ? 903  PRO A CA    1 
ATOM   4032  C  C     . PRO A 1  639 ? 159.951 111.260 164.635 1.00 83.35  ? 903  PRO A C     1 
ATOM   4033  O  O     . PRO A 1  639 ? 160.751 110.835 163.792 1.00 83.35  ? 903  PRO A O     1 
ATOM   4034  C  CB    . PRO A 1  639 ? 160.683 111.147 167.048 1.00 83.35  ? 903  PRO A CB    1 
ATOM   4035  C  CG    . PRO A 1  639 ? 159.424 111.283 167.830 1.00 83.35  ? 903  PRO A CG    1 
ATOM   4036  C  CD    . PRO A 1  639 ? 158.962 112.698 167.635 1.00 83.35  ? 903  PRO A CD    1 
ATOM   4037  N  N     . GLU A 1  640 ? 158.637 111.053 164.539 1.00 84.18  ? 904  GLU A N     1 
ATOM   4038  C  CA    . GLU A 1  640 ? 158.086 110.320 163.404 1.00 84.18  ? 904  GLU A CA    1 
ATOM   4039  C  C     . GLU A 1  640 ? 158.263 111.102 162.109 1.00 84.18  ? 904  GLU A C     1 
ATOM   4040  O  O     . GLU A 1  640 ? 158.640 110.536 161.076 1.00 84.18  ? 904  GLU A O     1 
ATOM   4041  C  CB    . GLU A 1  640 ? 156.611 110.004 163.647 1.00 84.18  ? 904  GLU A CB    1 
ATOM   4042  C  CG    . GLU A 1  640 ? 155.978 109.169 162.548 1.00 84.18  ? 904  GLU A CG    1 
ATOM   4043  C  CD    . GLU A 1  640 ? 154.531 108.824 162.834 1.00 84.18  ? 904  GLU A CD    1 
ATOM   4044  O  OE1   . GLU A 1  640 ? 154.011 109.257 163.883 1.00 84.18  ? 904  GLU A OE1   1 
ATOM   4045  O  OE2   . GLU A 1  640 ? 153.914 108.118 162.008 1.00 84.18  ? 904  GLU A OE2   1 
ATOM   4046  N  N     . SER A 1  641 ? 157.991 112.409 162.145 1.00 80.19  ? 905  SER A N     1 
ATOM   4047  C  CA    . SER A 1  641 ? 158.182 113.235 160.958 1.00 80.19  ? 905  SER A CA    1 
ATOM   4048  C  C     . SER A 1  641 ? 159.653 113.310 160.572 1.00 80.19  ? 905  SER A C     1 
ATOM   4049  O  O     . SER A 1  641 ? 159.990 113.395 159.385 1.00 80.19  ? 905  SER A O     1 
ATOM   4050  C  CB    . SER A 1  641 ? 157.616 114.634 161.196 1.00 80.19  ? 905  SER A CB    1 
ATOM   4051  O  OG    . SER A 1  641 ? 156.215 114.589 161.396 1.00 80.19  ? 905  SER A OG    1 
ATOM   4052  N  N     . LEU A 1  642 ? 160.546 113.276 161.563 1.00 76.72  ? 906  LEU A N     1 
ATOM   4053  C  CA    . LEU A 1  642 ? 161.975 113.308 161.271 1.00 76.72  ? 906  LEU A CA    1 
ATOM   4054  C  C     . LEU A 1  642 ? 162.436 112.007 160.630 1.00 76.72  ? 906  LEU A C     1 
ATOM   4055  O  O     . LEU A 1  642 ? 163.193 112.021 159.652 1.00 76.72  ? 906  LEU A O     1 
ATOM   4056  C  CB    . LEU A 1  642 ? 162.763 113.586 162.550 1.00 76.72  ? 906  LEU A CB    1 
ATOM   4057  C  CG    . LEU A 1  642 ? 164.277 113.697 162.377 1.00 76.72  ? 906  LEU A CG    1 
ATOM   4058  C  CD1   . LEU A 1  642 ? 164.609 114.850 161.451 1.00 76.72  ? 906  LEU A CD1   1 
ATOM   4059  C  CD2   . LEU A 1  642 ? 164.958 113.874 163.723 1.00 76.72  ? 906  LEU A CD2   1 
ATOM   4060  N  N     . CYS A 1  643 ? 161.991 110.869 161.166 1.00 82.01  ? 907  CYS A N     1 
ATOM   4061  C  CA    . CYS A 1  643 ? 162.401 109.578 160.627 1.00 82.01  ? 907  CYS A CA    1 
ATOM   4062  C  C     . CYS A 1  643 ? 161.786 109.297 159.262 1.00 82.01  ? 907  CYS A C     1 
ATOM   4063  O  O     . CYS A 1  643 ? 162.397 108.588 158.456 1.00 82.01  ? 907  CYS A O     1 
ATOM   4064  C  CB    . CYS A 1  643 ? 162.031 108.463 161.606 1.00 82.01  ? 907  CYS A CB    1 
ATOM   4065  S  SG    . CYS A 1  643 ? 162.562 106.810 161.103 1.00 82.01  ? 907  CYS A SG    1 
ATOM   4066  N  N     . GLN A 1  644 ? 160.601 109.838 158.983 1.00 81.92  ? 908  GLN A N     1 
ATOM   4067  C  CA    . GLN A 1  644 ? 159.915 109.601 157.721 1.00 81.92  ? 908  GLN A CA    1 
ATOM   4068  C  C     . GLN A 1  644 ? 160.066 110.747 156.730 1.00 81.92  ? 908  GLN A C     1 
ATOM   4069  O  O     . GLN A 1  644 ? 159.318 110.795 155.748 1.00 81.92  ? 908  GLN A O     1 
ATOM   4070  C  CB    . GLN A 1  644 ? 158.424 109.346 157.970 1.00 81.92  ? 908  GLN A CB    1 
ATOM   4071  C  CG    . GLN A 1  644 ? 158.131 108.082 158.759 1.00 81.92  ? 908  GLN A CG    1 
ATOM   4072  C  CD    . GLN A 1  644 ? 158.571 106.827 158.033 1.00 81.92  ? 908  GLN A CD    1 
ATOM   4073  O  OE1   . GLN A 1  644 ? 159.533 106.171 158.431 1.00 81.92  ? 908  GLN A OE1   1 
ATOM   4074  N  NE2   . GLN A 1  644 ? 157.866 106.486 156.961 1.00 81.92  ? 908  GLN A NE2   1 
ATOM   4075  N  N     . TYR A 1  645 ? 161.004 111.668 156.961 1.00 75.01  ? 909  TYR A N     1 
ATOM   4076  C  CA    . TYR A 1  645 ? 161.128 112.830 156.086 1.00 75.01  ? 909  TYR A CA    1 
ATOM   4077  C  C     . TYR A 1  645 ? 161.630 112.442 154.702 1.00 75.01  ? 909  TYR A C     1 
ATOM   4078  O  O     . TYR A 1  645 ? 161.213 113.026 153.696 1.00 75.01  ? 909  TYR A O     1 
ATOM   4079  C  CB    . TYR A 1  645 ? 162.060 113.866 156.713 1.00 75.01  ? 909  TYR A CB    1 
ATOM   4080  C  CG    . TYR A 1  645 ? 162.204 115.121 155.887 1.00 75.01  ? 909  TYR A CG    1 
ATOM   4081  C  CD1   . TYR A 1  645 ? 161.213 116.092 155.885 1.00 75.01  ? 909  TYR A CD1   1 
ATOM   4082  C  CD2   . TYR A 1  645 ? 163.323 115.328 155.094 1.00 75.01  ? 909  TYR A CD2   1 
ATOM   4083  C  CE1   . TYR A 1  645 ? 161.340 117.239 155.127 1.00 75.01  ? 909  TYR A CE1   1 
ATOM   4084  C  CE2   . TYR A 1  645 ? 163.458 116.470 154.332 1.00 75.01  ? 909  TYR A CE2   1 
ATOM   4085  C  CZ    . TYR A 1  645 ? 162.464 117.422 154.352 1.00 75.01  ? 909  TYR A CZ    1 
ATOM   4086  O  OH    . TYR A 1  645 ? 162.592 118.562 153.595 1.00 75.01  ? 909  TYR A OH    1 
ATOM   4087  N  N     . SER A 1  646 ? 162.533 111.461 154.629 1.00 76.74  ? 910  SER A N     1 
ATOM   4088  C  CA    . SER A 1  646 ? 163.115 111.086 153.343 1.00 76.74  ? 910  SER A CA    1 
ATOM   4089  C  C     . SER A 1  646 ? 162.070 110.468 152.422 1.00 76.74  ? 910  SER A C     1 
ATOM   4090  O  O     . SER A 1  646 ? 161.978 110.826 151.241 1.00 76.74  ? 910  SER A O     1 
ATOM   4091  C  CB    . SER A 1  646 ? 164.281 110.122 153.560 1.00 76.74  ? 910  SER A CB    1 
ATOM   4092  O  OG    . SER A 1  646 ? 164.840 109.714 152.324 1.00 76.74  ? 910  SER A OG    1 
ATOM   4093  N  N     . PHE A 1  647 ? 161.283 109.552 152.971 1.00 75.77  ? 911  PHE A N     1 
ATOM   4094  C  CA    . PHE A 1  647 ? 160.236 108.886 152.215 1.00 75.77  ? 911  PHE A CA    1 
ATOM   4095  C  C     . PHE A 1  647 ? 159.211 109.900 151.719 1.00 75.77  ? 911  PHE A C     1 
ATOM   4096  O  O     . PHE A 1  647 ? 158.800 109.862 150.563 1.00 75.77  ? 911  PHE A O     1 
ATOM   4097  C  CB    . PHE A 1  647 ? 159.567 107.820 153.081 1.00 75.77  ? 911  PHE A CB    1 
ATOM   4098  C  CG    . PHE A 1  647 ? 158.269 107.315 152.526 1.00 75.77  ? 911  PHE A CG    1 
ATOM   4099  C  CD1   . PHE A 1  647 ? 158.024 107.343 151.166 1.00 75.77  ? 911  PHE A CD1   1 
ATOM   4100  C  CD2   . PHE A 1  647 ? 157.295 106.808 153.368 1.00 75.77  ? 911  PHE A CD2   1 
ATOM   4101  C  CE1   . PHE A 1  647 ? 156.830 106.877 150.654 1.00 75.77  ? 911  PHE A CE1   1 
ATOM   4102  C  CE2   . PHE A 1  647 ? 156.098 106.341 152.864 1.00 75.77  ? 911  PHE A CE2   1 
ATOM   4103  C  CZ    . PHE A 1  647 ? 155.865 106.375 151.504 1.00 75.77  ? 911  PHE A CZ    1 
ATOM   4104  N  N     . ASN A 1  648 ? 158.805 110.810 152.596 1.00 75.11  ? 912  ASN A N     1 
ATOM   4105  C  CA    . ASN A 1  648 ? 157.834 111.838 152.242 1.00 75.11  ? 912  ASN A CA    1 
ATOM   4106  C  C     . ASN A 1  648 ? 158.380 112.764 151.163 1.00 75.11  ? 912  ASN A C     1 
ATOM   4107  O  O     . ASN A 1  648 ? 157.657 113.138 150.234 1.00 75.11  ? 912  ASN A O     1 
ATOM   4108  C  CB    . ASN A 1  648 ? 157.436 112.636 153.483 1.00 75.11  ? 912  ASN A CB    1 
ATOM   4109  C  CG    . ASN A 1  648 ? 156.603 111.825 154.453 1.00 75.11  ? 912  ASN A CG    1 
ATOM   4110  O  OD1   . ASN A 1  648 ? 155.715 111.076 154.050 1.00 75.11  ? 912  ASN A OD1   1 
ATOM   4111  N  ND2   . ASN A 1  648 ? 156.886 111.972 155.742 1.00 75.11  ? 912  ASN A ND2   1 
ATOM   4112  N  N     . SER A 1  649 ? 159.657 113.138 151.265 1.00 75.19  ? 913  SER A N     1 
ATOM   4113  C  CA    . SER A 1  649 ? 160.258 114.000 150.253 1.00 75.19  ? 913  SER A CA    1 
ATOM   4114  C  C     . SER A 1  649 ? 160.336 113.294 148.905 1.00 75.19  ? 913  SER A C     1 
ATOM   4115  O  O     . SER A 1  649 ? 160.094 113.908 147.859 1.00 75.19  ? 913  SER A O     1 
ATOM   4116  C  CB    . SER A 1  649 ? 161.647 114.449 150.705 1.00 75.19  ? 913  SER A CB    1 
ATOM   4117  O  OG    . SER A 1  649 ? 162.535 113.348 150.789 1.00 75.19  ? 913  SER A OG    1 
ATOM   4118  N  N     . GLN A 1  650 ? 160.672 112.002 148.910 1.00 73.54  ? 914  GLN A N     1 
ATOM   4119  C  CA    . GLN A 1  650 ? 160.723 111.255 147.658 1.00 73.54  ? 914  GLN A CA    1 
ATOM   4120  C  C     . GLN A 1  650 ? 159.343 111.147 147.023 1.00 73.54  ? 914  GLN A C     1 
ATOM   4121  O  O     . GLN A 1  650 ? 159.202 111.297 145.803 1.00 73.54  ? 914  GLN A O     1 
ATOM   4122  C  CB    . GLN A 1  650 ? 161.318 109.868 147.896 1.00 73.54  ? 914  GLN A CB    1 
ATOM   4123  C  CG    . GLN A 1  650 ? 162.789 109.886 148.274 1.00 73.54  ? 914  GLN A CG    1 
ATOM   4124  C  CD    . GLN A 1  650 ? 163.343 108.499 148.524 1.00 73.54  ? 914  GLN A CD    1 
ATOM   4125  O  OE1   . GLN A 1  650 ? 162.613 107.509 148.478 1.00 73.54  ? 914  GLN A OE1   1 
ATOM   4126  N  NE2   . GLN A 1  650 ? 164.641 108.420 148.791 1.00 73.54  ? 914  GLN A NE2   1 
ATOM   4127  N  N     . ARG A 1  651 ? 158.311 110.898 147.833 1.00 74.85  ? 915  ARG A N     1 
ATOM   4128  C  CA    . ARG A 1  651 ? 156.956 110.836 147.293 1.00 74.85  ? 915  ARG A CA    1 
ATOM   4129  C  C     . ARG A 1  651 ? 156.512 112.196 146.766 1.00 74.85  ? 915  ARG A C     1 
ATOM   4130  O  O     . ARG A 1  651 ? 155.836 112.281 145.736 1.00 74.85  ? 915  ARG A O     1 
ATOM   4131  C  CB    . ARG A 1  651 ? 155.987 110.327 148.360 1.00 74.85  ? 915  ARG A CB    1 
ATOM   4132  C  CG    . ARG A 1  651 ? 154.552 110.218 147.878 1.00 74.85  ? 915  ARG A CG    1 
ATOM   4133  C  CD    . ARG A 1  651 ? 154.421 109.160 146.794 1.00 74.85  ? 915  ARG A CD    1 
ATOM   4134  N  NE    . ARG A 1  651 ? 153.052 109.042 146.304 1.00 74.85  ? 915  ARG A NE    1 
ATOM   4135  C  CZ    . ARG A 1  651 ? 152.545 109.781 145.322 1.00 74.85  ? 915  ARG A CZ    1 
ATOM   4136  N  NH1   . ARG A 1  651 ? 153.295 110.694 144.722 1.00 74.85  ? 915  ARG A NH1   1 
ATOM   4137  N  NH2   . ARG A 1  651 ? 151.287 109.608 144.941 1.00 74.85  ? 915  ARG A NH2   1 
ATOM   4138  N  N     . PHE A 1  652 ? 156.890 113.271 147.461 1.00 70.14  ? 916  PHE A N     1 
ATOM   4139  C  CA    . PHE A 1  652 ? 156.585 114.622 147.000 1.00 70.14  ? 916  PHE A CA    1 
ATOM   4140  C  C     . PHE A 1  652 ? 157.226 114.898 145.645 1.00 70.14  ? 916  PHE A C     1 
ATOM   4141  O  O     . PHE A 1  652 ? 156.575 115.420 144.728 1.00 70.14  ? 916  PHE A O     1 
ATOM   4142  C  CB    . PHE A 1  652 ? 157.071 115.620 148.053 1.00 70.14  ? 916  PHE A CB    1 
ATOM   4143  C  CG    . PHE A 1  652 ? 156.755 117.053 147.748 1.00 70.14  ? 916  PHE A CG    1 
ATOM   4144  C  CD1   . PHE A 1  652 ? 155.484 117.556 147.950 1.00 70.14  ? 916  PHE A CD1   1 
ATOM   4145  C  CD2   . PHE A 1  652 ? 157.741 117.908 147.290 1.00 70.14  ? 916  PHE A CD2   1 
ATOM   4146  C  CE1   . PHE A 1  652 ? 155.204 118.881 147.688 1.00 70.14  ? 916  PHE A CE1   1 
ATOM   4147  C  CE2   . PHE A 1  652 ? 157.464 119.231 147.026 1.00 70.14  ? 916  PHE A CE2   1 
ATOM   4148  C  CZ    . PHE A 1  652 ? 156.193 119.717 147.221 1.00 70.14  ? 916  PHE A CZ    1 
ATOM   4149  N  N     . ALA A 1  653 ? 158.505 114.541 145.501 1.00 72.86  ? 917  ALA A N     1 
ATOM   4150  C  CA    . ALA A 1  653 ? 159.198 114.745 144.235 1.00 72.86  ? 917  ALA A CA    1 
ATOM   4151  C  C     . ALA A 1  653 ? 158.577 113.910 143.123 1.00 72.86  ? 917  ALA A C     1 
ATOM   4152  O  O     . ALA A 1  653 ? 158.415 114.390 141.995 1.00 72.86  ? 917  ALA A O     1 
ATOM   4153  C  CB    . ALA A 1  653 ? 160.682 114.414 144.390 1.00 72.86  ? 917  ALA A CB    1 
ATOM   4154  N  N     . GLU A 1  654 ? 158.222 112.658 143.421 1.00 73.89  ? 918  GLU A N     1 
ATOM   4155  C  CA    . GLU A 1  654 ? 157.588 111.813 142.414 1.00 73.89  ? 918  GLU A CA    1 
ATOM   4156  C  C     . GLU A 1  654 ? 156.236 112.377 141.993 1.00 73.89  ? 918  GLU A C     1 
ATOM   4157  O  O     . GLU A 1  654 ? 155.886 112.350 140.807 1.00 73.89  ? 918  GLU A O     1 
ATOM   4158  C  CB    . GLU A 1  654 ? 157.434 110.389 142.945 1.00 73.89  ? 918  GLU A CB    1 
ATOM   4159  C  CG    . GLU A 1  654 ? 156.855 109.413 141.937 1.00 73.89  ? 918  GLU A CG    1 
ATOM   4160  C  CD    . GLU A 1  654 ? 156.760 108.004 142.482 1.00 73.89  ? 918  GLU A CD    1 
ATOM   4161  O  OE1   . GLU A 1  654 ? 157.128 107.794 143.657 1.00 73.89  ? 918  GLU A OE1   1 
ATOM   4162  O  OE2   . GLU A 1  654 ? 156.316 107.106 141.736 1.00 73.89  ? 918  GLU A OE2   1 
ATOM   4163  N  N     . LEU A 1  655 ? 155.464 112.892 142.951 1.00 73.30  ? 919  LEU A N     1 
ATOM   4164  C  CA    . LEU A 1  655 ? 154.182 113.510 142.630 1.00 73.30  ? 919  LEU A CA    1 
ATOM   4165  C  C     . LEU A 1  655 ? 154.371 114.700 141.701 1.00 73.30  ? 919  LEU A C     1 
ATOM   4166  O  O     . LEU A 1  655 ? 153.669 114.834 140.689 1.00 73.30  ? 919  LEU A O     1 
ATOM   4167  C  CB    . LEU A 1  655 ? 153.480 113.938 143.919 1.00 73.30  ? 919  LEU A CB    1 
ATOM   4168  C  CG    . LEU A 1  655 ? 152.081 114.539 143.806 1.00 73.30  ? 919  LEU A CG    1 
ATOM   4169  C  CD1   . LEU A 1  655 ? 151.111 113.515 143.254 1.00 73.30  ? 919  LEU A CD1   1 
ATOM   4170  C  CD2   . LEU A 1  655 ? 151.611 115.051 145.158 1.00 73.30  ? 919  LEU A CD2   1 
ATOM   4171  N  N     . LEU A 1  656 ? 155.325 115.577 142.031 1.00 72.09  ? 920  LEU A N     1 
ATOM   4172  C  CA    . LEU A 1  656 ? 155.594 116.728 141.173 1.00 72.09  ? 920  LEU A CA    1 
ATOM   4173  C  C     . LEU A 1  656 ? 156.048 116.292 139.785 1.00 72.09  ? 920  LEU A C     1 
ATOM   4174  O  O     . LEU A 1  656 ? 155.677 116.910 138.780 1.00 72.09  ? 920  LEU A O     1 
ATOM   4175  C  CB    . LEU A 1  656 ? 156.646 117.634 141.809 1.00 72.09  ? 920  LEU A CB    1 
ATOM   4176  C  CG    . LEU A 1  656 ? 156.278 118.379 143.089 1.00 72.09  ? 920  LEU A CG    1 
ATOM   4177  C  CD1   . LEU A 1  656 ? 157.486 119.149 143.587 1.00 72.09  ? 920  LEU A CD1   1 
ATOM   4178  C  CD2   . LEU A 1  656 ? 155.102 119.310 142.854 1.00 72.09  ? 920  LEU A CD2   1 
ATOM   4179  N  N     . SER A 1  657 ? 156.851 115.230 139.709 1.00 74.48  ? 921  SER A N     1 
ATOM   4180  C  CA    . SER A 1  657 ? 157.386 114.807 138.420 1.00 74.48  ? 921  SER A CA    1 
ATOM   4181  C  C     . SER A 1  657 ? 156.316 114.145 137.563 1.00 74.48  ? 921  SER A C     1 
ATOM   4182  O  O     . SER A 1  657 ? 156.366 114.221 136.330 1.00 74.48  ? 921  SER A O     1 
ATOM   4183  C  CB    . SER A 1  657 ? 158.568 113.860 138.630 1.00 74.48  ? 921  SER A CB    1 
ATOM   4184  O  OG    . SER A 1  657 ? 159.641 114.521 139.276 1.00 74.48  ? 921  SER A OG    1 
ATOM   4185  N  N     . THR A 1  658 ? 155.343 113.487 138.191 1.00 73.16  ? 922  THR A N     1 
ATOM   4186  C  CA    . THR A 1  658 ? 154.327 112.764 137.431 1.00 73.16  ? 922  THR A CA    1 
ATOM   4187  C  C     . THR A 1  658 ? 153.128 113.642 137.080 1.00 73.16  ? 922  THR A C     1 
ATOM   4188  O  O     . THR A 1  658 ? 152.824 113.838 135.899 1.00 73.16  ? 922  THR A O     1 
ATOM   4189  C  CB    . THR A 1  658 ? 153.869 111.521 138.203 1.00 73.16  ? 922  THR A CB    1 
ATOM   4190  O  OG1   . THR A 1  658 ? 153.370 111.908 139.490 1.00 73.16  ? 922  THR A OG1   1 
ATOM   4191  C  CG2   . THR A 1  658 ? 155.018 110.537 138.367 1.00 73.16  ? 922  THR A CG2   1 
ATOM   4192  N  N     . LYS A 1  659 ? 152.406 114.105 138.097 1.00 70.85  ? 923  LYS A N     1 
ATOM   4193  C  CA    . LYS A 1  659 ? 151.177 114.874 137.886 1.00 70.85  ? 923  LYS A CA    1 
ATOM   4194  C  C     . LYS A 1  659 ? 151.274 116.395 137.844 1.00 70.85  ? 923  LYS A C     1 
ATOM   4195  O  O     . LYS A 1  659 ? 150.258 117.080 137.925 1.00 70.85  ? 923  LYS A O     1 
ATOM   4196  C  CB    . LYS A 1  659 ? 150.121 114.466 138.916 1.00 70.85  ? 923  LYS A CB    1 
ATOM   4197  C  CG    . LYS A 1  659 ? 149.990 112.965 139.103 1.00 70.85  ? 923  LYS A CG    1 
ATOM   4198  C  CD    . LYS A 1  659 ? 148.540 112.559 139.303 1.00 70.85  ? 923  LYS A CD    1 
ATOM   4199  C  CE    . LYS A 1  659 ? 148.101 111.549 138.257 1.00 70.85  ? 923  LYS A CE    1 
ATOM   4200  N  NZ    . LYS A 1  659 ? 148.023 112.158 136.901 1.00 70.85  ? 923  LYS A NZ    1 
ATOM   4201  N  N     . PHE A 1  660 ? 152.479 116.928 137.723 1.00 71.44  ? 924  PHE A N     1 
ATOM   4202  C  CA    . PHE A 1  660 ? 152.650 118.374 137.645 1.00 71.44  ? 924  PHE A CA    1 
ATOM   4203  C  C     . PHE A 1  660 ? 153.659 118.753 136.566 1.00 71.44  ? 924  PHE A C     1 
ATOM   4204  O  O     . PHE A 1  660 ? 154.396 119.734 136.717 1.00 71.44  ? 924  PHE A O     1 
ATOM   4205  C  CB    . PHE A 1  660 ? 153.064 118.950 138.999 1.00 71.44  ? 924  PHE A CB    1 
ATOM   4206  C  CG    . PHE A 1  660 ? 151.990 118.860 140.046 1.00 71.44  ? 924  PHE A CG    1 
ATOM   4207  C  CD1   . PHE A 1  660 ? 150.966 119.791 140.090 1.00 71.44  ? 924  PHE A CD1   1 
ATOM   4208  C  CD2   . PHE A 1  660 ? 151.997 117.837 140.979 1.00 71.44  ? 924  PHE A CD2   1 
ATOM   4209  C  CE1   . PHE A 1  660 ? 149.974 119.708 141.050 1.00 71.44  ? 924  PHE A CE1   1 
ATOM   4210  C  CE2   . PHE A 1  660 ? 151.008 117.749 141.940 1.00 71.44  ? 924  PHE A CE2   1 
ATOM   4211  C  CZ    . PHE A 1  660 ? 149.995 118.686 141.975 1.00 71.44  ? 924  PHE A CZ    1 
ATOM   4212  N  N     . LYS A 1  661 ? 153.705 117.984 135.474 1.00 75.66  ? 925  LYS A N     1 
ATOM   4213  C  CA    . LYS A 1  661 ? 154.697 118.217 134.428 1.00 75.66  ? 925  LYS A CA    1 
ATOM   4214  C  C     . LYS A 1  661 ? 154.516 119.574 133.760 1.00 75.66  ? 925  LYS A C     1 
ATOM   4215  O  O     . LYS A 1  661 ? 155.484 120.167 133.272 1.00 75.66  ? 925  LYS A O     1 
ATOM   4216  C  CB    . LYS A 1  661 ? 154.623 117.106 133.381 1.00 75.66  ? 925  LYS A CB    1 
ATOM   4217  C  CG    . LYS A 1  661 ? 155.055 115.741 133.879 1.00 75.66  ? 925  LYS A CG    1 
ATOM   4218  C  CD    . LYS A 1  661 ? 154.975 114.707 132.769 1.00 75.66  ? 925  LYS A CD    1 
ATOM   4219  C  CE    . LYS A 1  661 ? 155.386 113.330 133.261 1.00 75.66  ? 925  LYS A CE    1 
ATOM   4220  N  NZ    . LYS A 1  661 ? 155.299 112.309 132.180 1.00 75.66  ? 925  LYS A NZ    1 
ATOM   4221  N  N     . TYR A 1  662 ? 153.282 120.082 133.723 1.00 78.44  ? 926  TYR A N     1 
ATOM   4222  C  CA    . TYR A 1  662 ? 153.004 121.319 133.000 1.00 78.44  ? 926  TYR A CA    1 
ATOM   4223  C  C     . TYR A 1  662 ? 153.762 122.519 133.554 1.00 78.44  ? 926  TYR A C     1 
ATOM   4224  O  O     . TYR A 1  662 ? 153.873 123.533 132.855 1.00 78.44  ? 926  TYR A O     1 
ATOM   4225  C  CB    . TYR A 1  662 ? 151.502 121.609 133.015 1.00 78.44  ? 926  TYR A CB    1 
ATOM   4226  C  CG    . TYR A 1  662 ? 150.939 121.878 134.391 1.00 78.44  ? 926  TYR A CG    1 
ATOM   4227  C  CD1   . TYR A 1  662 ? 150.484 120.839 135.191 1.00 78.44  ? 926  TYR A CD1   1 
ATOM   4228  C  CD2   . TYR A 1  662 ? 150.854 123.172 134.887 1.00 78.44  ? 926  TYR A CD2   1 
ATOM   4229  C  CE1   . TYR A 1  662 ? 149.967 121.081 136.449 1.00 78.44  ? 926  TYR A CE1   1 
ATOM   4230  C  CE2   . TYR A 1  662 ? 150.339 123.423 136.143 1.00 78.44  ? 926  TYR A CE2   1 
ATOM   4231  C  CZ    . TYR A 1  662 ? 149.897 122.375 136.920 1.00 78.44  ? 926  TYR A CZ    1 
ATOM   4232  O  OH    . TYR A 1  662 ? 149.382 122.622 138.171 1.00 78.44  ? 926  TYR A OH    1 
ATOM   4233  N  N     . ARG A 1  663 ? 154.277 122.440 134.776 1.00 77.14  ? 927  ARG A N     1 
ATOM   4234  C  CA    . ARG A 1  663 ? 155.020 123.543 135.371 1.00 77.14  ? 927  ARG A CA    1 
ATOM   4235  C  C     . ARG A 1  663 ? 156.427 123.166 135.799 1.00 77.14  ? 927  ARG A C     1 
ATOM   4236  O  O     . ARG A 1  663 ? 157.353 123.958 135.616 1.00 77.14  ? 927  ARG A O     1 
ATOM   4237  C  CB    . ARG A 1  663 ? 154.260 124.104 136.582 1.00 77.14  ? 927  ARG A CB    1 
ATOM   4238  C  CG    . ARG A 1  663 ? 154.939 125.305 137.218 1.00 77.14  ? 927  ARG A CG    1 
ATOM   4239  C  CD    . ARG A 1  663 ? 154.108 125.901 138.336 1.00 77.14  ? 927  ARG A CD    1 
ATOM   4240  N  NE    . ARG A 1  663 ? 154.807 127.004 138.989 1.00 77.14  ? 927  ARG A NE    1 
ATOM   4241  C  CZ    . ARG A 1  663 ? 154.785 128.260 138.557 1.00 77.14  ? 927  ARG A CZ    1 
ATOM   4242  N  NH1   . ARG A 1  663 ? 154.100 128.576 137.466 1.00 77.14  ? 927  ARG A NH1   1 
ATOM   4243  N  NH2   . ARG A 1  663 ? 155.450 129.201 139.212 1.00 77.14  ? 927  ARG A NH2   1 
ATOM   4244  N  N     . TYR A 1  664 ? 156.620 121.974 136.359 1.00 76.52  ? 928  TYR A N     1 
ATOM   4245  C  CA    . TYR A 1  664 ? 157.905 121.575 136.928 1.00 76.52  ? 928  TYR A CA    1 
ATOM   4246  C  C     . TYR A 1  664 ? 158.664 120.614 136.024 1.00 76.52  ? 928  TYR A C     1 
ATOM   4247  O  O     . TYR A 1  664 ? 159.321 119.686 136.503 1.00 76.52  ? 928  TYR A O     1 
ATOM   4248  C  CB    . TYR A 1  664 ? 157.699 120.968 138.311 1.00 76.52  ? 928  TYR A CB    1 
ATOM   4249  C  CG    . TYR A 1  664 ? 157.215 121.970 139.334 1.00 76.52  ? 928  TYR A CG    1 
ATOM   4250  C  CD1   . TYR A 1  664 ? 158.099 122.850 139.940 1.00 76.52  ? 928  TYR A CD1   1 
ATOM   4251  C  CD2   . TYR A 1  664 ? 155.875 122.040 139.688 1.00 76.52  ? 928  TYR A CD2   1 
ATOM   4252  C  CE1   . TYR A 1  664 ? 157.665 123.770 140.872 1.00 76.52  ? 928  TYR A CE1   1 
ATOM   4253  C  CE2   . TYR A 1  664 ? 155.431 122.957 140.620 1.00 76.52  ? 928  TYR A CE2   1 
ATOM   4254  C  CZ    . TYR A 1  664 ? 156.331 123.820 141.209 1.00 76.52  ? 928  TYR A CZ    1 
ATOM   4255  O  OH    . TYR A 1  664 ? 155.899 124.736 142.138 1.00 76.52  ? 928  TYR A OH    1 
ATOM   4256  N  N     . GLU A 1  665 ? 158.593 120.814 134.712 1.00 82.71  ? 929  GLU A N     1 
ATOM   4257  C  CA    . GLU A 1  665 ? 159.344 120.002 133.763 1.00 82.71  ? 929  GLU A CA    1 
ATOM   4258  C  C     . GLU A 1  665 ? 160.616 120.742 133.367 1.00 82.71  ? 929  GLU A C     1 
ATOM   4259  O  O     . GLU A 1  665 ? 160.553 121.796 132.725 1.00 82.71  ? 929  GLU A O     1 
ATOM   4260  C  CB    . GLU A 1  665 ? 158.502 119.686 132.530 1.00 82.71  ? 929  GLU A CB    1 
ATOM   4261  C  CG    . GLU A 1  665 ? 159.193 118.781 131.526 1.00 82.71  ? 929  GLU A CG    1 
ATOM   4262  C  CD    . GLU A 1  665 ? 158.310 118.448 130.341 1.00 82.71  ? 929  GLU A CD    1 
ATOM   4263  O  OE1   . GLU A 1  665 ? 157.164 118.941 130.297 1.00 82.71  ? 929  GLU A OE1   1 
ATOM   4264  O  OE2   . GLU A 1  665 ? 158.763 117.696 129.453 1.00 82.71  ? 929  GLU A OE2   1 
ATOM   4265  N  N     . GLY A 1  666 ? 161.765 120.190 133.750 1.00 81.67  ? 930  GLY A N     1 
ATOM   4266  C  CA    . GLY A 1  666 ? 163.037 120.781 133.384 1.00 81.67  ? 930  GLY A CA    1 
ATOM   4267  C  C     . GLY A 1  666 ? 163.365 122.083 134.076 1.00 81.67  ? 930  GLY A C     1 
ATOM   4268  O  O     . GLY A 1  666 ? 164.259 122.803 133.624 1.00 81.67  ? 930  GLY A O     1 
ATOM   4269  N  N     . LYS A 1  667 ? 162.670 122.411 135.162 1.00 78.13  ? 931  LYS A N     1 
ATOM   4270  C  CA    . LYS A 1  667 ? 162.973 123.616 135.922 1.00 78.13  ? 931  LYS A CA    1 
ATOM   4271  C  C     . LYS A 1  667 ? 162.386 123.477 137.319 1.00 78.13  ? 931  LYS A C     1 
ATOM   4272  O  O     . LYS A 1  667 ? 161.420 122.741 137.538 1.00 78.13  ? 931  LYS A O     1 
ATOM   4273  C  CB    . LYS A 1  667 ? 162.439 124.877 135.231 1.00 78.13  ? 931  LYS A CB    1 
ATOM   4274  C  CG    . LYS A 1  667 ? 160.926 124.960 135.130 1.00 78.13  ? 931  LYS A CG    1 
ATOM   4275  C  CD    . LYS A 1  667 ? 160.506 126.223 134.392 1.00 78.13  ? 931  LYS A CD    1 
ATOM   4276  C  CE    . LYS A 1  667 ? 158.995 126.341 134.298 1.00 78.13  ? 931  LYS A CE    1 
ATOM   4277  N  NZ    . LYS A 1  667 ? 158.577 127.571 133.572 1.00 78.13  ? 931  LYS A NZ    1 
ATOM   4278  N  N     . ILE A 1  668 ? 162.989 124.201 138.262 1.00 75.93  ? 932  ILE A N     1 
ATOM   4279  C  CA    . ILE A 1  668 ? 162.615 124.124 139.669 1.00 75.93  ? 932  ILE A CA    1 
ATOM   4280  C  C     . ILE A 1  668 ? 163.102 125.401 140.337 1.00 75.93  ? 932  ILE A C     1 
ATOM   4281  O  O     . ILE A 1  668 ? 164.005 126.074 139.838 1.00 75.93  ? 932  ILE A O     1 
ATOM   4282  C  CB    . ILE A 1  668 ? 163.214 122.857 140.335 1.00 75.93  ? 932  ILE A CB    1 
ATOM   4283  C  CG1   . ILE A 1  668 ? 162.575 122.592 141.700 1.00 75.93  ? 932  ILE A CG1   1 
ATOM   4284  C  CG2   . ILE A 1  668 ? 164.723 122.982 140.465 1.00 75.93  ? 932  ILE A CG2   1 
ATOM   4285  C  CD1   . ILE A 1  668 ? 161.113 122.225 141.633 1.00 75.93  ? 932  ILE A CD1   1 
ATOM   4286  N  N     . THR A 1  669 ? 162.489 125.751 141.465 1.00 77.63  ? 933  THR A N     1 
ATOM   4287  C  CA    . THR A 1  669 ? 162.888 126.945 142.191 1.00 77.63  ? 933  THR A CA    1 
ATOM   4288  C  C     . THR A 1  669 ? 164.090 126.639 143.082 1.00 77.63  ? 933  THR A C     1 
ATOM   4289  O  O     . THR A 1  669 ? 164.761 125.613 142.943 1.00 77.63  ? 933  THR A O     1 
ATOM   4290  C  CB    . THR A 1  669 ? 161.732 127.481 143.029 1.00 77.63  ? 933  THR A CB    1 
ATOM   4291  O  OG1   . THR A 1  669 ? 161.512 126.608 144.138 1.00 77.63  ? 933  THR A OG1   1 
ATOM   4292  C  CG2   . THR A 1  669 ? 160.467 127.528 142.202 1.00 77.63  ? 933  THR A CG2   1 
ATOM   4293  N  N     . ASN A 1  670 ? 164.367 127.551 144.014 1.00 77.14  ? 934  ASN A N     1 
ATOM   4294  C  CA    . ASN A 1  670 ? 165.457 127.336 144.957 1.00 77.14  ? 934  ASN A CA    1 
ATOM   4295  C  C     . ASN A 1  670 ? 164.984 126.544 146.169 1.00 77.14  ? 934  ASN A C     1 
ATOM   4296  O  O     . ASN A 1  670 ? 165.620 125.561 146.575 1.00 77.14  ? 934  ASN A O     1 
ATOM   4297  C  CB    . ASN A 1  670 ? 166.035 128.681 145.396 1.00 77.14  ? 934  ASN A CB    1 
ATOM   4298  C  CG    . ASN A 1  670 ? 166.704 129.424 144.264 1.00 77.14  ? 934  ASN A CG    1 
ATOM   4299  O  OD1   . ASN A 1  670 ? 167.413 128.836 143.452 1.00 77.14  ? 934  ASN A OD1   1 
ATOM   4300  N  ND2   . ASN A 1  670 ? 166.476 130.729 144.201 1.00 77.14  ? 934  ASN A ND2   1 
ATOM   4301  N  N     . TYR A 1  671 ? 163.857 126.953 146.755 1.00 72.59  ? 935  TYR A N     1 
ATOM   4302  C  CA    . TYR A 1  671 ? 163.477 126.430 148.060 1.00 72.59  ? 935  TYR A CA    1 
ATOM   4303  C  C     . TYR A 1  671 ? 162.910 125.021 147.982 1.00 72.59  ? 935  TYR A C     1 
ATOM   4304  O  O     . TYR A 1  671 ? 163.068 124.252 148.934 1.00 72.59  ? 935  TYR A O     1 
ATOM   4305  C  CB    . TYR A 1  671 ? 162.490 127.373 148.742 1.00 72.59  ? 935  TYR A CB    1 
ATOM   4306  C  CG    . TYR A 1  671 ? 163.137 128.662 149.180 1.00 72.59  ? 935  TYR A CG    1 
ATOM   4307  C  CD1   . TYR A 1  671 ? 163.982 128.690 150.281 1.00 72.59  ? 935  TYR A CD1   1 
ATOM   4308  C  CD2   . TYR A 1  671 ? 162.899 129.848 148.505 1.00 72.59  ? 935  TYR A CD2   1 
ATOM   4309  C  CE1   . TYR A 1  671 ? 164.580 129.860 150.692 1.00 72.59  ? 935  TYR A CE1   1 
ATOM   4310  C  CE2   . TYR A 1  671 ? 163.491 131.026 148.913 1.00 72.59  ? 935  TYR A CE2   1 
ATOM   4311  C  CZ    . TYR A 1  671 ? 164.332 131.024 150.006 1.00 72.59  ? 935  TYR A CZ    1 
ATOM   4312  O  OH    . TYR A 1  671 ? 164.929 132.191 150.421 1.00 72.59  ? 935  TYR A OH    1 
ATOM   4313  N  N     . PHE A 1  672 ? 162.354 124.650 146.836 1.00 70.97  ? 936  PHE A N     1 
ATOM   4314  C  CA    . PHE A 1  672 ? 161.853 123.296 146.669 1.00 70.97  ? 936  PHE A CA    1 
ATOM   4315  C  C     . PHE A 1  672 ? 163.056 122.356 146.705 1.00 70.97  ? 936  PHE A C     1 
ATOM   4316  O  O     . PHE A 1  672 ? 163.021 121.316 147.357 1.00 70.97  ? 936  PHE A O     1 
ATOM   4317  C  CB    . PHE A 1  672 ? 161.078 123.154 145.364 1.00 70.97  ? 936  PHE A CB    1 
ATOM   4318  C  CG    . PHE A 1  672 ? 159.604 123.391 145.513 1.00 70.97  ? 936  PHE A CG    1 
ATOM   4319  C  CD1   . PHE A 1  672 ? 158.909 122.847 146.577 1.00 70.97  ? 936  PHE A CD1   1 
ATOM   4320  C  CD2   . PHE A 1  672 ? 158.916 124.162 144.595 1.00 70.97  ? 936  PHE A CD2   1 
ATOM   4321  C  CE1   . PHE A 1  672 ? 157.553 123.063 146.722 1.00 70.97  ? 936  PHE A CE1   1 
ATOM   4322  C  CE2   . PHE A 1  672 ? 157.560 124.382 144.733 1.00 70.97  ? 936  PHE A CE2   1 
ATOM   4323  C  CZ    . PHE A 1  672 ? 156.877 123.833 145.798 1.00 70.97  ? 936  PHE A CZ    1 
ATOM   4324  N  N     . HIS A 1  673 ? 164.121 122.730 146.003 1.00 71.02  ? 937  HIS A N     1 
ATOM   4325  C  CA    . HIS A 1  673 ? 165.350 121.946 145.992 1.00 71.02  ? 937  HIS A CA    1 
ATOM   4326  C  C     . HIS A 1  673 ? 165.971 121.888 147.381 1.00 71.02  ? 937  HIS A C     1 
ATOM   4327  O  O     . HIS A 1  673 ? 166.366 120.817 147.858 1.00 71.02  ? 937  HIS A O     1 
ATOM   4328  C  CB    . HIS A 1  673 ? 166.337 122.534 144.983 1.00 71.02  ? 937  HIS A CB    1 
ATOM   4329  C  CG    . HIS A 1  673 ? 167.631 121.787 144.904 1.00 71.02  ? 937  HIS A CG    1 
ATOM   4330  N  ND1   . HIS A 1  673 ? 167.745 120.560 144.289 1.00 71.02  ? 937  HIS A ND1   1 
ATOM   4331  C  CD2   . HIS A 1  673 ? 168.866 122.091 145.369 1.00 71.02  ? 937  HIS A CD2   1 
ATOM   4332  C  CE1   . HIS A 1  673 ? 168.994 120.140 144.375 1.00 71.02  ? 937  HIS A CE1   1 
ATOM   4333  N  NE2   . HIS A 1  673 ? 169.695 121.051 145.026 1.00 71.02  ? 937  HIS A NE2   1 
ATOM   4334  N  N     . LYS A 1  674 ? 166.048 123.035 148.039 1.00 72.11  ? 938  LYS A N     1 
ATOM   4335  C  CA    . LYS A 1  674 ? 166.629 123.094 149.368 1.00 72.11  ? 938  LYS A CA    1 
ATOM   4336  C  C     . LYS A 1  674 ? 165.872 122.220 150.359 1.00 72.11  ? 938  LYS A C     1 
ATOM   4337  O  O     . LYS A 1  674 ? 166.478 121.572 151.206 1.00 72.11  ? 938  LYS A O     1 
ATOM   4338  C  CB    . LYS A 1  674 ? 166.655 124.535 149.872 1.00 72.11  ? 938  LYS A CB    1 
ATOM   4339  C  CG    . LYS A 1  674 ? 167.859 125.336 149.411 1.00 72.11  ? 938  LYS A CG    1 
ATOM   4340  C  CD    . LYS A 1  674 ? 167.633 126.823 149.621 1.00 72.11  ? 938  LYS A CD    1 
ATOM   4341  C  CE    . LYS A 1  674 ? 168.925 127.605 149.467 1.00 72.11  ? 938  LYS A CE    1 
ATOM   4342  N  NZ    . LYS A 1  674 ? 169.187 128.470 150.649 1.00 72.11  ? 938  LYS A NZ    1 
ATOM   4343  N  N     . THR A 1  675 ? 164.550 122.189 150.239 1.00 71.18  ? 939  THR A N     1 
ATOM   4344  C  CA    . THR A 1  675 ? 163.722 121.426 151.164 1.00 71.18  ? 939  THR A CA    1 
ATOM   4345  C  C     . THR A 1  675 ? 163.799 119.933 150.874 1.00 71.18  ? 939  THR A C     1 
ATOM   4346  O  O     . THR A 1  675 ? 163.841 119.113 151.798 1.00 71.18  ? 939  THR A O     1 
ATOM   4347  C  CB    . THR A 1  675 ? 162.276 121.917 151.087 1.00 71.18  ? 939  THR A CB    1 
ATOM   4348  O  OG1   . THR A 1  675 ? 162.227 123.311 151.416 1.00 71.18  ? 939  THR A OG1   1 
ATOM   4349  C  CG2   . THR A 1  675 ? 161.391 121.146 152.053 1.00 71.18  ? 939  THR A CG2   1 
ATOM   4350  N  N     . LEU A 1  676 ? 163.825 119.557 149.595 1.00 72.53  ? 940  LEU A N     1 
ATOM   4351  C  CA    . LEU A 1  676 ? 163.776 118.144 149.249 1.00 72.53  ? 940  LEU A CA    1 
ATOM   4352  C  C     . LEU A 1  676 ? 165.149 117.486 149.268 1.00 72.53  ? 940  LEU A C     1 
ATOM   4353  O  O     . LEU A 1  676 ? 165.234 116.254 149.278 1.00 72.53  ? 940  LEU A O     1 
ATOM   4354  C  CB    . LEU A 1  676 ? 163.136 117.967 147.873 1.00 72.53  ? 940  LEU A CB    1 
ATOM   4355  C  CG    . LEU A 1  676 ? 161.661 118.352 147.788 1.00 72.53  ? 940  LEU A CG    1 
ATOM   4356  C  CD1   . LEU A 1  676 ? 161.162 118.252 146.357 1.00 72.53  ? 940  LEU A CD1   1 
ATOM   4357  C  CD2   . LEU A 1  676 ? 160.845 117.471 148.714 1.00 72.53  ? 940  LEU A CD2   1 
ATOM   4358  N  N     . ALA A 1  677 ? 166.226 118.269 149.276 1.00 71.42  ? 941  ALA A N     1 
ATOM   4359  C  CA    . ALA A 1  677 ? 167.555 117.691 149.130 1.00 71.42  ? 941  ALA A CA    1 
ATOM   4360  C  C     . ALA A 1  677 ? 168.446 117.848 150.354 1.00 71.42  ? 941  ALA A C     1 
ATOM   4361  O  O     . ALA A 1  677 ? 169.227 116.938 150.649 1.00 71.42  ? 941  ALA A O     1 
ATOM   4362  C  CB    . ALA A 1  677 ? 168.267 118.306 147.920 1.00 71.42  ? 941  ALA A CB    1 
ATOM   4363  N  N     . HIS A 1  678 ? 168.359 118.963 151.080 1.00 70.31  ? 942  HIS A N     1 
ATOM   4364  C  CA    . HIS A 1  678 ? 169.396 119.322 152.039 1.00 70.31  ? 942  HIS A CA    1 
ATOM   4365  C  C     . HIS A 1  678 ? 168.905 119.422 153.480 1.00 70.31  ? 942  HIS A C     1 
ATOM   4366  O  O     . HIS A 1  678 ? 169.690 119.791 154.358 1.00 70.31  ? 942  HIS A O     1 
ATOM   4367  C  CB    . HIS A 1  678 ? 170.048 120.643 151.625 1.00 70.31  ? 942  HIS A CB    1 
ATOM   4368  C  CG    . HIS A 1  678 ? 170.712 120.598 150.284 1.00 70.31  ? 942  HIS A CG    1 
ATOM   4369  N  ND1   . HIS A 1  678 ? 171.888 119.916 150.057 1.00 70.31  ? 942  HIS A ND1   1 
ATOM   4370  C  CD2   . HIS A 1  678 ? 170.372 121.162 149.101 1.00 70.31  ? 942  HIS A CD2   1 
ATOM   4371  C  CE1   . HIS A 1  678 ? 172.240 120.057 148.791 1.00 70.31  ? 942  HIS A CE1   1 
ATOM   4372  N  NE2   . HIS A 1  678 ? 171.336 120.809 148.189 1.00 70.31  ? 942  HIS A NE2   1 
ATOM   4373  N  N     . VAL A 1  679 ? 167.647 119.097 153.758 1.00 68.86  ? 943  VAL A N     1 
ATOM   4374  C  CA    . VAL A 1  679 ? 167.115 119.258 155.114 1.00 68.86  ? 943  VAL A CA    1 
ATOM   4375  C  C     . VAL A 1  679 ? 167.631 118.182 156.069 1.00 68.86  ? 943  VAL A C     1 
ATOM   4376  O  O     . VAL A 1  679 ? 168.102 118.530 157.163 1.00 68.86  ? 943  VAL A O     1 
ATOM   4377  C  CB    . VAL A 1  679 ? 165.578 119.297 155.110 1.00 68.86  ? 943  VAL A CB    1 
ATOM   4378  C  CG1   . VAL A 1  679 ? 165.048 119.261 156.532 1.00 68.86  ? 943  VAL A CG1   1 
ATOM   4379  C  CG2   . VAL A 1  679 ? 165.093 120.550 154.411 1.00 68.86  ? 943  VAL A CG2   1 
ATOM   4380  N  N     . PRO A 1  680 ? 167.564 116.882 155.736 1.00 68.49  ? 944  PRO A N     1 
ATOM   4381  C  CA    . PRO A 1  680 ? 168.025 115.871 156.707 1.00 68.49  ? 944  PRO A CA    1 
ATOM   4382  C  C     . PRO A 1  680 ? 169.478 116.037 157.116 1.00 68.49  ? 944  PRO A C     1 
ATOM   4383  O  O     . PRO A 1  680 ? 169.823 115.797 158.281 1.00 68.49  ? 944  PRO A O     1 
ATOM   4384  C  CB    . PRO A 1  680 ? 167.796 114.546 155.967 1.00 68.49  ? 944  PRO A CB    1 
ATOM   4385  C  CG    . PRO A 1  680 ? 166.750 114.846 154.969 1.00 68.49  ? 944  PRO A CG    1 
ATOM   4386  C  CD    . PRO A 1  680 ? 167.021 116.243 154.523 1.00 68.49  ? 944  PRO A CD    1 
ATOM   4387  N  N     . GLU A 1  681 ? 170.342 116.453 156.189 1.00 72.40  ? 945  GLU A N     1 
ATOM   4388  C  CA    . GLU A 1  681 ? 171.751 116.614 156.527 1.00 72.40  ? 945  GLU A CA    1 
ATOM   4389  C  C     . GLU A 1  681 ? 171.958 117.793 157.470 1.00 72.40  ? 945  GLU A C     1 
ATOM   4390  O  O     . GLU A 1  681 ? 172.746 117.703 158.418 1.00 72.40  ? 945  GLU A O     1 
ATOM   4391  C  CB    . GLU A 1  681 ? 172.583 116.775 155.255 1.00 72.40  ? 945  GLU A CB    1 
ATOM   4392  C  CG    . GLU A 1  681 ? 174.084 116.737 155.495 1.00 72.40  ? 945  GLU A CG    1 
ATOM   4393  C  CD    . GLU A 1  681 ? 174.883 116.810 154.209 1.00 72.40  ? 945  GLU A CD    1 
ATOM   4394  O  OE1   . GLU A 1  681 ? 174.268 116.943 153.131 1.00 72.40  ? 945  GLU A OE1   1 
ATOM   4395  O  OE2   . GLU A 1  681 ? 176.128 116.726 154.276 1.00 72.40  ? 945  GLU A OE2   1 
ATOM   4396  N  N     . ILE A 1  682 ? 171.247 118.900 157.242 1.00 69.64  ? 946  ILE A N     1 
ATOM   4397  C  CA    . ILE A 1  682 ? 171.346 120.033 158.159 1.00 69.64  ? 946  ILE A CA    1 
ATOM   4398  C  C     . ILE A 1  682 ? 170.803 119.653 159.530 1.00 69.64  ? 946  ILE A C     1 
ATOM   4399  O  O     . ILE A 1  682 ? 171.327 120.085 160.564 1.00 69.64  ? 946  ILE A O     1 
ATOM   4400  C  CB    . ILE A 1  682 ? 170.619 121.263 157.586 1.00 69.64  ? 946  ILE A CB    1 
ATOM   4401  C  CG1   . ILE A 1  682 ? 171.265 121.711 156.278 1.00 69.64  ? 946  ILE A CG1   1 
ATOM   4402  C  CG2   . ILE A 1  682 ? 170.655 122.413 158.577 1.00 69.64  ? 946  ILE A CG2   1 
ATOM   4403  C  CD1   . ILE A 1  682 ? 170.457 122.754 155.544 1.00 69.64  ? 946  ILE A CD1   1 
ATOM   4404  N  N     . ILE A 1  683 ? 169.749 118.836 159.564 1.00 71.82  ? 947  ILE A N     1 
ATOM   4405  C  CA    . ILE A 1  683 ? 169.203 118.393 160.844 1.00 71.82  ? 947  ILE A CA    1 
ATOM   4406  C  C     . ILE A 1  683 ? 170.222 117.545 161.595 1.00 71.82  ? 947  ILE A C     1 
ATOM   4407  O  O     . ILE A 1  683 ? 170.497 117.779 162.777 1.00 71.82  ? 947  ILE A O     1 
ATOM   4408  C  CB    . ILE A 1  683 ? 167.883 117.630 160.639 1.00 71.82  ? 947  ILE A CB    1 
ATOM   4409  C  CG1   . ILE A 1  683 ? 166.814 118.553 160.055 1.00 71.82  ? 947  ILE A CG1   1 
ATOM   4410  C  CG2   . ILE A 1  683 ? 167.415 117.035 161.952 1.00 71.82  ? 947  ILE A CG2   1 
ATOM   4411  C  CD1   . ILE A 1  683 ? 166.465 119.708 160.954 1.00 71.82  ? 947  ILE A CD1   1 
ATOM   4412  N  N     . GLU A 1  684 ? 170.798 116.547 160.924 1.00 75.08  ? 948  GLU A N     1 
ATOM   4413  C  CA    . GLU A 1  684 ? 171.762 115.682 161.595 1.00 75.08  ? 948  GLU A CA    1 
ATOM   4414  C  C     . GLU A 1  684 ? 173.059 116.411 161.924 1.00 75.08  ? 948  GLU A C     1 
ATOM   4415  O  O     . GLU A 1  684 ? 173.807 115.956 162.795 1.00 75.08  ? 948  GLU A O     1 
ATOM   4416  C  CB    . GLU A 1  684 ? 172.054 114.444 160.744 1.00 75.08  ? 948  GLU A CB    1 
ATOM   4417  C  CG    . GLU A 1  684 ? 172.792 114.728 159.452 1.00 75.08  ? 948  GLU A CG    1 
ATOM   4418  C  CD    . GLU A 1  684 ? 173.001 113.482 158.615 1.00 75.08  ? 948  GLU A CD    1 
ATOM   4419  O  OE1   . GLU A 1  684 ? 172.549 112.398 159.039 1.00 75.08  ? 948  GLU A OE1   1 
ATOM   4420  O  OE2   . GLU A 1  684 ? 173.616 113.586 157.533 1.00 75.08  ? 948  GLU A OE2   1 
ATOM   4421  N  N     . ARG A 1  685 ? 173.302 117.550 161.291 1.00 73.88  ? 949  ARG A N     1 
ATOM   4422  C  CA    . ARG A 1  685 ? 174.522 118.301 161.559 1.00 73.88  ? 949  ARG A CA    1 
ATOM   4423  C  C     . ARG A 1  685 ? 174.374 119.300 162.705 1.00 73.88  ? 949  ARG A C     1 
ATOM   4424  O  O     . ARG A 1  685 ? 175.180 119.313 163.631 1.00 73.88  ? 949  ARG A O     1 
ATOM   4425  C  CB    . ARG A 1  685 ? 174.992 119.034 160.304 1.00 73.88  ? 949  ARG A CB    1 
ATOM   4426  C  CG    . ARG A 1  685 ? 175.737 120.325 160.603 1.00 73.88  ? 949  ARG A CG    1 
ATOM   4427  C  CD    . ARG A 1  685 ? 176.037 121.101 159.334 1.00 73.88  ? 949  ARG A CD    1 
ATOM   4428  N  NE    . ARG A 1  685 ? 175.429 122.427 159.354 1.00 73.88  ? 949  ARG A NE    1 
ATOM   4429  C  CZ    . ARG A 1  685 ? 175.233 123.172 158.273 1.00 73.88  ? 949  ARG A CZ    1 
ATOM   4430  N  NH1   . ARG A 1  685 ? 175.599 122.722 157.082 1.00 73.88  ? 949  ARG A NH1   1 
ATOM   4431  N  NH2   . ARG A 1  685 ? 174.671 124.366 158.381 1.00 73.88  ? 949  ARG A NH2   1 
ATOM   4432  N  N     . ASP A 1  686 ? 173.339 120.130 162.637 1.00 76.02  ? 950  ASP A N     1 
ATOM   4433  C  CA    . ASP A 1  686 ? 173.108 121.155 163.645 1.00 76.02  ? 950  ASP A CA    1 
ATOM   4434  C  C     . ASP A 1  686 ? 172.129 120.736 164.732 1.00 76.02  ? 950  ASP A C     1 
ATOM   4435  O  O     . ASP A 1  686 ? 172.307 121.136 165.887 1.00 76.02  ? 950  ASP A O     1 
ATOM   4436  C  CB    . ASP A 1  686 ? 172.591 122.437 162.983 1.00 76.02  ? 950  ASP A CB    1 
ATOM   4437  C  CG    . ASP A 1  686 ? 173.634 123.100 162.112 1.00 76.02  ? 950  ASP A CG    1 
ATOM   4438  O  OD1   . ASP A 1  686 ? 174.837 122.948 162.408 1.00 76.02  ? 950  ASP A OD1   1 
ATOM   4439  O  OD2   . ASP A 1  686 ? 173.254 123.777 161.134 1.00 76.02  ? 950  ASP A OD2   1 
ATOM   4440  N  N     . GLY A 1  687 ? 171.107 119.951 164.397 1.00 76.68  ? 951  GLY A N     1 
ATOM   4441  C  CA    . GLY A 1  687 ? 170.128 119.511 165.360 1.00 76.68  ? 951  GLY A CA    1 
ATOM   4442  C  C     . GLY A 1  687 ? 168.777 120.189 165.267 1.00 76.68  ? 951  GLY A C     1 
ATOM   4443  O  O     . GLY A 1  687 ? 167.781 119.609 165.714 1.00 76.68  ? 951  GLY A O     1 
ATOM   4444  N  N     . SER A 1  688 ? 168.707 121.394 164.703 1.00 74.94  ? 952  SER A N     1 
ATOM   4445  C  CA    . SER A 1  688 ? 167.445 122.120 164.647 1.00 74.94  ? 952  SER A CA    1 
ATOM   4446  C  C     . SER A 1  688 ? 167.518 123.210 163.590 1.00 74.94  ? 952  SER A C     1 
ATOM   4447  O  O     . SER A 1  688 ? 168.443 124.028 163.603 1.00 74.94  ? 952  SER A O     1 
ATOM   4448  C  CB    . SER A 1  688 ? 167.105 122.732 166.009 1.00 74.94  ? 952  SER A CB    1 
ATOM   4449  O  OG    . SER A 1  688 ? 165.907 123.485 165.943 1.00 74.94  ? 952  SER A OG    1 
ATOM   4450  N  N     . ILE A 1  689 ? 166.543 123.217 162.682 1.00 72.35  ? 953  ILE A N     1 
ATOM   4451  C  CA    . ILE A 1  689 ? 166.341 124.327 161.757 1.00 72.35  ? 953  ILE A CA    1 
ATOM   4452  C  C     . ILE A 1  689 ? 165.172 125.151 162.279 1.00 72.35  ? 953  ILE A C     1 
ATOM   4453  O  O     . ILE A 1  689 ? 164.220 124.603 162.845 1.00 72.35  ? 953  ILE A O     1 
ATOM   4454  C  CB    . ILE A 1  689 ? 166.083 123.832 160.320 1.00 72.35  ? 953  ILE A CB    1 
ATOM   4455  C  CG1   . ILE A 1  689 ? 167.291 123.065 159.789 1.00 72.35  ? 953  ILE A CG1   1 
ATOM   4456  C  CG2   . ILE A 1  689 ? 165.768 124.992 159.388 1.00 72.35  ? 953  ILE A CG2   1 
ATOM   4457  C  CD1   . ILE A 1  689 ? 167.023 122.354 158.482 1.00 72.35  ? 953  ILE A CD1   1 
ATOM   4458  N  N     . GLY A 1  690 ? 165.232 126.467 162.098 1.00 71.57  ? 954  GLY A N     1 
ATOM   4459  C  CA    . GLY A 1  690 ? 164.177 127.333 162.581 1.00 71.57  ? 954  GLY A CA    1 
ATOM   4460  C  C     . GLY A 1  690 ? 164.612 128.143 163.783 1.00 71.57  ? 954  GLY A C     1 
ATOM   4461  O  O     . GLY A 1  690 ? 164.262 129.320 163.909 1.00 71.57  ? 954  GLY A O     1 
ATOM   4462  N  N     . ALA A 1  691 ? 165.375 127.515 164.680 1.00 72.16  ? 955  ALA A N     1 
ATOM   4463  C  CA    . ALA A 1  691 ? 165.964 128.256 165.788 1.00 72.16  ? 955  ALA A CA    1 
ATOM   4464  C  C     . ALA A 1  691 ? 167.025 129.229 165.296 1.00 72.16  ? 955  ALA A C     1 
ATOM   4465  O  O     . ALA A 1  691 ? 167.315 130.226 165.966 1.00 72.16  ? 955  ALA A O     1 
ATOM   4466  C  CB    . ALA A 1  691 ? 166.558 127.290 166.813 1.00 72.16  ? 955  ALA A CB    1 
ATOM   4467  N  N     . TRP A 1  692 ? 167.609 128.957 164.128 1.00 71.20  ? 956  TRP A N     1 
ATOM   4468  C  CA    . TRP A 1  692 ? 168.621 129.810 163.520 1.00 71.20  ? 956  TRP A CA    1 
ATOM   4469  C  C     . TRP A 1  692 ? 168.045 130.687 162.413 1.00 71.20  ? 956  TRP A C     1 
ATOM   4470  O  O     . TRP A 1  692 ? 168.774 131.101 161.506 1.00 71.20  ? 956  TRP A O     1 
ATOM   4471  C  CB    . TRP A 1  692 ? 169.765 128.955 162.978 1.00 71.20  ? 956  TRP A CB    1 
ATOM   4472  C  CG    . TRP A 1  692 ? 170.527 128.231 164.041 1.00 71.20  ? 956  TRP A CG    1 
ATOM   4473  C  CD1   . TRP A 1  692 ? 170.323 126.952 164.466 1.00 71.20  ? 956  TRP A CD1   1 
ATOM   4474  C  CD2   . TRP A 1  692 ? 171.624 128.739 164.808 1.00 71.20  ? 956  TRP A CD2   1 
ATOM   4475  N  NE1   . TRP A 1  692 ? 171.220 126.633 165.456 1.00 71.20  ? 956  TRP A NE1   1 
ATOM   4476  C  CE2   . TRP A 1  692 ? 172.031 127.713 165.683 1.00 71.20  ? 956  TRP A CE2   1 
ATOM   4477  C  CE3   . TRP A 1  692 ? 172.300 129.961 164.841 1.00 71.20  ? 956  TRP A CE3   1 
ATOM   4478  C  CZ2   . TRP A 1  692 ? 173.082 127.873 166.580 1.00 71.20  ? 956  TRP A CZ2   1 
ATOM   4479  C  CZ3   . TRP A 1  692 ? 173.343 130.116 165.732 1.00 71.20  ? 956  TRP A CZ3   1 
ATOM   4480  C  CH2   . TRP A 1  692 ? 173.723 129.080 166.590 1.00 71.20  ? 956  TRP A CH2   1 
ATOM   4481  N  N     . ALA A 1  693 ? 166.747 130.975 162.468 1.00 70.72  ? 957  ALA A N     1 
ATOM   4482  C  CA    . ALA A 1  693 ? 166.088 131.739 161.422 1.00 70.72  ? 957  ALA A CA    1 
ATOM   4483  C  C     . ALA A 1  693 ? 166.444 133.221 161.524 1.00 70.72  ? 957  ALA A C     1 
ATOM   4484  O  O     . ALA A 1  693 ? 166.979 133.699 162.528 1.00 70.72  ? 957  ALA A O     1 
ATOM   4485  C  CB    . ALA A 1  693 ? 164.574 131.551 161.494 1.00 70.72  ? 957  ALA A CB    1 
ATOM   4486  N  N     . SER A 1  694 ? 166.131 133.954 160.456 1.00 75.00  ? 958  SER A N     1 
ATOM   4487  C  CA    . SER A 1  694 ? 166.378 135.386 160.374 1.00 75.00  ? 958  SER A CA    1 
ATOM   4488  C  C     . SER A 1  694 ? 165.155 136.205 160.762 1.00 75.00  ? 958  SER A C     1 
ATOM   4489  O  O     . SER A 1  694 ? 165.019 137.353 160.325 1.00 75.00  ? 958  SER A O     1 
ATOM   4490  C  CB    . SER A 1  694 ? 166.835 135.762 158.964 1.00 75.00  ? 958  SER A CB    1 
ATOM   4491  O  OG    . SER A 1  694 ? 165.797 135.557 158.022 1.00 75.00  ? 958  SER A OG    1 
ATOM   4492  N  N     . GLU A 1  695 ? 164.258 135.601 161.534 1.00 77.25  ? 959  GLU A N     1 
ATOM   4493  C  CA    . GLU A 1  695 ? 163.025 136.261 161.948 1.00 77.25  ? 959  GLU A CA    1 
ATOM   4494  C  C     . GLU A 1  695 ? 163.241 137.319 163.022 1.00 77.25  ? 959  GLU A C     1 
ATOM   4495  O  O     . GLU A 1  695 ? 162.546 138.334 163.049 1.00 77.25  ? 959  GLU A O     1 
ATOM   4496  C  CB    . GLU A 1  695 ? 162.006 135.227 162.434 1.00 77.25  ? 959  GLU A CB    1 
ATOM   4497  C  CG    . GLU A 1  695 ? 160.624 135.798 162.707 1.00 77.25  ? 959  GLU A CG    1 
ATOM   4498  C  CD    . GLU A 1  695 ? 159.513 134.924 162.159 1.00 77.25  ? 959  GLU A CD    1 
ATOM   4499  O  OE1   . GLU A 1  695 ? 159.542 133.699 162.405 1.00 77.25  ? 959  GLU A OE1   1 
ATOM   4500  O  OE2   . GLU A 1  695 ? 158.611 135.461 161.482 1.00 77.25  ? 959  GLU A OE2   1 
ATOM   4501  N  N     . GLY A 1  696 ? 164.203 137.083 163.907 1.00 72.36  ? 960  GLY A N     1 
ATOM   4502  C  CA    . GLY A 1  696 ? 164.471 138.031 164.977 1.00 72.36  ? 960  GLY A CA    1 
ATOM   4503  C  C     . GLY A 1  696 ? 164.903 139.389 164.458 1.00 72.36  ? 960  GLY A C     1 
ATOM   4504  O  O     . GLY A 1  696 ? 164.490 140.425 164.983 1.00 72.36  ? 960  GLY A O     1 
ATOM   4505  N  N     . ASN A 1  697 ? 165.733 139.403 163.413 1.00 76.67  ? 961  ASN A N     1 
ATOM   4506  C  CA    . ASN A 1  697 ? 166.135 140.667 162.805 1.00 76.67  ? 961  ASN A CA    1 
ATOM   4507  C  C     . ASN A 1  697 ? 164.936 141.387 162.198 1.00 76.67  ? 961  ASN A C     1 
ATOM   4508  O  O     . ASN A 1  697 ? 164.825 142.617 162.285 1.00 76.67  ? 961  ASN A O     1 
ATOM   4509  C  CB    . ASN A 1  697 ? 167.211 140.415 161.746 1.00 76.67  ? 961  ASN A CB    1 
ATOM   4510  C  CG    . ASN A 1  697 ? 167.885 141.692 161.276 1.00 76.67  ? 961  ASN A CG    1 
ATOM   4511  O  OD1   . ASN A 1  697 ? 167.569 142.787 161.739 1.00 76.67  ? 961  ASN A OD1   1 
ATOM   4512  N  ND2   . ASN A 1  697 ? 168.821 141.554 160.344 1.00 76.67  ? 961  ASN A ND2   1 
ATOM   4513  N  N     . GLN A 1  698 ? 164.015 140.635 161.593 1.00 74.27  ? 962  GLN A N     1 
ATOM   4514  C  CA    . GLN A 1  698 ? 162.824 141.261 161.031 1.00 74.27  ? 962  GLN A CA    1 
ATOM   4515  C  C     . GLN A 1  698 ? 161.945 141.847 162.127 1.00 74.27  ? 962  GLN A C     1 
ATOM   4516  O  O     . GLN A 1  698 ? 161.428 142.961 161.988 1.00 74.27  ? 962  GLN A O     1 
ATOM   4517  C  CB    . GLN A 1  698 ? 162.042 140.254 160.191 1.00 74.27  ? 962  GLN A CB    1 
ATOM   4518  C  CG    . GLN A 1  698 ? 162.811 139.757 158.986 1.00 74.27  ? 962  GLN A CG    1 
ATOM   4519  C  CD    . GLN A 1  698 ? 163.287 140.891 158.103 1.00 74.27  ? 962  GLN A CD    1 
ATOM   4520  O  OE1   . GLN A 1  698 ? 164.486 141.144 157.994 1.00 74.27  ? 962  GLN A OE1   1 
ATOM   4521  N  NE2   . GLN A 1  698 ? 162.349 141.598 157.488 1.00 74.27  ? 962  GLN A NE2   1 
ATOM   4522  N  N     . SER A 1  699 ? 161.771 141.116 163.230 1.00 71.56  ? 963  SER A N     1 
ATOM   4523  C  CA    . SER A 1  699 ? 161.018 141.662 164.355 1.00 71.56  ? 963  SER A CA    1 
ATOM   4524  C  C     . SER A 1  699 ? 161.700 142.903 164.918 1.00 71.56  ? 963  SER A C     1 
ATOM   4525  O  O     . SER A 1  699 ? 161.029 143.842 165.363 1.00 71.56  ? 963  SER A O     1 
ATOM   4526  C  CB    . SER A 1  699 ? 160.850 140.598 165.439 1.00 71.56  ? 963  SER A CB    1 
ATOM   4527  O  OG    . SER A 1  699 ? 160.078 139.509 164.966 1.00 71.56  ? 963  SER A OG    1 
ATOM   4528  N  N     . GLY A 1  700 ? 163.034 142.927 164.900 1.00 71.73  ? 964  GLY A N     1 
ATOM   4529  C  CA    . GLY A 1  700 ? 163.752 144.088 165.395 1.00 71.73  ? 964  GLY A CA    1 
ATOM   4530  C  C     . GLY A 1  700 ? 163.696 145.275 164.456 1.00 71.73  ? 964  GLY A C     1 
ATOM   4531  O  O     . GLY A 1  700 ? 163.932 146.411 164.873 1.00 71.73  ? 964  GLY A O     1 
ATOM   4532  N  N     . ASN A 1  701 ? 163.417 145.032 163.173 1.00 71.11  ? 965  ASN A N     1 
ATOM   4533  C  CA    . ASN A 1  701 ? 163.237 146.144 162.240 1.00 71.11  ? 965  ASN A CA    1 
ATOM   4534  C  C     . ASN A 1  701 ? 162.080 147.044 162.666 1.00 71.11  ? 965  ASN A C     1 
ATOM   4535  O  O     . ASN A 1  701 ? 162.158 148.274 162.543 1.00 71.11  ? 965  ASN A O     1 
ATOM   4536  C  CB    . ASN A 1  701 ? 163.005 145.616 160.825 1.00 71.11  ? 965  ASN A CB    1 
ATOM   4537  C  CG    . ASN A 1  701 ? 164.255 145.025 160.212 1.00 71.11  ? 965  ASN A CG    1 
ATOM   4538  O  OD1   . ASN A 1  701 ? 165.349 145.562 160.369 1.00 71.11  ? 965  ASN A OD1   1 
ATOM   4539  N  ND2   . ASN A 1  701 ? 164.098 143.918 159.497 1.00 71.11  ? 965  ASN A ND2   1 
ATOM   4540  N  N     . LYS A 1  702 ? 161.038 146.419 163.202 1.00 65.83  ? 966  LYS A N     1 
ATOM   4541  C  CA    . LYS A 1  702 ? 159.872 147.131 163.691 1.00 65.83  ? 966  LYS A CA    1 
ATOM   4542  C  C     . LYS A 1  702 ? 160.321 148.068 164.800 1.00 65.83  ? 966  LYS A C     1 
ATOM   4543  O  O     . LYS A 1  702 ? 160.032 149.262 164.778 1.00 65.83  ? 966  LYS A O     1 
ATOM   4544  C  CB    . LYS A 1  702 ? 158.850 146.137 164.235 1.00 65.83  ? 966  LYS A CB    1 
ATOM   4545  C  CG    . LYS A 1  702 ? 157.479 146.726 164.515 1.00 65.83  ? 966  LYS A CG    1 
ATOM   4546  C  CD    . LYS A 1  702 ? 156.415 145.640 164.525 1.00 65.83  ? 966  LYS A CD    1 
ATOM   4547  C  CE    . LYS A 1  702 ? 155.498 145.771 165.729 1.00 65.83  ? 966  LYS A CE    1 
ATOM   4548  N  NZ    . LYS A 1  702 ? 154.275 144.936 165.583 1.00 65.83  ? 966  LYS A NZ    1 
ATOM   4549  N  N     . LEU A 1  703 ? 161.038 147.512 165.770 1.00 66.30  ? 967  LEU A N     1 
ATOM   4550  C  CA    . LEU A 1  703 ? 161.550 148.281 166.898 1.00 66.30  ? 967  LEU A CA    1 
ATOM   4551  C  C     . LEU A 1  703 ? 162.451 149.411 166.426 1.00 66.30  ? 967  LEU A C     1 
ATOM   4552  O  O     . LEU A 1  703 ? 162.416 150.511 166.981 1.00 66.30  ? 967  LEU A O     1 
ATOM   4553  C  CB    . LEU A 1  703 ? 162.305 147.365 167.859 1.00 66.30  ? 967  LEU A CB    1 
ATOM   4554  C  CG    . LEU A 1  703 ? 161.480 146.306 168.587 1.00 66.30  ? 967  LEU A CG    1 
ATOM   4555  C  CD1   . LEU A 1  703 ? 162.390 145.395 169.391 1.00 66.30  ? 967  LEU A CD1   1 
ATOM   4556  C  CD2   . LEU A 1  703 ? 160.440 146.959 169.480 1.00 66.30  ? 967  LEU A CD2   1 
ATOM   4557  N  N     . PHE A 1  704 ? 163.229 149.149 165.384 1.00 67.07  ? 968  PHE A N     1 
ATOM   4558  C  CA    . PHE A 1  704 ? 164.107 150.168 164.839 1.00 67.07  ? 968  PHE A CA    1 
ATOM   4559  C  C     . PHE A 1  704 ? 163.269 151.341 164.357 1.00 67.07  ? 968  PHE A C     1 
ATOM   4560  O  O     . PHE A 1  704 ? 163.498 152.483 164.747 1.00 67.07  ? 968  PHE A O     1 
ATOM   4561  C  CB    . PHE A 1  704 ? 164.930 149.614 163.680 1.00 67.07  ? 968  PHE A CB    1 
ATOM   4562  C  CG    . PHE A 1  704 ? 165.547 150.677 162.818 1.00 67.07  ? 968  PHE A CG    1 
ATOM   4563  C  CD1   . PHE A 1  704 ? 166.900 150.951 162.898 1.00 67.07  ? 968  PHE A CD1   1 
ATOM   4564  C  CD2   . PHE A 1  704 ? 164.774 151.405 161.933 1.00 67.07  ? 968  PHE A CD2   1 
ATOM   4565  C  CE1   . PHE A 1  704 ? 167.471 151.929 162.109 1.00 67.07  ? 968  PHE A CE1   1 
ATOM   4566  C  CE2   . PHE A 1  704 ? 165.339 152.385 161.141 1.00 67.07  ? 968  PHE A CE2   1 
ATOM   4567  C  CZ    . PHE A 1  704 ? 166.690 152.648 161.229 1.00 67.07  ? 968  PHE A CZ    1 
ATOM   4568  N  N     . ARG A 1  705 ? 162.289 151.052 163.510 1.00 65.59  ? 969  ARG A N     1 
ATOM   4569  C  CA    . ARG A 1  705 ? 161.424 152.097 162.970 1.00 65.59  ? 969  ARG A CA    1 
ATOM   4570  C  C     . ARG A 1  705 ? 160.773 152.900 164.089 1.00 65.59  ? 969  ARG A C     1 
ATOM   4571  O  O     . ARG A 1  705 ? 160.790 154.138 164.076 1.00 65.59  ? 969  ARG A O     1 
ATOM   4572  C  CB    . ARG A 1  705 ? 160.355 151.484 162.065 1.00 65.59  ? 969  ARG A CB    1 
ATOM   4573  C  CG    . ARG A 1  705 ? 160.883 150.880 160.778 1.00 65.59  ? 969  ARG A CG    1 
ATOM   4574  C  CD    . ARG A 1  705 ? 159.748 150.348 159.916 1.00 65.59  ? 969  ARG A CD    1 
ATOM   4575  N  NE    . ARG A 1  705 ? 160.237 149.678 158.714 1.00 65.59  ? 969  ARG A NE    1 
ATOM   4576  C  CZ    . ARG A 1  705 ? 160.485 150.293 157.563 1.00 65.59  ? 969  ARG A CZ    1 
ATOM   4577  N  NH1   . ARG A 1  705 ? 160.292 151.600 157.451 1.00 65.59  ? 969  ARG A NH1   1 
ATOM   4578  N  NH2   . ARG A 1  705 ? 160.927 149.602 156.522 1.00 65.59  ? 969  ARG A NH2   1 
ATOM   4579  N  N     . ARG A 1  706 ? 160.202 152.207 165.077 1.00 64.55  ? 970  ARG A N     1 
ATOM   4580  C  CA    . ARG A 1  706 ? 159.481 152.900 166.139 1.00 64.55  ? 970  ARG A CA    1 
ATOM   4581  C  C     . ARG A 1  706 ? 160.426 153.734 166.997 1.00 64.55  ? 970  ARG A C     1 
ATOM   4582  O  O     . ARG A 1  706 ? 160.080 154.841 167.426 1.00 64.55  ? 970  ARG A O     1 
ATOM   4583  C  CB    . ARG A 1  706 ? 158.712 151.893 166.993 1.00 64.55  ? 970  ARG A CB    1 
ATOM   4584  C  CG    . ARG A 1  706 ? 157.874 152.530 168.087 1.00 64.55  ? 970  ARG A CG    1 
ATOM   4585  C  CD    . ARG A 1  706 ? 156.978 151.510 168.768 1.00 64.55  ? 970  ARG A CD    1 
ATOM   4586  N  NE    . ARG A 1  706 ? 156.231 152.101 169.873 1.00 64.55  ? 970  ARG A NE    1 
ATOM   4587  C  CZ    . ARG A 1  706 ? 155.287 151.467 170.561 1.00 64.55  ? 970  ARG A CZ    1 
ATOM   4588  N  NH1   . ARG A 1  706 ? 154.956 150.223 170.245 1.00 64.55  ? 970  ARG A NH1   1 
ATOM   4589  N  NH2   . ARG A 1  706 ? 154.663 152.083 171.555 1.00 64.55  ? 970  ARG A NH2   1 
ATOM   4590  N  N     . PHE A 1  707 ? 161.635 153.226 167.245 1.00 66.10  ? 971  PHE A N     1 
ATOM   4591  C  CA    . PHE A 1  707 ? 162.592 153.954 168.070 1.00 66.10  ? 971  PHE A CA    1 
ATOM   4592  C  C     . PHE A 1  707 ? 163.086 155.201 167.354 1.00 66.10  ? 971  PHE A C     1 
ATOM   4593  O  O     . PHE A 1  707 ? 163.256 156.258 167.971 1.00 66.10  ? 971  PHE A O     1 
ATOM   4594  C  CB    . PHE A 1  707 ? 163.765 153.046 168.443 1.00 66.10  ? 971  PHE A CB    1 
ATOM   4595  C  CG    . PHE A 1  707 ? 163.399 151.939 169.390 1.00 66.10  ? 971  PHE A CG    1 
ATOM   4596  C  CD1   . PHE A 1  707 ? 162.209 151.977 170.095 1.00 66.10  ? 971  PHE A CD1   1 
ATOM   4597  C  CD2   . PHE A 1  707 ? 164.243 150.856 169.567 1.00 66.10  ? 971  PHE A CD2   1 
ATOM   4598  C  CE1   . PHE A 1  707 ? 161.870 150.959 170.963 1.00 66.10  ? 971  PHE A CE1   1 
ATOM   4599  C  CE2   . PHE A 1  707 ? 163.908 149.835 170.433 1.00 66.10  ? 971  PHE A CE2   1 
ATOM   4600  C  CZ    . PHE A 1  707 ? 162.720 149.887 171.132 1.00 66.10  ? 971  PHE A CZ    1 
ATOM   4601  N  N     . ARG A 1  708 ? 163.262 155.087 166.042 1.00 66.09  ? 972  ARG A N     1 
ATOM   4602  C  CA    . ARG A 1  708 ? 163.712 156.207 165.227 1.00 66.09  ? 972  ARG A CA    1 
ATOM   4603  C  C     . ARG A 1  708 ? 162.623 157.273 165.108 1.00 66.09  ? 972  ARG A C     1 
ATOM   4604  O  O     . ARG A 1  708 ? 162.922 158.464 165.031 1.00 66.09  ? 972  ARG A O     1 
ATOM   4605  C  CB    . ARG A 1  708 ? 164.129 155.724 163.836 1.00 66.09  ? 972  ARG A CB    1 
ATOM   4606  C  CG    . ARG A 1  708 ? 163.750 156.672 162.710 1.00 66.09  ? 972  ARG A CG    1 
ATOM   4607  C  CD    . ARG A 1  708 ? 164.417 156.273 161.404 1.00 66.09  ? 972  ARG A CD    1 
ATOM   4608  N  NE    . ARG A 1  708 ? 164.960 157.426 160.693 1.00 66.09  ? 972  ARG A NE    1 
ATOM   4609  C  CZ    . ARG A 1  708 ? 164.467 157.902 159.554 1.00 66.09  ? 972  ARG A CZ    1 
ATOM   4610  N  NH1   . ARG A 1  708 ? 163.415 157.323 158.992 1.00 66.09  ? 972  ARG A NH1   1 
ATOM   4611  N  NH2   . ARG A 1  708 ? 165.026 158.957 158.977 1.00 66.09  ? 972  ARG A NH2   1 
ATOM   4612  N  N     . LYS A 1  709 ? 161.363 156.844 165.093 1.00 67.45  ? 973  LYS A N     1 
ATOM   4613  C  CA    . LYS A 1  709 ? 160.253 157.780 164.984 1.00 67.45  ? 973  LYS A CA    1 
ATOM   4614  C  C     . LYS A 1  709 ? 159.881 158.408 166.322 1.00 67.45  ? 973  LYS A C     1 
ATOM   4615  O  O     . LYS A 1  709 ? 159.334 159.516 166.338 1.00 67.45  ? 973  LYS A O     1 
ATOM   4616  C  CB    . LYS A 1  709 ? 159.035 157.079 164.378 1.00 67.45  ? 973  LYS A CB    1 
ATOM   4617  C  CG    . LYS A 1  709 ? 157.877 158.008 164.049 1.00 67.45  ? 973  LYS A CG    1 
ATOM   4618  C  CD    . LYS A 1  709 ? 156.688 157.243 163.495 1.00 67.45  ? 973  LYS A CD    1 
ATOM   4619  C  CE    . LYS A 1  709 ? 156.944 156.790 162.069 1.00 67.45  ? 973  LYS A CE    1 
ATOM   4620  N  NZ    . LYS A 1  709 ? 155.743 156.144 161.472 1.00 67.45  ? 973  LYS A NZ    1 
ATOM   4621  N  N     . MET A 1  710 ? 160.179 157.747 167.445 1.00 71.36  ? 974  MET A N     1 
ATOM   4622  C  CA    . MET A 1  710 ? 159.650 158.198 168.725 1.00 71.36  ? 974  MET A CA    1 
ATOM   4623  C  C     . MET A 1  710 ? 160.669 158.297 169.855 1.00 71.36  ? 974  MET A C     1 
ATOM   4624  O  O     . MET A 1  710 ? 160.356 158.914 170.877 1.00 71.36  ? 974  MET A O     1 
ATOM   4625  C  CB    . MET A 1  710 ? 158.510 157.269 169.170 1.00 71.36  ? 974  MET A CB    1 
ATOM   4626  C  CG    . MET A 1  710 ? 157.280 157.328 168.283 1.00 71.36  ? 974  MET A CG    1 
ATOM   4627  S  SD    . MET A 1  710 ? 156.039 156.120 168.771 1.00 71.36  ? 974  MET A SD    1 
ATOM   4628  C  CE    . MET A 1  710 ? 155.529 156.798 170.345 1.00 71.36  ? 974  MET A CE    1 
ATOM   4629  N  N     . ASN A 1  711 ? 161.858 157.716 169.723 1.00 73.76  ? 975  ASN A N     1 
ATOM   4630  C  CA    . ASN A 1  711 ? 162.806 157.657 170.834 1.00 73.76  ? 975  ASN A CA    1 
ATOM   4631  C  C     . ASN A 1  711 ? 164.208 158.044 170.373 1.00 73.76  ? 975  ASN A C     1 
ATOM   4632  O  O     . ASN A 1  711 ? 165.192 157.363 170.662 1.00 73.76  ? 975  ASN A O     1 
ATOM   4633  C  CB    . ASN A 1  711 ? 162.808 156.268 171.469 1.00 73.76  ? 975  ASN A CB    1 
ATOM   4634  C  CG    . ASN A 1  711 ? 161.530 155.971 172.225 1.00 73.76  ? 975  ASN A CG    1 
ATOM   4635  O  OD1   . ASN A 1  711 ? 160.997 156.830 172.927 1.00 73.76  ? 975  ASN A OD1   1 
ATOM   4636  N  ND2   . ASN A 1  711 ? 161.031 154.749 172.087 1.00 73.76  ? 975  ASN A ND2   1 
ATOM   4637  N  N     . ALA A 1  712 ? 164.315 159.156 169.648 1.00 75.47  ? 976  ALA A N     1 
ATOM   4638  C  CA    . ALA A 1  712 ? 165.611 159.633 169.189 1.00 75.47  ? 976  ALA A CA    1 
ATOM   4639  C  C     . ALA A 1  712 ? 165.520 161.113 168.856 1.00 75.47  ? 976  ALA A C     1 
ATOM   4640  O  O     . ALA A 1  712 ? 164.434 161.659 168.645 1.00 75.47  ? 976  ALA A O     1 
ATOM   4641  C  CB    . ALA A 1  712 ? 166.103 158.846 167.969 1.00 75.47  ? 976  ALA A CB    1 
ATOM   4642  N  N     . ARG A 1  713 ? 166.680 161.753 168.757 1.00 76.45  ? 977  ARG A N     1 
ATOM   4643  C  CA    . ARG A 1  713 ? 166.749 163.158 168.388 1.00 76.45  ? 977  ARG A CA    1 
ATOM   4644  C  C     . ARG A 1  713 ? 166.466 163.231 166.893 1.00 76.45  ? 977  ARG A C     1 
ATOM   4645  O  O     . ARG A 1  713 ? 167.026 162.461 166.118 1.00 76.45  ? 977  ARG A O     1 
ATOM   4646  C  CB    . ARG A 1  713 ? 168.131 163.723 168.695 1.00 76.45  ? 977  ARG A CB    1 
ATOM   4647  C  CG    . ARG A 1  713 ? 168.110 165.012 169.496 1.00 76.45  ? 977  ARG A CG    1 
ATOM   4648  C  CD    . ARG A 1  713 ? 169.019 164.921 170.709 1.00 76.45  ? 977  ARG A CD    1 
ATOM   4649  N  NE    . ARG A 1  713 ? 169.906 163.764 170.648 1.00 76.45  ? 977  ARG A NE    1 
ATOM   4650  C  CZ    . ARG A 1  713 ? 171.172 163.776 171.049 1.00 76.45  ? 977  ARG A CZ    1 
ATOM   4651  N  NH1   . ARG A 1  713 ? 171.909 162.678 170.959 1.00 76.45  ? 977  ARG A NH1   1 
ATOM   4652  N  NH2   . ARG A 1  713 ? 171.702 164.886 171.539 1.00 76.45  ? 977  ARG A NH2   1 
ATOM   4653  N  N     . GLN A 1  714 ? 165.603 164.153 166.486 1.00 77.40  ? 978  GLN A N     1 
ATOM   4654  C  CA    . GLN A 1  714 ? 165.226 164.278 165.085 1.00 77.40  ? 978  GLN A CA    1 
ATOM   4655  C  C     . GLN A 1  714 ? 166.271 165.074 164.314 1.00 77.40  ? 978  GLN A C     1 
ATOM   4656  O  O     . GLN A 1  714 ? 165.939 166.038 163.619 1.00 77.40  ? 978  GLN A O     1 
ATOM   4657  C  CB    . GLN A 1  714 ? 163.851 164.936 164.958 1.00 77.40  ? 978  GLN A CB    1 
ATOM   4658  C  CG    . GLN A 1  714 ? 162.723 164.120 165.565 1.00 77.40  ? 978  GLN A CG    1 
ATOM   4659  C  CD    . GLN A 1  714 ? 162.563 162.768 164.900 1.00 77.40  ? 978  GLN A CD    1 
ATOM   4660  O  OE1   . GLN A 1  714 ? 162.867 161.733 165.492 1.00 77.40  ? 978  GLN A OE1   1 
ATOM   4661  N  NE2   . GLN A 1  714 ? 162.086 162.770 163.662 1.00 77.40  ? 978  GLN A NE2   1 
ATOM   4662  N  N     . SER A 1  715 ? 167.533 164.670 164.424 1.00 77.10  ? 979  SER A N     1 
ATOM   4663  C  CA    . SER A 1  715 ? 168.632 165.320 163.726 1.00 77.10  ? 979  SER A CA    1 
ATOM   4664  C  C     . SER A 1  715 ? 169.378 164.282 162.904 1.00 77.10  ? 979  SER A C     1 
ATOM   4665  O  O     . SER A 1  715 ? 169.496 163.123 163.311 1.00 77.10  ? 979  SER A O     1 
ATOM   4666  C  CB    . SER A 1  715 ? 169.587 166.009 164.706 1.00 77.10  ? 979  SER A CB    1 
ATOM   4667  O  OG    . SER A 1  715 ? 170.668 166.616 164.020 1.00 77.10  ? 979  SER A OG    1 
ATOM   4668  N  N     . LYS A 1  716 ? 169.880 164.707 161.743 1.00 79.03  ? 980  LYS A N     1 
ATOM   4669  C  CA    . LYS A 1  716 ? 170.524 163.776 160.824 1.00 79.03  ? 980  LYS A CA    1 
ATOM   4670  C  C     . LYS A 1  716 ? 171.813 163.196 161.391 1.00 79.03  ? 980  LYS A C     1 
ATOM   4671  O  O     . LYS A 1  716 ? 172.184 162.074 161.032 1.00 79.03  ? 980  LYS A O     1 
ATOM   4672  C  CB    . LYS A 1  716 ? 170.801 164.473 159.490 1.00 79.03  ? 980  LYS A CB    1 
ATOM   4673  C  CG    . LYS A 1  716 ? 171.308 163.551 158.395 1.00 79.03  ? 980  LYS A CG    1 
ATOM   4674  C  CD    . LYS A 1  716 ? 171.597 164.316 157.116 1.00 79.03  ? 980  LYS A CD    1 
ATOM   4675  C  CE    . LYS A 1  716 ? 170.312 164.720 156.412 1.00 79.03  ? 980  LYS A CE    1 
ATOM   4676  N  NZ    . LYS A 1  716 ? 170.582 165.361 155.096 1.00 79.03  ? 980  LYS A NZ    1 
ATOM   4677  N  N     . CYS A 1  717 ? 172.495 163.922 162.275 1.00 80.54  ? 981  CYS A N     1 
ATOM   4678  C  CA    . CYS A 1  717 ? 173.770 163.485 162.825 1.00 80.54  ? 981  CYS A CA    1 
ATOM   4679  C  C     . CYS A 1  717 ? 173.667 163.066 164.288 1.00 80.54  ? 981  CYS A C     1 
ATOM   4680  O  O     . CYS A 1  717 ? 174.683 163.031 164.990 1.00 80.54  ? 981  CYS A O     1 
ATOM   4681  C  CB    . CYS A 1  717 ? 174.817 164.587 162.661 1.00 80.54  ? 981  CYS A CB    1 
ATOM   4682  S  SG    . CYS A 1  717 ? 174.449 166.106 163.561 1.00 80.54  ? 981  CYS A SG    1 
ATOM   4683  N  N     . TYR A 1  718 ? 172.461 162.749 164.761 1.00 78.56  ? 982  TYR A N     1 
ATOM   4684  C  CA    . TYR A 1  718 ? 172.285 162.293 166.135 1.00 78.56  ? 982  TYR A CA    1 
ATOM   4685  C  C     . TYR A 1  718 ? 171.360 161.094 166.290 1.00 78.56  ? 982  TYR A C     1 
ATOM   4686  O  O     . TYR A 1  718 ? 171.336 160.509 167.376 1.00 78.56  ? 982  TYR A O     1 
ATOM   4687  C  CB    . TYR A 1  718 ? 171.750 163.432 167.015 1.00 78.56  ? 982  TYR A CB    1 
ATOM   4688  C  CG    . TYR A 1  718 ? 172.719 164.571 167.240 1.00 78.56  ? 982  TYR A CG    1 
ATOM   4689  C  CD1   . TYR A 1  718 ? 173.775 164.443 168.132 1.00 78.56  ? 982  TYR A CD1   1 
ATOM   4690  C  CD2   . TYR A 1  718 ? 172.559 165.785 166.587 1.00 78.56  ? 982  TYR A CD2   1 
ATOM   4691  C  CE1   . TYR A 1  718 ? 174.657 165.483 168.350 1.00 78.56  ? 982  TYR A CE1   1 
ATOM   4692  C  CE2   . TYR A 1  718 ? 173.435 166.832 166.801 1.00 78.56  ? 982  TYR A CE2   1 
ATOM   4693  C  CZ    . TYR A 1  718 ? 174.482 166.675 167.682 1.00 78.56  ? 982  TYR A CZ    1 
ATOM   4694  O  OH    . TYR A 1  718 ? 175.357 167.714 167.896 1.00 78.56  ? 982  TYR A OH    1 
ATOM   4695  N  N     . GLU A 1  719 ? 170.610 160.699 165.260 1.00 81.49  ? 983  GLU A N     1 
ATOM   4696  C  CA    . GLU A 1  719 ? 169.590 159.670 165.443 1.00 81.49  ? 983  GLU A CA    1 
ATOM   4697  C  C     . GLU A 1  719 ? 170.200 158.277 165.539 1.00 81.49  ? 983  GLU A C     1 
ATOM   4698  O  O     . GLU A 1  719 ? 169.687 157.418 166.267 1.00 81.49  ? 983  GLU A O     1 
ATOM   4699  C  CB    . GLU A 1  719 ? 168.576 159.737 164.301 1.00 81.49  ? 983  GLU A CB    1 
ATOM   4700  C  CG    . GLU A 1  719 ? 169.185 159.484 162.932 1.00 81.49  ? 983  GLU A CG    1 
ATOM   4701  C  CD    . GLU A 1  719 ? 168.185 159.619 161.806 1.00 81.49  ? 983  GLU A CD    1 
ATOM   4702  O  OE1   . GLU A 1  719 ? 166.997 159.880 162.090 1.00 81.49  ? 983  GLU A OE1   1 
ATOM   4703  O  OE2   . GLU A 1  719 ? 168.594 159.479 160.634 1.00 81.49  ? 983  GLU A OE2   1 
ATOM   4704  N  N     . MET A 1  720 ? 171.295 158.034 164.815 1.00 78.34  ? 984  MET A N     1 
ATOM   4705  C  CA    . MET A 1  720 ? 171.864 156.690 164.753 1.00 78.34  ? 984  MET A CA    1 
ATOM   4706  C  C     . MET A 1  720 ? 172.278 156.199 166.134 1.00 78.34  ? 984  MET A C     1 
ATOM   4707  O  O     . MET A 1  720 ? 171.857 155.122 166.574 1.00 78.34  ? 984  MET A O     1 
ATOM   4708  C  CB    . MET A 1  720 ? 173.056 156.673 163.796 1.00 78.34  ? 984  MET A CB    1 
ATOM   4709  C  CG    . MET A 1  720 ? 172.698 156.863 162.329 1.00 78.34  ? 984  MET A CG    1 
ATOM   4710  S  SD    . MET A 1  720 ? 171.730 155.498 161.653 1.00 78.34  ? 984  MET A SD    1 
ATOM   4711  C  CE    . MET A 1  720 ? 170.092 156.216 161.579 1.00 78.34  ? 984  MET A CE    1 
ATOM   4712  N  N     . GLU A 1  721 ? 173.100 156.982 166.836 1.00 79.57  ? 985  GLU A N     1 
ATOM   4713  C  CA    . GLU A 1  721 ? 173.590 156.550 168.140 1.00 79.57  ? 985  GLU A CA    1 
ATOM   4714  C  C     . GLU A 1  721 ? 172.468 156.467 169.167 1.00 79.57  ? 985  GLU A C     1 
ATOM   4715  O  O     . GLU A 1  721 ? 172.479 155.570 170.017 1.00 79.57  ? 985  GLU A O     1 
ATOM   4716  C  CB    . GLU A 1  721 ? 174.700 157.485 168.624 1.00 79.57  ? 985  GLU A CB    1 
ATOM   4717  C  CG    . GLU A 1  721 ? 174.262 158.915 168.889 1.00 79.57  ? 985  GLU A CG    1 
ATOM   4718  C  CD    . GLU A 1  721 ? 175.415 159.808 169.303 1.00 79.57  ? 985  GLU A CD    1 
ATOM   4719  O  OE1   . GLU A 1  721 ? 176.560 159.314 169.357 1.00 79.57  ? 985  GLU A OE1   1 
ATOM   4720  O  OE2   . GLU A 1  721 ? 175.176 161.003 169.574 1.00 79.57  ? 985  GLU A OE2   1 
ATOM   4721  N  N     . ASP A 1  722 ? 171.485 157.367 169.094 1.00 75.77  ? 986  ASP A N     1 
ATOM   4722  C  CA    . ASP A 1  722 ? 170.364 157.312 170.028 1.00 75.77  ? 986  ASP A CA    1 
ATOM   4723  C  C     . ASP A 1  722 ? 169.561 156.032 169.841 1.00 75.77  ? 986  ASP A C     1 
ATOM   4724  O  O     . ASP A 1  722 ? 169.258 155.328 170.813 1.00 75.77  ? 986  ASP A O     1 
ATOM   4725  C  CB    . ASP A 1  722 ? 169.467 158.535 169.850 1.00 75.77  ? 986  ASP A CB    1 
ATOM   4726  C  CG    . ASP A 1  722 ? 170.132 159.817 170.299 1.00 75.77  ? 986  ASP A CG    1 
ATOM   4727  O  OD1   . ASP A 1  722 ? 170.999 159.758 171.195 1.00 75.77  ? 986  ASP A OD1   1 
ATOM   4728  O  OD2   . ASP A 1  722 ? 169.780 160.885 169.757 1.00 75.77  ? 986  ASP A OD2   1 
ATOM   4729  N  N     . VAL A 1  723 ? 169.205 155.717 168.593 1.00 69.57  ? 987  VAL A N     1 
ATOM   4730  C  CA    . VAL A 1  723 ? 168.440 154.503 168.324 1.00 69.57  ? 987  VAL A CA    1 
ATOM   4731  C  C     . VAL A 1  723 ? 169.246 153.272 168.715 1.00 69.57  ? 987  VAL A C     1 
ATOM   4732  O  O     . VAL A 1  723 ? 168.710 152.312 169.280 1.00 69.57  ? 987  VAL A O     1 
ATOM   4733  C  CB    . VAL A 1  723 ? 168.010 154.451 166.848 1.00 69.57  ? 987  VAL A CB    1 
ATOM   4734  C  CG1   . VAL A 1  723 ? 167.330 153.130 166.544 1.00 69.57  ? 987  VAL A CG1   1 
ATOM   4735  C  CG2   . VAL A 1  723 ? 167.080 155.604 166.532 1.00 69.57  ? 987  VAL A CG2   1 
ATOM   4736  N  N     . LEU A 1  724 ? 170.551 153.286 168.431 1.00 66.50  ? 988  LEU A N     1 
ATOM   4737  C  CA    . LEU A 1  724 ? 171.391 152.144 168.772 1.00 66.50  ? 988  LEU A CA    1 
ATOM   4738  C  C     . LEU A 1  724 ? 171.429 151.923 170.279 1.00 66.50  ? 988  LEU A C     1 
ATOM   4739  O  O     . LEU A 1  724 ? 171.245 150.797 170.758 1.00 66.50  ? 988  LEU A O     1 
ATOM   4740  C  CB    . LEU A 1  724 ? 172.800 152.352 168.217 1.00 66.50  ? 988  LEU A CB    1 
ATOM   4741  C  CG    . LEU A 1  724 ? 173.790 151.206 168.421 1.00 66.50  ? 988  LEU A CG    1 
ATOM   4742  C  CD1   . LEU A 1  724 ? 173.305 149.953 167.718 1.00 66.50  ? 988  LEU A CD1   1 
ATOM   4743  C  CD2   . LEU A 1  724 ? 175.170 151.601 167.924 1.00 66.50  ? 988  LEU A CD2   1 
ATOM   4744  N  N     . LYS A 1  725 ? 171.649 152.994 171.045 1.00 65.55  ? 989  LYS A N     1 
ATOM   4745  C  CA    . LYS A 1  725 ? 171.707 152.871 172.498 1.00 65.55  ? 989  LYS A CA    1 
ATOM   4746  C  C     . LYS A 1  725 ? 170.370 152.414 173.065 1.00 65.55  ? 989  LYS A C     1 
ATOM   4747  O  O     . LYS A 1  725 ? 170.320 151.563 173.961 1.00 65.55  ? 989  LYS A O     1 
ATOM   4748  C  CB    . LYS A 1  725 ? 172.129 154.203 173.117 1.00 65.55  ? 989  LYS A CB    1 
ATOM   4749  C  CG    . LYS A 1  725 ? 172.250 154.169 174.628 1.00 65.55  ? 989  LYS A CG    1 
ATOM   4750  C  CD    . LYS A 1  725 ? 172.800 155.477 175.165 1.00 65.55  ? 989  LYS A CD    1 
ATOM   4751  C  CE    . LYS A 1  725 ? 171.771 156.587 175.060 1.00 65.55  ? 989  LYS A CE    1 
ATOM   4752  N  NZ    . LYS A 1  725 ? 170.626 156.366 175.984 1.00 65.55  ? 989  LYS A NZ    1 
ATOM   4753  N  N     . HIS A 1  726 ? 169.268 152.967 172.551 1.00 65.20  ? 990  HIS A N     1 
ATOM   4754  C  CA    . HIS A 1  726 ? 167.958 152.595 173.075 1.00 65.20  ? 990  HIS A CA    1 
ATOM   4755  C  C     . HIS A 1  726 ? 167.631 151.141 172.763 1.00 65.20  ? 990  HIS A C     1 
ATOM   4756  O  O     . HIS A 1  726 ? 167.105 150.418 173.618 1.00 65.20  ? 990  HIS A O     1 
ATOM   4757  C  CB    . HIS A 1  726 ? 166.882 153.521 172.514 1.00 65.20  ? 990  HIS A CB    1 
ATOM   4758  C  CG    . HIS A 1  726 ? 165.513 153.247 173.053 1.00 65.20  ? 990  HIS A CG    1 
ATOM   4759  N  ND1   . HIS A 1  726 ? 165.136 153.588 174.334 1.00 65.20  ? 990  HIS A ND1   1 
ATOM   4760  C  CD2   . HIS A 1  726 ? 164.431 152.664 172.485 1.00 65.20  ? 990  HIS A CD2   1 
ATOM   4761  C  CE1   . HIS A 1  726 ? 163.881 153.226 174.532 1.00 65.20  ? 990  HIS A CE1   1 
ATOM   4762  N  NE2   . HIS A 1  726 ? 163.430 152.664 173.425 1.00 65.20  ? 990  HIS A NE2   1 
ATOM   4763  N  N     . HIS A 1  727 ? 167.943 150.686 171.548 1.00 66.70  ? 991  HIS A N     1 
ATOM   4764  C  CA    . HIS A 1  727 ? 167.655 149.302 171.195 1.00 66.70  ? 991  HIS A CA    1 
ATOM   4765  C  C     . HIS A 1  727 ? 168.584 148.339 171.922 1.00 66.70  ? 991  HIS A C     1 
ATOM   4766  O  O     . HIS A 1  727 ? 168.215 147.183 172.156 1.00 66.70  ? 991  HIS A O     1 
ATOM   4767  C  CB    . HIS A 1  727 ? 167.755 149.114 169.681 1.00 66.70  ? 991  HIS A CB    1 
ATOM   4768  C  CG    . HIS A 1  727 ? 167.220 147.801 169.200 1.00 66.70  ? 991  HIS A CG    1 
ATOM   4769  N  ND1   . HIS A 1  727 ? 167.990 146.661 169.140 1.00 66.70  ? 991  HIS A ND1   1 
ATOM   4770  C  CD2   . HIS A 1  727 ? 165.990 147.448 168.761 1.00 66.70  ? 991  HIS A CD2   1 
ATOM   4771  C  CE1   . HIS A 1  727 ? 167.259 145.661 168.681 1.00 66.70  ? 991  HIS A CE1   1 
ATOM   4772  N  NE2   . HIS A 1  727 ? 166.040 146.112 168.444 1.00 66.70  ? 991  HIS A NE2   1 
ATOM   4773  N  N     . TRP A 1  728 ? 169.786 148.791 172.286 1.00 64.65  ? 992  TRP A N     1 
ATOM   4774  C  CA    . TRP A 1  728 ? 170.657 147.974 173.123 1.00 64.65  ? 992  TRP A CA    1 
ATOM   4775  C  C     . TRP A 1  728 ? 170.089 147.845 174.530 1.00 64.65  ? 992  TRP A C     1 
ATOM   4776  O  O     . TRP A 1  728 ? 170.070 146.753 175.109 1.00 64.65  ? 992  TRP A O     1 
ATOM   4777  C  CB    . TRP A 1  728 ? 172.060 148.575 173.164 1.00 64.65  ? 992  TRP A CB    1 
ATOM   4778  C  CG    . TRP A 1  728 ? 173.024 147.767 173.969 1.00 64.65  ? 992  TRP A CG    1 
ATOM   4779  C  CD1   . TRP A 1  728 ? 173.422 148.007 175.250 1.00 64.65  ? 992  TRP A CD1   1 
ATOM   4780  C  CD2   . TRP A 1  728 ? 173.721 146.591 173.545 1.00 64.65  ? 992  TRP A CD2   1 
ATOM   4781  N  NE1   . TRP A 1  728 ? 174.320 147.050 175.653 1.00 64.65  ? 992  TRP A NE1   1 
ATOM   4782  C  CE2   . TRP A 1  728 ? 174.522 146.170 174.624 1.00 64.65  ? 992  TRP A CE2   1 
ATOM   4783  C  CE3   . TRP A 1  728 ? 173.745 145.853 172.359 1.00 64.65  ? 992  TRP A CE3   1 
ATOM   4784  C  CZ2   . TRP A 1  728 ? 175.337 145.043 174.553 1.00 64.65  ? 992  TRP A CZ2   1 
ATOM   4785  C  CZ3   . TRP A 1  728 ? 174.556 144.736 172.290 1.00 64.65  ? 992  TRP A CZ3   1 
ATOM   4786  C  CH2   . TRP A 1  728 ? 175.340 144.342 173.380 1.00 64.65  ? 992  TRP A CH2   1 
ATOM   4787  N  N     . LEU A 1  729 ? 169.630 148.961 175.102 1.00 64.99  ? 993  LEU A N     1 
ATOM   4788  C  CA    . LEU A 1  729 ? 169.048 148.924 176.439 1.00 64.99  ? 993  LEU A CA    1 
ATOM   4789  C  C     . LEU A 1  729 ? 167.781 148.080 176.470 1.00 64.99  ? 993  LEU A C     1 
ATOM   4790  O  O     . LEU A 1  729 ? 167.498 147.405 177.467 1.00 64.99  ? 993  LEU A O     1 
ATOM   4791  C  CB    . LEU A 1  729 ? 168.751 150.343 176.926 1.00 64.99  ? 993  LEU A CB    1 
ATOM   4792  C  CG    . LEU A 1  729 ? 169.947 151.253 177.201 1.00 64.99  ? 993  LEU A CG    1 
ATOM   4793  C  CD1   . LEU A 1  729 ? 169.475 152.658 177.538 1.00 64.99  ? 993  LEU A CD1   1 
ATOM   4794  C  CD2   . LEU A 1  729 ? 170.802 150.689 178.321 1.00 64.99  ? 993  LEU A CD2   1 
ATOM   4795  N  N     . TYR A 1  730 ? 167.002 148.108 175.387 1.00 64.96  ? 994  TYR A N     1 
ATOM   4796  C  CA    . TYR A 1  730 ? 165.747 147.366 175.348 1.00 64.96  ? 994  TYR A CA    1 
ATOM   4797  C  C     . TYR A 1  730 ? 165.946 145.856 175.338 1.00 64.96  ? 994  TYR A C     1 
ATOM   4798  O  O     . TYR A 1  730 ? 165.009 145.124 175.677 1.00 64.96  ? 994  TYR A O     1 
ATOM   4799  C  CB    . TYR A 1  730 ? 164.932 147.793 174.125 1.00 64.96  ? 994  TYR A CB    1 
ATOM   4800  C  CG    . TYR A 1  730 ? 163.593 147.104 174.008 1.00 64.96  ? 994  TYR A CG    1 
ATOM   4801  C  CD1   . TYR A 1  730 ? 162.542 147.441 174.849 1.00 64.96  ? 994  TYR A CD1   1 
ATOM   4802  C  CD2   . TYR A 1  730 ? 163.378 146.119 173.054 1.00 64.96  ? 994  TYR A CD2   1 
ATOM   4803  C  CE1   . TYR A 1  730 ? 161.318 146.812 174.748 1.00 64.96  ? 994  TYR A CE1   1 
ATOM   4804  C  CE2   . TYR A 1  730 ? 162.156 145.487 172.944 1.00 64.96  ? 994  TYR A CE2   1 
ATOM   4805  C  CZ    . TYR A 1  730 ? 161.130 145.838 173.792 1.00 64.96  ? 994  TYR A CZ    1 
ATOM   4806  O  OH    . TYR A 1  730 ? 159.911 145.211 173.685 1.00 64.96  ? 994  TYR A OH    1 
ATOM   4807  N  N     . THR A 1  731 ? 167.131 145.371 174.981 1.00 66.89  ? 995  THR A N     1 
ATOM   4808  C  CA    . THR A 1  731 ? 167.408 143.943 174.893 1.00 66.89  ? 995  THR A CA    1 
ATOM   4809  C  C     . THR A 1  731 ? 168.319 143.494 176.029 1.00 66.89  ? 995  THR A C     1 
ATOM   4810  O  O     . THR A 1  731 ? 169.208 142.660 175.847 1.00 66.89  ? 995  THR A O     1 
ATOM   4811  C  CB    . THR A 1  731 ? 168.024 143.588 173.542 1.00 66.89  ? 995  THR A CB    1 
ATOM   4812  O  OG1   . THR A 1  731 ? 169.272 144.275 173.390 1.00 66.89  ? 995  THR A OG1   1 
ATOM   4813  C  CG2   . THR A 1  731 ? 167.091 143.993 172.413 1.00 66.89  ? 995  THR A CG2   1 
ATOM   4814  N  N     . SER A 1  732 ? 168.103 144.048 177.219 1.00 69.23  ? 996  SER A N     1 
ATOM   4815  C  CA    . SER A 1  732 ? 168.891 143.715 178.401 1.00 69.23  ? 996  SER A CA    1 
ATOM   4816  C  C     . SER A 1  732 ? 168.058 142.812 179.302 1.00 69.23  ? 996  SER A C     1 
ATOM   4817  O  O     . SER A 1  732 ? 167.014 143.229 179.814 1.00 69.23  ? 996  SER A O     1 
ATOM   4818  C  CB    . SER A 1  732 ? 169.321 144.980 179.140 1.00 69.23  ? 996  SER A CB    1 
ATOM   4819  O  OG    . SER A 1  732 ? 170.184 145.769 178.339 1.00 69.23  ? 996  SER A OG    1 
ATOM   4820  N  N     . LYS A 1  733 ? 168.519 141.573 179.491 1.00 71.68  ? 997  LYS A N     1 
ATOM   4821  C  CA    . LYS A 1  733 ? 167.805 140.647 180.363 1.00 71.68  ? 997  LYS A CA    1 
ATOM   4822  C  C     . LYS A 1  733 ? 167.789 141.135 181.805 1.00 71.68  ? 997  LYS A C     1 
ATOM   4823  O  O     . LYS A 1  733 ? 166.858 140.821 182.556 1.00 71.68  ? 997  LYS A O     1 
ATOM   4824  C  CB    . LYS A 1  733 ? 168.433 139.256 180.279 1.00 71.68  ? 997  LYS A CB    1 
ATOM   4825  C  CG    . LYS A 1  733 ? 168.267 138.585 178.925 1.00 71.68  ? 997  LYS A CG    1 
ATOM   4826  C  CD    . LYS A 1  733 ? 168.857 137.186 178.926 1.00 71.68  ? 997  LYS A CD    1 
ATOM   4827  C  CE    . LYS A 1  733 ? 168.771 136.550 177.549 1.00 71.68  ? 997  LYS A CE    1 
ATOM   4828  N  NZ    . LYS A 1  733 ? 167.363 136.276 177.153 1.00 71.68  ? 997  LYS A NZ    1 
ATOM   4829  N  N     . TYR A 1  734 ? 168.806 141.901 182.207 1.00 70.21  ? 998  TYR A N     1 
ATOM   4830  C  CA    . TYR A 1  734 ? 168.827 142.467 183.551 1.00 70.21  ? 998  TYR A CA    1 
ATOM   4831  C  C     . TYR A 1  734 ? 167.615 143.360 183.786 1.00 70.21  ? 998  TYR A C     1 
ATOM   4832  O  O     . TYR A 1  734 ? 166.968 143.285 184.836 1.00 70.21  ? 998  TYR A O     1 
ATOM   4833  C  CB    . TYR A 1  734 ? 170.123 143.246 183.769 1.00 70.21  ? 998  TYR A CB    1 
ATOM   4834  C  CG    . TYR A 1  734 ? 170.258 143.841 185.151 1.00 70.21  ? 998  TYR A CG    1 
ATOM   4835  C  CD1   . TYR A 1  734 ? 170.578 143.045 186.241 1.00 70.21  ? 998  TYR A CD1   1 
ATOM   4836  C  CD2   . TYR A 1  734 ? 170.067 145.199 185.365 1.00 70.21  ? 998  TYR A CD2   1 
ATOM   4837  C  CE1   . TYR A 1  734 ? 170.703 143.584 187.506 1.00 70.21  ? 998  TYR A CE1   1 
ATOM   4838  C  CE2   . TYR A 1  734 ? 170.189 145.747 186.625 1.00 70.21  ? 998  TYR A CE2   1 
ATOM   4839  C  CZ    . TYR A 1  734 ? 170.507 144.935 187.692 1.00 70.21  ? 998  TYR A CZ    1 
ATOM   4840  O  OH    . TYR A 1  734 ? 170.631 145.476 188.951 1.00 70.21  ? 998  TYR A OH    1 
ATOM   4841  N  N     . LEU A 1  735 ? 167.289 144.211 182.812 1.00 70.09  ? 999  LEU A N     1 
ATOM   4842  C  CA    . LEU A 1  735 ? 166.117 145.071 182.941 1.00 70.09  ? 999  LEU A CA    1 
ATOM   4843  C  C     . LEU A 1  735 ? 164.830 144.268 182.799 1.00 70.09  ? 999  LEU A C     1 
ATOM   4844  O  O     . LEU A 1  735 ? 163.830 144.555 183.467 1.00 70.09  ? 999  LEU A O     1 
ATOM   4845  C  CB    . LEU A 1  735 ? 166.166 146.190 181.901 1.00 70.09  ? 999  LEU A CB    1 
ATOM   4846  C  CG    . LEU A 1  735 ? 167.286 147.221 182.036 1.00 70.09  ? 999  LEU A CG    1 
ATOM   4847  C  CD1   . LEU A 1  735 ? 167.265 148.181 180.858 1.00 70.09  ? 999  LEU A CD1   1 
ATOM   4848  C  CD2   . LEU A 1  735 ? 167.168 147.975 183.349 1.00 70.09  ? 999  LEU A CD2   1 
ATOM   4849  N  N     . GLN A 1  736 ? 164.836 143.257 181.927 1.00 69.37  ? 1000 GLN A N     1 
ATOM   4850  C  CA    . GLN A 1  736 ? 163.635 142.455 181.718 1.00 69.37  ? 1000 GLN A CA    1 
ATOM   4851  C  C     . GLN A 1  736 ? 163.285 141.634 182.951 1.00 69.37  ? 1000 GLN A C     1 
ATOM   4852  O  O     . GLN A 1  736 ? 162.120 141.266 183.140 1.00 69.37  ? 1000 GLN A O     1 
ATOM   4853  C  CB    . GLN A 1  736 ? 163.820 141.541 180.506 1.00 69.37  ? 1000 GLN A CB    1 
ATOM   4854  C  CG    . GLN A 1  736 ? 163.935 142.283 179.186 1.00 69.37  ? 1000 GLN A CG    1 
ATOM   4855  C  CD    . GLN A 1  736 ? 164.155 141.351 178.012 1.00 69.37  ? 1000 GLN A CD    1 
ATOM   4856  O  OE1   . GLN A 1  736 ? 164.285 140.139 178.181 1.00 69.37  ? 1000 GLN A OE1   1 
ATOM   4857  N  NE2   . GLN A 1  736 ? 164.204 141.916 176.812 1.00 69.37  ? 1000 GLN A NE2   1 
ATOM   4858  N  N     . LYS A 1  737 ? 164.273 141.336 183.797 1.00 73.77  ? 1001 LYS A N     1 
ATOM   4859  C  CA    . LYS A 1  737 ? 163.996 140.572 185.008 1.00 73.77  ? 1001 LYS A CA    1 
ATOM   4860  C  C     . LYS A 1  737 ? 163.162 141.371 186.002 1.00 73.77  ? 1001 LYS A C     1 
ATOM   4861  O  O     . LYS A 1  737 ? 162.391 140.787 186.772 1.00 73.77  ? 1001 LYS A O     1 
ATOM   4862  C  CB    . LYS A 1  737 ? 165.307 140.119 185.652 1.00 73.77  ? 1001 LYS A CB    1 
ATOM   4863  C  CG    . LYS A 1  737 ? 165.129 139.178 186.831 1.00 73.77  ? 1001 LYS A CG    1 
ATOM   4864  C  CD    . LYS A 1  737 ? 166.469 138.757 187.407 1.00 73.77  ? 1001 LYS A CD    1 
ATOM   4865  C  CE    . LYS A 1  737 ? 167.195 137.806 186.469 1.00 73.77  ? 1001 LYS A CE    1 
ATOM   4866  N  NZ    . LYS A 1  737 ? 166.493 136.499 186.354 1.00 73.77  ? 1001 LYS A NZ    1 
ATOM   4867  N  N     . PHE A 1  738 ? 163.284 142.691 185.969 1.00 75.32  ? 1002 PHE A N     1 
ATOM   4868  C  CA    . PHE A 1  738 ? 162.523 143.534 186.877 1.00 75.32  ? 1002 PHE A CA    1 
ATOM   4869  C  C     . PHE A 1  738 ? 161.035 143.491 186.563 1.00 75.32  ? 1002 PHE A C     1 
ATOM   4870  O  O     . PHE A 1  738 ? 160.207 143.394 187.463 1.00 75.32  ? 1002 PHE A O     1 
ATOM   4871  C  CB    . PHE A 1  738 ? 163.021 144.975 186.813 1.00 75.32  ? 1002 PHE A CB    1 
ATOM   4872  C  CG    . PHE A 1  738 ? 164.168 145.258 187.734 1.00 75.32  ? 1002 PHE A CG    1 
ATOM   4873  C  CD1   . PHE A 1  738 ? 164.090 146.280 188.661 1.00 75.32  ? 1002 PHE A CD1   1 
ATOM   4874  C  CD2   . PHE A 1  738 ? 165.322 144.501 187.673 1.00 75.32  ? 1002 PHE A CD2   1 
ATOM   4875  C  CE1   . PHE A 1  738 ? 165.145 146.544 189.512 1.00 75.32  ? 1002 PHE A CE1   1 
ATOM   4876  C  CE2   . PHE A 1  738 ? 166.381 144.758 188.519 1.00 75.32  ? 1002 PHE A CE2   1 
ATOM   4877  C  CZ    . PHE A 1  738 ? 166.293 145.781 189.441 1.00 75.32  ? 1002 PHE A CZ    1 
ATOM   4878  N  N     . MET A 1  739 ? 160.700 143.556 185.280 1.00 78.26  ? 1003 MET A N     1 
ATOM   4879  C  CA    . MET A 1  739 ? 159.306 143.546 184.855 1.00 78.26  ? 1003 MET A CA    1 
ATOM   4880  C  C     . MET A 1  739 ? 158.621 142.211 185.106 1.00 78.26  ? 1003 MET A C     1 
ATOM   4881  O  O     . MET A 1  739 ? 157.387 142.155 185.085 1.00 78.26  ? 1003 MET A O     1 
ATOM   4882  C  CB    . MET A 1  739 ? 159.212 143.907 183.372 1.00 78.26  ? 1003 MET A CB    1 
ATOM   4883  C  CG    . MET A 1  739 ? 159.642 145.330 183.054 1.00 78.26  ? 1003 MET A CG    1 
ATOM   4884  S  SD    . MET A 1  739 ? 158.627 146.568 183.881 1.00 78.26  ? 1003 MET A SD    1 
ATOM   4885  C  CE    . MET A 1  739 ? 157.079 146.376 183.003 1.00 78.26  ? 1003 MET A CE    1 
ATOM   4886  N  N     . ASN A 1  740 ? 159.380 141.142 185.339 1.00 81.64  ? 1004 ASN A N     1 
ATOM   4887  C  CA    . ASN A 1  740 ? 158.823 139.830 185.635 1.00 81.64  ? 1004 ASN A CA    1 
ATOM   4888  C  C     . ASN A 1  740 ? 158.958 139.454 187.104 1.00 81.64  ? 1004 ASN A C     1 
ATOM   4889  O  O     . ASN A 1  740 ? 158.741 138.291 187.458 1.00 81.64  ? 1004 ASN A O     1 
ATOM   4890  C  CB    . ASN A 1  740 ? 159.486 138.766 184.760 1.00 81.64  ? 1004 ASN A CB    1 
ATOM   4891  C  CG    . ASN A 1  740 ? 159.092 138.885 183.303 1.00 81.64  ? 1004 ASN A CG    1 
ATOM   4892  O  OD1   . ASN A 1  740 ? 157.929 139.126 182.980 1.00 81.64  ? 1004 ASN A OD1   1 
ATOM   4893  N  ND2   . ASN A 1  740 ? 160.061 138.714 182.412 1.00 81.64  ? 1004 ASN A ND2   1 
ATOM   4894  N  N     . ALA A 1  741 ? 159.316 140.410 187.966 1.00 87.81  ? 1005 ALA A N     1 
ATOM   4895  C  CA    . ALA A 1  741 ? 159.454 140.112 189.388 1.00 87.81  ? 1005 ALA A CA    1 
ATOM   4896  C  C     . ALA A 1  741 ? 158.114 139.770 190.025 1.00 87.81  ? 1005 ALA A C     1 
ATOM   4897  O  O     . ALA A 1  741 ? 158.076 139.148 191.093 1.00 87.81  ? 1005 ALA A O     1 
ATOM   4898  C  CB    . ALA A 1  741 ? 160.102 141.292 190.112 1.00 87.81  ? 1005 ALA A CB    1 
ATOM   4899  N  N     . HIS A 1  742 ? 157.020 140.134 189.365 1.00 90.35  ? 1006 HIS A N     1 
ATOM   4900  C  CA    . HIS A 1  742 ? 155.696 139.833 189.897 1.00 90.35  ? 1006 HIS A CA    1 
ATOM   4901  C  C     . HIS A 1  742 ? 155.443 138.327 189.913 1.00 90.35  ? 1006 HIS A C     1 
ATOM   4902  O  O     . HIS A 1  742 ? 154.693 137.826 190.748 1.00 90.35  ? 1006 HIS A O     1 
ATOM   4903  C  CB    . HIS A 1  742 ? 154.604 140.563 189.112 1.00 90.35  ? 1006 HIS A CB    1 
ATOM   4904  C  CG    . HIS A 1  742 ? 154.250 139.911 187.814 1.00 90.35  ? 1006 HIS A CG    1 
ATOM   4905  N  ND1   . HIS A 1  742 ? 153.235 140.372 187.004 1.00 90.35  ? 1006 HIS A ND1   1 
ATOM   4906  C  CD2   . HIS A 1  742 ? 154.776 138.835 187.183 1.00 90.35  ? 1006 HIS A CD2   1 
ATOM   4907  C  CE1   . HIS A 1  742 ? 153.150 139.608 185.930 1.00 90.35  ? 1006 HIS A CE1   1 
ATOM   4908  N  NE2   . HIS A 1  742 ? 154.074 138.668 186.014 1.00 90.35  ? 1006 HIS A NE2   1 
ATOM   4909  N  N     . ASN A 1  743 ? 156.068 137.609 188.985 1.00 97.24  ? 1007 ASN A N     1 
ATOM   4910  C  CA    . ASN A 1  743 ? 155.923 136.161 188.919 1.00 97.24  ? 1007 ASN A CA    1 
ATOM   4911  C  C     . ASN A 1  743 ? 156.931 135.495 189.847 1.00 97.24  ? 1007 ASN A C     1 
ATOM   4912  O  O     . ASN A 1  743 ? 157.744 134.674 189.410 1.00 97.24  ? 1007 ASN A O     1 
ATOM   4913  C  CB    . ASN A 1  743 ? 156.100 135.673 187.479 1.00 97.24  ? 1007 ASN A CB    1 
ATOM   4914  C  CG    . ASN A 1  743 ? 155.667 134.231 187.292 1.00 97.24  ? 1007 ASN A CG    1 
ATOM   4915  O  OD1   . ASN A 1  743 ? 155.239 133.569 188.238 1.00 97.24  ? 1007 ASN A OD1   1 
ATOM   4916  N  ND2   . ASN A 1  743 ? 155.776 133.736 186.064 1.00 97.24  ? 1007 ASN A ND2   1 
ATOM   4917  N  N     . ALA A 1  744 ? 156.890 135.850 191.127 1.00 96.83  ? 1008 ALA A N     1 
ATOM   4918  C  CA    . ALA A 1  744 ? 157.809 135.294 192.112 1.00 96.83  ? 1008 ALA A CA    1 
ATOM   4919  C  C     . ALA A 1  744 ? 157.215 135.383 193.513 1.00 96.83  ? 1008 ALA A C     1 
ATOM   4920  O  O     . ALA A 1  744 ? 157.625 134.664 194.424 1.00 96.83  ? 1008 ALA A O     1 
ATOM   4921  C  CB    . ALA A 1  744 ? 159.147 136.012 192.055 1.00 96.83  ? 1008 ALA A CB    1 
ATOM   4922  N  N     . PRO B 1  128 ? 149.126 132.457 228.151 1.00 371.61 ? 392  PRO C N     1 
ATOM   4923  C  CA    . PRO B 1  128 ? 150.330 132.792 227.383 1.00 371.61 ? 392  PRO C CA    1 
ATOM   4924  C  C     . PRO B 1  128 ? 150.109 133.958 226.423 1.00 371.61 ? 392  PRO C C     1 
ATOM   4925  O  O     . PRO B 1  128 ? 149.980 133.747 225.218 1.00 371.61 ? 392  PRO C O     1 
ATOM   4926  C  CB    . PRO B 1  128 ? 150.623 131.500 226.613 1.00 371.61 ? 392  PRO C CB    1 
ATOM   4927  C  CG    . PRO B 1  128 ? 150.004 130.425 227.440 1.00 371.61 ? 392  PRO C CG    1 
ATOM   4928  C  CD    . PRO B 1  128 ? 148.764 131.036 228.017 1.00 371.61 ? 392  PRO C CD    1 
ATOM   4929  N  N     . ARG B 1  129 ? 150.050 135.173 226.962 1.00 354.21 ? 393  ARG C N     1 
ATOM   4930  C  CA    . ARG B 1  129 ? 149.851 136.371 226.152 1.00 354.21 ? 393  ARG C CA    1 
ATOM   4931  C  C     . ARG B 1  129 ? 151.190 136.847 225.601 1.00 354.21 ? 393  ARG C C     1 
ATOM   4932  O  O     . ARG B 1  129 ? 152.106 137.160 226.359 1.00 354.21 ? 393  ARG C O     1 
ATOM   4933  C  CB    . ARG B 1  129 ? 149.196 137.479 226.981 1.00 354.21 ? 393  ARG C CB    1 
ATOM   4934  C  CG    . ARG B 1  129 ? 147.791 137.151 227.463 1.00 354.21 ? 393  ARG C CG    1 
ATOM   4935  C  CD    . ARG B 1  129 ? 147.047 138.398 227.921 1.00 354.21 ? 393  ARG C CD    1 
ATOM   4936  N  NE    . ARG B 1  129 ? 147.760 139.625 227.577 1.00 354.21 ? 393  ARG C NE    1 
ATOM   4937  C  CZ    . ARG B 1  129 ? 147.191 140.690 227.020 1.00 354.21 ? 393  ARG C CZ    1 
ATOM   4938  N  NH1   . ARG B 1  129 ? 147.917 141.763 226.742 1.00 354.21 ? 393  ARG C NH1   1 
ATOM   4939  N  NH2   . ARG B 1  129 ? 145.896 140.681 226.740 1.00 354.21 ? 393  ARG C NH2   1 
ATOM   4940  N  N     . GLN B 1  130 ? 151.297 136.909 224.278 1.00 343.80 ? 394  GLN C N     1 
ATOM   4941  C  CA    . GLN B 1  130 ? 152.540 137.318 223.630 1.00 343.80 ? 394  GLN C CA    1 
ATOM   4942  C  C     . GLN B 1  130 ? 152.563 138.820 223.359 1.00 343.80 ? 394  GLN C C     1 
ATOM   4943  O  O     . GLN B 1  130 ? 153.406 139.541 223.903 1.00 343.80 ? 394  GLN C O     1 
ATOM   4944  C  CB    . GLN B 1  130 ? 152.736 136.529 222.330 1.00 343.80 ? 394  GLN C CB    1 
ATOM   4945  C  CG    . GLN B 1  130 ? 152.980 135.043 222.534 1.00 343.80 ? 394  GLN C CG    1 
ATOM   4946  C  CD    . GLN B 1  130 ? 153.138 134.298 221.224 1.00 343.80 ? 394  GLN C CD    1 
ATOM   4947  O  OE1   . GLN B 1  130 ? 153.002 134.878 220.148 1.00 343.80 ? 394  GLN C OE1   1 
ATOM   4948  N  NE2   . GLN B 1  130 ? 153.425 133.004 221.309 1.00 343.80 ? 394  GLN C NE2   1 
ATOM   4949  N  N     . HIS B 1  131 ? 151.629 139.303 222.541 1.00 332.30 ? 395  HIS C N     1 
ATOM   4950  C  CA    . HIS B 1  131 ? 151.497 140.721 222.229 1.00 332.30 ? 395  HIS C CA    1 
ATOM   4951  C  C     . HIS B 1  131 ? 150.247 140.903 221.380 1.00 332.30 ? 395  HIS C C     1 
ATOM   4952  O  O     . HIS B 1  131 ? 149.708 139.940 220.827 1.00 332.30 ? 395  HIS C O     1 
ATOM   4953  C  CB    . HIS B 1  131 ? 152.732 141.270 221.500 1.00 332.30 ? 395  HIS C CB    1 
ATOM   4954  C  CG    . HIS B 1  131 ? 152.765 142.765 221.406 1.00 332.30 ? 395  HIS C CG    1 
ATOM   4955  N  ND1   . HIS B 1  131 ? 152.187 143.461 220.366 1.00 332.30 ? 395  HIS C ND1   1 
ATOM   4956  C  CD2   . HIS B 1  131 ? 153.296 143.698 222.232 1.00 332.30 ? 395  HIS C CD2   1 
ATOM   4957  C  CE1   . HIS B 1  131 ? 152.365 144.757 220.553 1.00 332.30 ? 395  HIS C CE1   1 
ATOM   4958  N  NE2   . HIS B 1  131 ? 153.036 144.927 221.677 1.00 332.30 ? 395  HIS C NE2   1 
ATOM   4959  N  N     . LEU B 1  132 ? 149.794 142.154 221.284 1.00 324.75 ? 396  LEU C N     1 
ATOM   4960  C  CA    . LEU B 1  132 ? 148.582 142.458 220.532 1.00 324.75 ? 396  LEU C CA    1 
ATOM   4961  C  C     . LEU B 1  132 ? 148.766 142.311 219.026 1.00 324.75 ? 396  LEU C C     1 
ATOM   4962  O  O     . LEU B 1  132 ? 147.831 141.879 218.344 1.00 324.75 ? 396  LEU C O     1 
ATOM   4963  C  CB    . LEU B 1  132 ? 148.108 143.875 220.860 1.00 324.75 ? 396  LEU C CB    1 
ATOM   4964  C  CG    . LEU B 1  132 ? 146.804 144.343 220.212 1.00 324.75 ? 396  LEU C CG    1 
ATOM   4965  C  CD1   . LEU B 1  132 ? 145.636 143.484 220.671 1.00 324.75 ? 396  LEU C CD1   1 
ATOM   4966  C  CD2   . LEU B 1  132 ? 146.552 145.808 220.528 1.00 324.75 ? 396  LEU C CD2   1 
ATOM   4967  N  N     . LEU B 1  133 ? 149.937 142.652 218.488 1.00 324.43 ? 397  LEU C N     1 
ATOM   4968  C  CA    . LEU B 1  133 ? 150.161 142.599 217.048 1.00 324.43 ? 397  LEU C CA    1 
ATOM   4969  C  C     . LEU B 1  133 ? 150.757 141.277 216.581 1.00 324.43 ? 397  LEU C C     1 
ATOM   4970  O  O     . LEU B 1  133 ? 150.945 141.093 215.375 1.00 324.43 ? 397  LEU C O     1 
ATOM   4971  C  CB    . LEU B 1  133 ? 151.058 143.765 216.599 1.00 324.43 ? 397  LEU C CB    1 
ATOM   4972  C  CG    . LEU B 1  133 ? 152.493 143.922 217.118 1.00 324.43 ? 397  LEU C CG    1 
ATOM   4973  C  CD1   . LEU B 1  133 ? 153.488 143.106 216.302 1.00 324.43 ? 397  LEU C CD1   1 
ATOM   4974  C  CD2   . LEU B 1  133 ? 152.895 145.393 217.130 1.00 324.43 ? 397  LEU C CD2   1 
ATOM   4975  N  N     . SER B 1  134 ? 150.986 140.351 217.508 1.00 326.41 ? 398  SER C N     1 
ATOM   4976  C  CA    . SER B 1  134 ? 151.535 139.040 217.171 1.00 326.41 ? 398  SER C CA    1 
ATOM   4977  C  C     . SER B 1  134 ? 150.434 138.051 216.783 1.00 326.41 ? 398  SER C C     1 
ATOM   4978  O  O     . SER B 1  134 ? 150.671 136.848 216.700 1.00 326.41 ? 398  SER C O     1 
ATOM   4979  C  CB    . SER B 1  134 ? 152.346 138.482 218.342 1.00 326.41 ? 398  SER C CB    1 
ATOM   4980  O  OG    . SER B 1  134 ? 153.627 138.051 217.918 1.00 326.41 ? 398  SER C OG    1 
ATOM   4981  N  N     . LEU B 1  135 ? 149.232 138.569 216.550 1.00 326.72 ? 399  LEU C N     1 
ATOM   4982  C  CA    . LEU B 1  135 ? 148.089 137.754 216.171 1.00 326.72 ? 399  LEU C CA    1 
ATOM   4983  C  C     . LEU B 1  135 ? 147.545 138.207 214.823 1.00 326.72 ? 399  LEU C C     1 
ATOM   4984  O  O     . LEU B 1  135 ? 147.742 139.349 214.398 1.00 326.72 ? 399  LEU C O     1 
ATOM   4985  C  CB    . LEU B 1  135 ? 146.985 137.828 217.234 1.00 326.72 ? 399  LEU C CB    1 
ATOM   4986  C  CG    . LEU B 1  135 ? 147.134 136.972 218.496 1.00 326.72 ? 399  LEU C CG    1 
ATOM   4987  C  CD1   . LEU B 1  135 ? 148.248 137.487 219.387 1.00 326.72 ? 399  LEU C CD1   1 
ATOM   4988  C  CD2   . LEU B 1  135 ? 145.827 136.930 219.269 1.00 326.72 ? 399  LEU C CD2   1 
ATOM   4989  N  N     . THR B 1  136 ? 146.852 137.292 214.151 1.00 308.72 ? 400  THR C N     1 
ATOM   4990  C  CA    . THR B 1  136 ? 146.244 137.602 212.869 1.00 308.72 ? 400  THR C CA    1 
ATOM   4991  C  C     . THR B 1  136 ? 144.988 138.447 213.068 1.00 308.72 ? 400  THR C C     1 
ATOM   4992  O  O     . THR B 1  136 ? 144.522 138.666 214.189 1.00 308.72 ? 400  THR C O     1 
ATOM   4993  C  CB    . THR B 1  136 ? 145.910 136.321 212.105 1.00 308.72 ? 400  THR C CB    1 
ATOM   4994  O  OG1   . THR B 1  136 ? 145.474 136.653 210.781 1.00 308.72 ? 400  THR C OG1   1 
ATOM   4995  C  CG2   . THR B 1  136 ? 144.809 135.550 212.815 1.00 308.72 ? 400  THR C CG2   1 
ATOM   4996  N  N     . ARG B 1  137 ? 144.452 138.928 211.950 1.00 287.24 ? 401  ARG C N     1 
ATOM   4997  C  CA    . ARG B 1  137 ? 143.253 139.756 211.950 1.00 287.24 ? 401  ARG C CA    1 
ATOM   4998  C  C     . ARG B 1  137 ? 142.103 139.065 212.671 1.00 287.24 ? 401  ARG C C     1 
ATOM   4999  O  O     . ARG B 1  137 ? 141.410 139.680 213.481 1.00 287.24 ? 401  ARG C O     1 
ATOM   5000  C  CB    . ARG B 1  137 ? 142.842 140.094 210.516 1.00 287.24 ? 401  ARG C CB    1 
ATOM   5001  C  CG    . ARG B 1  137 ? 142.670 141.579 210.246 1.00 287.24 ? 401  ARG C CG    1 
ATOM   5002  C  CD    . ARG B 1  137 ? 142.208 141.823 208.819 1.00 287.24 ? 401  ARG C CD    1 
ATOM   5003  N  NE    . ARG B 1  137 ? 143.136 141.262 207.841 1.00 287.24 ? 401  ARG C NE    1 
ATOM   5004  C  CZ    . ARG B 1  137 ? 144.397 141.656 207.699 1.00 287.24 ? 401  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG B 1  137 ? 144.882 142.617 208.472 1.00 287.24 ? 401  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG B 1  137 ? 145.172 141.093 206.784 1.00 287.24 ? 401  ARG C NH2   1 
ATOM   5007  N  N     . ARG B 1  138 ? 141.913 137.784 212.371 1.00 294.11 ? 402  ARG C N     1 
ATOM   5008  C  CA    . ARG B 1  138 ? 140.854 136.998 212.989 1.00 294.11 ? 402  ARG C CA    1 
ATOM   5009  C  C     . ARG B 1  138 ? 141.086 136.871 214.490 1.00 294.11 ? 402  ARG C C     1 
ATOM   5010  O  O     . ARG B 1  138 ? 140.160 137.030 215.285 1.00 294.11 ? 402  ARG C O     1 
ATOM   5011  C  CB    . ARG B 1  138 ? 140.772 135.611 212.349 1.00 294.11 ? 402  ARG C CB    1 
ATOM   5012  C  CG    . ARG B 1  138 ? 140.286 135.621 210.908 1.00 294.11 ? 402  ARG C CG    1 
ATOM   5013  C  CD    . ARG B 1  138 ? 139.710 136.976 210.529 1.00 294.11 ? 402  ARG C CD    1 
ATOM   5014  N  NE    . ARG B 1  138 ? 139.204 136.991 209.160 1.00 294.11 ? 402  ARG C NE    1 
ATOM   5015  C  CZ    . ARG B 1  138 ? 137.914 136.987 208.840 1.00 294.11 ? 402  ARG C CZ    1 
ATOM   5016  N  NH1   . ARG B 1  138 ? 136.992 136.969 209.793 1.00 294.11 ? 402  ARG C NH1   1 
ATOM   5017  N  NH2   . ARG B 1  138 ? 137.545 137.002 207.566 1.00 294.11 ? 402  ARG C NH2   1 
ATOM   5018  N  N     . ALA B 1  139 ? 142.326 136.583 214.873 1.00 312.43 ? 403  ALA C N     1 
ATOM   5019  C  CA    . ALA B 1  139 ? 142.666 136.443 216.284 1.00 312.43 ? 403  ALA C CA    1 
ATOM   5020  C  C     . ALA B 1  139 ? 142.604 137.781 217.011 1.00 312.43 ? 403  ALA C C     1 
ATOM   5021  O  O     . ALA B 1  139 ? 142.131 137.848 218.151 1.00 312.43 ? 403  ALA C O     1 
ATOM   5022  C  CB    . ALA B 1  139 ? 144.050 135.815 216.426 1.00 312.43 ? 403  ALA C CB    1 
ATOM   5023  N  N     . GLN B 1  140 ? 143.068 138.857 216.370 1.00 311.97 ? 404  GLN C N     1 
ATOM   5024  C  CA    . GLN B 1  140 ? 142.942 140.179 216.975 1.00 311.97 ? 404  GLN C CA    1 
ATOM   5025  C  C     . GLN B 1  140 ? 141.481 140.584 217.123 1.00 311.97 ? 404  GLN C C     1 
ATOM   5026  O  O     . GLN B 1  140 ? 141.116 141.247 218.100 1.00 311.97 ? 404  GLN C O     1 
ATOM   5027  C  CB    . GLN B 1  140 ? 143.706 141.214 216.149 1.00 311.97 ? 404  GLN C CB    1 
ATOM   5028  C  CG    . GLN B 1  140 ? 145.217 141.038 216.179 1.00 311.97 ? 404  GLN C CG    1 
ATOM   5029  C  CD    . GLN B 1  140 ? 145.943 142.059 215.325 1.00 311.97 ? 404  GLN C CD    1 
ATOM   5030  O  OE1   . GLN B 1  140 ? 145.318 142.873 214.644 1.00 311.97 ? 404  GLN C OE1   1 
ATOM   5031  N  NE2   . GLN B 1  140 ? 147.269 142.020 215.356 1.00 311.97 ? 404  GLN C NE2   1 
ATOM   5032  N  N     . LYS B 1  141 ? 140.630 140.188 216.173 1.00 309.47 ? 405  LYS C N     1 
ATOM   5033  C  CA    . LYS B 1  141 ? 139.199 140.431 216.317 1.00 309.47 ? 405  LYS C CA    1 
ATOM   5034  C  C     . LYS B 1  141 ? 138.625 139.648 217.487 1.00 309.47 ? 405  LYS C C     1 
ATOM   5035  O  O     . LYS B 1  141 ? 137.802 140.167 218.246 1.00 309.47 ? 405  LYS C O     1 
ATOM   5036  C  CB    . LYS B 1  141 ? 138.468 140.063 215.028 1.00 309.47 ? 405  LYS C CB    1 
ATOM   5037  C  CG    . LYS B 1  141 ? 136.983 140.368 215.069 1.00 309.47 ? 405  LYS C CG    1 
ATOM   5038  C  CD    . LYS B 1  141 ? 136.289 139.879 213.816 1.00 309.47 ? 405  LYS C CD    1 
ATOM   5039  C  CE    . LYS B 1  141 ? 136.643 140.745 212.624 1.00 309.47 ? 405  LYS C CE    1 
ATOM   5040  N  NZ    . LYS B 1  141 ? 135.858 140.358 211.425 1.00 309.47 ? 405  LYS C NZ    1 
ATOM   5041  N  N     . HIS B 1  142 ? 139.028 138.384 217.632 1.00 319.70 ? 406  HIS C N     1 
ATOM   5042  C  CA    . HIS B 1  142 ? 138.610 137.603 218.791 1.00 319.70 ? 406  HIS C CA    1 
ATOM   5043  C  C     . HIS B 1  142 ? 139.040 138.278 220.087 1.00 319.70 ? 406  HIS C C     1 
ATOM   5044  O  O     . HIS B 1  142 ? 138.305 138.267 221.081 1.00 319.70 ? 406  HIS C O     1 
ATOM   5045  C  CB    . HIS B 1  142 ? 139.185 136.188 218.703 1.00 319.70 ? 406  HIS C CB    1 
ATOM   5046  C  CG    . HIS B 1  142 ? 138.794 135.303 219.845 1.00 319.70 ? 406  HIS C CG    1 
ATOM   5047  N  ND1   . HIS B 1  142 ? 137.532 134.762 219.970 1.00 319.70 ? 406  HIS C ND1   1 
ATOM   5048  C  CD2   . HIS B 1  142 ? 139.497 134.867 220.917 1.00 319.70 ? 406  HIS C CD2   1 
ATOM   5049  C  CE1   . HIS B 1  142 ? 137.476 134.029 221.068 1.00 319.70 ? 406  HIS C CE1   1 
ATOM   5050  N  NE2   . HIS B 1  142 ? 138.656 134.077 221.661 1.00 319.70 ? 406  HIS C NE2   1 
ATOM   5051  N  N     . ARG B 1  143 ? 140.211 138.902 220.074 1.00 324.77 ? 407  ARG C N     1 
ATOM   5052  C  CA    . ARG B 1  143 ? 140.731 139.565 221.266 1.00 324.77 ? 407  ARG C CA    1 
ATOM   5053  C  C     . ARG B 1  143 ? 140.089 140.919 221.572 1.00 324.77 ? 407  ARG C C     1 
ATOM   5054  O  O     . ARG B 1  143 ? 140.039 141.335 222.728 1.00 324.77 ? 407  ARG C O     1 
ATOM   5055  C  CB    . ARG B 1  143 ? 142.248 139.727 221.156 1.00 324.77 ? 407  ARG C CB    1 
ATOM   5056  C  CG    . ARG B 1  143 ? 142.990 138.429 220.890 1.00 324.77 ? 407  ARG C CG    1 
ATOM   5057  C  CD    . ARG B 1  143 ? 143.251 137.671 222.180 1.00 324.77 ? 407  ARG C CD    1 
ATOM   5058  N  NE    . ARG B 1  143 ? 144.094 138.428 223.100 1.00 324.77 ? 407  ARG C NE    1 
ATOM   5059  C  CZ    . ARG B 1  143 ? 145.183 139.099 222.738 1.00 324.77 ? 407  ARG C CZ    1 
ATOM   5060  N  NH1   . ARG B 1  143 ? 145.888 139.759 223.647 1.00 324.77 ? 407  ARG C NH1   1 
ATOM   5061  N  NH2   . ARG B 1  143 ? 145.568 139.113 221.470 1.00 324.77 ? 407  ARG C NH2   1 
ATOM   5062  N  N     . LEU B 1  144 ? 139.579 141.602 220.552 1.00 318.80 ? 408  LEU C N     1 
ATOM   5063  C  CA    . LEU B 1  144 ? 138.965 142.917 220.762 1.00 318.80 ? 408  LEU C CA    1 
ATOM   5064  C  C     . LEU B 1  144 ? 137.438 142.931 220.646 1.00 318.80 ? 408  LEU C C     1 
ATOM   5065  O  O     . LEU B 1  144 ? 136.812 143.984 220.766 1.00 318.80 ? 408  LEU C O     1 
ATOM   5066  C  CB    . LEU B 1  144 ? 139.567 143.950 219.802 1.00 318.80 ? 408  LEU C CB    1 
ATOM   5067  C  CG    . LEU B 1  144 ? 141.032 143.756 219.402 1.00 318.80 ? 408  LEU C CG    1 
ATOM   5068  C  CD1   . LEU B 1  144 ? 141.310 144.390 218.048 1.00 318.80 ? 408  LEU C CD1   1 
ATOM   5069  C  CD2   . LEU B 1  144 ? 141.968 144.319 220.459 1.00 318.80 ? 408  LEU C CD2   1 
ATOM   5070  N  N     . ARG B 1  145 ? 136.844 141.763 220.423 1.00 319.25 ? 409  ARG C N     1 
ATOM   5071  C  CA    . ARG B 1  145 ? 135.394 141.647 220.275 1.00 319.25 ? 409  ARG C CA    1 
ATOM   5072  C  C     . ARG B 1  145 ? 134.610 142.401 221.345 1.00 319.25 ? 409  ARG C C     1 
ATOM   5073  O  O     . ARG B 1  145 ? 133.581 143.014 221.042 1.00 319.25 ? 409  ARG C O     1 
ATOM   5074  C  CB    . ARG B 1  145 ? 134.990 140.167 220.272 1.00 319.25 ? 409  ARG C CB    1 
ATOM   5075  C  CG    . ARG B 1  145 ? 135.243 139.441 221.589 1.00 319.25 ? 409  ARG C CG    1 
ATOM   5076  C  CD    . ARG B 1  145 ? 134.936 137.957 221.500 1.00 319.25 ? 409  ARG C CD    1 
ATOM   5077  N  NE    . ARG B 1  145 ? 135.069 137.303 222.801 1.00 319.25 ? 409  ARG C NE    1 
ATOM   5078  C  CZ    . ARG B 1  145 ? 136.206 136.807 223.280 1.00 319.25 ? 409  ARG C CZ    1 
ATOM   5079  N  NH1   . ARG B 1  145 ? 137.321 136.882 222.567 1.00 319.25 ? 409  ARG C NH1   1 
ATOM   5080  N  NH2   . ARG B 1  145 ? 136.228 136.232 224.474 1.00 319.25 ? 409  ARG C NH2   1 
ATOM   5081  N  N     . GLU B 1  146 ? 135.110 142.374 222.574 1.00 326.50 ? 410  GLU C N     1 
ATOM   5082  C  CA    . GLU B 1  146 ? 134.455 143.054 223.681 1.00 326.50 ? 410  GLU C CA    1 
ATOM   5083  C  C     . GLU B 1  146 ? 134.244 144.536 223.392 1.00 326.50 ? 410  GLU C C     1 
ATOM   5084  O  O     . GLU B 1  146 ? 133.110 145.013 223.342 1.00 326.50 ? 410  GLU C O     1 
ATOM   5085  C  CB    . GLU B 1  146 ? 135.272 142.884 224.961 1.00 326.50 ? 410  GLU C CB    1 
ATOM   5086  C  CG    . GLU B 1  146 ? 136.764 142.726 224.721 1.00 326.50 ? 410  GLU C CG    1 
ATOM   5087  C  CD    . GLU B 1  146 ? 137.495 142.202 225.940 1.00 326.50 ? 410  GLU C CD    1 
ATOM   5088  O  OE1   . GLU B 1  146 ? 138.543 142.780 226.298 1.00 326.50 ? 410  GLU C OE1   1 
ATOM   5089  O  OE2   . GLU B 1  146 ? 137.023 141.214 226.539 1.00 326.50 ? 410  GLU C OE2   1 
ATOM   5090  N  N     . LEU B 1  147 ? 135.343 145.260 223.197 1.00 331.71 ? 411  LEU C N     1 
ATOM   5091  C  CA    . LEU B 1  147 ? 135.277 146.691 222.932 1.00 331.71 ? 411  LEU C CA    1 
ATOM   5092  C  C     . LEU B 1  147 ? 134.752 147.001 221.541 1.00 331.71 ? 411  LEU C C     1 
ATOM   5093  O  O     . LEU B 1  147 ? 134.185 148.075 221.342 1.00 331.71 ? 411  LEU C O     1 
ATOM   5094  C  CB    . LEU B 1  147 ? 136.648 147.331 223.143 1.00 331.71 ? 411  LEU C CB    1 
ATOM   5095  C  CG    . LEU B 1  147 ? 136.846 147.897 224.548 1.00 331.71 ? 411  LEU C CG    1 
ATOM   5096  C  CD1   . LEU B 1  147 ? 136.020 149.159 224.719 1.00 331.71 ? 411  LEU C CD1   1 
ATOM   5097  C  CD2   . LEU B 1  147 ? 136.429 146.872 225.586 1.00 331.71 ? 411  LEU C CD2   1 
ATOM   5098  N  N     . LYS B 1  148 ? 134.908 146.084 220.586 1.00 328.89 ? 412  LYS C N     1 
ATOM   5099  C  CA    . LYS B 1  148 ? 134.242 146.231 219.297 1.00 328.89 ? 412  LYS C CA    1 
ATOM   5100  C  C     . LYS B 1  148 ? 132.737 146.377 219.493 1.00 328.89 ? 412  LYS C C     1 
ATOM   5101  O  O     . LYS B 1  148 ? 132.127 147.375 219.083 1.00 328.89 ? 412  LYS C O     1 
ATOM   5102  C  CB    . LYS B 1  148 ? 134.568 145.024 218.412 1.00 328.89 ? 412  LYS C CB    1 
ATOM   5103  C  CG    . LYS B 1  148 ? 134.033 145.093 216.986 1.00 328.89 ? 412  LYS C CG    1 
ATOM   5104  C  CD    . LYS B 1  148 ? 134.471 143.861 216.196 1.00 328.89 ? 412  LYS C CD    1 
ATOM   5105  C  CE    . LYS B 1  148 ? 133.957 143.876 214.764 1.00 328.89 ? 412  LYS C CE    1 
ATOM   5106  N  NZ    . LYS B 1  148 ? 134.377 142.654 214.020 1.00 328.89 ? 412  LYS C NZ    1 
ATOM   5107  N  N     . ILE B 1  149 ? 132.133 145.389 220.158 1.00 332.81 ? 413  ILE C N     1 
ATOM   5108  C  CA    . ILE B 1  149 ? 130.694 145.410 220.404 1.00 332.81 ? 413  ILE C CA    1 
ATOM   5109  C  C     . ILE B 1  149 ? 130.310 146.618 221.248 1.00 332.81 ? 413  ILE C C     1 
ATOM   5110  O  O     . ILE B 1  149 ? 129.279 147.256 221.006 1.00 332.81 ? 413  ILE C O     1 
ATOM   5111  C  CB    . ILE B 1  149 ? 130.251 144.092 221.066 1.00 332.81 ? 413  ILE C CB    1 
ATOM   5112  C  CG1   . ILE B 1  149 ? 130.507 142.913 220.126 1.00 332.81 ? 413  ILE C CG1   1 
ATOM   5113  C  CG2   . ILE B 1  149 ? 128.782 144.154 221.460 1.00 332.81 ? 413  ILE C CG2   1 
ATOM   5114  C  CD1   . ILE B 1  149 ? 130.351 141.563 220.787 1.00 332.81 ? 413  ILE C CD1   1 
ATOM   5115  N  N     . GLN B 1  150 ? 131.132 146.956 222.245 1.00 338.69 ? 414  GLN C N     1 
ATOM   5116  C  CA    . GLN B 1  150 ? 130.792 148.061 223.138 1.00 338.69 ? 414  GLN C CA    1 
ATOM   5117  C  C     . GLN B 1  150 ? 130.788 149.394 222.398 1.00 338.69 ? 414  GLN C C     1 
ATOM   5118  O  O     . GLN B 1  150 ? 129.841 150.181 222.521 1.00 338.69 ? 414  GLN C O     1 
ATOM   5119  C  CB    . GLN B 1  150 ? 131.762 148.102 224.319 1.00 338.69 ? 414  GLN C CB    1 
ATOM   5120  C  CG    . GLN B 1  150 ? 131.634 146.920 225.266 1.00 338.69 ? 414  GLN C CG    1 
ATOM   5121  C  CD    . GLN B 1  150 ? 132.610 146.991 226.421 1.00 338.69 ? 414  GLN C CD    1 
ATOM   5122  O  OE1   . GLN B 1  150 ? 133.421 147.913 226.507 1.00 338.69 ? 414  GLN C OE1   1 
ATOM   5123  N  NE2   . GLN B 1  150 ? 132.542 146.011 227.315 1.00 338.69 ? 414  GLN C NE2   1 
ATOM   5124  N  N     . VAL B 1  151 ? 131.845 149.671 221.629 1.00 341.56 ? 415  VAL C N     1 
ATOM   5125  C  CA    . VAL B 1  151 ? 131.904 150.907 220.855 1.00 341.56 ? 415  VAL C CA    1 
ATOM   5126  C  C     . VAL B 1  151 ? 130.761 150.963 219.852 1.00 341.56 ? 415  VAL C C     1 
ATOM   5127  O  O     . VAL B 1  151 ? 130.142 152.016 219.662 1.00 341.56 ? 415  VAL C O     1 
ATOM   5128  C  CB    . VAL B 1  151 ? 133.276 151.047 220.169 1.00 341.56 ? 415  VAL C CB    1 
ATOM   5129  C  CG1   . VAL B 1  151 ? 133.270 152.220 219.202 1.00 341.56 ? 415  VAL C CG1   1 
ATOM   5130  C  CG2   . VAL B 1  151 ? 134.367 151.240 221.211 1.00 341.56 ? 415  VAL C CG2   1 
ATOM   5131  N  N     . LYS B 1  152 ? 130.440 149.834 219.213 1.00 341.26 ? 416  LYS C N     1 
ATOM   5132  C  CA    . LYS B 1  152 ? 129.325 149.834 218.269 1.00 341.26 ? 416  LYS C CA    1 
ATOM   5133  C  C     . LYS B 1  152 ? 128.012 150.184 218.964 1.00 341.26 ? 416  LYS C C     1 
ATOM   5134  O  O     . LYS B 1  152 ? 127.301 151.110 218.550 1.00 341.26 ? 416  LYS C O     1 
ATOM   5135  C  CB    . LYS B 1  152 ? 129.222 148.478 217.570 1.00 341.26 ? 416  LYS C CB    1 
ATOM   5136  C  CG    . LYS B 1  152 ? 130.343 148.200 216.584 1.00 341.26 ? 416  LYS C CG    1 
ATOM   5137  C  CD    . LYS B 1  152 ? 130.146 146.862 215.894 1.00 341.26 ? 416  LYS C CD    1 
ATOM   5138  C  CE    . LYS B 1  152 ? 131.276 146.565 214.925 1.00 341.26 ? 416  LYS C CE    1 
ATOM   5139  N  NZ    . LYS B 1  152 ? 131.069 145.262 214.237 1.00 341.26 ? 416  LYS C NZ    1 
ATOM   5140  N  N     . GLU B 1  153 ? 127.683 149.462 220.038 1.00 347.19 ? 417  GLU C N     1 
ATOM   5141  C  CA    . GLU B 1  153 ? 126.411 149.647 220.724 1.00 347.19 ? 417  GLU C CA    1 
ATOM   5142  C  C     . GLU B 1  153 ? 126.327 150.965 221.479 1.00 347.19 ? 417  GLU C C     1 
ATOM   5143  O  O     . GLU B 1  153 ? 125.225 151.359 221.872 1.00 347.19 ? 417  GLU C O     1 
ATOM   5144  C  CB    . GLU B 1  153 ? 126.161 148.491 221.695 1.00 347.19 ? 417  GLU C CB    1 
ATOM   5145  C  CG    . GLU B 1  153 ? 127.105 148.468 222.884 1.00 347.19 ? 417  GLU C CG    1 
ATOM   5146  C  CD    . GLU B 1  153 ? 126.891 147.263 223.776 1.00 347.19 ? 417  GLU C CD    1 
ATOM   5147  O  OE1   . GLU B 1  153 ? 126.020 146.429 223.451 1.00 347.19 ? 417  GLU C OE1   1 
ATOM   5148  O  OE2   . GLU B 1  153 ? 127.594 147.149 224.802 1.00 347.19 ? 417  GLU C OE2   1 
ATOM   5149  N  N     . PHE B 1  154 ? 127.451 151.647 221.707 1.00 349.43 ? 418  PHE C N     1 
ATOM   5150  C  CA    . PHE B 1  154 ? 127.415 152.943 222.367 1.00 349.43 ? 418  PHE C CA    1 
ATOM   5151  C  C     . PHE B 1  154 ? 127.611 154.117 221.420 1.00 349.43 ? 418  PHE C C     1 
ATOM   5152  O  O     . PHE B 1  154 ? 127.415 155.262 221.837 1.00 349.43 ? 418  PHE C O     1 
ATOM   5153  C  CB    . PHE B 1  154 ? 128.472 153.004 223.478 1.00 349.43 ? 418  PHE C CB    1 
ATOM   5154  N  N     . ALA B 1  155 ? 127.992 153.865 220.169 1.00 350.39 ? 419  ALA C N     1 
ATOM   5155  C  CA    . ALA B 1  155 ? 128.036 154.905 219.153 1.00 350.39 ? 419  ALA C CA    1 
ATOM   5156  C  C     . ALA B 1  155 ? 126.839 154.867 218.215 1.00 350.39 ? 419  ALA C C     1 
ATOM   5157  O  O     . ALA B 1  155 ? 126.616 155.837 217.483 1.00 350.39 ? 419  ALA C O     1 
ATOM   5158  C  CB    . ALA B 1  155 ? 129.327 154.795 218.335 1.00 350.39 ? 419  ALA C CB    1 
ATOM   5159  N  N     . ASP B 1  156 ? 126.070 153.777 218.209 1.00 351.54 ? 420  ASP C N     1 
ATOM   5160  C  CA    . ASP B 1  156 ? 124.868 153.734 217.384 1.00 351.54 ? 420  ASP C CA    1 
ATOM   5161  C  C     . ASP B 1  156 ? 123.644 154.298 218.092 1.00 351.54 ? 420  ASP C C     1 
ATOM   5162  O  O     . ASP B 1  156 ? 122.635 154.582 217.435 1.00 351.54 ? 420  ASP C O     1 
ATOM   5163  C  CB    . ASP B 1  156 ? 124.586 152.298 216.927 1.00 351.54 ? 420  ASP C CB    1 
ATOM   5164  C  CG    . ASP B 1  156 ? 124.324 151.349 218.084 1.00 351.54 ? 420  ASP C CG    1 
ATOM   5165  O  OD1   . ASP B 1  156 ? 124.418 151.778 219.252 1.00 351.54 ? 420  ASP C OD1   1 
ATOM   5166  O  OD2   . ASP B 1  156 ? 124.021 150.167 217.821 1.00 351.54 ? 420  ASP C OD2   1 
ATOM   5167  N  N     . LYS B 1  157 ? 123.707 154.470 219.414 1.00 354.48 ? 421  LYS C N     1 
ATOM   5168  C  CA    . LYS B 1  157 ? 122.552 154.963 220.159 1.00 354.48 ? 421  LYS C CA    1 
ATOM   5169  C  C     . LYS B 1  157 ? 122.309 156.443 219.888 1.00 354.48 ? 421  LYS C C     1 
ATOM   5170  O  O     . LYS B 1  157 ? 121.257 156.828 219.365 1.00 354.48 ? 421  LYS C O     1 
ATOM   5171  C  CB    . LYS B 1  157 ? 122.748 154.716 221.657 1.00 354.48 ? 421  LYS C CB    1 
ATOM   5172  C  CG    . LYS B 1  157 ? 122.682 153.256 222.070 1.00 354.48 ? 421  LYS C CG    1 
ATOM   5173  C  CD    . LYS B 1  157 ? 122.875 153.107 223.572 1.00 354.48 ? 421  LYS C CD    1 
ATOM   5174  C  CE    . LYS B 1  157 ? 122.833 151.650 224.002 1.00 354.48 ? 421  LYS C CE    1 
ATOM   5175  N  NZ    . LYS B 1  157 ? 123.050 151.502 225.468 1.00 354.48 ? 421  LYS C NZ    1 
ATOM   5176  N  N     . GLU B 1  158 ? 123.276 157.291 220.237 1.00 355.81 ? 422  GLU C N     1 
ATOM   5177  C  CA    . GLU B 1  158 ? 123.119 158.736 220.131 1.00 355.81 ? 422  GLU C CA    1 
ATOM   5178  C  C     . GLU B 1  158 ? 123.968 159.366 219.039 1.00 355.81 ? 422  GLU C C     1 
ATOM   5179  O  O     . GLU B 1  158 ? 123.543 160.357 218.442 1.00 355.81 ? 422  GLU C O     1 
ATOM   5180  C  CB    . GLU B 1  158 ? 123.455 159.401 221.474 1.00 355.81 ? 422  GLU C CB    1 
ATOM   5181  C  CG    . GLU B 1  158 ? 123.076 160.875 221.582 1.00 355.81 ? 422  GLU C CG    1 
ATOM   5182  C  CD    . GLU B 1  158 ? 124.161 161.807 221.072 1.00 355.81 ? 422  GLU C CD    1 
ATOM   5183  O  OE1   . GLU B 1  158 ? 125.351 161.435 221.144 1.00 355.81 ? 422  GLU C OE1   1 
ATOM   5184  O  OE2   . GLU B 1  158 ? 123.821 162.913 220.600 1.00 355.81 ? 422  GLU C OE2   1 
ATOM   5185  N  N     . GLU B 1  159 ? 125.140 158.800 218.775 1.00 356.17 ? 423  GLU C N     1 
ATOM   5186  C  CA    . GLU B 1  159 ? 126.046 159.344 217.767 1.00 356.17 ? 423  GLU C CA    1 
ATOM   5187  C  C     . GLU B 1  159 ? 125.648 159.052 216.319 1.00 356.17 ? 423  GLU C C     1 
ATOM   5188  O  O     . GLU B 1  159 ? 126.466 159.203 215.409 1.00 356.17 ? 423  GLU C O     1 
ATOM   5189  C  CB    . GLU B 1  159 ? 127.474 158.857 218.025 1.00 356.17 ? 423  GLU C CB    1 
ATOM   5190  C  CG    . GLU B 1  159 ? 127.696 158.303 219.423 1.00 356.17 ? 423  GLU C CG    1 
ATOM   5191  C  CD    . GLU B 1  159 ? 128.337 159.312 220.354 1.00 356.17 ? 423  GLU C CD    1 
ATOM   5192  O  OE1   . GLU B 1  159 ? 129.490 159.713 220.093 1.00 356.17 ? 423  GLU C OE1   1 
ATOM   5193  O  OE2   . GLU B 1  159 ? 127.689 159.703 221.347 1.00 356.17 ? 423  GLU C OE2   1 
ATOM   5194  N  N     . GLY B 1  160 ? 124.404 158.639 216.097 1.00 350.21 ? 424  GLY C N     1 
ATOM   5195  C  CA    . GLY B 1  160 ? 123.957 158.352 214.748 1.00 350.21 ? 424  GLY C CA    1 
ATOM   5196  C  C     . GLY B 1  160 ? 124.167 156.910 214.336 1.00 350.21 ? 424  GLY C C     1 
ATOM   5197  O  O     . GLY B 1  160 ? 123.219 156.235 213.924 1.00 350.21 ? 424  GLY C O     1 
ATOM   5198  N  N     . GLY B 1  161 ? 125.400 156.420 214.443 1.00 342.72 ? 425  GLY C N     1 
ATOM   5199  C  CA    . GLY B 1  161 ? 125.678 155.036 214.114 1.00 342.72 ? 425  GLY C CA    1 
ATOM   5200  C  C     . GLY B 1  161 ? 126.753 154.832 213.067 1.00 342.72 ? 425  GLY C C     1 
ATOM   5201  O  O     . GLY B 1  161 ? 126.775 153.798 212.392 1.00 342.72 ? 425  GLY C O     1 
ATOM   5202  N  N     . ASP B 1  162 ? 127.652 155.803 212.920 1.00 328.08 ? 426  ASP C N     1 
ATOM   5203  C  CA    . ASP B 1  162 ? 128.788 155.693 212.012 1.00 328.08 ? 426  ASP C CA    1 
ATOM   5204  C  C     . ASP B 1  162 ? 129.998 155.234 212.819 1.00 328.08 ? 426  ASP C C     1 
ATOM   5205  O  O     . ASP B 1  162 ? 130.429 155.920 213.753 1.00 328.08 ? 426  ASP C O     1 
ATOM   5206  C  CB    . ASP B 1  162 ? 129.060 157.022 211.309 1.00 328.08 ? 426  ASP C CB    1 
ATOM   5207  C  CG    . ASP B 1  162 ? 130.050 156.890 210.164 1.00 328.08 ? 426  ASP C CG    1 
ATOM   5208  O  OD1   . ASP B 1  162 ? 130.559 155.774 209.926 1.00 328.08 ? 426  ASP C OD1   1 
ATOM   5209  O  OD2   . ASP B 1  162 ? 130.314 157.910 209.494 1.00 328.08 ? 426  ASP C OD2   1 
ATOM   5210  N  N     . VAL B 1  163 ? 130.546 154.075 212.455 1.00 320.10 ? 427  VAL C N     1 
ATOM   5211  C  CA    . VAL B 1  163 ? 131.630 153.480 213.230 1.00 320.10 ? 427  VAL C CA    1 
ATOM   5212  C  C     . VAL B 1  163 ? 132.977 154.056 212.811 1.00 320.10 ? 427  VAL C C     1 
ATOM   5213  O  O     . VAL B 1  163 ? 133.772 154.485 213.655 1.00 320.10 ? 427  VAL C O     1 
ATOM   5214  C  CB    . VAL B 1  163 ? 131.601 151.946 213.092 1.00 320.10 ? 427  VAL C CB    1 
ATOM   5215  C  CG1   . VAL B 1  163 ? 132.791 151.321 213.804 1.00 320.10 ? 427  VAL C CG1   1 
ATOM   5216  C  CG2   . VAL B 1  163 ? 130.292 151.388 213.640 1.00 320.10 ? 427  VAL C CG2   1 
ATOM   5217  N  N     . LYS B 1  164 ? 133.252 154.075 211.504 1.00 310.19 ? 428  LYS C N     1 
ATOM   5218  C  CA    . LYS B 1  164 ? 134.553 154.533 211.021 1.00 310.19 ? 428  LYS C CA    1 
ATOM   5219  C  C     . LYS B 1  164 ? 134.810 155.987 211.403 1.00 310.19 ? 428  LYS C C     1 
ATOM   5220  O  O     . LYS B 1  164 ? 135.952 156.367 211.697 1.00 310.19 ? 428  LYS C O     1 
ATOM   5221  C  CB    . LYS B 1  164 ? 134.635 154.341 209.504 1.00 310.19 ? 428  LYS C CB    1 
ATOM   5222  C  CG    . LYS B 1  164 ? 135.984 154.677 208.859 1.00 310.19 ? 428  LYS C CG    1 
ATOM   5223  C  CD    . LYS B 1  164 ? 136.100 156.154 208.488 1.00 310.19 ? 428  LYS C CD    1 
ATOM   5224  C  CE    . LYS B 1  164 ? 135.034 156.574 207.486 1.00 310.19 ? 428  LYS C CE    1 
ATOM   5225  N  NZ    . LYS B 1  164 ? 135.238 155.939 206.156 1.00 310.19 ? 428  LYS C NZ    1 
ATOM   5226  N  N     . ALA B 1  165 ? 133.762 156.817 211.389 1.00 322.08 ? 429  ALA C N     1 
ATOM   5227  C  CA    . ALA B 1  165 ? 133.912 158.219 211.768 1.00 322.08 ? 429  ALA C CA    1 
ATOM   5228  C  C     . ALA B 1  165 ? 134.413 158.346 213.201 1.00 322.08 ? 429  ALA C C     1 
ATOM   5229  O  O     . ALA B 1  165 ? 135.420 159.017 213.467 1.00 322.08 ? 429  ALA C O     1 
ATOM   5230  C  CB    . ALA B 1  165 ? 132.582 158.951 211.591 1.00 322.08 ? 429  ALA C CB    1 
ATOM   5231  N  N     . VAL B 1  166 ? 133.718 157.696 214.138 1.00 325.90 ? 430  VAL C N     1 
ATOM   5232  C  CA    . VAL B 1  166 ? 134.142 157.700 215.534 1.00 325.90 ? 430  VAL C CA    1 
ATOM   5233  C  C     . VAL B 1  166 ? 135.544 157.124 215.667 1.00 325.90 ? 430  VAL C C     1 
ATOM   5234  O  O     . VAL B 1  166 ? 136.359 157.609 216.461 1.00 325.90 ? 430  VAL C O     1 
ATOM   5235  C  CB    . VAL B 1  166 ? 133.130 156.924 216.397 1.00 325.90 ? 430  VAL C CB    1 
ATOM   5236  C  CG1   . VAL B 1  166 ? 133.628 156.818 217.824 1.00 325.90 ? 430  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL B 1  166 ? 131.768 157.599 216.348 1.00 325.90 ? 430  VAL C CG2   1 
ATOM   5238  N  N     . CYS B 1  167 ? 135.853 156.093 214.878 1.00 314.63 ? 431  CYS C N     1 
ATOM   5239  C  CA    . CYS B 1  167 ? 137.166 155.462 214.960 1.00 314.63 ? 431  CYS C CA    1 
ATOM   5240  C  C     . CYS B 1  167 ? 138.277 156.447 214.619 1.00 314.63 ? 431  CYS C C     1 
ATOM   5241  O  O     . CYS B 1  167 ? 139.215 156.638 215.406 1.00 314.63 ? 431  CYS C O     1 
ATOM   5242  C  CB    . CYS B 1  167 ? 137.219 154.241 214.043 1.00 314.63 ? 431  CYS C CB    1 
ATOM   5243  S  SG    . CYS B 1  167 ? 136.205 152.853 214.603 1.00 314.63 ? 431  CYS C SG    1 
ATOM   5244  N  N     . LEU B 1  168 ? 138.195 157.089 213.449 1.00 312.52 ? 432  LEU C N     1 
ATOM   5245  C  CA    . LEU B 1  168 ? 139.301 157.969 213.085 1.00 312.52 ? 432  LEU C CA    1 
ATOM   5246  C  C     . LEU B 1  168 ? 139.301 159.233 213.933 1.00 312.52 ? 432  LEU C C     1 
ATOM   5247  O  O     . LEU B 1  168 ? 140.369 159.803 214.174 1.00 312.52 ? 432  LEU C O     1 
ATOM   5248  C  CB    . LEU B 1  168 ? 139.301 158.339 211.597 1.00 312.52 ? 432  LEU C CB    1 
ATOM   5249  C  CG    . LEU B 1  168 ? 138.524 159.515 211.007 1.00 312.52 ? 432  LEU C CG    1 
ATOM   5250  C  CD1   . LEU B 1  168 ? 139.207 159.934 209.710 1.00 312.52 ? 432  LEU C CD1   1 
ATOM   5251  C  CD2   . LEU B 1  168 ? 137.089 159.160 210.740 1.00 312.52 ? 432  LEU C CD2   1 
ATOM   5252  N  N     . THR B 1  169 ? 138.136 159.667 214.428 1.00 324.57 ? 433  THR C N     1 
ATOM   5253  C  CA    . THR B 1  169 ? 138.124 160.814 215.332 1.00 324.57 ? 433  THR C CA    1 
ATOM   5254  C  C     . THR B 1  169 ? 138.846 160.494 216.636 1.00 324.57 ? 433  THR C C     1 
ATOM   5255  O  O     . THR B 1  169 ? 139.673 161.287 217.107 1.00 324.57 ? 433  THR C O     1 
ATOM   5256  C  CB    . THR B 1  169 ? 136.688 161.257 215.611 1.00 324.57 ? 433  THR C CB    1 
ATOM   5257  O  OG1   . THR B 1  169 ? 136.058 161.644 214.384 1.00 324.57 ? 433  THR C OG1   1 
ATOM   5258  C  CG2   . THR B 1  169 ? 136.671 162.433 216.575 1.00 324.57 ? 433  THR C CG2   1 
ATOM   5259  N  N     . LEU B 1  170 ? 138.552 159.335 217.231 1.00 321.38 ? 434  LEU C N     1 
ATOM   5260  C  CA    . LEU B 1  170 ? 139.237 158.933 218.453 1.00 321.38 ? 434  LEU C CA    1 
ATOM   5261  C  C     . LEU B 1  170 ? 140.727 158.748 218.207 1.00 321.38 ? 434  LEU C C     1 
ATOM   5262  O  O     . LEU B 1  170 ? 141.556 159.081 219.062 1.00 321.38 ? 434  LEU C O     1 
ATOM   5263  C  CB    . LEU B 1  170 ? 138.619 157.648 219.009 1.00 321.38 ? 434  LEU C CB    1 
ATOM   5264  C  CG    . LEU B 1  170 ? 137.187 157.737 219.539 1.00 321.38 ? 434  LEU C CG    1 
ATOM   5265  C  CD1   . LEU B 1  170 ? 136.676 156.359 219.934 1.00 321.38 ? 434  LEU C CD1   1 
ATOM   5266  C  CD2   . LEU B 1  170 ? 137.098 158.704 220.710 1.00 321.38 ? 434  LEU C CD2   1 
ATOM   5267  N  N     . PHE B 1  171 ? 141.092 158.222 217.033 1.00 305.12 ? 435  PHE C N     1 
ATOM   5268  C  CA    . PHE B 1  171 ? 142.511 158.055 216.742 1.00 305.12 ? 435  PHE C CA    1 
ATOM   5269  C  C     . PHE B 1  171 ? 143.212 159.402 216.614 1.00 305.12 ? 435  PHE C C     1 
ATOM   5270  O  O     . PHE B 1  171 ? 144.325 159.574 217.121 1.00 305.12 ? 435  PHE C O     1 
ATOM   5271  C  CB    . PHE B 1  171 ? 142.720 157.234 215.472 1.00 305.12 ? 435  PHE C CB    1 
ATOM   5272  C  CG    . PHE B 1  171 ? 144.167 156.954 215.177 1.00 305.12 ? 435  PHE C CG    1 
ATOM   5273  C  CD1   . PHE B 1  171 ? 144.847 155.960 215.861 1.00 305.12 ? 435  PHE C CD1   1 
ATOM   5274  C  CD2   . PHE B 1  171 ? 144.857 157.707 214.245 1.00 305.12 ? 435  PHE C CD2   1 
ATOM   5275  C  CE1   . PHE B 1  171 ? 146.182 155.708 215.601 1.00 305.12 ? 435  PHE C CE1   1 
ATOM   5276  C  CE2   . PHE B 1  171 ? 146.192 157.460 213.982 1.00 305.12 ? 435  PHE C CE2   1 
ATOM   5277  C  CZ    . PHE B 1  171 ? 146.854 156.460 214.659 1.00 305.12 ? 435  PHE C CZ    1 
ATOM   5278  N  N     . LEU B 1  172 ? 142.581 160.370 215.944 1.00 311.02 ? 436  LEU C N     1 
ATOM   5279  C  CA    . LEU B 1  172 ? 143.184 161.694 215.823 1.00 311.02 ? 436  LEU C CA    1 
ATOM   5280  C  C     . LEU B 1  172 ? 143.301 162.373 217.181 1.00 311.02 ? 436  LEU C C     1 
ATOM   5281  O  O     . LEU B 1  172 ? 144.287 163.071 217.450 1.00 311.02 ? 436  LEU C O     1 
ATOM   5282  C  CB    . LEU B 1  172 ? 142.374 162.559 214.857 1.00 311.02 ? 436  LEU C CB    1 
ATOM   5283  C  CG    . LEU B 1  172 ? 142.400 162.143 213.386 1.00 311.02 ? 436  LEU C CG    1 
ATOM   5284  C  CD1   . LEU B 1  172 ? 141.451 163.001 212.564 1.00 311.02 ? 436  LEU C CD1   1 
ATOM   5285  C  CD2   . LEU B 1  172 ? 143.815 162.222 212.835 1.00 311.02 ? 436  LEU C CD2   1 
ATOM   5286  N  N     . LEU B 1  173 ? 142.310 162.176 218.054 1.00 321.06 ? 437  LEU C N     1 
ATOM   5287  C  CA    . LEU B 1  173 ? 142.400 162.741 219.398 1.00 321.06 ? 437  LEU C CA    1 
ATOM   5288  C  C     . LEU B 1  173 ? 143.544 162.114 220.187 1.00 321.06 ? 437  LEU C C     1 
ATOM   5289  O  O     . LEU B 1  173 ? 144.344 162.827 220.806 1.00 321.06 ? 437  LEU C O     1 
ATOM   5290  C  CB    . LEU B 1  173 ? 141.074 162.561 220.135 1.00 321.06 ? 437  LEU C CB    1 
ATOM   5291  C  CG    . LEU B 1  173 ? 139.888 163.352 219.579 1.00 321.06 ? 437  LEU C CG    1 
ATOM   5292  C  CD1   . LEU B 1  173 ? 138.607 162.988 220.311 1.00 321.06 ? 437  LEU C CD1   1 
ATOM   5293  C  CD2   . LEU B 1  173 ? 140.152 164.848 219.660 1.00 321.06 ? 437  LEU C CD2   1 
ATOM   5294  N  N     . ALA B 1  174 ? 143.647 160.782 220.168 1.00 312.61 ? 438  ALA C N     1 
ATOM   5295  C  CA    . ALA B 1  174 ? 144.742 160.110 220.858 1.00 312.61 ? 438  ALA C CA    1 
ATOM   5296  C  C     . ALA B 1  174 ? 146.096 160.429 220.239 1.00 312.61 ? 438  ALA C C     1 
ATOM   5297  O  O     . ALA B 1  174 ? 147.120 160.310 220.920 1.00 312.61 ? 438  ALA C O     1 
ATOM   5298  C  CB    . ALA B 1  174 ? 144.516 158.598 220.862 1.00 312.61 ? 438  ALA C CB    1 
ATOM   5299  N  N     . LEU B 1  175 ? 146.123 160.828 218.967 1.00 305.70 ? 439  LEU C N     1 
ATOM   5300  C  CA    . LEU B 1  175 ? 147.376 161.194 218.319 1.00 305.70 ? 439  LEU C CA    1 
ATOM   5301  C  C     . LEU B 1  175 ? 147.807 162.599 218.720 1.00 305.70 ? 439  LEU C C     1 
ATOM   5302  O  O     . LEU B 1  175 ? 148.977 162.828 219.047 1.00 305.70 ? 439  LEU C O     1 
ATOM   5303  C  CB    . LEU B 1  175 ? 147.222 161.082 216.800 1.00 305.70 ? 439  LEU C CB    1 
ATOM   5304  C  CG    . LEU B 1  175 ? 148.466 161.144 215.911 1.00 305.70 ? 439  LEU C CG    1 
ATOM   5305  C  CD1   . LEU B 1  175 ? 148.214 160.355 214.640 1.00 305.70 ? 439  LEU C CD1   1 
ATOM   5306  C  CD2   . LEU B 1  175 ? 148.853 162.574 215.575 1.00 305.70 ? 439  LEU C CD2   1 
ATOM   5307  N  N     . ARG B 1  176 ? 146.850 163.523 218.707 1.00 323.34 ? 440  ARG C N     1 
ATOM   5308  C  CA    . ARG B 1  176 ? 147.104 164.902 219.091 1.00 323.34 ? 440  ARG C CA    1 
ATOM   5309  C  C     . ARG B 1  176 ? 147.534 164.929 220.550 1.00 323.34 ? 440  ARG C C     1 
ATOM   5310  O  O     . ARG B 1  176 ? 148.246 165.837 220.981 1.00 323.34 ? 440  ARG C O     1 
ATOM   5311  C  CB    . ARG B 1  176 ? 145.852 165.757 218.891 1.00 323.34 ? 440  ARG C CB    1 
ATOM   5312  N  N     . ALA B 1  177 ? 147.085 163.931 221.307 1.00 312.62 ? 441  ALA C N     1 
ATOM   5313  C  CA    . ALA B 1  177 ? 147.443 163.816 222.714 1.00 312.62 ? 441  ALA C CA    1 
ATOM   5314  C  C     . ALA B 1  177 ? 148.959 163.763 222.782 1.00 312.62 ? 441  ALA C C     1 
ATOM   5315  O  O     . ALA B 1  177 ? 149.578 164.314 223.692 1.00 312.62 ? 441  ALA C O     1 
ATOM   5316  C  CB    . ALA B 1  177 ? 146.833 162.564 223.320 1.00 312.62 ? 441  ALA C CB    1 
ATOM   5317  N  N     . ARG B 1  178 ? 149.547 163.088 221.800 1.00 304.42 ? 442  ARG C N     1 
ATOM   5318  C  CA    . ARG B 1  178 ? 151.000 162.981 221.696 1.00 304.42 ? 442  ARG C CA    1 
ATOM   5319  C  C     . ARG B 1  178 ? 151.523 164.217 220.947 1.00 304.42 ? 442  ARG C C     1 
ATOM   5320  O  O     . ARG B 1  178 ? 152.712 164.328 220.647 1.00 304.42 ? 442  ARG C O     1 
ATOM   5321  C  CB    . ARG B 1  178 ? 151.400 161.701 220.962 1.00 304.42 ? 442  ARG C CB    1 
ATOM   5322  C  CG    . ARG B 1  178 ? 150.645 160.462 221.414 1.00 304.42 ? 442  ARG C CG    1 
ATOM   5323  C  CD    . ARG B 1  178 ? 150.770 159.337 220.398 1.00 304.42 ? 442  ARG C CD    1 
ATOM   5324  N  NE    . ARG B 1  178 ? 149.556 159.177 219.602 1.00 304.42 ? 442  ARG C NE    1 
ATOM   5325  C  CZ    . ARG B 1  178 ? 148.729 158.142 219.701 1.00 304.42 ? 442  ARG C CZ    1 
ATOM   5326  N  NH1   . ARG B 1  178 ? 148.981 157.169 220.564 1.00 304.42 ? 442  ARG C NH1   1 
ATOM   5327  N  NH2   . ARG B 1  178 ? 147.647 158.080 218.937 1.00 304.42 ? 442  ARG C NH2   1 
ATOM   5328  N  N     . ASN B 1  179 ? 150.618 165.151 220.674 1.00 310.01 ? 443  ASN C N     1 
ATOM   5329  C  CA    . ASN B 1  179 ? 150.957 166.401 219.995 1.00 310.01 ? 443  ASN C CA    1 
ATOM   5330  C  C     . ASN B 1  179 ? 151.785 166.224 218.724 1.00 310.01 ? 443  ASN C C     1 
ATOM   5331  O  O     . ASN B 1  179 ? 152.724 166.979 218.477 1.00 310.01 ? 443  ASN C O     1 
ATOM   5332  C  CB    . ASN B 1  179 ? 151.681 167.347 220.958 1.00 310.01 ? 443  ASN C CB    1 
ATOM   5333  C  CG    . ASN B 1  179 ? 152.357 166.612 222.099 1.00 310.01 ? 443  ASN C CG    1 
ATOM   5334  O  OD1   . ASN B 1  179 ? 151.775 165.712 222.704 1.00 310.01 ? 443  ASN C OD1   1 
ATOM   5335  N  ND2   . ASN B 1  179 ? 153.592 166.995 222.399 1.00 310.01 ? 443  ASN C ND2   1 
ATOM   5336  N  N     . GLU B 1  180 ? 151.432 165.228 217.920 1.00 293.12 ? 444  GLU C N     1 
ATOM   5337  C  CA    . GLU B 1  180 ? 152.130 164.967 216.671 1.00 293.12 ? 444  GLU C CA    1 
ATOM   5338  C  C     . GLU B 1  180 ? 151.356 165.564 215.503 1.00 293.12 ? 444  GLU C C     1 
ATOM   5339  O  O     . GLU B 1  180 ? 150.123 165.606 215.505 1.00 293.12 ? 444  GLU C O     1 
ATOM   5340  C  CB    . GLU B 1  180 ? 152.320 163.465 216.450 1.00 293.12 ? 444  GLU C CB    1 
ATOM   5341  C  CG    . GLU B 1  180 ? 153.269 162.800 217.431 1.00 293.12 ? 444  GLU C CG    1 
ATOM   5342  C  CD    . GLU B 1  180 ? 153.408 161.312 217.183 1.00 293.12 ? 444  GLU C CD    1 
ATOM   5343  O  OE1   . GLU B 1  180 ? 152.665 160.778 216.333 1.00 293.12 ? 444  GLU C OE1   1 
ATOM   5344  O  OE2   . GLU B 1  180 ? 154.263 160.675 217.835 1.00 293.12 ? 444  GLU C OE2   1 
ATOM   5345  N  N     . HIS B 1  181 ? 152.097 166.034 214.503 1.00 277.45 ? 445  HIS C N     1 
ATOM   5346  C  CA    . HIS B 1  181 ? 151.506 166.571 213.285 1.00 277.45 ? 445  HIS C CA    1 
ATOM   5347  C  C     . HIS B 1  181 ? 151.790 165.726 212.055 1.00 277.45 ? 445  HIS C C     1 
ATOM   5348  O  O     . HIS B 1  181 ? 150.950 165.672 211.153 1.00 277.45 ? 445  HIS C O     1 
ATOM   5349  C  CB    . HIS B 1  181 ? 152.005 167.999 213.033 1.00 277.45 ? 445  HIS C CB    1 
ATOM   5350  C  CG    . HIS B 1  181 ? 151.580 168.982 214.080 1.00 277.45 ? 445  HIS C CG    1 
ATOM   5351  N  ND1   . HIS B 1  181 ? 150.296 169.476 214.159 1.00 277.45 ? 445  HIS C ND1   1 
ATOM   5352  C  CD2   . HIS B 1  181 ? 152.269 169.564 215.090 1.00 277.45 ? 445  HIS C CD2   1 
ATOM   5353  C  CE1   . HIS B 1  181 ? 150.212 170.319 215.173 1.00 277.45 ? 445  HIS C CE1   1 
ATOM   5354  N  NE2   . HIS B 1  181 ? 151.396 170.390 215.754 1.00 277.45 ? 445  HIS C NE2   1 
ATOM   5355  N  N     . ARG B 1  182 ? 152.944 165.067 212.029 1.00 256.19 ? 446  ARG C N     1 
ATOM   5356  C  CA    . ARG B 1  182 ? 153.331 164.228 210.901 1.00 256.19 ? 446  ARG C CA    1 
ATOM   5357  C  C     . ARG B 1  182 ? 152.333 163.104 210.645 1.00 256.19 ? 446  ARG C C     1 
ATOM   5358  O  O     . ARG B 1  182 ? 151.799 162.976 209.544 1.00 256.19 ? 446  ARG C O     1 
ATOM   5359  C  CB    . ARG B 1  182 ? 154.725 163.641 211.130 1.00 256.19 ? 446  ARG C CB    1 
ATOM   5360  C  CG    . ARG B 1  182 ? 155.078 162.496 210.195 1.00 256.19 ? 446  ARG C CG    1 
ATOM   5361  C  CD    . ARG B 1  182 ? 155.076 161.163 210.924 1.00 256.19 ? 446  ARG C CD    1 
ATOM   5362  N  NE    . ARG B 1  182 ? 155.565 161.288 212.294 1.00 256.19 ? 446  ARG C NE    1 
ATOM   5363  C  CZ    . ARG B 1  182 ? 156.802 160.987 212.675 1.00 256.19 ? 446  ARG C CZ    1 
ATOM   5364  N  NH1   . ARG B 1  182 ? 157.681 160.541 211.789 1.00 256.19 ? 446  ARG C NH1   1 
ATOM   5365  N  NH2   . ARG B 1  182 ? 157.160 161.132 213.944 1.00 256.19 ? 446  ARG C NH2   1 
ATOM   5366  N  N     . GLN B 1  183 ? 152.087 162.300 211.676 1.00 254.53 ? 447  GLN C N     1 
ATOM   5367  C  CA    . GLN B 1  183 ? 151.157 161.182 211.585 1.00 254.53 ? 447  GLN C CA    1 
ATOM   5368  C  C     . GLN B 1  183 ? 149.735 161.664 211.323 1.00 254.53 ? 447  GLN C C     1 
ATOM   5369  O  O     . GLN B 1  183 ? 149.003 161.059 210.541 1.00 254.53 ? 447  GLN C O     1 
ATOM   5370  C  CB    . GLN B 1  183 ? 151.202 160.341 212.861 1.00 254.53 ? 447  GLN C CB    1 
ATOM   5371  C  CG    . GLN B 1  183 ? 151.941 159.022 212.707 1.00 254.53 ? 447  GLN C CG    1 
ATOM   5372  C  CD    . GLN B 1  183 ? 151.004 157.832 212.634 1.00 254.53 ? 447  GLN C CD    1 
ATOM   5373  O  OE1   . GLN B 1  183 ? 150.729 157.309 211.554 1.00 254.53 ? 447  GLN C OE1   1 
ATOM   5374  N  NE2   . GLN B 1  183 ? 150.509 157.396 213.786 1.00 254.53 ? 447  GLN C NE2   1 
ATOM   5375  N  N     . ALA B 1  184 ? 149.342 162.749 211.982 1.00 256.75 ? 448  ALA C N     1 
ATOM   5376  C  CA    . ALA B 1  184 ? 148.003 163.297 211.791 1.00 256.75 ? 448  ALA C CA    1 
ATOM   5377  C  C     . ALA B 1  184 ? 147.775 163.685 210.337 1.00 256.75 ? 448  ALA C C     1 
ATOM   5378  O  O     . ALA B 1  184 ? 146.759 163.317 209.734 1.00 256.75 ? 448  ALA C O     1 
ATOM   5379  C  CB    . ALA B 1  184 ? 147.793 164.502 212.708 1.00 256.75 ? 448  ALA C CB    1 
ATOM   5380  N  N     . ASP B 1  185 ? 148.719 164.429 209.754 1.00 249.78 ? 449  ASP C N     1 
ATOM   5381  C  CA    . ASP B 1  185 ? 148.591 164.822 208.355 1.00 249.78 ? 449  ASP C CA    1 
ATOM   5382  C  C     . ASP B 1  185 ? 148.628 163.608 207.435 1.00 249.78 ? 449  ASP C C     1 
ATOM   5383  O  O     . ASP B 1  185 ? 147.909 163.565 206.429 1.00 249.78 ? 449  ASP C O     1 
ATOM   5384  C  CB    . ASP B 1  185 ? 149.696 165.813 207.988 1.00 249.78 ? 449  ASP C CB    1 
ATOM   5385  C  CG    . ASP B 1  185 ? 149.534 167.151 208.684 1.00 249.78 ? 449  ASP C CG    1 
ATOM   5386  O  OD1   . ASP B 1  185 ? 148.383 167.533 208.983 1.00 249.78 ? 449  ASP C OD1   1 
ATOM   5387  O  OD2   . ASP B 1  185 ? 150.559 167.820 208.934 1.00 249.78 ? 449  ASP C OD2   1 
ATOM   5388  N  N     . GLU B 1  186 ? 149.447 162.607 207.769 1.00 240.20 ? 450  GLU C N     1 
ATOM   5389  C  CA    . GLU B 1  186 ? 149.512 161.398 206.954 1.00 240.20 ? 450  GLU C CA    1 
ATOM   5390  C  C     . GLU B 1  186 ? 148.165 160.690 206.914 1.00 240.20 ? 450  GLU C C     1 
ATOM   5391  O  O     . GLU B 1  186 ? 147.659 160.355 205.837 1.00 240.20 ? 450  GLU C O     1 
ATOM   5392  C  CB    . GLU B 1  186 ? 150.596 160.458 207.483 1.00 240.20 ? 450  GLU C CB    1 
ATOM   5393  C  CG    . GLU B 1  186 ? 152.015 160.951 207.262 1.00 240.20 ? 450  GLU C CG    1 
ATOM   5394  C  CD    . GLU B 1  186 ? 153.055 159.991 207.803 1.00 240.20 ? 450  GLU C CD    1 
ATOM   5395  O  OE1   . GLU B 1  186 ? 152.668 158.997 208.452 1.00 240.20 ? 450  GLU C OE1   1 
ATOM   5396  O  OE2   . GLU B 1  186 ? 154.260 160.232 207.580 1.00 240.20 ? 450  GLU C OE2   1 
ATOM   5397  N  N     . LEU B 1  187 ? 147.563 160.457 208.082 1.00 239.65 ? 451  LEU C N     1 
ATOM   5398  C  CA    . LEU B 1  187 ? 146.279 159.766 208.106 1.00 239.65 ? 451  LEU C CA    1 
ATOM   5399  C  C     . LEU B 1  187 ? 145.167 160.624 207.512 1.00 239.65 ? 451  LEU C C     1 
ATOM   5400  O  O     . LEU B 1  187 ? 144.230 160.084 206.914 1.00 239.65 ? 451  LEU C O     1 
ATOM   5401  C  CB    . LEU B 1  187 ? 145.935 159.325 209.531 1.00 239.65 ? 451  LEU C CB    1 
ATOM   5402  C  CG    . LEU B 1  187 ? 144.681 158.454 209.693 1.00 239.65 ? 451  LEU C CG    1 
ATOM   5403  C  CD1   . LEU B 1  187 ? 144.862 157.422 210.790 1.00 239.65 ? 451  LEU C CD1   1 
ATOM   5404  C  CD2   . LEU B 1  187 ? 143.448 159.312 209.984 1.00 239.65 ? 451  LEU C CD2   1 
ATOM   5405  N  N     . GLU B 1  188 ? 145.249 161.950 207.651 1.00 229.88 ? 452  GLU C N     1 
ATOM   5406  C  CA    . GLU B 1  188 ? 144.271 162.806 206.989 1.00 229.88 ? 452  GLU C CA    1 
ATOM   5407  C  C     . GLU B 1  188 ? 144.362 162.669 205.474 1.00 229.88 ? 452  GLU C C     1 
ATOM   5408  O  O     . GLU B 1  188 ? 143.337 162.550 204.792 1.00 229.88 ? 452  GLU C O     1 
ATOM   5409  C  CB    . GLU B 1  188 ? 144.469 164.261 207.411 1.00 229.88 ? 452  GLU C CB    1 
ATOM   5410  C  CG    . GLU B 1  188 ? 143.458 165.223 206.806 1.00 229.88 ? 452  GLU C CG    1 
ATOM   5411  C  CD    . GLU B 1  188 ? 142.043 164.971 207.296 1.00 229.88 ? 452  GLU C CD    1 
ATOM   5412  O  OE1   . GLU B 1  188 ? 141.883 164.445 208.417 1.00 229.88 ? 452  GLU C OE1   1 
ATOM   5413  O  OE2   . GLU B 1  188 ? 141.090 165.300 206.559 1.00 229.88 ? 452  GLU C OE2   1 
ATOM   5414  N  N     . ALA B 1  189 ? 145.584 162.665 204.935 1.00 217.55 ? 453  ALA C N     1 
ATOM   5415  C  CA    . ALA B 1  189 ? 145.761 162.503 203.496 1.00 217.55 ? 453  ALA C CA    1 
ATOM   5416  C  C     . ALA B 1  189 ? 145.309 161.124 203.031 1.00 217.55 ? 453  ALA C C     1 
ATOM   5417  O  O     . ALA B 1  189 ? 144.736 160.987 201.943 1.00 217.55 ? 453  ALA C O     1 
ATOM   5418  C  CB    . ALA B 1  189 ? 147.222 162.746 203.117 1.00 217.55 ? 453  ALA C CB    1 
ATOM   5419  N  N     . ILE B 1  190 ? 145.554 160.091 203.838 1.00 217.32 ? 454  ILE C N     1 
ATOM   5420  C  CA    . ILE B 1  190 ? 145.151 158.738 203.459 1.00 217.32 ? 454  ILE C CA    1 
ATOM   5421  C  C     . ILE B 1  190 ? 143.631 158.618 203.445 1.00 217.32 ? 454  ILE C C     1 
ATOM   5422  O  O     . ILE B 1  190 ? 143.034 158.196 202.448 1.00 217.32 ? 454  ILE C O     1 
ATOM   5423  C  CB    . ILE B 1  190 ? 145.790 157.696 204.394 1.00 217.32 ? 454  ILE C CB    1 
ATOM   5424  C  CG1   . ILE B 1  190 ? 147.315 157.732 204.276 1.00 217.32 ? 454  ILE C CG1   1 
ATOM   5425  C  CG2   . ILE B 1  190 ? 145.260 156.305 204.084 1.00 217.32 ? 454  ILE C CG2   1 
ATOM   5426  C  CD1   . ILE B 1  190 ? 147.831 157.419 202.890 1.00 217.32 ? 454  ILE C CD1   1 
ATOM   5427  N  N     . MET B 1  191 ? 143.007 158.983 204.559 1.00 221.56 ? 455  MET C N     1 
ATOM   5428  C  CA    . MET B 1  191 ? 141.556 158.894 204.690 1.00 221.56 ? 455  MET C CA    1 
ATOM   5429  C  C     . MET B 1  191 ? 140.800 159.814 203.737 1.00 221.56 ? 455  MET C C     1 
ATOM   5430  O  O     . MET B 1  191 ? 139.654 159.539 203.384 1.00 221.56 ? 455  MET C O     1 
ATOM   5431  C  CB    . MET B 1  191 ? 141.127 159.155 206.136 1.00 221.56 ? 455  MET C CB    1 
ATOM   5432  C  CG    . MET B 1  191 ? 140.670 157.906 206.875 1.00 221.56 ? 455  MET C CG    1 
ATOM   5433  S  SD    . MET B 1  191 ? 141.488 156.403 206.300 1.00 221.56 ? 455  MET C SD    1 
ATOM   5434  C  CE    . MET B 1  191 ? 140.119 155.538 205.535 1.00 221.56 ? 455  MET C CE    1 
ATOM   5435  N  N     . GLN B 1  192 ? 141.438 160.903 203.321 1.00 204.30 ? 456  GLN C N     1 
ATOM   5436  C  CA    . GLN B 1  192 ? 140.798 161.841 202.408 1.00 204.30 ? 456  GLN C CA    1 
ATOM   5437  C  C     . GLN B 1  192 ? 141.041 161.492 200.947 1.00 204.30 ? 456  GLN C C     1 
ATOM   5438  O  O     . GLN B 1  192 ? 140.163 161.724 200.107 1.00 204.30 ? 456  GLN C O     1 
ATOM   5439  C  CB    . GLN B 1  192 ? 141.292 163.264 202.688 1.00 204.30 ? 456  GLN C CB    1 
ATOM   5440  C  CG    . GLN B 1  192 ? 140.618 164.332 201.847 1.00 204.30 ? 456  GLN C CG    1 
ATOM   5441  C  CD    . GLN B 1  192 ? 139.125 164.414 202.095 1.00 204.30 ? 456  GLN C CD    1 
ATOM   5442  O  OE1   . GLN B 1  192 ? 138.324 163.961 201.278 1.00 204.30 ? 456  GLN C OE1   1 
ATOM   5443  N  NE2   . GLN B 1  192 ? 138.743 164.995 203.226 1.00 204.30 ? 456  GLN C NE2   1 
ATOM   5444  N  N     . GLY B 1  193 ? 142.201 160.926 200.627 1.00 183.12 ? 457  GLY C N     1 
ATOM   5445  C  CA    . GLY B 1  193 ? 142.515 160.568 199.259 1.00 183.12 ? 457  GLY C CA    1 
ATOM   5446  C  C     . GLY B 1  193 ? 143.245 161.663 198.511 1.00 183.12 ? 457  GLY C C     1 
ATOM   5447  O  O     . GLY B 1  193 ? 142.848 162.042 197.405 1.00 183.12 ? 457  GLY C O     1 
ATOM   5448  N  N     . ARG B 1  194 ? 144.333 162.152 199.100 1.00 178.46 ? 458  ARG C N     1 
ATOM   5449  C  CA    . ARG B 1  194 ? 145.114 163.219 198.486 1.00 178.46 ? 458  ARG C CA    1 
ATOM   5450  C  C     . ARG B 1  194 ? 146.623 162.964 198.457 1.00 178.46 ? 458  ARG C C     1 
ATOM   5451  O  O     . ARG B 1  194 ? 147.338 163.598 197.684 1.00 178.46 ? 458  ARG C O     1 
ATOM   5452  C  CB    . ARG B 1  194 ? 144.825 164.551 199.180 1.00 178.46 ? 458  ARG C CB    1 
ATOM   5453  C  CG    . ARG B 1  194 ? 143.381 164.714 199.626 1.00 178.46 ? 458  ARG C CG    1 
ATOM   5454  C  CD    . ARG B 1  194 ? 143.296 165.400 200.979 1.00 178.46 ? 458  ARG C CD    1 
ATOM   5455  N  NE    . ARG B 1  194 ? 143.768 166.780 200.920 1.00 178.46 ? 458  ARG C NE    1 
ATOM   5456  C  CZ    . ARG B 1  194 ? 145.049 167.131 200.937 1.00 178.46 ? 458  ARG C CZ    1 
ATOM   5457  N  NH1   . ARG B 1  194 ? 145.389 168.411 200.878 1.00 178.46 ? 458  ARG C NH1   1 
ATOM   5458  N  NH2   . ARG B 1  194 ? 145.992 166.202 201.014 1.00 178.46 ? 458  ARG C NH2   1 
ATOM   5459  N  N     . GLY B 1  195 ? 147.110 162.047 199.290 1.00 165.03 ? 459  GLY C N     1 
ATOM   5460  C  CA    . GLY B 1  195 ? 148.531 161.756 199.320 1.00 165.03 ? 459  GLY C CA    1 
ATOM   5461  C  C     . GLY B 1  195 ? 148.773 160.273 199.492 1.00 165.03 ? 459  GLY C C     1 
ATOM   5462  O  O     . GLY B 1  195 ? 147.964 159.554 200.084 1.00 165.03 ? 459  GLY C O     1 
ATOM   5463  N  N     . SER B 1  196 ? 149.908 159.816 198.969 1.00 146.77 ? 460  SER C N     1 
ATOM   5464  C  CA    . SER B 1  196 ? 150.275 158.406 199.021 1.00 146.77 ? 460  SER C CA    1 
ATOM   5465  C  C     . SER B 1  196 ? 149.137 157.611 198.408 1.00 146.77 ? 460  SER C C     1 
ATOM   5466  O  O     . SER B 1  196 ? 148.450 156.851 199.090 1.00 146.77 ? 460  SER C O     1 
ATOM   5467  C  CB    . SER B 1  196 ? 150.535 157.957 200.457 1.00 146.77 ? 460  SER C CB    1 
ATOM   5468  O  OG    . SER B 1  196 ? 151.709 157.167 200.533 1.00 146.77 ? 460  SER C OG    1 
ATOM   5469  N  N     . GLY B 1  197 ? 148.946 157.795 197.107 1.00 122.56 ? 461  GLY C N     1 
ATOM   5470  C  CA    . GLY B 1  197 ? 147.871 157.139 196.392 1.00 122.56 ? 461  GLY C CA    1 
ATOM   5471  C  C     . GLY B 1  197 ? 147.124 158.112 195.507 1.00 122.56 ? 461  GLY C C     1 
ATOM   5472  O  O     . GLY B 1  197 ? 146.675 159.166 195.967 1.00 122.56 ? 461  GLY C O     1 
ATOM   5473  N  N     . LEU B 1  198 ? 146.983 157.767 194.233 1.00 96.94  ? 462  LEU C N     1 
ATOM   5474  C  CA    . LEU B 1  198 ? 146.401 158.654 193.239 1.00 96.94  ? 462  LEU C CA    1 
ATOM   5475  C  C     . LEU B 1  198 ? 144.921 158.348 193.070 1.00 96.94  ? 462  LEU C C     1 
ATOM   5476  O  O     . LEU B 1  198 ? 144.487 157.210 193.263 1.00 96.94  ? 462  LEU C O     1 
ATOM   5477  C  CB    . LEU B 1  198 ? 147.114 158.507 191.893 1.00 96.94  ? 462  LEU C CB    1 
ATOM   5478  C  CG    . LEU B 1  198 ? 148.464 159.203 191.709 1.00 96.94  ? 462  LEU C CG    1 
ATOM   5479  C  CD1   . LEU B 1  198 ? 149.555 158.510 192.501 1.00 96.94  ? 462  LEU C CD1   1 
ATOM   5480  C  CD2   . LEU B 1  198 ? 148.827 159.241 190.240 1.00 96.94  ? 462  LEU C CD2   1 
ATOM   5481  N  N     . GLN B 1  199 ? 144.149 159.372 192.723 1.00 92.91  ? 463  GLN C N     1 
ATOM   5482  C  CA    . GLN B 1  199 ? 142.752 159.167 192.386 1.00 92.91  ? 463  GLN C CA    1 
ATOM   5483  C  C     . GLN B 1  199 ? 142.639 158.496 191.016 1.00 92.91  ? 463  GLN C C     1 
ATOM   5484  O  O     . GLN B 1  199 ? 143.548 158.605 190.189 1.00 92.91  ? 463  GLN C O     1 
ATOM   5485  C  CB    . GLN B 1  199 ? 142.004 160.497 192.387 1.00 92.91  ? 463  GLN C CB    1 
ATOM   5486  C  CG    . GLN B 1  199 ? 141.940 161.152 193.752 1.00 92.91  ? 463  GLN C CG    1 
ATOM   5487  C  CD    . GLN B 1  199 ? 141.147 160.330 194.747 1.00 92.91  ? 463  GLN C CD    1 
ATOM   5488  O  OE1   . GLN B 1  199 ? 140.126 159.735 194.403 1.00 92.91  ? 463  GLN C OE1   1 
ATOM   5489  N  NE2   . GLN B 1  199 ? 141.616 160.288 195.988 1.00 92.91  ? 463  GLN C NE2   1 
ATOM   5490  N  N     . PRO B 1  200 ? 141.539 157.785 190.754 1.00 81.70  ? 464  PRO C N     1 
ATOM   5491  C  CA    . PRO B 1  200 ? 141.400 157.133 189.441 1.00 81.70  ? 464  PRO C CA    1 
ATOM   5492  C  C     . PRO B 1  200 ? 141.399 158.110 188.279 1.00 81.70  ? 464  PRO C C     1 
ATOM   5493  O  O     . PRO B 1  200 ? 141.930 157.785 187.210 1.00 81.70  ? 464  PRO C O     1 
ATOM   5494  C  CB    . PRO B 1  200 ? 140.066 156.385 189.561 1.00 81.70  ? 464  PRO C CB    1 
ATOM   5495  C  CG    . PRO B 1  200 ? 139.319 157.104 190.628 1.00 81.70  ? 464  PRO C CG    1 
ATOM   5496  C  CD    . PRO B 1  200 ? 140.359 157.562 191.606 1.00 81.70  ? 464  PRO C CD    1 
ATOM   5497  N  N     . ALA B 1  201 ? 140.831 159.305 188.456 1.00 76.63  ? 465  ALA C N     1 
ATOM   5498  C  CA    . ALA B 1  201 ? 140.868 160.299 187.390 1.00 76.63  ? 465  ALA C CA    1 
ATOM   5499  C  C     . ALA B 1  201 ? 142.294 160.756 187.114 1.00 76.63  ? 465  ALA C C     1 
ATOM   5500  O  O     . ALA B 1  201 ? 142.664 161.003 185.960 1.00 76.63  ? 465  ALA C O     1 
ATOM   5501  C  CB    . ALA B 1  201 ? 139.981 161.490 187.752 1.00 76.63  ? 465  ALA C CB    1 
ATOM   5502  N  N     . VAL B 1  202 ? 143.115 160.856 188.160 1.00 77.31  ? 466  VAL C N     1 
ATOM   5503  C  CA    . VAL B 1  202 ? 144.493 161.303 187.987 1.00 77.31  ? 466  VAL C CA    1 
ATOM   5504  C  C     . VAL B 1  202 ? 145.287 160.292 187.169 1.00 77.31  ? 466  VAL C C     1 
ATOM   5505  O  O     . VAL B 1  202 ? 145.946 160.645 186.182 1.00 77.31  ? 466  VAL C O     1 
ATOM   5506  C  CB    . VAL B 1  202 ? 145.147 161.556 189.356 1.00 77.31  ? 466  VAL C CB    1 
ATOM   5507  C  CG1   . VAL B 1  202 ? 146.612 161.891 189.181 1.00 77.31  ? 466  VAL C CG1   1 
ATOM   5508  C  CG2   . VAL B 1  202 ? 144.423 162.673 190.088 1.00 77.31  ? 466  VAL C CG2   1 
ATOM   5509  N  N     . CYS B 1  203 ? 145.244 159.019 187.568 1.00 78.52  ? 467  CYS C N     1 
ATOM   5510  C  CA    . CYS B 1  203 ? 145.974 158.007 186.815 1.00 78.52  ? 467  CYS C CA    1 
ATOM   5511  C  C     . CYS B 1  203 ? 145.372 157.805 185.431 1.00 78.52  ? 467  CYS C C     1 
ATOM   5512  O  O     . CYS B 1  203 ? 146.087 157.436 184.495 1.00 78.52  ? 467  CYS C O     1 
ATOM   5513  C  CB    . CYS B 1  203 ? 146.015 156.692 187.590 1.00 78.52  ? 467  CYS C CB    1 
ATOM   5514  S  SG    . CYS B 1  203 ? 144.412 155.924 187.845 1.00 78.52  ? 467  CYS C SG    1 
ATOM   5515  N  N     . LEU B 1  204 ? 144.073 158.072 185.271 1.00 72.38  ? 468  LEU C N     1 
ATOM   5516  C  CA    . LEU B 1  204 ? 143.475 158.041 183.940 1.00 72.38  ? 468  LEU C CA    1 
ATOM   5517  C  C     . LEU B 1  204 ? 144.067 159.127 183.051 1.00 72.38  ? 468  LEU C C     1 
ATOM   5518  O  O     . LEU B 1  204 ? 144.415 158.875 181.892 1.00 72.38  ? 468  LEU C O     1 
ATOM   5519  C  CB    . LEU B 1  204 ? 141.958 158.198 184.042 1.00 72.38  ? 468  LEU C CB    1 
ATOM   5520  C  CG    . LEU B 1  204 ? 141.188 158.132 182.722 1.00 72.38  ? 468  LEU C CG    1 
ATOM   5521  C  CD1   . LEU B 1  204 ? 141.370 156.775 182.064 1.00 72.38  ? 468  LEU C CD1   1 
ATOM   5522  C  CD2   . LEU B 1  204 ? 139.715 158.424 182.948 1.00 72.38  ? 468  LEU C CD2   1 
ATOM   5523  N  N     . ALA B 1  205 ? 144.178 160.347 183.580 1.00 71.14  ? 469  ALA C N     1 
ATOM   5524  C  CA    . ALA B 1  205 ? 144.798 161.431 182.826 1.00 71.14  ? 469  ALA C CA    1 
ATOM   5525  C  C     . ALA B 1  205 ? 146.246 161.106 182.492 1.00 71.14  ? 469  ALA C C     1 
ATOM   5526  O  O     . ALA B 1  205 ? 146.724 161.418 181.395 1.00 71.14  ? 469  ALA C O     1 
ATOM   5527  C  CB    . ALA B 1  205 ? 144.712 162.736 183.614 1.00 71.14  ? 469  ALA C CB    1 
ATOM   5528  N  N     . ILE B 1  206 ? 146.959 160.474 183.424 1.00 68.38  ? 470  ILE C N     1 
ATOM   5529  C  CA    . ILE B 1  206 ? 148.353 160.118 183.175 1.00 68.38  ? 470  ILE C CA    1 
ATOM   5530  C  C     . ILE B 1  206 ? 148.449 159.071 182.071 1.00 68.38  ? 470  ILE C C     1 
ATOM   5531  O  O     . ILE B 1  206 ? 149.295 159.166 181.175 1.00 68.38  ? 470  ILE C O     1 
ATOM   5532  C  CB    . ILE B 1  206 ? 149.026 159.637 184.472 1.00 68.38  ? 470  ILE C CB    1 
ATOM   5533  C  CG1   . ILE B 1  206 ? 149.101 160.781 185.482 1.00 68.38  ? 470  ILE C CG1   1 
ATOM   5534  C  CG2   . ILE B 1  206 ? 150.410 159.088 184.184 1.00 68.38  ? 470  ILE C CG2   1 
ATOM   5535  C  CD1   . ILE B 1  206 ? 149.534 160.346 186.856 1.00 68.38  ? 470  ILE C CD1   1 
ATOM   5536  N  N     . ARG B 1  207 ? 147.572 158.078 182.121 1.00 67.73  ? 471  ARG C N     1 
ATOM   5537  C  CA    . ARG B 1  207 ? 147.583 157.018 181.124 1.00 67.73  ? 471  ARG C CA    1 
ATOM   5538  C  C     . ARG B 1  207 ? 147.174 157.498 179.737 1.00 67.73  ? 471  ARG C C     1 
ATOM   5539  O  O     . ARG B 1  207 ? 147.677 157.000 178.734 1.00 67.73  ? 471  ARG C O     1 
ATOM   5540  C  CB    . ARG B 1  207 ? 146.676 155.870 181.558 1.00 67.73  ? 471  ARG C CB    1 
ATOM   5541  C  CG    . ARG B 1  207 ? 146.239 154.970 180.417 1.00 67.73  ? 471  ARG C CG    1 
ATOM   5542  C  CD    . ARG B 1  207 ? 145.128 154.033 180.855 1.00 67.73  ? 471  ARG C CD    1 
ATOM   5543  N  NE    . ARG B 1  207 ? 144.637 153.217 179.751 1.00 67.73  ? 471  ARG C NE    1 
ATOM   5544  C  CZ    . ARG B 1  207 ? 144.074 153.709 178.654 1.00 67.73  ? 471  ARG C CZ    1 
ATOM   5545  N  NH1   . ARG B 1  207 ? 143.930 155.018 178.512 1.00 67.73  ? 471  ARG C NH1   1 
ATOM   5546  N  NH2   . ARG B 1  207 ? 143.654 152.893 177.699 1.00 67.73  ? 471  ARG C NH2   1 
ATOM   5547  N  N     . VAL B 1  208 ? 146.268 158.467 179.677 1.00 68.23  ? 472  VAL C N     1 
ATOM   5548  C  CA    . VAL B 1  208 ? 145.794 158.970 178.390 1.00 68.23  ? 472  VAL C CA    1 
ATOM   5549  C  C     . VAL B 1  208 ? 146.794 159.956 177.796 1.00 68.23  ? 472  VAL C C     1 
ATOM   5550  O  O     . VAL B 1  208 ? 147.215 159.819 176.642 1.00 68.23  ? 472  VAL C O     1 
ATOM   5551  C  CB    . VAL B 1  208 ? 144.400 159.603 178.538 1.00 68.23  ? 472  VAL C CB    1 
ATOM   5552  C  CG1   . VAL B 1  208 ? 144.001 160.289 177.250 1.00 68.23  ? 472  VAL C CG1   1 
ATOM   5553  C  CG2   . VAL B 1  208 ? 143.378 158.541 178.905 1.00 68.23  ? 472  VAL C CG2   1 
ATOM   5554  N  N     . ASN B 1  209 ? 147.188 160.966 178.574 1.00 66.77  ? 473  ASN C N     1 
ATOM   5555  C  CA    . ASN B 1  209 ? 148.056 162.022 178.064 1.00 66.77  ? 473  ASN C CA    1 
ATOM   5556  C  C     . ASN B 1  209 ? 149.481 161.550 177.800 1.00 66.77  ? 473  ASN C C     1 
ATOM   5557  O  O     . ASN B 1  209 ? 150.281 162.332 177.277 1.00 66.77  ? 473  ASN C O     1 
ATOM   5558  C  CB    . ASN B 1  209 ? 148.070 163.199 179.043 1.00 66.77  ? 473  ASN C CB    1 
ATOM   5559  C  CG    . ASN B 1  209 ? 148.463 164.511 178.383 1.00 66.77  ? 473  ASN C CG    1 
ATOM   5560  O  OD1   . ASN B 1  209 ? 148.246 165.585 178.942 1.00 66.77  ? 473  ASN C OD1   1 
ATOM   5561  N  ND2   . ASN B 1  209 ? 149.037 164.431 177.189 1.00 66.77  ? 473  ASN C ND2   1 
ATOM   5562  N  N     . THR B 1  210 ? 149.820 160.306 178.140 1.00 66.41  ? 474  THR C N     1 
ATOM   5563  C  CA    . THR B 1  210 ? 151.137 159.751 177.851 1.00 66.41  ? 474  THR C CA    1 
ATOM   5564  C  C     . THR B 1  210 ? 151.064 158.609 176.847 1.00 66.41  ? 474  THR C C     1 
ATOM   5565  O  O     . THR B 1  210 ? 152.041 157.871 176.680 1.00 66.41  ? 474  THR C O     1 
ATOM   5566  C  CB    . THR B 1  210 ? 151.823 159.280 179.135 1.00 66.41  ? 474  THR C CB    1 
ATOM   5567  O  OG1   . THR B 1  210 ? 151.012 158.285 179.773 1.00 66.41  ? 474  THR C OG1   1 
ATOM   5568  C  CG2   . THR B 1  210 ? 152.037 160.447 180.084 1.00 66.41  ? 474  THR C CG2   1 
ATOM   5569  N  N     . PHE B 1  211 ? 149.939 158.481 176.156 1.00 68.55  ? 475  PHE C N     1 
ATOM   5570  C  CA    . PHE B 1  211 ? 149.786 157.455 175.128 1.00 68.55  ? 475  PHE C CA    1 
ATOM   5571  C  C     . PHE B 1  211 ? 150.004 156.020 175.595 1.00 68.55  ? 475  PHE C C     1 
ATOM   5572  O  O     . PHE B 1  211 ? 150.305 155.147 174.785 1.00 68.55  ? 475  PHE C O     1 
ATOM   5573  C  CB    . PHE B 1  211 ? 150.743 157.735 173.967 1.00 68.55  ? 475  PHE C CB    1 
ATOM   5574  C  CG    . PHE B 1  211 ? 150.459 159.016 173.240 1.00 68.55  ? 475  PHE C CG    1 
ATOM   5575  C  CD1   . PHE B 1  211 ? 149.494 159.068 172.253 1.00 68.55  ? 475  PHE C CD1   1 
ATOM   5576  C  CD2   . PHE B 1  211 ? 151.165 160.166 173.539 1.00 68.55  ? 475  PHE C CD2   1 
ATOM   5577  C  CE1   . PHE B 1  211 ? 149.234 160.245 171.580 1.00 68.55  ? 475  PHE C CE1   1 
ATOM   5578  C  CE2   . PHE B 1  211 ? 150.912 161.346 172.871 1.00 68.55  ? 475  PHE C CE2   1 
ATOM   5579  C  CZ    . PHE B 1  211 ? 149.943 161.386 171.889 1.00 68.55  ? 475  PHE C CZ    1 
ATOM   5580  N  N     . LEU B 1  212 ? 149.860 155.767 176.888 1.00 69.54  ? 476  LEU C N     1 
ATOM   5581  C  CA    . LEU B 1  212 ? 150.041 154.416 177.399 1.00 69.54  ? 476  LEU C CA    1 
ATOM   5582  C  C     . LEU B 1  212 ? 148.920 153.500 176.928 1.00 69.54  ? 476  LEU C C     1 
ATOM   5583  O  O     . LEU B 1  212 ? 147.739 153.850 176.996 1.00 69.54  ? 476  LEU C O     1 
ATOM   5584  C  CB    . LEU B 1  212 ? 150.091 154.426 178.926 1.00 69.54  ? 476  LEU C CB    1 
ATOM   5585  C  CG    . LEU B 1  212 ? 151.346 154.996 179.580 1.00 69.54  ? 476  LEU C CG    1 
ATOM   5586  C  CD1   . LEU B 1  212 ? 151.148 155.134 181.079 1.00 69.54  ? 476  LEU C CD1   1 
ATOM   5587  C  CD2   . LEU B 1  212 ? 152.520 154.085 179.280 1.00 69.54  ? 476  LEU C CD2   1 
ATOM   5588  N  N     . SER B 1  213 ? 149.299 152.322 176.445 1.00 74.93  ? 477  SER C N     1 
ATOM   5589  C  CA    . SER B 1  213 ? 148.319 151.294 176.139 1.00 74.93  ? 477  SER C CA    1 
ATOM   5590  C  C     . SER B 1  213 ? 147.812 150.658 177.430 1.00 74.93  ? 477  SER C C     1 
ATOM   5591  O  O     . SER B 1  213 ? 148.456 150.724 178.481 1.00 74.93  ? 477  SER C O     1 
ATOM   5592  C  CB    . SER B 1  213 ? 148.925 150.230 175.223 1.00 74.93  ? 477  SER C CB    1 
ATOM   5593  O  OG    . SER B 1  213 ? 147.997 149.196 174.946 1.00 74.93  ? 477  SER C OG    1 
ATOM   5594  N  N     . CYS B 1  214 ? 146.632 150.042 177.344 1.00 77.65  ? 478  CYS C N     1 
ATOM   5595  C  CA    . CYS B 1  214 ? 146.069 149.383 178.517 1.00 77.65  ? 478  CYS C CA    1 
ATOM   5596  C  C     . CYS B 1  214 ? 146.954 148.233 178.981 1.00 77.65  ? 478  CYS C C     1 
ATOM   5597  O  O     . CYS B 1  214 ? 147.125 148.028 180.189 1.00 77.65  ? 478  CYS C O     1 
ATOM   5598  C  CB    . CYS B 1  214 ? 144.655 148.889 178.211 1.00 77.65  ? 478  CYS C CB    1 
ATOM   5599  S  SG    . CYS B 1  214 ? 143.794 148.127 179.597 1.00 77.65  ? 478  CYS C SG    1 
ATOM   5600  N  N     . SER B 1  215 ? 147.546 147.495 178.041 1.00 75.52  ? 479  SER C N     1 
ATOM   5601  C  CA    . SER B 1  215 ? 148.437 146.399 178.405 1.00 75.52  ? 479  SER C CA    1 
ATOM   5602  C  C     . SER B 1  215 ? 149.710 146.920 179.062 1.00 75.52  ? 479  SER C C     1 
ATOM   5603  O  O     . SER B 1  215 ? 150.159 146.384 180.081 1.00 75.52  ? 479  SER C O     1 
ATOM   5604  C  CB    . SER B 1  215 ? 148.771 145.567 177.167 1.00 75.52  ? 479  SER C CB    1 
ATOM   5605  O  OG    . SER B 1  215 ? 147.608 144.954 176.638 1.00 75.52  ? 479  SER C OG    1 
ATOM   5606  N  N     . GLN B 1  216 ? 150.260 147.980 178.482 1.00 71.87  ? 480  GLN C N     1 
ATOM   5607  C  CA    . GLN B 1  216 ? 151.461 148.610 178.998 1.00 71.87  ? 480  GLN C CA    1 
ATOM   5608  C  C     . GLN B 1  216 ? 151.200 149.119 180.407 1.00 71.87  ? 480  GLN C C     1 
ATOM   5609  O  O     . GLN B 1  216 ? 151.980 148.874 181.323 1.00 71.87  ? 480  GLN C O     1 
ATOM   5610  C  CB    . GLN B 1  216 ? 151.859 149.782 178.102 1.00 71.87  ? 480  GLN C CB    1 
ATOM   5611  C  CG    . GLN B 1  216 ? 153.063 149.525 177.213 1.00 71.87  ? 480  GLN C CG    1 
ATOM   5612  C  CD    . GLN B 1  216 ? 153.211 148.068 176.839 1.00 71.87  ? 480  GLN C CD    1 
ATOM   5613  O  OE1   . GLN B 1  216 ? 153.376 147.209 177.701 1.00 71.87  ? 480  GLN C OE1   1 
ATOM   5614  N  NE2   . GLN B 1  216 ? 153.160 147.782 175.545 1.00 71.87  ? 480  GLN C NE2   1 
ATOM   5615  N  N     . TYR B 1  217 ? 150.088 149.823 180.573 1.00 73.33  ? 481  TYR C N     1 
ATOM   5616  C  CA    . TYR B 1  217 ? 149.726 150.387 181.868 1.00 73.33  ? 481  TYR C CA    1 
ATOM   5617  C  C     . TYR B 1  217 ? 149.513 149.290 182.901 1.00 73.33  ? 481  TYR C C     1 
ATOM   5618  O  O     . TYR B 1  217 ? 149.899 149.442 184.066 1.00 73.33  ? 481  TYR C O     1 
ATOM   5619  C  CB    . TYR B 1  217 ? 148.473 151.250 181.744 1.00 73.33  ? 481  TYR C CB    1 
ATOM   5620  C  CG    . TYR B 1  217 ? 148.066 151.891 183.050 1.00 73.33  ? 481  TYR C CG    1 
ATOM   5621  C  CD1   . TYR B 1  217 ? 148.729 153.011 183.531 1.00 73.33  ? 481  TYR C CD1   1 
ATOM   5622  C  CD2   . TYR B 1  217 ? 147.034 151.363 183.812 1.00 73.33  ? 481  TYR C CD2   1 
ATOM   5623  C  CE1   . TYR B 1  217 ? 148.365 153.596 184.727 1.00 73.33  ? 481  TYR C CE1   1 
ATOM   5624  C  CE2   . TYR B 1  217 ? 146.666 151.939 185.011 1.00 73.33  ? 481  TYR C CE2   1 
ATOM   5625  C  CZ    . TYR B 1  217 ? 147.333 153.055 185.462 1.00 73.33  ? 481  TYR C CZ    1 
ATOM   5626  O  OH    . TYR B 1  217 ? 146.965 153.632 186.654 1.00 73.33  ? 481  TYR C OH    1 
ATOM   5627  N  N     . HIS B 1  218 ? 148.899 148.175 182.496 1.00 75.34  ? 482  HIS C N     1 
ATOM   5628  C  CA    . HIS B 1  218 ? 148.727 147.061 183.422 1.00 75.34  ? 482  HIS C CA    1 
ATOM   5629  C  C     . HIS B 1  218 ? 150.072 146.468 183.820 1.00 75.34  ? 482  HIS C C     1 
ATOM   5630  O  O     . HIS B 1  218 ? 150.277 146.101 184.982 1.00 75.34  ? 482  HIS C O     1 
ATOM   5631  C  CB    . HIS B 1  218 ? 147.833 145.990 182.801 1.00 75.34  ? 482  HIS C CB    1 
ATOM   5632  C  CG    . HIS B 1  218 ? 147.577 144.824 183.704 1.00 75.34  ? 482  HIS C CG    1 
ATOM   5633  N  ND1   . HIS B 1  218 ? 146.735 144.896 184.792 1.00 75.34  ? 482  HIS C ND1   1 
ATOM   5634  C  CD2   . HIS B 1  218 ? 148.057 143.558 183.683 1.00 75.34  ? 482  HIS C CD2   1 
ATOM   5635  C  CE1   . HIS B 1  218 ? 146.705 143.725 185.401 1.00 75.34  ? 482  HIS C CE1   1 
ATOM   5636  N  NE2   . HIS B 1  218 ? 147.499 142.895 184.749 1.00 75.34  ? 482  HIS C NE2   1 
ATOM   5637  N  N     . LYS B 1  219 ? 151.000 146.364 182.866 1.00 73.37  ? 483  LYS C N     1 
ATOM   5638  C  CA    . LYS B 1  219 ? 152.342 145.882 183.180 1.00 73.37  ? 483  LYS C CA    1 
ATOM   5639  C  C     . LYS B 1  219 ? 153.022 146.785 184.201 1.00 73.37  ? 483  LYS C C     1 
ATOM   5640  O  O     . LYS B 1  219 ? 153.609 146.310 185.180 1.00 73.37  ? 483  LYS C O     1 
ATOM   5641  C  CB    . LYS B 1  219 ? 153.180 145.795 181.904 1.00 73.37  ? 483  LYS C CB    1 
ATOM   5642  C  CG    . LYS B 1  219 ? 152.776 144.683 180.956 1.00 73.37  ? 483  LYS C CG    1 
ATOM   5643  C  CD    . LYS B 1  219 ? 153.549 144.782 179.653 1.00 73.37  ? 483  LYS C CD    1 
ATOM   5644  C  CE    . LYS B 1  219 ? 155.016 144.444 179.854 1.00 73.37  ? 483  LYS C CE    1 
ATOM   5645  N  NZ    . LYS B 1  219 ? 155.764 144.435 178.568 1.00 73.37  ? 483  LYS C NZ    1 
ATOM   5646  N  N     . MET B 1  220 ? 152.951 148.100 183.980 1.00 76.99  ? 484  MET C N     1 
ATOM   5647  C  CA    . MET B 1  220 ? 153.565 149.046 184.906 1.00 76.99  ? 484  MET C CA    1 
ATOM   5648  C  C     . MET B 1  220 ? 152.930 148.954 186.288 1.00 76.99  ? 484  MET C C     1 
ATOM   5649  O  O     . MET B 1  220 ? 153.629 148.960 187.309 1.00 76.99  ? 484  MET C O     1 
ATOM   5650  C  CB    . MET B 1  220 ? 153.451 150.467 184.354 1.00 76.99  ? 484  MET C CB    1 
ATOM   5651  C  CG    . MET B 1  220 ? 154.099 151.526 185.230 1.00 76.99  ? 484  MET C CG    1 
ATOM   5652  S  SD    . MET B 1  220 ? 153.957 153.184 184.536 1.00 76.99  ? 484  MET C SD    1 
ATOM   5653  C  CE    . MET B 1  220 ? 152.212 153.502 184.778 1.00 76.99  ? 484  MET C CE    1 
ATOM   5654  N  N     . TYR B 1  221 ? 151.608 148.861 186.325 1.00 82.22  ? 485  TYR C N     1 
ATOM   5655  C  CA    . TYR B 1  221 ? 150.891 148.763 187.587 1.00 82.22  ? 485  TYR C CA    1 
ATOM   5656  C  C     . TYR B 1  221 ? 151.304 147.509 188.347 1.00 82.22  ? 485  TYR C C     1 
ATOM   5657  O  O     . TYR B 1  221 ? 151.561 147.556 189.546 1.00 82.22  ? 485  TYR C O     1 
ATOM   5658  C  CB    . TYR B 1  221 ? 149.385 148.759 187.338 1.00 82.22  ? 485  TYR C CB    1 
ATOM   5659  C  CG    . TYR B 1  221 ? 148.579 148.137 188.451 1.00 82.22  ? 485  TYR C CG    1 
ATOM   5660  C  CD1   . TYR B 1  221 ? 148.037 148.918 189.458 1.00 82.22  ? 485  TYR C CD1   1 
ATOM   5661  C  CD2   . TYR B 1  221 ? 148.354 146.771 188.489 1.00 82.22  ? 485  TYR C CD2   1 
ATOM   5662  C  CE1   . TYR B 1  221 ? 147.295 148.355 190.477 1.00 82.22  ? 485  TYR C CE1   1 
ATOM   5663  C  CE2   . TYR B 1  221 ? 147.614 146.200 189.504 1.00 82.22  ? 485  TYR C CE2   1 
ATOM   5664  C  CZ    . TYR B 1  221 ? 147.088 146.997 190.494 1.00 82.22  ? 485  TYR C CZ    1 
ATOM   5665  O  OH    . TYR B 1  221 ? 146.350 146.435 191.507 1.00 82.22  ? 485  TYR C OH    1 
ATOM   5666  N  N     . ARG B 1  222 ? 151.371 146.387 187.640 1.00 79.52  ? 486  ARG C N     1 
ATOM   5667  C  CA    . ARG B 1  222 ? 151.754 145.118 188.241 1.00 79.52  ? 486  ARG C CA    1 
ATOM   5668  C  C     . ARG B 1  222 ? 153.182 145.161 188.774 1.00 79.52  ? 486  ARG C C     1 
ATOM   5669  O  O     . ARG B 1  222 ? 153.456 144.658 189.860 1.00 79.52  ? 486  ARG C O     1 
ATOM   5670  C  CB    . ARG B 1  222 ? 151.586 143.977 187.240 1.00 79.52  ? 486  ARG C CB    1 
ATOM   5671  C  CG    . ARG B 1  222 ? 152.873 143.248 186.900 1.00 79.52  ? 486  ARG C CG    1 
ATOM   5672  C  CD    . ARG B 1  222 ? 153.269 143.489 185.453 1.00 79.52  ? 486  ARG C CD    1 
ATOM   5673  N  NE    . ARG B 1  222 ? 152.966 142.344 184.599 1.00 79.52  ? 486  ARG C NE    1 
ATOM   5674  C  CZ    . ARG B 1  222 ? 151.835 141.650 184.650 1.00 79.52  ? 486  ARG C CZ    1 
ATOM   5675  N  NH1   . ARG B 1  222 ? 150.890 141.978 185.518 1.00 79.52  ? 486  ARG C NH1   1 
ATOM   5676  N  NH2   . ARG B 1  222 ? 151.647 140.626 183.832 1.00 79.52  ? 486  ARG C NH2   1 
ATOM   5677  N  N     . THR B 1  223 ? 154.090 145.759 188.010 1.00 79.27  ? 487  THR C N     1 
ATOM   5678  C  CA    . THR B 1  223 ? 155.482 145.866 188.436 1.00 79.27  ? 487  THR C CA    1 
ATOM   5679  C  C     . THR B 1  223 ? 155.612 146.737 189.680 1.00 79.27  ? 487  THR C C     1 
ATOM   5680  O  O     . THR B 1  223 ? 156.318 146.381 190.633 1.00 79.27  ? 487  THR C O     1 
ATOM   5681  C  CB    . THR B 1  223 ? 156.334 146.425 187.296 1.00 79.27  ? 487  THR C CB    1 
ATOM   5682  O  OG1   . THR B 1  223 ? 156.253 145.551 186.164 1.00 79.27  ? 487  THR C OG1   1 
ATOM   5683  C  CG2   . THR B 1  223 ? 157.784 146.551 187.725 1.00 79.27  ? 487  THR C CG2   1 
ATOM   5684  N  N     . VAL B 1  224 ? 154.932 147.886 189.690 1.00 80.87  ? 488  VAL C N     1 
ATOM   5685  C  CA    . VAL B 1  224 ? 155.019 148.793 190.832 1.00 80.87  ? 488  VAL C CA    1 
ATOM   5686  C  C     . VAL B 1  224 ? 154.424 148.143 192.075 1.00 80.87  ? 488  VAL C C     1 
ATOM   5687  O  O     . VAL B 1  224 ? 154.981 148.242 193.175 1.00 80.87  ? 488  VAL C O     1 
ATOM   5688  C  CB    . VAL B 1  224 ? 154.336 150.134 190.510 1.00 80.87  ? 488  VAL C CB    1 
ATOM   5689  C  CG1   . VAL B 1  224 ? 154.265 151.005 191.752 1.00 80.87  ? 488  VAL C CG1   1 
ATOM   5690  C  CG2   . VAL B 1  224 ? 155.093 150.856 189.410 1.00 80.87  ? 488  VAL C CG2   1 
ATOM   5691  N  N     . LYS B 1  225 ? 153.287 147.460 191.920 1.00 86.39  ? 489  LYS C N     1 
ATOM   5692  C  CA    . LYS B 1  225 ? 152.660 146.816 193.070 1.00 86.39  ? 489  LYS C CA    1 
ATOM   5693  C  C     . LYS B 1  225 ? 153.516 145.672 193.597 1.00 86.39  ? 489  LYS C C     1 
ATOM   5694  O  O     . LYS B 1  225 ? 153.547 145.418 194.807 1.00 86.39  ? 489  LYS C O     1 
ATOM   5695  C  CB    . LYS B 1  225 ? 151.265 146.315 192.698 1.00 86.39  ? 489  LYS C CB    1 
ATOM   5696  C  CG    . LYS B 1  225 ? 150.496 145.718 193.865 1.00 86.39  ? 489  LYS C CG    1 
ATOM   5697  C  CD    . LYS B 1  225 ? 149.094 145.303 193.459 1.00 86.39  ? 489  LYS C CD    1 
ATOM   5698  C  CE    . LYS B 1  225 ? 148.349 144.680 194.627 1.00 86.39  ? 489  LYS C CE    1 
ATOM   5699  N  NZ    . LYS B 1  225 ? 146.976 144.253 194.243 1.00 86.39  ? 489  LYS C NZ    1 
ATOM   5700  N  N     . ALA B 1  226 ? 154.222 144.972 192.708 1.00 85.41  ? 490  ALA C N     1 
ATOM   5701  C  CA    . ALA B 1  226 ? 155.052 143.856 193.147 1.00 85.41  ? 490  ALA C CA    1 
ATOM   5702  C  C     . ALA B 1  226 ? 156.304 144.347 193.864 1.00 85.41  ? 490  ALA C C     1 
ATOM   5703  O  O     . ALA B 1  226 ? 156.660 143.834 194.931 1.00 85.41  ? 490  ALA C O     1 
ATOM   5704  C  CB    . ALA B 1  226 ? 155.423 142.977 191.953 1.00 85.41  ? 490  ALA C CB    1 
ATOM   5705  N  N     . ILE B 1  227 ? 156.987 145.341 193.294 1.00 85.34  ? 491  ILE C N     1 
ATOM   5706  C  CA    . ILE B 1  227 ? 158.253 145.785 193.871 1.00 85.34  ? 491  ILE C CA    1 
ATOM   5707  C  C     . ILE B 1  227 ? 158.012 146.636 195.113 1.00 85.34  ? 491  ILE C C     1 
ATOM   5708  O  O     . ILE B 1  227 ? 158.572 146.371 196.183 1.00 85.34  ? 491  ILE C O     1 
ATOM   5709  C  CB    . ILE B 1  227 ? 159.089 146.536 192.821 1.00 85.34  ? 491  ILE C CB    1 
ATOM   5710  C  CG1   . ILE B 1  227 ? 159.499 145.581 191.700 1.00 85.34  ? 491  ILE C CG1   1 
ATOM   5711  C  CG2   . ILE B 1  227 ? 160.313 147.165 193.466 1.00 85.34  ? 491  ILE C CG2   1 
ATOM   5712  C  CD1   . ILE B 1  227 ? 160.121 146.267 190.513 1.00 85.34  ? 491  ILE C CD1   1 
ATOM   5713  N  N     . THR B 1  228 ? 157.180 147.672 194.993 1.00 95.31  ? 492  THR C N     1 
ATOM   5714  C  CA    . THR B 1  228 ? 156.955 148.564 196.127 1.00 95.31  ? 492  THR C CA    1 
ATOM   5715  C  C     . THR B 1  228 ? 156.136 147.884 197.217 1.00 95.31  ? 492  THR C C     1 
ATOM   5716  O  O     . THR B 1  228 ? 156.445 148.016 198.407 1.00 95.31  ? 492  THR C O     1 
ATOM   5717  C  CB    . THR B 1  228 ? 156.259 149.844 195.664 1.00 95.31  ? 492  THR C CB    1 
ATOM   5718  O  OG1   . THR B 1  228 ? 157.069 150.504 194.685 1.00 95.31  ? 492  THR C OG1   1 
ATOM   5719  C  CG2   . THR B 1  228 ? 156.034 150.784 196.838 1.00 95.31  ? 492  THR C CG2   1 
ATOM   5720  N  N     . GLY B 1  229 ? 155.098 147.145 196.833 1.00 101.74 ? 493  GLY C N     1 
ATOM   5721  C  CA    . GLY B 1  229 ? 154.175 146.577 197.790 1.00 101.74 ? 493  GLY C CA    1 
ATOM   5722  C  C     . GLY B 1  229 ? 153.054 147.500 198.211 1.00 101.74 ? 493  GLY C C     1 
ATOM   5723  O  O     . GLY B 1  229 ? 152.258 147.124 199.081 1.00 101.74 ? 493  GLY C O     1 
ATOM   5724  N  N     . ARG B 1  230 ? 152.964 148.690 197.623 1.00 128.21 ? 494  ARG C N     1 
ATOM   5725  C  CA    . ARG B 1  230 ? 151.929 149.662 197.937 1.00 128.21 ? 494  ARG C CA    1 
ATOM   5726  C  C     . ARG B 1  230 ? 151.263 150.111 196.646 1.00 128.21 ? 494  ARG C C     1 
ATOM   5727  O  O     . ARG B 1  230 ? 151.942 150.485 195.686 1.00 128.21 ? 494  ARG C O     1 
ATOM   5728  C  CB    . ARG B 1  230 ? 152.512 150.872 198.680 1.00 128.21 ? 494  ARG C CB    1 
ATOM   5729  C  CG    . ARG B 1  230 ? 153.063 150.545 200.059 1.00 128.21 ? 494  ARG C CG    1 
ATOM   5730  C  CD    . ARG B 1  230 ? 153.683 151.769 200.718 1.00 128.21 ? 494  ARG C CD    1 
ATOM   5731  N  NE    . ARG B 1  230 ? 152.689 152.793 201.026 1.00 128.21 ? 494  ARG C NE    1 
ATOM   5732  C  CZ    . ARG B 1  230 ? 152.983 154.012 201.465 1.00 128.21 ? 494  ARG C CZ    1 
ATOM   5733  N  NH1   . ARG B 1  230 ? 154.247 154.367 201.652 1.00 128.21 ? 494  ARG C NH1   1 
ATOM   5734  N  NH2   . ARG B 1  230 ? 152.012 154.878 201.719 1.00 128.21 ? 494  ARG C NH2   1 
ATOM   5735  N  N     . GLN B 1  231 ? 149.938 150.051 196.616 1.00 111.51 ? 495  GLN C N     1 
ATOM   5736  C  CA    . GLN B 1  231 ? 149.185 150.429 195.428 1.00 111.51 ? 495  GLN C CA    1 
ATOM   5737  C  C     . GLN B 1  231 ? 149.179 151.929 195.172 1.00 111.51 ? 495  GLN C C     1 
ATOM   5738  O  O     . GLN B 1  231 ? 148.405 152.669 195.775 1.00 111.51 ? 495  GLN C O     1 
ATOM   5739  C  CB    . GLN B 1  231 ? 147.751 149.909 195.517 1.00 111.51 ? 495  GLN C CB    1 
ATOM   5740  C  CG    . GLN B 1  231 ? 147.479 148.705 194.633 1.00 111.51 ? 495  GLN C CG    1 
ATOM   5741  C  CD    . GLN B 1  231 ? 146.019 148.581 194.255 1.00 111.51 ? 495  GLN C CD    1 
ATOM   5742  O  OE1   . GLN B 1  231 ? 145.172 149.322 194.752 1.00 111.51 ? 495  GLN C OE1   1 
ATOM   5743  N  NE2   . GLN B 1  231 ? 145.715 147.640 193.370 1.00 111.51 ? 495  GLN C NE2   1 
ATOM   5744  N  N     . ILE B 1  232 ? 150.050 152.370 194.273 1.00 97.73  ? 496  ILE C N     1 
ATOM   5745  C  CA    . ILE B 1  232 ? 150.129 153.779 193.909 1.00 97.73  ? 496  ILE C CA    1 
ATOM   5746  C  C     . ILE B 1  232 ? 149.102 154.153 192.843 1.00 97.73  ? 496  ILE C C     1 
ATOM   5747  O  O     . ILE B 1  232 ? 148.611 155.293 192.845 1.00 97.73  ? 496  ILE C O     1 
ATOM   5748  C  CB    . ILE B 1  232 ? 151.557 154.131 193.439 1.00 97.73  ? 496  ILE C CB    1 
ATOM   5749  C  CG1   . ILE B 1  232 ? 152.565 153.832 194.549 1.00 97.73  ? 496  ILE C CG1   1 
ATOM   5750  C  CG2   . ILE B 1  232 ? 151.661 155.588 193.026 1.00 97.73  ? 496  ILE C CG2   1 
ATOM   5751  C  CD1   . ILE B 1  232 ? 152.333 154.633 195.809 1.00 97.73  ? 496  ILE C CD1   1 
ATOM   5752  N  N     . PHE B 1  233 ? 148.775 153.199 191.971 1.00 90.15  ? 497  PHE C N     1 
ATOM   5753  C  CA    . PHE B 1  233 ? 147.793 153.393 190.904 1.00 90.15  ? 497  PHE C CA    1 
ATOM   5754  C  C     . PHE B 1  233 ? 146.599 152.464 191.109 1.00 90.15  ? 497  PHE C C     1 
ATOM   5755  O  O     . PHE B 1  233 ? 146.635 151.585 191.966 1.00 90.15  ? 497  PHE C O     1 
ATOM   5756  C  CB    . PHE B 1  233 ? 148.409 153.080 189.539 1.00 90.15  ? 497  PHE C CB    1 
ATOM   5757  C  CG    . PHE B 1  233 ? 149.706 153.783 189.271 1.00 90.15  ? 497  PHE C CG    1 
ATOM   5758  C  CD1   . PHE B 1  233 ? 149.728 154.986 188.588 1.00 90.15  ? 497  PHE C CD1   1 
ATOM   5759  C  CD2   . PHE B 1  233 ? 150.905 153.229 189.677 1.00 90.15  ? 497  PHE C CD2   1 
ATOM   5760  C  CE1   . PHE B 1  233 ? 150.920 155.632 188.329 1.00 90.15  ? 497  PHE C CE1   1 
ATOM   5761  C  CE2   . PHE B 1  233 ? 152.102 153.869 189.422 1.00 90.15  ? 497  PHE C CE2   1 
ATOM   5762  C  CZ    . PHE B 1  233 ? 152.109 155.073 188.747 1.00 90.15  ? 497  PHE C CZ    1 
ATOM   5763  N  N     . GLN B 1  234 ? 145.545 152.656 190.320 1.00 89.54  ? 498  GLN C N     1 
ATOM   5764  C  CA    . GLN B 1  234 ? 144.368 151.808 190.403 1.00 89.54  ? 498  GLN C CA    1 
ATOM   5765  C  C     . GLN B 1  234 ? 144.369 150.763 189.297 1.00 89.54  ? 498  GLN C C     1 
ATOM   5766  O  O     . GLN B 1  234 ? 145.024 150.931 188.265 1.00 89.54  ? 498  GLN C O     1 
ATOM   5767  C  CB    . GLN B 1  234 ? 143.103 152.659 190.327 1.00 89.54  ? 498  GLN C CB    1 
ATOM   5768  C  CG    . GLN B 1  234 ? 142.791 153.405 191.612 1.00 89.54  ? 498  GLN C CG    1 
ATOM   5769  C  CD    . GLN B 1  234 ? 143.611 154.662 191.785 1.00 89.54  ? 498  GLN C CD    1 
ATOM   5770  O  OE1   . GLN B 1  234 ? 144.183 155.184 190.831 1.00 89.54  ? 498  GLN C OE1   1 
ATOM   5771  N  NE2   . GLN B 1  234 ? 143.677 155.154 193.013 1.00 89.54  ? 498  GLN C NE2   1 
ATOM   5772  N  N     . PRO B 1  235 ? 143.652 149.657 189.492 1.00 85.63  ? 499  PRO C N     1 
ATOM   5773  C  CA    . PRO B 1  235 ? 143.546 148.647 188.434 1.00 85.63  ? 499  PRO C CA    1 
ATOM   5774  C  C     . PRO B 1  235 ? 142.798 149.183 187.222 1.00 85.63  ? 499  PRO C C     1 
ATOM   5775  O  O     . PRO B 1  235 ? 142.303 150.311 187.197 1.00 85.63  ? 499  PRO C O     1 
ATOM   5776  C  CB    . PRO B 1  235 ? 142.778 147.505 189.106 1.00 85.63  ? 499  PRO C CB    1 
ATOM   5777  C  CG    . PRO B 1  235 ? 143.039 147.689 190.564 1.00 85.63  ? 499  PRO C CG    1 
ATOM   5778  C  CD    . PRO B 1  235 ? 143.093 149.174 190.765 1.00 85.63  ? 499  PRO C CD    1 
ATOM   5779  N  N     . LEU B 1  236 ? 142.716 148.330 186.199 1.00 79.73  ? 500  LEU C N     1 
ATOM   5780  C  CA    . LEU B 1  236 ? 142.147 148.749 184.923 1.00 79.73  ? 500  LEU C CA    1 
ATOM   5781  C  C     . LEU B 1  236 ? 140.643 148.972 185.025 1.00 79.73  ? 500  LEU C C     1 
ATOM   5782  O  O     . LEU B 1  236 ? 140.094 149.868 184.371 1.00 79.73  ? 500  LEU C O     1 
ATOM   5783  C  CB    . LEU B 1  236 ? 142.468 147.708 183.852 1.00 79.73  ? 500  LEU C CB    1 
ATOM   5784  C  CG    . LEU B 1  236 ? 143.961 147.537 183.568 1.00 79.73  ? 500  LEU C CG    1 
ATOM   5785  C  CD1   . LEU B 1  236 ? 144.201 146.373 182.621 1.00 79.73  ? 500  LEU C CD1   1 
ATOM   5786  C  CD2   . LEU B 1  236 ? 144.556 148.824 183.015 1.00 79.73  ? 500  LEU C CD2   1 
ATOM   5787  N  N     . HIS B 1  237 ? 139.956 148.163 185.835 1.00 84.62  ? 501  HIS C N     1 
ATOM   5788  C  CA    . HIS B 1  237 ? 138.510 148.306 185.951 1.00 84.62  ? 501  HIS C CA    1 
ATOM   5789  C  C     . HIS B 1  237 ? 138.129 149.627 186.604 1.00 84.62  ? 501  HIS C C     1 
ATOM   5790  O  O     . HIS B 1  237 ? 137.080 150.193 186.281 1.00 84.62  ? 501  HIS C O     1 
ATOM   5791  C  CB    . HIS B 1  237 ? 137.920 147.134 186.732 1.00 84.62  ? 501  HIS C CB    1 
ATOM   5792  C  CG    . HIS B 1  237 ? 138.394 147.051 188.148 1.00 84.62  ? 501  HIS C CG    1 
ATOM   5793  N  ND1   . HIS B 1  237 ? 137.784 147.735 189.177 1.00 84.62  ? 501  HIS C ND1   1 
ATOM   5794  C  CD2   . HIS B 1  237 ? 139.419 146.365 188.707 1.00 84.62  ? 501  HIS C CD2   1 
ATOM   5795  C  CE1   . HIS B 1  237 ? 138.412 147.473 190.309 1.00 84.62  ? 501  HIS C CE1   1 
ATOM   5796  N  NE2   . HIS B 1  237 ? 139.408 146.645 190.051 1.00 84.62  ? 501  HIS C NE2   1 
ATOM   5797  N  N     . ALA B 1  238 ? 138.966 150.140 187.509 1.00 78.30  ? 502  ALA C N     1 
ATOM   5798  C  CA    . ALA B 1  238 ? 138.718 151.466 188.063 1.00 78.30  ? 502  ALA C CA    1 
ATOM   5799  C  C     . ALA B 1  238 ? 138.775 152.529 186.975 1.00 78.30  ? 502  ALA C C     1 
ATOM   5800  O  O     . ALA B 1  238 ? 137.956 153.456 186.954 1.00 78.30  ? 502  ALA C O     1 
ATOM   5801  C  CB    . ALA B 1  238 ? 139.725 151.773 189.171 1.00 78.30  ? 502  ALA C CB    1 
ATOM   5802  N  N     . LEU B 1  239 ? 139.730 152.403 186.051 1.00 75.81  ? 503  LEU C N     1 
ATOM   5803  C  CA    . LEU B 1  239 ? 139.794 153.324 184.921 1.00 75.81  ? 503  LEU C CA    1 
ATOM   5804  C  C     . LEU B 1  239 ? 138.553 153.203 184.049 1.00 75.81  ? 503  LEU C C     1 
ATOM   5805  O  O     . LEU B 1  239 ? 137.955 154.211 183.651 1.00 75.81  ? 503  LEU C O     1 
ATOM   5806  C  CB    . LEU B 1  239 ? 141.049 153.050 184.094 1.00 75.81  ? 503  LEU C CB    1 
ATOM   5807  C  CG    . LEU B 1  239 ? 142.386 153.319 184.774 1.00 75.81  ? 503  LEU C CG    1 
ATOM   5808  C  CD1   . LEU B 1  239 ? 143.523 152.907 183.861 1.00 75.81  ? 503  LEU C CD1   1 
ATOM   5809  C  CD2   . LEU B 1  239 ? 142.490 154.780 185.136 1.00 75.81  ? 503  LEU C CD2   1 
ATOM   5810  N  N     . ARG B 1  240 ? 138.168 151.972 183.744 1.00 77.00  ? 504  ARG C N     1 
ATOM   5811  C  CA    . ARG B 1  240 ? 136.994 151.745 182.922 1.00 77.00  ? 504  ARG C CA    1 
ATOM   5812  C  C     . ARG B 1  240 ? 135.785 152.414 183.554 1.00 77.00  ? 504  ARG C C     1 
ATOM   5813  O  O     . ARG B 1  240 ? 135.004 153.073 182.873 1.00 77.00  ? 504  ARG C O     1 
ATOM   5814  C  CB    . ARG B 1  240 ? 136.737 150.250 182.760 1.00 77.00  ? 504  ARG C CB    1 
ATOM   5815  C  CG    . ARG B 1  240 ? 136.744 149.775 181.318 1.00 77.00  ? 504  ARG C CG    1 
ATOM   5816  C  CD    . ARG B 1  240 ? 136.979 148.277 181.238 1.00 77.00  ? 504  ARG C CD    1 
ATOM   5817  N  NE    . ARG B 1  240 ? 138.325 147.963 180.771 1.00 77.00  ? 504  ARG C NE    1 
ATOM   5818  C  CZ    . ARG B 1  240 ? 139.056 146.954 181.229 1.00 77.00  ? 504  ARG C CZ    1 
ATOM   5819  N  NH1   . ARG B 1  240 ? 138.573 146.156 182.169 1.00 77.00  ? 504  ARG C NH1   1 
ATOM   5820  N  NH2   . ARG B 1  240 ? 140.271 146.741 180.745 1.00 77.00  ? 504  ARG C NH2   1 
ATOM   5821  N  N     . ASN B 1  241 ? 135.641 152.252 184.864 1.00 77.98  ? 505  ASN C N     1 
ATOM   5822  C  CA    . ASN B 1  241 ? 134.511 152.827 185.580 1.00 77.98  ? 505  ASN C CA    1 
ATOM   5823  C  C     . ASN B 1  241 ? 134.560 154.348 185.614 1.00 77.98  ? 505  ASN C C     1 
ATOM   5824  O  O     . ASN B 1  241 ? 133.513 154.992 185.491 1.00 77.98  ? 505  ASN C O     1 
ATOM   5825  C  CB    . ASN B 1  241 ? 134.469 152.276 187.009 1.00 77.98  ? 505  ASN C CB    1 
ATOM   5826  C  CG    . ASN B 1  241 ? 133.161 152.578 187.720 1.00 77.98  ? 505  ASN C CG    1 
ATOM   5827  O  OD1   . ASN B 1  241 ? 132.255 153.192 187.156 1.00 77.98  ? 505  ASN C OD1   1 
ATOM   5828  N  ND2   . ASN B 1  241 ? 133.058 152.143 188.970 1.00 77.98  ? 505  ASN C ND2   1 
ATOM   5829  N  N     . ALA B 1  242 ? 135.747 154.936 185.769 1.00 73.84  ? 506  ALA C N     1 
ATOM   5830  C  CA    . ALA B 1  242 ? 135.865 156.389 185.764 1.00 73.84  ? 506  ALA C CA    1 
ATOM   5831  C  C     . ALA B 1  242 ? 135.655 156.990 184.381 1.00 73.84  ? 506  ALA C C     1 
ATOM   5832  O  O     . ALA B 1  242 ? 135.362 158.186 184.279 1.00 73.84  ? 506  ALA C O     1 
ATOM   5833  C  CB    . ALA B 1  242 ? 137.233 156.810 186.304 1.00 73.84  ? 506  ALA C CB    1 
ATOM   5834  N  N     . GLU B 1  243 ? 135.807 156.193 183.321 1.00 77.85  ? 507  GLU C N     1 
ATOM   5835  C  CA    . GLU B 1  243 ? 135.620 156.715 181.969 1.00 77.85  ? 507  GLU C CA    1 
ATOM   5836  C  C     . GLU B 1  243 ? 134.185 157.182 181.736 1.00 77.85  ? 507  GLU C C     1 
ATOM   5837  O  O     . GLU B 1  243 ? 133.944 158.097 180.941 1.00 77.85  ? 507  GLU C O     1 
ATOM   5838  C  CB    . GLU B 1  243 ? 136.005 155.658 180.934 1.00 77.85  ? 507  GLU C CB    1 
ATOM   5839  C  CG    . GLU B 1  243 ? 137.490 155.374 180.839 1.00 77.85  ? 507  GLU C CG    1 
ATOM   5840  C  CD    . GLU B 1  243 ? 137.809 154.302 179.816 1.00 77.85  ? 507  GLU C CD    1 
ATOM   5841  O  OE1   . GLU B 1  243 ? 136.860 153.703 179.266 1.00 77.85  ? 507  GLU C OE1   1 
ATOM   5842  O  OE2   . GLU B 1  243 ? 139.007 154.057 179.563 1.00 77.85  ? 507  GLU C OE2   1 
ATOM   5843  N  N     . LYS B 1  244 ? 133.237 156.515 182.382 1.00 74.12  ? 508  LYS C N     1 
ATOM   5844  C  CA    . LYS B 1  244 ? 131.817 156.809 182.216 1.00 74.12  ? 508  LYS C CA    1 
ATOM   5845  C  C     . LYS B 1  244 ? 131.408 158.261 182.434 1.00 74.12  ? 508  LYS C C     1 
ATOM   5846  O  O     . LYS B 1  244 ? 130.494 158.758 181.779 1.00 74.12  ? 508  LYS C O     1 
ATOM   5847  C  CB    . LYS B 1  244 ? 130.989 155.909 183.133 1.00 74.12  ? 508  LYS C CB    1 
ATOM   5848  C  CG    . LYS B 1  244 ? 130.669 154.549 182.539 1.00 74.12  ? 508  LYS C CG    1 
ATOM   5849  C  CD    . LYS B 1  244 ? 131.804 154.055 181.660 1.00 74.12  ? 508  LYS C CD    1 
ATOM   5850  C  CE    . LYS B 1  244 ? 131.945 152.545 181.748 1.00 74.12  ? 508  LYS C CE    1 
ATOM   5851  N  NZ    . LYS B 1  244 ? 131.283 152.000 182.965 1.00 74.12  ? 508  LYS C NZ    1 
ATOM   5852  N  N     . VAL B 1  245 ? 132.081 158.941 183.350 1.00 71.25  ? 509  VAL C N     1 
ATOM   5853  C  CA    . VAL B 1  245 ? 131.732 160.323 183.670 1.00 71.25  ? 509  VAL C CA    1 
ATOM   5854  C  C     . VAL B 1  245 ? 132.107 161.257 182.528 1.00 71.25  ? 509  VAL C C     1 
ATOM   5855  O  O     . VAL B 1  245 ? 131.411 162.247 182.270 1.00 71.25  ? 509  VAL C O     1 
ATOM   5856  C  CB    . VAL B 1  245 ? 132.406 160.744 184.992 1.00 71.25  ? 509  VAL C CB    1 
ATOM   5857  C  CG1   . VAL B 1  245 ? 132.115 162.205 185.305 1.00 71.25  ? 509  VAL C CG1   1 
ATOM   5858  C  CG2   . VAL B 1  245 ? 131.943 159.849 186.131 1.00 71.25  ? 509  VAL C CG2   1 
ATOM   5859  N  N     . LEU B 1  246 ? 133.189 160.954 181.815 1.00 70.97  ? 510  LEU C N     1 
ATOM   5860  C  CA    . LEU B 1  246 ? 133.691 161.840 180.772 1.00 70.97  ? 510  LEU C CA    1 
ATOM   5861  C  C     . LEU B 1  246 ? 133.032 161.594 179.419 1.00 70.97  ? 510  LEU C C     1 
ATOM   5862  O  O     . LEU B 1  246 ? 132.866 162.533 178.634 1.00 70.97  ? 510  LEU C O     1 
ATOM   5863  C  CB    . LEU B 1  246 ? 135.208 161.688 180.646 1.00 70.97  ? 510  LEU C CB    1 
ATOM   5864  C  CG    . LEU B 1  246 ? 136.008 162.133 181.870 1.00 70.97  ? 510  LEU C CG    1 
ATOM   5865  C  CD1   . LEU B 1  246 ? 137.481 161.797 181.704 1.00 70.97  ? 510  LEU C CD1   1 
ATOM   5866  C  CD2   . LEU B 1  246 ? 135.820 163.620 182.119 1.00 70.97  ? 510  LEU C CD2   1 
ATOM   5867  N  N     . LEU B 1  247 ? 132.655 160.349 179.128 1.00 68.75  ? 511  LEU C N     1 
ATOM   5868  C  CA    . LEU B 1  247 ? 132.068 160.027 177.839 1.00 68.75  ? 511  LEU C CA    1 
ATOM   5869  C  C     . LEU B 1  247 ? 130.677 160.647 177.713 1.00 68.75  ? 511  LEU C C     1 
ATOM   5870  O  O     . LEU B 1  247 ? 129.994 160.876 178.714 1.00 68.75  ? 511  LEU C O     1 
ATOM   5871  C  CB    . LEU B 1  247 ? 131.989 158.512 177.656 1.00 68.75  ? 511  LEU C CB    1 
ATOM   5872  C  CG    . LEU B 1  247 ? 133.331 157.787 177.552 1.00 68.75  ? 511  LEU C CG    1 
ATOM   5873  C  CD1   . LEU B 1  247 ? 133.123 156.283 177.491 1.00 68.75  ? 511  LEU C CD1   1 
ATOM   5874  C  CD2   . LEU B 1  247 ? 134.104 158.278 176.341 1.00 68.75  ? 511  LEU C CD2   1 
ATOM   5875  N  N     . PRO B 1  248 ? 130.244 160.935 176.488 1.00 68.26  ? 512  PRO C N     1 
ATOM   5876  C  CA    . PRO B 1  248 ? 128.913 161.519 176.289 1.00 68.26  ? 512  PRO C CA    1 
ATOM   5877  C  C     . PRO B 1  248 ? 127.810 160.559 176.708 1.00 68.26  ? 512  PRO C C     1 
ATOM   5878  O  O     . PRO B 1  248 ? 128.015 159.359 176.895 1.00 68.26  ? 512  PRO C O     1 
ATOM   5879  C  CB    . PRO B 1  248 ? 128.866 161.793 174.782 1.00 68.26  ? 512  PRO C CB    1 
ATOM   5880  C  CG    . PRO B 1  248 ? 130.296 161.882 174.371 1.00 68.26  ? 512  PRO C CG    1 
ATOM   5881  C  CD    . PRO B 1  248 ? 131.016 160.894 175.236 1.00 68.26  ? 512  PRO C CD    1 
ATOM   5882  N  N     . GLY B 1  249 ? 126.613 161.117 176.850 1.00 72.18  ? 513  GLY C N     1 
ATOM   5883  C  CA    . GLY B 1  249 ? 125.468 160.331 177.266 1.00 72.18  ? 513  GLY C CA    1 
ATOM   5884  C  C     . GLY B 1  249 ? 125.436 160.017 178.744 1.00 72.18  ? 513  GLY C C     1 
ATOM   5885  O  O     . GLY B 1  249 ? 125.059 158.904 179.131 1.00 72.18  ? 513  GLY C O     1 
ATOM   5886  N  N     . TYR B 1  250 ? 125.825 160.964 179.582 1.00 71.67  ? 514  TYR C N     1 
ATOM   5887  C  CA    . TYR B 1  250 ? 125.848 160.766 181.027 1.00 71.67  ? 514  TYR C CA    1 
ATOM   5888  C  C     . TYR B 1  250 ? 125.079 161.834 181.788 1.00 71.67  ? 514  TYR C C     1 
ATOM   5889  O  O     . TYR B 1  250 ? 124.472 161.528 182.817 1.00 71.67  ? 514  TYR C O     1 
ATOM   5890  C  CB    . TYR B 1  250 ? 127.302 160.720 181.525 1.00 71.67  ? 514  TYR C CB    1 
ATOM   5891  C  CG    . TYR B 1  250 ? 127.434 160.485 183.012 1.00 71.67  ? 514  TYR C CG    1 
ATOM   5892  C  CD1   . TYR B 1  250 ? 127.236 159.223 183.555 1.00 71.67  ? 514  TYR C CD1   1 
ATOM   5893  C  CD2   . TYR B 1  250 ? 127.755 161.526 183.873 1.00 71.67  ? 514  TYR C CD2   1 
ATOM   5894  C  CE1   . TYR B 1  250 ? 127.354 159.004 184.913 1.00 71.67  ? 514  TYR C CE1   1 
ATOM   5895  C  CE2   . TYR B 1  250 ? 127.876 161.316 185.232 1.00 71.67  ? 514  TYR C CE2   1 
ATOM   5896  C  CZ    . TYR B 1  250 ? 127.674 160.054 185.747 1.00 71.67  ? 514  TYR C CZ    1 
ATOM   5897  O  OH    . TYR B 1  250 ? 127.794 159.840 187.100 1.00 71.67  ? 514  TYR C OH    1 
ATOM   5898  N  N     . HIS B 1  251 ? 125.086 163.076 181.311 1.00 72.89  ? 515  HIS C N     1 
ATOM   5899  C  CA    . HIS B 1  251 ? 124.418 164.143 182.042 1.00 72.89  ? 515  HIS C CA    1 
ATOM   5900  C  C     . HIS B 1  251 ? 123.063 164.462 181.424 1.00 72.89  ? 515  HIS C C     1 
ATOM   5901  O  O     . HIS B 1  251 ? 122.933 164.501 180.196 1.00 72.89  ? 515  HIS C O     1 
ATOM   5902  C  CB    . HIS B 1  251 ? 125.277 165.406 182.056 1.00 72.89  ? 515  HIS C CB    1 
ATOM   5903  C  CG    . HIS B 1  251 ? 126.558 165.255 182.814 1.00 72.89  ? 515  HIS C CG    1 
ATOM   5904  N  ND1   . HIS B 1  251 ? 127.717 164.792 182.231 1.00 72.89  ? 515  HIS C ND1   1 
ATOM   5905  C  CD2   . HIS B 1  251 ? 126.862 165.501 184.111 1.00 72.89  ? 515  HIS C CD2   1 
ATOM   5906  C  CE1   . HIS B 1  251 ? 128.680 164.761 183.134 1.00 72.89  ? 515  HIS C CE1   1 
ATOM   5907  N  NE2   . HIS B 1  251 ? 128.187 165.186 184.283 1.00 72.89  ? 515  HIS C NE2   1 
ATOM   5908  N  N     . PRO B 1  252 ? 122.045 164.693 182.250 1.00 70.67  ? 516  PRO C N     1 
ATOM   5909  C  CA    . PRO B 1  252 ? 120.719 165.018 181.715 1.00 70.67  ? 516  PRO C CA    1 
ATOM   5910  C  C     . PRO B 1  252 ? 120.658 166.444 181.189 1.00 70.67  ? 516  PRO C C     1 
ATOM   5911  O  O     . PRO B 1  252 ? 121.297 167.355 181.722 1.00 70.67  ? 516  PRO C O     1 
ATOM   5912  C  CB    . PRO B 1  252 ? 119.798 164.836 182.927 1.00 70.67  ? 516  PRO C CB    1 
ATOM   5913  C  CG    . PRO B 1  252 ? 120.679 165.109 184.098 1.00 70.67  ? 516  PRO C CG    1 
ATOM   5914  C  CD    . PRO B 1  252 ? 122.043 164.596 183.720 1.00 70.67  ? 516  PRO C CD    1 
ATOM   5915  N  N     . PHE B 1  253 ? 119.885 166.632 180.127 1.00 73.07  ? 517  PHE C N     1 
ATOM   5916  C  CA    . PHE B 1  253 ? 119.735 167.937 179.508 1.00 73.07  ? 517  PHE C CA    1 
ATOM   5917  C  C     . PHE B 1  253 ? 118.421 167.970 178.753 1.00 73.07  ? 517  PHE C C     1 
ATOM   5918  O  O     . PHE B 1  253 ? 117.852 166.924 178.450 1.00 73.07  ? 517  PHE C O     1 
ATOM   5919  C  CB    . PHE B 1  253 ? 120.880 168.184 178.534 1.00 73.07  ? 517  PHE C CB    1 
ATOM   5920  C  CG    . PHE B 1  253 ? 120.929 167.199 177.405 1.00 73.07  ? 517  PHE C CG    1 
ATOM   5921  C  CD1   . PHE B 1  253 ? 121.977 166.306 177.293 1.00 73.07  ? 517  PHE C CD1   1 
ATOM   5922  C  CD2   . PHE B 1  253 ? 119.919 167.161 176.461 1.00 73.07  ? 517  PHE C CD2   1 
ATOM   5923  C  CE1   . PHE B 1  253 ? 122.022 165.395 176.256 1.00 73.07  ? 517  PHE C CE1   1 
ATOM   5924  C  CE2   . PHE B 1  253 ? 119.957 166.253 175.422 1.00 73.07  ? 517  PHE C CE2   1 
ATOM   5925  C  CZ    . PHE B 1  253 ? 121.010 165.369 175.319 1.00 73.07  ? 517  PHE C CZ    1 
ATOM   5926  N  N     . GLU B 1  254 ? 117.945 169.169 178.444 1.00 76.68  ? 518  GLU C N     1 
ATOM   5927  C  CA    . GLU B 1  254 ? 116.693 169.324 177.718 1.00 76.68  ? 518  GLU C CA    1 
ATOM   5928  C  C     . GLU B 1  254 ? 116.602 170.699 177.081 1.00 76.68  ? 518  GLU C C     1 
ATOM   5929  O  O     . GLU B 1  254 ? 116.797 171.711 177.748 1.00 76.68  ? 518  GLU C O     1 
ATOM   5930  C  CB    . GLU B 1  254 ? 115.506 169.117 178.656 1.00 76.68  ? 518  GLU C CB    1 
ATOM   5931  C  CG    . GLU B 1  254 ? 114.904 170.410 179.176 1.00 76.68  ? 518  GLU C CG    1 
ATOM   5932  C  CD    . GLU B 1  254 ? 113.415 170.294 179.425 1.00 76.68  ? 518  GLU C CD    1 
ATOM   5933  O  OE1   . GLU B 1  254 ? 113.028 169.683 180.443 1.00 76.68  ? 518  GLU C OE1   1 
ATOM   5934  O  OE2   . GLU B 1  254 ? 112.631 170.811 178.602 1.00 76.68  ? 518  GLU C OE2   1 
ATOM   5935  N  N     . TRP B 1  255 ? 116.307 170.732 175.787 1.00 71.71  ? 519  TRP C N     1 
ATOM   5936  C  CA    . TRP B 1  255 ? 116.182 171.991 175.067 1.00 71.71  ? 519  TRP C CA    1 
ATOM   5937  C  C     . TRP B 1  255 ? 114.817 172.597 175.336 1.00 71.71  ? 519  TRP C C     1 
ATOM   5938  O  O     . TRP B 1  255 ? 113.866 171.875 175.619 1.00 71.71  ? 519  TRP C O     1 
ATOM   5939  C  CB    . TRP B 1  255 ? 116.381 171.764 173.572 1.00 71.71  ? 519  TRP C CB    1 
ATOM   5940  C  CG    . TRP B 1  255 ? 117.553 170.894 173.279 1.00 71.71  ? 519  TRP C CG    1 
ATOM   5941  C  CD1   . TRP B 1  255 ? 117.638 169.550 173.469 1.00 71.71  ? 519  TRP C CD1   1 
ATOM   5942  C  CD2   . TRP B 1  255 ? 118.819 171.308 172.757 1.00 71.71  ? 519  TRP C CD2   1 
ATOM   5943  N  NE1   . TRP B 1  255 ? 118.876 169.097 173.092 1.00 71.71  ? 519  TRP C NE1   1 
ATOM   5944  C  CE2   . TRP B 1  255 ? 119.621 170.158 172.651 1.00 71.71  ? 519  TRP C CE2   1 
ATOM   5945  C  CE3   . TRP B 1  255 ? 119.350 172.539 172.366 1.00 71.71  ? 519  TRP C CE3   1 
ATOM   5946  C  CZ2   . TRP B 1  255 ? 120.924 170.201 172.172 1.00 71.71  ? 519  TRP C CZ2   1 
ATOM   5947  C  CZ3   . TRP B 1  255 ? 120.644 172.579 171.891 1.00 71.71  ? 519  TRP C CZ3   1 
ATOM   5948  C  CH2   . TRP B 1  255 ? 121.417 171.418 171.797 1.00 71.71  ? 519  TRP C CH2   1 
ATOM   5949  N  N     . GLN B 1  256 ? 114.726 173.921 175.258 1.00 76.84  ? 520  GLN C N     1 
ATOM   5950  C  CA    . GLN B 1  256 ? 113.470 174.623 175.506 1.00 76.84  ? 520  GLN C CA    1 
ATOM   5951  C  C     . GLN B 1  256 ? 112.350 174.066 174.646 1.00 76.84  ? 520  GLN C C     1 
ATOM   5952  O  O     . GLN B 1  256 ? 111.368 173.540 175.166 1.00 76.84  ? 520  GLN C O     1 
ATOM   5953  C  CB    . GLN B 1  256 ? 113.624 176.119 175.254 1.00 76.84  ? 520  GLN C CB    1 
ATOM   5954  C  CG    . GLN B 1  256 ? 112.713 176.961 176.127 1.00 76.84  ? 520  GLN C CG    1 
ATOM   5955  C  CD    . GLN B 1  256 ? 112.036 176.138 177.205 1.00 76.84  ? 520  GLN C CD    1 
ATOM   5956  O  OE1   . GLN B 1  256 ? 112.313 176.303 178.393 1.00 76.84  ? 520  GLN C OE1   1 
ATOM   5957  N  NE2   . GLN B 1  256 ? 111.146 175.241 176.795 1.00 76.84  ? 520  GLN C NE2   1 
ATOM   5958  N  N     . PRO B 1  257 ? 112.478 174.222 173.323 1.00 70.62  ? 521  PRO C N     1 
ATOM   5959  C  CA    . PRO B 1  257 ? 111.520 173.699 172.354 1.00 70.62  ? 521  PRO C CA    1 
ATOM   5960  C  C     . PRO B 1  257 ? 112.126 172.439 171.767 1.00 70.62  ? 521  PRO C C     1 
ATOM   5961  O  O     . PRO B 1  257 ? 113.020 172.548 170.932 1.00 70.62  ? 521  PRO C O     1 
ATOM   5962  C  CB    . PRO B 1  257 ? 111.470 174.802 171.300 1.00 70.62  ? 521  PRO C CB    1 
ATOM   5963  C  CG    . PRO B 1  257 ? 112.792 175.500 171.401 1.00 70.62  ? 521  PRO C CG    1 
ATOM   5964  C  CD    . PRO B 1  257 ? 113.479 175.080 172.675 1.00 70.62  ? 521  PRO C CD    1 
ATOM   5965  N  N     . PRO B 1  258 ? 111.655 171.264 172.215 1.00 69.69  ? 522  PRO C N     1 
ATOM   5966  C  CA    . PRO B 1  258 ? 112.091 169.915 171.838 1.00 69.69  ? 522  PRO C CA    1 
ATOM   5967  C  C     . PRO B 1  258 ? 112.574 169.802 170.400 1.00 69.69  ? 522  PRO C C     1 
ATOM   5968  O  O     . PRO B 1  258 ? 111.842 170.152 169.478 1.00 69.69  ? 522  PRO C O     1 
ATOM   5969  C  CB    . PRO B 1  258 ? 110.823 169.089 172.026 1.00 69.69  ? 522  PRO C CB    1 
ATOM   5970  C  CG    . PRO B 1  258 ? 110.117 169.765 173.151 1.00 69.69  ? 522  PRO C CG    1 
ATOM   5971  C  CD    . PRO B 1  258 ? 110.488 171.224 173.113 1.00 69.69  ? 522  PRO C CD    1 
ATOM   5972  N  N     . LEU B 1  259 ? 113.799 169.325 170.215 1.00 72.02  ? 523  LEU C N     1 
ATOM   5973  C  CA    . LEU B 1  259 ? 114.349 169.182 168.877 1.00 72.02  ? 523  LEU C CA    1 
ATOM   5974  C  C     . LEU B 1  259 ? 113.417 168.365 167.990 1.00 72.02  ? 523  LEU C C     1 
ATOM   5975  O  O     . LEU B 1  259 ? 112.691 167.482 168.455 1.00 72.02  ? 523  LEU C O     1 
ATOM   5976  C  CB    . LEU B 1  259 ? 115.725 168.520 168.935 1.00 72.02  ? 523  LEU C CB    1 
ATOM   5977  C  CG    . LEU B 1  259 ? 116.828 169.317 169.631 1.00 72.02  ? 523  LEU C CG    1 
ATOM   5978  C  CD1   . LEU B 1  259 ? 118.097 168.490 169.739 1.00 72.02  ? 523  LEU C CD1   1 
ATOM   5979  C  CD2   . LEU B 1  259 ? 117.092 170.618 168.892 1.00 72.02  ? 523  LEU C CD2   1 
ATOM   5980  N  N     . LYS B 1  260 ? 113.446 168.670 166.696 1.00 75.28  ? 524  LYS C N     1 
ATOM   5981  C  CA    . LYS B 1  260 ? 112.617 167.982 165.717 1.00 75.28  ? 524  LYS C CA    1 
ATOM   5982  C  C     . LYS B 1  260 ? 113.351 166.757 165.187 1.00 75.28  ? 524  LYS C C     1 
ATOM   5983  O  O     . LYS B 1  260 ? 114.538 166.834 164.854 1.00 75.28  ? 524  LYS C O     1 
ATOM   5984  C  CB    . LYS B 1  260 ? 112.252 168.920 164.567 1.00 75.28  ? 524  LYS C CB    1 
ATOM   5985  C  CG    . LYS B 1  260 ? 111.458 170.143 164.992 1.00 75.28  ? 524  LYS C CG    1 
ATOM   5986  C  CD    . LYS B 1  260 ? 110.125 169.750 165.608 1.00 75.28  ? 524  LYS C CD    1 
ATOM   5987  C  CE    . LYS B 1  260 ? 109.207 169.119 164.575 1.00 75.28  ? 524  LYS C CE    1 
ATOM   5988  N  NZ    . LYS B 1  260 ? 108.832 170.083 163.505 1.00 75.28  ? 524  LYS C NZ    1 
ATOM   5989  N  N     . ASN B 1  261 ? 112.640 165.629 165.122 1.00 75.45  ? 525  ASN C N     1 
ATOM   5990  C  CA    . ASN B 1  261 ? 113.179 164.371 164.602 1.00 75.45  ? 525  ASN C CA    1 
ATOM   5991  C  C     . ASN B 1  261 ? 114.383 163.888 165.406 1.00 75.45  ? 525  ASN C C     1 
ATOM   5992  O  O     . ASN B 1  261 ? 115.241 163.171 164.887 1.00 75.45  ? 525  ASN C O     1 
ATOM   5993  C  CB    . ASN B 1  261 ? 113.543 164.491 163.119 1.00 75.45  ? 525  ASN C CB    1 
ATOM   5994  C  CG    . ASN B 1  261 ? 112.337 164.767 162.244 1.00 75.45  ? 525  ASN C CG    1 
ATOM   5995  O  OD1   . ASN B 1  261 ? 112.228 165.831 161.636 1.00 75.45  ? 525  ASN C OD1   1 
ATOM   5996  N  ND2   . ASN B 1  261 ? 111.424 163.806 162.176 1.00 75.45  ? 525  ASN C ND2   1 
ATOM   5997  N  N     . VAL B 1  262 ? 114.456 164.271 166.679 1.00 75.25  ? 526  VAL C N     1 
ATOM   5998  C  CA    . VAL B 1  262 ? 115.539 163.869 167.566 1.00 75.25  ? 526  VAL C CA    1 
ATOM   5999  C  C     . VAL B 1  262 ? 114.932 163.290 168.835 1.00 75.25  ? 526  VAL C C     1 
ATOM   6000  O  O     . VAL B 1  262 ? 114.001 163.866 169.408 1.00 75.25  ? 526  VAL C O     1 
ATOM   6001  C  CB    . VAL B 1  262 ? 116.476 165.050 167.899 1.00 75.25  ? 526  VAL C CB    1 
ATOM   6002  C  CG1   . VAL B 1  262 ? 117.536 164.626 168.902 1.00 75.25  ? 526  VAL C CG1   1 
ATOM   6003  C  CG2   . VAL B 1  262 ? 117.123 165.590 166.633 1.00 75.25  ? 526  VAL C CG2   1 
ATOM   6004  N  N     . SER B 1  263 ? 115.459 162.149 169.272 1.00 73.43  ? 527  SER C N     1 
ATOM   6005  C  CA    . SER B 1  263 ? 114.940 161.480 170.453 1.00 73.43  ? 527  SER C CA    1 
ATOM   6006  C  C     . SER B 1  263 ? 115.293 162.273 171.711 1.00 73.43  ? 527  SER C C     1 
ATOM   6007  O  O     . SER B 1  263 ? 116.098 163.208 171.691 1.00 73.43  ? 527  SER C O     1 
ATOM   6008  C  CB    . SER B 1  263 ? 115.483 160.056 170.536 1.00 73.43  ? 527  SER C CB    1 
ATOM   6009  O  OG    . SER B 1  263 ? 115.034 159.274 169.443 1.00 73.43  ? 527  SER C OG    1 
ATOM   6010  N  N     . SER B 1  264 ? 114.673 161.887 172.826 1.00 72.59  ? 528  SER C N     1 
ATOM   6011  C  CA    . SER B 1  264 ? 114.920 162.527 174.110 1.00 72.59  ? 528  SER C CA    1 
ATOM   6012  C  C     . SER B 1  264 ? 115.827 161.714 175.022 1.00 72.59  ? 528  SER C C     1 
ATOM   6013  O  O     . SER B 1  264 ? 116.161 162.185 176.115 1.00 72.59  ? 528  SER C O     1 
ATOM   6014  C  CB    . SER B 1  264 ? 113.596 162.797 174.833 1.00 72.59  ? 528  SER C CB    1 
ATOM   6015  O  OG    . SER B 1  264 ? 112.799 163.718 174.110 1.00 72.59  ? 528  SER C OG    1 
ATOM   6016  N  N     . ARG B 1  265 ? 116.221 160.513 174.607 1.00 76.05  ? 529  ARG C N     1 
ATOM   6017  C  CA    . ARG B 1  265 ? 117.098 159.670 175.409 1.00 76.05  ? 529  ARG C CA    1 
ATOM   6018  C  C     . ARG B 1  265 ? 118.435 160.355 175.652 1.00 76.05  ? 529  ARG C C     1 
ATOM   6019  O  O     . ARG B 1  265 ? 119.165 160.666 174.708 1.00 76.05  ? 529  ARG C O     1 
ATOM   6020  C  CB    . ARG B 1  265 ? 117.309 158.328 174.706 1.00 76.05  ? 529  ARG C CB    1 
ATOM   6021  C  CG    . ARG B 1  265 ? 116.046 157.502 174.548 1.00 76.05  ? 529  ARG C CG    1 
ATOM   6022  C  CD    . ARG B 1  265 ? 115.546 157.007 175.892 1.00 76.05  ? 529  ARG C CD    1 
ATOM   6023  N  NE    . ARG B 1  265 ? 116.536 156.170 176.563 1.00 76.05  ? 529  ARG C NE    1 
ATOM   6024  C  CZ    . ARG B 1  265 ? 116.671 154.863 176.359 1.00 76.05  ? 529  ARG C CZ    1 
ATOM   6025  N  NH1   . ARG B 1  265 ? 115.876 154.239 175.501 1.00 76.05  ? 529  ARG C NH1   1 
ATOM   6026  N  NH2   . ARG B 1  265 ? 117.600 154.181 177.013 1.00 76.05  ? 529  ARG C NH2   1 
ATOM   6027  N  N     . THR B 1  266 ? 118.754 160.586 176.924 1.00 76.79  ? 530  THR C N     1 
ATOM   6028  C  CA    . THR B 1  266 ? 119.984 161.264 177.309 1.00 76.79  ? 530  THR C CA    1 
ATOM   6029  C  C     . THR B 1  266 ? 121.135 160.306 177.579 1.00 76.79  ? 530  THR C C     1 
ATOM   6030  O  O     . THR B 1  266 ? 122.246 160.762 177.866 1.00 76.79  ? 530  THR C O     1 
ATOM   6031  C  CB    . THR B 1  266 ? 119.744 162.135 178.547 1.00 76.79  ? 530  THR C CB    1 
ATOM   6032  O  OG1   . THR B 1  266 ? 119.334 161.307 179.642 1.00 76.79  ? 530  THR C OG1   1 
ATOM   6033  C  CG2   . THR B 1  266 ? 118.666 163.170 178.268 1.00 76.79  ? 530  THR C CG2   1 
ATOM   6034  N  N     . ASP B 1  267 ? 120.903 158.998 177.496 1.00 76.01  ? 531  ASP C N     1 
ATOM   6035  C  CA    . ASP B 1  267 ? 121.941 157.994 177.724 1.00 76.01  ? 531  ASP C CA    1 
ATOM   6036  C  C     . ASP B 1  267 ? 122.435 157.380 176.421 1.00 76.01  ? 531  ASP C C     1 
ATOM   6037  O  O     . ASP B 1  267 ? 122.757 156.190 176.364 1.00 76.01  ? 531  ASP C O     1 
ATOM   6038  C  CB    . ASP B 1  267 ? 121.431 156.911 178.671 1.00 76.01  ? 531  ASP C CB    1 
ATOM   6039  C  CG    . ASP B 1  267 ? 120.210 156.184 178.132 1.00 76.01  ? 531  ASP C CG    1 
ATOM   6040  O  OD1   . ASP B 1  267 ? 119.700 156.569 177.058 1.00 76.01  ? 531  ASP C OD1   1 
ATOM   6041  O  OD2   . ASP B 1  267 ? 119.760 155.218 178.783 1.00 76.01  ? 531  ASP C OD2   1 
ATOM   6042  N  N     . VAL B 1  268 ? 122.508 158.175 175.358 1.00 75.35  ? 532  VAL C N     1 
ATOM   6043  C  CA    . VAL B 1  268 ? 122.904 157.703 174.037 1.00 75.35  ? 532  VAL C CA    1 
ATOM   6044  C  C     . VAL B 1  268 ? 124.365 158.074 173.827 1.00 75.35  ? 532  VAL C C     1 
ATOM   6045  O  O     . VAL B 1  268 ? 124.709 159.259 173.732 1.00 75.35  ? 532  VAL C O     1 
ATOM   6046  C  CB    . VAL B 1  268 ? 122.017 158.293 172.934 1.00 75.35  ? 532  VAL C CB    1 
ATOM   6047  C  CG1   . VAL B 1  268 ? 122.535 157.887 171.568 1.00 75.35  ? 532  VAL C CG1   1 
ATOM   6048  C  CG2   . VAL B 1  268 ? 120.579 157.840 173.116 1.00 75.35  ? 532  VAL C CG2   1 
ATOM   6049  N  N     . GLY B 1  269 ? 125.227 157.063 173.750 1.00 75.20  ? 533  GLY C N     1 
ATOM   6050  C  CA    . GLY B 1  269 ? 126.642 157.285 173.529 1.00 75.20  ? 533  GLY C CA    1 
ATOM   6051  C  C     . GLY B 1  269 ? 127.090 156.901 172.134 1.00 75.20  ? 533  GLY C C     1 
ATOM   6052  O  O     . GLY B 1  269 ? 126.566 157.419 171.143 1.00 75.20  ? 533  GLY C O     1 
ATOM   6053  N  N     . ILE B 1  270 ? 128.062 155.995 172.043 1.00 72.26  ? 534  ILE C N     1 
ATOM   6054  C  CA    . ILE B 1  270 ? 128.543 155.539 170.745 1.00 72.26  ? 534  ILE C CA    1 
ATOM   6055  C  C     . ILE B 1  270 ? 127.483 154.664 170.093 1.00 72.26  ? 534  ILE C C     1 
ATOM   6056  O  O     . ILE B 1  270 ? 127.067 153.641 170.653 1.00 72.26  ? 534  ILE C O     1 
ATOM   6057  C  CB    . ILE B 1  270 ? 129.872 154.786 170.894 1.00 72.26  ? 534  ILE C CB    1 
ATOM   6058  C  CG1   . ILE B 1  270 ? 130.957 155.721 171.427 1.00 72.26  ? 534  ILE C CG1   1 
ATOM   6059  C  CG2   . ILE B 1  270 ? 130.292 154.187 169.562 1.00 72.26  ? 534  ILE C CG2   1 
ATOM   6060  C  CD1   . ILE B 1  270 ? 132.222 155.013 171.853 1.00 72.26  ? 534  ILE C CD1   1 
ATOM   6061  N  N     . ILE B 1  271 ? 127.043 155.061 168.901 1.00 73.18  ? 535  ILE C N     1 
ATOM   6062  C  CA    . ILE B 1  271 ? 126.017 154.323 168.173 1.00 73.18  ? 535  ILE C CA    1 
ATOM   6063  C  C     . ILE B 1  271 ? 126.546 153.934 166.801 1.00 73.18  ? 535  ILE C C     1 
ATOM   6064  O  O     . ILE B 1  271 ? 127.684 154.260 166.445 1.00 73.18  ? 535  ILE C O     1 
ATOM   6065  C  CB    . ILE B 1  271 ? 124.723 155.145 168.046 1.00 73.18  ? 535  ILE C CB    1 
ATOM   6066  C  CG1   . ILE B 1  271 ? 124.989 156.435 167.268 1.00 73.18  ? 535  ILE C CG1   1 
ATOM   6067  C  CG2   . ILE B 1  271 ? 124.151 155.451 169.417 1.00 73.18  ? 535  ILE C CG2   1 
ATOM   6068  C  CD1   . ILE B 1  271 ? 123.737 157.192 166.898 1.00 73.18  ? 535  ILE C CD1   1 
ATOM   6069  N  N     . ASP B 1  272 ? 125.724 153.235 166.025 1.00 78.30  ? 536  ASP C N     1 
ATOM   6070  C  CA    . ASP B 1  272 ? 126.105 152.871 164.670 1.00 78.30  ? 536  ASP C CA    1 
ATOM   6071  C  C     . ASP B 1  272 ? 126.059 154.092 163.760 1.00 78.30  ? 536  ASP C C     1 
ATOM   6072  O  O     . ASP B 1  272 ? 125.185 154.955 163.881 1.00 78.30  ? 536  ASP C O     1 
ATOM   6073  C  CB    . ASP B 1  272 ? 125.185 151.775 164.135 1.00 78.30  ? 536  ASP C CB    1 
ATOM   6074  C  CG    . ASP B 1  272 ? 125.622 151.258 162.781 1.00 78.30  ? 536  ASP C CG    1 
ATOM   6075  O  OD1   . ASP B 1  272 ? 126.628 150.520 162.720 1.00 78.30  ? 536  ASP C OD1   1 
ATOM   6076  O  OD2   . ASP B 1  272 ? 124.957 151.588 161.778 1.00 78.30  ? 536  ASP C OD2   1 
ATOM   6077  N  N     . GLY B 1  273 ? 127.016 154.159 162.839 1.00 78.37  ? 537  GLY C N     1 
ATOM   6078  C  CA    . GLY B 1  273 ? 127.137 155.308 161.965 1.00 78.37  ? 537  GLY C CA    1 
ATOM   6079  C  C     . GLY B 1  273 ? 126.261 155.243 160.731 1.00 78.37  ? 537  GLY C C     1 
ATOM   6080  O  O     . GLY B 1  273 ? 125.914 156.280 160.158 1.00 78.37  ? 537  GLY C O     1 
ATOM   6081  N  N     . LEU B 1  274 ? 125.897 154.031 160.309 1.00 79.19  ? 538  LEU C N     1 
ATOM   6082  C  CA    . LEU B 1  274 ? 125.053 153.869 159.131 1.00 79.19  ? 538  LEU C CA    1 
ATOM   6083  C  C     . LEU B 1  274 ? 123.641 154.399 159.339 1.00 79.19  ? 538  LEU C C     1 
ATOM   6084  O  O     . LEU B 1  274 ? 122.919 154.579 158.352 1.00 79.19  ? 538  LEU C O     1 
ATOM   6085  C  CB    . LEU B 1  274 ? 124.997 152.397 158.723 1.00 79.19  ? 538  LEU C CB    1 
ATOM   6086  C  CG    . LEU B 1  274 ? 126.313 151.774 158.256 1.00 79.19  ? 538  LEU C CG    1 
ATOM   6087  C  CD1   . LEU B 1  274 ? 126.146 150.281 158.027 1.00 79.19  ? 538  LEU C CD1   1 
ATOM   6088  C  CD2   . LEU B 1  274 ? 126.813 152.458 156.996 1.00 79.19  ? 538  LEU C CD2   1 
ATOM   6089  N  N     . SER B 1  275 ? 123.237 154.646 160.587 1.00 78.30  ? 539  SER C N     1 
ATOM   6090  C  CA    . SER B 1  275 ? 121.927 155.217 160.905 1.00 78.30  ? 539  SER C CA    1 
ATOM   6091  C  C     . SER B 1  275 ? 120.791 154.357 160.355 1.00 78.30  ? 539  SER C C     1 
ATOM   6092  O  O     . SER B 1  275 ? 119.870 154.854 159.704 1.00 78.30  ? 539  SER C O     1 
ATOM   6093  C  CB    . SER B 1  275 ? 121.815 156.656 160.398 1.00 78.30  ? 539  SER C CB    1 
ATOM   6094  O  OG    . SER B 1  275 ? 122.749 157.497 161.053 1.00 78.30  ? 539  SER C OG    1 
ATOM   6095  N  N     . GLY B 1  276 ? 120.857 153.055 160.619 1.00 79.51  ? 540  GLY C N     1 
ATOM   6096  C  CA    . GLY B 1  276 ? 119.817 152.146 160.190 1.00 79.51  ? 540  GLY C CA    1 
ATOM   6097  C  C     . GLY B 1  276 ? 119.779 151.856 158.708 1.00 79.51  ? 540  GLY C C     1 
ATOM   6098  O  O     . GLY B 1  276 ? 118.738 151.417 158.208 1.00 79.51  ? 540  GLY C O     1 
ATOM   6099  N  N     . LEU B 1  277 ? 120.874 152.092 157.988 1.00 78.63  ? 541  LEU C N     1 
ATOM   6100  C  CA    . LEU B 1  277 ? 120.906 151.799 156.562 1.00 78.63  ? 541  LEU C CA    1 
ATOM   6101  C  C     . LEU B 1  277 ? 120.797 150.298 156.329 1.00 78.63  ? 541  LEU C C     1 
ATOM   6102  O  O     . LEU B 1  277 ? 121.543 149.510 156.916 1.00 78.63  ? 541  LEU C O     1 
ATOM   6103  C  CB    . LEU B 1  277 ? 122.192 152.342 155.941 1.00 78.63  ? 541  LEU C CB    1 
ATOM   6104  C  CG    . LEU B 1  277 ? 122.341 152.161 154.430 1.00 78.63  ? 541  LEU C CG    1 
ATOM   6105  C  CD1   . LEU B 1  277 ? 121.249 152.915 153.690 1.00 78.63  ? 541  LEU C CD1   1 
ATOM   6106  C  CD2   . LEU B 1  277 ? 123.717 152.615 153.971 1.00 78.63  ? 541  LEU C CD2   1 
ATOM   6107  N  N     . ALA B 1  278 ? 119.863 149.906 155.470 1.00 80.32  ? 542  ALA C N     1 
ATOM   6108  C  CA    . ALA B 1  278 ? 119.634 148.496 155.200 1.00 80.32  ? 542  ALA C CA    1 
ATOM   6109  C  C     . ALA B 1  278 ? 120.775 147.913 154.377 1.00 80.32  ? 542  ALA C C     1 
ATOM   6110  O  O     . ALA B 1  278 ? 121.271 148.532 153.432 1.00 80.32  ? 542  ALA C O     1 
ATOM   6111  C  CB    . ALA B 1  278 ? 118.306 148.295 154.470 1.00 80.32  ? 542  ALA C CB    1 
ATOM   6112  N  N     . SER B 1  279 ? 121.189 146.701 154.751 1.00 86.76  ? 543  SER C N     1 
ATOM   6113  C  CA    . SER B 1  279 ? 122.292 146.010 154.095 1.00 86.76  ? 543  SER C CA    1 
ATOM   6114  C  C     . SER B 1  279 ? 121.818 144.800 153.299 1.00 86.76  ? 543  SER C C     1 
ATOM   6115  O  O     . SER B 1  279 ? 122.608 143.888 153.035 1.00 86.76  ? 543  SER C O     1 
ATOM   6116  C  CB    . SER B 1  279 ? 123.344 145.586 155.122 1.00 86.76  ? 543  SER C CB    1 
ATOM   6117  O  OG    . SER B 1  279 ? 123.930 146.715 155.746 1.00 86.76  ? 543  SER C OG    1 
ATOM   6118  N  N     . SER B 1  280 ? 120.544 144.767 152.920 1.00 83.31  ? 544  SER C N     1 
ATOM   6119  C  CA    . SER B 1  280 ? 120.032 143.654 152.136 1.00 83.31  ? 544  SER C CA    1 
ATOM   6120  C  C     . SER B 1  280 ? 120.655 143.652 150.745 1.00 83.31  ? 544  SER C C     1 
ATOM   6121  O  O     . SER B 1  280 ? 121.002 144.698 150.191 1.00 83.31  ? 544  SER C O     1 
ATOM   6122  C  CB    . SER B 1  280 ? 118.509 143.730 152.030 1.00 83.31  ? 544  SER C CB    1 
ATOM   6123  O  OG    . SER B 1  280 ? 117.904 143.596 153.304 1.00 83.31  ? 544  SER C OG    1 
ATOM   6124  N  N     . VAL B 1  281 ? 120.803 142.449 150.184 1.00 79.90  ? 545  VAL C N     1 
ATOM   6125  C  CA    . VAL B 1  281 ? 121.347 142.305 148.840 1.00 79.90  ? 545  VAL C CA    1 
ATOM   6126  C  C     . VAL B 1  281 ? 120.429 142.915 147.794 1.00 79.90  ? 545  VAL C C     1 
ATOM   6127  O  O     . VAL B 1  281 ? 120.874 143.225 146.685 1.00 79.90  ? 545  VAL C O     1 
ATOM   6128  C  CB    . VAL B 1  281 ? 121.609 140.819 148.526 1.00 79.90  ? 545  VAL C CB    1 
ATOM   6129  C  CG1   . VAL B 1  281 ? 122.641 140.248 149.484 1.00 79.90  ? 545  VAL C CG1   1 
ATOM   6130  C  CG2   . VAL B 1  281 ? 120.313 140.032 148.599 1.00 79.90  ? 545  VAL C CG2   1 
ATOM   6131  N  N     . ASP B 1  282 ? 119.153 143.104 148.122 1.00 79.31  ? 546  ASP C N     1 
ATOM   6132  C  CA    . ASP B 1  282 ? 118.172 143.612 147.173 1.00 79.31  ? 546  ASP C CA    1 
ATOM   6133  C  C     . ASP B 1  282 ? 118.302 145.114 146.942 1.00 79.31  ? 546  ASP C C     1 
ATOM   6134  O  O     . ASP B 1  282 ? 117.544 145.671 146.143 1.00 79.31  ? 546  ASP C O     1 
ATOM   6135  C  CB    . ASP B 1  282 ? 116.760 143.278 147.675 1.00 79.31  ? 546  ASP C CB    1 
ATOM   6136  C  CG    . ASP B 1  282 ? 115.706 143.329 146.579 1.00 79.31  ? 546  ASP C CG    1 
ATOM   6137  O  OD1   . ASP B 1  282 ? 116.056 143.565 145.405 1.00 79.31  ? 546  ASP C OD1   1 
ATOM   6138  O  OD2   . ASP B 1  282 ? 114.514 143.132 146.903 1.00 79.31  ? 546  ASP C OD2   1 
ATOM   6139  N  N     . GLU B 1  283 ? 119.202 145.765 147.672 1.00 76.80  ? 547  GLU C N     1 
ATOM   6140  C  CA    . GLU B 1  283 ? 119.375 147.210 147.559 1.00 76.80  ? 547  GLU C CA    1 
ATOM   6141  C  C     . GLU B 1  283 ? 120.781 147.622 147.152 1.00 76.80  ? 547  GLU C C     1 
ATOM   6142  O  O     . GLU B 1  283 ? 121.614 146.783 146.816 1.00 76.80  ? 547  GLU C O     1 
ATOM   6143  C  CB    . GLU B 1  283 ? 119.001 147.892 148.874 1.00 76.80  ? 547  GLU C CB    1 
ATOM   6144  C  CG    . GLU B 1  283 ? 117.525 147.804 149.214 1.00 76.80  ? 547  GLU C CG    1 
ATOM   6145  C  CD    . GLU B 1  283 ? 117.284 147.303 150.623 1.00 76.80  ? 547  GLU C CD    1 
ATOM   6146  O  OE1   . GLU B 1  283 ? 118.087 147.641 151.516 1.00 76.80  ? 547  GLU C OE1   1 
ATOM   6147  O  OE2   . GLU B 1  283 ? 116.295 146.572 150.836 1.00 76.80  ? 547  GLU C OE2   1 
ATOM   6148  N  N     . TYR B 1  284 ? 121.048 148.924 147.187 1.00 70.88  ? 548  TYR C N     1 
ATOM   6149  C  CA    . TYR B 1  284 ? 122.362 149.442 146.828 1.00 70.88  ? 548  TYR C CA    1 
ATOM   6150  C  C     . TYR B 1  284 ? 123.422 148.800 147.709 1.00 70.88  ? 548  TYR C C     1 
ATOM   6151  O  O     . TYR B 1  284 ? 123.233 148.678 148.916 1.00 70.88  ? 548  TYR C O     1 
ATOM   6152  C  CB    . TYR B 1  284 ? 122.401 150.959 146.988 1.00 70.88  ? 548  TYR C CB    1 
ATOM   6153  C  CG    . TYR B 1  284 ? 123.502 151.618 146.196 1.00 70.88  ? 548  TYR C CG    1 
ATOM   6154  C  CD1   . TYR B 1  284 ? 123.681 151.329 144.854 1.00 70.88  ? 548  TYR C CD1   1 
ATOM   6155  C  CD2   . TYR B 1  284 ? 124.364 152.525 146.791 1.00 70.88  ? 548  TYR C CD2   1 
ATOM   6156  C  CE1   . TYR B 1  284 ? 124.687 151.927 144.124 1.00 70.88  ? 548  TYR C CE1   1 
ATOM   6157  C  CE2   . TYR B 1  284 ? 125.374 153.127 146.069 1.00 70.88  ? 548  TYR C CE2   1 
ATOM   6158  C  CZ    . TYR B 1  284 ? 125.529 152.824 144.736 1.00 70.88  ? 548  TYR C CZ    1 
ATOM   6159  O  OH    . TYR B 1  284 ? 126.532 153.420 144.011 1.00 70.88  ? 548  TYR C OH    1 
ATOM   6160  N  N     . PRO B 1  285 ? 124.548 148.387 147.111 1.00 70.97  ? 549  PRO C N     1 
ATOM   6161  C  CA    . PRO B 1  285 ? 125.583 147.736 147.921 1.00 70.97  ? 549  PRO C CA    1 
ATOM   6162  C  C     . PRO B 1  285 ? 126.203 148.701 148.920 1.00 70.97  ? 549  PRO C C     1 
ATOM   6163  O  O     . PRO B 1  285 ? 126.464 149.865 148.610 1.00 70.97  ? 549  PRO C O     1 
ATOM   6164  C  CB    . PRO B 1  285 ? 126.609 147.275 146.880 1.00 70.97  ? 549  PRO C CB    1 
ATOM   6165  C  CG    . PRO B 1  285 ? 125.844 147.202 145.600 1.00 70.97  ? 549  PRO C CG    1 
ATOM   6166  C  CD    . PRO B 1  285 ? 124.848 148.316 145.672 1.00 70.97  ? 549  PRO C CD    1 
ATOM   6167  N  N     . VAL B 1  286 ? 126.437 148.201 150.129 1.00 79.35  ? 550  VAL C N     1 
ATOM   6168  C  CA    . VAL B 1  286 ? 127.115 148.947 151.182 1.00 79.35  ? 550  VAL C CA    1 
ATOM   6169  C  C     . VAL B 1  286 ? 128.420 148.232 151.502 1.00 79.35  ? 550  VAL C C     1 
ATOM   6170  O  O     . VAL B 1  286 ? 128.451 147.001 151.617 1.00 79.35  ? 550  VAL C O     1 
ATOM   6171  C  CB    . VAL B 1  286 ? 126.231 149.101 152.435 1.00 79.35  ? 550  VAL C CB    1 
ATOM   6172  C  CG1   . VAL B 1  286 ? 125.878 147.745 153.032 1.00 79.35  ? 550  VAL C CG1   1 
ATOM   6173  C  CG2   . VAL B 1  286 ? 126.922 149.979 153.467 1.00 79.35  ? 550  VAL C CG2   1 
ATOM   6174  N  N     . ASP B 1  287 ? 129.505 149.002 151.610 1.00 84.31  ? 551  ASP C N     1 
ATOM   6175  C  CA    . ASP B 1  287 ? 130.820 148.428 151.868 1.00 84.31  ? 551  ASP C CA    1 
ATOM   6176  C  C     . ASP B 1  287 ? 131.617 149.268 152.858 1.00 84.31  ? 551  ASP C C     1 
ATOM   6177  O  O     . ASP B 1  287 ? 132.852 149.235 152.850 1.00 84.31  ? 551  ASP C O     1 
ATOM   6178  C  CB    . ASP B 1  287 ? 131.606 148.263 150.565 1.00 84.31  ? 551  ASP C CB    1 
ATOM   6179  C  CG    . ASP B 1  287 ? 131.817 149.578 149.835 1.00 84.31  ? 551  ASP C CG    1 
ATOM   6180  O  OD1   . ASP B 1  287 ? 131.289 150.614 150.290 1.00 84.31  ? 551  ASP C OD1   1 
ATOM   6181  O  OD2   . ASP B 1  287 ? 132.517 149.575 148.801 1.00 84.31  ? 551  ASP C OD2   1 
ATOM   6182  N  N     . THR B 1  288 ? 130.934 150.024 153.712 1.00 81.04  ? 552  THR C N     1 
ATOM   6183  C  CA    . THR B 1  288 ? 131.588 150.894 154.676 1.00 81.04  ? 552  THR C CA    1 
ATOM   6184  C  C     . THR B 1  288 ? 131.036 150.609 156.067 1.00 81.04  ? 552  THR C C     1 
ATOM   6185  O  O     . THR B 1  288 ? 129.980 149.990 156.229 1.00 81.04  ? 552  THR C O     1 
ATOM   6186  C  CB    . THR B 1  288 ? 131.398 152.374 154.315 1.00 81.04  ? 552  THR C CB    1 
ATOM   6187  O  OG1   . THR B 1  288 ? 130.002 152.697 154.336 1.00 81.04  ? 552  THR C OG1   1 
ATOM   6188  C  CG2   . THR B 1  288 ? 131.961 152.665 152.930 1.00 81.04  ? 552  THR C CG2   1 
ATOM   6189  N  N     . ILE B 1  289 ? 131.776 151.088 157.062 1.00 75.88  ? 553  ILE C N     1 
ATOM   6190  C  CA    . ILE B 1  289 ? 131.424 150.960 158.467 1.00 75.88  ? 553  ILE C CA    1 
ATOM   6191  C  C     . ILE B 1  289 ? 131.576 152.346 159.077 1.00 75.88  ? 553  ILE C C     1 
ATOM   6192  O  O     . ILE B 1  289 ? 132.388 153.139 158.607 1.00 75.88  ? 553  ILE C O     1 
ATOM   6193  C  CB    . ILE B 1  289 ? 132.356 149.980 159.192 1.00 75.88  ? 553  ILE C CB    1 
ATOM   6194  C  CG1   . ILE B 1  289 ? 133.641 150.688 159.616 1.00 75.88  ? 553  ILE C CG1   1 
ATOM   6195  C  CG2   . ILE B 1  289 ? 132.684 148.798 158.296 1.00 75.88  ? 553  ILE C CG2   1 
ATOM   6196  C  CD1   . ILE B 1  289 ? 134.892 149.890 159.324 1.00 75.88  ? 553  ILE C CD1   1 
ATOM   6197  N  N     . ALA B 1  290 ? 130.808 152.651 160.117 1.00 74.81  ? 554  ALA C N     1 
ATOM   6198  C  CA    . ALA B 1  290 ? 130.894 153.973 160.715 1.00 74.81  ? 554  ALA C CA    1 
ATOM   6199  C  C     . ALA B 1  290 ? 130.451 153.923 162.169 1.00 74.81  ? 554  ALA C C     1 
ATOM   6200  O  O     . ALA B 1  290 ? 129.592 153.122 162.548 1.00 74.81  ? 554  ALA C O     1 
ATOM   6201  C  CB    . ALA B 1  290 ? 130.041 154.984 159.943 1.00 74.81  ? 554  ALA C CB    1 
ATOM   6202  N  N     . LYS B 1  291 ? 131.051 154.796 162.977 1.00 70.45  ? 555  LYS C N     1 
ATOM   6203  C  CA    . LYS B 1  291 ? 130.681 154.983 164.372 1.00 70.45  ? 555  LYS C CA    1 
ATOM   6204  C  C     . LYS B 1  291 ? 130.684 156.473 164.679 1.00 70.45  ? 555  LYS C C     1 
ATOM   6205  O  O     . LYS B 1  291 ? 131.525 157.221 164.173 1.00 70.45  ? 555  LYS C O     1 
ATOM   6206  C  CB    . LYS B 1  291 ? 131.640 154.254 165.324 1.00 70.45  ? 555  LYS C CB    1 
ATOM   6207  C  CG    . LYS B 1  291 ? 131.697 152.749 165.137 1.00 70.45  ? 555  LYS C CG    1 
ATOM   6208  C  CD    . LYS B 1  291 ? 130.382 152.092 165.514 1.00 70.45  ? 555  LYS C CD    1 
ATOM   6209  C  CE    . LYS B 1  291 ? 130.495 150.578 165.483 1.00 70.45  ? 555  LYS C CE    1 
ATOM   6210  N  NZ    . LYS B 1  291 ? 130.660 150.065 164.096 1.00 70.45  ? 555  LYS C NZ    1 
ATOM   6211  N  N     . ARG B 1  292 ? 129.739 156.900 165.512 1.00 73.96  ? 556  ARG C N     1 
ATOM   6212  C  CA    . ARG B 1  292 ? 129.612 158.317 165.823 1.00 73.96  ? 556  ARG C CA    1 
ATOM   6213  C  C     . ARG B 1  292 ? 128.825 158.492 167.111 1.00 73.96  ? 556  ARG C C     1 
ATOM   6214  O  O     . ARG B 1  292 ? 128.139 157.578 167.576 1.00 73.96  ? 556  ARG C O     1 
ATOM   6215  C  CB    . ARG B 1  292 ? 128.931 159.083 164.683 1.00 73.96  ? 556  ARG C CB    1 
ATOM   6216  C  CG    . ARG B 1  292 ? 127.485 158.679 164.445 1.00 73.96  ? 556  ARG C CG    1 
ATOM   6217  C  CD    . ARG B 1  292 ? 126.853 159.495 163.329 1.00 73.96  ? 556  ARG C CD    1 
ATOM   6218  N  NE    . ARG B 1  292 ? 125.490 159.060 163.041 1.00 73.96  ? 556  ARG C NE    1 
ATOM   6219  C  CZ    . ARG B 1  292 ? 124.411 159.518 163.667 1.00 73.96  ? 556  ARG C CZ    1 
ATOM   6220  N  NH1   . ARG B 1  292 ? 124.533 160.430 164.621 1.00 73.96  ? 556  ARG C NH1   1 
ATOM   6221  N  NH2   . ARG B 1  292 ? 123.208 159.065 163.340 1.00 73.96  ? 556  ARG C NH2   1 
ATOM   6222  N  N     . PHE B 1  293 ? 128.934 159.689 167.675 1.00 72.55  ? 557  PHE C N     1 
ATOM   6223  C  CA    . PHE B 1  293 ? 128.133 160.083 168.821 1.00 72.55  ? 557  PHE C CA    1 
ATOM   6224  C  C     . PHE B 1  293 ? 126.835 160.715 168.323 1.00 72.55  ? 557  PHE C C     1 
ATOM   6225  O  O     . PHE B 1  293 ? 126.514 160.681 167.132 1.00 72.55  ? 557  PHE C O     1 
ATOM   6226  C  CB    . PHE B 1  293 ? 128.915 161.046 169.717 1.00 72.55  ? 557  PHE C CB    1 
ATOM   6227  C  CG    . PHE B 1  293 ? 130.102 160.423 170.402 1.00 72.55  ? 557  PHE C CG    1 
ATOM   6228  C  CD1   . PHE B 1  293 ? 129.941 159.655 171.544 1.00 72.55  ? 557  PHE C CD1   1 
ATOM   6229  C  CD2   . PHE B 1  293 ? 131.382 160.622 169.914 1.00 72.55  ? 557  PHE C CD2   1 
ATOM   6230  C  CE1   . PHE B 1  293 ? 131.035 159.088 172.177 1.00 72.55  ? 557  PHE C CE1   1 
ATOM   6231  C  CE2   . PHE B 1  293 ? 132.477 160.058 170.542 1.00 72.55  ? 557  PHE C CE2   1 
ATOM   6232  C  CZ    . PHE B 1  293 ? 132.303 159.289 171.673 1.00 72.55  ? 557  PHE C CZ    1 
ATOM   6233  N  N     . ARG B 1  294 ? 126.072 161.299 169.240 1.00 75.53  ? 558  ARG C N     1 
ATOM   6234  C  CA    . ARG B 1  294 ? 124.967 162.183 168.901 1.00 75.53  ? 558  ARG C CA    1 
ATOM   6235  C  C     . ARG B 1  294 ? 125.406 163.610 169.197 1.00 75.53  ? 558  ARG C C     1 
ATOM   6236  O  O     . ARG B 1  294 ? 126.022 163.867 170.239 1.00 75.53  ? 558  ARG C O     1 
ATOM   6237  C  CB    . ARG B 1  294 ? 123.704 161.822 169.685 1.00 75.53  ? 558  ARG C CB    1 
ATOM   6238  C  CG    . ARG B 1  294 ? 122.458 162.570 169.244 1.00 75.53  ? 558  ARG C CG    1 
ATOM   6239  C  CD    . ARG B 1  294 ? 121.248 162.143 170.060 1.00 75.53  ? 558  ARG C CD    1 
ATOM   6240  N  NE    . ARG B 1  294 ? 121.362 162.540 171.460 1.00 75.53  ? 558  ARG C NE    1 
ATOM   6241  C  CZ    . ARG B 1  294 ? 120.524 162.146 172.413 1.00 75.53  ? 558  ARG C CZ    1 
ATOM   6242  N  NH1   . ARG B 1  294 ? 119.512 161.345 172.111 1.00 75.53  ? 558  ARG C NH1   1 
ATOM   6243  N  NH2   . ARG B 1  294 ? 120.694 162.549 173.664 1.00 75.53  ? 558  ARG C NH2   1 
ATOM   6244  N  N     . TYR B 1  295 ? 125.091 164.529 168.279 1.00 75.04  ? 559  TYR C N     1 
ATOM   6245  C  CA    . TYR B 1  295 ? 125.733 165.842 168.276 1.00 75.04  ? 559  TYR C CA    1 
ATOM   6246  C  C     . TYR B 1  295 ? 125.383 166.638 169.526 1.00 75.04  ? 559  TYR C C     1 
ATOM   6247  O  O     . TYR B 1  295 ? 126.257 167.252 170.150 1.00 75.04  ? 559  TYR C O     1 
ATOM   6248  C  CB    . TYR B 1  295 ? 125.344 166.616 167.013 1.00 75.04  ? 559  TYR C CB    1 
ATOM   6249  C  CG    . TYR B 1  295 ? 126.151 167.879 166.811 1.00 75.04  ? 559  TYR C CG    1 
ATOM   6250  C  CD1   . TYR B 1  295 ? 127.486 167.806 166.444 1.00 75.04  ? 559  TYR C CD1   1 
ATOM   6251  C  CD2   . TYR B 1  295 ? 125.585 169.136 166.974 1.00 75.04  ? 559  TYR C CD2   1 
ATOM   6252  C  CE1   . TYR B 1  295 ? 128.242 168.944 166.256 1.00 75.04  ? 559  TYR C CE1   1 
ATOM   6253  C  CE2   . TYR B 1  295 ? 126.332 170.280 166.782 1.00 75.04  ? 559  TYR C CE2   1 
ATOM   6254  C  CZ    . TYR B 1  295 ? 127.659 170.177 166.425 1.00 75.04  ? 559  TYR C CZ    1 
ATOM   6255  O  OH    . TYR B 1  295 ? 128.404 171.319 166.236 1.00 75.04  ? 559  TYR C OH    1 
ATOM   6256  N  N     . ASP B 1  296 ? 124.102 166.653 169.904 1.00 75.23  ? 560  ASP C N     1 
ATOM   6257  C  CA    . ASP B 1  296 ? 123.713 167.381 171.106 1.00 75.23  ? 560  ASP C CA    1 
ATOM   6258  C  C     . ASP B 1  296 ? 124.357 166.774 172.346 1.00 75.23  ? 560  ASP C C     1 
ATOM   6259  O  O     . ASP B 1  296 ? 124.809 167.502 173.238 1.00 75.23  ? 560  ASP C O     1 
ATOM   6260  C  CB    . ASP B 1  296 ? 122.186 167.421 171.235 1.00 75.23  ? 560  ASP C CB    1 
ATOM   6261  C  CG    . ASP B 1  296 ? 121.563 166.040 171.327 1.00 75.23  ? 560  ASP C CG    1 
ATOM   6262  O  OD1   . ASP B 1  296 ? 122.305 165.041 171.236 1.00 75.23  ? 560  ASP C OD1   1 
ATOM   6263  O  OD2   . ASP B 1  296 ? 120.327 165.950 171.491 1.00 75.23  ? 560  ASP C OD2   1 
ATOM   6264  N  N     . SER B 1  297 ? 124.418 165.441 172.415 1.00 73.64  ? 561  SER C N     1 
ATOM   6265  C  CA    . SER B 1  297 ? 125.081 164.791 173.540 1.00 73.64  ? 561  SER C CA    1 
ATOM   6266  C  C     . SER B 1  297 ? 126.565 165.130 173.568 1.00 73.64  ? 561  SER C C     1 
ATOM   6267  O  O     . SER B 1  297 ? 127.145 165.328 174.642 1.00 73.64  ? 561  SER C O     1 
ATOM   6268  C  CB    . SER B 1  297 ? 124.873 163.279 173.473 1.00 73.64  ? 561  SER C CB    1 
ATOM   6269  O  OG    . SER B 1  297 ? 125.543 162.626 174.538 1.00 73.64  ? 561  SER C OG    1 
ATOM   6270  N  N     . ALA B 1  298 ? 127.191 165.220 172.393 1.00 72.51  ? 562  ALA C N     1 
ATOM   6271  C  CA    . ALA B 1  298 ? 128.600 165.591 172.333 1.00 72.51  ? 562  ALA C CA    1 
ATOM   6272  C  C     . ALA B 1  298 ? 128.816 167.012 172.836 1.00 72.51  ? 562  ALA C C     1 
ATOM   6273  O  O     . ALA B 1  298 ? 129.769 167.278 173.579 1.00 72.51  ? 562  ALA C O     1 
ATOM   6274  C  CB    . ALA B 1  298 ? 129.124 165.439 170.906 1.00 72.51  ? 562  ALA C CB    1 
ATOM   6275  N  N     . LEU B 1  299 ? 127.937 167.939 172.450 1.00 71.03  ? 563  LEU C N     1 
ATOM   6276  C  CA    . LEU B 1  299 ? 128.076 169.310 172.930 1.00 71.03  ? 563  LEU C CA    1 
ATOM   6277  C  C     . LEU B 1  299 ? 127.838 169.398 174.433 1.00 71.03  ? 563  LEU C C     1 
ATOM   6278  O  O     . LEU B 1  299 ? 128.521 170.158 175.132 1.00 71.03  ? 563  LEU C O     1 
ATOM   6279  C  CB    . LEU B 1  299 ? 127.124 170.241 172.180 1.00 71.03  ? 563  LEU C CB    1 
ATOM   6280  C  CG    . LEU B 1  299 ? 127.432 170.485 170.704 1.00 71.03  ? 563  LEU C CG    1 
ATOM   6281  C  CD1   . LEU B 1  299 ? 126.398 171.418 170.104 1.00 71.03  ? 563  LEU C CD1   1 
ATOM   6282  C  CD2   . LEU B 1  299 ? 128.832 171.047 170.531 1.00 71.03  ? 563  LEU C CD2   1 
ATOM   6283  N  N     . VAL B 1  300 ? 126.880 168.628 174.952 1.00 70.53  ? 564  VAL C N     1 
ATOM   6284  C  CA    . VAL B 1  300 ? 126.637 168.628 176.393 1.00 70.53  ? 564  VAL C CA    1 
ATOM   6285  C  C     . VAL B 1  300 ? 127.846 168.075 177.139 1.00 70.53  ? 564  VAL C C     1 
ATOM   6286  O  O     . VAL B 1  300 ? 128.232 168.593 178.195 1.00 70.53  ? 564  VAL C O     1 
ATOM   6287  C  CB    . VAL B 1  300 ? 125.355 167.843 176.724 1.00 70.53  ? 564  VAL C CB    1 
ATOM   6288  C  CG1   . VAL B 1  300 ? 125.198 167.692 178.228 1.00 70.53  ? 564  VAL C CG1   1 
ATOM   6289  C  CG2   . VAL B 1  300 ? 124.144 168.549 176.144 1.00 70.53  ? 564  VAL C CG2   1 
ATOM   6290  N  N     . SER B 1  301 ? 128.468 167.021 176.602 1.00 71.21  ? 565  SER C N     1 
ATOM   6291  C  CA    . SER B 1  301 ? 129.678 166.488 177.219 1.00 71.21  ? 565  SER C CA    1 
ATOM   6292  C  C     . SER B 1  301 ? 130.808 167.510 177.188 1.00 71.21  ? 565  SER C C     1 
ATOM   6293  O  O     . SER B 1  301 ? 131.545 167.661 178.169 1.00 71.21  ? 565  SER C O     1 
ATOM   6294  C  CB    . SER B 1  301 ? 130.103 165.199 176.518 1.00 71.21  ? 565  SER C CB    1 
ATOM   6295  O  OG    . SER B 1  301 ? 131.301 164.689 177.077 1.00 71.21  ? 565  SER C OG    1 
ATOM   6296  N  N     . ALA B 1  302 ? 130.954 168.229 176.073 1.00 68.87  ? 566  ALA C N     1 
ATOM   6297  C  CA    . ALA B 1  302 ? 131.997 169.247 175.987 1.00 68.87  ? 566  ALA C CA    1 
ATOM   6298  C  C     . ALA B 1  302 ? 131.759 170.372 176.988 1.00 68.87  ? 566  ALA C C     1 
ATOM   6299  O  O     . ALA B 1  302 ? 132.708 170.885 177.596 1.00 68.87  ? 566  ALA C O     1 
ATOM   6300  C  CB    . ALA B 1  302 ? 132.074 169.800 174.565 1.00 68.87  ? 566  ALA C CB    1 
ATOM   6301  N  N     . LEU B 1  303 ? 130.499 170.770 177.173 1.00 71.30  ? 567  LEU C N     1 
ATOM   6302  C  CA    . LEU B 1  303 ? 130.197 171.820 178.140 1.00 71.30  ? 567  LEU C CA    1 
ATOM   6303  C  C     . LEU B 1  303 ? 130.451 171.344 179.566 1.00 71.30  ? 567  LEU C C     1 
ATOM   6304  O  O     . LEU B 1  303 ? 130.969 172.098 180.397 1.00 71.30  ? 567  LEU C O     1 
ATOM   6305  C  CB    . LEU B 1  303 ? 128.755 172.295 177.971 1.00 71.30  ? 567  LEU C CB    1 
ATOM   6306  C  CG    . LEU B 1  303 ? 128.450 173.025 176.661 1.00 71.30  ? 567  LEU C CG    1 
ATOM   6307  C  CD1   . LEU B 1  303 ? 126.967 173.336 176.548 1.00 71.30  ? 567  LEU C CD1   1 
ATOM   6308  C  CD2   . LEU B 1  303 ? 129.281 174.293 176.542 1.00 71.30  ? 567  LEU C CD2   1 
ATOM   6309  N  N     . MET B 1  304 ? 130.090 170.095 179.869 1.00 76.47  ? 568  MET C N     1 
ATOM   6310  C  CA    . MET B 1  304 ? 130.439 169.529 181.168 1.00 76.47  ? 568  MET C CA    1 
ATOM   6311  C  C     . MET B 1  304 ? 131.950 169.489 181.361 1.00 76.47  ? 568  MET C C     1 
ATOM   6312  O  O     . MET B 1  304 ? 132.448 169.652 182.481 1.00 76.47  ? 568  MET C O     1 
ATOM   6313  C  CB    . MET B 1  304 ? 129.839 168.131 181.311 1.00 76.47  ? 568  MET C CB    1 
ATOM   6314  C  CG    . MET B 1  304 ? 128.336 168.119 181.508 1.00 76.47  ? 568  MET C CG    1 
ATOM   6315  S  SD    . MET B 1  304 ? 127.869 168.796 183.112 1.00 76.47  ? 568  MET C SD    1 
ATOM   6316  C  CE    . MET B 1  304 ? 126.094 168.860 182.923 1.00 76.47  ? 568  MET C CE    1 
ATOM   6317  N  N     . ASP B 1  305 ? 132.696 169.288 180.274 1.00 77.71  ? 569  ASP C N     1 
ATOM   6318  C  CA    . ASP B 1  305 ? 134.150 169.221 180.375 1.00 77.71  ? 569  ASP C CA    1 
ATOM   6319  C  C     . ASP B 1  305 ? 134.754 170.596 180.639 1.00 77.71  ? 569  ASP C C     1 
ATOM   6320  O  O     . ASP B 1  305 ? 135.708 170.724 181.416 1.00 77.71  ? 569  ASP C O     1 
ATOM   6321  C  CB    . ASP B 1  305 ? 134.728 168.612 179.098 1.00 77.71  ? 569  ASP C CB    1 
ATOM   6322  C  CG    . ASP B 1  305 ? 136.219 168.373 179.187 1.00 77.71  ? 569  ASP C CG    1 
ATOM   6323  O  OD1   . ASP B 1  305 ? 136.632 167.437 179.902 1.00 77.71  ? 569  ASP C OD1   1 
ATOM   6324  O  OD2   . ASP B 1  305 ? 136.979 169.112 178.530 1.00 77.71  ? 569  ASP C OD2   1 
ATOM   6325  N  N     . MET B 1  306 ? 134.196 171.613 179.988 1.00 80.47  ? 570  MET C N     1 
ATOM   6326  C  CA    . MET B 1  306 ? 134.681 172.989 180.085 1.00 80.47  ? 570  MET C CA    1 
ATOM   6327  C  C     . MET B 1  306 ? 134.055 173.820 181.202 1.00 80.47  ? 570  MET C C     1 
ATOM   6328  O  O     . MET B 1  306 ? 134.388 174.989 181.373 1.00 80.47  ? 570  MET C O     1 
ATOM   6329  C  CB    . MET B 1  306 ? 134.445 173.697 178.751 1.00 80.47  ? 570  MET C CB    1 
ATOM   6330  C  CG    . MET B 1  306 ? 135.630 174.488 178.232 1.00 80.47  ? 570  MET C CG    1 
ATOM   6331  S  SD    . MET B 1  306 ? 135.228 175.318 176.684 1.00 80.47  ? 570  MET C SD    1 
ATOM   6332  C  CE    . MET B 1  306 ? 133.734 174.447 176.223 1.00 80.47  ? 570  MET C CE    1 
ATOM   6333  N  N     . GLU B 1  307 ? 133.146 173.220 181.955 1.00 86.64  ? 571  GLU C N     1 
ATOM   6334  C  CA    . GLU B 1  307 ? 132.470 173.915 183.047 1.00 86.64  ? 571  GLU C CA    1 
ATOM   6335  C  C     . GLU B 1  307 ? 133.420 174.742 183.910 1.00 86.64  ? 571  GLU C C     1 
ATOM   6336  O  O     . GLU B 1  307 ? 133.139 175.904 184.228 1.00 86.64  ? 571  GLU C O     1 
ATOM   6337  C  CB    . GLU B 1  307 ? 131.727 172.890 183.910 1.00 86.64  ? 571  GLU C CB    1 
ATOM   6338  C  CG    . GLU B 1  307 ? 130.954 173.492 185.069 1.00 86.64  ? 571  GLU C CG    1 
ATOM   6339  C  CD    . GLU B 1  307 ? 130.208 172.449 185.874 1.00 86.64  ? 571  GLU C CD    1 
ATOM   6340  O  OE1   . GLU B 1  307 ? 130.313 171.250 185.540 1.00 86.64  ? 571  GLU C OE1   1 
ATOM   6341  O  OE2   . GLU B 1  307 ? 129.518 172.827 186.843 1.00 86.64  ? 571  GLU C OE2   1 
ATOM   6342  N  N     . GLU B 1  308 ? 134.544 174.147 184.316 1.00 91.04  ? 572  GLU C N     1 
ATOM   6343  C  CA    . GLU B 1  308 ? 135.470 174.848 185.200 1.00 91.04  ? 572  GLU C CA    1 
ATOM   6344  C  C     . GLU B 1  308 ? 136.082 176.061 184.512 1.00 91.04  ? 572  GLU C C     1 
ATOM   6345  O  O     . GLU B 1  308 ? 136.227 177.126 185.125 1.00 91.04  ? 572  GLU C O     1 
ATOM   6346  C  CB    . GLU B 1  308 ? 136.564 173.894 185.680 1.00 91.04  ? 572  GLU C CB    1 
ATOM   6347  C  CG    . GLU B 1  308 ? 136.059 172.776 186.576 1.00 91.04  ? 572  GLU C CG    1 
ATOM   6348  C  CD    . GLU B 1  308 ? 135.538 173.285 187.906 1.00 91.04  ? 572  GLU C CD    1 
ATOM   6349  O  OE1   . GLU B 1  308 ? 136.064 174.304 188.402 1.00 91.04  ? 572  GLU C OE1   1 
ATOM   6350  O  OE2   . GLU B 1  308 ? 134.602 172.666 188.455 1.00 91.04  ? 572  GLU C OE2   1 
ATOM   6351  N  N     . ASP B 1  309 ? 136.444 175.921 183.235 1.00 88.73  ? 573  ASP C N     1 
ATOM   6352  C  CA    . ASP B 1  309 ? 136.987 177.055 182.495 1.00 88.73  ? 573  ASP C CA    1 
ATOM   6353  C  C     . ASP B 1  309 ? 135.947 178.156 182.336 1.00 88.73  ? 573  ASP C C     1 
ATOM   6354  O  O     . ASP B 1  309 ? 136.272 179.344 182.445 1.00 88.73  ? 573  ASP C O     1 
ATOM   6355  C  CB    . ASP B 1  309 ? 137.498 176.596 181.130 1.00 88.73  ? 573  ASP C CB    1 
ATOM   6356  C  CG    . ASP B 1  309 ? 138.728 175.717 181.235 1.00 88.73  ? 573  ASP C CG    1 
ATOM   6357  O  OD1   . ASP B 1  309 ? 139.500 175.887 182.201 1.00 88.73  ? 573  ASP C OD1   1 
ATOM   6358  O  OD2   . ASP B 1  309 ? 138.922 174.856 180.351 1.00 88.73  ? 573  ASP C OD2   1 
ATOM   6359  N  N     . ILE B 1  310 ? 134.690 177.780 182.090 1.00 86.84  ? 574  ILE C N     1 
ATOM   6360  C  CA    . ILE B 1  310 ? 133.629 178.778 181.968 1.00 86.84  ? 574  ILE C CA    1 
ATOM   6361  C  C     . ILE B 1  310 ? 133.445 179.525 183.282 1.00 86.84  ? 574  ILE C C     1 
ATOM   6362  O  O     . ILE B 1  310 ? 133.295 180.754 183.302 1.00 86.84  ? 574  ILE C O     1 
ATOM   6363  C  CB    . ILE B 1  310 ? 132.319 178.114 181.505 1.00 86.84  ? 574  ILE C CB    1 
ATOM   6364  C  CG1   . ILE B 1  310 ? 132.474 177.545 180.095 1.00 86.84  ? 574  ILE C CG1   1 
ATOM   6365  C  CG2   . ILE B 1  310 ? 131.169 179.106 181.553 1.00 86.84  ? 574  ILE C CG2   1 
ATOM   6366  C  CD1   . ILE B 1  310 ? 131.332 176.649 179.675 1.00 86.84  ? 574  ILE C CD1   1 
ATOM   6367  N  N     . LEU B 1  311 ? 133.462 178.800 184.402 1.00 90.25  ? 575  LEU C N     1 
ATOM   6368  C  CA    . LEU B 1  311 ? 133.294 179.448 185.699 1.00 90.25  ? 575  LEU C CA    1 
ATOM   6369  C  C     . LEU B 1  311 ? 134.469 180.365 186.017 1.00 90.25  ? 575  LEU C C     1 
ATOM   6370  O  O     . LEU B 1  311 ? 134.279 181.469 186.545 1.00 90.25  ? 575  LEU C O     1 
ATOM   6371  C  CB    . LEU B 1  311 ? 133.119 178.396 186.794 1.00 90.25  ? 575  LEU C CB    1 
ATOM   6372  C  CG    . LEU B 1  311 ? 131.835 177.568 186.721 1.00 90.25  ? 575  LEU C CG    1 
ATOM   6373  C  CD1   . LEU B 1  311 ? 131.838 176.477 187.779 1.00 90.25  ? 575  LEU C CD1   1 
ATOM   6374  C  CD2   . LEU B 1  311 ? 130.615 178.461 186.868 1.00 90.25  ? 575  LEU C CD2   1 
ATOM   6375  N  N     . GLU B 1  312 ? 135.691 179.932 185.698 1.00 92.69  ? 576  GLU C N     1 
ATOM   6376  C  CA    . GLU B 1  312 ? 136.854 180.782 185.931 1.00 92.69  ? 576  GLU C CA    1 
ATOM   6377  C  C     . GLU B 1  312 ? 136.805 182.030 185.059 1.00 92.69  ? 576  GLU C C     1 
ATOM   6378  O  O     . GLU B 1  312 ? 137.190 183.120 185.498 1.00 92.69  ? 576  GLU C O     1 
ATOM   6379  C  CB    . GLU B 1  312 ? 138.141 179.998 185.679 1.00 92.69  ? 576  GLU C CB    1 
ATOM   6380  C  CG    . GLU B 1  312 ? 139.406 180.780 185.989 1.00 92.69  ? 576  GLU C CG    1 
ATOM   6381  C  CD    . GLU B 1  312 ? 140.664 179.960 185.787 1.00 92.69  ? 576  GLU C CD    1 
ATOM   6382  O  OE1   . GLU B 1  312 ? 140.550 178.783 185.385 1.00 92.69  ? 576  GLU C OE1   1 
ATOM   6383  O  OE2   . GLU B 1  312 ? 141.766 180.494 186.030 1.00 92.69  ? 576  GLU C OE2   1 
ATOM   6384  N  N     . GLY B 1  313 ? 136.329 181.893 183.820 1.00 92.24  ? 577  GLY C N     1 
ATOM   6385  C  CA    . GLY B 1  313 ? 136.176 183.061 182.967 1.00 92.24  ? 577  GLY C CA    1 
ATOM   6386  C  C     . GLY B 1  313 ? 135.132 184.025 183.494 1.00 92.24  ? 577  GLY C C     1 
ATOM   6387  O  O     . GLY B 1  313 ? 135.307 185.244 183.436 1.00 92.24  ? 577  GLY C O     1 
ATOM   6388  N  N     . MET B 1  314 ? 134.070 183.474 184.064 1.00 96.37  ? 578  MET C N     1 
ATOM   6389  C  CA    . MET B 1  314 ? 133.014 184.288 184.633 1.00 96.37  ? 578  MET C CA    1 
ATOM   6390  C  C     . MET B 1  314 ? 133.555 185.059 185.829 1.00 96.37  ? 578  MET C C     1 
ATOM   6391  O  O     . MET B 1  314 ? 133.245 186.235 186.009 1.00 96.37  ? 578  MET C O     1 
ATOM   6392  C  CB    . MET B 1  314 ? 131.849 183.408 185.071 1.00 96.37  ? 578  MET C CB    1 
ATOM   6393  C  CG    . MET B 1  314 ? 130.485 184.023 184.832 1.00 96.37  ? 578  MET C CG    1 
ATOM   6394  S  SD    . MET B 1  314 ? 129.169 182.829 185.114 1.00 96.37  ? 578  MET C SD    1 
ATOM   6395  C  CE    . MET B 1  314 ? 128.439 182.747 183.482 1.00 96.37  ? 578  MET C CE    1 
ATOM   6396  N  N     . ARG B 1  315 ? 134.369 184.394 186.643 1.00 94.82  ? 579  ARG C N     1 
ATOM   6397  C  CA    . ARG B 1  315 ? 134.937 185.036 187.825 1.00 94.82  ? 579  ARG C CA    1 
ATOM   6398  C  C     . ARG B 1  315 ? 135.968 186.094 187.445 1.00 94.82  ? 579  ARG C C     1 
ATOM   6399  O  O     . ARG B 1  315 ? 136.066 187.138 188.100 1.00 94.82  ? 579  ARG C O     1 
ATOM   6400  C  CB    . ARG B 1  315 ? 135.563 183.989 188.746 1.00 94.82  ? 579  ARG C CB    1 
ATOM   6401  C  CG    . ARG B 1  315 ? 134.557 183.076 189.423 1.00 94.82  ? 579  ARG C CG    1 
ATOM   6402  C  CD    . ARG B 1  315 ? 135.218 182.214 190.485 1.00 94.82  ? 579  ARG C CD    1 
ATOM   6403  N  NE    . ARG B 1  315 ? 136.202 181.299 189.915 1.00 94.82  ? 579  ARG C NE    1 
ATOM   6404  C  CZ    . ARG B 1  315 ? 135.917 180.085 189.457 1.00 94.82  ? 579  ARG C CZ    1 
ATOM   6405  N  NH1   . ARG B 1  315 ? 134.671 179.634 189.500 1.00 94.82  ? 579  ARG C NH1   1 
ATOM   6406  N  NH2   . ARG B 1  315 ? 136.877 179.321 188.956 1.00 94.82  ? 579  ARG C NH2   1 
ATOM   6407  N  N     . SER B 1  316 ? 136.745 185.843 186.388 1.00 92.49  ? 580  SER C N     1 
ATOM   6408  C  CA    . SER B 1  316 ? 137.838 186.741 186.034 1.00 92.49  ? 580  SER C CA    1 
ATOM   6409  C  C     . SER B 1  316 ? 137.359 188.024 185.365 1.00 92.49  ? 580  SER C C     1 
ATOM   6410  O  O     . SER B 1  316 ? 138.101 189.011 185.349 1.00 92.49  ? 580  SER C O     1 
ATOM   6411  C  CB    . SER B 1  316 ? 138.830 186.021 185.120 1.00 92.49  ? 580  SER C CB    1 
ATOM   6412  O  OG    . SER B 1  316 ? 139.890 186.880 184.738 1.00 92.49  ? 580  SER C OG    1 
ATOM   6413  N  N     . GLN B 1  317 ? 136.147 188.036 184.814 1.00 97.86  ? 581  GLN C N     1 
ATOM   6414  C  CA    . GLN B 1  317 ? 135.612 189.205 184.131 1.00 97.86  ? 581  GLN C CA    1 
ATOM   6415  C  C     . GLN B 1  317 ? 134.762 190.080 185.043 1.00 97.86  ? 581  GLN C C     1 
ATOM   6416  O  O     . GLN B 1  317 ? 134.063 190.971 184.549 1.00 97.86  ? 581  GLN C O     1 
ATOM   6417  C  CB    . GLN B 1  317 ? 134.793 188.776 182.912 1.00 97.86  ? 581  GLN C CB    1 
ATOM   6418  C  CG    . GLN B 1  317 ? 135.599 188.075 181.834 1.00 97.86  ? 581  GLN C CG    1 
ATOM   6419  C  CD    . GLN B 1  317 ? 136.604 188.992 181.169 1.00 97.86  ? 581  GLN C CD    1 
ATOM   6420  O  OE1   . GLN B 1  317 ? 136.324 190.165 180.922 1.00 97.86  ? 581  GLN C OE1   1 
ATOM   6421  N  NE2   . GLN B 1  317 ? 137.784 188.460 180.874 1.00 97.86  ? 581  GLN C NE2   1 
ATOM   6422  N  N     . ASP B 1  318 ? 134.813 189.849 186.355 1.00 98.59  ? 582  ASP C N     1 
ATOM   6423  C  CA    . ASP B 1  318 ? 134.017 190.587 187.335 1.00 98.59  ? 582  ASP C CA    1 
ATOM   6424  C  C     . ASP B 1  318 ? 132.520 190.407 187.073 1.00 98.59  ? 582  ASP C C     1 
ATOM   6425  O  O     . ASP B 1  318 ? 131.776 191.363 186.845 1.00 98.59  ? 582  ASP C O     1 
ATOM   6426  C  CB    . ASP B 1  318 ? 134.403 192.071 187.355 1.00 98.59  ? 582  ASP C CB    1 
ATOM   6427  C  CG    . ASP B 1  318 ? 135.793 192.303 187.905 1.00 98.59  ? 582  ASP C CG    1 
ATOM   6428  O  OD1   . ASP B 1  318 ? 136.239 191.502 188.754 1.00 98.59  ? 582  ASP C OD1   1 
ATOM   6429  O  OD2   . ASP B 1  318 ? 136.442 193.285 187.488 1.00 98.59  ? 582  ASP C OD2   1 
ATOM   6430  N  N     . LEU B 1  319 ? 132.090 189.148 187.106 1.00 98.22  ? 583  LEU C N     1 
ATOM   6431  C  CA    . LEU B 1  319 ? 130.684 188.786 187.008 1.00 98.22  ? 583  LEU C CA    1 
ATOM   6432  C  C     . LEU B 1  319 ? 130.306 187.905 188.190 1.00 98.22  ? 583  LEU C C     1 
ATOM   6433  O  O     . LEU B 1  319 ? 131.145 187.527 189.011 1.00 98.22  ? 583  LEU C O     1 
ATOM   6434  C  CB    . LEU B 1  319 ? 130.362 188.061 185.692 1.00 98.22  ? 583  LEU C CB    1 
ATOM   6435  C  CG    . LEU B 1  319 ? 130.084 188.894 184.440 1.00 98.22  ? 583  LEU C CG    1 
ATOM   6436  C  CD1   . LEU B 1  319 ? 131.351 189.520 183.893 1.00 98.22  ? 583  LEU C CD1   1 
ATOM   6437  C  CD2   . LEU B 1  319 ? 129.397 188.044 183.378 1.00 98.22  ? 583  LEU C CD2   1 
ATOM   6438  N  N     . ASP B 1  320 ? 129.020 187.577 188.262 1.00 102.45 ? 584  ASP C N     1 
ATOM   6439  C  CA    . ASP B 1  320 ? 128.474 186.742 189.323 1.00 102.45 ? 584  ASP C CA    1 
ATOM   6440  C  C     . ASP B 1  320 ? 128.327 185.317 188.807 1.00 102.45 ? 584  ASP C C     1 
ATOM   6441  O  O     . ASP B 1  320 ? 127.902 185.106 187.666 1.00 102.45 ? 584  ASP C O     1 
ATOM   6442  C  CB    . ASP B 1  320 ? 127.129 187.285 189.801 1.00 102.45 ? 584  ASP C CB    1 
ATOM   6443  C  CG    . ASP B 1  320 ? 127.261 188.597 190.546 1.00 102.45 ? 584  ASP C CG    1 
ATOM   6444  O  OD1   . ASP B 1  320 ? 128.318 188.827 191.171 1.00 102.45 ? 584  ASP C OD1   1 
ATOM   6445  O  OD2   . ASP B 1  320 ? 126.305 189.400 190.509 1.00 102.45 ? 584  ASP C OD2   1 
ATOM   6446  N  N     . ASP B 1  321 ? 128.680 184.343 189.647 1.00 100.82 ? 585  ASP C N     1 
ATOM   6447  C  CA    . ASP B 1  321 ? 128.622 182.948 189.228 1.00 100.82 ? 585  ASP C CA    1 
ATOM   6448  C  C     . ASP B 1  321 ? 127.195 182.432 189.108 1.00 100.82 ? 585  ASP C C     1 
ATOM   6449  O  O     . ASP B 1  321 ? 126.957 181.475 188.362 1.00 100.82 ? 585  ASP C O     1 
ATOM   6450  C  CB    . ASP B 1  321 ? 129.411 182.073 190.202 1.00 100.82 ? 585  ASP C CB    1 
ATOM   6451  C  CG    . ASP B 1  321 ? 130.904 182.304 190.108 1.00 100.82 ? 585  ASP C CG    1 
ATOM   6452  O  OD1   . ASP B 1  321 ? 131.380 182.673 189.015 1.00 100.82 ? 585  ASP C OD1   1 
ATOM   6453  O  OD2   . ASP B 1  321 ? 131.602 182.113 191.126 1.00 100.82 ? 585  ASP C OD2   1 
ATOM   6454  N  N     . TYR B 1  322 ? 126.241 183.032 189.818 1.00 98.61  ? 586  TYR C N     1 
ATOM   6455  C  CA    . TYR B 1  322 ? 124.859 182.573 189.771 1.00 98.61  ? 586  TYR C CA    1 
ATOM   6456  C  C     . TYR B 1  322 ? 124.096 183.098 188.560 1.00 98.61  ? 586  TYR C C     1 
ATOM   6457  O  O     . TYR B 1  322 ? 122.880 182.894 188.480 1.00 98.61  ? 586  TYR C O     1 
ATOM   6458  C  CB    . TYR B 1  322 ? 124.124 182.958 191.060 1.00 98.61  ? 586  TYR C CB    1 
ATOM   6459  C  CG    . TYR B 1  322 ? 123.998 184.446 191.299 1.00 98.61  ? 586  TYR C CG    1 
ATOM   6460  C  CD1   . TYR B 1  322 ? 122.914 185.162 190.805 1.00 98.61  ? 586  TYR C CD1   1 
ATOM   6461  C  CD2   . TYR B 1  322 ? 124.959 185.135 192.027 1.00 98.61  ? 586  TYR C CD2   1 
ATOM   6462  C  CE1   . TYR B 1  322 ? 122.795 186.520 191.024 1.00 98.61  ? 586  TYR C CE1   1 
ATOM   6463  C  CE2   . TYR B 1  322 ? 124.845 186.493 192.254 1.00 98.61  ? 586  TYR C CE2   1 
ATOM   6464  C  CZ    . TYR B 1  322 ? 123.764 187.180 191.748 1.00 98.61  ? 586  TYR C CZ    1 
ATOM   6465  O  OH    . TYR B 1  322 ? 123.649 188.533 191.970 1.00 98.61  ? 586  TYR C OH    1 
ATOM   6466  N  N     . LEU B 1  323 ? 124.769 183.768 187.628 1.00 92.10  ? 587  LEU C N     1 
ATOM   6467  C  CA    . LEU B 1  323 ? 124.103 184.233 186.421 1.00 92.10  ? 587  LEU C CA    1 
ATOM   6468  C  C     . LEU B 1  323 ? 123.739 183.055 185.528 1.00 92.10  ? 587  LEU C C     1 
ATOM   6469  O  O     . LEU B 1  323 ? 124.550 182.155 185.296 1.00 92.10  ? 587  LEU C O     1 
ATOM   6470  C  CB    . LEU B 1  323 ? 124.997 185.210 185.660 1.00 92.10  ? 587  LEU C CB    1 
ATOM   6471  C  CG    . LEU B 1  323 ? 125.282 186.552 186.336 1.00 92.10  ? 587  LEU C CG    1 
ATOM   6472  C  CD1   . LEU B 1  323 ? 126.299 187.343 185.531 1.00 92.10  ? 587  LEU C CD1   1 
ATOM   6473  C  CD2   . LEU B 1  323 ? 123.999 187.348 186.514 1.00 92.10  ? 587  LEU C CD2   1 
ATOM   6474  N  N     . ASN B 1  324 ? 122.506 183.066 185.022 1.00 86.72  ? 588  ASN C N     1 
ATOM   6475  C  CA    . ASN B 1  324 ? 122.013 182.012 184.143 1.00 86.72  ? 588  ASN C CA    1 
ATOM   6476  C  C     . ASN B 1  324 ? 121.531 182.582 182.815 1.00 86.72  ? 588  ASN C C     1 
ATOM   6477  O  O     . ASN B 1  324 ? 120.608 182.041 182.199 1.00 86.72  ? 588  ASN C O     1 
ATOM   6478  C  CB    . ASN B 1  324 ? 120.905 181.206 184.822 1.00 86.72  ? 588  ASN C CB    1 
ATOM   6479  C  CG    . ASN B 1  324 ? 119.713 182.060 185.221 1.00 86.72  ? 588  ASN C CG    1 
ATOM   6480  O  OD1   . ASN B 1  324 ? 119.655 183.254 184.925 1.00 86.72  ? 588  ASN C OD1   1 
ATOM   6481  N  ND2   . ASN B 1  324 ? 118.750 181.446 185.899 1.00 86.72  ? 588  ASN C ND2   1 
ATOM   6482  N  N     . GLY B 1  325 ? 122.144 183.673 182.364 1.00 82.04  ? 589  GLY C N     1 
ATOM   6483  C  CA    . GLY B 1  325 ? 121.771 184.303 181.121 1.00 82.04  ? 589  GLY C CA    1 
ATOM   6484  C  C     . GLY B 1  325 ? 122.053 183.423 179.921 1.00 82.04  ? 589  GLY C C     1 
ATOM   6485  O  O     . GLY B 1  325 ? 122.696 182.374 180.026 1.00 82.04  ? 589  GLY C O     1 
ATOM   6486  N  N     . PRO B 1  326 ? 121.576 183.838 178.751 1.00 76.45  ? 590  PRO C N     1 
ATOM   6487  C  CA    . PRO B 1  326 ? 121.784 183.027 177.544 1.00 76.45  ? 590  PRO C CA    1 
ATOM   6488  C  C     . PRO B 1  326 ? 123.227 183.047 177.067 1.00 76.45  ? 590  PRO C C     1 
ATOM   6489  O  O     . PRO B 1  326 ? 123.701 184.055 176.534 1.00 76.45  ? 590  PRO C O     1 
ATOM   6490  C  CB    . PRO B 1  326 ? 120.844 183.677 176.522 1.00 76.45  ? 590  PRO C CB    1 
ATOM   6491  C  CG    . PRO B 1  326 ? 120.717 185.090 176.982 1.00 76.45  ? 590  PRO C CG    1 
ATOM   6492  C  CD    . PRO B 1  326 ? 120.779 185.047 178.482 1.00 76.45  ? 590  PRO C CD    1 
ATOM   6493  N  N     . PHE B 1  327 ? 123.933 181.936 177.254 1.00 76.67  ? 591  PHE C N     1 
ATOM   6494  C  CA    . PHE B 1  327 ? 125.308 181.827 176.789 1.00 76.67  ? 591  PHE C CA    1 
ATOM   6495  C  C     . PHE B 1  327 ? 125.338 181.620 175.281 1.00 76.67  ? 591  PHE C C     1 
ATOM   6496  O  O     . PHE B 1  327 ? 124.635 180.761 174.743 1.00 76.67  ? 591  PHE C O     1 
ATOM   6497  C  CB    . PHE B 1  327 ? 126.023 180.670 177.488 1.00 76.67  ? 591  PHE C CB    1 
ATOM   6498  C  CG    . PHE B 1  327 ? 126.278 180.903 178.950 1.00 76.67  ? 591  PHE C CG    1 
ATOM   6499  C  CD1   . PHE B 1  327 ? 126.162 182.167 179.497 1.00 76.67  ? 591  PHE C CD1   1 
ATOM   6500  C  CD2   . PHE B 1  327 ? 126.639 179.854 179.777 1.00 76.67  ? 591  PHE C CD2   1 
ATOM   6501  C  CE1   . PHE B 1  327 ? 126.397 182.376 180.839 1.00 76.67  ? 591  PHE C CE1   1 
ATOM   6502  C  CE2   . PHE B 1  327 ? 126.876 180.061 181.120 1.00 76.67  ? 591  PHE C CE2   1 
ATOM   6503  C  CZ    . PHE B 1  327 ? 126.755 181.324 181.650 1.00 76.67  ? 591  PHE C CZ    1 
ATOM   6504  N  N     . THR B 1  328 ? 126.160 182.413 174.600 1.00 71.35  ? 592  THR C N     1 
ATOM   6505  C  CA    . THR B 1  328 ? 126.311 182.340 173.153 1.00 71.35  ? 592  THR C CA    1 
ATOM   6506  C  C     . THR B 1  328 ? 127.597 181.591 172.832 1.00 71.35  ? 592  THR C C     1 
ATOM   6507  O  O     . THR B 1  328 ? 128.693 182.076 173.130 1.00 71.35  ? 592  THR C O     1 
ATOM   6508  C  CB    . THR B 1  328 ? 126.333 183.735 172.530 1.00 71.35  ? 592  THR C CB    1 
ATOM   6509  O  OG1   . THR B 1  328 ? 125.109 184.414 172.834 1.00 71.35  ? 592  THR C OG1   1 
ATOM   6510  C  CG2   . THR B 1  328 ? 126.489 183.638 171.022 1.00 71.35  ? 592  THR C CG2   1 
ATOM   6511  N  N     . VAL B 1  329 ? 127.460 180.417 172.227 1.00 67.84  ? 593  VAL C N     1 
ATOM   6512  C  CA    . VAL B 1  329 ? 128.596 179.564 171.903 1.00 67.84  ? 593  VAL C CA    1 
ATOM   6513  C  C     . VAL B 1  329 ? 128.747 179.498 170.390 1.00 67.84  ? 593  VAL C C     1 
ATOM   6514  O  O     . VAL B 1  329 ? 127.763 179.412 169.648 1.00 67.84  ? 593  VAL C O     1 
ATOM   6515  C  CB    . VAL B 1  329 ? 128.421 178.154 172.509 1.00 67.84  ? 593  VAL C CB    1 
ATOM   6516  C  CG1   . VAL B 1  329 ? 129.579 177.247 172.120 1.00 67.84  ? 593  VAL C CG1   1 
ATOM   6517  C  CG2   . VAL B 1  329 ? 128.288 178.240 174.020 1.00 67.84  ? 593  VAL C CG2   1 
ATOM   6518  N  N     . VAL B 1  330 ? 129.993 179.547 169.926 1.00 66.75  ? 594  VAL C N     1 
ATOM   6519  C  CA    . VAL B 1  330 ? 130.318 179.397 168.512 1.00 66.75  ? 594  VAL C CA    1 
ATOM   6520  C  C     . VAL B 1  330 ? 131.343 178.275 168.398 1.00 66.75  ? 594  VAL C C     1 
ATOM   6521  O  O     . VAL B 1  330 ? 132.274 178.193 169.209 1.00 66.75  ? 594  VAL C O     1 
ATOM   6522  C  CB    . VAL B 1  330 ? 130.840 180.701 167.887 1.00 66.75  ? 594  VAL C CB    1 
ATOM   6523  C  CG1   . VAL B 1  330 ? 132.127 181.151 168.552 1.00 66.75  ? 594  VAL C CG1   1 
ATOM   6524  C  CG2   . VAL B 1  330 ? 131.049 180.528 166.392 1.00 66.75  ? 594  VAL C CG2   1 
ATOM   6525  N  N     . VAL B 1  331 ? 131.152 177.390 167.426 1.00 69.34  ? 595  VAL C N     1 
ATOM   6526  C  CA    . VAL B 1  331 ? 132.023 176.242 167.240 1.00 69.34  ? 595  VAL C CA    1 
ATOM   6527  C  C     . VAL B 1  331 ? 132.648 176.305 165.849 1.00 69.34  ? 595  VAL C C     1 
ATOM   6528  O  O     . VAL B 1  331 ? 132.280 177.127 165.010 1.00 69.34  ? 595  VAL C O     1 
ATOM   6529  C  CB    . VAL B 1  331 ? 131.278 174.910 167.454 1.00 69.34  ? 595  VAL C CB    1 
ATOM   6530  C  CG1   . VAL B 1  331 ? 130.731 174.832 168.869 1.00 69.34  ? 595  VAL C CG1   1 
ATOM   6531  C  CG2   . VAL B 1  331 ? 130.164 174.761 166.436 1.00 69.34  ? 595  VAL C CG2   1 
ATOM   6532  N  N     . LYS B 1  332 ? 133.593 175.400 165.623 1.00 71.44  ? 596  LYS C N     1 
ATOM   6533  C  CA    . LYS B 1  332 ? 134.294 175.291 164.358 1.00 71.44  ? 596  LYS C CA    1 
ATOM   6534  C  C     . LYS B 1  332 ? 134.197 173.848 163.890 1.00 71.44  ? 596  LYS C C     1 
ATOM   6535  O  O     . LYS B 1  332 ? 134.496 172.927 164.644 1.00 71.44  ? 596  LYS C O     1 
ATOM   6536  C  CB    . LYS B 1  332 ? 135.757 175.688 164.531 1.00 71.44  ? 596  LYS C CB    1 
ATOM   6537  C  CG    . LYS B 1  332 ? 136.407 176.244 163.278 1.00 71.44  ? 596  LYS C CG    1 
ATOM   6538  C  CD    . LYS B 1  332 ? 137.630 175.432 162.887 1.00 71.44  ? 596  LYS C CD    1 
ATOM   6539  C  CE    . LYS B 1  332 ? 138.820 175.761 163.771 1.00 71.44  ? 596  LYS C CE    1 
ATOM   6540  N  NZ    . LYS B 1  332 ? 139.943 174.806 163.563 1.00 71.44  ? 596  LYS C NZ    1 
ATOM   6541  N  N     . GLU B 1  333 ? 133.774 173.654 162.647 1.00 76.44  ? 597  GLU C N     1 
ATOM   6542  C  CA    . GLU B 1  333 ? 133.628 172.321 162.086 1.00 76.44  ? 597  GLU C CA    1 
ATOM   6543  C  C     . GLU B 1  333 ? 134.722 172.053 161.060 1.00 76.44  ? 597  GLU C C     1 
ATOM   6544  O  O     . GLU B 1  333 ? 135.280 172.972 160.455 1.00 76.44  ? 597  GLU C O     1 
ATOM   6545  C  CB    . GLU B 1  333 ? 132.249 172.149 161.443 1.00 76.44  ? 597  GLU C CB    1 
ATOM   6546  C  CG    . GLU B 1  333 ? 131.104 172.182 162.439 1.00 76.44  ? 597  GLU C CG    1 
ATOM   6547  C  CD    . GLU B 1  333 ? 129.750 172.030 161.778 1.00 76.44  ? 597  GLU C CD    1 
ATOM   6548  O  OE1   . GLU B 1  333 ? 129.691 172.022 160.531 1.00 76.44  ? 597  GLU C OE1   1 
ATOM   6549  O  OE2   . GLU B 1  333 ? 128.744 171.920 162.508 1.00 76.44  ? 597  GLU C OE2   1 
ATOM   6550  N  N     . SER B 1  334 ? 135.021 170.770 160.868 1.00 74.83  ? 598  SER C N     1 
ATOM   6551  C  CA    . SER B 1  334 ? 136.070 170.362 159.946 1.00 74.83  ? 598  SER C CA    1 
ATOM   6552  C  C     . SER B 1  334 ? 135.792 168.944 159.473 1.00 74.83  ? 598  SER C C     1 
ATOM   6553  O  O     . SER B 1  334 ? 135.139 168.156 160.161 1.00 74.83  ? 598  SER C O     1 
ATOM   6554  C  CB    . SER B 1  334 ? 137.456 170.450 160.595 1.00 74.83  ? 598  SER C CB    1 
ATOM   6555  O  OG    . SER B 1  334 ? 137.782 171.789 160.923 1.00 74.83  ? 598  SER C OG    1 
ATOM   6556  N  N     . CYS B 1  335 ? 136.307 168.631 158.284 1.00 73.58  ? 599  CYS C N     1 
ATOM   6557  C  CA    . CYS B 1  335 ? 136.133 167.316 157.681 1.00 73.58  ? 599  CYS C CA    1 
ATOM   6558  C  C     . CYS B 1  335 ? 137.145 167.108 156.562 1.00 73.58  ? 599  CYS C C     1 
ATOM   6559  O  O     . CYS B 1  335 ? 137.272 167.952 155.669 1.00 73.58  ? 599  CYS C O     1 
ATOM   6560  C  CB    . CYS B 1  335 ? 134.709 167.151 157.147 1.00 73.58  ? 599  CYS C CB    1 
ATOM   6561  S  SG    . CYS B 1  335 ? 134.365 165.542 156.401 1.00 73.58  ? 599  CYS C SG    1 
ATOM   6562  N  N     . ASP B 1  336 ? 137.872 165.994 156.602 1.00 77.26  ? 600  ASP C N     1 
ATOM   6563  C  CA    . ASP B 1  336 ? 138.874 165.694 155.591 1.00 77.26  ? 600  ASP C CA    1 
ATOM   6564  C  C     . ASP B 1  336 ? 138.941 164.191 155.374 1.00 77.26  ? 600  ASP C C     1 
ATOM   6565  O  O     . ASP B 1  336 ? 138.679 163.401 156.285 1.00 77.26  ? 600  ASP C O     1 
ATOM   6566  C  CB    . ASP B 1  336 ? 140.259 166.225 155.990 1.00 77.26  ? 600  ASP C CB    1 
ATOM   6567  C  CG    . ASP B 1  336 ? 141.268 166.142 154.856 1.00 77.26  ? 600  ASP C CG    1 
ATOM   6568  O  OD1   . ASP B 1  336 ? 140.905 165.670 153.758 1.00 77.26  ? 600  ASP C OD1   1 
ATOM   6569  O  OD2   . ASP B 1  336 ? 142.430 166.548 155.065 1.00 77.26  ? 600  ASP C OD2   1 
ATOM   6570  N  N     . GLY B 1  337 ? 139.299 163.805 154.151 1.00 76.31  ? 601  GLY C N     1 
ATOM   6571  C  CA    . GLY B 1  337 ? 139.509 162.418 153.811 1.00 76.31  ? 601  GLY C CA    1 
ATOM   6572  C  C     . GLY B 1  337 ? 140.959 162.013 153.994 1.00 76.31  ? 601  GLY C C     1 
ATOM   6573  O  O     . GLY B 1  337 ? 141.863 162.844 153.984 1.00 76.31  ? 601  GLY C O     1 
ATOM   6574  N  N     . MET B 1  338 ? 141.171 160.712 154.166 1.00 76.37  ? 602  MET C N     1 
ATOM   6575  C  CA    . MET B 1  338 ? 142.495 160.167 154.417 1.00 76.37  ? 602  MET C CA    1 
ATOM   6576  C  C     . MET B 1  338 ? 142.735 158.960 153.525 1.00 76.37  ? 602  MET C C     1 
ATOM   6577  O  O     . MET B 1  338 ? 141.817 158.189 153.233 1.00 76.37  ? 602  MET C O     1 
ATOM   6578  C  CB    . MET B 1  338 ? 142.664 159.769 155.886 1.00 76.37  ? 602  MET C CB    1 
ATOM   6579  C  CG    . MET B 1  338 ? 142.627 160.941 156.846 1.00 76.37  ? 602  MET C CG    1 
ATOM   6580  S  SD    . MET B 1  338 ? 142.718 160.425 158.569 1.00 76.37  ? 602  MET C SD    1 
ATOM   6581  C  CE    . MET B 1  338 ? 144.412 159.859 158.655 1.00 76.37  ? 602  MET C CE    1 
ATOM   6582  N  N     . GLY B 1  339 ? 143.986 158.803 153.094 1.00 74.80  ? 603  GLY C N     1 
ATOM   6583  C  CA    . GLY B 1  339 ? 144.393 157.690 152.270 1.00 74.80  ? 603  GLY C CA    1 
ATOM   6584  C  C     . GLY B 1  339 ? 145.391 156.792 152.985 1.00 74.80  ? 603  GLY C C     1 
ATOM   6585  O  O     . GLY B 1  339 ? 145.865 157.083 154.082 1.00 74.80  ? 603  GLY C O     1 
ATOM   6586  N  N     . ASP B 1  340 ? 145.700 155.674 152.326 1.00 78.44  ? 604  ASP C N     1 
ATOM   6587  C  CA    . ASP B 1  340 ? 146.663 154.693 152.826 1.00 78.44  ? 604  ASP C CA    1 
ATOM   6588  C  C     . ASP B 1  340 ? 146.259 154.168 154.204 1.00 78.44  ? 604  ASP C C     1 
ATOM   6589  O  O     . ASP B 1  340 ? 147.084 154.017 155.107 1.00 78.44  ? 604  ASP C O     1 
ATOM   6590  C  CB    . ASP B 1  340 ? 148.078 155.276 152.851 1.00 78.44  ? 604  ASP C CB    1 
ATOM   6591  C  CG    . ASP B 1  340 ? 148.636 155.509 151.462 1.00 78.44  ? 604  ASP C CG    1 
ATOM   6592  O  OD1   . ASP B 1  340 ? 148.246 154.772 150.532 1.00 78.44  ? 604  ASP C OD1   1 
ATOM   6593  O  OD2   . ASP B 1  340 ? 149.464 156.429 151.298 1.00 78.44  ? 604  ASP C OD2   1 
ATOM   6594  N  N     . VAL B 1  341 ? 144.970 153.891 154.360 1.00 74.15  ? 605  VAL C N     1 
ATOM   6595  C  CA    . VAL B 1  341 ? 144.439 153.276 155.574 1.00 74.15  ? 605  VAL C CA    1 
ATOM   6596  C  C     . VAL B 1  341 ? 144.216 151.808 155.227 1.00 74.15  ? 605  VAL C C     1 
ATOM   6597  O  O     . VAL B 1  341 ? 143.188 151.425 154.667 1.00 74.15  ? 605  VAL C O     1 
ATOM   6598  C  CB    . VAL B 1  341 ? 143.163 153.964 156.056 1.00 74.15  ? 605  VAL C CB    1 
ATOM   6599  C  CG1   . VAL B 1  341 ? 142.602 153.248 157.275 1.00 74.15  ? 605  VAL C CG1   1 
ATOM   6600  C  CG2   . VAL B 1  341 ? 143.437 155.425 156.370 1.00 74.15  ? 605  VAL C CG2   1 
ATOM   6601  N  N     . SER B 1  342 ? 145.200 150.977 155.563 1.00 76.40  ? 606  SER C N     1 
ATOM   6602  C  CA    . SER B 1  342 ? 145.197 149.586 155.133 1.00 76.40  ? 606  SER C CA    1 
ATOM   6603  C  C     . SER B 1  342 ? 144.015 148.825 155.724 1.00 76.40  ? 606  SER C C     1 
ATOM   6604  O  O     . SER B 1  342 ? 143.574 149.084 156.846 1.00 76.40  ? 606  SER C O     1 
ATOM   6605  C  CB    . SER B 1  342 ? 146.506 148.906 155.531 1.00 76.40  ? 606  SER C CB    1 
ATOM   6606  O  OG    . SER B 1  342 ? 146.624 148.818 156.940 1.00 76.40  ? 606  SER C OG    1 
ATOM   6607  N  N     . GLU B 1  343 ? 143.506 147.876 154.946 1.00 79.47  ? 607  GLU C N     1 
ATOM   6608  C  CA    . GLU B 1  343 ? 142.422 147.002 155.363 1.00 79.47  ? 607  GLU C CA    1 
ATOM   6609  C  C     . GLU B 1  343 ? 142.983 145.790 156.100 1.00 79.47  ? 607  GLU C C     1 
ATOM   6610  O  O     . GLU B 1  343 ? 144.120 145.368 155.877 1.00 79.47  ? 607  GLU C O     1 
ATOM   6611  C  CB    . GLU B 1  343 ? 141.603 146.560 154.147 1.00 79.47  ? 607  GLU C CB    1 
ATOM   6612  C  CG    . GLU B 1  343 ? 140.364 145.740 154.468 1.00 79.47  ? 607  GLU C CG    1 
ATOM   6613  C  CD    . GLU B 1  343 ? 139.580 145.364 153.227 1.00 79.47  ? 607  GLU C CD    1 
ATOM   6614  O  OE1   . GLU B 1  343 ? 140.018 145.723 152.115 1.00 79.47  ? 607  GLU C OE1   1 
ATOM   6615  O  OE2   . GLU B 1  343 ? 138.526 144.708 153.365 1.00 79.47  ? 607  GLU C OE2   1 
ATOM   6616  N  N     . LYS B 1  344 ? 142.173 145.235 156.994 1.00 76.34  ? 608  LYS C N     1 
ATOM   6617  C  CA    . LYS B 1  344 ? 142.562 144.089 157.799 1.00 76.34  ? 608  LYS C CA    1 
ATOM   6618  C  C     . LYS B 1  344 ? 141.962 142.807 157.236 1.00 76.34  ? 608  LYS C C     1 
ATOM   6619  O  O     . LYS B 1  344 ? 141.023 142.830 156.436 1.00 76.34  ? 608  LYS C O     1 
ATOM   6620  C  CB    . LYS B 1  344 ? 142.129 144.274 159.257 1.00 76.34  ? 608  LYS C CB    1 
ATOM   6621  C  CG    . LYS B 1  344 ? 142.846 145.406 159.969 1.00 76.34  ? 608  LYS C CG    1 
ATOM   6622  C  CD    . LYS B 1  344 ? 142.392 145.531 161.411 1.00 76.34  ? 608  LYS C CD    1 
ATOM   6623  C  CE    . LYS B 1  344 ? 143.192 146.594 162.142 1.00 76.34  ? 608  LYS C CE    1 
ATOM   6624  N  NZ    . LYS B 1  344 ? 142.922 147.955 161.603 1.00 76.34  ? 608  LYS C NZ    1 
ATOM   6625  N  N     . HIS B 1  345 ? 142.527 141.680 157.660 1.00 75.49  ? 609  HIS C N     1 
ATOM   6626  C  CA    . HIS B 1  345 ? 141.994 140.378 157.290 1.00 75.49  ? 609  HIS C CA    1 
ATOM   6627  C  C     . HIS B 1  345 ? 140.699 140.107 158.055 1.00 75.49  ? 609  HIS C C     1 
ATOM   6628  O  O     . HIS B 1  345 ? 140.211 140.936 158.829 1.00 75.49  ? 609  HIS C O     1 
ATOM   6629  C  CB    . HIS B 1  345 ? 143.019 139.281 157.569 1.00 75.49  ? 609  HIS C CB    1 
ATOM   6630  C  CG    . HIS B 1  345 ? 144.259 139.379 156.737 1.00 75.49  ? 609  HIS C CG    1 
ATOM   6631  N  ND1   . HIS B 1  345 ? 144.298 139.007 155.410 1.00 75.49  ? 609  HIS C ND1   1 
ATOM   6632  C  CD2   . HIS B 1  345 ? 145.509 139.800 157.045 1.00 75.49  ? 609  HIS C CD2   1 
ATOM   6633  C  CE1   . HIS B 1  345 ? 145.517 139.195 154.938 1.00 75.49  ? 609  HIS C CE1   1 
ATOM   6634  N  NE2   . HIS B 1  345 ? 146.270 139.678 155.909 1.00 75.49  ? 609  HIS C NE2   1 
ATOM   6635  N  N     . GLY B 1  346 ? 140.137 138.923 157.834 1.00 79.91  ? 610  GLY C N     1 
ATOM   6636  C  CA    . GLY B 1  346 ? 138.961 138.500 158.566 1.00 79.91  ? 610  GLY C CA    1 
ATOM   6637  C  C     . GLY B 1  346 ? 137.665 138.794 157.841 1.00 79.91  ? 610  GLY C C     1 
ATOM   6638  O  O     . GLY B 1  346 ? 137.626 139.254 156.696 1.00 79.91  ? 610  GLY C O     1 
ATOM   6639  N  N     . SER B 1  347 ? 136.570 138.514 158.542 1.00 82.34  ? 611  SER C N     1 
ATOM   6640  C  CA    . SER B 1  347 ? 135.239 138.714 157.995 1.00 82.34  ? 611  SER C CA    1 
ATOM   6641  C  C     . SER B 1  347 ? 134.863 140.194 158.021 1.00 82.34  ? 611  SER C C     1 
ATOM   6642  O  O     . SER B 1  347 ? 135.539 141.029 158.627 1.00 82.34  ? 611  SER C O     1 
ATOM   6643  C  CB    . SER B 1  347 ? 134.213 137.890 158.771 1.00 82.34  ? 611  SER C CB    1 
ATOM   6644  O  OG    . SER B 1  347 ? 134.095 138.350 160.106 1.00 82.34  ? 611  SER C OG    1 
ATOM   6645  N  N     . GLY B 1  348 ? 133.762 140.512 157.347 1.00 85.86  ? 612  GLY C N     1 
ATOM   6646  C  CA    . GLY B 1  348 ? 133.287 141.871 157.260 1.00 85.86  ? 612  GLY C CA    1 
ATOM   6647  C  C     . GLY B 1  348 ? 133.113 142.320 155.825 1.00 85.86  ? 612  GLY C C     1 
ATOM   6648  O  O     . GLY B 1  348 ? 133.482 141.617 154.880 1.00 85.86  ? 612  GLY C O     1 
ATOM   6649  N  N     . PRO B 1  349 ? 132.541 143.506 155.634 1.00 84.54  ? 613  PRO C N     1 
ATOM   6650  C  CA    . PRO B 1  349 ? 132.344 144.020 154.275 1.00 84.54  ? 613  PRO C CA    1 
ATOM   6651  C  C     . PRO B 1  349 ? 133.665 144.402 153.624 1.00 84.54  ? 613  PRO C C     1 
ATOM   6652  O  O     . PRO B 1  349 ? 134.704 144.527 154.275 1.00 84.54  ? 613  PRO C O     1 
ATOM   6653  C  CB    . PRO B 1  349 ? 131.453 145.247 154.486 1.00 84.54  ? 613  PRO C CB    1 
ATOM   6654  C  CG    . PRO B 1  349 ? 131.755 145.687 155.879 1.00 84.54  ? 613  PRO C CG    1 
ATOM   6655  C  CD    . PRO B 1  349 ? 132.030 144.432 156.659 1.00 84.54  ? 613  PRO C CD    1 
ATOM   6656  N  N     . ALA B 1  350 ? 133.606 144.586 152.307 1.00 82.38  ? 614  ALA C N     1 
ATOM   6657  C  CA    . ALA B 1  350 ? 134.779 144.965 151.520 1.00 82.38  ? 614  ALA C CA    1 
ATOM   6658  C  C     . ALA B 1  350 ? 135.058 146.442 151.761 1.00 82.38  ? 614  ALA C C     1 
ATOM   6659  O  O     . ALA B 1  350 ? 134.632 147.314 151.003 1.00 82.38  ? 614  ALA C O     1 
ATOM   6660  C  CB    . ALA B 1  350 ? 134.557 144.669 150.042 1.00 82.38  ? 614  ALA C CB    1 
ATOM   6661  N  N     . VAL B 1  351 ? 135.794 146.724 152.830 1.00 79.81  ? 615  VAL C N     1 
ATOM   6662  C  CA    . VAL B 1  351 ? 136.089 148.094 153.239 1.00 79.81  ? 615  VAL C CA    1 
ATOM   6663  C  C     . VAL B 1  351 ? 137.164 148.675 152.327 1.00 79.81  ? 615  VAL C C     1 
ATOM   6664  O  O     . VAL B 1  351 ? 138.197 148.029 152.099 1.00 79.81  ? 615  VAL C O     1 
ATOM   6665  C  CB    . VAL B 1  351 ? 136.525 148.146 154.712 1.00 79.81  ? 615  VAL C CB    1 
ATOM   6666  C  CG1   . VAL B 1  351 ? 136.936 149.555 155.096 1.00 79.81  ? 615  VAL C CG1   1 
ATOM   6667  C  CG2   . VAL B 1  351 ? 135.407 147.645 155.611 1.00 79.81  ? 615  VAL C CG2   1 
ATOM   6668  N  N     . PRO B 1  352 ? 136.969 149.874 151.783 1.00 77.94  ? 616  PRO C N     1 
ATOM   6669  C  CA    . PRO B 1  352 ? 138.014 150.487 150.960 1.00 77.94  ? 616  PRO C CA    1 
ATOM   6670  C  C     . PRO B 1  352 ? 139.199 150.933 151.803 1.00 77.94  ? 616  PRO C C     1 
ATOM   6671  O  O     . PRO B 1  352 ? 139.138 151.004 153.032 1.00 77.94  ? 616  PRO C O     1 
ATOM   6672  C  CB    . PRO B 1  352 ? 137.305 151.686 150.321 1.00 77.94  ? 616  PRO C CB    1 
ATOM   6673  C  CG    . PRO B 1  352 ? 136.217 152.022 151.278 1.00 77.94  ? 616  PRO C CG    1 
ATOM   6674  C  CD    . PRO B 1  352 ? 135.761 150.714 151.862 1.00 77.94  ? 616  PRO C CD    1 
ATOM   6675  N  N     . GLU B 1  353 ? 140.305 151.223 151.126 1.00 81.64  ? 617  GLU C N     1 
ATOM   6676  C  CA    . GLU B 1  353 ? 141.532 151.647 151.794 1.00 81.64  ? 617  GLU C CA    1 
ATOM   6677  C  C     . GLU B 1  353 ? 141.611 153.158 151.954 1.00 81.64  ? 617  GLU C C     1 
ATOM   6678  O  O     . GLU B 1  353 ? 142.604 153.781 151.587 1.00 81.64  ? 617  GLU C O     1 
ATOM   6679  C  CB    . GLU B 1  353 ? 142.756 151.146 151.027 1.00 81.64  ? 617  GLU C CB    1 
ATOM   6680  C  CG    . GLU B 1  353 ? 143.136 149.710 151.337 1.00 81.64  ? 617  GLU C CG    1 
ATOM   6681  C  CD    . GLU B 1  353 ? 144.581 149.405 150.999 1.00 81.64  ? 617  GLU C CD    1 
ATOM   6682  O  OE1   . GLU B 1  353 ? 144.907 148.217 150.797 1.00 81.64  ? 617  GLU C OE1   1 
ATOM   6683  O  OE2   . GLU B 1  353 ? 145.391 150.353 150.936 1.00 81.64  ? 617  GLU C OE2   1 
ATOM   6684  N  N     . LYS B 1  354 ? 140.558 153.741 152.509 1.00 77.74  ? 618  LYS C N     1 
ATOM   6685  C  CA    . LYS B 1  354 ? 140.495 155.179 152.728 1.00 77.74  ? 618  LYS C CA    1 
ATOM   6686  C  C     . LYS B 1  354 ? 139.744 155.443 154.024 1.00 77.74  ? 618  LYS C C     1 
ATOM   6687  O  O     . LYS B 1  354 ? 139.194 154.531 154.646 1.00 77.74  ? 618  LYS C O     1 
ATOM   6688  C  CB    . LYS B 1  354 ? 139.824 155.904 151.553 1.00 77.74  ? 618  LYS C CB    1 
ATOM   6689  C  CG    . LYS B 1  354 ? 140.621 155.892 150.257 1.00 77.74  ? 618  LYS C CG    1 
ATOM   6690  C  CD    . LYS B 1  354 ? 139.921 156.677 149.166 1.00 77.74  ? 618  LYS C CD    1 
ATOM   6691  C  CE    . LYS B 1  354 ? 140.673 156.579 147.851 1.00 77.74  ? 618  LYS C CE    1 
ATOM   6692  N  NZ    . LYS B 1  354 ? 141.995 157.258 147.924 1.00 77.74  ? 618  LYS C NZ    1 
ATOM   6693  N  N     . ALA B 1  355 ? 139.725 156.711 154.428 1.00 74.42  ? 619  ALA C N     1 
ATOM   6694  C  CA    . ALA B 1  355 ? 139.049 157.111 155.653 1.00 74.42  ? 619  ALA C CA    1 
ATOM   6695  C  C     . ALA B 1  355 ? 138.666 158.579 155.559 1.00 74.42  ? 619  ALA C C     1 
ATOM   6696  O  O     . ALA B 1  355 ? 139.369 159.380 154.938 1.00 74.42  ? 619  ALA C O     1 
ATOM   6697  C  CB    . ALA B 1  355 ? 139.927 156.871 156.886 1.00 74.42  ? 619  ALA C CB    1 
ATOM   6698  N  N     . VAL B 1  356 ? 137.541 158.923 156.182 1.00 70.82  ? 620  VAL C N     1 
ATOM   6699  C  CA    . VAL B 1  356 ? 137.046 160.294 156.234 1.00 70.82  ? 620  VAL C CA    1 
ATOM   6700  C  C     . VAL B 1  356 ? 136.672 160.607 157.675 1.00 70.82  ? 620  VAL C C     1 
ATOM   6701  O  O     . VAL B 1  356 ? 135.949 159.836 158.314 1.00 70.82  ? 620  VAL C O     1 
ATOM   6702  C  CB    . VAL B 1  356 ? 135.835 160.508 155.306 1.00 70.82  ? 620  VAL C CB    1 
ATOM   6703  C  CG1   . VAL B 1  356 ? 135.301 161.924 155.455 1.00 70.82  ? 620  VAL C CG1   1 
ATOM   6704  C  CG2   . VAL B 1  356 ? 136.209 160.225 153.861 1.00 70.82  ? 620  VAL C CG2   1 
ATOM   6705  N  N     . ARG B 1  357 ? 137.160 161.735 158.184 1.00 69.91  ? 621  ARG C N     1 
ATOM   6706  C  CA    . ARG B 1  357 ? 136.934 162.135 159.563 1.00 69.91  ? 621  ARG C CA    1 
ATOM   6707  C  C     . ARG B 1  357 ? 136.107 163.412 159.618 1.00 69.91  ? 621  ARG C C     1 
ATOM   6708  O  O     . ARG B 1  357 ? 136.135 164.231 158.695 1.00 69.91  ? 621  ARG C O     1 
ATOM   6709  C  CB    . ARG B 1  357 ? 138.258 162.351 160.302 1.00 69.91  ? 621  ARG C CB    1 
ATOM   6710  C  CG    . ARG B 1  357 ? 139.092 161.093 160.458 1.00 69.91  ? 621  ARG C CG    1 
ATOM   6711  C  CD    . ARG B 1  357 ? 140.382 161.382 161.199 1.00 69.91  ? 621  ARG C CD    1 
ATOM   6712  N  NE    . ARG B 1  357 ? 140.135 161.806 162.572 1.00 69.91  ? 621  ARG C NE    1 
ATOM   6713  C  CZ    . ARG B 1  357 ? 140.323 163.044 163.014 1.00 69.91  ? 621  ARG C CZ    1 
ATOM   6714  N  NH1   . ARG B 1  357 ? 140.762 163.984 162.189 1.00 69.91  ? 621  ARG C NH1   1 
ATOM   6715  N  NH2   . ARG B 1  357 ? 140.071 163.344 164.280 1.00 69.91  ? 621  ARG C NH2   1 
ATOM   6716  N  N     . PHE B 1  358 ? 135.372 163.573 160.716 1.00 71.03  ? 622  PHE C N     1 
ATOM   6717  C  CA    . PHE B 1  358 ? 134.574 164.766 160.960 1.00 71.03  ? 622  PHE C CA    1 
ATOM   6718  C  C     . PHE B 1  358 ? 134.700 165.145 162.427 1.00 71.03  ? 622  PHE C C     1 
ATOM   6719  O  O     . PHE B 1  358 ? 134.599 164.285 163.307 1.00 71.03  ? 622  PHE C O     1 
ATOM   6720  C  CB    . PHE B 1  358 ? 133.102 164.543 160.593 1.00 71.03  ? 622  PHE C CB    1 
ATOM   6721  C  CG    . PHE B 1  358 ? 132.245 165.765 160.756 1.00 71.03  ? 622  PHE C CG    1 
ATOM   6722  C  CD1   . PHE B 1  358 ? 132.289 166.786 159.823 1.00 71.03  ? 622  PHE C CD1   1 
ATOM   6723  C  CD2   . PHE B 1  358 ? 131.395 165.892 161.840 1.00 71.03  ? 622  PHE C CD2   1 
ATOM   6724  C  CE1   . PHE B 1  358 ? 131.501 167.911 159.970 1.00 71.03  ? 622  PHE C CE1   1 
ATOM   6725  C  CE2   . PHE B 1  358 ? 130.606 167.016 161.991 1.00 71.03  ? 622  PHE C CE2   1 
ATOM   6726  C  CZ    . PHE B 1  358 ? 130.659 168.026 161.056 1.00 71.03  ? 622  PHE C CZ    1 
ATOM   6727  N  N     . SER B 1  359 ? 134.920 166.432 162.687 1.00 71.74  ? 623  SER C N     1 
ATOM   6728  C  CA    . SER B 1  359 ? 135.170 166.892 164.044 1.00 71.74  ? 623  SER C CA    1 
ATOM   6729  C  C     . SER B 1  359 ? 134.603 168.292 164.224 1.00 71.74  ? 623  SER C C     1 
ATOM   6730  O  O     . SER B 1  359 ? 134.243 168.969 163.258 1.00 71.74  ? 623  SER C O     1 
ATOM   6731  C  CB    . SER B 1  359 ? 136.668 166.882 164.369 1.00 71.74  ? 623  SER C CB    1 
ATOM   6732  O  OG    . SER B 1  359 ? 137.189 165.565 164.333 1.00 71.74  ? 623  SER C OG    1 
ATOM   6733  N  N     . PHE B 1  360 ? 134.546 168.719 165.481 1.00 69.51  ? 624  PHE C N     1 
ATOM   6734  C  CA    . PHE B 1  360 ? 134.066 170.045 165.840 1.00 69.51  ? 624  PHE C CA    1 
ATOM   6735  C  C     . PHE B 1  360 ? 134.968 170.609 166.933 1.00 69.51  ? 624  PHE C C     1 
ATOM   6736  O  O     . PHE B 1  360 ? 135.668 169.862 167.612 1.00 69.51  ? 624  PHE C O     1 
ATOM   6737  C  CB    . PHE B 1  360 ? 132.603 170.010 166.277 1.00 69.51  ? 624  PHE C CB    1 
ATOM   6738  C  CG    . PHE B 1  360 ? 132.401 169.615 167.707 1.00 69.51  ? 624  PHE C CG    1 
ATOM   6739  C  CD1   . PHE B 1  360 ? 131.940 168.351 168.029 1.00 69.51  ? 624  PHE C CD1   1 
ATOM   6740  C  CD2   . PHE B 1  360 ? 132.655 170.510 168.728 1.00 69.51  ? 624  PHE C CD2   1 
ATOM   6741  C  CE1   . PHE B 1  360 ? 131.745 167.985 169.344 1.00 69.51  ? 624  PHE C CE1   1 
ATOM   6742  C  CE2   . PHE B 1  360 ? 132.461 170.151 170.046 1.00 69.51  ? 624  PHE C CE2   1 
ATOM   6743  C  CZ    . PHE B 1  360 ? 132.006 168.886 170.354 1.00 69.51  ? 624  PHE C CZ    1 
ATOM   6744  N  N     . THR B 1  361 ? 134.948 171.925 167.099 1.00 70.33  ? 625  THR C N     1 
ATOM   6745  C  CA    . THR B 1  361 ? 135.803 172.596 168.070 1.00 70.33  ? 625  THR C CA    1 
ATOM   6746  C  C     . THR B 1  361 ? 135.157 173.909 168.478 1.00 70.33  ? 625  THR C C     1 
ATOM   6747  O  O     . THR B 1  361 ? 134.865 174.747 167.620 1.00 70.33  ? 625  THR C O     1 
ATOM   6748  C  CB    . THR B 1  361 ? 137.201 172.854 167.496 1.00 70.33  ? 625  THR C CB    1 
ATOM   6749  O  OG1   . THR B 1  361 ? 137.845 171.606 167.212 1.00 70.33  ? 625  THR C OG1   1 
ATOM   6750  C  CG2   . THR B 1  361 ? 138.044 173.653 168.477 1.00 70.33  ? 625  THR C CG2   1 
ATOM   6751  N  N     . VAL B 1  362 ? 134.939 174.085 169.782 1.00 66.54  ? 626  VAL C N     1 
ATOM   6752  C  CA    . VAL B 1  362 ? 134.415 175.348 170.284 1.00 66.54  ? 626  VAL C CA    1 
ATOM   6753  C  C     . VAL B 1  362 ? 135.461 176.441 170.103 1.00 66.54  ? 626  VAL C C     1 
ATOM   6754  O  O     . VAL B 1  362 ? 136.672 176.182 170.075 1.00 66.54  ? 626  VAL C O     1 
ATOM   6755  C  CB    . VAL B 1  362 ? 133.999 175.221 171.761 1.00 66.54  ? 626  VAL C CB    1 
ATOM   6756  C  CG1   . VAL B 1  362 ? 132.894 174.191 171.915 1.00 66.54  ? 626  VAL C CG1   1 
ATOM   6757  C  CG2   . VAL B 1  362 ? 135.199 174.856 172.616 1.00 66.54  ? 626  VAL C CG2   1 
ATOM   6758  N  N     . MET B 1  363 ? 134.993 177.676 169.973 1.00 69.88  ? 627  MET C N     1 
ATOM   6759  C  CA    . MET B 1  363 ? 135.882 178.815 169.785 1.00 69.88  ? 627  MET C CA    1 
ATOM   6760  C  C     . MET B 1  363 ? 135.802 179.835 170.907 1.00 69.88  ? 627  MET C C     1 
ATOM   6761  O  O     . MET B 1  363 ? 136.837 180.208 171.463 1.00 69.88  ? 627  MET C O     1 
ATOM   6762  C  CB    . MET B 1  363 ? 135.583 179.502 168.447 1.00 69.88  ? 627  MET C CB    1 
ATOM   6763  C  CG    . MET B 1  363 ? 135.905 178.645 167.236 1.00 69.88  ? 627  MET C CG    1 
ATOM   6764  S  SD    . MET B 1  363 ? 137.648 178.194 167.147 1.00 69.88  ? 627  MET C SD    1 
ATOM   6765  C  CE    . MET B 1  363 ? 138.389 179.782 166.783 1.00 69.88  ? 627  MET C CE    1 
ATOM   6766  N  N     . ARG B 1  364 ? 134.596 180.274 171.242 1.00 71.31  ? 628  ARG C N     1 
ATOM   6767  C  CA    . ARG B 1  364 ? 134.430 181.254 172.300 1.00 71.31  ? 628  ARG C CA    1 
ATOM   6768  C  C     . ARG B 1  364 ? 133.022 181.244 172.869 1.00 71.31  ? 628  ARG C C     1 
ATOM   6769  O  O     . ARG B 1  364 ? 132.081 180.812 172.211 1.00 71.31  ? 628  ARG C O     1 
ATOM   6770  C  CB    . ARG B 1  364 ? 134.759 182.649 171.775 1.00 71.31  ? 628  ARG C CB    1 
ATOM   6771  C  CG    . ARG B 1  364 ? 133.539 183.530 171.584 1.00 71.31  ? 628  ARG C CG    1 
ATOM   6772  C  CD    . ARG B 1  364 ? 133.836 184.669 170.627 1.00 71.31  ? 628  ARG C CD    1 
ATOM   6773  N  NE    . ARG B 1  364 ? 135.015 184.397 169.813 1.00 71.31  ? 628  ARG C NE    1 
ATOM   6774  C  CZ    . ARG B 1  364 ? 135.228 184.921 168.611 1.00 71.31  ? 628  ARG C CZ    1 
ATOM   6775  N  NH1   . ARG B 1  364 ? 134.338 185.748 168.081 1.00 71.31  ? 628  ARG C NH1   1 
ATOM   6776  N  NH2   . ARG B 1  364 ? 136.329 184.618 167.939 1.00 71.31  ? 628  ARG C NH2   1 
ATOM   6777  N  N     . ILE B 1  365 ? 132.892 181.719 174.101 1.00 73.22  ? 629  ILE C N     1 
ATOM   6778  C  CA    . ILE B 1  365 ? 131.601 181.794 174.775 1.00 73.22  ? 629  ILE C CA    1 
ATOM   6779  C  C     . ILE B 1  365 ? 131.427 183.208 175.306 1.00 73.22  ? 629  ILE C C     1 
ATOM   6780  O  O     . ILE B 1  365 ? 132.336 183.764 175.931 1.00 73.22  ? 629  ILE C O     1 
ATOM   6781  C  CB    . ILE B 1  365 ? 131.492 180.759 175.913 1.00 73.22  ? 629  ILE C CB    1 
ATOM   6782  C  CG1   . ILE B 1  365 ? 131.592 179.340 175.353 1.00 73.22  ? 629  ILE C CG1   1 
ATOM   6783  C  CG2   . ILE B 1  365 ? 130.190 180.936 176.673 1.00 73.22  ? 629  ILE C CG2   1 
ATOM   6784  C  CD1   . ILE B 1  365 ? 131.755 178.277 176.411 1.00 73.22  ? 629  ILE C CD1   1 
ATOM   6785  N  N     . THR B 1  366 ? 130.256 183.792 175.059 1.00 80.24  ? 630  THR C N     1 
ATOM   6786  C  CA    . THR B 1  366 ? 130.019 185.192 175.395 1.00 80.24  ? 630  THR C CA    1 
ATOM   6787  C  C     . THR B 1  366 ? 128.626 185.344 175.987 1.00 80.24  ? 630  THR C C     1 
ATOM   6788  O  O     . THR B 1  366 ? 127.643 184.913 175.377 1.00 80.24  ? 630  THR C O     1 
ATOM   6789  C  CB    . THR B 1  366 ? 130.174 186.080 174.159 1.00 80.24  ? 630  THR C CB    1 
ATOM   6790  O  OG1   . THR B 1  366 ? 131.507 185.961 173.647 1.00 80.24  ? 630  THR C OG1   1 
ATOM   6791  C  CG2   . THR B 1  366 ? 129.897 187.531 174.505 1.00 80.24  ? 630  THR C CG2   1 
ATOM   6792  N  N     . ILE B 1  367 ? 128.548 185.958 177.166 1.00 88.88  ? 631  ILE C N     1 
ATOM   6793  C  CA    . ILE B 1  367 ? 127.283 186.278 177.815 1.00 88.88  ? 631  ILE C CA    1 
ATOM   6794  C  C     . ILE B 1  367 ? 126.939 187.731 177.526 1.00 88.88  ? 631  ILE C C     1 
ATOM   6795  O  O     . ILE B 1  367 ? 127.820 188.586 177.376 1.00 88.88  ? 631  ILE C O     1 
ATOM   6796  C  CB    . ILE B 1  367 ? 127.340 186.013 179.336 1.00 88.88  ? 631  ILE C CB    1 
ATOM   6797  C  CG1   . ILE B 1  367 ? 125.956 186.197 179.968 1.00 88.88  ? 631  ILE C CG1   1 
ATOM   6798  C  CG2   . ILE B 1  367 ? 128.371 186.913 180.001 1.00 88.88  ? 631  ILE C CG2   1 
ATOM   6799  C  CD1   . ILE B 1  367 ? 125.854 185.717 181.397 1.00 88.88  ? 631  ILE C CD1   1 
ATOM   6800  N  N     . GLU B 1  368 ? 125.642 188.014 177.429 1.00 100.74 ? 632  GLU C N     1 
ATOM   6801  C  CA    . GLU B 1  368 ? 125.152 189.379 177.278 1.00 100.74 ? 632  GLU C CA    1 
ATOM   6802  C  C     . GLU B 1  368 ? 124.861 189.942 178.664 1.00 100.74 ? 632  GLU C C     1 
ATOM   6803  O  O     . GLU B 1  368 ? 123.804 189.671 179.243 1.00 100.74 ? 632  GLU C O     1 
ATOM   6804  C  CB    . GLU B 1  368 ? 123.907 189.416 176.396 1.00 100.74 ? 632  GLU C CB    1 
ATOM   6805  C  CG    . GLU B 1  368 ? 123.388 190.819 176.127 1.00 100.74 ? 632  GLU C CG    1 
ATOM   6806  C  CD    . GLU B 1  368 ? 122.189 190.828 175.200 1.00 100.74 ? 632  GLU C CD    1 
ATOM   6807  O  OE1   . GLU B 1  368 ? 121.748 189.736 174.788 1.00 100.74 ? 632  GLU C OE1   1 
ATOM   6808  O  OE2   . GLU B 1  368 ? 121.690 191.928 174.883 1.00 100.74 ? 632  GLU C OE2   1 
ATOM   6809  N  N     . HIS B 1  369 ? 125.797 190.721 179.196 1.00 104.07 ? 633  HIS C N     1 
ATOM   6810  C  CA    . HIS B 1  369 ? 125.668 191.324 180.515 1.00 104.07 ? 633  HIS C CA    1 
ATOM   6811  C  C     . HIS B 1  369 ? 125.361 192.806 180.360 1.00 104.07 ? 633  HIS C C     1 
ATOM   6812  O  O     . HIS B 1  369 ? 126.094 193.529 179.676 1.00 104.07 ? 633  HIS C O     1 
ATOM   6813  C  CB    . HIS B 1  369 ? 126.946 191.129 181.334 1.00 104.07 ? 633  HIS C CB    1 
ATOM   6814  C  CG    . HIS B 1  369 ? 126.823 191.566 182.761 1.00 104.07 ? 633  HIS C CG    1 
ATOM   6815  N  ND1   . HIS B 1  369 ? 127.914 191.724 183.587 1.00 104.07 ? 633  HIS C ND1   1 
ATOM   6816  C  CD2   . HIS B 1  369 ? 125.737 191.874 183.510 1.00 104.07 ? 633  HIS C CD2   1 
ATOM   6817  C  CE1   . HIS B 1  369 ? 127.508 192.113 184.782 1.00 104.07 ? 633  HIS C CE1   1 
ATOM   6818  N  NE2   . HIS B 1  369 ? 126.191 192.212 184.762 1.00 104.07 ? 633  HIS C NE2   1 
ATOM   6819  N  N     . GLY B 1  370 ? 124.281 193.253 180.995 1.00 107.03 ? 634  GLY C N     1 
ATOM   6820  C  CA    . GLY B 1  370 ? 123.878 194.642 180.909 1.00 107.03 ? 634  GLY C CA    1 
ATOM   6821  C  C     . GLY B 1  370 ? 123.414 195.033 179.522 1.00 107.03 ? 634  GLY C C     1 
ATOM   6822  O  O     . GLY B 1  370 ? 122.351 194.598 179.069 1.00 107.03 ? 634  GLY C O     1 
ATOM   6823  N  N     . SER B 1  371 ? 124.207 195.856 178.837 1.00 109.58 ? 635  SER C N     1 
ATOM   6824  C  CA    . SER B 1  371 ? 123.880 196.319 177.492 1.00 109.58 ? 635  SER C CA    1 
ATOM   6825  C  C     . SER B 1  371 ? 124.734 195.633 176.431 1.00 109.58 ? 635  SER C C     1 
ATOM   6826  O  O     . SER B 1  371 ? 124.203 195.067 175.470 1.00 109.58 ? 635  SER C O     1 
ATOM   6827  C  CB    . SER B 1  371 ? 124.044 197.842 177.408 1.00 109.58 ? 635  SER C CB    1 
ATOM   6828  O  OG    . SER B 1  371 ? 123.771 198.312 176.100 1.00 109.58 ? 635  SER C OG    1 
ATOM   6829  N  N     . GLN B 1  372 ? 126.053 195.671 176.590 1.00 105.77 ? 636  GLN C N     1 
ATOM   6830  C  CA    . GLN B 1  372 ? 126.966 195.100 175.613 1.00 105.77 ? 636  GLN C CA    1 
ATOM   6831  C  C     . GLN B 1  372 ? 127.251 193.640 175.961 1.00 105.77 ? 636  GLN C C     1 
ATOM   6832  O  O     . GLN B 1  372 ? 126.623 193.052 176.845 1.00 105.77 ? 636  GLN C O     1 
ATOM   6833  C  CB    . GLN B 1  372 ? 128.247 195.929 175.544 1.00 105.77 ? 636  GLN C CB    1 
ATOM   6834  C  CG    . GLN B 1  372 ? 129.063 195.916 176.826 1.00 105.77 ? 636  GLN C CG    1 
ATOM   6835  C  CD    . GLN B 1  372 ? 130.291 196.800 176.742 1.00 105.77 ? 636  GLN C CD    1 
ATOM   6836  O  OE1   . GLN B 1  372 ? 130.573 197.392 175.700 1.00 105.77 ? 636  GLN C OE1   1 
ATOM   6837  N  NE2   . GLN B 1  372 ? 131.027 196.896 177.842 1.00 105.77 ? 636  GLN C NE2   1 
ATOM   6838  N  N     . ASN B 1  373 ? 128.208 193.040 175.263 1.00 95.18  ? 637  ASN C N     1 
ATOM   6839  C  CA    . ASN B 1  373 ? 128.601 191.656 175.475 1.00 95.18  ? 637  ASN C CA    1 
ATOM   6840  C  C     . ASN B 1  373 ? 129.981 191.595 176.117 1.00 95.18  ? 637  ASN C C     1 
ATOM   6841  O  O     . ASN B 1  373 ? 130.755 192.555 176.087 1.00 95.18  ? 637  ASN C O     1 
ATOM   6842  C  CB    . ASN B 1  373 ? 128.596 190.882 174.151 1.00 95.18  ? 637  ASN C CB    1 
ATOM   6843  C  CG    . ASN B 1  373 ? 127.200 190.671 173.604 1.00 95.18  ? 637  ASN C CG    1 
ATOM   6844  O  OD1   . ASN B 1  373 ? 126.269 190.365 174.347 1.00 95.18  ? 637  ASN C OD1   1 
ATOM   6845  N  ND2   . ASN B 1  373 ? 127.047 190.833 172.295 1.00 95.18  ? 637  ASN C ND2   1 
ATOM   6846  N  N     . VAL B 1  374 ? 130.282 190.439 176.707 1.00 88.50  ? 638  VAL C N     1 
ATOM   6847  C  CA    . VAL B 1  374 ? 131.597 190.183 177.283 1.00 88.50  ? 638  VAL C CA    1 
ATOM   6848  C  C     . VAL B 1  374 ? 131.931 188.704 177.127 1.00 88.50  ? 638  VAL C C     1 
ATOM   6849  O  O     . VAL B 1  374 ? 131.132 187.830 177.479 1.00 88.50  ? 638  VAL C O     1 
ATOM   6850  C  CB    . VAL B 1  374 ? 131.667 190.638 178.756 1.00 88.50  ? 638  VAL C CB    1 
ATOM   6851  C  CG1   . VAL B 1  374 ? 130.634 189.916 179.611 1.00 88.50  ? 638  VAL C CG1   1 
ATOM   6852  C  CG2   . VAL B 1  374 ? 133.068 190.419 179.311 1.00 88.50  ? 638  VAL C CG2   1 
ATOM   6853  N  N     . LYS B 1  375 ? 133.105 188.414 176.572 1.00 83.11  ? 639  LYS C N     1 
ATOM   6854  C  CA    . LYS B 1  375 ? 133.486 187.029 176.332 1.00 83.11  ? 639  LYS C CA    1 
ATOM   6855  C  C     . LYS B 1  375 ? 133.933 186.370 177.631 1.00 83.11  ? 639  LYS C C     1 
ATOM   6856  O  O     . LYS B 1  375 ? 134.650 186.972 178.436 1.00 83.11  ? 639  LYS C O     1 
ATOM   6857  C  CB    . LYS B 1  375 ? 134.589 186.953 175.276 1.00 83.11  ? 639  LYS C CB    1 
ATOM   6858  C  CG    . LYS B 1  375 ? 135.894 187.625 175.661 1.00 83.11  ? 639  LYS C CG    1 
ATOM   6859  C  CD    . LYS B 1  375 ? 136.926 187.478 174.558 1.00 83.11  ? 639  LYS C CD    1 
ATOM   6860  C  CE    . LYS B 1  375 ? 136.590 188.363 173.369 1.00 83.11  ? 639  LYS C CE    1 
ATOM   6861  N  NZ    . LYS B 1  375 ? 137.655 188.328 172.330 1.00 83.11  ? 639  LYS C NZ    1 
ATOM   6862  N  N     . VAL B 1  376 ? 133.494 185.132 177.838 1.00 81.51  ? 640  VAL C N     1 
ATOM   6863  C  CA    . VAL B 1  376 ? 133.836 184.407 179.055 1.00 81.51  ? 640  VAL C CA    1 
ATOM   6864  C  C     . VAL B 1  376 ? 135.019 183.468 178.840 1.00 81.51  ? 640  VAL C C     1 
ATOM   6865  O  O     . VAL B 1  376 ? 135.916 183.399 179.687 1.00 81.51  ? 640  VAL C O     1 
ATOM   6866  C  CB    . VAL B 1  376 ? 132.609 183.638 179.571 1.00 81.51  ? 640  VAL C CB    1 
ATOM   6867  C  CG1   . VAL B 1  376 ? 132.977 182.794 180.778 1.00 81.51  ? 640  VAL C CG1   1 
ATOM   6868  C  CG2   . VAL B 1  376 ? 131.484 184.602 179.910 1.00 81.51  ? 640  VAL C CG2   1 
ATOM   6869  N  N     . PHE B 1  377 ? 135.030 182.760 177.718 1.00 77.94  ? 641  PHE C N     1 
ATOM   6870  C  CA    . PHE B 1  377 ? 136.122 181.842 177.426 1.00 77.94  ? 641  PHE C CA    1 
ATOM   6871  C  C     . PHE B 1  377 ? 136.423 181.778 175.939 1.00 77.94  ? 641  PHE C C     1 
ATOM   6872  O  O     . PHE B 1  377 ? 135.526 181.905 175.113 1.00 77.94  ? 641  PHE C O     1 
ATOM   6873  C  CB    . PHE B 1  377 ? 135.794 180.442 177.935 1.00 77.94  ? 641  PHE C CB    1 
ATOM   6874  C  CG    . PHE B 1  377 ? 136.505 179.351 177.191 1.00 77.94  ? 641  PHE C CG    1 
ATOM   6875  C  CD1   . PHE B 1  377 ? 137.614 178.733 177.738 1.00 77.94  ? 641  PHE C CD1   1 
ATOM   6876  C  CD2   . PHE B 1  377 ? 136.066 178.945 175.945 1.00 77.94  ? 641  PHE C CD2   1 
ATOM   6877  C  CE1   . PHE B 1  377 ? 138.273 177.729 177.056 1.00 77.94  ? 641  PHE C CE1   1 
ATOM   6878  C  CE2   . PHE B 1  377 ? 136.719 177.941 175.257 1.00 77.94  ? 641  PHE C CE2   1 
ATOM   6879  C  CZ    . PHE B 1  377 ? 137.824 177.332 175.813 1.00 77.94  ? 641  PHE C CZ    1 
ATOM   6880  N  N     . GLU B 1  378 ? 137.692 181.577 175.606 1.00 81.13  ? 642  GLU C N     1 
ATOM   6881  C  CA    . GLU B 1  378 ? 138.106 181.476 174.215 1.00 81.13  ? 642  GLU C CA    1 
ATOM   6882  C  C     . GLU B 1  378 ? 139.339 180.587 174.141 1.00 81.13  ? 642  GLU C C     1 
ATOM   6883  O  O     . GLU B 1  378 ? 140.184 180.614 175.040 1.00 81.13  ? 642  GLU C O     1 
ATOM   6884  C  CB    . GLU B 1  378 ? 138.390 182.854 173.604 1.00 81.13  ? 642  GLU C CB    1 
ATOM   6885  C  CG    . GLU B 1  378 ? 139.565 183.593 174.217 1.00 81.13  ? 642  GLU C CG    1 
ATOM   6886  C  CD    . GLU B 1  378 ? 139.761 184.969 173.611 1.00 81.13  ? 642  GLU C CD    1 
ATOM   6887  O  OE1   . GLU B 1  378 ? 138.961 185.350 172.731 1.00 81.13  ? 642  GLU C OE1   1 
ATOM   6888  O  OE2   . GLU B 1  378 ? 140.716 185.667 174.012 1.00 81.13  ? 642  GLU C OE2   1 
ATOM   6889  N  N     . GLU B 1  379 ? 139.425 179.798 173.078 1.00 77.46  ? 643  GLU C N     1 
ATOM   6890  C  CA    . GLU B 1  379 ? 140.519 178.849 172.943 1.00 77.46  ? 643  GLU C CA    1 
ATOM   6891  C  C     . GLU B 1  379 ? 141.829 179.588 172.689 1.00 77.46  ? 643  GLU C C     1 
ATOM   6892  O  O     . GLU B 1  379 ? 141.918 180.371 171.733 1.00 77.46  ? 643  GLU C O     1 
ATOM   6893  C  CB    . GLU B 1  379 ? 140.237 177.868 171.806 1.00 77.46  ? 643  GLU C CB    1 
ATOM   6894  C  CG    . GLU B 1  379 ? 141.311 176.811 171.619 1.00 77.46  ? 643  GLU C CG    1 
ATOM   6895  C  CD    . GLU B 1  379 ? 141.407 175.857 172.794 1.00 77.46  ? 643  GLU C CD    1 
ATOM   6896  O  OE1   . GLU B 1  379 ? 140.389 175.662 173.491 1.00 77.46  ? 643  GLU C OE1   1 
ATOM   6897  O  OE2   . GLU B 1  379 ? 142.503 175.302 173.021 1.00 77.46  ? 643  GLU C OE2   1 
ATOM   6898  N  N     . PRO B 1  380 ? 142.860 179.373 173.508 1.00 72.39  ? 644  PRO C N     1 
ATOM   6899  C  CA    . PRO B 1  380 ? 144.145 180.044 173.271 1.00 72.39  ? 644  PRO C CA    1 
ATOM   6900  C  C     . PRO B 1  380 ? 144.908 179.437 172.106 1.00 72.39  ? 644  PRO C C     1 
ATOM   6901  O  O     . PRO B 1  380 ? 145.629 180.139 171.391 1.00 72.39  ? 644  PRO C O     1 
ATOM   6902  C  CB    . PRO B 1  380 ? 144.890 179.847 174.596 1.00 72.39  ? 644  PRO C CB    1 
ATOM   6903  C  CG    . PRO B 1  380 ? 144.318 178.587 175.153 1.00 72.39  ? 644  PRO C CG    1 
ATOM   6904  C  CD    . PRO B 1  380 ? 142.872 178.568 174.741 1.00 72.39  ? 644  PRO C CD    1 
ATOM   6905  N  N     . LYS B 1  381 ? 144.757 178.127 171.910 1.00 72.24  ? 645  LYS C N     1 
ATOM   6906  C  CA    . LYS B 1  381 ? 145.413 177.394 170.830 1.00 72.24  ? 645  LYS C CA    1 
ATOM   6907  C  C     . LYS B 1  381 ? 144.342 176.823 169.906 1.00 72.24  ? 645  LYS C C     1 
ATOM   6908  O  O     . LYS B 1  381 ? 143.974 175.645 170.014 1.00 72.24  ? 645  LYS C O     1 
ATOM   6909  C  CB    . LYS B 1  381 ? 146.307 176.283 171.378 1.00 72.24  ? 645  LYS C CB    1 
ATOM   6910  C  CG    . LYS B 1  381 ? 147.422 176.770 172.288 1.00 72.24  ? 645  LYS C CG    1 
ATOM   6911  C  CD    . LYS B 1  381 ? 148.455 177.568 171.516 1.00 72.24  ? 645  LYS C CD    1 
ATOM   6912  C  CE    . LYS B 1  381 ? 149.582 178.035 172.420 1.00 72.24  ? 645  LYS C CE    1 
ATOM   6913  N  NZ    . LYS B 1  381 ? 150.413 176.896 172.899 1.00 72.24  ? 645  LYS C NZ    1 
ATOM   6914  N  N     . PRO B 1  382 ? 143.820 177.634 168.984 1.00 71.69  ? 646  PRO C N     1 
ATOM   6915  C  CA    . PRO B 1  382 ? 142.721 177.159 168.129 1.00 71.69  ? 646  PRO C CA    1 
ATOM   6916  C  C     . PRO B 1  382 ? 143.130 176.069 167.158 1.00 71.69  ? 646  PRO C C     1 
ATOM   6917  O  O     . PRO B 1  382 ? 142.272 175.281 166.741 1.00 71.69  ? 646  PRO C O     1 
ATOM   6918  C  CB    . PRO B 1  382 ? 142.279 178.429 167.392 1.00 71.69  ? 646  PRO C CB    1 
ATOM   6919  C  CG    . PRO B 1  382 ? 143.501 179.281 167.363 1.00 71.69  ? 646  PRO C CG    1 
ATOM   6920  C  CD    . PRO B 1  382 ? 144.228 179.010 168.651 1.00 71.69  ? 646  PRO C CD    1 
ATOM   6921  N  N     . ASN B 1  383 ? 144.406 175.993 166.782 1.00 74.49  ? 647  ASN C N     1 
ATOM   6922  C  CA    . ASN B 1  383 ? 144.889 174.994 165.838 1.00 74.49  ? 647  ASN C CA    1 
ATOM   6923  C  C     . ASN B 1  383 ? 145.637 173.859 166.528 1.00 74.49  ? 647  ASN C C     1 
ATOM   6924  O  O     . ASN B 1  383 ? 146.528 173.247 165.930 1.00 74.49  ? 647  ASN C O     1 
ATOM   6925  C  CB    . ASN B 1  383 ? 145.777 175.654 164.783 1.00 74.49  ? 647  ASN C CB    1 
ATOM   6926  C  CG    . ASN B 1  383 ? 144.995 176.545 163.841 1.00 74.49  ? 647  ASN C CG    1 
ATOM   6927  O  OD1   . ASN B 1  383 ? 143.899 176.196 163.405 1.00 74.49  ? 647  ASN C OD1   1 
ATOM   6928  N  ND2   . ASN B 1  383 ? 145.554 177.707 163.524 1.00 74.49  ? 647  ASN C ND2   1 
ATOM   6929  N  N     . SER B 1  384 ? 145.292 173.566 167.778 1.00 72.43  ? 648  SER C N     1 
ATOM   6930  C  CA    . SER B 1  384 ? 145.963 172.512 168.521 1.00 72.43  ? 648  SER C CA    1 
ATOM   6931  C  C     . SER B 1  384 ? 145.209 171.195 168.397 1.00 72.43  ? 648  SER C C     1 
ATOM   6932  O  O     . SER B 1  384 ? 143.997 171.164 168.164 1.00 72.43  ? 648  SER C O     1 
ATOM   6933  C  CB    . SER B 1  384 ? 146.097 172.896 169.994 1.00 72.43  ? 648  SER C CB    1 
ATOM   6934  O  OG    . SER B 1  384 ? 146.717 171.861 170.736 1.00 72.43  ? 648  SER C OG    1 
ATOM   6935  N  N     . GLU B 1  385 ? 145.918 170.093 168.597 1.00 72.19  ? 649  GLU C N     1 
ATOM   6936  C  CA    . GLU B 1  385 ? 145.296 168.781 168.520 1.00 72.19  ? 649  GLU C CA    1 
ATOM   6937  C  C     . GLU B 1  385 ? 144.608 168.421 169.834 1.00 72.19  ? 649  GLU C C     1 
ATOM   6938  O  O     . GLU B 1  385 ? 143.844 167.463 169.897 1.00 72.19  ? 649  GLU C O     1 
ATOM   6939  C  CB    . GLU B 1  385 ? 146.331 167.719 168.161 1.00 72.19  ? 649  GLU C CB    1 
ATOM   6940  C  CG    . GLU B 1  385 ? 147.716 168.280 167.900 1.00 72.19  ? 649  GLU C CG    1 
ATOM   6941  C  CD    . GLU B 1  385 ? 148.766 167.672 168.804 1.00 72.19  ? 649  GLU C CD    1 
ATOM   6942  O  OE1   . GLU B 1  385 ? 148.546 166.546 169.295 1.00 72.19  ? 649  GLU C OE1   1 
ATOM   6943  O  OE2   . GLU B 1  385 ? 149.811 168.317 169.023 1.00 72.19  ? 649  GLU C OE2   1 
ATOM   6944  N  N     . LEU B 1  386 ? 144.880 169.193 170.882 1.00 69.96  ? 650  LEU C N     1 
ATOM   6945  C  CA    . LEU B 1  386 ? 144.278 168.941 172.184 1.00 69.96  ? 650  LEU C CA    1 
ATOM   6946  C  C     . LEU B 1  386 ? 142.888 169.546 172.330 1.00 69.96  ? 650  LEU C C     1 
ATOM   6947  O  O     . LEU B 1  386 ? 142.331 169.511 173.432 1.00 69.96  ? 650  LEU C O     1 
ATOM   6948  C  CB    . LEU B 1  386 ? 145.192 169.475 173.289 1.00 69.96  ? 650  LEU C CB    1 
ATOM   6949  C  CG    . LEU B 1  386 ? 146.564 168.807 173.408 1.00 69.96  ? 650  LEU C CG    1 
ATOM   6950  C  CD1   . LEU B 1  386 ? 147.417 169.504 174.456 1.00 69.96  ? 650  LEU C CD1   1 
ATOM   6951  C  CD2   . LEU B 1  386 ? 146.421 167.327 173.726 1.00 69.96  ? 650  LEU C CD2   1 
ATOM   6952  N  N     . CYS B 1  387 ? 142.315 170.100 171.257 1.00 73.41  ? 651  CYS C N     1 
ATOM   6953  C  CA    . CYS B 1  387 ? 141.001 170.728 171.326 1.00 73.41  ? 651  CYS C CA    1 
ATOM   6954  C  C     . CYS B 1  387 ? 140.126 170.369 170.130 1.00 73.41  ? 651  CYS C C     1 
ATOM   6955  O  O     . CYS B 1  387 ? 139.076 170.987 169.931 1.00 73.41  ? 651  CYS C O     1 
ATOM   6956  C  CB    . CYS B 1  387 ? 141.136 172.249 171.438 1.00 73.41  ? 651  CYS C CB    1 
ATOM   6957  S  SG    . CYS B 1  387 ? 141.882 173.036 169.994 1.00 73.41  ? 651  CYS C SG    1 
ATOM   6958  N  N     . CYS B 1  388 ? 140.527 169.383 169.335 1.00 73.77  ? 652  CYS C N     1 
ATOM   6959  C  CA    . CYS B 1  388 ? 139.777 168.955 168.155 1.00 73.77  ? 652  CYS C CA    1 
ATOM   6960  C  C     . CYS B 1  388 ? 138.983 167.707 168.535 1.00 73.77  ? 652  CYS C C     1 
ATOM   6961  O  O     . CYS B 1  388 ? 139.473 166.582 168.426 1.00 73.77  ? 652  CYS C O     1 
ATOM   6962  C  CB    . CYS B 1  388 ? 140.713 168.691 166.979 1.00 73.77  ? 652  CYS C CB    1 
ATOM   6963  S  SG    . CYS B 1  388 ? 139.878 168.225 165.449 1.00 73.77  ? 652  CYS C SG    1 
ATOM   6964  N  N     . LYS B 1  389 ? 137.750 167.914 168.981 1.00 69.16  ? 653  LYS C N     1 
ATOM   6965  C  CA    . LYS B 1  389 ? 136.921 166.804 169.437 1.00 69.16  ? 653  LYS C CA    1 
ATOM   6966  C  C     . LYS B 1  389 ? 136.346 166.050 168.244 1.00 69.16  ? 653  LYS C C     1 
ATOM   6967  O  O     . LYS B 1  389 ? 135.664 166.652 167.409 1.00 69.16  ? 653  LYS C O     1 
ATOM   6968  C  CB    . LYS B 1  389 ? 135.793 167.308 170.327 1.00 69.16  ? 653  LYS C CB    1 
ATOM   6969  C  CG    . LYS B 1  389 ? 136.264 167.881 171.646 1.00 69.16  ? 653  LYS C CG    1 
ATOM   6970  C  CD    . LYS B 1  389 ? 135.096 168.302 172.512 1.00 69.16  ? 653  LYS C CD    1 
ATOM   6971  C  CE    . LYS B 1  389 ? 135.580 168.942 173.800 1.00 69.16  ? 653  LYS C CE    1 
ATOM   6972  N  NZ    . LYS B 1  389 ? 136.267 167.957 174.679 1.00 69.16  ? 653  LYS C NZ    1 
ATOM   6973  N  N     . PRO B 1  390 ? 136.588 164.746 168.135 1.00 69.77  ? 654  PRO C N     1 
ATOM   6974  C  CA    . PRO B 1  390 ? 136.026 163.985 167.017 1.00 69.77  ? 654  PRO C CA    1 
ATOM   6975  C  C     . PRO B 1  390 ? 134.543 163.723 167.212 1.00 69.77  ? 654  PRO C C     1 
ATOM   6976  O  O     . PRO B 1  390 ? 134.054 163.584 168.335 1.00 69.77  ? 654  PRO C O     1 
ATOM   6977  C  CB    . PRO B 1  390 ? 136.822 162.677 167.048 1.00 69.77  ? 654  PRO C CB    1 
ATOM   6978  C  CG    . PRO B 1  390 ? 137.178 162.515 168.485 1.00 69.77  ? 654  PRO C CG    1 
ATOM   6979  C  CD    . PRO B 1  390 ? 137.418 163.905 169.014 1.00 69.77  ? 654  PRO C CD    1 
ATOM   6980  N  N     . LEU B 1  391 ? 133.826 163.652 166.098 1.00 70.87  ? 655  LEU C N     1 
ATOM   6981  C  CA    . LEU B 1  391 ? 132.400 163.359 166.128 1.00 70.87  ? 655  LEU C CA    1 
ATOM   6982  C  C     . LEU B 1  391 ? 132.023 162.100 165.366 1.00 70.87  ? 655  LEU C C     1 
ATOM   6983  O  O     . LEU B 1  391 ? 131.269 161.275 165.886 1.00 70.87  ? 655  LEU C O     1 
ATOM   6984  C  CB    . LEU B 1  391 ? 131.604 164.541 165.569 1.00 70.87  ? 655  LEU C CB    1 
ATOM   6985  C  CG    . LEU B 1  391 ? 130.089 164.350 165.624 1.00 70.87  ? 655  LEU C CG    1 
ATOM   6986  C  CD1   . LEU B 1  391 ? 129.608 164.252 167.066 1.00 70.87  ? 655  LEU C CD1   1 
ATOM   6987  C  CD2   . LEU B 1  391 ? 129.388 165.471 164.889 1.00 70.87  ? 655  LEU C CD2   1 
ATOM   6988  N  N     . CYS B 1  392 ? 132.522 161.929 164.145 1.00 72.76  ? 656  CYS C N     1 
ATOM   6989  C  CA    . CYS B 1  392 ? 132.154 160.786 163.325 1.00 72.76  ? 656  CYS C CA    1 
ATOM   6990  C  C     . CYS B 1  392 ? 133.396 160.247 162.635 1.00 72.76  ? 656  CYS C C     1 
ATOM   6991  O  O     . CYS B 1  392 ? 134.260 161.015 162.206 1.00 72.76  ? 656  CYS C O     1 
ATOM   6992  C  CB    . CYS B 1  392 ? 131.092 161.160 162.285 1.00 72.76  ? 656  CYS C CB    1 
ATOM   6993  S  SG    . CYS B 1  392 ? 130.531 159.777 161.264 1.00 72.76  ? 656  CYS C SG    1 
ATOM   6994  N  N     . LEU B 1  393 ? 133.476 158.922 162.536 1.00 71.90  ? 657  LEU C N     1 
ATOM   6995  C  CA    . LEU B 1  393 ? 134.607 158.242 161.923 1.00 71.90  ? 657  LEU C CA    1 
ATOM   6996  C  C     . LEU B 1  393 ? 134.085 157.108 161.056 1.00 71.90  ? 657  LEU C C     1 
ATOM   6997  O  O     . LEU B 1  393 ? 133.367 156.232 161.546 1.00 71.90  ? 657  LEU C O     1 
ATOM   6998  C  CB    . LEU B 1  393 ? 135.565 157.694 162.985 1.00 71.90  ? 657  LEU C CB    1 
ATOM   6999  C  CG    . LEU B 1  393 ? 136.283 158.693 163.889 1.00 71.90  ? 657  LEU C CG    1 
ATOM   7000  C  CD1   . LEU B 1  393 ? 137.082 157.957 164.950 1.00 71.90  ? 657  LEU C CD1   1 
ATOM   7001  C  CD2   . LEU B 1  393 ? 137.183 159.597 163.075 1.00 71.90  ? 657  LEU C CD2   1 
ATOM   7002  N  N     . MET B 1  394 ? 134.467 157.117 159.784 1.00 77.25  ? 658  MET C N     1 
ATOM   7003  C  CA    . MET B 1  394 ? 134.041 156.091 158.842 1.00 77.25  ? 658  MET C CA    1 
ATOM   7004  C  C     . MET B 1  394 ? 135.124 155.812 157.807 1.00 77.25  ? 658  MET C C     1 
ATOM   7005  O  O     . MET B 1  394 ? 135.826 156.721 157.373 1.00 77.25  ? 658  MET C O     1 
ATOM   7006  C  CB    . MET B 1  394 ? 132.761 156.525 158.136 1.00 77.25  ? 658  MET C CB    1 
ATOM   7007  C  CG    . MET B 1  394 ? 133.005 157.386 156.910 1.00 77.25  ? 658  MET C CG    1 
ATOM   7008  S  SD    . MET B 1  394 ? 131.605 158.449 156.515 1.00 77.25  ? 658  MET C SD    1 
ATOM   7009  C  CE    . MET B 1  394 ? 132.058 159.943 157.390 1.00 77.25  ? 658  MET C CE    1 
ATOM   7010  N  N     . LEU B 1  395 ? 135.249 154.550 157.413 1.00 78.17  ? 659  LEU C N     1 
ATOM   7011  C  CA    . LEU B 1  395 ? 136.242 154.139 156.421 1.00 78.17  ? 659  LEU C CA    1 
ATOM   7012  C  C     . LEU B 1  395 ? 135.571 154.139 155.055 1.00 78.17  ? 659  LEU C C     1 
ATOM   7013  O  O     . LEU B 1  395 ? 135.110 153.109 154.562 1.00 78.17  ? 659  LEU C O     1 
ATOM   7014  C  CB    . LEU B 1  395 ? 136.815 152.771 156.765 1.00 78.17  ? 659  LEU C CB    1 
ATOM   7015  C  CG    . LEU B 1  395 ? 137.635 152.660 158.051 1.00 78.17  ? 659  LEU C CG    1 
ATOM   7016  C  CD1   . LEU B 1  395 ? 138.008 151.211 158.323 1.00 78.17  ? 659  LEU C CD1   1 
ATOM   7017  C  CD2   . LEU B 1  395 ? 138.878 153.527 157.970 1.00 78.17  ? 659  LEU C CD2   1 
ATOM   7018  N  N     . ALA B 1  396 ? 135.515 155.314 154.434 1.00 80.20  ? 660  ALA C N     1 
ATOM   7019  C  CA    . ALA B 1  396 ? 134.886 155.474 153.132 1.00 80.20  ? 660  ALA C CA    1 
ATOM   7020  C  C     . ALA B 1  396 ? 135.777 156.368 152.278 1.00 80.20  ? 660  ALA C C     1 
ATOM   7021  O  O     . ALA B 1  396 ? 136.905 156.699 152.656 1.00 80.20  ? 660  ALA C O     1 
ATOM   7022  C  CB    . ALA B 1  396 ? 133.466 156.038 153.280 1.00 80.20  ? 660  ALA C CB    1 
ATOM   7023  N  N     . ASP B 1  397 ? 135.263 156.765 151.117 1.00 84.78  ? 661  ASP C N     1 
ATOM   7024  C  CA    . ASP B 1  397 ? 135.976 157.631 150.190 1.00 84.78  ? 661  ASP C CA    1 
ATOM   7025  C  C     . ASP B 1  397 ? 135.304 158.995 150.174 1.00 84.78  ? 661  ASP C C     1 
ATOM   7026  O  O     . ASP B 1  397 ? 134.075 159.085 150.084 1.00 84.78  ? 661  ASP C O     1 
ATOM   7027  C  CB    . ASP B 1  397 ? 135.997 157.031 148.782 1.00 84.78  ? 661  ASP C CB    1 
ATOM   7028  C  CG    . ASP B 1  397 ? 136.922 157.779 147.838 1.00 84.78  ? 661  ASP C CG    1 
ATOM   7029  O  OD1   . ASP B 1  397 ? 137.543 158.774 148.265 1.00 84.78  ? 661  ASP C OD1   1 
ATOM   7030  O  OD2   . ASP B 1  397 ? 137.026 157.368 146.664 1.00 84.78  ? 661  ASP C OD2   1 
ATOM   7031  N  N     . GLU B 1  398 ? 136.111 160.055 150.262 1.00 86.18  ? 662  GLU C N     1 
ATOM   7032  C  CA    . GLU B 1  398 ? 135.572 161.407 150.204 1.00 86.18  ? 662  GLU C CA    1 
ATOM   7033  C  C     . GLU B 1  398 ? 134.996 161.749 148.838 1.00 86.18  ? 662  GLU C C     1 
ATOM   7034  O  O     . GLU B 1  398 ? 134.262 162.736 148.724 1.00 86.18  ? 662  GLU C O     1 
ATOM   7035  C  CB    . GLU B 1  398 ? 136.653 162.422 150.578 1.00 86.18  ? 662  GLU C CB    1 
ATOM   7036  C  CG    . GLU B 1  398 ? 137.809 162.487 149.595 1.00 86.18  ? 662  GLU C CG    1 
ATOM   7037  C  CD    . GLU B 1  398 ? 138.882 163.468 150.023 1.00 86.18  ? 662  GLU C CD    1 
ATOM   7038  O  OE1   . GLU B 1  398 ? 138.728 164.089 151.096 1.00 86.18  ? 662  GLU C OE1   1 
ATOM   7039  O  OE2   . GLU B 1  398 ? 139.881 163.618 149.288 1.00 86.18  ? 662  GLU C OE2   1 
ATOM   7040  N  N     . SER B 1  399 ? 135.309 160.966 147.805 1.00 82.90  ? 663  SER C N     1 
ATOM   7041  C  CA    . SER B 1  399 ? 134.752 161.180 146.477 1.00 82.90  ? 663  SER C CA    1 
ATOM   7042  C  C     . SER B 1  399 ? 133.453 160.422 146.244 1.00 82.90  ? 663  SER C C     1 
ATOM   7043  O  O     . SER B 1  399 ? 132.701 160.781 145.332 1.00 82.90  ? 663  SER C O     1 
ATOM   7044  C  CB    . SER B 1  399 ? 135.769 160.776 145.402 1.00 82.90  ? 663  SER C CB    1 
ATOM   7045  O  OG    . SER B 1  399 ? 136.920 161.600 145.456 1.00 82.90  ? 663  SER C OG    1 
ATOM   7046  N  N     . ASP B 1  400 ? 133.174 159.390 147.040 1.00 79.87  ? 664  ASP C N     1 
ATOM   7047  C  CA    . ASP B 1  400 ? 131.914 158.666 146.935 1.00 79.87  ? 664  ASP C CA    1 
ATOM   7048  C  C     . ASP B 1  400 ? 130.785 159.529 147.482 1.00 79.87  ? 664  ASP C C     1 
ATOM   7049  O  O     . ASP B 1  400 ? 130.542 159.550 148.693 1.00 79.87  ? 664  ASP C O     1 
ATOM   7050  C  CB    . ASP B 1  400 ? 131.992 157.335 147.686 1.00 79.87  ? 664  ASP C CB    1 
ATOM   7051  C  CG    . ASP B 1  400 ? 130.804 156.433 147.407 1.00 79.87  ? 664  ASP C CG    1 
ATOM   7052  O  OD1   . ASP B 1  400 ? 129.906 156.837 146.640 1.00 79.87  ? 664  ASP C OD1   1 
ATOM   7053  O  OD2   . ASP B 1  400 ? 130.769 155.313 147.960 1.00 79.87  ? 664  ASP C OD2   1 
ATOM   7054  N  N     . HIS B 1  401 ? 130.128 160.271 146.602 1.00 72.55  ? 665  HIS C N     1 
ATOM   7055  C  CA    . HIS B 1  401 ? 129.065 161.176 147.016 1.00 72.55  ? 665  HIS C CA    1 
ATOM   7056  C  C     . HIS B 1  401 ? 127.877 160.504 147.688 1.00 72.55  ? 665  HIS C C     1 
ATOM   7057  O  O     . HIS B 1  401 ? 127.316 161.034 148.645 1.00 72.55  ? 665  HIS C O     1 
ATOM   7058  C  CB    . HIS B 1  401 ? 128.583 162.005 145.827 1.00 72.55  ? 665  HIS C CB    1 
ATOM   7059  C  CG    . HIS B 1  401 ? 128.005 163.328 146.214 1.00 72.55  ? 665  HIS C CG    1 
ATOM   7060  N  ND1   . HIS B 1  401 ? 128.787 164.403 146.573 1.00 72.55  ? 665  HIS C ND1   1 
ATOM   7061  C  CD2   . HIS B 1  401 ? 126.723 163.749 146.303 1.00 72.55  ? 665  HIS C CD2   1 
ATOM   7062  C  CE1   . HIS B 1  401 ? 128.011 165.431 146.864 1.00 72.55  ? 665  HIS C CE1   1 
ATOM   7063  N  NE2   . HIS B 1  401 ? 126.754 165.060 146.708 1.00 72.55  ? 665  HIS C NE2   1 
ATOM   7064  N  N     . GLU B 1  402 ? 127.494 159.336 147.192 1.00 74.44  ? 666  GLU C N     1 
ATOM   7065  C  CA    . GLU B 1  402 ? 126.339 158.632 147.742 1.00 74.44  ? 666  GLU C CA    1 
ATOM   7066  C  C     . GLU B 1  402 ? 126.582 158.220 149.190 1.00 74.44  ? 666  GLU C C     1 
ATOM   7067  O  O     . GLU B 1  402 ? 125.790 158.542 150.084 1.00 74.44  ? 666  GLU C O     1 
ATOM   7068  C  CB    . GLU B 1  402 ? 126.013 157.413 146.877 1.00 74.44  ? 666  GLU C CB    1 
ATOM   7069  C  CG    . GLU B 1  402 ? 125.506 157.758 145.485 1.00 74.44  ? 666  GLU C CG    1 
ATOM   7070  C  CD    . GLU B 1  402 ? 126.625 158.042 144.503 1.00 74.44  ? 666  GLU C CD    1 
ATOM   7071  O  OE1   . GLU B 1  402 ? 127.805 157.907 144.890 1.00 74.44  ? 666  GLU C OE1   1 
ATOM   7072  O  OE2   . GLU B 1  402 ? 126.325 158.400 143.345 1.00 74.44  ? 666  GLU C OE2   1 
ATOM   7073  N  N     . THR B 1  403 ? 127.678 157.500 149.438 1.00 74.11  ? 667  THR C N     1 
ATOM   7074  C  CA    . THR B 1  403 ? 127.982 157.052 150.793 1.00 74.11  ? 667  THR C CA    1 
ATOM   7075  C  C     . THR B 1  403 ? 128.247 158.234 151.717 1.00 74.11  ? 667  THR C C     1 
ATOM   7076  O  O     . THR B 1  403 ? 127.829 158.228 152.882 1.00 74.11  ? 667  THR C O     1 
ATOM   7077  C  CB    . THR B 1  403 ? 129.182 156.104 150.775 1.00 74.11  ? 667  THR C CB    1 
ATOM   7078  O  OG1   . THR B 1  403 ? 128.889 154.976 149.940 1.00 74.11  ? 667  THR C OG1   1 
ATOM   7079  C  CG2   . THR B 1  403 ? 129.500 155.613 152.178 1.00 74.11  ? 667  THR C CG2   1 
ATOM   7080  N  N     . LEU B 1  404 ? 128.931 159.262 151.212 1.00 72.18  ? 668  LEU C N     1 
ATOM   7081  C  CA    . LEU B 1  404 ? 129.227 160.433 152.031 1.00 72.18  ? 668  LEU C CA    1 
ATOM   7082  C  C     . LEU B 1  404 ? 127.945 161.100 152.511 1.00 72.18  ? 668  LEU C C     1 
ATOM   7083  O  O     . LEU B 1  404 ? 127.803 161.420 153.698 1.00 72.18  ? 668  LEU C O     1 
ATOM   7084  C  CB    . LEU B 1  404 ? 130.086 161.418 151.239 1.00 72.18  ? 668  LEU C CB    1 
ATOM   7085  C  CG    . LEU B 1  404 ? 130.625 162.635 151.991 1.00 72.18  ? 668  LEU C CG    1 
ATOM   7086  C  CD1   . LEU B 1  404 ? 131.593 162.194 153.077 1.00 72.18  ? 668  LEU C CD1   1 
ATOM   7087  C  CD2   . LEU B 1  404 ? 131.293 163.609 151.033 1.00 72.18  ? 668  LEU C CD2   1 
ATOM   7088  N  N     . THR B 1  405 ? 126.990 161.307 151.601 1.00 70.08  ? 669  THR C N     1 
ATOM   7089  C  CA    . THR B 1  405 ? 125.719 161.906 151.996 1.00 70.08  ? 669  THR C CA    1 
ATOM   7090  C  C     . THR B 1  405 ? 124.931 160.981 152.914 1.00 70.08  ? 669  THR C C     1 
ATOM   7091  O  O     . THR B 1  405 ? 124.327 161.439 153.890 1.00 70.08  ? 669  THR C O     1 
ATOM   7092  C  CB    . THR B 1  405 ? 124.892 162.265 150.762 1.00 70.08  ? 669  THR C CB    1 
ATOM   7093  O  OG1   . THR B 1  405 ? 124.672 161.090 149.972 1.00 70.08  ? 669  THR C OG1   1 
ATOM   7094  C  CG2   . THR B 1  405 ? 125.603 163.318 149.928 1.00 70.08  ? 669  THR C CG2   1 
ATOM   7095  N  N     . ALA B 1  406 ? 124.931 159.676 152.625 1.00 69.43  ? 670  ALA C N     1 
ATOM   7096  C  CA    . ALA B 1  406 ? 124.196 158.738 153.467 1.00 69.43  ? 670  ALA C CA    1 
ATOM   7097  C  C     . ALA B 1  406 ? 124.738 158.716 154.888 1.00 69.43  ? 670  ALA C C     1 
ATOM   7098  O  O     . ALA B 1  406 ? 123.985 158.466 155.836 1.00 69.43  ? 670  ALA C O     1 
ATOM   7099  C  CB    . ALA B 1  406 ? 124.244 157.336 152.861 1.00 69.43  ? 670  ALA C CB    1 
ATOM   7100  N  N     . ILE B 1  407 ? 126.033 158.975 155.058 1.00 68.28  ? 671  ILE C N     1 
ATOM   7101  C  CA    . ILE B 1  407 ? 126.596 158.987 156.403 1.00 68.28  ? 671  ILE C CA    1 
ATOM   7102  C  C     . ILE B 1  407 ? 126.418 160.350 157.069 1.00 68.28  ? 671  ILE C C     1 
ATOM   7103  O  O     . ILE B 1  407 ? 126.184 160.422 158.281 1.00 68.28  ? 671  ILE C O     1 
ATOM   7104  C  CB    . ILE B 1  407 ? 128.075 158.565 156.364 1.00 68.28  ? 671  ILE C CB    1 
ATOM   7105  C  CG1   . ILE B 1  407 ? 128.211 157.153 155.792 1.00 68.28  ? 671  ILE C CG1   1 
ATOM   7106  C  CG2   . ILE B 1  407 ? 128.690 158.619 157.753 1.00 68.28  ? 671  ILE C CG2   1 
ATOM   7107  C  CD1   . ILE B 1  407 ? 127.497 156.095 156.599 1.00 68.28  ? 671  ILE C CD1   1 
ATOM   7108  N  N     . LEU B 1  408 ? 126.498 161.443 156.310 1.00 68.97  ? 672  LEU C N     1 
ATOM   7109  C  CA    . LEU B 1  408 ? 126.505 162.768 156.917 1.00 68.97  ? 672  LEU C CA    1 
ATOM   7110  C  C     . LEU B 1  408 ? 125.126 163.406 157.043 1.00 68.97  ? 672  LEU C C     1 
ATOM   7111  O  O     . LEU B 1  408 ? 125.003 164.424 157.731 1.00 68.97  ? 672  LEU C O     1 
ATOM   7112  C  CB    . LEU B 1  408 ? 127.417 163.712 156.126 1.00 68.97  ? 672  LEU C CB    1 
ATOM   7113  C  CG    . LEU B 1  408 ? 128.915 163.410 156.155 1.00 68.97  ? 672  LEU C CG    1 
ATOM   7114  C  CD1   . LEU B 1  408 ? 129.662 164.386 155.261 1.00 68.97  ? 672  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU B 1  408 ? 129.448 163.457 157.578 1.00 68.97  ? 672  LEU C CD2   1 
ATOM   7116  N  N     . SER B 1  409 ? 124.092 162.850 156.411 1.00 71.62  ? 673  SER C N     1 
ATOM   7117  C  CA    . SER B 1  409 ? 122.776 163.479 156.485 1.00 71.62  ? 673  SER C CA    1 
ATOM   7118  C  C     . SER B 1  409 ? 122.177 163.510 157.890 1.00 71.62  ? 673  SER C C     1 
ATOM   7119  O  O     . SER B 1  409 ? 121.546 164.527 158.231 1.00 71.62  ? 673  SER C O     1 
ATOM   7120  C  CB    . SER B 1  409 ? 121.822 162.804 155.487 1.00 71.62  ? 673  SER C CB    1 
ATOM   7121  O  OG    . SER B 1  409 ? 121.596 161.441 155.794 1.00 71.62  ? 673  SER C OG    1 
ATOM   7122  N  N     . PRO B 1  410 ? 122.315 162.482 158.741 1.00 73.13  ? 674  PRO C N     1 
ATOM   7123  C  CA    . PRO B 1  410 ? 121.770 162.619 160.103 1.00 73.13  ? 674  PRO C CA    1 
ATOM   7124  C  C     . PRO B 1  410 ? 122.437 163.723 160.905 1.00 73.13  ? 674  PRO C C     1 
ATOM   7125  O  O     . PRO B 1  410 ? 121.758 164.440 161.651 1.00 73.13  ? 674  PRO C O     1 
ATOM   7126  C  CB    . PRO B 1  410 ? 122.021 161.236 160.721 1.00 73.13  ? 674  PRO C CB    1 
ATOM   7127  C  CG    . PRO B 1  410 ? 122.149 160.319 159.565 1.00 73.13  ? 674  PRO C CG    1 
ATOM   7128  C  CD    . PRO B 1  410 ? 122.839 161.122 158.515 1.00 73.13  ? 674  PRO C CD    1 
ATOM   7129  N  N     . LEU B 1  411 ? 123.756 163.882 160.768 1.00 72.15  ? 675  LEU C N     1 
ATOM   7130  C  CA    . LEU B 1  411 ? 124.449 164.943 161.491 1.00 72.15  ? 675  LEU C CA    1 
ATOM   7131  C  C     . LEU B 1  411 ? 123.979 166.317 161.033 1.00 72.15  ? 675  LEU C C     1 
ATOM   7132  O  O     . LEU B 1  411 ? 123.782 167.220 161.855 1.00 72.15  ? 675  LEU C O     1 
ATOM   7133  C  CB    . LEU B 1  411 ? 125.960 164.804 161.306 1.00 72.15  ? 675  LEU C CB    1 
ATOM   7134  C  CG    . LEU B 1  411 ? 126.599 163.556 161.916 1.00 72.15  ? 675  LEU C CG    1 
ATOM   7135  C  CD1   . LEU B 1  411 ? 128.071 163.472 161.546 1.00 72.15  ? 675  LEU C CD1   1 
ATOM   7136  C  CD2   . LEU B 1  411 ? 126.421 163.552 163.424 1.00 72.15  ? 675  LEU C CD2   1 
ATOM   7137  N  N     . ILE B 1  412 ? 123.785 166.493 159.725 1.00 71.91  ? 676  ILE C N     1 
ATOM   7138  C  CA    . ILE B 1  412 ? 123.309 167.774 159.215 1.00 71.91  ? 676  ILE C CA    1 
ATOM   7139  C  C     . ILE B 1  412 ? 121.880 168.034 159.674 1.00 71.91  ? 676  ILE C C     1 
ATOM   7140  O  O     . ILE B 1  412 ? 121.514 169.172 159.989 1.00 71.91  ? 676  ILE C O     1 
ATOM   7141  C  CB    . ILE B 1  412 ? 123.437 167.818 157.682 1.00 71.91  ? 676  ILE C CB    1 
ATOM   7142  C  CG1   . ILE B 1  412 ? 124.896 167.621 157.273 1.00 71.91  ? 676  ILE C CG1   1 
ATOM   7143  C  CG2   . ILE B 1  412 ? 122.906 169.133 157.137 1.00 71.91  ? 676  ILE C CG2   1 
ATOM   7144  C  CD1   . ILE B 1  412 ? 125.828 168.670 157.836 1.00 71.91  ? 676  ILE C CD1   1 
ATOM   7145  N  N     . ALA B 1  413 ? 121.053 166.987 159.732 1.00 74.75  ? 677  ALA C N     1 
ATOM   7146  C  CA    . ALA B 1  413 ? 119.694 167.152 160.238 1.00 74.75  ? 677  ALA C CA    1 
ATOM   7147  C  C     . ALA B 1  413 ? 119.706 167.590 161.698 1.00 74.75  ? 677  ALA C C     1 
ATOM   7148  O  O     . ALA B 1  413 ? 118.966 168.501 162.094 1.00 74.75  ? 677  ALA C O     1 
ATOM   7149  C  CB    . ALA B 1  413 ? 118.910 165.852 160.069 1.00 74.75  ? 677  ALA C CB    1 
ATOM   7150  N  N     . GLU B 1  414 ? 120.546 166.950 162.515 1.00 75.78  ? 678  GLU C N     1 
ATOM   7151  C  CA    . GLU B 1  414 ? 120.663 167.335 163.918 1.00 75.78  ? 678  GLU C CA    1 
ATOM   7152  C  C     . GLU B 1  414 ? 121.143 168.775 164.051 1.00 75.78  ? 678  GLU C C     1 
ATOM   7153  O  O     . GLU B 1  414 ? 120.634 169.540 164.878 1.00 75.78  ? 678  GLU C O     1 
ATOM   7154  C  CB    . GLU B 1  414 ? 121.614 166.383 164.646 1.00 75.78  ? 678  GLU C CB    1 
ATOM   7155  C  CG    . GLU B 1  414 ? 121.097 164.961 164.779 1.00 75.78  ? 678  GLU C CG    1 
ATOM   7156  C  CD    . GLU B 1  414 ? 122.090 164.042 165.464 1.00 75.78  ? 678  GLU C CD    1 
ATOM   7157  O  OE1   . GLU B 1  414 ? 123.229 164.484 165.722 1.00 75.78  ? 678  GLU C OE1   1 
ATOM   7158  O  OE2   . GLU B 1  414 ? 121.733 162.878 165.743 1.00 75.78  ? 678  GLU C OE2   1 
ATOM   7159  N  N     . ARG B 1  415 ? 122.127 169.160 163.236 1.00 73.77  ? 679  ARG C N     1 
ATOM   7160  C  CA    . ARG B 1  415 ? 122.647 170.523 163.271 1.00 73.77  ? 679  ARG C CA    1 
ATOM   7161  C  C     . ARG B 1  415 ? 121.562 171.537 162.926 1.00 73.77  ? 679  ARG C C     1 
ATOM   7162  O  O     . ARG B 1  415 ? 121.396 172.549 163.619 1.00 73.77  ? 679  ARG C O     1 
ATOM   7163  C  CB    . ARG B 1  415 ? 123.831 170.634 162.310 1.00 73.77  ? 679  ARG C CB    1 
ATOM   7164  C  CG    . ARG B 1  415 ? 124.518 171.986 162.255 1.00 73.77  ? 679  ARG C CG    1 
ATOM   7165  C  CD    . ARG B 1  415 ? 125.749 171.893 161.361 1.00 73.77  ? 679  ARG C CD    1 
ATOM   7166  N  NE    . ARG B 1  415 ? 126.479 173.153 161.253 1.00 73.77  ? 679  ARG C NE    1 
ATOM   7167  C  CZ    . ARG B 1  415 ? 126.293 174.043 160.285 1.00 73.77  ? 679  ARG C CZ    1 
ATOM   7168  N  NH1   . ARG B 1  415 ? 127.005 175.162 160.264 1.00 73.77  ? 679  ARG C NH1   1 
ATOM   7169  N  NH2   . ARG B 1  415 ? 125.405 173.811 159.329 1.00 73.77  ? 679  ARG C NH2   1 
ATOM   7170  N  N     . GLU B 1  416 ? 120.807 171.275 161.856 1.00 77.71  ? 680  GLU C N     1 
ATOM   7171  C  CA    . GLU B 1  416 ? 119.742 172.187 161.453 1.00 77.71  ? 680  GLU C CA    1 
ATOM   7172  C  C     . GLU B 1  416 ? 118.668 172.285 162.528 1.00 77.71  ? 680  GLU C C     1 
ATOM   7173  O  O     . GLU B 1  416 ? 118.139 173.369 162.798 1.00 77.71  ? 680  GLU C O     1 
ATOM   7174  C  CB    . GLU B 1  416 ? 119.136 171.732 160.125 1.00 77.71  ? 680  GLU C CB    1 
ATOM   7175  C  CG    . GLU B 1  416 ? 120.084 171.828 158.941 1.00 77.71  ? 680  GLU C CG    1 
ATOM   7176  C  CD    . GLU B 1  416 ? 120.445 173.258 158.594 1.00 77.71  ? 680  GLU C CD    1 
ATOM   7177  O  OE1   . GLU B 1  416 ? 119.598 174.154 158.797 1.00 77.71  ? 680  GLU C OE1   1 
ATOM   7178  O  OE2   . GLU B 1  416 ? 121.575 173.486 158.115 1.00 77.71  ? 680  GLU C OE2   1 
ATOM   7179  N  N     . ALA B 1  417 ? 118.332 171.156 163.157 1.00 76.08  ? 681  ALA C N     1 
ATOM   7180  C  CA    . ALA B 1  417 ? 117.318 171.179 164.206 1.00 76.08  ? 681  ALA C CA    1 
ATOM   7181  C  C     . ALA B 1  417 ? 117.805 171.943 165.431 1.00 76.08  ? 681  ALA C C     1 
ATOM   7182  O  O     . ALA B 1  417 ? 117.020 172.621 166.102 1.00 76.08  ? 681  ALA C O     1 
ATOM   7183  C  CB    . ALA B 1  417 ? 116.921 169.752 164.583 1.00 76.08  ? 681  ALA C CB    1 
ATOM   7184  N  N     . MET B 1  418 ? 119.095 171.839 165.725 1.00 73.65  ? 682  MET C N     1 
ATOM   7185  C  CA    . MET B 1  418 ? 119.667 172.512 166.885 1.00 73.65  ? 682  MET C CA    1 
ATOM   7186  C  C     . MET B 1  418 ? 119.841 174.006 166.674 1.00 73.65  ? 682  MET C C     1 
ATOM   7187  O  O     . MET B 1  418 ? 119.834 174.778 167.628 1.00 73.65  ? 682  MET C O     1 
ATOM   7188  C  CB    . MET B 1  418 ? 121.029 171.917 167.233 1.00 73.65  ? 682  MET C CB    1 
ATOM   7189  C  CG    . MET B 1  418 ? 121.014 170.445 167.591 1.00 73.65  ? 682  MET C CG    1 
ATOM   7190  S  SD    . MET B 1  418 ? 122.677 169.883 167.991 1.00 73.65  ? 682  MET C SD    1 
ATOM   7191  C  CE    . MET B 1  418 ? 123.551 171.443 168.015 1.00 73.65  ? 682  MET C CE    1 
ATOM   7192  N  N     . LYS B 1  419 ? 119.985 174.424 165.424 1.00 72.96  ? 683  LYS C N     1 
ATOM   7193  C  CA    . LYS B 1  419 ? 120.195 175.836 165.109 1.00 72.96  ? 683  LYS C CA    1 
ATOM   7194  C  C     . LYS B 1  419 ? 119.072 176.778 165.542 1.00 72.96  ? 683  LYS C C     1 
ATOM   7195  O  O     . LYS B 1  419 ? 119.203 177.992 165.412 1.00 72.96  ? 683  LYS C O     1 
ATOM   7196  C  CB    . LYS B 1  419 ? 120.457 176.008 163.611 1.00 72.96  ? 683  LYS C CB    1 
ATOM   7197  C  CG    . LYS B 1  419 ? 121.849 176.515 163.278 1.00 72.96  ? 683  LYS C CG    1 
ATOM   7198  C  CD    . LYS B 1  419 ? 122.011 176.731 161.783 1.00 72.96  ? 683  LYS C CD    1 
ATOM   7199  C  CE    . LYS B 1  419 ? 122.357 175.433 161.072 1.00 72.96  ? 683  LYS C CE    1 
ATOM   7200  N  NZ    . LYS B 1  419 ? 123.739 175.452 160.517 1.00 72.96  ? 683  LYS C NZ    1 
ATOM   7201  N  N     . SER B 1  420 ? 117.978 176.231 166.058 1.00 75.29  ? 684  SER C N     1 
ATOM   7202  C  CA    . SER B 1  420 ? 116.846 177.054 166.477 1.00 75.29  ? 684  SER C CA    1 
ATOM   7203  C  C     . SER B 1  420 ? 116.271 176.556 167.797 1.00 75.29  ? 684  SER C C     1 
ATOM   7204  O  O     . SER B 1  420 ? 115.060 176.380 167.950 1.00 75.29  ? 684  SER C O     1 
ATOM   7205  C  CB    . SER B 1  420 ? 115.769 177.077 165.396 1.00 75.29  ? 684  SER C CB    1 
ATOM   7206  O  OG    . SER B 1  420 ? 115.202 175.791 165.214 1.00 75.29  ? 684  SER C OG    1 
ATOM   7207  N  N     . SER B 1  421 ? 117.138 176.320 168.778 1.00 75.22  ? 685  SER C N     1 
ATOM   7208  C  CA    . SER B 1  421 ? 116.687 175.858 170.085 1.00 75.22  ? 685  SER C CA    1 
ATOM   7209  C  C     . SER B 1  421 ? 117.672 176.328 171.146 1.00 75.22  ? 685  SER C C     1 
ATOM   7210  O  O     . SER B 1  421 ? 118.805 176.715 170.848 1.00 75.22  ? 685  SER C O     1 
ATOM   7211  C  CB    . SER B 1  421 ? 116.535 174.335 170.116 1.00 75.22  ? 685  SER C CB    1 
ATOM   7212  O  OG    . SER B 1  421 ? 116.122 173.891 171.396 1.00 75.22  ? 685  SER C OG    1 
ATOM   7213  N  N     . GLU B 1  422 ? 117.219 176.289 172.396 1.00 79.24  ? 686  GLU C N     1 
ATOM   7214  C  CA    . GLU B 1  422 ? 118.034 176.634 173.549 1.00 79.24  ? 686  GLU C CA    1 
ATOM   7215  C  C     . GLU B 1  422 ? 118.203 175.410 174.439 1.00 79.24  ? 686  GLU C C     1 
ATOM   7216  O  O     . GLU B 1  422 ? 117.346 174.523 174.483 1.00 79.24  ? 686  GLU C O     1 
ATOM   7217  C  CB    . GLU B 1  422 ? 117.412 177.783 174.353 1.00 79.24  ? 686  GLU C CB    1 
ATOM   7218  C  CG    . GLU B 1  422 ? 117.395 179.116 173.624 1.00 79.24  ? 686  GLU C CG    1 
ATOM   7219  C  CD    . GLU B 1  422 ? 116.751 180.218 174.442 1.00 79.24  ? 686  GLU C CD    1 
ATOM   7220  O  OE1   . GLU B 1  422 ? 116.207 179.915 175.524 1.00 79.24  ? 686  GLU C OE1   1 
ATOM   7221  O  OE2   . GLU B 1  422 ? 116.788 181.388 174.004 1.00 79.24  ? 686  GLU C OE2   1 
ATOM   7222  N  N     . LEU B 1  423 ? 119.319 175.378 175.163 1.00 75.19  ? 687  LEU C N     1 
ATOM   7223  C  CA    . LEU B 1  423 ? 119.699 174.232 175.983 1.00 75.19  ? 687  LEU C CA    1 
ATOM   7224  C  C     . LEU B 1  423 ? 119.710 174.647 177.448 1.00 75.19  ? 687  LEU C C     1 
ATOM   7225  O  O     . LEU B 1  423 ? 120.466 175.542 177.841 1.00 75.19  ? 687  LEU C O     1 
ATOM   7226  C  CB    . LEU B 1  423 ? 121.064 173.689 175.561 1.00 75.19  ? 687  LEU C CB    1 
ATOM   7227  C  CG    . LEU B 1  423 ? 121.569 172.452 176.306 1.00 75.19  ? 687  LEU C CG    1 
ATOM   7228  C  CD1   . LEU B 1  423 ? 120.639 171.272 176.080 1.00 75.19  ? 687  LEU C CD1   1 
ATOM   7229  C  CD2   . LEU B 1  423 ? 122.985 172.112 175.873 1.00 75.19  ? 687  LEU C CD2   1 
ATOM   7230  N  N     . THR B 1  424 ? 118.872 173.995 178.250 1.00 79.52  ? 688  THR C N     1 
ATOM   7231  C  CA    . THR B 1  424 ? 118.879 174.163 179.696 1.00 79.52  ? 688  THR C CA    1 
ATOM   7232  C  C     . THR B 1  424 ? 119.842 173.152 180.305 1.00 79.52  ? 688  THR C C     1 
ATOM   7233  O  O     . THR B 1  424 ? 119.661 171.942 180.143 1.00 79.52  ? 688  THR C O     1 
ATOM   7234  C  CB    . THR B 1  424 ? 117.476 173.971 180.273 1.00 79.52  ? 688  THR C CB    1 
ATOM   7235  O  OG1   . THR B 1  424 ? 116.584 174.941 179.709 1.00 79.52  ? 688  THR C OG1   1 
ATOM   7236  C  CG2   . THR B 1  424 ? 117.499 174.123 181.785 1.00 79.52  ? 688  THR C CG2   1 
ATOM   7237  N  N     . LEU B 1  425 ? 120.864 173.647 181.000 1.00 81.73  ? 689  LEU C N     1 
ATOM   7238  C  CA    . LEU B 1  425 ? 121.941 172.785 181.464 1.00 81.73  ? 689  LEU C CA    1 
ATOM   7239  C  C     . LEU B 1  425 ? 122.381 173.239 182.848 1.00 81.73  ? 689  LEU C C     1 
ATOM   7240  O  O     . LEU B 1  425 ? 122.380 174.434 183.154 1.00 81.73  ? 689  LEU C O     1 
ATOM   7241  C  CB    . LEU B 1  425 ? 123.109 172.807 180.468 1.00 81.73  ? 689  LEU C CB    1 
ATOM   7242  C  CG    . LEU B 1  425 ? 124.233 171.766 180.499 1.00 81.73  ? 689  LEU C CG    1 
ATOM   7243  C  CD1   . LEU B 1  425 ? 125.239 172.074 181.579 1.00 81.73  ? 689  LEU C CD1   1 
ATOM   7244  C  CD2   . LEU B 1  425 ? 123.679 170.361 180.675 1.00 81.73  ? 689  LEU C CD2   1 
ATOM   7245  N  N     . GLU B 1  426 ? 122.765 172.274 183.679 1.00 86.74  ? 690  GLU C N     1 
ATOM   7246  C  CA    . GLU B 1  426 ? 123.134 172.532 185.065 1.00 86.74  ? 690  GLU C CA    1 
ATOM   7247  C  C     . GLU B 1  426 ? 124.648 172.669 185.181 1.00 86.74  ? 690  GLU C C     1 
ATOM   7248  O  O     . GLU B 1  426 ? 125.389 171.750 184.818 1.00 86.74  ? 690  GLU C O     1 
ATOM   7249  C  CB    . GLU B 1  426 ? 122.636 171.414 185.981 1.00 86.74  ? 690  GLU C CB    1 
ATOM   7250  C  CG    . GLU B 1  426 ? 122.916 171.640 187.453 1.00 86.74  ? 690  GLU C CG    1 
ATOM   7251  C  CD    . GLU B 1  426 ? 122.364 170.532 188.330 1.00 86.74  ? 690  GLU C CD    1 
ATOM   7252  O  OE1   . GLU B 1  426 ? 121.792 169.562 187.789 1.00 86.74  ? 690  GLU C OE1   1 
ATOM   7253  O  OE2   . GLU B 1  426 ? 122.507 170.632 189.566 1.00 86.74  ? 690  GLU C OE2   1 
ATOM   7254  N  N     . MET B 1  427 ? 125.098 173.809 185.703 1.00 88.53  ? 691  MET C N     1 
ATOM   7255  C  CA    . MET B 1  427 ? 126.510 174.058 185.969 1.00 88.53  ? 691  MET C CA    1 
ATOM   7256  C  C     . MET B 1  427 ? 126.655 174.543 187.402 1.00 88.53  ? 691  MET C C     1 
ATOM   7257  O  O     . MET B 1  427 ? 126.212 175.648 187.732 1.00 88.53  ? 691  MET C O     1 
ATOM   7258  C  CB    . MET B 1  427 ? 127.086 175.089 184.994 1.00 88.53  ? 691  MET C CB    1 
ATOM   7259  C  CG    . MET B 1  427 ? 127.183 174.604 183.561 1.00 88.53  ? 691  MET C CG    1 
ATOM   7260  S  SD    . MET B 1  427 ? 127.760 175.894 182.445 1.00 88.53  ? 691  MET C SD    1 
ATOM   7261  C  CE    . MET B 1  427 ? 129.461 176.064 182.972 1.00 88.53  ? 691  MET C CE    1 
ATOM   7262  N  N     . GLY B 1  428 ? 127.279 173.725 188.247 1.00 89.55  ? 692  GLY C N     1 
ATOM   7263  C  CA    . GLY B 1  428 ? 127.421 174.075 189.645 1.00 89.55  ? 692  GLY C CA    1 
ATOM   7264  C  C     . GLY B 1  428 ? 126.124 174.126 190.417 1.00 89.55  ? 692  GLY C C     1 
ATOM   7265  O  O     . GLY B 1  428 ? 126.065 174.767 191.469 1.00 89.55  ? 692  GLY C O     1 
ATOM   7266  N  N     . GLY B 1  429 ? 125.078 173.468 189.925 1.00 88.55  ? 693  GLY C N     1 
ATOM   7267  C  CA    . GLY B 1  429 ? 123.797 173.491 190.602 1.00 88.55  ? 693  GLY C CA    1 
ATOM   7268  C  C     . GLY B 1  429 ? 122.873 174.607 190.173 1.00 88.55  ? 693  GLY C C     1 
ATOM   7269  O  O     . GLY B 1  429 ? 121.926 174.930 190.898 1.00 88.55  ? 693  GLY C O     1 
ATOM   7270  N  N     . ILE B 1  430 ? 123.120 175.211 189.014 1.00 87.78  ? 694  ILE C N     1 
ATOM   7271  C  CA    . ILE B 1  430 ? 122.278 176.288 188.500 1.00 87.78  ? 694  ILE C CA    1 
ATOM   7272  C  C     . ILE B 1  430 ? 121.938 176.001 187.043 1.00 87.78  ? 694  ILE C C     1 
ATOM   7273  O  O     . ILE B 1  430 ? 122.846 175.792 186.226 1.00 87.78  ? 694  ILE C O     1 
ATOM   7274  C  CB    . ILE B 1  430 ? 122.959 177.659 188.639 1.00 87.78  ? 694  ILE C CB    1 
ATOM   7275  C  CG1   . ILE B 1  430 ? 123.182 178.016 190.112 1.00 87.78  ? 694  ILE C CG1   1 
ATOM   7276  C  CG2   . ILE B 1  430 ? 122.130 178.734 187.954 1.00 87.78  ? 694  ILE C CG2   1 
ATOM   7277  C  CD1   . ILE B 1  430 ? 124.530 177.588 190.659 1.00 87.78  ? 694  ILE C CD1   1 
ATOM   7278  N  N     . PRO B 1  431 ? 120.656 175.975 186.673 1.00 85.75  ? 695  PRO C N     1 
ATOM   7279  C  CA    . PRO B 1  431 ? 120.275 175.745 185.270 1.00 85.75  ? 695  PRO C CA    1 
ATOM   7280  C  C     . PRO B 1  431 ? 120.721 176.905 184.394 1.00 85.75  ? 695  PRO C C     1 
ATOM   7281  O  O     . PRO B 1  431 ? 120.303 178.048 184.596 1.00 85.75  ? 695  PRO C O     1 
ATOM   7282  C  CB    . PRO B 1  431 ? 118.745 175.643 185.333 1.00 85.75  ? 695  PRO C CB    1 
ATOM   7283  C  CG    . PRO B 1  431 ? 118.446 175.279 186.754 1.00 85.75  ? 695  PRO C CG    1 
ATOM   7284  C  CD    . PRO B 1  431 ? 119.486 175.987 187.566 1.00 85.75  ? 695  PRO C CD    1 
ATOM   7285  N  N     . ARG B 1  432 ? 121.570 176.600 183.418 1.00 84.34  ? 696  ARG C N     1 
ATOM   7286  C  CA    . ARG B 1  432 ? 122.080 177.607 182.501 1.00 84.34  ? 696  ARG C CA    1 
ATOM   7287  C  C     . ARG B 1  432 ? 121.466 177.450 181.114 1.00 84.34  ? 696  ARG C C     1 
ATOM   7288  O  O     . ARG B 1  432 ? 121.071 176.356 180.716 1.00 84.34  ? 696  ARG C O     1 
ATOM   7289  C  CB    . ARG B 1  432 ? 123.604 177.532 182.424 1.00 84.34  ? 696  ARG C CB    1 
ATOM   7290  C  CG    . ARG B 1  432 ? 124.296 177.715 183.764 1.00 84.34  ? 696  ARG C CG    1 
ATOM   7291  C  CD    . ARG B 1  432 ? 124.722 179.159 183.972 1.00 84.34  ? 696  ARG C CD    1 
ATOM   7292  N  NE    . ARG B 1  432 ? 124.943 179.473 185.381 1.00 84.34  ? 696  ARG C NE    1 
ATOM   7293  C  CZ    . ARG B 1  432 ? 126.036 179.140 186.059 1.00 84.34  ? 696  ARG C CZ    1 
ATOM   7294  N  NH1   . ARG B 1  432 ? 126.153 179.466 187.338 1.00 84.34  ? 696  ARG C NH1   1 
ATOM   7295  N  NH2   . ARG B 1  432 ? 127.013 178.478 185.458 1.00 84.34  ? 696  ARG C NH2   1 
ATOM   7296  N  N     . THR B 1  433 ? 121.396 178.556 180.384 1.00 77.49  ? 697  THR C N     1 
ATOM   7297  C  CA    . THR B 1  433 ? 120.821 178.588 179.046 1.00 77.49  ? 697  THR C CA    1 
ATOM   7298  C  C     . THR B 1  433 ? 121.937 178.726 178.020 1.00 77.49  ? 697  THR C C     1 
ATOM   7299  O  O     . THR B 1  433 ? 122.829 179.566 178.178 1.00 77.49  ? 697  THR C O     1 
ATOM   7300  C  CB    . THR B 1  433 ? 119.825 179.741 178.902 1.00 77.49  ? 697  THR C CB    1 
ATOM   7301  O  OG1   . THR B 1  433 ? 118.769 179.582 179.858 1.00 77.49  ? 697  THR C OG1   1 
ATOM   7302  C  CG2   . THR B 1  433 ? 119.231 179.764 177.502 1.00 77.49  ? 697  THR C CG2   1 
ATOM   7303  N  N     . PHE B 1  434 ? 121.884 177.905 176.975 1.00 74.79  ? 698  PHE C N     1 
ATOM   7304  C  CA    . PHE B 1  434 ? 122.910 177.873 175.944 1.00 74.79  ? 698  PHE C CA    1 
ATOM   7305  C  C     . PHE B 1  434 ? 122.287 178.047 174.567 1.00 74.79  ? 698  PHE C C     1 
ATOM   7306  O  O     . PHE B 1  434 ? 121.228 177.482 174.276 1.00 74.79  ? 698  PHE C O     1 
ATOM   7307  C  CB    . PHE B 1  434 ? 123.692 176.558 175.989 1.00 74.79  ? 698  PHE C CB    1 
ATOM   7308  C  CG    . PHE B 1  434 ? 124.564 176.412 177.199 1.00 74.79  ? 698  PHE C CG    1 
ATOM   7309  C  CD1   . PHE B 1  434 ? 125.828 176.972 177.228 1.00 74.79  ? 698  PHE C CD1   1 
ATOM   7310  C  CD2   . PHE B 1  434 ? 124.117 175.721 178.310 1.00 74.79  ? 698  PHE C CD2   1 
ATOM   7311  C  CE1   . PHE B 1  434 ? 126.632 176.836 178.339 1.00 74.79  ? 698  PHE C CE1   1 
ATOM   7312  C  CE2   . PHE B 1  434 ? 124.917 175.587 179.424 1.00 74.79  ? 698  PHE C CE2   1 
ATOM   7313  C  CZ    . PHE B 1  434 ? 126.174 176.145 179.439 1.00 74.79  ? 698  PHE C CZ    1 
ATOM   7314  N  N     . LYS B 1  435 ? 122.954 178.830 173.724 1.00 69.81  ? 699  LYS C N     1 
ATOM   7315  C  CA    . LYS B 1  435 ? 122.617 178.942 172.315 1.00 69.81  ? 699  LYS C CA    1 
ATOM   7316  C  C     . LYS B 1  435 ? 123.896 178.819 171.500 1.00 69.81  ? 699  LYS C C     1 
ATOM   7317  O  O     . LYS B 1  435 ? 124.987 179.159 171.963 1.00 69.81  ? 699  LYS C O     1 
ATOM   7318  C  CB    . LYS B 1  435 ? 121.900 180.262 171.998 1.00 69.81  ? 699  LYS C CB    1 
ATOM   7319  C  CG    . LYS B 1  435 ? 122.742 181.504 172.217 1.00 69.81  ? 699  LYS C CG    1 
ATOM   7320  C  CD    . LYS B 1  435 ? 121.967 182.758 171.852 1.00 69.81  ? 699  LYS C CD    1 
ATOM   7321  C  CE    . LYS B 1  435 ? 120.889 183.057 172.879 1.00 69.81  ? 699  LYS C CE    1 
ATOM   7322  N  NZ    . LYS B 1  435 ? 120.209 184.353 172.610 1.00 69.81  ? 699  LYS C NZ    1 
ATOM   7323  N  N     . PHE B 1  436 ? 123.754 178.324 170.274 1.00 66.39  ? 700  PHE C N     1 
ATOM   7324  C  CA    . PHE B 1  436 ? 124.903 177.963 169.460 1.00 66.39  ? 700  PHE C CA    1 
ATOM   7325  C  C     . PHE B 1  436 ? 124.885 178.720 168.139 1.00 66.39  ? 700  PHE C C     1 
ATOM   7326  O  O     . PHE B 1  436 ? 123.832 179.108 167.627 1.00 66.39  ? 700  PHE C O     1 
ATOM   7327  C  CB    . PHE B 1  436 ? 124.942 176.451 169.198 1.00 66.39  ? 700  PHE C CB    1 
ATOM   7328  C  CG    . PHE B 1  436 ? 125.172 175.626 170.434 1.00 66.39  ? 700  PHE C CG    1 
ATOM   7329  C  CD1   . PHE B 1  436 ? 126.450 175.438 170.934 1.00 66.39  ? 700  PHE C CD1   1 
ATOM   7330  C  CD2   . PHE B 1  436 ? 124.107 175.040 171.096 1.00 66.39  ? 700  PHE C CD2   1 
ATOM   7331  C  CE1   . PHE B 1  436 ? 126.660 174.678 172.069 1.00 66.39  ? 700  PHE C CE1   1 
ATOM   7332  C  CE2   . PHE B 1  436 ? 124.311 174.281 172.230 1.00 66.39  ? 700  PHE C CE2   1 
ATOM   7333  C  CZ    . PHE B 1  436 ? 125.588 174.099 172.718 1.00 66.39  ? 700  PHE C CZ    1 
ATOM   7334  N  N     . ILE B 1  437 ? 126.086 178.925 167.598 1.00 66.66  ? 701  ILE C N     1 
ATOM   7335  C  CA    . ILE B 1  437 ? 126.297 179.499 166.273 1.00 66.66  ? 701  ILE C CA    1 
ATOM   7336  C  C     . ILE B 1  437 ? 127.313 178.615 165.564 1.00 66.66  ? 701  ILE C C     1 
ATOM   7337  O  O     . ILE B 1  437 ? 128.484 178.580 165.954 1.00 66.66  ? 701  ILE C O     1 
ATOM   7338  C  CB    . ILE B 1  437 ? 126.801 180.952 166.333 1.00 66.66  ? 701  ILE C CB    1 
ATOM   7339  C  CG1   . ILE B 1  437 ? 125.748 181.860 166.968 1.00 66.66  ? 701  ILE C CG1   1 
ATOM   7340  C  CG2   . ILE B 1  437 ? 127.162 181.445 164.943 1.00 66.66  ? 701  ILE C CG2   1 
ATOM   7341  C  CD1   . ILE B 1  437 ? 126.253 183.244 167.292 1.00 66.66  ? 701  ILE C CD1   1 
ATOM   7342  N  N     . PHE B 1  438 ? 126.839 177.836 164.601 1.00 71.89  ? 702  PHE C N     1 
ATOM   7343  C  CA    . PHE B 1  438 ? 127.695 176.898 163.891 1.00 71.89  ? 702  PHE C CA    1 
ATOM   7344  C  C     . PHE B 1  438 ? 128.388 177.488 162.678 1.00 71.89  ? 702  PHE C C     1 
ATOM   7345  O  O     . PHE B 1  438 ? 127.751 178.037 161.782 1.00 71.89  ? 702  PHE C O     1 
ATOM   7346  C  CB    . PHE B 1  438 ? 126.901 175.659 163.482 1.00 71.89  ? 702  PHE C CB    1 
ATOM   7347  C  CG    . PHE B 1  438 ? 126.361 174.879 164.643 1.00 71.89  ? 702  PHE C CG    1 
ATOM   7348  C  CD1   . PHE B 1  438 ? 127.014 173.750 165.097 1.00 71.89  ? 702  PHE C CD1   1 
ATOM   7349  C  CD2   . PHE B 1  438 ? 125.201 175.277 165.280 1.00 71.89  ? 702  PHE C CD2   1 
ATOM   7350  C  CE1   . PHE B 1  438 ? 126.520 173.030 166.165 1.00 71.89  ? 702  PHE C CE1   1 
ATOM   7351  C  CE2   . PHE B 1  438 ? 124.701 174.562 166.349 1.00 71.89  ? 702  PHE C CE2   1 
ATOM   7352  C  CZ    . PHE B 1  438 ? 125.361 173.436 166.792 1.00 71.89  ? 702  PHE C CZ    1 
ATOM   7353  N  N     . ARG B 1  439 ? 129.709 177.354 162.646 1.00 71.94  ? 703  ARG C N     1 
ATOM   7354  C  CA    . ARG B 1  439 ? 130.506 177.862 161.538 1.00 71.94  ? 703  ARG C CA    1 
ATOM   7355  C  C     . ARG B 1  439 ? 131.487 176.804 161.056 1.00 71.94  ? 703  ARG C C     1 
ATOM   7356  O  O     . ARG B 1  439 ? 132.310 176.316 161.824 1.00 71.94  ? 703  ARG C O     1 
ATOM   7357  C  CB    . ARG B 1  439 ? 131.261 179.122 161.956 1.00 71.94  ? 703  ARG C CB    1 
ATOM   7358  C  CG    . ARG B 1  439 ? 130.430 180.391 161.884 1.00 71.94  ? 703  ARG C CG    1 
ATOM   7359  C  CD    . ARG B 1  439 ? 131.231 181.595 162.348 1.00 71.94  ? 703  ARG C CD    1 
ATOM   7360  N  NE    . ARG B 1  439 ? 132.509 181.698 161.653 1.00 71.94  ? 703  ARG C NE    1 
ATOM   7361  C  CZ    . ARG B 1  439 ? 132.915 182.778 160.994 1.00 71.94  ? 703  ARG C CZ    1 
ATOM   7362  N  NH1   . ARG B 1  439 ? 132.141 183.852 160.940 1.00 71.94  ? 703  ARG C NH1   1 
ATOM   7363  N  NH2   . ARG B 1  439 ? 134.094 182.784 160.390 1.00 71.94  ? 703  ARG C NH2   1 
ATOM   7364  N  N     . GLY B 1  440 ? 131.392 176.450 159.780 1.00 73.73  ? 704  GLY C N     1 
ATOM   7365  C  CA    . GLY B 1  440 ? 132.269 175.452 159.200 1.00 73.73  ? 704  GLY C CA    1 
ATOM   7366  C  C     . GLY B 1  440 ? 133.304 176.043 158.265 1.00 73.73  ? 704  GLY C C     1 
ATOM   7367  O  O     . GLY B 1  440 ? 132.968 176.504 157.171 1.00 73.73  ? 704  GLY C O     1 
ATOM   7368  N  N     . THR B 1  441 ? 134.569 176.034 158.683 1.00 75.58  ? 705  THR C N     1 
ATOM   7369  C  CA    . THR B 1  441 ? 135.649 176.603 157.885 1.00 75.58  ? 705  THR C CA    1 
ATOM   7370  C  C     . THR B 1  441 ? 136.814 175.657 157.639 1.00 75.58  ? 705  THR C C     1 
ATOM   7371  O  O     . THR B 1  441 ? 137.614 175.928 156.736 1.00 75.58  ? 705  THR C O     1 
ATOM   7372  C  CB    . THR B 1  441 ? 136.193 177.880 158.542 1.00 75.58  ? 705  THR C CB    1 
ATOM   7373  O  OG1   . THR B 1  441 ? 136.709 177.569 159.842 1.00 75.58  ? 705  THR C OG1   1 
ATOM   7374  C  CG2   . THR B 1  441 ? 135.098 178.928 158.671 1.00 75.58  ? 705  THR C CG2   1 
ATOM   7375  N  N     . GLY B 1  442 ? 136.943 174.570 158.395 1.00 75.08  ? 706  GLY C N     1 
ATOM   7376  C  CA    . GLY B 1  442 ? 138.057 173.658 158.226 1.00 75.08  ? 706  GLY C CA    1 
ATOM   7377  C  C     . GLY B 1  442 ? 137.893 172.710 157.057 1.00 75.08  ? 706  GLY C C     1 
ATOM   7378  O  O     . GLY B 1  442 ? 138.060 171.495 157.205 1.00 75.08  ? 706  GLY C O     1 
ATOM   7379  N  N     . TYR B 1  443 ? 137.570 173.254 155.887 1.00 76.64  ? 707  TYR C N     1 
ATOM   7380  C  CA    . TYR B 1  443 ? 137.360 172.471 154.677 1.00 76.64  ? 707  TYR C CA    1 
ATOM   7381  C  C     . TYR B 1  443 ? 138.327 172.950 153.606 1.00 76.64  ? 707  TYR C C     1 
ATOM   7382  O  O     . TYR B 1  443 ? 138.488 174.158 153.410 1.00 76.64  ? 707  TYR C O     1 
ATOM   7383  C  CB    . TYR B 1  443 ? 135.921 172.608 154.165 1.00 76.64  ? 707  TYR C CB    1 
ATOM   7384  C  CG    . TYR B 1  443 ? 134.855 172.006 155.053 1.00 76.64  ? 707  TYR C CG    1 
ATOM   7385  C  CD1   . TYR B 1  443 ? 135.178 171.108 156.058 1.00 76.64  ? 707  TYR C CD1   1 
ATOM   7386  C  CD2   . TYR B 1  443 ? 133.519 172.342 154.881 1.00 76.64  ? 707  TYR C CD2   1 
ATOM   7387  C  CE1   . TYR B 1  443 ? 134.201 170.563 156.867 1.00 76.64  ? 707  TYR C CE1   1 
ATOM   7388  C  CE2   . TYR B 1  443 ? 132.536 171.800 155.684 1.00 76.64  ? 707  TYR C CE2   1 
ATOM   7389  C  CZ    . TYR B 1  443 ? 132.883 170.911 156.675 1.00 76.64  ? 707  TYR C CZ    1 
ATOM   7390  O  OH    . TYR B 1  443 ? 131.907 170.368 157.479 1.00 76.64  ? 707  TYR C OH    1 
ATOM   7391  N  N     . ASP B 1  444 ? 138.969 172.010 152.918 1.00 83.55  ? 708  ASP C N     1 
ATOM   7392  C  CA    . ASP B 1  444 ? 139.760 172.383 151.757 1.00 83.55  ? 708  ASP C CA    1 
ATOM   7393  C  C     . ASP B 1  444 ? 138.842 172.700 150.579 1.00 83.55  ? 708  ASP C C     1 
ATOM   7394  O  O     . ASP B 1  444 ? 137.650 172.383 150.585 1.00 83.55  ? 708  ASP C O     1 
ATOM   7395  C  CB    . ASP B 1  444 ? 140.755 171.278 151.390 1.00 83.55  ? 708  ASP C CB    1 
ATOM   7396  C  CG    . ASP B 1  444 ? 140.081 169.956 151.066 1.00 83.55  ? 708  ASP C CG    1 
ATOM   7397  O  OD1   . ASP B 1  444 ? 138.846 169.853 151.210 1.00 83.55  ? 708  ASP C OD1   1 
ATOM   7398  O  OD2   . ASP B 1  444 ? 140.793 169.013 150.663 1.00 83.55  ? 708  ASP C OD2   1 
ATOM   7399  N  N     . GLU B 1  445 ? 139.418 173.336 149.556 1.00 81.60  ? 709  GLU C N     1 
ATOM   7400  C  CA    . GLU B 1  445 ? 138.611 173.812 148.437 1.00 81.60  ? 709  GLU C CA    1 
ATOM   7401  C  C     . GLU B 1  445 ? 137.961 172.665 147.672 1.00 81.60  ? 709  GLU C C     1 
ATOM   7402  O  O     . GLU B 1  445 ? 136.857 172.827 147.139 1.00 81.60  ? 709  GLU C O     1 
ATOM   7403  C  CB    . GLU B 1  445 ? 139.469 174.661 147.499 1.00 81.60  ? 709  GLU C CB    1 
ATOM   7404  C  CG    . GLU B 1  445 ? 138.692 175.316 146.369 1.00 81.60  ? 709  GLU C CG    1 
ATOM   7405  C  CD    . GLU B 1  445 ? 139.559 176.211 145.507 1.00 81.60  ? 709  GLU C CD    1 
ATOM   7406  O  OE1   . GLU B 1  445 ? 140.776 176.299 145.773 1.00 81.60  ? 709  GLU C OE1   1 
ATOM   7407  O  OE2   . GLU B 1  445 ? 139.024 176.829 144.564 1.00 81.60  ? 709  GLU C OE2   1 
ATOM   7408  N  N     . LYS B 1  446 ? 138.626 171.518 147.647 1.00 76.94  ? 710  LYS C N     1 
ATOM   7409  C  CA    . LYS B 1  446 ? 138.111 170.346 146.955 1.00 76.94  ? 710  LYS C CA    1 
ATOM   7410  C  C     . LYS B 1  446 ? 136.782 169.889 147.545 1.00 76.94  ? 710  LYS C C     1 
ATOM   7411  O  O     . LYS B 1  446 ? 135.816 169.673 146.819 1.00 76.94  ? 710  LYS C O     1 
ATOM   7412  C  CB    . LYS B 1  446 ? 139.132 169.210 147.013 1.00 76.94  ? 710  LYS C CB    1 
ATOM   7413  C  CG    . LYS B 1  446 ? 138.630 167.893 146.452 1.00 76.94  ? 710  LYS C CG    1 
ATOM   7414  C  CD    . LYS B 1  446 ? 139.746 167.135 145.754 1.00 76.94  ? 710  LYS C CD    1 
ATOM   7415  C  CE    . LYS B 1  446 ? 139.403 165.662 145.611 1.00 76.94  ? 710  LYS C CE    1 
ATOM   7416  N  NZ    . LYS B 1  446 ? 139.925 164.859 146.750 1.00 76.94  ? 710  LYS C NZ    1 
ATOM   7417  N  N     . LEU B 1  447 ? 136.736 169.745 148.865 1.00 75.86  ? 711  LEU C N     1 
ATOM   7418  C  CA    . LEU B 1  447 ? 135.521 169.306 149.544 1.00 75.86  ? 711  LEU C CA    1 
ATOM   7419  C  C     . LEU B 1  447 ? 134.437 170.375 149.483 1.00 75.86  ? 711  LEU C C     1 
ATOM   7420  O  O     . LEU B 1  447 ? 133.248 170.054 149.380 1.00 75.86  ? 711  LEU C O     1 
ATOM   7421  C  CB    . LEU B 1  447 ? 135.830 168.935 150.993 1.00 75.86  ? 711  LEU C CB    1 
ATOM   7422  C  CG    . LEU B 1  447 ? 134.664 168.364 151.800 1.00 75.86  ? 711  LEU C CG    1 
ATOM   7423  C  CD1   . LEU B 1  447 ? 134.193 167.052 151.195 1.00 75.86  ? 711  LEU C CD1   1 
ATOM   7424  C  CD2   . LEU B 1  447 ? 135.055 168.178 153.256 1.00 75.86  ? 711  LEU C CD2   1 
ATOM   7425  N  N     . VAL B 1  448 ? 134.827 171.651 149.545 1.00 72.83  ? 712  VAL C N     1 
ATOM   7426  C  CA    . VAL B 1  448 ? 133.851 172.733 149.418 1.00 72.83  ? 712  VAL C CA    1 
ATOM   7427  C  C     . VAL B 1  448 ? 133.171 172.671 148.057 1.00 72.83  ? 712  VAL C C     1 
ATOM   7428  O  O     . VAL B 1  448 ? 131.943 172.764 147.948 1.00 72.83  ? 712  VAL C O     1 
ATOM   7429  C  CB    . VAL B 1  448 ? 134.525 174.097 149.648 1.00 72.83  ? 712  VAL C CB    1 
ATOM   7430  C  CG1   . VAL B 1  448 ? 133.546 175.222 149.364 1.00 72.83  ? 712  VAL C CG1   1 
ATOM   7431  C  CG2   . VAL B 1  448 ? 135.040 174.198 151.068 1.00 72.83  ? 712  VAL C CG2   1 
ATOM   7432  N  N     . ARG B 1  449 ? 133.967 172.479 147.015 1.00 75.63  ? 713  ARG C N     1 
ATOM   7433  C  CA    . ARG B 1  449 ? 133.428 172.395 145.670 1.00 75.63  ? 713  ARG C CA    1 
ATOM   7434  C  C     . ARG B 1  449 ? 132.547 171.163 145.501 1.00 75.63  ? 713  ARG C C     1 
ATOM   7435  O  O     . ARG B 1  449 ? 131.543 171.207 144.795 1.00 75.63  ? 713  ARG C O     1 
ATOM   7436  C  CB    . ARG B 1  449 ? 134.559 172.374 144.644 1.00 75.63  ? 713  ARG C CB    1 
ATOM   7437  C  CG    . ARG B 1  449 ? 135.151 173.741 144.354 1.00 75.63  ? 713  ARG C CG    1 
ATOM   7438  C  CD    . ARG B 1  449 ? 136.242 173.649 143.303 1.00 75.63  ? 713  ARG C CD    1 
ATOM   7439  N  NE    . ARG B 1  449 ? 135.981 174.534 142.174 1.00 75.63  ? 713  ARG C NE    1 
ATOM   7440  C  CZ    . ARG B 1  449 ? 136.006 175.859 142.249 1.00 75.63  ? 713  ARG C CZ    1 
ATOM   7441  N  NH1   . ARG B 1  449 ? 136.283 176.451 143.401 1.00 75.63  ? 713  ARG C NH1   1 
ATOM   7442  N  NH2   . ARG B 1  449 ? 135.756 176.591 141.174 1.00 75.63  ? 713  ARG C NH2   1 
ATOM   7443  N  N     . GLU B 1  450 ? 132.918 170.067 146.154 1.00 75.79  ? 714  GLU C N     1 
ATOM   7444  C  CA    . GLU B 1  450 ? 132.151 168.833 146.041 1.00 75.79  ? 714  GLU C CA    1 
ATOM   7445  C  C     . GLU B 1  450 ? 130.839 168.887 146.814 1.00 75.79  ? 714  GLU C C     1 
ATOM   7446  O  O     . GLU B 1  450 ? 129.866 168.246 146.404 1.00 75.79  ? 714  GLU C O     1 
ATOM   7447  C  CB    . GLU B 1  450 ? 132.991 167.649 146.524 1.00 75.79  ? 714  GLU C CB    1 
ATOM   7448  C  CG    . GLU B 1  450 ? 132.323 166.296 146.346 1.00 75.79  ? 714  GLU C CG    1 
ATOM   7449  C  CD    . GLU B 1  450 ? 133.209 165.145 146.776 1.00 75.79  ? 714  GLU C CD    1 
ATOM   7450  O  OE1   . GLU B 1  450 ? 134.341 165.403 147.237 1.00 75.79  ? 714  GLU C OE1   1 
ATOM   7451  O  OE2   . GLU B 1  450 ? 132.773 163.982 146.651 1.00 75.79  ? 714  GLU C OE2   1 
ATOM   7452  N  N     . VAL B 1  451 ? 130.785 169.640 147.907 1.00 73.76  ? 715  VAL C N     1 
ATOM   7453  C  CA    . VAL B 1  451 ? 129.610 169.683 148.772 1.00 73.76  ? 715  VAL C CA    1 
ATOM   7454  C  C     . VAL B 1  451 ? 128.684 170.837 148.411 1.00 73.76  ? 715  VAL C C     1 
ATOM   7455  O  O     . VAL B 1  451 ? 127.467 170.668 148.345 1.00 73.76  ? 715  VAL C O     1 
ATOM   7456  C  CB    . VAL B 1  451 ? 130.042 169.753 150.252 1.00 73.76  ? 715  VAL C CB    1 
ATOM   7457  C  CG1   . VAL B 1  451 ? 128.839 169.970 151.135 1.00 73.76  ? 715  VAL C CG1   1 
ATOM   7458  C  CG2   . VAL B 1  451 ? 130.761 168.476 150.650 1.00 73.76  ? 715  VAL C CG2   1 
ATOM   7459  N  N     . GLU B 1  452 ? 129.242 172.020 148.166 1.00 75.94  ? 716  GLU C N     1 
ATOM   7460  C  CA    . GLU B 1  452 ? 128.422 173.198 147.875 1.00 75.94  ? 716  GLU C CA    1 
ATOM   7461  C  C     . GLU B 1  452 ? 127.758 173.150 146.509 1.00 75.94  ? 716  GLU C C     1 
ATOM   7462  O  O     . GLU B 1  452 ? 127.162 174.159 146.113 1.00 75.94  ? 716  GLU C O     1 
ATOM   7463  C  CB    . GLU B 1  452 ? 129.266 174.468 147.990 1.00 75.94  ? 716  GLU C CB    1 
ATOM   7464  C  CG    . GLU B 1  452 ? 129.732 174.770 149.401 1.00 75.94  ? 716  GLU C CG    1 
ATOM   7465  C  CD    . GLU B 1  452 ? 128.585 175.118 150.329 1.00 75.94  ? 716  GLU C CD    1 
ATOM   7466  O  OE1   . GLU B 1  452 ? 127.590 175.704 149.854 1.00 75.94  ? 716  GLU C OE1   1 
ATOM   7467  O  OE2   . GLU B 1  452 ? 128.679 174.806 151.534 1.00 75.94  ? 716  GLU C OE2   1 
ATOM   7468  N  N     . GLY B 1  453 ? 127.832 172.043 145.775 1.00 75.18  ? 717  GLY C N     1 
ATOM   7469  C  CA    . GLY B 1  453 ? 127.202 171.958 144.474 1.00 75.18  ? 717  GLY C CA    1 
ATOM   7470  C  C     . GLY B 1  453 ? 127.882 172.820 143.433 1.00 75.18  ? 717  GLY C C     1 
ATOM   7471  O  O     . GLY B 1  453 ? 127.218 173.502 142.647 1.00 75.18  ? 717  GLY C O     1 
ATOM   7472  N  N     . LEU B 1  454 ? 129.208 172.796 143.418 1.00 75.64  ? 718  LEU C N     1 
ATOM   7473  C  CA    . LEU B 1  454 ? 130.006 173.549 142.465 1.00 75.64  ? 718  LEU C CA    1 
ATOM   7474  C  C     . LEU B 1  454 ? 130.765 172.587 141.558 1.00 75.64  ? 718  LEU C C     1 
ATOM   7475  O  O     . LEU B 1  454 ? 130.689 171.363 141.701 1.00 75.64  ? 718  LEU C O     1 
ATOM   7476  C  CB    . LEU B 1  454 ? 130.965 174.492 143.194 1.00 75.64  ? 718  LEU C CB    1 
ATOM   7477  C  CG    . LEU B 1  454 ? 130.317 175.618 144.000 1.00 75.64  ? 718  LEU C CG    1 
ATOM   7478  C  CD1   . LEU B 1  454 ? 131.368 176.399 144.771 1.00 75.64  ? 718  LEU C CD1   1 
ATOM   7479  C  CD2   . LEU B 1  454 ? 129.522 176.536 143.088 1.00 75.64  ? 718  LEU C CD2   1 
ATOM   7480  N  N     . GLU B 1  455 ? 131.504 173.157 140.612 1.00 79.46  ? 719  GLU C N     1 
ATOM   7481  C  CA    . GLU B 1  455 ? 132.312 172.373 139.695 1.00 79.46  ? 719  GLU C CA    1 
ATOM   7482  C  C     . GLU B 1  455 ? 133.690 172.123 140.305 1.00 79.46  ? 719  GLU C C     1 
ATOM   7483  O  O     . GLU B 1  455 ? 133.967 172.489 141.449 1.00 79.46  ? 719  GLU C O     1 
ATOM   7484  C  CB    . GLU B 1  455 ? 132.409 173.080 138.344 1.00 79.46  ? 719  GLU C CB    1 
ATOM   7485  C  CG    . GLU B 1  455 ? 131.079 173.162 137.609 1.00 79.46  ? 719  GLU C CG    1 
ATOM   7486  C  CD    . GLU B 1  455 ? 131.179 173.899 136.289 1.00 79.46  ? 719  GLU C CD    1 
ATOM   7487  O  OE1   . GLU B 1  455 ? 132.255 174.459 135.997 1.00 79.46  ? 719  GLU C OE1   1 
ATOM   7488  O  OE2   . GLU B 1  455 ? 130.177 173.921 135.544 1.00 79.46  ? 719  GLU C OE2   1 
ATOM   7489  N  N     . ALA B 1  456 ? 134.569 171.494 139.534 1.00 81.16  ? 720  ALA C N     1 
ATOM   7490  C  CA    . ALA B 1  456 ? 135.897 171.150 140.022 1.00 81.16  ? 720  ALA C CA    1 
ATOM   7491  C  C     . ALA B 1  456 ? 136.768 172.405 140.070 1.00 81.16  ? 720  ALA C C     1 
ATOM   7492  O  O     . ALA B 1  456 ? 136.319 173.524 139.804 1.00 81.16  ? 720  ALA C O     1 
ATOM   7493  C  CB    . ALA B 1  456 ? 136.513 170.059 139.152 1.00 81.16  ? 720  ALA C CB    1 
ATOM   7494  N  N     . SER B 1  457 ? 138.043 172.224 140.415 1.00 80.91  ? 721  SER C N     1 
ATOM   7495  C  CA    . SER B 1  457 ? 138.953 173.358 140.523 1.00 80.91  ? 721  SER C CA    1 
ATOM   7496  C  C     . SER B 1  457 ? 139.410 173.858 139.160 1.00 80.91  ? 721  SER C C     1 
ATOM   7497  O  O     . SER B 1  457 ? 139.668 175.056 139.000 1.00 80.91  ? 721  SER C O     1 
ATOM   7498  C  CB    . SER B 1  457 ? 140.164 172.981 141.376 1.00 80.91  ? 721  SER C CB    1 
ATOM   7499  O  OG    . SER B 1  457 ? 139.776 172.687 142.707 1.00 80.91  ? 721  SER C OG    1 
ATOM   7500  N  N     . GLY B 1  458 ? 139.516 172.969 138.174 1.00 84.66  ? 722  GLY C N     1 
ATOM   7501  C  CA    . GLY B 1  458 ? 139.929 173.360 136.841 1.00 84.66  ? 722  GLY C CA    1 
ATOM   7502  C  C     . GLY B 1  458 ? 138.879 174.078 136.025 1.00 84.66  ? 722  GLY C C     1 
ATOM   7503  O  O     . GLY B 1  458 ? 139.118 174.357 134.847 1.00 84.66  ? 722  GLY C O     1 
ATOM   7504  N  N     . SER B 1  459 ? 137.725 174.383 136.613 1.00 82.02  ? 723  SER C N     1 
ATOM   7505  C  CA    . SER B 1  459 ? 136.662 175.055 135.888 1.00 82.02  ? 723  SER C CA    1 
ATOM   7506  C  C     . SER B 1  459 ? 137.027 176.516 135.628 1.00 82.02  ? 723  SER C C     1 
ATOM   7507  O  O     . SER B 1  459 ? 138.047 177.028 136.095 1.00 82.02  ? 723  SER C O     1 
ATOM   7508  C  CB    . SER B 1  459 ? 135.351 174.969 136.667 1.00 82.02  ? 723  SER C CB    1 
ATOM   7509  O  OG    . SER B 1  459 ? 134.312 175.656 135.994 1.00 82.02  ? 723  SER C OG    1 
ATOM   7510  N  N     . VAL B 1  460 ? 136.167 177.190 134.864 1.00 74.84  ? 724  VAL C N     1 
ATOM   7511  C  CA    . VAL B 1  460 ? 136.370 178.605 134.577 1.00 74.84  ? 724  VAL C CA    1 
ATOM   7512  C  C     . VAL B 1  460 ? 135.929 179.497 135.734 1.00 74.84  ? 724  VAL C C     1 
ATOM   7513  O  O     . VAL B 1  460 ? 136.519 180.568 135.939 1.00 74.84  ? 724  VAL C O     1 
ATOM   7514  C  CB    . VAL B 1  460 ? 135.646 178.997 133.275 1.00 74.84  ? 724  VAL C CB    1 
ATOM   7515  C  CG1   . VAL B 1  460 ? 134.140 178.849 133.423 1.00 74.84  ? 724  VAL C CG1   1 
ATOM   7516  C  CG2   . VAL B 1  460 ? 136.017 180.412 132.853 1.00 74.84  ? 724  VAL C CG2   1 
ATOM   7517  N  N     . TYR B 1  461 ? 134.934 179.070 136.499 1.00 74.13  ? 725  TYR C N     1 
ATOM   7518  C  CA    . TYR B 1  461 ? 134.537 179.826 137.675 1.00 74.13  ? 725  TYR C CA    1 
ATOM   7519  C  C     . TYR B 1  461 ? 135.558 179.325 138.683 1.00 74.13  ? 725  TYR C C     1 
ATOM   7520  O  O     . TYR B 1  461 ? 135.564 178.146 139.026 1.00 74.13  ? 725  TYR C O     1 
ATOM   7521  C  CB    . TYR B 1  461 ? 133.107 179.491 138.065 1.00 74.13  ? 725  TYR C CB    1 
ATOM   7522  C  CG    . TYR B 1  461 ? 132.134 179.833 136.964 1.00 74.13  ? 725  TYR C CG    1 
ATOM   7523  C  CD1   . TYR B 1  461 ? 131.453 181.040 136.966 1.00 74.13  ? 725  TYR C CD1   1 
ATOM   7524  C  CD2   . TYR B 1  461 ? 131.923 178.965 135.906 1.00 74.13  ? 725  TYR C CD2   1 
ATOM   7525  C  CE1   . TYR B 1  461 ? 130.572 181.363 135.954 1.00 74.13  ? 725  TYR C CE1   1 
ATOM   7526  C  CE2   . TYR B 1  461 ? 131.045 179.280 134.889 1.00 74.13  ? 725  TYR C CE2   1 
ATOM   7527  C  CZ    . TYR B 1  461 ? 130.374 180.481 134.919 1.00 74.13  ? 725  TYR C CZ    1 
ATOM   7528  O  OH    . TYR B 1  461 ? 129.498 180.799 133.910 1.00 74.13  ? 725  TYR C OH    1 
ATOM   7529  N  N     . ILE B 1  462 ? 136.426 180.214 139.153 1.00 73.38  ? 726  ILE C N     1 
ATOM   7530  C  CA    . ILE B 1  462 ? 137.526 179.793 140.011 1.00 73.38  ? 726  ILE C CA    1 
ATOM   7531  C  C     . ILE B 1  462 ? 137.274 180.079 141.490 1.00 73.38  ? 726  ILE C C     1 
ATOM   7532  O  O     . ILE B 1  462 ? 137.824 179.386 142.352 1.00 73.38  ? 726  ILE C O     1 
ATOM   7533  C  CB    . ILE B 1  462 ? 138.833 180.453 139.542 1.00 73.38  ? 726  ILE C CB    1 
ATOM   7534  C  CG1   . ILE B 1  462 ? 138.743 181.973 139.662 1.00 73.38  ? 726  ILE C CG1   1 
ATOM   7535  C  CG2   . ILE B 1  462 ? 139.150 180.050 138.112 1.00 73.38  ? 726  ILE C CG2   1 
ATOM   7536  C  CD1   . ILE B 1  462 ? 140.065 182.669 139.459 1.00 73.38  ? 726  ILE C CD1   1 
ATOM   7537  N  N     . CYS B 1  463 ? 136.465 181.081 141.810 1.00 71.59  ? 727  CYS C N     1 
ATOM   7538  C  CA    . CYS B 1  463 ? 136.268 181.495 143.190 1.00 71.59  ? 727  CYS C CA    1 
ATOM   7539  C  C     . CYS B 1  463 ? 134.975 180.920 143.753 1.00 71.59  ? 727  CYS C C     1 
ATOM   7540  O  O     . CYS B 1  463 ? 133.976 180.775 143.044 1.00 71.59  ? 727  CYS C O     1 
ATOM   7541  C  CB    . CYS B 1  463 ? 136.248 183.020 143.303 1.00 71.59  ? 727  CYS C CB    1 
ATOM   7542  S  SG    . CYS B 1  463 ? 136.103 183.628 144.995 1.00 71.59  ? 727  CYS C SG    1 
ATOM   7543  N  N     . THR B 1  464 ? 135.009 180.590 145.044 1.00 70.28  ? 728  THR C N     1 
ATOM   7544  C  CA    . THR B 1  464 ? 133.839 180.117 145.771 1.00 70.28  ? 728  THR C CA    1 
ATOM   7545  C  C     . THR B 1  464 ? 133.208 181.214 146.620 1.00 70.28  ? 728  THR C C     1 
ATOM   7546  O  O     . THR B 1  464 ? 132.335 180.928 147.445 1.00 70.28  ? 728  THR C O     1 
ATOM   7547  C  CB    . THR B 1  464 ? 134.206 178.921 146.651 1.00 70.28  ? 728  THR C CB    1 
ATOM   7548  O  OG1   . THR B 1  464 ? 135.168 179.326 147.632 1.00 70.28  ? 728  THR C OG1   1 
ATOM   7549  C  CG2   . THR B 1  464 ? 134.793 177.802 145.807 1.00 70.28  ? 728  THR C CG2   1 
ATOM   7550  N  N     . LEU B 1  465 ? 133.637 182.458 146.436 1.00 72.47  ? 729  LEU C N     1 
ATOM   7551  C  CA    . LEU B 1  465 ? 133.105 183.603 147.163 1.00 72.47  ? 729  LEU C CA    1 
ATOM   7552  C  C     . LEU B 1  465 ? 132.420 184.610 146.255 1.00 72.47  ? 729  LEU C C     1 
ATOM   7553  O  O     . LEU B 1  465 ? 131.394 185.179 146.635 1.00 72.47  ? 729  LEU C O     1 
ATOM   7554  C  CB    . LEU B 1  465 ? 134.226 184.306 147.946 1.00 72.47  ? 729  LEU C CB    1 
ATOM   7555  C  CG    . LEU B 1  465 ? 134.721 183.677 149.252 1.00 72.47  ? 729  LEU C CG    1 
ATOM   7556  C  CD1   . LEU B 1  465 ? 135.554 182.430 148.995 1.00 72.47  ? 729  LEU C CD1   1 
ATOM   7557  C  CD2   . LEU B 1  465 ? 135.518 184.689 150.057 1.00 72.47  ? 729  LEU C CD2   1 
ATOM   7558  N  N     . CYS B 1  466 ? 132.963 184.846 145.065 1.00 74.40  ? 730  CYS C N     1 
ATOM   7559  C  CA    . CYS B 1  466 ? 132.379 185.737 144.076 1.00 74.40  ? 730  CYS C CA    1 
ATOM   7560  C  C     . CYS B 1  466 ? 132.077 184.960 142.800 1.00 74.40  ? 730  CYS C C     1 
ATOM   7561  O  O     . CYS B 1  466 ? 132.343 183.760 142.697 1.00 74.40  ? 730  CYS C O     1 
ATOM   7562  C  CB    . CYS B 1  466 ? 133.310 186.920 143.785 1.00 74.40  ? 730  CYS C CB    1 
ATOM   7563  S  SG    . CYS B 1  466 ? 134.914 186.452 143.109 1.00 74.40  ? 730  CYS C SG    1 
ATOM   7564  N  N     . ASP B 1  467 ? 131.512 185.662 141.818 1.00 76.41  ? 731  ASP C N     1 
ATOM   7565  C  CA    . ASP B 1  467 ? 131.042 185.043 140.586 1.00 76.41  ? 731  ASP C CA    1 
ATOM   7566  C  C     . ASP B 1  467 ? 131.936 185.347 139.389 1.00 76.41  ? 731  ASP C C     1 
ATOM   7567  O  O     . ASP B 1  467 ? 131.503 185.176 138.245 1.00 76.41  ? 731  ASP C O     1 
ATOM   7568  C  CB    . ASP B 1  467 ? 129.608 185.485 140.291 1.00 76.41  ? 731  ASP C CB    1 
ATOM   7569  C  CG    . ASP B 1  467 ? 128.611 184.919 141.278 1.00 76.41  ? 731  ASP C CG    1 
ATOM   7570  O  OD1   . ASP B 1  467 ? 128.864 183.821 141.814 1.00 76.41  ? 731  ASP C OD1   1 
ATOM   7571  O  OD2   . ASP B 1  467 ? 127.574 185.571 141.519 1.00 76.41  ? 731  ASP C OD2   1 
ATOM   7572  N  N     . THR B 1  468 ? 133.167 185.791 139.621 1.00 75.34  ? 732  THR C N     1 
ATOM   7573  C  CA    . THR B 1  468 ? 134.058 186.094 138.512 1.00 75.34  ? 732  THR C CA    1 
ATOM   7574  C  C     . THR B 1  468 ? 134.601 184.809 137.895 1.00 75.34  ? 732  THR C C     1 
ATOM   7575  O  O     . THR B 1  468 ? 134.591 183.742 138.515 1.00 75.34  ? 732  THR C O     1 
ATOM   7576  C  CB    . THR B 1  468 ? 135.216 186.980 138.973 1.00 75.34  ? 732  THR C CB    1 
ATOM   7577  O  OG1   . THR B 1  468 ? 135.927 187.468 137.829 1.00 75.34  ? 732  THR C OG1   1 
ATOM   7578  C  CG2   . THR B 1  468 ? 136.176 186.188 139.843 1.00 75.34  ? 732  THR C CG2   1 
ATOM   7579  N  N     . THR B 1  469 ? 135.068 184.918 136.657 1.00 75.40  ? 733  THR C N     1 
ATOM   7580  C  CA    . THR B 1  469 ? 135.666 183.795 135.953 1.00 75.40  ? 733  THR C CA    1 
ATOM   7581  C  C     . THR B 1  469 ? 137.181 183.954 135.901 1.00 75.40  ? 733  THR C C     1 
ATOM   7582  O  O     . THR B 1  469 ? 137.737 184.970 136.323 1.00 75.40  ? 733  THR C O     1 
ATOM   7583  C  CB    . THR B 1  469 ? 135.105 183.669 134.535 1.00 75.40  ? 733  THR C CB    1 
ATOM   7584  O  OG1   . THR B 1  469 ? 135.454 184.831 133.776 1.00 75.40  ? 733  THR C OG1   1 
ATOM   7585  C  CG2   . THR B 1  469 ? 133.592 183.537 134.573 1.00 75.40  ? 733  THR C CG2   1 
ATOM   7586  N  N     . ARG B 1  470 ? 137.847 182.923 135.401 1.00 76.49  ? 734  ARG C N     1 
ATOM   7587  C  CA    . ARG B 1  470 ? 139.299 182.916 135.319 1.00 76.49  ? 734  ARG C CA    1 
ATOM   7588  C  C     . ARG B 1  470 ? 139.871 184.034 134.459 1.00 76.49  ? 734  ARG C C     1 
ATOM   7589  O  O     . ARG B 1  470 ? 140.988 184.485 134.693 1.00 76.49  ? 734  ARG C O     1 
ATOM   7590  C  CB    . ARG B 1  470 ? 139.790 181.569 134.799 1.00 76.49  ? 734  ARG C CB    1 
ATOM   7591  C  CG    . ARG B 1  470 ? 141.238 181.576 134.349 1.00 76.49  ? 734  ARG C CG    1 
ATOM   7592  C  CD    . ARG B 1  470 ? 141.974 180.369 134.898 1.00 76.49  ? 734  ARG C CD    1 
ATOM   7593  N  NE    . ARG B 1  470 ? 141.508 180.023 136.235 1.00 76.49  ? 734  ARG C NE    1 
ATOM   7594  C  CZ    . ARG B 1  470 ? 141.312 178.781 136.657 1.00 76.49  ? 734  ARG C CZ    1 
ATOM   7595  N  NH1   . ARG B 1  470 ? 141.542 177.760 135.844 1.00 76.49  ? 734  ARG C NH1   1 
ATOM   7596  N  NH2   . ARG B 1  470 ? 140.887 178.558 137.892 1.00 76.49  ? 734  ARG C NH2   1 
ATOM   7597  N  N     . LEU B 1  471 ? 139.112 184.484 133.468 1.00 79.25  ? 735  LEU C N     1 
ATOM   7598  C  CA    . LEU B 1  471 ? 139.604 185.535 132.585 1.00 79.25  ? 735  LEU C CA    1 
ATOM   7599  C  C     . LEU B 1  471 ? 139.587 186.893 133.278 1.00 79.25  ? 735  LEU C C     1 
ATOM   7600  O  O     . LEU B 1  471 ? 140.620 187.566 133.363 1.00 79.25  ? 735  LEU C O     1 
ATOM   7601  C  CB    . LEU B 1  471 ? 138.774 185.564 131.298 1.00 79.25  ? 735  LEU C CB    1 
ATOM   7602  C  CG    . LEU B 1  471 ? 139.252 186.431 130.128 1.00 79.25  ? 735  LEU C CG    1 
ATOM   7603  C  CD1   . LEU B 1  471 ? 138.830 185.806 128.809 1.00 79.25  ? 735  LEU C CD1   1 
ATOM   7604  C  CD2   . LEU B 1  471 ? 138.711 187.851 130.223 1.00 79.25  ? 735  LEU C CD2   1 
ATOM   7605  N  N     . GLU B 1  472 ? 138.424 187.270 133.794 1.00 82.83  ? 736  GLU C N     1 
ATOM   7606  C  CA    . GLU B 1  472 ? 138.263 188.541 134.483 1.00 82.83  ? 736  GLU C CA    1 
ATOM   7607  C  C     . GLU B 1  472 ? 139.093 188.612 135.761 1.00 82.83  ? 736  GLU C C     1 
ATOM   7608  O  O     . GLU B 1  472 ? 139.489 189.695 136.189 1.00 82.83  ? 736  GLU C O     1 
ATOM   7609  C  CB    . GLU B 1  472 ? 136.789 188.784 134.805 1.00 82.83  ? 736  GLU C CB    1 
ATOM   7610  C  CG    . GLU B 1  472 ? 136.396 190.249 134.842 1.00 82.83  ? 736  GLU C CG    1 
ATOM   7611  C  CD    . GLU B 1  472 ? 134.932 190.445 135.181 1.00 82.83  ? 736  GLU C CD    1 
ATOM   7612  O  OE1   . GLU B 1  472 ? 134.424 189.719 136.062 1.00 82.83  ? 736  GLU C OE1   1 
ATOM   7613  O  OE2   . GLU B 1  472 ? 134.289 191.322 134.567 1.00 82.83  ? 736  GLU C OE2   1 
ATOM   7614  N  N     . ALA B 1  473 ? 139.350 187.463 136.375 1.00 80.78  ? 737  ALA C N     1 
ATOM   7615  C  CA    . ALA B 1  473 ? 140.138 187.429 137.602 1.00 80.78  ? 737  ALA C CA    1 
ATOM   7616  C  C     . ALA B 1  473 ? 141.600 187.752 137.329 1.00 80.78  ? 737  ALA C C     1 
ATOM   7617  O  O     . ALA B 1  473 ? 142.324 188.183 138.233 1.00 80.78  ? 737  ALA C O     1 
ATOM   7618  C  CB    . ALA B 1  473 ? 140.009 186.066 138.276 1.00 80.78  ? 737  ALA C CB    1 
ATOM   7619  N  N     . SER B 1  474 ? 142.056 187.535 136.095 1.00 82.18  ? 738  SER C N     1 
ATOM   7620  C  CA    . SER B 1  474 ? 143.420 187.848 135.694 1.00 82.18  ? 738  SER C CA    1 
ATOM   7621  C  C     . SER B 1  474 ? 143.543 189.226 135.053 1.00 82.18  ? 738  SER C C     1 
ATOM   7622  O  O     . SER B 1  474 ? 144.519 189.484 134.340 1.00 82.18  ? 738  SER C O     1 
ATOM   7623  C  CB    . SER B 1  474 ? 143.947 186.777 134.737 1.00 82.18  ? 738  SER C CB    1 
ATOM   7624  O  OG    . SER B 1  474 ? 143.235 186.795 133.513 1.00 82.18  ? 738  SER C OG    1 
ATOM   7625  N  N     . GLN B 1  475 ? 142.578 190.115 135.290 1.00 82.29  ? 739  GLN C N     1 
ATOM   7626  C  CA    . GLN B 1  475 ? 142.612 191.462 134.733 1.00 82.29  ? 739  GLN C CA    1 
ATOM   7627  C  C     . GLN B 1  475 ? 142.318 192.561 135.742 1.00 82.29  ? 739  GLN C C     1 
ATOM   7628  O  O     . GLN B 1  475 ? 142.680 193.715 135.483 1.00 82.29  ? 739  GLN C O     1 
ATOM   7629  C  CB    . GLN B 1  475 ? 141.618 191.587 133.568 1.00 82.29  ? 739  GLN C CB    1 
ATOM   7630  C  CG    . GLN B 1  475 ? 141.984 190.753 132.352 1.00 82.29  ? 739  GLN C CG    1 
ATOM   7631  C  CD    . GLN B 1  475 ? 140.969 190.876 131.234 1.00 82.29  ? 739  GLN C CD    1 
ATOM   7632  O  OE1   . GLN B 1  475 ? 139.944 191.540 131.382 1.00 82.29  ? 739  GLN C OE1   1 
ATOM   7633  N  NE2   . GLN B 1  475 ? 141.249 190.233 130.107 1.00 82.29  ? 739  GLN C NE2   1 
ATOM   7634  N  N     . ASN B 1  476 ? 141.682 192.255 136.871 1.00 82.03  ? 740  ASN C N     1 
ATOM   7635  C  CA    . ASN B 1  476 ? 141.350 193.240 137.892 1.00 82.03  ? 740  ASN C CA    1 
ATOM   7636  C  C     . ASN B 1  476 ? 142.109 193.006 139.190 1.00 82.03  ? 740  ASN C C     1 
ATOM   7637  O  O     . ASN B 1  476 ? 142.789 193.912 139.684 1.00 82.03  ? 740  ASN C O     1 
ATOM   7638  C  CB    . ASN B 1  476 ? 139.836 193.211 138.149 1.00 82.03  ? 740  ASN C CB    1 
ATOM   7639  C  CG    . ASN B 1  476 ? 139.356 194.385 138.974 1.00 82.03  ? 740  ASN C CG    1 
ATOM   7640  O  OD1   . ASN B 1  476 ? 140.143 195.229 139.402 1.00 82.03  ? 740  ASN C OD1   1 
ATOM   7641  N  ND2   . ASN B 1  476 ? 138.049 194.451 139.193 1.00 82.03  ? 740  ASN C ND2   1 
ATOM   7642  N  N     . LEU B 1  477 ? 141.972 191.812 139.768 1.00 80.28  ? 741  LEU C N     1 
ATOM   7643  C  CA    . LEU B 1  477 ? 142.819 191.279 140.832 1.00 80.28  ? 741  LEU C CA    1 
ATOM   7644  C  C     . LEU B 1  477 ? 142.598 191.919 142.199 1.00 80.28  ? 741  LEU C C     1 
ATOM   7645  O  O     . LEU B 1  477 ? 143.088 191.395 143.204 1.00 80.28  ? 741  LEU C O     1 
ATOM   7646  C  CB    . LEU B 1  477 ? 144.302 191.429 140.465 1.00 80.28  ? 741  LEU C CB    1 
ATOM   7647  C  CG    . LEU B 1  477 ? 145.002 190.433 139.536 1.00 80.28  ? 741  LEU C CG    1 
ATOM   7648  C  CD1   . LEU B 1  477 ? 144.915 189.022 140.095 1.00 80.28  ? 741  LEU C CD1   1 
ATOM   7649  C  CD2   . LEU B 1  477 ? 144.470 190.511 138.113 1.00 80.28  ? 741  LEU C CD2   1 
ATOM   7650  N  N     . VAL B 1  478 ? 141.867 193.031 142.274 1.00 82.30  ? 742  VAL C N     1 
ATOM   7651  C  CA    . VAL B 1  478 ? 141.743 193.722 143.555 1.00 82.30  ? 742  VAL C CA    1 
ATOM   7652  C  C     . VAL B 1  478 ? 140.319 194.172 143.859 1.00 82.30  ? 742  VAL C C     1 
ATOM   7653  O  O     . VAL B 1  478 ? 140.002 194.501 145.007 1.00 82.30  ? 742  VAL C O     1 
ATOM   7654  C  CB    . VAL B 1  478 ? 142.709 194.922 143.624 1.00 82.30  ? 742  VAL C CB    1 
ATOM   7655  C  CG1   . VAL B 1  478 ? 144.152 194.448 143.725 1.00 82.30  ? 742  VAL C CG1   1 
ATOM   7656  C  CG2   . VAL B 1  478 ? 142.534 195.806 142.403 1.00 82.30  ? 742  VAL C CG2   1 
ATOM   7657  N  N     . PHE B 1  479 ? 139.448 194.196 142.852 1.00 80.90  ? 743  PHE C N     1 
ATOM   7658  C  CA    . PHE B 1  479 ? 138.086 194.701 143.034 1.00 80.90  ? 743  PHE C CA    1 
ATOM   7659  C  C     . PHE B 1  479 ? 137.099 193.554 142.847 1.00 80.90  ? 743  PHE C C     1 
ATOM   7660  O  O     . PHE B 1  479 ? 136.681 193.241 141.731 1.00 80.90  ? 743  PHE C O     1 
ATOM   7661  C  CB    . PHE B 1  479 ? 137.788 195.854 142.081 1.00 80.90  ? 743  PHE C CB    1 
ATOM   7662  C  CG    . PHE B 1  479 ? 138.577 197.099 142.367 1.00 80.90  ? 743  PHE C CG    1 
ATOM   7663  C  CD1   . PHE B 1  479 ? 138.249 197.912 143.439 1.00 80.90  ? 743  PHE C CD1   1 
ATOM   7664  C  CD2   . PHE B 1  479 ? 139.623 197.476 141.545 1.00 80.90  ? 743  PHE C CD2   1 
ATOM   7665  C  CE1   . PHE B 1  479 ? 138.969 199.062 143.701 1.00 80.90  ? 743  PHE C CE1   1 
ATOM   7666  C  CE2   . PHE B 1  479 ? 140.345 198.626 141.800 1.00 80.90  ? 743  PHE C CE2   1 
ATOM   7667  C  CZ    . PHE B 1  479 ? 140.017 199.420 142.878 1.00 80.90  ? 743  PHE C CZ    1 
ATOM   7668  N  N     . HIS B 1  480 ? 136.720 192.929 143.960 1.00 78.98  ? 744  HIS C N     1 
ATOM   7669  C  CA    . HIS B 1  480 ? 135.699 191.892 143.976 1.00 78.98  ? 744  HIS C CA    1 
ATOM   7670  C  C     . HIS B 1  480 ? 134.965 191.952 145.309 1.00 78.98  ? 744  HIS C C     1 
ATOM   7671  O  O     . HIS B 1  480 ? 135.391 192.630 146.247 1.00 78.98  ? 744  HIS C O     1 
ATOM   7672  C  CB    . HIS B 1  480 ? 136.303 190.502 143.739 1.00 78.98  ? 744  HIS C CB    1 
ATOM   7673  C  CG    . HIS B 1  480 ? 136.871 190.321 142.366 1.00 78.98  ? 744  HIS C CG    1 
ATOM   7674  N  ND1   . HIS B 1  480 ? 138.170 190.653 142.049 1.00 78.98  ? 744  HIS C ND1   1 
ATOM   7675  C  CD2   . HIS B 1  480 ? 136.313 189.854 141.225 1.00 78.98  ? 744  HIS C CD2   1 
ATOM   7676  C  CE1   . HIS B 1  480 ? 138.390 190.395 140.772 1.00 78.98  ? 744  HIS C CE1   1 
ATOM   7677  N  NE2   . HIS B 1  480 ? 137.279 189.908 140.249 1.00 78.98  ? 744  HIS C NE2   1 
ATOM   7678  N  N     . SER B 1  481 ? 133.848 191.232 145.387 1.00 76.50  ? 745  SER C N     1 
ATOM   7679  C  CA    . SER B 1  481 ? 133.019 191.242 146.583 1.00 76.50  ? 745  SER C CA    1 
ATOM   7680  C  C     . SER B 1  481 ? 132.432 189.856 146.798 1.00 76.50  ? 745  SER C C     1 
ATOM   7681  O  O     . SER B 1  481 ? 132.104 189.157 145.835 1.00 76.50  ? 745  SER C O     1 
ATOM   7682  C  CB    . SER B 1  481 ? 131.897 192.281 146.477 1.00 76.50  ? 745  SER C CB    1 
ATOM   7683  O  OG    . SER B 1  481 ? 130.982 191.936 145.453 1.00 76.50  ? 745  SER C OG    1 
ATOM   7684  N  N     . ILE B 1  482 ? 132.303 189.467 148.068 1.00 72.72  ? 746  ILE C N     1 
ATOM   7685  C  CA    . ILE B 1  482 ? 131.759 188.155 148.396 1.00 72.72  ? 746  ILE C CA    1 
ATOM   7686  C  C     . ILE B 1  482 ? 130.277 188.118 148.058 1.00 72.72  ? 746  ILE C C     1 
ATOM   7687  O  O     . ILE B 1  482 ? 129.499 188.976 148.494 1.00 72.72  ? 746  ILE C O     1 
ATOM   7688  C  CB    . ILE B 1  482 ? 132.003 187.832 149.877 1.00 72.72  ? 746  ILE C CB    1 
ATOM   7689  C  CG1   . ILE B 1  482 ? 133.503 187.750 150.164 1.00 72.72  ? 746  ILE C CG1   1 
ATOM   7690  C  CG2   . ILE B 1  482 ? 131.311 186.536 150.261 1.00 72.72  ? 746  ILE C CG2   1 
ATOM   7691  C  CD1   . ILE B 1  482 ? 133.838 187.678 151.636 1.00 72.72  ? 746  ILE C CD1   1 
ATOM   7692  N  N     . THR B 1  483 ? 129.880 187.123 147.278 1.00 73.07  ? 747  THR C N     1 
ATOM   7693  C  CA    . THR B 1  483 ? 128.490 186.974 146.863 1.00 73.07  ? 747  THR C CA    1 
ATOM   7694  C  C     . THR B 1  483 ? 127.923 185.593 147.159 1.00 73.07  ? 747  THR C C     1 
ATOM   7695  O  O     . THR B 1  483 ? 126.754 185.486 147.538 1.00 73.07  ? 747  THR C O     1 
ATOM   7696  C  CB    . THR B 1  483 ? 128.363 187.282 145.359 1.00 73.07  ? 747  THR C CB    1 
ATOM   7697  O  OG1   . THR B 1  483 ? 128.821 188.615 145.104 1.00 73.07  ? 747  THR C OG1   1 
ATOM   7698  C  CG2   . THR B 1  483 ? 126.919 187.156 144.899 1.00 73.07  ? 747  THR C CG2   1 
ATOM   7699  N  N     . ARG B 1  484 ? 128.727 184.539 147.018 1.00 72.50  ? 748  ARG C N     1 
ATOM   7700  C  CA    . ARG B 1  484 ? 128.228 183.177 147.156 1.00 72.50  ? 748  ARG C CA    1 
ATOM   7701  C  C     . ARG B 1  484 ? 127.672 182.933 148.554 1.00 72.50  ? 748  ARG C C     1 
ATOM   7702  O  O     . ARG B 1  484 ? 128.156 183.485 149.546 1.00 72.50  ? 748  ARG C O     1 
ATOM   7703  C  CB    . ARG B 1  484 ? 129.342 182.172 146.858 1.00 72.50  ? 748  ARG C CB    1 
ATOM   7704  C  CG    . ARG B 1  484 ? 129.907 182.266 145.452 1.00 72.50  ? 748  ARG C CG    1 
ATOM   7705  C  CD    . ARG B 1  484 ? 128.901 181.794 144.420 1.00 72.50  ? 748  ARG C CD    1 
ATOM   7706  N  NE    . ARG B 1  484 ? 129.428 181.890 143.062 1.00 72.50  ? 748  ARG C NE    1 
ATOM   7707  C  CZ    . ARG B 1  484 ? 130.103 180.921 142.453 1.00 72.50  ? 748  ARG C CZ    1 
ATOM   7708  N  NH1   . ARG B 1  484 ? 130.338 179.778 143.081 1.00 72.50  ? 748  ARG C NH1   1 
ATOM   7709  N  NH2   . ARG B 1  484 ? 130.545 181.095 141.215 1.00 72.50  ? 748  ARG C NH2   1 
ATOM   7710  N  N     . SER B 1  485 ? 126.642 182.093 148.623 1.00 71.54  ? 749  SER C N     1 
ATOM   7711  C  CA    . SER B 1  485 ? 126.023 181.712 149.885 1.00 71.54  ? 749  SER C CA    1 
ATOM   7712  C  C     . SER B 1  485 ? 125.246 180.422 149.664 1.00 71.54  ? 749  SER C C     1 
ATOM   7713  O  O     . SER B 1  485 ? 125.109 179.942 148.537 1.00 71.54  ? 749  SER C O     1 
ATOM   7714  C  CB    . SER B 1  485 ? 125.115 182.822 150.425 1.00 71.54  ? 749  SER C CB    1 
ATOM   7715  O  OG    . SER B 1  485 ? 123.997 183.023 149.580 1.00 71.54  ? 749  SER C OG    1 
ATOM   7716  N  N     . HIS B 1  486 ? 124.769 179.844 150.759 1.00 70.87  ? 750  HIS C N     1 
ATOM   7717  C  CA    . HIS B 1  486 ? 124.034 178.592 150.698 1.00 70.87  ? 750  HIS C CA    1 
ATOM   7718  C  C     . HIS B 1  486 ? 122.685 178.738 150.016 1.00 70.87  ? 750  HIS C C     1 
ATOM   7719  O  O     . HIS B 1  486 ? 122.394 178.041 149.047 1.00 70.87  ? 750  HIS C O     1 
ATOM   7720  C  CB    . HIS B 1  486 ? 123.848 178.008 152.097 1.00 70.87  ? 750  HIS C CB    1 
ATOM   7721  C  CG    . HIS B 1  486 ? 123.667 176.523 152.109 1.00 70.87  ? 750  HIS C CG    1 
ATOM   7722  N  ND1   . HIS B 1  486 ? 124.598 175.656 151.583 1.00 70.87  ? 750  HIS C ND1   1 
ATOM   7723  C  CD2   . HIS B 1  486 ? 122.660 175.751 152.582 1.00 70.87  ? 750  HIS C CD2   1 
ATOM   7724  C  CE1   . HIS B 1  486 ? 124.175 174.414 151.732 1.00 70.87  ? 750  HIS C CE1   1 
ATOM   7725  N  NE2   . HIS B 1  486 ? 123.000 174.444 152.335 1.00 70.87  ? 750  HIS C NE2   1 
ATOM   7726  N  N     . ALA B 1  487 ? 121.862 179.651 150.513 1.00 68.82  ? 751  ALA C N     1 
ATOM   7727  C  CA    . ALA B 1  487 ? 120.534 179.835 149.936 1.00 68.82  ? 751  ALA C CA    1 
ATOM   7728  C  C     . ALA B 1  487 ? 120.623 180.230 148.469 1.00 68.82  ? 751  ALA C C     1 
ATOM   7729  O  O     . ALA B 1  487 ? 119.800 179.801 147.649 1.00 68.82  ? 751  ALA C O     1 
ATOM   7730  C  CB    . ALA B 1  487 ? 119.756 180.884 150.730 1.00 68.82  ? 751  ALA C CB    1 
ATOM   7731  N  N     . GLU B 1  488 ? 121.620 181.044 148.116 1.00 71.73  ? 752  GLU C N     1 
ATOM   7732  C  CA    . GLU B 1  488 ? 121.806 181.402 146.715 1.00 71.73  ? 752  GLU C CA    1 
ATOM   7733  C  C     . GLU B 1  488 ? 122.179 180.183 145.884 1.00 71.73  ? 752  GLU C C     1 
ATOM   7734  O  O     . GLU B 1  488 ? 121.715 180.035 144.750 1.00 71.73  ? 752  GLU C O     1 
ATOM   7735  C  CB    . GLU B 1  488 ? 122.870 182.491 146.582 1.00 71.73  ? 752  GLU C CB    1 
ATOM   7736  C  CG    . GLU B 1  488 ? 123.065 182.977 145.156 1.00 71.73  ? 752  GLU C CG    1 
ATOM   7737  C  CD    . GLU B 1  488 ? 124.073 184.101 145.057 1.00 71.73  ? 752  GLU C CD    1 
ATOM   7738  O  OE1   . GLU B 1  488 ? 124.625 184.496 146.104 1.00 71.73  ? 752  GLU C OE1   1 
ATOM   7739  O  OE2   . GLU B 1  488 ? 124.316 184.587 143.933 1.00 71.73  ? 752  GLU C OE2   1 
ATOM   7740  N  N     . ASN B 1  489 ? 123.009 179.293 146.433 1.00 68.29  ? 753  ASN C N     1 
ATOM   7741  C  CA    . ASN B 1  489 ? 123.347 178.069 145.713 1.00 68.29  ? 753  ASN C CA    1 
ATOM   7742  C  C     . ASN B 1  489 ? 122.118 177.190 145.518 1.00 68.29  ? 753  ASN C C     1 
ATOM   7743  O  O     . ASN B 1  489 ? 121.939 176.585 144.453 1.00 68.29  ? 753  ASN C O     1 
ATOM   7744  C  CB    . ASN B 1  489 ? 124.442 177.304 146.455 1.00 68.29  ? 753  ASN C CB    1 
ATOM   7745  C  CG    . ASN B 1  489 ? 125.792 177.987 146.366 1.00 68.29  ? 753  ASN C CG    1 
ATOM   7746  O  OD1   . ASN B 1  489 ? 126.176 178.492 145.312 1.00 68.29  ? 753  ASN C OD1   1 
ATOM   7747  N  ND2   . ASN B 1  489 ? 126.520 178.005 147.475 1.00 68.29  ? 753  ASN C ND2   1 
ATOM   7748  N  N     . LEU B 1  490 ? 121.255 177.113 146.534 1.00 66.35  ? 754  LEU C N     1 
ATOM   7749  C  CA    . LEU B 1  490 ? 120.021 176.345 146.398 1.00 66.35  ? 754  LEU C CA    1 
ATOM   7750  C  C     . LEU B 1  490 ? 119.130 176.930 145.308 1.00 66.35  ? 754  LEU C C     1 
ATOM   7751  O  O     . LEU B 1  490 ? 118.594 176.199 144.465 1.00 66.35  ? 754  LEU C O     1 
ATOM   7752  C  CB    . LEU B 1  490 ? 119.282 176.300 147.735 1.00 66.35  ? 754  LEU C CB    1 
ATOM   7753  C  CG    . LEU B 1  490 ? 119.970 175.533 148.865 1.00 66.35  ? 754  LEU C CG    1 
ATOM   7754  C  CD1   . LEU B 1  490 ? 119.200 175.688 150.165 1.00 66.35  ? 754  LEU C CD1   1 
ATOM   7755  C  CD2   . LEU B 1  490 ? 120.119 174.066 148.500 1.00 66.35  ? 754  LEU C CD2   1 
ATOM   7756  N  N     . GLN B 1  491 ? 118.965 178.255 145.308 1.00 67.07  ? 755  GLN C N     1 
ATOM   7757  C  CA    . GLN B 1  491 ? 118.154 178.900 144.280 1.00 67.07  ? 755  GLN C CA    1 
ATOM   7758  C  C     . GLN B 1  491 ? 118.744 178.684 142.892 1.00 67.07  ? 755  GLN C C     1 
ATOM   7759  O  O     . GLN B 1  491 ? 118.009 178.459 141.921 1.00 67.07  ? 755  GLN C O     1 
ATOM   7760  C  CB    . GLN B 1  491 ? 118.022 180.392 144.577 1.00 67.07  ? 755  GLN C CB    1 
ATOM   7761  C  CG    . GLN B 1  491 ? 117.230 180.706 145.831 1.00 67.07  ? 755  GLN C CG    1 
ATOM   7762  C  CD    . GLN B 1  491 ? 117.152 182.193 146.106 1.00 67.07  ? 755  GLN C CD    1 
ATOM   7763  O  OE1   . GLN B 1  491 ? 117.746 182.999 145.392 1.00 67.07  ? 755  GLN C OE1   1 
ATOM   7764  N  NE2   . GLN B 1  491 ? 116.416 182.565 147.148 1.00 67.07  ? 755  GLN C NE2   1 
ATOM   7765  N  N     . ARG B 1  492 ? 120.066 178.737 142.805 1.00 67.12  ? 756  ARG C N     1 
ATOM   7766  C  CA    . ARG B 1  492 ? 120.737 178.532 141.536 1.00 67.12  ? 756  ARG C CA    1 
ATOM   7767  C  C     . ARG B 1  492 ? 120.448 177.131 141.028 1.00 67.12  ? 756  ARG C C     1 
ATOM   7768  O  O     . ARG B 1  492 ? 120.056 176.955 139.878 1.00 67.12  ? 756  ARG C O     1 
ATOM   7769  C  CB    . ARG B 1  492 ? 122.240 178.748 141.680 1.00 67.12  ? 756  ARG C CB    1 
ATOM   7770  C  CG    . ARG B 1  492 ? 122.612 180.129 142.190 1.00 67.12  ? 756  ARG C CG    1 
ATOM   7771  C  CD    . ARG B 1  492 ? 123.176 180.992 141.076 1.00 67.12  ? 756  ARG C CD    1 
ATOM   7772  N  NE    . ARG B 1  492 ? 124.413 181.654 141.476 1.00 67.12  ? 756  ARG C NE    1 
ATOM   7773  C  CZ    . ARG B 1  492 ? 124.599 182.969 141.446 1.00 67.12  ? 756  ARG C CZ    1 
ATOM   7774  N  NH1   . ARG B 1  492 ? 125.758 183.484 141.829 1.00 67.12  ? 756  ARG C NH1   1 
ATOM   7775  N  NH2   . ARG B 1  492 ? 123.627 183.769 141.033 1.00 67.12  ? 756  ARG C NH2   1 
ATOM   7776  N  N     . TYR B 1  493 ? 120.625 176.130 141.884 1.00 64.14  ? 757  TYR C N     1 
ATOM   7777  C  CA    . TYR B 1  493 ? 120.372 174.755 141.466 1.00 64.14  ? 757  TYR C CA    1 
ATOM   7778  C  C     . TYR B 1  493 ? 118.916 174.560 141.066 1.00 64.14  ? 757  TYR C C     1 
ATOM   7779  O  O     . TYR B 1  493 ? 118.617 173.794 140.141 1.00 64.14  ? 757  TYR C O     1 
ATOM   7780  C  CB    . TYR B 1  493 ? 120.748 173.766 142.565 1.00 64.14  ? 757  TYR C CB    1 
ATOM   7781  C  CG    . TYR B 1  493 ? 120.442 172.343 142.161 1.00 64.14  ? 757  TYR C CG    1 
ATOM   7782  C  CD1   . TYR B 1  493 ? 121.237 171.680 141.237 1.00 64.14  ? 757  TYR C CD1   1 
ATOM   7783  C  CD2   . TYR B 1  493 ? 119.342 171.672 142.680 1.00 64.14  ? 757  TYR C CD2   1 
ATOM   7784  C  CE1   . TYR B 1  493 ? 120.955 170.385 140.853 1.00 64.14  ? 757  TYR C CE1   1 
ATOM   7785  C  CE2   . TYR B 1  493 ? 119.053 170.377 142.303 1.00 64.14  ? 757  TYR C CE2   1 
ATOM   7786  C  CZ    . TYR B 1  493 ? 119.862 169.739 141.390 1.00 64.14  ? 757  TYR C CZ    1 
ATOM   7787  O  OH    . TYR B 1  493 ? 119.574 168.448 141.013 1.00 64.14  ? 757  TYR C OH    1 
ATOM   7788  N  N     . GLU B 1  494 ? 118.016 175.277 141.724 1.00 66.03  ? 758  GLU C N     1 
ATOM   7789  C  CA    . GLU B 1  494 ? 116.608 175.181 141.384 1.00 66.03  ? 758  GLU C CA    1 
ATOM   7790  C  C     . GLU B 1  494 ? 116.426 175.696 139.965 1.00 66.03  ? 758  GLU C C     1 
ATOM   7791  O  O     . GLU B 1  494 ? 115.772 175.060 139.144 1.00 66.03  ? 758  GLU C O     1 
ATOM   7792  C  CB    . GLU B 1  494 ? 115.753 175.987 142.356 1.00 66.03  ? 758  GLU C CB    1 
ATOM   7793  C  CG    . GLU B 1  494 ? 114.423 175.332 142.683 1.00 66.03  ? 758  GLU C CG    1 
ATOM   7794  C  CD    . GLU B 1  494 ? 114.395 173.864 142.306 1.00 66.03  ? 758  GLU C CD    1 
ATOM   7795  O  OE1   . GLU B 1  494 ? 113.414 173.429 141.668 1.00 66.03  ? 758  GLU C OE1   1 
ATOM   7796  O  OE2   . GLU B 1  494 ? 115.356 173.144 142.647 1.00 66.03  ? 758  GLU C OE2   1 
ATOM   7797  N  N     . VAL B 1  495 ? 117.011 176.854 139.680 1.00 64.89  ? 759  VAL C N     1 
ATOM   7798  C  CA    . VAL B 1  495 ? 116.919 177.436 138.343 1.00 64.89  ? 759  VAL C CA    1 
ATOM   7799  C  C     . VAL B 1  495 ? 117.537 176.500 137.310 1.00 64.89  ? 759  VAL C C     1 
ATOM   7800  O  O     . VAL B 1  495 ? 117.024 176.356 136.193 1.00 64.89  ? 759  VAL C O     1 
ATOM   7801  C  CB    . VAL B 1  495 ? 117.580 178.827 138.320 1.00 64.89  ? 759  VAL C CB    1 
ATOM   7802  C  CG1   . VAL B 1  495 ? 117.620 179.380 136.905 1.00 64.89  ? 759  VAL C CG1   1 
ATOM   7803  C  CG2   . VAL B 1  495 ? 116.833 179.779 139.239 1.00 64.89  ? 759  VAL C CG2   1 
ATOM   7804  N  N     . TRP B 1  496 ? 118.617 175.829 137.687 1.00 63.60  ? 760  TRP C N     1 
ATOM   7805  C  CA    . TRP B 1  496 ? 119.279 174.913 136.770 1.00 63.60  ? 760  TRP C CA    1 
ATOM   7806  C  C     . TRP B 1  496 ? 118.417 173.703 136.434 1.00 63.60  ? 760  TRP C C     1 
ATOM   7807  O  O     . TRP B 1  496 ? 118.330 173.304 135.279 1.00 63.60  ? 760  TRP C O     1 
ATOM   7808  C  CB    . TRP B 1  496 ? 120.619 174.449 137.331 1.00 63.60  ? 760  TRP C CB    1 
ATOM   7809  C  CG    . TRP B 1  496 ? 121.124 173.205 136.682 1.00 63.60  ? 760  TRP C CG    1 
ATOM   7810  C  CD1   . TRP B 1  496 ? 120.838 171.925 137.041 1.00 63.60  ? 760  TRP C CD1   1 
ATOM   7811  C  CD2   . TRP B 1  496 ? 122.004 173.119 135.556 1.00 63.60  ? 760  TRP C CD2   1 
ATOM   7812  N  NE1   . TRP B 1  496 ? 121.486 171.044 136.212 1.00 63.60  ? 760  TRP C NE1   1 
ATOM   7813  C  CE2   . TRP B 1  496 ? 122.209 171.754 135.291 1.00 63.60  ? 760  TRP C CE2   1 
ATOM   7814  C  CE3   . TRP B 1  496 ? 122.639 174.064 134.748 1.00 63.60  ? 760  TRP C CE3   1 
ATOM   7815  C  CZ2   . TRP B 1  496 ? 123.021 171.310 134.254 1.00 63.60  ? 760  TRP C CZ2   1 
ATOM   7816  C  CZ3   . TRP B 1  496 ? 123.443 173.621 133.719 1.00 63.60  ? 760  TRP C CZ3   1 
ATOM   7817  C  CH2   . TRP B 1  496 ? 123.628 172.258 133.481 1.00 63.60  ? 760  TRP C CH2   1 
ATOM   7818  N  N     . ARG B 1  497 ? 117.780 173.118 137.440 1.00 65.95  ? 761  ARG C N     1 
ATOM   7819  C  CA    . ARG B 1  497 ? 116.942 171.946 137.211 1.00 65.95  ? 761  ARG C CA    1 
ATOM   7820  C  C     . ARG B 1  497 ? 115.657 172.320 136.482 1.00 65.95  ? 761  ARG C C     1 
ATOM   7821  O  O     . ARG B 1  497 ? 115.290 171.697 135.480 1.00 65.95  ? 761  ARG C O     1 
ATOM   7822  C  CB    . ARG B 1  497 ? 116.628 171.255 138.538 1.00 65.95  ? 761  ARG C CB    1 
ATOM   7823  C  CG    . ARG B 1  497 ? 115.811 169.985 138.380 1.00 65.95  ? 761  ARG C CG    1 
ATOM   7824  C  CD    . ARG B 1  497 ? 115.520 169.340 139.721 1.00 65.95  ? 761  ARG C CD    1 
ATOM   7825  N  NE    . ARG B 1  497 ? 114.714 170.208 140.572 1.00 65.95  ? 761  ARG C NE    1 
ATOM   7826  C  CZ    . ARG B 1  497 ? 113.392 170.315 140.492 1.00 65.95  ? 761  ARG C CZ    1 
ATOM   7827  N  NH1   . ARG B 1  497 ? 112.720 169.607 139.595 1.00 65.95  ? 761  ARG C NH1   1 
ATOM   7828  N  NH2   . ARG B 1  497 ? 112.741 171.132 141.308 1.00 65.95  ? 761  ARG C NH2   1 
ATOM   7829  N  N     . SER B 1  498 ? 114.954 173.343 136.976 1.00 69.16  ? 762  SER C N     1 
ATOM   7830  C  CA    . SER B 1  498 ? 113.668 173.702 136.388 1.00 69.16  ? 762  SER C CA    1 
ATOM   7831  C  C     . SER B 1  498 ? 113.823 174.305 134.998 1.00 69.16  ? 762  SER C C     1 
ATOM   7832  O  O     . SER B 1  498 ? 112.976 174.068 134.128 1.00 69.16  ? 762  SER C O     1 
ATOM   7833  C  CB    . SER B 1  498 ? 112.926 174.672 137.306 1.00 69.16  ? 762  SER C CB    1 
ATOM   7834  O  OG    . SER B 1  498 ? 113.609 175.909 137.396 1.00 69.16  ? 762  SER C OG    1 
ATOM   7835  N  N     . ASN B 1  499 ? 114.891 175.074 134.769 1.00 71.13  ? 763  ASN C N     1 
ATOM   7836  C  CA    . ASN B 1  499 ? 115.137 175.770 133.509 1.00 71.13  ? 763  ASN C CA    1 
ATOM   7837  C  C     . ASN B 1  499 ? 113.919 176.602 133.117 1.00 71.13  ? 763  ASN C C     1 
ATOM   7838  O  O     . ASN B 1  499 ? 113.211 176.256 132.164 1.00 71.13  ? 763  ASN C O     1 
ATOM   7839  C  CB    . ASN B 1  499 ? 115.489 174.774 132.402 1.00 71.13  ? 763  ASN C CB    1 
ATOM   7840  C  CG    . ASN B 1  499 ? 116.000 175.453 131.145 1.00 71.13  ? 763  ASN C CG    1 
ATOM   7841  O  OD1   . ASN B 1  499 ? 116.086 176.679 131.077 1.00 71.13  ? 763  ASN C OD1   1 
ATOM   7842  N  ND2   . ASN B 1  499 ? 116.344 174.655 130.141 1.00 71.13  ? 763  ASN C ND2   1 
ATOM   7843  N  N     . PRO B 1  500 ? 113.642 177.699 133.828 1.00 71.29  ? 764  PRO C N     1 
ATOM   7844  C  CA    . PRO B 1  500 ? 112.421 178.466 133.523 1.00 71.29  ? 764  PRO C CA    1 
ATOM   7845  C  C     . PRO B 1  500 ? 112.455 179.147 132.168 1.00 71.29  ? 764  PRO C C     1 
ATOM   7846  O  O     . PRO B 1  500 ? 111.467 179.084 131.425 1.00 71.29  ? 764  PRO C O     1 
ATOM   7847  C  CB    . PRO B 1  500 ? 112.362 179.491 134.666 1.00 71.29  ? 764  PRO C CB    1 
ATOM   7848  C  CG    . PRO B 1  500 ? 113.220 178.916 135.748 1.00 71.29  ? 764  PRO C CG    1 
ATOM   7849  C  CD    . PRO B 1  500 ? 114.320 178.203 135.032 1.00 71.29  ? 764  PRO C CD    1 
ATOM   7850  N  N     . TYR B 1  501 ? 113.561 179.800 131.823 1.00 76.88  ? 765  TYR C N     1 
ATOM   7851  C  CA    . TYR B 1  501 ? 113.643 180.623 130.625 1.00 76.88  ? 765  TYR C CA    1 
ATOM   7852  C  C     . TYR B 1  501 ? 113.885 179.820 129.353 1.00 76.88  ? 765  TYR C C     1 
ATOM   7853  O  O     . TYR B 1  501 ? 113.838 180.398 128.261 1.00 76.88  ? 765  TYR C O     1 
ATOM   7854  C  CB    . TYR B 1  501 ? 114.743 181.675 130.791 1.00 76.88  ? 765  TYR C CB    1 
ATOM   7855  C  CG    . TYR B 1  501 ? 114.434 182.700 131.857 1.00 76.88  ? 765  TYR C CG    1 
ATOM   7856  C  CD1   . TYR B 1  501 ? 113.586 183.766 131.593 1.00 76.88  ? 765  TYR C CD1   1 
ATOM   7857  C  CD2   . TYR B 1  501 ? 114.983 182.599 133.128 1.00 76.88  ? 765  TYR C CD2   1 
ATOM   7858  C  CE1   . TYR B 1  501 ? 113.295 184.705 132.563 1.00 76.88  ? 765  TYR C CE1   1 
ATOM   7859  C  CE2   . TYR B 1  501 ? 114.698 183.534 134.105 1.00 76.88  ? 765  TYR C CE2   1 
ATOM   7860  C  CZ    . TYR B 1  501 ? 113.854 184.585 133.817 1.00 76.88  ? 765  TYR C CZ    1 
ATOM   7861  O  OH    . TYR B 1  501 ? 113.565 185.520 134.783 1.00 76.88  ? 765  TYR C OH    1 
ATOM   7862  N  N     . HIS B 1  502 ? 114.141 178.519 129.466 1.00 76.91  ? 766  HIS C N     1 
ATOM   7863  C  CA    . HIS B 1  502 ? 114.299 177.628 128.316 1.00 76.91  ? 766  HIS C CA    1 
ATOM   7864  C  C     . HIS B 1  502 ? 115.413 178.113 127.388 1.00 76.91  ? 766  HIS C C     1 
ATOM   7865  O  O     . HIS B 1  502 ? 115.186 178.495 126.240 1.00 76.91  ? 766  HIS C O     1 
ATOM   7866  C  CB    . HIS B 1  502 ? 112.979 177.480 127.553 1.00 76.91  ? 766  HIS C CB    1 
ATOM   7867  C  CG    . HIS B 1  502 ? 111.877 176.868 128.360 1.00 76.91  ? 766  HIS C CG    1 
ATOM   7868  N  ND1   . HIS B 1  502 ? 111.847 175.529 128.686 1.00 76.91  ? 766  HIS C ND1   1 
ATOM   7869  C  CD2   . HIS B 1  502 ? 110.758 177.410 128.894 1.00 76.91  ? 766  HIS C CD2   1 
ATOM   7870  C  CE1   . HIS B 1  502 ? 110.761 175.275 129.393 1.00 76.91  ? 766  HIS C CE1   1 
ATOM   7871  N  NE2   . HIS B 1  502 ? 110.083 176.399 129.534 1.00 76.91  ? 766  HIS C NE2   1 
ATOM   7872  N  N     . GLU B 1  503 ? 116.636 178.096 127.911 1.00 76.70  ? 767  GLU C N     1 
ATOM   7873  C  CA    . GLU B 1  503 ? 117.806 178.509 127.152 1.00 76.70  ? 767  GLU C CA    1 
ATOM   7874  C  C     . GLU B 1  503 ? 118.778 177.344 127.026 1.00 76.70  ? 767  GLU C C     1 
ATOM   7875  O  O     . GLU B 1  503 ? 118.583 176.278 127.614 1.00 76.70  ? 767  GLU C O     1 
ATOM   7876  C  CB    . GLU B 1  503 ? 118.488 179.725 127.795 1.00 76.70  ? 767  GLU C CB    1 
ATOM   7877  C  CG    . GLU B 1  503 ? 119.009 179.494 129.200 1.00 76.70  ? 767  GLU C CG    1 
ATOM   7878  C  CD    . GLU B 1  503 ? 119.576 180.760 129.815 1.00 76.70  ? 767  GLU C CD    1 
ATOM   7879  O  OE1   . GLU B 1  503 ? 119.550 181.812 129.142 1.00 76.70  ? 767  GLU C OE1   1 
ATOM   7880  O  OE2   . GLU B 1  503 ? 120.042 180.707 130.971 1.00 76.70  ? 767  GLU C OE2   1 
ATOM   7881  N  N     . SER B 1  504 ? 119.830 177.561 126.240 1.00 76.80  ? 768  SER C N     1 
ATOM   7882  C  CA    . SER B 1  504 ? 120.779 176.503 125.922 1.00 76.80  ? 768  SER C CA    1 
ATOM   7883  C  C     . SER B 1  504 ? 121.609 176.139 127.153 1.00 76.80  ? 768  SER C C     1 
ATOM   7884  O  O     . SER B 1  504 ? 121.450 176.701 128.240 1.00 76.80  ? 768  SER C O     1 
ATOM   7885  C  CB    . SER B 1  504 ? 121.678 176.929 124.764 1.00 76.80  ? 768  SER C CB    1 
ATOM   7886  O  OG    . SER B 1  504 ? 122.500 178.022 125.132 1.00 76.80  ? 768  SER C OG    1 
ATOM   7887  N  N     . VAL B 1  505 ? 122.518 175.180 126.971 1.00 73.53  ? 769  VAL C N     1 
ATOM   7888  C  CA    . VAL B 1  505 ? 123.291 174.660 128.098 1.00 73.53  ? 769  VAL C CA    1 
ATOM   7889  C  C     . VAL B 1  505 ? 124.333 175.680 128.550 1.00 73.53  ? 769  VAL C C     1 
ATOM   7890  O  O     . VAL B 1  505 ? 124.540 175.891 129.750 1.00 73.53  ? 769  VAL C O     1 
ATOM   7891  C  CB    . VAL B 1  505 ? 123.926 173.303 127.740 1.00 73.53  ? 769  VAL C CB    1 
ATOM   7892  C  CG1   . VAL B 1  505 ? 124.874 173.426 126.554 1.00 73.53  ? 769  VAL C CG1   1 
ATOM   7893  C  CG2   . VAL B 1  505 ? 124.648 172.721 128.945 1.00 73.53  ? 769  VAL C CG2   1 
ATOM   7894  N  N     . GLU B 1  506 ? 124.995 176.343 127.597 1.00 78.19  ? 770  GLU C N     1 
ATOM   7895  C  CA    . GLU B 1  506 ? 125.998 177.335 127.973 1.00 78.19  ? 770  GLU C CA    1 
ATOM   7896  C  C     . GLU B 1  506 ? 125.353 178.595 128.537 1.00 78.19  ? 770  GLU C C     1 
ATOM   7897  O  O     . GLU B 1  506 ? 125.871 179.178 129.497 1.00 78.19  ? 770  GLU C O     1 
ATOM   7898  C  CB    . GLU B 1  506 ? 126.895 177.666 126.776 1.00 78.19  ? 770  GLU C CB    1 
ATOM   7899  C  CG    . GLU B 1  506 ? 126.218 178.423 125.643 1.00 78.19  ? 770  GLU C CG    1 
ATOM   7900  C  CD    . GLU B 1  506 ? 125.524 177.508 124.653 1.00 78.19  ? 770  GLU C CD    1 
ATOM   7901  O  OE1   . GLU B 1  506 ? 125.309 176.322 124.980 1.00 78.19  ? 770  GLU C OE1   1 
ATOM   7902  O  OE2   . GLU B 1  506 ? 125.190 177.977 123.546 1.00 78.19  ? 770  GLU C OE2   1 
ATOM   7903  N  N     . GLU B 1  507 ? 124.214 179.014 127.980 1.00 77.37  ? 771  GLU C N     1 
ATOM   7904  C  CA    . GLU B 1  507 ? 123.507 180.163 128.533 1.00 77.37  ? 771  GLU C CA    1 
ATOM   7905  C  C     . GLU B 1  507 ? 122.979 179.855 129.926 1.00 77.37  ? 771  GLU C C     1 
ATOM   7906  O  O     . GLU B 1  507 ? 123.000 180.715 130.814 1.00 77.37  ? 771  GLU C O     1 
ATOM   7907  C  CB    . GLU B 1  507 ? 122.369 180.578 127.602 1.00 77.37  ? 771  GLU C CB    1 
ATOM   7908  C  CG    . GLU B 1  507 ? 122.838 181.121 126.264 1.00 77.37  ? 771  GLU C CG    1 
ATOM   7909  C  CD    . GLU B 1  507 ? 121.689 181.492 125.346 1.00 77.37  ? 771  GLU C CD    1 
ATOM   7910  O  OE1   . GLU B 1  507 ? 120.525 181.203 125.698 1.00 77.37  ? 771  GLU C OE1   1 
ATOM   7911  O  OE2   . GLU B 1  507 ? 121.949 182.074 124.273 1.00 77.37  ? 771  GLU C OE2   1 
ATOM   7912  N  N     . LEU B 1  508 ? 122.517 178.622 130.143 1.00 72.46  ? 772  LEU C N     1 
ATOM   7913  C  CA    . LEU B 1  508 ? 122.041 178.244 131.468 1.00 72.46  ? 772  LEU C CA    1 
ATOM   7914  C  C     . LEU B 1  508 ? 123.194 178.149 132.462 1.00 72.46  ? 772  LEU C C     1 
ATOM   7915  O  O     . LEU B 1  508 ? 123.032 178.490 133.639 1.00 72.46  ? 772  LEU C O     1 
ATOM   7916  C  CB    . LEU B 1  508 ? 121.271 176.927 131.392 1.00 72.46  ? 772  LEU C CB    1 
ATOM   7917  C  CG    . LEU B 1  508 ? 120.552 176.498 132.667 1.00 72.46  ? 772  LEU C CG    1 
ATOM   7918  C  CD1   . LEU B 1  508 ? 119.501 177.523 133.042 1.00 72.46  ? 772  LEU C CD1   1 
ATOM   7919  C  CD2   . LEU B 1  508 ? 119.922 175.132 132.480 1.00 72.46  ? 772  LEU C CD2   1 
ATOM   7920  N  N     . ARG B 1  509 ? 124.366 177.694 132.012 1.00 73.85  ? 773  ARG C N     1 
ATOM   7921  C  CA    . ARG B 1  509 ? 125.535 177.712 132.886 1.00 73.85  ? 773  ARG C CA    1 
ATOM   7922  C  C     . ARG B 1  509 ? 125.922 179.138 133.253 1.00 73.85  ? 773  ARG C C     1 
ATOM   7923  O  O     . ARG B 1  509 ? 126.296 179.416 134.400 1.00 73.85  ? 773  ARG C O     1 
ATOM   7924  C  CB    . ARG B 1  509 ? 126.715 177.008 132.222 1.00 73.85  ? 773  ARG C CB    1 
ATOM   7925  C  CG    . ARG B 1  509 ? 127.915 176.909 133.144 1.00 73.85  ? 773  ARG C CG    1 
ATOM   7926  C  CD    . ARG B 1  509 ? 129.125 176.286 132.477 1.00 73.85  ? 773  ARG C CD    1 
ATOM   7927  N  NE    . ARG B 1  509 ? 130.243 176.195 133.407 1.00 73.85  ? 773  ARG C NE    1 
ATOM   7928  C  CZ    . ARG B 1  509 ? 131.471 175.819 133.066 1.00 73.85  ? 773  ARG C CZ    1 
ATOM   7929  N  NH1   . ARG B 1  509 ? 131.755 175.522 131.803 1.00 73.85  ? 773  ARG C NH1   1 
ATOM   7930  N  NH2   . ARG B 1  509 ? 132.424 175.762 133.988 1.00 73.85  ? 773  ARG C NH2   1 
ATOM   7931  N  N     . ASP B 1  510 ? 125.868 180.050 132.282 1.00 73.19  ? 774  ASP C N     1 
ATOM   7932  C  CA    . ASP B 1  510 ? 126.158 181.452 132.561 1.00 73.19  ? 774  ASP C CA    1 
ATOM   7933  C  C     . ASP B 1  510 ? 125.168 182.014 133.574 1.00 73.19  ? 774  ASP C C     1 
ATOM   7934  O  O     . ASP B 1  510 ? 125.550 182.729 134.508 1.00 73.19  ? 774  ASP C O     1 
ATOM   7935  C  CB    . ASP B 1  510 ? 126.125 182.261 131.262 1.00 73.19  ? 774  ASP C CB    1 
ATOM   7936  C  CG    . ASP B 1  510 ? 126.658 183.674 131.434 1.00 73.19  ? 774  ASP C CG    1 
ATOM   7937  O  OD1   . ASP B 1  510 ? 127.078 184.033 132.555 1.00 73.19  ? 774  ASP C OD1   1 
ATOM   7938  O  OD2   . ASP B 1  510 ? 126.650 184.433 130.444 1.00 73.19  ? 774  ASP C OD2   1 
ATOM   7939  N  N     . ARG B 1  511 ? 123.883 181.696 133.403 1.00 70.17  ? 775  ARG C N     1 
ATOM   7940  C  CA    . ARG B 1  511 ? 122.867 182.197 134.323 1.00 70.17  ? 775  ARG C CA    1 
ATOM   7941  C  C     . ARG B 1  511 ? 123.046 181.618 135.721 1.00 70.17  ? 775  ARG C C     1 
ATOM   7942  O  O     . ARG B 1  511 ? 122.808 182.305 136.721 1.00 70.17  ? 775  ARG C O     1 
ATOM   7943  C  CB    . ARG B 1  511 ? 121.470 181.877 133.788 1.00 70.17  ? 775  ARG C CB    1 
ATOM   7944  C  CG    . ARG B 1  511 ? 120.335 182.472 134.609 1.00 70.17  ? 775  ARG C CG    1 
ATOM   7945  C  CD    . ARG B 1  511 ? 118.979 182.122 134.015 1.00 70.17  ? 775  ARG C CD    1 
ATOM   7946  N  NE    . ARG B 1  511 ? 118.792 182.715 132.694 1.00 70.17  ? 775  ARG C NE    1 
ATOM   7947  C  CZ    . ARG B 1  511 ? 118.356 183.954 132.487 1.00 70.17  ? 775  ARG C CZ    1 
ATOM   7948  N  NH1   . ARG B 1  511 ? 118.060 184.735 133.516 1.00 70.17  ? 775  ARG C NH1   1 
ATOM   7949  N  NH2   . ARG B 1  511 ? 118.217 184.411 131.250 1.00 70.17  ? 775  ARG C NH2   1 
ATOM   7950  N  N     . VAL B 1  512 ? 123.468 180.354 135.813 1.00 68.22  ? 776  VAL C N     1 
ATOM   7951  C  CA    . VAL B 1  512 ? 123.610 179.700 137.111 1.00 68.22  ? 776  VAL C CA    1 
ATOM   7952  C  C     . VAL B 1  512 ? 124.987 179.916 137.724 1.00 68.22  ? 776  VAL C C     1 
ATOM   7953  O  O     . VAL B 1  512 ? 125.170 179.647 138.922 1.00 68.22  ? 776  VAL C O     1 
ATOM   7954  C  CB    . VAL B 1  512 ? 123.332 178.188 136.989 1.00 68.22  ? 776  VAL C CB    1 
ATOM   7955  C  CG1   . VAL B 1  512 ? 124.515 177.475 136.344 1.00 68.22  ? 776  VAL C CG1   1 
ATOM   7956  C  CG2   . VAL B 1  512 ? 122.969 177.582 138.334 1.00 68.22  ? 776  VAL C CG2   1 
ATOM   7957  N  N     . LYS B 1  513 ? 125.959 180.394 136.944 1.00 69.54  ? 777  LYS C N     1 
ATOM   7958  C  CA    . LYS B 1  513 ? 127.323 180.640 137.417 1.00 69.54  ? 777  LYS C CA    1 
ATOM   7959  C  C     . LYS B 1  513 ? 127.981 179.352 137.914 1.00 69.54  ? 777  LYS C C     1 
ATOM   7960  O  O     . LYS B 1  513 ? 128.623 179.318 138.966 1.00 69.54  ? 777  LYS C O     1 
ATOM   7961  C  CB    . LYS B 1  513 ? 127.349 181.725 138.498 1.00 69.54  ? 777  LYS C CB    1 
ATOM   7962  C  CG    . LYS B 1  513 ? 126.825 183.074 138.036 1.00 69.54  ? 777  LYS C CG    1 
ATOM   7963  C  CD    . LYS B 1  513 ? 127.714 183.675 136.961 1.00 69.54  ? 777  LYS C CD    1 
ATOM   7964  C  CE    . LYS B 1  513 ? 127.293 185.097 136.630 1.00 69.54  ? 777  LYS C CE    1 
ATOM   7965  N  NZ    . LYS B 1  513 ? 125.972 185.142 135.945 1.00 69.54  ? 777  LYS C NZ    1 
ATOM   7966  N  N     . GLY B 1  514 ? 127.814 178.282 137.142 1.00 69.47  ? 778  GLY C N     1 
ATOM   7967  C  CA    . GLY B 1  514 ? 128.531 177.049 137.405 1.00 69.47  ? 778  GLY C CA    1 
ATOM   7968  C  C     . GLY B 1  514 ? 128.038 176.240 138.583 1.00 69.47  ? 778  GLY C C     1 
ATOM   7969  O  O     . GLY B 1  514 ? 128.848 175.627 139.285 1.00 69.47  ? 778  GLY C O     1 
ATOM   7970  N  N     . VAL B 1  515 ? 126.731 176.218 138.824 1.00 65.73  ? 779  VAL C N     1 
ATOM   7971  C  CA    . VAL B 1  515 ? 126.138 175.406 139.880 1.00 65.73  ? 779  VAL C CA    1 
ATOM   7972  C  C     . VAL B 1  515 ? 125.303 174.316 139.223 1.00 65.73  ? 779  VAL C C     1 
ATOM   7973  O  O     . VAL B 1  515 ? 124.370 174.609 138.466 1.00 65.73  ? 779  VAL C O     1 
ATOM   7974  C  CB    . VAL B 1  515 ? 125.289 176.258 140.836 1.00 65.73  ? 779  VAL C CB    1 
ATOM   7975  C  CG1   . VAL B 1  515 ? 124.597 175.374 141.859 1.00 65.73  ? 779  VAL C CG1   1 
ATOM   7976  C  CG2   . VAL B 1  515 ? 126.155 177.298 141.526 1.00 65.73  ? 779  VAL C CG2   1 
ATOM   7977  N  N     . SER B 1  516 ? 125.638 173.055 139.508 1.00 64.70  ? 780  SER C N     1 
ATOM   7978  C  CA    . SER B 1  516 ? 124.942 171.938 138.883 1.00 64.70  ? 780  SER C CA    1 
ATOM   7979  C  C     . SER B 1  516 ? 124.612 170.815 139.859 1.00 64.70  ? 780  SER C C     1 
ATOM   7980  O  O     . SER B 1  516 ? 124.279 169.710 139.413 1.00 64.70  ? 780  SER C O     1 
ATOM   7981  C  CB    . SER B 1  516 ? 125.768 171.378 137.720 1.00 64.70  ? 780  SER C CB    1 
ATOM   7982  O  OG    . SER B 1  516 ? 125.922 172.342 136.693 1.00 64.70  ? 780  SER C OG    1 
ATOM   7983  N  N     . ALA B 1  517 ? 124.691 171.052 141.166 1.00 67.30  ? 781  ALA C N     1 
ATOM   7984  C  CA    . ALA B 1  517 ? 124.378 170.022 142.144 1.00 67.30  ? 781  ALA C CA    1 
ATOM   7985  C  C     . ALA B 1  517 ? 123.702 170.667 143.343 1.00 67.30  ? 781  ALA C C     1 
ATOM   7986  O  O     . ALA B 1  517 ? 123.836 171.869 143.584 1.00 67.30  ? 781  ALA C O     1 
ATOM   7987  C  CB    . ALA B 1  517 ? 125.632 169.253 142.578 1.00 67.30  ? 781  ALA C CB    1 
ATOM   7988  N  N     . LYS B 1  518 ? 122.970 169.849 144.093 1.00 64.92  ? 782  LYS C N     1 
ATOM   7989  C  CA    . LYS B 1  518 ? 122.222 170.338 145.242 1.00 64.92  ? 782  LYS C CA    1 
ATOM   7990  C  C     . LYS B 1  518 ? 123.102 170.300 146.484 1.00 64.92  ? 782  LYS C C     1 
ATOM   7991  O  O     . LYS B 1  518 ? 123.536 169.212 146.886 1.00 64.92  ? 782  LYS C O     1 
ATOM   7992  C  CB    . LYS B 1  518 ? 120.974 169.502 145.464 1.00 64.92  ? 782  LYS C CB    1 
ATOM   7993  C  CG    . LYS B 1  518 ? 120.074 170.022 146.570 1.00 64.92  ? 782  LYS C CG    1 
ATOM   7994  C  CD    . LYS B 1  518 ? 118.807 169.194 146.684 1.00 64.92  ? 782  LYS C CD    1 
ATOM   7995  C  CE    . LYS B 1  518 ? 117.913 169.715 147.796 1.00 64.92  ? 782  LYS C CE    1 
ATOM   7996  N  NZ    . LYS B 1  518 ? 116.668 168.911 147.926 1.00 64.92  ? 782  LYS C NZ    1 
ATOM   7997  N  N     . PRO B 1  519 ? 123.395 171.438 147.109 1.00 67.44  ? 783  PRO C N     1 
ATOM   7998  C  CA    . PRO B 1  519 ? 124.209 171.421 148.329 1.00 67.44  ? 783  PRO C CA    1 
ATOM   7999  C  C     . PRO B 1  519 ? 123.482 170.723 149.468 1.00 67.44  ? 783  PRO C C     1 
ATOM   8000  O  O     . PRO B 1  519 ? 122.251 170.677 149.514 1.00 67.44  ? 783  PRO C O     1 
ATOM   8001  C  CB    . PRO B 1  519 ? 124.422 172.908 148.634 1.00 67.44  ? 783  PRO C CB    1 
ATOM   8002  C  CG    . PRO B 1  519 ? 124.190 173.602 147.332 1.00 67.44  ? 783  PRO C CG    1 
ATOM   8003  C  CD    . PRO B 1  519 ? 123.120 172.808 146.650 1.00 67.44  ? 783  PRO C CD    1 
ATOM   8004  N  N     . PHE B 1  520 ? 124.265 170.173 150.400 1.00 70.40  ? 784  PHE C N     1 
ATOM   8005  C  CA    . PHE B 1  520 ? 123.682 169.510 151.559 1.00 70.40  ? 784  PHE C CA    1 
ATOM   8006  C  C     . PHE B 1  520 ? 124.388 169.863 152.864 1.00 70.40  ? 784  PHE C C     1 
ATOM   8007  O  O     . PHE B 1  520 ? 123.993 169.351 153.919 1.00 70.40  ? 784  PHE C O     1 
ATOM   8008  C  CB    . PHE B 1  520 ? 123.665 167.987 151.355 1.00 70.40  ? 784  PHE C CB    1 
ATOM   8009  C  CG    . PHE B 1  520 ? 125.028 167.370 151.223 1.00 70.40  ? 784  PHE C CG    1 
ATOM   8010  C  CD1   . PHE B 1  520 ? 125.659 167.309 149.992 1.00 70.40  ? 784  PHE C CD1   1 
ATOM   8011  C  CD2   . PHE B 1  520 ? 125.663 166.818 152.322 1.00 70.40  ? 784  PHE C CD2   1 
ATOM   8012  C  CE1   . PHE B 1  520 ? 126.908 166.734 149.866 1.00 70.40  ? 784  PHE C CE1   1 
ATOM   8013  C  CE2   . PHE B 1  520 ? 126.910 166.239 152.201 1.00 70.40  ? 784  PHE C CE2   1 
ATOM   8014  C  CZ    . PHE B 1  520 ? 127.534 166.197 150.972 1.00 70.40  ? 784  PHE C CZ    1 
ATOM   8015  N  N     . ILE B 1  521 ? 125.409 170.717 152.833 1.00 69.22  ? 785  ILE C N     1 
ATOM   8016  C  CA    . ILE B 1  521 ? 126.052 171.224 154.039 1.00 69.22  ? 785  ILE C CA    1 
ATOM   8017  C  C     . ILE B 1  521 ? 126.217 172.729 153.892 1.00 69.22  ? 785  ILE C C     1 
ATOM   8018  O  O     . ILE B 1  521 ? 126.695 173.213 152.861 1.00 69.22  ? 785  ILE C O     1 
ATOM   8019  C  CB    . ILE B 1  521 ? 127.418 170.555 154.302 1.00 69.22  ? 785  ILE C CB    1 
ATOM   8020  C  CG1   . ILE B 1  521 ? 127.251 169.056 154.550 1.00 69.22  ? 785  ILE C CG1   1 
ATOM   8021  C  CG2   . ILE B 1  521 ? 128.122 171.213 155.480 1.00 69.22  ? 785  ILE C CG2   1 
ATOM   8022  C  CD1   . ILE B 1  521 ? 128.557 168.298 154.575 1.00 69.22  ? 785  ILE C CD1   1 
ATOM   8023  N  N     . GLU B 1  522 ? 125.816 173.468 154.922 1.00 75.84  ? 786  GLU C N     1 
ATOM   8024  C  CA    . GLU B 1  522 ? 125.921 174.920 154.920 1.00 75.84  ? 786  GLU C CA    1 
ATOM   8025  C  C     . GLU B 1  522 ? 127.304 175.326 155.415 1.00 75.84  ? 786  GLU C C     1 
ATOM   8026  O  O     . GLU B 1  522 ? 127.684 175.000 156.544 1.00 75.84  ? 786  GLU C O     1 
ATOM   8027  C  CB    . GLU B 1  522 ? 124.832 175.543 155.791 1.00 75.84  ? 786  GLU C CB    1 
ATOM   8028  C  CG    . GLU B 1  522 ? 124.826 177.062 155.781 1.00 75.84  ? 786  GLU C CG    1 
ATOM   8029  C  CD    . GLU B 1  522 ? 123.702 177.644 156.613 1.00 75.84  ? 786  GLU C CD    1 
ATOM   8030  O  OE1   . GLU B 1  522 ? 122.942 176.860 157.218 1.00 75.84  ? 786  GLU C OE1   1 
ATOM   8031  O  OE2   . GLU B 1  522 ? 123.579 178.886 156.661 1.00 75.84  ? 786  GLU C OE2   1 
ATOM   8032  N  N     . THR B 1  523 ? 128.051 176.032 154.570 1.00 75.94  ? 787  THR C N     1 
ATOM   8033  C  CA    . THR B 1  523 ? 129.372 176.529 154.919 1.00 75.94  ? 787  THR C CA    1 
ATOM   8034  C  C     . THR B 1  523 ? 129.428 178.028 154.666 1.00 75.94  ? 787  THR C C     1 
ATOM   8035  O  O     . THR B 1  523 ? 128.706 178.564 153.821 1.00 75.94  ? 787  THR C O     1 
ATOM   8036  C  CB    . THR B 1  523 ? 130.481 175.828 154.120 1.00 75.94  ? 787  THR C CB    1 
ATOM   8037  O  OG1   . THR B 1  523 ? 130.306 176.094 152.723 1.00 75.94  ? 787  THR C OG1   1 
ATOM   8038  C  CG2   . THR B 1  523 ? 130.439 174.328 154.352 1.00 75.94  ? 787  THR C CG2   1 
ATOM   8039  N  N     . VAL B 1  524 ? 130.297 178.701 155.411 1.00 73.11  ? 788  VAL C N     1 
ATOM   8040  C  CA    . VAL B 1  524 ? 130.477 180.143 155.271 1.00 73.11  ? 788  VAL C CA    1 
ATOM   8041  C  C     . VAL B 1  524 ? 131.637 180.399 154.317 1.00 73.11  ? 788  VAL C C     1 
ATOM   8042  O  O     . VAL B 1  524 ? 132.584 179.601 154.265 1.00 73.11  ? 788  VAL C O     1 
ATOM   8043  C  CB    . VAL B 1  524 ? 130.709 180.813 156.634 1.00 73.11  ? 788  VAL C CB    1 
ATOM   8044  C  CG1   . VAL B 1  524 ? 129.488 180.637 157.522 1.00 73.11  ? 788  VAL C CG1   1 
ATOM   8045  C  CG2   . VAL B 1  524 ? 131.944 180.239 157.307 1.00 73.11  ? 788  VAL C CG2   1 
ATOM   8046  N  N     . PRO B 1  525 ? 131.603 181.478 153.535 1.00 74.25  ? 789  PRO C N     1 
ATOM   8047  C  CA    . PRO B 1  525 ? 132.723 181.775 152.628 1.00 74.25  ? 789  PRO C CA    1 
ATOM   8048  C  C     . PRO B 1  525 ? 133.957 182.195 153.413 1.00 74.25  ? 789  PRO C C     1 
ATOM   8049  O  O     . PRO B 1  525 ? 133.971 183.245 154.059 1.00 74.25  ? 789  PRO C O     1 
ATOM   8050  C  CB    . PRO B 1  525 ? 132.181 182.916 151.759 1.00 74.25  ? 789  PRO C CB    1 
ATOM   8051  C  CG    . PRO B 1  525 ? 131.134 183.562 152.602 1.00 74.25  ? 789  PRO C CG    1 
ATOM   8052  C  CD    . PRO B 1  525 ? 130.512 182.459 153.410 1.00 74.25  ? 789  PRO C CD    1 
ATOM   8053  N  N     . SER B 1  526 ? 134.996 181.367 153.354 1.00 70.97  ? 790  SER C N     1 
ATOM   8054  C  CA    . SER B 1  526 ? 136.236 181.624 154.075 1.00 70.97  ? 790  SER C CA    1 
ATOM   8055  C  C     . SER B 1  526 ? 137.391 181.046 153.264 1.00 70.97  ? 790  SER C C     1 
ATOM   8056  O  O     . SER B 1  526 ? 137.202 180.538 152.156 1.00 70.97  ? 790  SER C O     1 
ATOM   8057  C  CB    . SER B 1  526 ? 136.170 181.039 155.491 1.00 70.97  ? 790  SER C CB    1 
ATOM   8058  O  OG    . SER B 1  526 ? 137.384 181.254 156.188 1.00 70.97  ? 790  SER C OG    1 
ATOM   8059  N  N     . ILE B 1  527 ? 138.597 181.128 153.822 1.00 69.13  ? 791  ILE C N     1 
ATOM   8060  C  CA    . ILE B 1  527 ? 139.811 180.664 153.161 1.00 69.13  ? 791  ILE C CA    1 
ATOM   8061  C  C     . ILE B 1  527 ? 140.647 179.877 154.159 1.00 69.13  ? 791  ILE C C     1 
ATOM   8062  O  O     . ILE B 1  527 ? 140.888 180.337 155.281 1.00 69.13  ? 791  ILE C O     1 
ATOM   8063  C  CB    . ILE B 1  527 ? 140.629 181.837 152.581 1.00 69.13  ? 791  ILE C CB    1 
ATOM   8064  C  CG1   . ILE B 1  527 ? 139.849 182.538 151.469 1.00 69.13  ? 791  ILE C CG1   1 
ATOM   8065  C  CG2   . ILE B 1  527 ? 141.975 181.352 152.066 1.00 69.13  ? 791  ILE C CG2   1 
ATOM   8066  C  CD1   . ILE B 1  527 ? 140.468 183.835 151.023 1.00 69.13  ? 791  ILE C CD1   1 
ATOM   8067  N  N     . ASP B 1  528 ? 141.091 178.692 153.749 1.00 74.16  ? 792  ASP C N     1 
ATOM   8068  C  CA    . ASP B 1  528 ? 141.993 177.880 154.553 1.00 74.16  ? 792  ASP C CA    1 
ATOM   8069  C  C     . ASP B 1  528 ? 143.417 178.395 154.387 1.00 74.16  ? 792  ASP C C     1 
ATOM   8070  O  O     . ASP B 1  528 ? 143.909 178.522 153.262 1.00 74.16  ? 792  ASP C O     1 
ATOM   8071  C  CB    . ASP B 1  528 ? 141.907 176.410 154.145 1.00 74.16  ? 792  ASP C CB    1 
ATOM   8072  C  CG    . ASP B 1  528 ? 142.721 175.506 155.048 1.00 74.16  ? 792  ASP C CG    1 
ATOM   8073  O  OD1   . ASP B 1  528 ? 142.288 175.263 156.194 1.00 74.16  ? 792  ASP C OD1   1 
ATOM   8074  O  OD2   . ASP B 1  528 ? 143.793 175.038 154.612 1.00 74.16  ? 792  ASP C OD2   1 
ATOM   8075  N  N     . ALA B 1  529 ? 144.075 178.688 155.508 1.00 70.49  ? 793  ALA C N     1 
ATOM   8076  C  CA    . ALA B 1  529 ? 145.401 179.293 155.477 1.00 70.49  ? 793  ALA C CA    1 
ATOM   8077  C  C     . ALA B 1  529 ? 146.497 178.295 155.124 1.00 70.49  ? 793  ALA C C     1 
ATOM   8078  O  O     . ALA B 1  529 ? 147.443 178.647 154.411 1.00 70.49  ? 793  ALA C O     1 
ATOM   8079  C  CB    . ALA B 1  529 ? 145.711 179.946 156.827 1.00 70.49  ? 793  ALA C CB    1 
ATOM   8080  N  N     . LEU B 1  530 ? 146.388 177.058 155.611 1.00 71.07  ? 794  LEU C N     1 
ATOM   8081  C  CA    . LEU B 1  530 ? 147.416 176.054 155.355 1.00 71.07  ? 794  LEU C CA    1 
ATOM   8082  C  C     . LEU B 1  530 ? 147.551 175.772 153.863 1.00 71.07  ? 794  LEU C C     1 
ATOM   8083  O  O     . LEU B 1  530 ? 148.641 175.885 153.288 1.00 71.07  ? 794  LEU C O     1 
ATOM   8084  C  CB    . LEU B 1  530 ? 147.088 174.771 156.121 1.00 71.07  ? 794  LEU C CB    1 
ATOM   8085  C  CG    . LEU B 1  530 ? 148.098 173.630 155.995 1.00 71.07  ? 794  LEU C CG    1 
ATOM   8086  C  CD1   . LEU B 1  530 ? 149.444 174.036 156.573 1.00 71.07  ? 794  LEU C CD1   1 
ATOM   8087  C  CD2   . LEU B 1  530 ? 147.576 172.372 156.670 1.00 71.07  ? 794  LEU C CD2   1 
ATOM   8088  N  N     . HIS B 1  531 ? 146.442 175.403 153.219 1.00 72.16  ? 795  HIS C N     1 
ATOM   8089  C  CA    . HIS B 1  531 ? 146.485 175.107 151.793 1.00 72.16  ? 795  HIS C CA    1 
ATOM   8090  C  C     . HIS B 1  531 ? 146.793 176.350 150.970 1.00 72.16  ? 795  HIS C C     1 
ATOM   8091  O  O     . HIS B 1  531 ? 147.416 176.246 149.908 1.00 72.16  ? 795  HIS C O     1 
ATOM   8092  C  CB    . HIS B 1  531 ? 145.165 174.480 151.348 1.00 72.16  ? 795  HIS C CB    1 
ATOM   8093  C  CG    . HIS B 1  531 ? 144.911 173.131 151.944 1.00 72.16  ? 795  HIS C CG    1 
ATOM   8094  N  ND1   . HIS B 1  531 ? 144.262 172.960 153.147 1.00 72.16  ? 795  HIS C ND1   1 
ATOM   8095  C  CD2   . HIS B 1  531 ? 145.226 171.889 151.506 1.00 72.16  ? 795  HIS C CD2   1 
ATOM   8096  C  CE1   . HIS B 1  531 ? 144.184 171.670 153.423 1.00 72.16  ? 795  HIS C CE1   1 
ATOM   8097  N  NE2   . HIS B 1  531 ? 144.761 170.999 152.443 1.00 72.16  ? 795  HIS C NE2   1 
ATOM   8098  N  N     . CYS B 1  532 ? 146.380 177.527 151.443 1.00 71.78  ? 796  CYS C N     1 
ATOM   8099  C  CA    . CYS B 1  532 ? 146.742 178.765 150.761 1.00 71.78  ? 796  CYS C CA    1 
ATOM   8100  C  C     . CYS B 1  532 ? 148.253 178.950 150.737 1.00 71.78  ? 796  CYS C C     1 
ATOM   8101  O  O     . CYS B 1  532 ? 148.841 179.234 149.686 1.00 71.78  ? 796  CYS C O     1 
ATOM   8102  C  CB    . CYS B 1  532 ? 146.065 179.957 151.439 1.00 71.78  ? 796  CYS C CB    1 
ATOM   8103  S  SG    . CYS B 1  532 ? 146.396 181.550 150.656 1.00 71.78  ? 796  CYS C SG    1 
ATOM   8104  N  N     . ASP B 1  533 ? 148.900 178.789 151.894 1.00 74.26  ? 797  ASP C N     1 
ATOM   8105  C  CA    . ASP B 1  533 ? 150.353 178.911 151.955 1.00 74.26  ? 797  ASP C CA    1 
ATOM   8106  C  C     . ASP B 1  533 ? 151.027 177.840 151.108 1.00 74.26  ? 797  ASP C C     1 
ATOM   8107  O  O     . ASP B 1  533 ? 152.031 178.104 150.436 1.00 74.26  ? 797  ASP C O     1 
ATOM   8108  C  CB    . ASP B 1  533 ? 150.825 178.826 153.406 1.00 74.26  ? 797  ASP C CB    1 
ATOM   8109  C  CG    . ASP B 1  533 ? 150.410 180.031 154.225 1.00 74.26  ? 797  ASP C CG    1 
ATOM   8110  O  OD1   . ASP B 1  533 ? 150.260 181.125 153.641 1.00 74.26  ? 797  ASP C OD1   1 
ATOM   8111  O  OD2   . ASP B 1  533 ? 150.237 179.884 155.453 1.00 74.26  ? 797  ASP C OD2   1 
ATOM   8112  N  N     . ILE B 1  534 ? 150.482 176.621 151.125 1.00 71.73  ? 798  ILE C N     1 
ATOM   8113  C  CA    . ILE B 1  534 ? 151.062 175.537 150.334 1.00 71.73  ? 798  ILE C CA    1 
ATOM   8114  C  C     . ILE B 1  534 ? 151.013 175.869 148.847 1.00 71.73  ? 798  ILE C C     1 
ATOM   8115  O  O     . ILE B 1  534 ? 152.016 175.735 148.132 1.00 71.73  ? 798  ILE C O     1 
ATOM   8116  C  CB    . ILE B 1  534 ? 150.348 174.209 150.647 1.00 71.73  ? 798  ILE C CB    1 
ATOM   8117  C  CG1   . ILE B 1  534 ? 150.650 173.766 152.080 1.00 71.73  ? 798  ILE C CG1   1 
ATOM   8118  C  CG2   . ILE B 1  534 ? 150.749 173.133 149.654 1.00 71.73  ? 798  ILE C CG2   1 
ATOM   8119  C  CD1   . ILE B 1  534 ? 149.788 172.621 152.556 1.00 71.73  ? 798  ILE C CD1   1 
ATOM   8120  N  N     . GLY B 1  535 ? 149.853 176.311 148.359 1.00 69.78  ? 799  GLY C N     1 
ATOM   8121  C  CA    . GLY B 1  535 ? 149.738 176.661 146.953 1.00 69.78  ? 799  GLY C CA    1 
ATOM   8122  C  C     . GLY B 1  535 ? 150.605 177.845 146.570 1.00 69.78  ? 799  GLY C C     1 
ATOM   8123  O  O     . GLY B 1  535 ? 151.222 177.853 145.499 1.00 69.78  ? 799  GLY C O     1 
ATOM   8124  N  N     . ASN B 1  536 ? 150.668 178.860 147.438 1.00 69.15  ? 800  ASN C N     1 
ATOM   8125  C  CA    . ASN B 1  536 ? 151.520 180.010 147.159 1.00 69.15  ? 800  ASN C CA    1 
ATOM   8126  C  C     . ASN B 1  536 ? 152.985 179.608 147.070 1.00 69.15  ? 800  ASN C C     1 
ATOM   8127  O  O     . ASN B 1  536 ? 153.695 180.055 146.162 1.00 69.15  ? 800  ASN C O     1 
ATOM   8128  C  CB    . ASN B 1  536 ? 151.328 181.079 148.233 1.00 69.15  ? 800  ASN C CB    1 
ATOM   8129  C  CG    . ASN B 1  536 ? 149.952 181.710 148.190 1.00 69.15  ? 800  ASN C CG    1 
ATOM   8130  O  OD1   . ASN B 1  536 ? 149.416 181.985 147.119 1.00 69.15  ? 800  ASN C OD1   1 
ATOM   8131  N  ND2   . ASN B 1  536 ? 149.373 181.943 149.360 1.00 69.15  ? 800  ASN C ND2   1 
ATOM   8132  N  N     . ALA B 1  537 ? 153.450 178.758 147.989 1.00 67.91  ? 801  ALA C N     1 
ATOM   8133  C  CA    . ALA B 1  537 ? 154.838 178.313 147.949 1.00 67.91  ? 801  ALA C CA    1 
ATOM   8134  C  C     . ALA B 1  537 ? 155.111 177.459 146.719 1.00 67.91  ? 801  ALA C C     1 
ATOM   8135  O  O     . ALA B 1  537 ? 156.181 177.567 146.111 1.00 67.91  ? 801  ALA C O     1 
ATOM   8136  C  CB    . ALA B 1  537 ? 155.180 177.544 149.222 1.00 67.91  ? 801  ALA C CB    1 
ATOM   8137  N  N     . ALA B 1  538 ? 154.158 176.606 146.334 1.00 69.69  ? 802  ALA C N     1 
ATOM   8138  C  CA    . ALA B 1  538 ? 154.345 175.798 145.132 1.00 69.69  ? 802  ALA C CA    1 
ATOM   8139  C  C     . ALA B 1  538 ? 154.454 176.676 143.893 1.00 69.69  ? 802  ALA C C     1 
ATOM   8140  O  O     . ALA B 1  538 ? 155.317 176.454 143.032 1.00 69.69  ? 802  ALA C O     1 
ATOM   8141  C  CB    . ALA B 1  538 ? 153.197 174.801 144.983 1.00 69.69  ? 802  ALA C CB    1 
ATOM   8142  N  N     . GLU B 1  539 ? 153.596 177.691 143.791 1.00 72.47  ? 803  GLU C N     1 
ATOM   8143  C  CA    . GLU B 1  539 ? 153.638 178.563 142.623 1.00 72.47  ? 803  GLU C CA    1 
ATOM   8144  C  C     . GLU B 1  539 ? 154.906 179.408 142.616 1.00 72.47  ? 803  GLU C C     1 
ATOM   8145  O  O     . GLU B 1  539 ? 155.474 179.678 141.554 1.00 72.47  ? 803  GLU C O     1 
ATOM   8146  C  CB    . GLU B 1  539 ? 152.393 179.445 142.574 1.00 72.47  ? 803  GLU C CB    1 
ATOM   8147  C  CG    . GLU B 1  539 ? 152.327 180.324 141.340 1.00 72.47  ? 803  GLU C CG    1 
ATOM   8148  C  CD    . GLU B 1  539 ? 152.155 179.538 140.056 1.00 72.47  ? 803  GLU C CD    1 
ATOM   8149  O  OE1   . GLU B 1  539 ? 151.586 178.428 140.104 1.00 72.47  ? 803  GLU C OE1   1 
ATOM   8150  O  OE2   . GLU B 1  539 ? 152.589 180.034 138.995 1.00 72.47  ? 803  GLU C OE2   1 
ATOM   8151  N  N     . PHE B 1  540 ? 155.384 179.786 143.793 1.00 68.22  ? 804  PHE C N     1 
ATOM   8152  C  CA    . PHE B 1  540 ? 156.616 180.550 143.856 1.00 68.22  ? 804  PHE C CA    1 
ATOM   8153  C  C     . PHE B 1  540 ? 157.741 179.645 143.372 1.00 68.22  ? 804  PHE C C     1 
ATOM   8154  O  O     . PHE B 1  540 ? 158.566 180.053 142.560 1.00 68.22  ? 804  PHE C O     1 
ATOM   8155  C  CB    . PHE B 1  540 ? 156.881 181.064 145.266 1.00 68.22  ? 804  PHE C CB    1 
ATOM   8156  C  CG    . PHE B 1  540 ? 156.544 182.514 145.446 1.00 68.22  ? 804  PHE C CG    1 
ATOM   8157  C  CD1   . PHE B 1  540 ? 157.538 183.474 145.439 1.00 68.22  ? 804  PHE C CD1   1 
ATOM   8158  C  CD2   . PHE B 1  540 ? 155.232 182.917 145.608 1.00 68.22  ? 804  PHE C CD2   1 
ATOM   8159  C  CE1   . PHE B 1  540 ? 157.231 184.811 145.599 1.00 68.22  ? 804  PHE C CE1   1 
ATOM   8160  C  CE2   . PHE B 1  540 ? 154.918 184.252 145.768 1.00 68.22  ? 804  PHE C CE2   1 
ATOM   8161  C  CZ    . PHE B 1  540 ? 155.919 185.200 145.764 1.00 68.22  ? 804  PHE C CZ    1 
ATOM   8162  N  N     . TYR B 1  541 ? 157.730 178.407 143.850 1.00 69.38  ? 805  TYR C N     1 
ATOM   8163  C  CA    . TYR B 1  541 ? 158.710 177.413 143.452 1.00 69.38  ? 805  TYR C CA    1 
ATOM   8164  C  C     . TYR B 1  541 ? 158.761 177.382 141.933 1.00 69.38  ? 805  TYR C C     1 
ATOM   8165  O  O     . TYR B 1  541 ? 159.825 177.498 141.334 1.00 69.38  ? 805  TYR C O     1 
ATOM   8166  C  CB    . TYR B 1  541 ? 158.291 176.047 143.986 1.00 69.38  ? 805  TYR C CB    1 
ATOM   8167  C  CG    . TYR B 1  541 ? 159.174 174.900 143.566 1.00 69.38  ? 805  TYR C CG    1 
ATOM   8168  C  CD1   . TYR B 1  541 ? 160.404 174.689 144.166 1.00 69.38  ? 805  TYR C CD1   1 
ATOM   8169  C  CD2   . TYR B 1  541 ? 158.764 174.012 142.583 1.00 69.38  ? 805  TYR C CD2   1 
ATOM   8170  C  CE1   . TYR B 1  541 ? 161.210 173.632 143.789 1.00 69.38  ? 805  TYR C CE1   1 
ATOM   8171  C  CE2   . TYR B 1  541 ? 159.562 172.953 142.200 1.00 69.38  ? 805  TYR C CE2   1 
ATOM   8172  C  CZ    . TYR B 1  541 ? 160.783 172.768 142.806 1.00 69.38  ? 805  TYR C CZ    1 
ATOM   8173  O  OH    . TYR B 1  541 ? 161.578 171.713 142.426 1.00 69.38  ? 805  TYR C OH    1 
ATOM   8174  N  N     . LYS B 1  542 ? 157.595 177.229 141.315 1.00 71.76  ? 806  LYS C N     1 
ATOM   8175  C  CA    . LYS B 1  542 ? 157.487 177.196 139.859 1.00 71.76  ? 806  LYS C CA    1 
ATOM   8176  C  C     . LYS B 1  542 ? 158.069 178.459 139.233 1.00 71.76  ? 806  LYS C C     1 
ATOM   8177  O  O     . LYS B 1  542 ? 158.799 178.391 138.237 1.00 71.76  ? 806  LYS C O     1 
ATOM   8178  C  CB    . LYS B 1  542 ? 156.026 177.020 139.447 1.00 71.76  ? 806  LYS C CB    1 
ATOM   8179  C  CG    . LYS B 1  542 ? 155.800 176.972 137.945 1.00 71.76  ? 806  LYS C CG    1 
ATOM   8180  C  CD    . LYS B 1  542 ? 156.338 175.686 137.345 1.00 71.76  ? 806  LYS C CD    1 
ATOM   8181  C  CE    . LYS B 1  542 ? 156.014 175.589 135.865 1.00 71.76  ? 806  LYS C CE    1 
ATOM   8182  N  NZ    . LYS B 1  542 ? 156.593 174.362 135.253 1.00 71.76  ? 806  LYS C NZ    1 
ATOM   8183  N  N     . ILE B 1  543 ? 157.759 179.621 139.810 1.00 69.09  ? 807  ILE C N     1 
ATOM   8184  C  CA    . ILE B 1  543 ? 158.271 180.879 139.277 1.00 69.09  ? 807  ILE C CA    1 
ATOM   8185  C  C     . ILE B 1  543 ? 159.789 180.928 139.380 1.00 69.09  ? 807  ILE C C     1 
ATOM   8186  O  O     . ILE B 1  543 ? 160.469 181.414 138.472 1.00 69.09  ? 807  ILE C O     1 
ATOM   8187  C  CB    . ILE B 1  543 ? 157.615 182.073 139.994 1.00 69.09  ? 807  ILE C CB    1 
ATOM   8188  C  CG1   . ILE B 1  543 ? 156.119 182.130 139.686 1.00 69.09  ? 807  ILE C CG1   1 
ATOM   8189  C  CG2   . ILE B 1  543 ? 158.283 183.376 139.594 1.00 69.09  ? 807  ILE C CG2   1 
ATOM   8190  C  CD1   . ILE B 1  543 ? 155.364 183.109 140.551 1.00 69.09  ? 807  ILE C CD1   1 
ATOM   8191  N  N     . PHE B 1  544 ? 160.347 180.422 140.481 1.00 71.70  ? 808  PHE C N     1 
ATOM   8192  C  CA    . PHE B 1  544 ? 161.797 180.386 140.639 1.00 71.70  ? 808  PHE C CA    1 
ATOM   8193  C  C     . PHE B 1  544 ? 162.442 179.522 139.562 1.00 71.70  ? 808  PHE C C     1 
ATOM   8194  O  O     . PHE B 1  544 ? 163.383 179.947 138.877 1.00 71.70  ? 808  PHE C O     1 
ATOM   8195  C  CB    . PHE B 1  544 ? 162.161 179.864 142.031 1.00 71.70  ? 808  PHE C CB    1 
ATOM   8196  C  CG    . PHE B 1  544 ? 161.808 180.803 143.148 1.00 71.70  ? 808  PHE C CG    1 
ATOM   8197  C  CD1   . PHE B 1  544 ? 161.511 182.131 142.893 1.00 71.70  ? 808  PHE C CD1   1 
ATOM   8198  C  CD2   . PHE B 1  544 ? 161.776 180.354 144.457 1.00 71.70  ? 808  PHE C CD2   1 
ATOM   8199  C  CE1   . PHE B 1  544 ? 161.186 182.991 143.924 1.00 71.70  ? 808  PHE C CE1   1 
ATOM   8200  C  CE2   . PHE B 1  544 ? 161.453 181.208 145.490 1.00 71.70  ? 808  PHE C CE2   1 
ATOM   8201  C  CZ    . PHE B 1  544 ? 161.158 182.529 145.224 1.00 71.70  ? 808  PHE C CZ    1 
ATOM   8202  N  N     . GLN B 1  545 ? 161.943 178.293 139.400 1.00 74.25  ? 809  GLN C N     1 
ATOM   8203  C  CA    . GLN B 1  545 ? 162.534 177.403 138.407 1.00 74.25  ? 809  GLN C CA    1 
ATOM   8204  C  C     . GLN B 1  545 ? 162.262 177.855 136.979 1.00 74.25  ? 809  GLN C C     1 
ATOM   8205  O  O     . GLN B 1  545 ? 162.938 177.381 136.060 1.00 74.25  ? 809  GLN C O     1 
ATOM   8206  C  CB    . GLN B 1  545 ? 162.044 175.967 138.610 1.00 74.25  ? 809  GLN C CB    1 
ATOM   8207  C  CG    . GLN B 1  545 ? 160.566 175.749 138.378 1.00 74.25  ? 809  GLN C CG    1 
ATOM   8208  C  CD    . GLN B 1  545 ? 160.155 174.318 138.656 1.00 74.25  ? 809  GLN C CD    1 
ATOM   8209  O  OE1   . GLN B 1  545 ? 160.993 173.471 138.965 1.00 74.25  ? 809  GLN C OE1   1 
ATOM   8210  N  NE2   . GLN B 1  545 ? 158.863 174.041 138.551 1.00 74.25  ? 809  GLN C NE2   1 
ATOM   8211  N  N     . LEU B 1  546 ? 161.299 178.755 136.770 1.00 75.37  ? 810  LEU C N     1 
ATOM   8212  C  CA    . LEU B 1  546 ? 161.172 179.399 135.467 1.00 75.37  ? 810  LEU C CA    1 
ATOM   8213  C  C     . LEU B 1  546 ? 162.174 180.538 135.307 1.00 75.37  ? 810  LEU C C     1 
ATOM   8214  O  O     . LEU B 1  546 ? 162.714 180.744 134.215 1.00 75.37  ? 810  LEU C O     1 
ATOM   8215  C  CB    . LEU B 1  546 ? 159.749 179.916 135.263 1.00 75.37  ? 810  LEU C CB    1 
ATOM   8216  C  CG    . LEU B 1  546 ? 158.642 178.873 135.115 1.00 75.37  ? 810  LEU C CG    1 
ATOM   8217  C  CD1   . LEU B 1  546 ? 157.285 179.550 135.047 1.00 75.37  ? 810  LEU C CD1   1 
ATOM   8218  C  CD2   . LEU B 1  546 ? 158.879 178.010 133.889 1.00 75.37  ? 810  LEU C CD2   1 
ATOM   8219  N  N     . GLU B 1  547 ? 162.425 181.293 136.379 1.00 76.82  ? 811  GLU C N     1 
ATOM   8220  C  CA    . GLU B 1  547 ? 163.352 182.417 136.291 1.00 76.82  ? 811  GLU C CA    1 
ATOM   8221  C  C     . GLU B 1  547 ? 164.783 181.941 136.092 1.00 76.82  ? 811  GLU C C     1 
ATOM   8222  O  O     . GLU B 1  547 ? 165.590 182.634 135.462 1.00 76.82  ? 811  GLU C O     1 
ATOM   8223  C  CB    . GLU B 1  547 ? 163.248 183.291 137.540 1.00 76.82  ? 811  GLU C CB    1 
ATOM   8224  C  CG    . GLU B 1  547 ? 161.922 184.013 137.680 1.00 76.82  ? 811  GLU C CG    1 
ATOM   8225  C  CD    . GLU B 1  547 ? 161.690 185.013 136.579 1.00 76.82  ? 811  GLU C CD    1 
ATOM   8226  O  OE1   . GLU B 1  547 ? 162.676 185.604 136.086 1.00 76.82  ? 811  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU B 1  547 ? 160.515 185.209 136.197 1.00 76.82  ? 811  GLU C OE2   1 
ATOM   8228  N  N     . ILE B 1  548 ? 165.118 180.762 136.621 1.00 76.32  ? 812  ILE C N     1 
ATOM   8229  C  CA    . ILE B 1  548 ? 166.452 180.221 136.383 1.00 76.32  ? 812  ILE C CA    1 
ATOM   8230  C  C     . ILE B 1  548 ? 166.690 180.014 134.894 1.00 76.32  ? 812  ILE C C     1 
ATOM   8231  O  O     . ILE B 1  548 ? 167.807 180.210 134.400 1.00 76.32  ? 812  ILE C O     1 
ATOM   8232  C  CB    . ILE B 1  548 ? 166.650 178.916 137.175 1.00 76.32  ? 812  ILE C CB    1 
ATOM   8233  C  CG1   . ILE B 1  548 ? 166.582 179.201 138.673 1.00 76.32  ? 812  ILE C CG1   1 
ATOM   8234  C  CG2   . ILE B 1  548 ? 167.977 178.268 136.822 1.00 76.32  ? 812  ILE C CG2   1 
ATOM   8235  C  CD1   . ILE B 1  548 ? 166.508 177.965 139.509 1.00 76.32  ? 812  ILE C CD1   1 
ATOM   8236  N  N     . GLY B 1  549 ? 165.654 179.638 134.154 1.00 79.26  ? 813  GLY C N     1 
ATOM   8237  C  CA    . GLY B 1  549 ? 165.804 179.383 132.739 1.00 79.26  ? 813  GLY C CA    1 
ATOM   8238  C  C     . GLY B 1  549 ? 165.612 180.564 131.816 1.00 79.26  ? 813  GLY C C     1 
ATOM   8239  O  O     . GLY B 1  549 ? 165.733 180.392 130.600 1.00 79.26  ? 813  GLY C O     1 
ATOM   8240  N  N     . GLU B 1  550 ? 165.305 181.749 132.349 1.00 86.10  ? 814  GLU C N     1 
ATOM   8241  C  CA    . GLU B 1  550 ? 165.125 182.956 131.538 1.00 86.10  ? 814  GLU C CA    1 
ATOM   8242  C  C     . GLU B 1  550 ? 164.048 182.753 130.475 1.00 86.10  ? 814  GLU C C     1 
ATOM   8243  O  O     . GLU B 1  550 ? 164.251 183.025 129.289 1.00 86.10  ? 814  GLU C O     1 
ATOM   8244  C  CB    . GLU B 1  550 ? 166.447 183.391 130.901 1.00 86.10  ? 814  GLU C CB    1 
ATOM   8245  C  CG    . GLU B 1  550 ? 167.491 183.860 131.900 1.00 86.10  ? 814  GLU C CG    1 
ATOM   8246  C  CD    . GLU B 1  550 ? 168.806 184.226 131.241 1.00 86.10  ? 814  GLU C CD    1 
ATOM   8247  O  OE1   . GLU B 1  550 ? 168.937 184.012 130.017 1.00 86.10  ? 814  GLU C OE1   1 
ATOM   8248  O  OE2   . GLU B 1  550 ? 169.712 184.717 131.946 1.00 86.10  ? 814  GLU C OE2   1 
ATOM   8249  N  N     . VAL B 1  551 ? 162.881 182.274 130.909 1.00 84.02  ? 815  VAL C N     1 
ATOM   8250  C  CA    . VAL B 1  551 ? 161.785 181.986 129.997 1.00 84.02  ? 815  VAL C CA    1 
ATOM   8251  C  C     . VAL B 1  551 ? 161.129 183.251 129.460 1.00 84.02  ? 815  VAL C C     1 
ATOM   8252  O  O     . VAL B 1  551 ? 160.437 183.198 128.438 1.00 84.02  ? 815  VAL C O     1 
ATOM   8253  C  CB    . VAL B 1  551 ? 160.749 181.081 130.704 1.00 84.02  ? 815  VAL C CB    1 
ATOM   8254  C  CG1   . VAL B 1  551 ? 160.048 181.839 131.820 1.00 84.02  ? 815  VAL C CG1   1 
ATOM   8255  C  CG2   . VAL B 1  551 ? 159.749 180.497 129.710 1.00 84.02  ? 815  VAL C CG2   1 
ATOM   8256  N  N     . TYR B 1  552 ? 161.349 184.398 130.106 1.00 83.01  ? 816  TYR C N     1 
ATOM   8257  C  CA    . TYR B 1  552 ? 160.727 185.639 129.658 1.00 83.01  ? 816  TYR C CA    1 
ATOM   8258  C  C     . TYR B 1  552 ? 161.261 186.124 128.316 1.00 83.01  ? 816  TYR C C     1 
ATOM   8259  O  O     . TYR B 1  552 ? 160.668 187.040 127.734 1.00 83.01  ? 816  TYR C O     1 
ATOM   8260  C  CB    . TYR B 1  552 ? 160.902 186.726 130.721 1.00 83.01  ? 816  TYR C CB    1 
ATOM   8261  C  CG    . TYR B 1  552 ? 162.336 187.118 130.999 1.00 83.01  ? 816  TYR C CG    1 
ATOM   8262  C  CD1   . TYR B 1  552 ? 163.089 186.442 131.949 1.00 83.01  ? 816  TYR C CD1   1 
ATOM   8263  C  CD2   . TYR B 1  552 ? 162.928 188.180 130.328 1.00 83.01  ? 816  TYR C CD2   1 
ATOM   8264  C  CE1   . TYR B 1  552 ? 164.397 186.802 132.211 1.00 83.01  ? 816  TYR C CE1   1 
ATOM   8265  C  CE2   . TYR B 1  552 ? 164.234 188.547 130.584 1.00 83.01  ? 816  TYR C CE2   1 
ATOM   8266  C  CZ    . TYR B 1  552 ? 164.963 187.856 131.527 1.00 83.01  ? 816  TYR C CZ    1 
ATOM   8267  O  OH    . TYR B 1  552 ? 166.265 188.221 131.783 1.00 83.01  ? 816  TYR C OH    1 
ATOM   8268  N  N     . LYS B 1  553 ? 162.291 185.455 127.803 1.00 86.61  ? 817  LYS C N     1 
ATOM   8269  C  CA    . LYS B 1  553 ? 162.882 185.792 126.510 1.00 86.61  ? 817  LYS C CA    1 
ATOM   8270  C  C     . LYS B 1  553 ? 162.887 184.588 125.561 1.00 86.61  ? 817  LYS C C     1 
ATOM   8271  O  O     . LYS B 1  553 ? 162.898 184.749 124.343 1.00 86.61  ? 817  LYS C O     1 
ATOM   8272  C  CB    . LYS B 1  553 ? 164.303 186.319 126.694 1.00 86.61  ? 817  LYS C CB    1 
ATOM   8273  C  CG    . LYS B 1  553 ? 164.482 187.769 126.281 1.00 86.61  ? 817  LYS C CG    1 
ATOM   8274  C  CD    . LYS B 1  553 ? 165.916 188.220 126.494 1.00 86.61  ? 817  LYS C CD    1 
ATOM   8275  C  CE    . LYS B 1  553 ? 166.652 187.275 127.428 1.00 86.61  ? 817  LYS C CE    1 
ATOM   8276  N  NZ    . LYS B 1  553 ? 168.098 187.183 127.092 1.00 86.61  ? 817  LYS C NZ    1 
ATOM   8277  N  N     . HIS B 1  554 ? 162.881 183.387 126.130 1.00 88.03  ? 818  HIS C N     1 
ATOM   8278  C  CA    . HIS B 1  554 ? 162.883 182.145 125.361 1.00 88.03  ? 818  HIS C CA    1 
ATOM   8279  C  C     . HIS B 1  554 ? 161.551 181.436 125.582 1.00 88.03  ? 818  HIS C C     1 
ATOM   8280  O  O     . HIS B 1  554 ? 161.424 180.593 126.480 1.00 88.03  ? 818  HIS C O     1 
ATOM   8281  C  CB    . HIS B 1  554 ? 164.048 181.239 125.755 1.00 88.03  ? 818  HIS C CB    1 
ATOM   8282  C  CG    . HIS B 1  554 ? 165.394 181.803 125.422 1.00 88.03  ? 818  HIS C CG    1 
ATOM   8283  N  ND1   . HIS B 1  554 ? 166.105 182.595 126.296 1.00 88.03  ? 818  HIS C ND1   1 
ATOM   8284  C  CD2   . HIS B 1  554 ? 166.159 181.688 124.311 1.00 88.03  ? 818  HIS C CD2   1 
ATOM   8285  C  CE1   . HIS B 1  554 ? 167.251 182.945 125.738 1.00 88.03  ? 818  HIS C CE1   1 
ATOM   8286  N  NE2   . HIS B 1  554 ? 167.308 182.407 124.533 1.00 88.03  ? 818  HIS C NE2   1 
ATOM   8287  N  N     . PRO B 1  555 ? 160.535 181.758 124.780 1.00 88.93  ? 819  PRO C N     1 
ATOM   8288  C  CA    . PRO B 1  555 ? 159.218 181.137 124.992 1.00 88.93  ? 819  PRO C CA    1 
ATOM   8289  C  C     . PRO B 1  555 ? 159.197 179.649 124.696 1.00 88.93  ? 819  PRO C C     1 
ATOM   8290  O  O     . PRO B 1  555 ? 158.425 178.913 125.324 1.00 88.93  ? 819  PRO C O     1 
ATOM   8291  C  CB    . PRO B 1  555 ? 158.309 181.918 124.034 1.00 88.93  ? 819  PRO C CB    1 
ATOM   8292  C  CG    . PRO B 1  555 ? 159.227 182.394 122.958 1.00 88.93  ? 819  PRO C CG    1 
ATOM   8293  C  CD    . PRO B 1  555 ? 160.541 182.678 123.630 1.00 88.93  ? 819  PRO C CD    1 
ATOM   8294  N  N     . ASN B 1  556 ? 160.018 179.182 123.762 1.00 92.58  ? 820  ASN C N     1 
ATOM   8295  C  CA    . ASN B 1  556 ? 160.071 177.769 123.422 1.00 92.58  ? 820  ASN C CA    1 
ATOM   8296  C  C     . ASN B 1  556 ? 161.085 177.048 124.300 1.00 92.58  ? 820  ASN C C     1 
ATOM   8297  O  O     . ASN B 1  556 ? 162.193 177.536 124.535 1.00 92.58  ? 820  ASN C O     1 
ATOM   8298  C  CB    . ASN B 1  556 ? 160.430 177.581 121.947 1.00 92.58  ? 820  ASN C CB    1 
ATOM   8299  C  CG    . ASN B 1  556 ? 159.315 178.017 121.018 1.00 92.58  ? 820  ASN C CG    1 
ATOM   8300  O  OD1   . ASN B 1  556 ? 158.141 177.746 121.269 1.00 92.58  ? 820  ASN C OD1   1 
ATOM   8301  N  ND2   . ASN B 1  556 ? 159.678 178.699 119.938 1.00 92.58  ? 820  ASN C ND2   1 
ATOM   8302  N  N     . ALA B 1  557 ? 160.691 175.872 124.782 1.00 93.26  ? 821  ALA C N     1 
ATOM   8303  C  CA    . ALA B 1  557 ? 161.544 175.074 125.650 1.00 93.26  ? 821  ALA C CA    1 
ATOM   8304  C  C     . ALA B 1  557 ? 161.036 173.641 125.656 1.00 93.26  ? 821  ALA C C     1 
ATOM   8305  O  O     . ALA B 1  557 ? 159.825 173.408 125.656 1.00 93.26  ? 821  ALA C O     1 
ATOM   8306  C  CB    . ALA B 1  557 ? 161.575 175.635 127.076 1.00 93.26  ? 821  ALA C CB    1 
ATOM   8307  N  N     . SER B 1  558 ? 161.966 172.691 125.660 1.00 95.91  ? 822  SER C N     1 
ATOM   8308  C  CA    . SER B 1  558 ? 161.618 171.278 125.678 1.00 95.91  ? 822  SER C CA    1 
ATOM   8309  C  C     . SER B 1  558 ? 161.388 170.830 127.120 1.00 95.91  ? 822  SER C C     1 
ATOM   8310  O  O     . SER B 1  558 ? 161.349 171.638 128.052 1.00 95.91  ? 822  SER C O     1 
ATOM   8311  C  CB    . SER B 1  558 ? 162.705 170.457 124.990 1.00 95.91  ? 822  SER C CB    1 
ATOM   8312  O  OG    . SER B 1  558 ? 163.917 170.501 125.722 1.00 95.91  ? 822  SER C OG    1 
ATOM   8313  N  N     . LYS B 1  559 ? 161.230 169.522 127.319 1.00 95.50  ? 823  LYS C N     1 
ATOM   8314  C  CA    . LYS B 1  559 ? 161.038 168.972 128.655 1.00 95.50  ? 823  LYS C CA    1 
ATOM   8315  C  C     . LYS B 1  559 ? 162.359 168.767 129.385 1.00 95.50  ? 823  LYS C C     1 
ATOM   8316  O  O     . LYS B 1  559 ? 162.427 168.945 130.608 1.00 95.50  ? 823  LYS C O     1 
ATOM   8317  C  CB    . LYS B 1  559 ? 160.278 167.646 128.572 1.00 95.50  ? 823  LYS C CB    1 
ATOM   8318  C  CG    . LYS B 1  559 ? 158.893 167.765 127.958 1.00 95.50  ? 823  LYS C CG    1 
ATOM   8319  C  CD    . LYS B 1  559 ? 157.998 168.669 128.787 1.00 95.50  ? 823  LYS C CD    1 
ATOM   8320  C  CE    . LYS B 1  559 ? 157.695 168.051 130.142 1.00 95.50  ? 823  LYS C CE    1 
ATOM   8321  N  NZ    . LYS B 1  559 ? 156.906 166.795 130.015 1.00 95.50  ? 823  LYS C NZ    1 
ATOM   8322  N  N     . GLU B 1  560 ? 163.412 168.395 128.652 1.00 96.54  ? 824  GLU C N     1 
ATOM   8323  C  CA    . GLU B 1  560 ? 164.713 168.191 129.278 1.00 96.54  ? 824  GLU C CA    1 
ATOM   8324  C  C     . GLU B 1  560 ? 165.247 169.485 129.874 1.00 96.54  ? 824  GLU C C     1 
ATOM   8325  O  O     . GLU B 1  560 ? 165.875 169.472 130.937 1.00 96.54  ? 824  GLU C O     1 
ATOM   8326  C  CB    . GLU B 1  560 ? 165.700 167.616 128.263 1.00 96.54  ? 824  GLU C CB    1 
ATOM   8327  C  CG    . GLU B 1  560 ? 165.367 166.203 127.813 1.00 96.54  ? 824  GLU C CG    1 
ATOM   8328  C  CD    . GLU B 1  560 ? 166.359 165.663 126.801 1.00 96.54  ? 824  GLU C CD    1 
ATOM   8329  O  OE1   . GLU B 1  560 ? 167.233 166.434 126.352 1.00 96.54  ? 824  GLU C OE1   1 
ATOM   8330  O  OE2   . GLU B 1  560 ? 166.264 164.467 126.455 1.00 96.54  ? 824  GLU C OE2   1 
ATOM   8331  N  N     . GLU B 1  561 ? 165.002 170.616 129.208 1.00 95.91  ? 825  GLU C N     1 
ATOM   8332  C  CA    . GLU B 1  561 ? 165.455 171.899 129.737 1.00 95.91  ? 825  GLU C CA    1 
ATOM   8333  C  C     . GLU B 1  561 ? 164.780 172.211 131.067 1.00 95.91  ? 825  GLU C C     1 
ATOM   8334  O  O     . GLU B 1  561 ? 165.438 172.617 132.032 1.00 95.91  ? 825  GLU C O     1 
ATOM   8335  C  CB    . GLU B 1  561 ? 165.185 173.007 128.719 1.00 95.91  ? 825  GLU C CB    1 
ATOM   8336  C  CG    . GLU B 1  561 ? 166.013 172.891 127.451 1.00 95.91  ? 825  GLU C CG    1 
ATOM   8337  C  CD    . GLU B 1  561 ? 165.698 173.980 126.445 1.00 95.91  ? 825  GLU C CD    1 
ATOM   8338  O  OE1   . GLU B 1  561 ? 164.745 174.752 126.681 1.00 95.91  ? 825  GLU C OE1   1 
ATOM   8339  O  OE2   . GLU B 1  561 ? 166.402 174.063 125.418 1.00 95.91  ? 825  GLU C OE2   1 
ATOM   8340  N  N     . ARG B 1  562 ? 163.460 172.024 131.135 1.00 91.55  ? 826  ARG C N     1 
ATOM   8341  C  CA    . ARG B 1  562 ? 162.742 172.263 132.383 1.00 91.55  ? 826  ARG C CA    1 
ATOM   8342  C  C     . ARG B 1  562 ? 163.200 171.301 133.472 1.00 91.55  ? 826  ARG C C     1 
ATOM   8343  O  O     . ARG B 1  562 ? 163.303 171.682 134.645 1.00 91.55  ? 826  ARG C O     1 
ATOM   8344  C  CB    . ARG B 1  562 ? 161.238 172.139 132.148 1.00 91.55  ? 826  ARG C CB    1 
ATOM   8345  C  CG    . ARG B 1  562 ? 160.669 173.215 131.239 1.00 91.55  ? 826  ARG C CG    1 
ATOM   8346  C  CD    . ARG B 1  562 ? 159.172 173.046 131.043 1.00 91.55  ? 826  ARG C CD    1 
ATOM   8347  N  NE    . ARG B 1  562 ? 158.635 174.028 130.106 1.00 91.55  ? 826  ARG C NE    1 
ATOM   8348  C  CZ    . ARG B 1  562 ? 158.192 175.230 130.459 1.00 91.55  ? 826  ARG C CZ    1 
ATOM   8349  N  NH1   . ARG B 1  562 ? 157.721 176.063 129.542 1.00 91.55  ? 826  ARG C NH1   1 
ATOM   8350  N  NH2   . ARG B 1  562 ? 158.218 175.598 131.732 1.00 91.55  ? 826  ARG C NH2   1 
ATOM   8351  N  N     . LYS B 1  563 ? 163.487 170.051 133.102 1.00 89.71  ? 827  LYS C N     1 
ATOM   8352  C  CA    . LYS B 1  563 ? 163.984 169.092 134.084 1.00 89.71  ? 827  LYS C CA    1 
ATOM   8353  C  C     . LYS B 1  563 ? 165.344 169.514 134.627 1.00 89.71  ? 827  LYS C C     1 
ATOM   8354  O  O     . LYS B 1  563 ? 165.594 169.414 135.834 1.00 89.71  ? 827  LYS C O     1 
ATOM   8355  C  CB    . LYS B 1  563 ? 164.058 167.697 133.466 1.00 89.71  ? 827  LYS C CB    1 
ATOM   8356  C  CG    . LYS B 1  563 ? 164.428 166.604 134.453 1.00 89.71  ? 827  LYS C CG    1 
ATOM   8357  C  CD    . LYS B 1  563 ? 164.491 165.245 133.776 1.00 89.71  ? 827  LYS C CD    1 
ATOM   8358  C  CE    . LYS B 1  563 ? 163.187 164.482 133.945 1.00 89.71  ? 827  LYS C CE    1 
ATOM   8359  N  NZ    . LYS B 1  563 ? 162.121 164.984 133.034 1.00 89.71  ? 827  LYS C NZ    1 
ATOM   8360  N  N     . ARG B 1  564 ? 166.232 169.990 133.752 1.00 88.00  ? 828  ARG C N     1 
ATOM   8361  C  CA    . ARG B 1  564 ? 167.532 170.479 134.201 1.00 88.00  ? 828  ARG C CA    1 
ATOM   8362  C  C     . ARG B 1  564 ? 167.374 171.690 135.109 1.00 88.00  ? 828  ARG C C     1 
ATOM   8363  O  O     . ARG B 1  564 ? 168.090 171.831 136.106 1.00 88.00  ? 828  ARG C O     1 
ATOM   8364  C  CB    . ARG B 1  564 ? 168.411 170.826 133.000 1.00 88.00  ? 828  ARG C CB    1 
ATOM   8365  C  CG    . ARG B 1  564 ? 168.703 169.657 132.087 1.00 88.00  ? 828  ARG C CG    1 
ATOM   8366  C  CD    . ARG B 1  564 ? 169.583 168.629 132.765 1.00 88.00  ? 828  ARG C CD    1 
ATOM   8367  N  NE    . ARG B 1  564 ? 169.816 167.483 131.896 1.00 88.00  ? 828  ARG C NE    1 
ATOM   8368  C  CZ    . ARG B 1  564 ? 170.815 167.399 131.026 1.00 88.00  ? 828  ARG C CZ    1 
ATOM   8369  N  NH1   . ARG B 1  564 ? 170.947 166.319 130.272 1.00 88.00  ? 828  ARG C NH1   1 
ATOM   8370  N  NH2   . ARG B 1  564 ? 171.680 168.397 130.908 1.00 88.00  ? 828  ARG C NH2   1 
ATOM   8371  N  N     . TRP B 1  565 ? 166.438 172.580 134.774 1.00 85.68  ? 829  TRP C N     1 
ATOM   8372  C  CA    . TRP B 1  565 ? 166.199 173.757 135.604 1.00 85.68  ? 829  TRP C CA    1 
ATOM   8373  C  C     . TRP B 1  565 ? 165.734 173.347 136.996 1.00 85.68  ? 829  TRP C C     1 
ATOM   8374  O  O     . TRP B 1  565 ? 166.221 173.862 138.012 1.00 85.68  ? 829  TRP C O     1 
ATOM   8375  C  CB    . TRP B 1  565 ? 165.163 174.663 134.936 1.00 85.68  ? 829  TRP C CB    1 
ATOM   8376  C  CG    . TRP B 1  565 ? 165.600 175.194 133.608 1.00 85.68  ? 829  TRP C CG    1 
ATOM   8377  C  CD1   . TRP B 1  565 ? 166.843 175.099 133.055 1.00 85.68  ? 829  TRP C CD1   1 
ATOM   8378  C  CD2   . TRP B 1  565 ? 164.786 175.879 132.647 1.00 85.68  ? 829  TRP C CD2   1 
ATOM   8379  N  NE1   . TRP B 1  565 ? 166.857 175.692 131.817 1.00 85.68  ? 829  TRP C NE1   1 
ATOM   8380  C  CE2   . TRP B 1  565 ? 165.606 176.176 131.542 1.00 85.68  ? 829  TRP C CE2   1 
ATOM   8381  C  CE3   . TRP B 1  565 ? 163.444 176.273 132.618 1.00 85.68  ? 829  TRP C CE3   1 
ATOM   8382  C  CZ2   . TRP B 1  565 ? 165.131 176.851 130.419 1.00 85.68  ? 829  TRP C CZ2   1 
ATOM   8383  C  CZ3   . TRP B 1  565 ? 162.975 176.944 131.502 1.00 85.68  ? 829  TRP C CZ3   1 
ATOM   8384  C  CH2   . TRP B 1  565 ? 163.816 177.227 130.419 1.00 85.68  ? 829  TRP C CH2   1 
ATOM   8385  N  N     . GLN B 1  566 ? 164.788 172.407 137.056 1.00 80.77  ? 830  GLN C N     1 
ATOM   8386  C  CA    . GLN B 1  566 ? 164.283 171.935 138.340 1.00 80.77  ? 830  GLN C CA    1 
ATOM   8387  C  C     . GLN B 1  566 ? 165.381 171.249 139.144 1.00 80.77  ? 830  GLN C C     1 
ATOM   8388  O  O     . GLN B 1  566 ? 165.496 171.451 140.358 1.00 80.77  ? 830  GLN C O     1 
ATOM   8389  C  CB    . GLN B 1  566 ? 163.103 170.989 138.120 1.00 80.77  ? 830  GLN C CB    1 
ATOM   8390  C  CG    . GLN B 1  566 ? 162.453 170.498 139.402 1.00 80.77  ? 830  GLN C CG    1 
ATOM   8391  C  CD    . GLN B 1  566 ? 161.252 169.613 139.142 1.00 80.77  ? 830  GLN C CD    1 
ATOM   8392  O  OE1   . GLN B 1  566 ? 160.914 169.327 137.994 1.00 80.77  ? 830  GLN C OE1   1 
ATOM   8393  N  NE2   . GLN B 1  566 ? 160.598 169.174 140.211 1.00 80.77  ? 830  GLN C NE2   1 
ATOM   8394  N  N     . ALA B 1  567 ? 166.205 170.433 138.480 1.00 81.13  ? 831  ALA C N     1 
ATOM   8395  C  CA    . ALA B 1  567 ? 167.280 169.739 139.181 1.00 81.13  ? 831  ALA C CA    1 
ATOM   8396  C  C     . ALA B 1  567 ? 168.316 170.721 139.714 1.00 81.13  ? 831  ALA C C     1 
ATOM   8397  O  O     . ALA B 1  567 ? 168.821 170.557 140.832 1.00 81.13  ? 831  ALA C O     1 
ATOM   8398  C  CB    . ALA B 1  567 ? 167.936 168.716 138.255 1.00 81.13  ? 831  ALA C CB    1 
ATOM   8399  N  N     . THR B 1  568 ? 168.647 171.746 138.927 1.00 79.08  ? 832  THR C N     1 
ATOM   8400  C  CA    . THR B 1  568 ? 169.594 172.758 139.380 1.00 79.08  ? 832  THR C CA    1 
ATOM   8401  C  C     . THR B 1  568 ? 169.042 173.520 140.576 1.00 79.08  ? 832  THR C C     1 
ATOM   8402  O  O     . THR B 1  568 ? 169.760 173.769 141.552 1.00 79.08  ? 832  THR C O     1 
ATOM   8403  C  CB    . THR B 1  568 ? 169.922 173.717 138.235 1.00 79.08  ? 832  THR C CB    1 
ATOM   8404  O  OG1   . THR B 1  568 ? 170.497 172.985 137.146 1.00 79.08  ? 832  THR C OG1   1 
ATOM   8405  C  CG2   . THR B 1  568 ? 170.903 174.783 138.697 1.00 79.08  ? 832  THR C CG2   1 
ATOM   8406  N  N     . LEU B 1  569 ? 167.761 173.896 140.520 1.00 75.94  ? 833  LEU C N     1 
ATOM   8407  C  CA    . LEU B 1  569 ? 167.148 174.571 141.660 1.00 75.94  ? 833  LEU C CA    1 
ATOM   8408  C  C     . LEU B 1  569 ? 167.161 173.687 142.900 1.00 75.94  ? 833  LEU C C     1 
ATOM   8409  O  O     . LEU B 1  569 ? 167.453 174.160 144.004 1.00 75.94  ? 833  LEU C O     1 
ATOM   8410  C  CB    . LEU B 1  569 ? 165.721 174.994 141.317 1.00 75.94  ? 833  LEU C CB    1 
ATOM   8411  C  CG    . LEU B 1  569 ? 164.956 175.698 142.438 1.00 75.94  ? 833  LEU C CG    1 
ATOM   8412  C  CD1   . LEU B 1  569 ? 165.688 176.949 142.892 1.00 75.94  ? 833  LEU C CD1   1 
ATOM   8413  C  CD2   . LEU B 1  569 ? 163.555 176.044 141.974 1.00 75.94  ? 833  LEU C CD2   1 
ATOM   8414  N  N     . ASP B 1  570 ? 166.861 172.398 142.735 1.00 79.36  ? 834  ASP C N     1 
ATOM   8415  C  CA    . ASP B 1  570 ? 166.841 171.489 143.877 1.00 79.36  ? 834  ASP C CA    1 
ATOM   8416  C  C     . ASP B 1  570 ? 168.229 171.335 144.486 1.00 79.36  ? 834  ASP C C     1 
ATOM   8417  O  O     . ASP B 1  570 ? 168.387 171.364 145.714 1.00 79.36  ? 834  ASP C O     1 
ATOM   8418  C  CB    . ASP B 1  570 ? 166.283 170.132 143.449 1.00 79.36  ? 834  ASP C CB    1 
ATOM   8419  C  CG    . ASP B 1  570 ? 164.801 170.184 143.145 1.00 79.36  ? 834  ASP C CG    1 
ATOM   8420  O  OD1   . ASP B 1  570 ? 164.102 171.025 143.747 1.00 79.36  ? 834  ASP C OD1   1 
ATOM   8421  O  OD2   . ASP B 1  570 ? 164.336 169.386 142.306 1.00 79.36  ? 834  ASP C OD2   1 
ATOM   8422  N  N     . LYS B 1  571 ? 169.251 171.175 143.642 1.00 76.66  ? 835  LYS C N     1 
ATOM   8423  C  CA    . LYS B 1  571 ? 170.612 171.044 144.153 1.00 76.66  ? 835  LYS C CA    1 
ATOM   8424  C  C     . LYS B 1  571 ? 171.066 172.323 144.842 1.00 76.66  ? 835  LYS C C     1 
ATOM   8425  O  O     . LYS B 1  571 ? 171.719 172.274 145.891 1.00 76.66  ? 835  LYS C O     1 
ATOM   8426  C  CB    . LYS B 1  571 ? 171.568 170.675 143.019 1.00 76.66  ? 835  LYS C CB    1 
ATOM   8427  C  CG    . LYS B 1  571 ? 171.348 169.283 142.455 1.00 76.66  ? 835  LYS C CG    1 
ATOM   8428  C  CD    . LYS B 1  571 ? 172.425 168.919 141.447 1.00 76.66  ? 835  LYS C CD    1 
ATOM   8429  C  CE    . LYS B 1  571 ? 172.226 169.664 140.137 1.00 76.66  ? 835  LYS C CE    1 
ATOM   8430  N  NZ    . LYS B 1  571 ? 173.205 169.237 139.100 1.00 76.66  ? 835  LYS C NZ    1 
ATOM   8431  N  N     . HIS B 1  572 ? 170.716 173.482 144.279 1.00 75.51  ? 836  HIS C N     1 
ATOM   8432  C  CA    . HIS B 1  572 ? 171.097 174.744 144.901 1.00 75.51  ? 836  HIS C CA    1 
ATOM   8433  C  C     . HIS B 1  572 ? 170.392 174.945 146.235 1.00 75.51  ? 836  HIS C C     1 
ATOM   8434  O  O     . HIS B 1  572 ? 170.989 175.486 147.173 1.00 75.51  ? 836  HIS C O     1 
ATOM   8435  C  CB    . HIS B 1  572 ? 170.794 175.904 143.955 1.00 75.51  ? 836  HIS C CB    1 
ATOM   8436  C  CG    . HIS B 1  572 ? 171.217 177.239 144.481 1.00 75.51  ? 836  HIS C CG    1 
ATOM   8437  N  ND1   . HIS B 1  572 ? 172.535 177.641 144.516 1.00 75.51  ? 836  HIS C ND1   1 
ATOM   8438  C  CD2   . HIS B 1  572 ? 170.498 178.263 144.997 1.00 75.51  ? 836  HIS C CD2   1 
ATOM   8439  C  CE1   . HIS B 1  572 ? 172.609 178.857 145.027 1.00 75.51  ? 836  HIS C CE1   1 
ATOM   8440  N  NE2   . HIS B 1  572 ? 171.387 179.257 145.329 1.00 75.51  ? 836  HIS C NE2   1 
ATOM   8441  N  N     . LEU B 1  573 ? 169.134 174.513 146.346 1.00 72.25  ? 837  LEU C N     1 
ATOM   8442  C  CA    . LEU B 1  573 ? 168.430 174.619 147.619 1.00 72.25  ? 837  LEU C CA    1 
ATOM   8443  C  C     . LEU B 1  573 ? 169.026 173.673 148.654 1.00 72.25  ? 837  LEU C C     1 
ATOM   8444  O  O     . LEU B 1  573 ? 169.160 174.030 149.829 1.00 72.25  ? 837  LEU C O     1 
ATOM   8445  C  CB    . LEU B 1  573 ? 166.938 174.346 147.428 1.00 72.25  ? 837  LEU C CB    1 
ATOM   8446  C  CG    . LEU B 1  573 ? 166.136 175.382 146.635 1.00 72.25  ? 837  LEU C CG    1 
ATOM   8447  C  CD1   . LEU B 1  573 ? 164.710 174.902 146.417 1.00 72.25  ? 837  LEU C CD1   1 
ATOM   8448  C  CD2   . LEU B 1  573 ? 166.149 176.737 147.327 1.00 72.25  ? 837  LEU C CD2   1 
ATOM   8449  N  N     . ARG B 1  574 ? 169.386 172.455 148.239 1.00 72.68  ? 838  ARG C N     1 
ATOM   8450  C  CA    . ARG B 1  574 ? 170.048 171.540 149.165 1.00 72.68  ? 838  ARG C CA    1 
ATOM   8451  C  C     . ARG B 1  574 ? 171.389 172.099 149.624 1.00 72.68  ? 838  ARG C C     1 
ATOM   8452  O  O     . ARG B 1  574 ? 171.780 171.927 150.784 1.00 72.68  ? 838  ARG C O     1 
ATOM   8453  C  CB    . ARG B 1  574 ? 170.243 170.164 148.526 1.00 72.68  ? 838  ARG C CB    1 
ATOM   8454  C  CG    . ARG B 1  574 ? 170.843 169.142 149.487 1.00 72.68  ? 838  ARG C CG    1 
ATOM   8455  C  CD    . ARG B 1  574 ? 171.110 167.802 148.820 1.00 72.68  ? 838  ARG C CD    1 
ATOM   8456  N  NE    . ARG B 1  574 ? 169.894 167.087 148.443 1.00 72.68  ? 838  ARG C NE    1 
ATOM   8457  C  CZ    . ARG B 1  574 ? 169.221 166.276 149.253 1.00 72.68  ? 838  ARG C CZ    1 
ATOM   8458  N  NH1   . ARG B 1  574 ? 168.133 165.660 148.817 1.00 72.68  ? 838  ARG C NH1   1 
ATOM   8459  N  NH2   . ARG B 1  574 ? 169.638 166.075 150.495 1.00 72.68  ? 838  ARG C NH2   1 
ATOM   8460  N  N     . LYS B 1  575 ? 172.107 172.775 148.726 1.00 73.22  ? 839  LYS C N     1 
ATOM   8461  C  CA    . LYS B 1  575 ? 173.435 173.276 149.066 1.00 73.22  ? 839  LYS C CA    1 
ATOM   8462  C  C     . LYS B 1  575 ? 173.362 174.499 149.972 1.00 73.22  ? 839  LYS C C     1 
ATOM   8463  O  O     . LYS B 1  575 ? 174.110 174.597 150.952 1.00 73.22  ? 839  LYS C O     1 
ATOM   8464  C  CB    . LYS B 1  575 ? 174.210 173.602 147.790 1.00 73.22  ? 839  LYS C CB    1 
ATOM   8465  C  CG    . LYS B 1  575 ? 175.642 174.050 148.024 1.00 73.22  ? 839  LYS C CG    1 
ATOM   8466  C  CD    . LYS B 1  575 ? 176.364 174.276 146.706 1.00 73.22  ? 839  LYS C CD    1 
ATOM   8467  C  CE    . LYS B 1  575 ? 177.794 174.738 146.927 1.00 73.22  ? 839  LYS C CE    1 
ATOM   8468  N  NZ    . LYS B 1  575 ? 178.509 174.956 145.639 1.00 73.22  ? 839  LYS C NZ    1 
ATOM   8469  N  N     . ARG B 1  576 ? 172.501 175.454 149.643 1.00 74.80  ? 840  ARG C N     1 
ATOM   8470  C  CA    . ARG B 1  576 ? 172.435 176.694 150.416 1.00 74.80  ? 840  ARG C CA    1 
ATOM   8471  C  C     . ARG B 1  576 ? 171.327 176.818 151.456 1.00 74.80  ? 840  ARG C C     1 
ATOM   8472  O  O     . ARG B 1  576 ? 171.461 177.577 152.413 1.00 74.80  ? 840  ARG C O     1 
ATOM   8473  C  CB    . ARG B 1  576 ? 172.375 177.892 149.467 1.00 74.80  ? 840  ARG C CB    1 
ATOM   8474  C  CG    . ARG B 1  576 ? 173.389 178.977 149.782 1.00 74.80  ? 840  ARG C CG    1 
ATOM   8475  C  CD    . ARG B 1  576 ? 174.187 179.357 148.548 1.00 74.80  ? 840  ARG C CD    1 
ATOM   8476  N  NE    . ARG B 1  576 ? 175.613 179.468 148.837 1.00 74.80  ? 840  ARG C NE    1 
ATOM   8477  C  CZ    . ARG B 1  576 ? 176.513 178.543 148.520 1.00 74.80  ? 840  ARG C CZ    1 
ATOM   8478  N  NH1   . ARG B 1  576 ? 176.137 177.433 147.901 1.00 74.80  ? 840  ARG C NH1   1 
ATOM   8479  N  NH2   . ARG B 1  576 ? 177.789 178.728 148.822 1.00 74.80  ? 840  ARG C NH2   1 
ATOM   8480  N  N     . MET B 1  577 ? 170.235 176.091 151.273 1.00 76.14  ? 841  MET C N     1 
ATOM   8481  C  CA    . MET B 1  577 ? 169.124 176.176 152.214 1.00 76.14  ? 841  MET C CA    1 
ATOM   8482  C  C     . MET B 1  577 ? 168.966 174.928 153.070 1.00 76.14  ? 841  MET C C     1 
ATOM   8483  O  O     . MET B 1  577 ? 168.068 174.890 153.920 1.00 76.14  ? 841  MET C O     1 
ATOM   8484  C  CB    . MET B 1  577 ? 167.816 176.454 151.469 1.00 76.14  ? 841  MET C CB    1 
ATOM   8485  C  CG    . MET B 1  577 ? 167.733 177.840 150.879 1.00 76.14  ? 841  MET C CG    1 
ATOM   8486  S  SD    . MET B 1  577 ? 167.889 179.067 152.184 1.00 76.14  ? 841  MET C SD    1 
ATOM   8487  C  CE    . MET B 1  577 ? 166.401 178.727 153.119 1.00 76.14  ? 841  MET C CE    1 
ATOM   8488  N  N     . ASN B 1  578 ? 169.804 173.911 152.869 1.00 76.88  ? 842  ASN C N     1 
ATOM   8489  C  CA    . ASN B 1  578 ? 169.731 172.667 153.635 1.00 76.88  ? 842  ASN C CA    1 
ATOM   8490  C  C     . ASN B 1  578 ? 168.364 172.002 153.500 1.00 76.88  ? 842  ASN C C     1 
ATOM   8491  O  O     . ASN B 1  578 ? 167.912 171.295 154.404 1.00 76.88  ? 842  ASN C O     1 
ATOM   8492  C  CB    . ASN B 1  578 ? 170.067 172.903 155.111 1.00 76.88  ? 842  ASN C CB    1 
ATOM   8493  C  CG    . ASN B 1  578 ? 171.513 173.297 155.322 1.00 76.88  ? 842  ASN C CG    1 
ATOM   8494  O  OD1   . ASN B 1  578 ? 172.414 172.757 154.683 1.00 76.88  ? 842  ASN C OD1   1 
ATOM   8495  N  ND2   . ASN B 1  578 ? 171.743 174.241 156.228 1.00 76.88  ? 842  ASN C ND2   1 
ATOM   8496  N  N     . LEU B 1  579 ? 167.694 172.230 152.375 1.00 74.97  ? 843  LEU C N     1 
ATOM   8497  C  CA    . LEU B 1  579 ? 166.358 171.708 152.134 1.00 74.97  ? 843  LEU C CA    1 
ATOM   8498  C  C     . LEU B 1  579 ? 166.430 170.459 151.267 1.00 74.97  ? 843  LEU C C     1 
ATOM   8499  O  O     . LEU B 1  579 ? 167.210 170.396 150.313 1.00 74.97  ? 843  LEU C O     1 
ATOM   8500  C  CB    . LEU B 1  579 ? 165.478 172.760 151.457 1.00 74.97  ? 843  LEU C CB    1 
ATOM   8501  C  CG    . LEU B 1  579 ? 165.151 173.995 152.298 1.00 74.97  ? 843  LEU C CG    1 
ATOM   8502  C  CD1   . LEU B 1  579 ? 164.415 175.039 151.473 1.00 74.97  ? 843  LEU C CD1   1 
ATOM   8503  C  CD2   . LEU B 1  579 ? 164.336 173.601 153.516 1.00 74.97  ? 843  LEU C CD2   1 
ATOM   8504  N  N     . LYS B 1  580 ? 165.618 169.472 151.605 1.00 75.72  ? 844  LYS C N     1 
ATOM   8505  C  CA    . LYS B 1  580 ? 165.556 168.254 150.805 1.00 75.72  ? 844  LYS C CA    1 
ATOM   8506  C  C     . LYS B 1  580 ? 164.463 168.377 149.752 1.00 75.72  ? 844  LYS C C     1 
ATOM   8507  O  O     . LYS B 1  580 ? 163.315 168.683 150.095 1.00 75.72  ? 844  LYS C O     1 
ATOM   8508  C  CB    . LYS B 1  580 ? 165.284 167.043 151.685 1.00 75.72  ? 844  LYS C CB    1 
ATOM   8509  C  CG    . LYS B 1  580 ? 165.229 165.730 150.926 1.00 75.72  ? 844  LYS C CG    1 
ATOM   8510  C  CD    . LYS B 1  580 ? 165.076 164.556 151.876 1.00 75.72  ? 844  LYS C CD    1 
ATOM   8511  C  CE    . LYS B 1  580 ? 163.682 164.513 152.477 1.00 75.72  ? 844  LYS C CE    1 
ATOM   8512  N  NZ    . LYS B 1  580 ? 162.653 164.170 151.459 1.00 75.72  ? 844  LYS C NZ    1 
ATOM   8513  N  N     . PRO B 1  581 ? 164.773 168.145 148.477 1.00 75.85  ? 845  PRO C N     1 
ATOM   8514  C  CA    . PRO B 1  581 ? 163.739 168.227 147.435 1.00 75.85  ? 845  PRO C CA    1 
ATOM   8515  C  C     . PRO B 1  581 ? 162.672 167.163 147.638 1.00 75.85  ? 845  PRO C C     1 
ATOM   8516  O  O     . PRO B 1  581 ? 162.972 165.972 147.744 1.00 75.85  ? 845  PRO C O     1 
ATOM   8517  C  CB    . PRO B 1  581 ? 164.524 167.997 146.139 1.00 75.85  ? 845  PRO C CB    1 
ATOM   8518  C  CG    . PRO B 1  581 ? 165.926 168.369 146.481 1.00 75.85  ? 845  PRO C CG    1 
ATOM   8519  C  CD    . PRO B 1  581 ? 166.115 167.963 147.906 1.00 75.85  ? 845  PRO C CD    1 
ATOM   8520  N  N     . ILE B 1  582 ? 161.419 167.607 147.693 1.00 79.03  ? 846  ILE C N     1 
ATOM   8521  C  CA    . ILE B 1  582 ? 160.277 166.730 147.890 1.00 79.03  ? 846  ILE C CA    1 
ATOM   8522  C  C     . ILE B 1  582 ? 159.372 166.824 146.667 1.00 79.03  ? 846  ILE C C     1 
ATOM   8523  O  O     . ILE B 1  582 ? 159.524 167.701 145.816 1.00 79.03  ? 846  ILE C O     1 
ATOM   8524  C  CB    . ILE B 1  582 ? 159.502 167.067 149.177 1.00 79.03  ? 846  ILE C CB    1 
ATOM   8525  C  CG1   . ILE B 1  582 ? 158.980 168.504 149.115 1.00 79.03  ? 846  ILE C CG1   1 
ATOM   8526  C  CG2   . ILE B 1  582 ? 160.389 166.874 150.394 1.00 79.03  ? 846  ILE C CG2   1 
ATOM   8527  C  CD1   . ILE B 1  582 ? 158.049 168.865 150.244 1.00 79.03  ? 846  ILE C CD1   1 
ATOM   8528  N  N     . MET B 1  583 ? 158.421 165.894 146.587 1.00 83.12  ? 847  MET C N     1 
ATOM   8529  C  CA    . MET B 1  583 ? 157.486 165.831 145.468 1.00 83.12  ? 847  MET C CA    1 
ATOM   8530  C  C     . MET B 1  583 ? 156.201 166.600 145.758 1.00 83.12  ? 847  MET C C     1 
ATOM   8531  O  O     . MET B 1  583 ? 155.816 167.486 144.990 1.00 83.12  ? 847  MET C O     1 
ATOM   8532  C  CB    . MET B 1  583 ? 157.173 164.367 145.130 1.00 83.12  ? 847  MET C CB    1 
ATOM   8533  C  CG    . MET B 1  583 ? 158.359 163.597 144.573 1.00 83.12  ? 847  MET C CG    1 
ATOM   8534  S  SD    . MET B 1  583 ? 157.984 161.860 144.269 1.00 83.12  ? 847  MET C SD    1 
ATOM   8535  C  CE    . MET B 1  583 ? 156.883 161.992 142.863 1.00 83.12  ? 847  MET C CE    1 
ATOM   8536  N  N     . ARG B 1  584 ? 155.540 166.252 146.857 1.00 82.02  ? 848  ARG C N     1 
ATOM   8537  C  CA    . ARG B 1  584 ? 154.307 166.919 147.254 1.00 82.02  ? 848  ARG C CA    1 
ATOM   8538  C  C     . ARG B 1  584 ? 154.635 168.043 148.228 1.00 82.02  ? 848  ARG C C     1 
ATOM   8539  O  O     . ARG B 1  584 ? 155.302 167.822 149.238 1.00 82.02  ? 848  ARG C O     1 
ATOM   8540  C  CB    . ARG B 1  584 ? 153.340 165.925 147.899 1.00 82.02  ? 848  ARG C CB    1 
ATOM   8541  C  CG    . ARG B 1  584 ? 151.872 166.265 147.694 1.00 82.02  ? 848  ARG C CG    1 
ATOM   8542  C  CD    . ARG B 1  584 ? 151.005 165.648 148.779 1.00 82.02  ? 848  ARG C CD    1 
ATOM   8543  N  NE    . ARG B 1  584 ? 149.748 166.369 148.951 1.00 82.02  ? 848  ARG C NE    1 
ATOM   8544  C  CZ    . ARG B 1  584 ? 149.658 167.683 149.125 1.00 82.02  ? 848  ARG C CZ    1 
ATOM   8545  N  NH1   . ARG B 1  584 ? 150.755 168.427 149.150 1.00 82.02  ? 848  ARG C NH1   1 
ATOM   8546  N  NH2   . ARG B 1  584 ? 148.471 168.255 149.273 1.00 82.02  ? 848  ARG C NH2   1 
ATOM   8547  N  N     . MET B 1  585 ? 154.167 169.249 147.924 1.00 75.47  ? 849  MET C N     1 
ATOM   8548  C  CA    . MET B 1  585 ? 154.442 170.397 148.779 1.00 75.47  ? 849  MET C CA    1 
ATOM   8549  C  C     . MET B 1  585 ? 153.773 170.239 150.139 1.00 75.47  ? 849  MET C C     1 
ATOM   8550  O  O     . MET B 1  585 ? 152.612 169.836 150.234 1.00 75.47  ? 849  MET C O     1 
ATOM   8551  C  CB    . MET B 1  585 ? 153.954 171.677 148.097 1.00 75.47  ? 849  MET C CB    1 
ATOM   8552  C  CG    . MET B 1  585 ? 154.255 172.956 148.856 1.00 75.47  ? 849  MET C CG    1 
ATOM   8553  S  SD    . MET B 1  585 ? 156.015 173.270 149.030 1.00 75.47  ? 849  MET C SD    1 
ATOM   8554  C  CE    . MET B 1  585 ? 156.452 173.693 147.346 1.00 75.47  ? 849  MET C CE    1 
ATOM   8555  N  N     . ASN B 1  586 ? 154.510 170.568 151.194 1.00 71.04  ? 850  ASN C N     1 
ATOM   8556  C  CA    . ASN B 1  586 ? 153.999 170.504 152.557 1.00 71.04  ? 850  ASN C CA    1 
ATOM   8557  C  C     . ASN B 1  586 ? 154.182 171.861 153.240 1.00 71.04  ? 850  ASN C C     1 
ATOM   8558  O  O     . ASN B 1  586 ? 154.549 172.855 152.608 1.00 71.04  ? 850  ASN C O     1 
ATOM   8559  C  CB    . ASN B 1  586 ? 154.671 169.366 153.333 1.00 71.04  ? 850  ASN C CB    1 
ATOM   8560  C  CG    . ASN B 1  586 ? 156.175 169.532 153.443 1.00 71.04  ? 850  ASN C CG    1 
ATOM   8561  O  OD1   . ASN B 1  586 ? 156.736 170.539 153.018 1.00 71.04  ? 850  ASN C OD1   1 
ATOM   8562  N  ND2   . ASN B 1  586 ? 156.834 168.538 154.024 1.00 71.04  ? 850  ASN C ND2   1 
ATOM   8563  N  N     . GLY B 1  587 ? 153.924 171.892 154.545 1.00 67.94  ? 851  GLY C N     1 
ATOM   8564  C  CA    . GLY B 1  587 ? 153.924 173.133 155.295 1.00 67.94  ? 851  GLY C CA    1 
ATOM   8565  C  C     . GLY B 1  587 ? 155.287 173.650 155.707 1.00 67.94  ? 851  GLY C C     1 
ATOM   8566  O  O     . GLY B 1  587 ? 155.555 174.850 155.601 1.00 67.94  ? 851  GLY C O     1 
ATOM   8567  N  N     . ASN B 1  588 ? 156.156 172.760 156.194 1.00 65.77  ? 852  ASN C N     1 
ATOM   8568  C  CA    . ASN B 1  588 ? 157.459 173.198 156.682 1.00 65.77  ? 852  ASN C CA    1 
ATOM   8569  C  C     . ASN B 1  588 ? 158.346 173.704 155.552 1.00 65.77  ? 852  ASN C C     1 
ATOM   8570  O  O     . ASN B 1  588 ? 159.041 174.715 155.716 1.00 65.77  ? 852  ASN C O     1 
ATOM   8571  C  CB    . ASN B 1  588 ? 158.148 172.059 157.433 1.00 65.77  ? 852  ASN C CB    1 
ATOM   8572  C  CG    . ASN B 1  588 ? 157.484 171.754 158.760 1.00 65.77  ? 852  ASN C CG    1 
ATOM   8573  O  OD1   . ASN B 1  588 ? 157.097 172.661 159.497 1.00 65.77  ? 852  ASN C OD1   1 
ATOM   8574  N  ND2   . ASN B 1  588 ? 157.352 170.471 159.074 1.00 65.77  ? 852  ASN C ND2   1 
ATOM   8575  N  N     . PHE B 1  589 ? 158.264 173.044 154.403 1.00 66.08  ? 853  PHE C N     1 
ATOM   8576  C  CA    . PHE B 1  589 ? 159.018 173.443 153.229 1.00 66.08  ? 853  PHE C CA    1 
ATOM   8577  C  C     . PHE B 1  589 ? 158.550 174.830 152.810 1.00 66.08  ? 853  PHE C C     1 
ATOM   8578  O  O     . PHE B 1  589 ? 159.347 175.674 152.413 1.00 66.08  ? 853  PHE C O     1 
ATOM   8579  C  CB    . PHE B 1  589 ? 158.783 172.447 152.097 1.00 66.08  ? 853  PHE C CB    1 
ATOM   8580  C  CG    . PHE B 1  589 ? 159.724 172.608 150.940 1.00 66.08  ? 853  PHE C CG    1 
ATOM   8581  C  CD1   . PHE B 1  589 ? 160.896 171.879 150.879 1.00 66.08  ? 853  PHE C CD1   1 
ATOM   8582  C  CD2   . PHE B 1  589 ? 159.429 173.479 149.909 1.00 66.08  ? 853  PHE C CD2   1 
ATOM   8583  C  CE1   . PHE B 1  589 ? 161.762 172.019 149.814 1.00 66.08  ? 853  PHE C CE1   1 
ATOM   8584  C  CE2   . PHE B 1  589 ? 160.291 173.625 148.840 1.00 66.08  ? 853  PHE C CE2   1 
ATOM   8585  C  CZ    . PHE B 1  589 ? 161.459 172.893 148.793 1.00 66.08  ? 853  PHE C CZ    1 
ATOM   8586  N  N     . ALA B 1  590 ? 157.244 175.055 152.903 1.00 65.72  ? 854  ALA C N     1 
ATOM   8587  C  CA    . ALA B 1  590 ? 156.654 176.344 152.556 1.00 65.72  ? 854  ALA C CA    1 
ATOM   8588  C  C     . ALA B 1  590 ? 157.126 177.436 153.507 1.00 65.72  ? 854  ALA C C     1 
ATOM   8589  O  O     . ALA B 1  590 ? 157.476 178.541 153.076 1.00 65.72  ? 854  ALA C O     1 
ATOM   8590  C  CB    . ALA B 1  590 ? 155.129 176.240 152.570 1.00 65.72  ? 854  ALA C CB    1 
ATOM   8591  N  N     . ARG B 1  591 ? 157.137 177.144 154.810 1.00 66.12  ? 855  ARG C N     1 
ATOM   8592  C  CA    . ARG B 1  591 ? 157.580 178.130 155.790 1.00 66.12  ? 855  ARG C CA    1 
ATOM   8593  C  C     . ARG B 1  591 ? 159.056 178.460 155.626 1.00 66.12  ? 855  ARG C C     1 
ATOM   8594  O  O     . ARG B 1  591 ? 159.464 179.606 155.845 1.00 66.12  ? 855  ARG C O     1 
ATOM   8595  C  CB    . ARG B 1  591 ? 157.315 177.620 157.206 1.00 66.12  ? 855  ARG C CB    1 
ATOM   8596  C  CG    . ARG B 1  591 ? 155.848 177.479 157.563 1.00 66.12  ? 855  ARG C CG    1 
ATOM   8597  C  CD    . ARG B 1  591 ? 155.689 176.959 158.982 1.00 66.12  ? 855  ARG C CD    1 
ATOM   8598  N  NE    . ARG B 1  591 ? 154.289 176.789 159.356 1.00 66.12  ? 855  ARG C NE    1 
ATOM   8599  C  CZ    . ARG B 1  591 ? 153.605 175.664 159.180 1.00 66.12  ? 855  ARG C CZ    1 
ATOM   8600  N  NH1   . ARG B 1  591 ? 154.191 174.610 158.631 1.00 66.12  ? 855  ARG C NH1   1 
ATOM   8601  N  NH2   . ARG B 1  591 ? 152.335 175.592 159.551 1.00 66.12  ? 855  ARG C NH2   1 
ATOM   8602  N  N     . LYS B 1  592 ? 159.871 177.473 155.250 1.00 70.12  ? 856  LYS C N     1 
ATOM   8603  C  CA    . LYS B 1  592 ? 161.300 177.713 155.091 1.00 70.12  ? 856  LYS C CA    1 
ATOM   8604  C  C     . LYS B 1  592 ? 161.629 178.364 153.754 1.00 70.12  ? 856  LYS C C     1 
ATOM   8605  O  O     . LYS B 1  592 ? 162.667 179.023 153.631 1.00 70.12  ? 856  LYS C O     1 
ATOM   8606  C  CB    . LYS B 1  592 ? 162.075 176.403 155.238 1.00 70.12  ? 856  LYS C CB    1 
ATOM   8607  C  CG    . LYS B 1  592 ? 162.062 175.827 156.643 1.00 70.12  ? 856  LYS C CG    1 
ATOM   8608  C  CD    . LYS B 1  592 ? 162.879 174.548 156.719 1.00 70.12  ? 856  LYS C CD    1 
ATOM   8609  C  CE    . LYS B 1  592 ? 162.855 173.956 158.118 1.00 70.12  ? 856  LYS C CE    1 
ATOM   8610  N  NZ    . LYS B 1  592 ? 163.643 172.694 158.198 1.00 70.12  ? 856  LYS C NZ    1 
ATOM   8611  N  N     . LEU B 1  593 ? 160.769 178.194 152.747 1.00 70.46  ? 857  LEU C N     1 
ATOM   8612  C  CA    . LEU B 1  593 ? 161.059 178.752 151.431 1.00 70.46  ? 857  LEU C CA    1 
ATOM   8613  C  C     . LEU B 1  593 ? 160.839 180.260 151.404 1.00 70.46  ? 857  LEU C C     1 
ATOM   8614  O  O     . LEU B 1  593 ? 161.599 180.992 150.760 1.00 70.46  ? 857  LEU C O     1 
ATOM   8615  C  CB    . LEU B 1  593 ? 160.198 178.063 150.373 1.00 70.46  ? 857  LEU C CB    1 
ATOM   8616  C  CG    . LEU B 1  593 ? 160.433 178.470 148.918 1.00 70.46  ? 857  LEU C CG    1 
ATOM   8617  C  CD1   . LEU B 1  593 ? 161.844 178.115 148.481 1.00 70.46  ? 857  LEU C CD1   1 
ATOM   8618  C  CD2   . LEU B 1  593 ? 159.407 177.815 148.008 1.00 70.46  ? 857  LEU C CD2   1 
ATOM   8619  N  N     . MET B 1  594 ? 159.809 180.745 152.096 1.00 74.78  ? 858  MET C N     1 
ATOM   8620  C  CA    . MET B 1  594 ? 159.494 182.168 152.086 1.00 74.78  ? 858  MET C CA    1 
ATOM   8621  C  C     . MET B 1  594 ? 160.446 182.955 152.978 1.00 74.78  ? 858  MET C C     1 
ATOM   8622  O  O     . MET B 1  594 ? 160.181 183.135 154.171 1.00 74.78  ? 858  MET C O     1 
ATOM   8623  C  CB    . MET B 1  594 ? 158.047 182.395 152.527 1.00 74.78  ? 858  MET C CB    1 
ATOM   8624  C  CG    . MET B 1  594 ? 157.011 181.796 151.592 1.00 74.78  ? 858  MET C CG    1 
ATOM   8625  S  SD    . MET B 1  594 ? 157.092 182.477 149.926 1.00 74.78  ? 858  MET C SD    1 
ATOM   8626  C  CE    . MET B 1  594 ? 157.889 181.137 149.043 1.00 74.78  ? 858  MET C CE    1 
ATOM   8627  N  N     . THR B 1  595 ? 161.553 183.429 152.410 1.00 76.71  ? 859  THR C N     1 
ATOM   8628  C  CA    . THR B 1  595 ? 162.533 184.204 153.158 1.00 76.71  ? 859  THR C CA    1 
ATOM   8629  C  C     . THR B 1  595 ? 163.351 185.019 152.164 1.00 76.71  ? 859  THR C C     1 
ATOM   8630  O  O     . THR B 1  595 ? 163.578 184.577 151.036 1.00 76.71  ? 859  THR C O     1 
ATOM   8631  C  CB    . THR B 1  595 ? 163.444 183.296 153.999 1.00 76.71  ? 859  THR C CB    1 
ATOM   8632  O  OG1   . THR B 1  595 ? 162.644 182.472 154.856 1.00 76.71  ? 859  THR C OG1   1 
ATOM   8633  C  CG2   . THR B 1  595 ? 164.373 184.124 154.871 1.00 76.71  ? 859  THR C CG2   1 
ATOM   8634  N  N     . GLN B 1  596 ? 163.778 186.213 152.586 1.00 78.58  ? 860  GLN C N     1 
ATOM   8635  C  CA    . GLN B 1  596 ? 164.538 187.088 151.697 1.00 78.58  ? 860  GLN C CA    1 
ATOM   8636  C  C     . GLN B 1  596 ? 165.874 186.470 151.302 1.00 78.58  ? 860  GLN C C     1 
ATOM   8637  O  O     . GLN B 1  596 ? 166.301 186.580 150.146 1.00 78.58  ? 860  GLN C O     1 
ATOM   8638  C  CB    . GLN B 1  596 ? 164.755 188.448 152.362 1.00 78.58  ? 860  GLN C CB    1 
ATOM   8639  C  CG    . GLN B 1  596 ? 163.477 189.234 152.601 1.00 78.58  ? 860  GLN C CG    1 
ATOM   8640  C  CD    . GLN B 1  596 ? 162.811 189.667 151.310 1.00 78.58  ? 860  GLN C CD    1 
ATOM   8641  O  OE1   . GLN B 1  596 ? 163.482 190.038 150.348 1.00 78.58  ? 860  GLN C OE1   1 
ATOM   8642  N  NE2   . GLN B 1  596 ? 161.485 189.623 151.284 1.00 78.58  ? 860  GLN C NE2   1 
ATOM   8643  N  N     . GLU B 1  597 ? 166.555 185.820 152.247 1.00 82.81  ? 861  GLU C N     1 
ATOM   8644  C  CA    . GLU B 1  597 ? 167.830 185.194 151.916 1.00 82.81  ? 861  GLU C CA    1 
ATOM   8645  C  C     . GLU B 1  597 ? 167.648 183.988 151.005 1.00 82.81  ? 861  GLU C C     1 
ATOM   8646  O  O     . GLU B 1  597 ? 168.562 183.649 150.244 1.00 82.81  ? 861  GLU C O     1 
ATOM   8647  C  CB    . GLU B 1  597 ? 168.582 184.812 153.194 1.00 82.81  ? 861  GLU C CB    1 
ATOM   8648  C  CG    . GLU B 1  597 ? 167.850 183.857 154.115 1.00 82.81  ? 861  GLU C CG    1 
ATOM   8649  C  CD    . GLU B 1  597 ? 168.111 182.404 153.784 1.00 82.81  ? 861  GLU C CD    1 
ATOM   8650  O  OE1   . GLU B 1  597 ? 169.100 182.124 153.075 1.00 82.81  ? 861  GLU C OE1   1 
ATOM   8651  O  OE2   . GLU B 1  597 ? 167.335 181.543 154.247 1.00 82.81  ? 861  GLU C OE2   1 
ATOM   8652  N  N     . THR B 1  598 ? 166.482 183.341 151.051 1.00 77.19  ? 862  THR C N     1 
ATOM   8653  C  CA    . THR B 1  598 ? 166.160 182.341 150.038 1.00 77.19  ? 862  THR C CA    1 
ATOM   8654  C  C     . THR B 1  598 ? 166.117 182.974 148.654 1.00 77.19  ? 862  THR C C     1 
ATOM   8655  O  O     . THR B 1  598 ? 166.627 182.406 147.680 1.00 77.19  ? 862  THR C O     1 
ATOM   8656  C  CB    . THR B 1  598 ? 164.824 181.673 150.361 1.00 77.19  ? 862  THR C CB    1 
ATOM   8657  O  OG1   . THR B 1  598 ? 164.889 181.075 151.659 1.00 77.19  ? 862  THR C OG1   1 
ATOM   8658  C  CG2   . THR B 1  598 ? 164.504 180.600 149.334 1.00 77.19  ? 862  THR C CG2   1 
ATOM   8659  N  N     . VAL B 1  599 ? 165.520 184.163 148.552 1.00 78.56  ? 863  VAL C N     1 
ATOM   8660  C  CA    . VAL B 1  599 ? 165.492 184.878 147.281 1.00 78.56  ? 863  VAL C CA    1 
ATOM   8661  C  C     . VAL B 1  599 ? 166.902 185.265 146.859 1.00 78.56  ? 863  VAL C C     1 
ATOM   8662  O  O     . VAL B 1  599 ? 167.229 185.264 145.668 1.00 78.56  ? 863  VAL C O     1 
ATOM   8663  C  CB    . VAL B 1  599 ? 164.569 186.105 147.379 1.00 78.56  ? 863  VAL C CB    1 
ATOM   8664  C  CG1   . VAL B 1  599 ? 164.610 186.915 146.092 1.00 78.56  ? 863  VAL C CG1   1 
ATOM   8665  C  CG2   . VAL B 1  599 ? 163.158 185.661 147.679 1.00 78.56  ? 863  VAL C CG2   1 
ATOM   8666  N  N     . ASP B 1  600 ? 167.761 185.597 147.823 1.00 78.89  ? 864  ASP C N     1 
ATOM   8667  C  CA    . ASP B 1  600 ? 169.150 185.906 147.494 1.00 78.89  ? 864  ASP C CA    1 
ATOM   8668  C  C     . ASP B 1  600 ? 169.862 184.682 146.929 1.00 78.89  ? 864  ASP C C     1 
ATOM   8669  O  O     . ASP B 1  600 ? 170.569 184.768 145.916 1.00 78.89  ? 864  ASP C O     1 
ATOM   8670  C  CB    . ASP B 1  600 ? 169.878 186.432 148.731 1.00 78.89  ? 864  ASP C CB    1 
ATOM   8671  C  CG    . ASP B 1  600 ? 169.373 187.791 149.169 1.00 78.89  ? 864  ASP C CG    1 
ATOM   8672  O  OD1   . ASP B 1  600 ? 168.916 188.565 148.302 1.00 78.89  ? 864  ASP C OD1   1 
ATOM   8673  O  OD2   . ASP B 1  600 ? 169.431 188.084 150.381 1.00 78.89  ? 864  ASP C OD2   1 
ATOM   8674  N  N     . ALA B 1  601 ? 169.682 183.528 147.576 1.00 78.18  ? 865  ALA C N     1 
ATOM   8675  C  CA    . ALA B 1  601 ? 170.279 182.294 147.077 1.00 78.18  ? 865  ALA C CA    1 
ATOM   8676  C  C     . ALA B 1  601 ? 169.755 181.938 145.692 1.00 78.18  ? 865  ALA C C     1 
ATOM   8677  O  O     . ALA B 1  601 ? 170.503 181.404 144.865 1.00 78.18  ? 865  ALA C O     1 
ATOM   8678  C  CB    . ALA B 1  601 ? 170.018 181.149 148.055 1.00 78.18  ? 865  ALA C CB    1 
ATOM   8679  N  N     . VAL B 1  602 ? 168.482 182.222 145.418 1.00 79.64  ? 866  VAL C N     1 
ATOM   8680  C  CA    . VAL B 1  602 ? 167.934 181.951 144.092 1.00 79.64  ? 866  VAL C CA    1 
ATOM   8681  C  C     . VAL B 1  602 ? 168.512 182.913 143.060 1.00 79.64  ? 866  VAL C C     1 
ATOM   8682  O  O     . VAL B 1  602 ? 168.901 182.506 141.960 1.00 79.64  ? 866  VAL C O     1 
ATOM   8683  C  CB    . VAL B 1  602 ? 166.395 182.010 144.124 1.00 79.64  ? 866  VAL C CB    1 
ATOM   8684  C  CG1   . VAL B 1  602 ? 165.833 181.895 142.719 1.00 79.64  ? 866  VAL C CG1   1 
ATOM   8685  C  CG2   . VAL B 1  602 ? 165.847 180.896 144.998 1.00 79.64  ? 866  VAL C CG2   1 
ATOM   8686  N  N     . CYS B 1  603 ? 168.578 184.204 143.399 1.00 81.78  ? 867  CYS C N     1 
ATOM   8687  C  CA    . CYS B 1  603 ? 169.166 185.197 142.507 1.00 81.78  ? 867  CYS C CA    1 
ATOM   8688  C  C     . CYS B 1  603 ? 170.635 184.920 142.231 1.00 81.78  ? 867  CYS C C     1 
ATOM   8689  O  O     . CYS B 1  603 ? 171.161 185.371 141.207 1.00 81.78  ? 867  CYS C O     1 
ATOM   8690  C  CB    . CYS B 1  603 ? 169.006 186.598 143.101 1.00 81.78  ? 867  CYS C CB    1 
ATOM   8691  S  SG    . CYS B 1  603 ? 167.301 187.189 143.183 1.00 81.78  ? 867  CYS C SG    1 
ATOM   8692  N  N     . GLU B 1  604 ? 171.311 184.196 143.125 1.00 80.20  ? 868  GLU C N     1 
ATOM   8693  C  CA    . GLU B 1  604 ? 172.663 183.735 142.833 1.00 80.20  ? 868  GLU C CA    1 
ATOM   8694  C  C     . GLU B 1  604 ? 172.724 182.829 141.607 1.00 80.20  ? 868  GLU C C     1 
ATOM   8695  O  O     . GLU B 1  604 ? 173.826 182.537 141.130 1.00 80.20  ? 868  GLU C O     1 
ATOM   8696  C  CB    . GLU B 1  604 ? 173.245 182.997 144.040 1.00 80.20  ? 868  GLU C CB    1 
ATOM   8697  C  CG    . GLU B 1  604 ? 173.524 183.884 145.240 1.00 80.20  ? 868  GLU C CG    1 
ATOM   8698  C  CD    . GLU B 1  604 ? 174.072 183.108 146.421 1.00 80.20  ? 868  GLU C CD    1 
ATOM   8699  O  OE1   . GLU B 1  604 ? 174.122 181.862 146.343 1.00 80.20  ? 868  GLU C OE1   1 
ATOM   8700  O  OE2   . GLU B 1  604 ? 174.450 183.742 147.428 1.00 80.20  ? 868  GLU C OE2   1 
ATOM   8701  N  N     . LEU B 1  605 ? 171.578 182.383 141.089 1.00 78.96  ? 869  LEU C N     1 
ATOM   8702  C  CA    . LEU B 1  605 ? 171.519 181.521 139.917 1.00 78.96  ? 869  LEU C CA    1 
ATOM   8703  C  C     . LEU B 1  605 ? 171.121 182.257 138.644 1.00 78.96  ? 869  LEU C C     1 
ATOM   8704  O  O     . LEU B 1  605 ? 171.249 181.687 137.556 1.00 78.96  ? 869  LEU C O     1 
ATOM   8705  C  CB    . LEU B 1  605 ? 170.527 180.375 140.154 1.00 78.96  ? 869  LEU C CB    1 
ATOM   8706  C  CG    . LEU B 1  605 ? 170.844 179.349 141.242 1.00 78.96  ? 869  LEU C CG    1 
ATOM   8707  C  CD1   . LEU B 1  605 ? 169.662 178.418 141.447 1.00 78.96  ? 869  LEU C CD1   1 
ATOM   8708  C  CD2   . LEU B 1  605 ? 172.077 178.557 140.875 1.00 78.96  ? 869  LEU C CD2   1 
ATOM   8709  N  N     . ILE B 1  606 ? 170.646 183.489 138.747 1.00 82.50  ? 870  ILE C N     1 
ATOM   8710  C  CA    . ILE B 1  606 ? 170.098 184.227 137.612 1.00 82.50  ? 870  ILE C CA    1 
ATOM   8711  C  C     . ILE B 1  606 ? 171.120 185.265 137.163 1.00 82.50  ? 870  ILE C C     1 
ATOM   8712  O  O     . ILE B 1  606 ? 171.588 186.053 137.997 1.00 82.50  ? 870  ILE C O     1 
ATOM   8713  C  CB    . ILE B 1  606 ? 168.761 184.898 137.972 1.00 82.50  ? 870  ILE C CB    1 
ATOM   8714  C  CG1   . ILE B 1  606 ? 167.723 183.838 138.339 1.00 82.50  ? 870  ILE C CG1   1 
ATOM   8715  C  CG2   . ILE B 1  606 ? 168.267 185.752 136.818 1.00 82.50  ? 870  ILE C CG2   1 
ATOM   8716  C  CD1   . ILE B 1  606 ? 166.470 184.404 138.961 1.00 82.50  ? 870  ILE C CD1   1 
ATOM   8717  N  N     . PRO B 1  607 ? 171.491 185.300 135.882 1.00 84.88  ? 871  PRO C N     1 
ATOM   8718  C  CA    . PRO B 1  607 ? 172.488 186.274 135.417 1.00 84.88  ? 871  PRO C CA    1 
ATOM   8719  C  C     . PRO B 1  607 ? 171.981 187.708 135.422 1.00 84.88  ? 871  PRO C C     1 
ATOM   8720  O  O     . PRO B 1  607 ? 172.726 188.633 135.763 1.00 84.88  ? 871  PRO C O     1 
ATOM   8721  C  CB    . PRO B 1  607 ? 172.793 185.807 133.987 1.00 84.88  ? 871  PRO C CB    1 
ATOM   8722  C  CG    . PRO B 1  607 ? 172.371 184.373 133.951 1.00 84.88  ? 871  PRO C CG    1 
ATOM   8723  C  CD    . PRO B 1  607 ? 171.177 184.299 134.850 1.00 84.88  ? 871  PRO C CD    1 
ATOM   8724  N  N     . SER B 1  608 ? 170.722 187.903 135.036 1.00 87.25  ? 872  SER C N     1 
ATOM   8725  C  CA    . SER B 1  608 ? 170.170 189.240 134.873 1.00 87.25  ? 872  SER C CA    1 
ATOM   8726  C  C     . SER B 1  608 ? 170.147 189.989 136.206 1.00 87.25  ? 872  SER C C     1 
ATOM   8727  O  O     . SER B 1  608 ? 170.242 189.403 137.289 1.00 87.25  ? 872  SER C O     1 
ATOM   8728  C  CB    . SER B 1  608 ? 168.763 189.170 134.282 1.00 87.25  ? 872  SER C CB    1 
ATOM   8729  O  OG    . SER B 1  608 ? 168.205 190.464 134.140 1.00 87.25  ? 872  SER C OG    1 
ATOM   8730  N  N     . GLU B 1  609 ? 170.010 191.311 136.113 1.00 89.78  ? 873  GLU C N     1 
ATOM   8731  C  CA    . GLU B 1  609 ? 170.045 192.174 137.289 1.00 89.78  ? 873  GLU C CA    1 
ATOM   8732  C  C     . GLU B 1  609 ? 168.647 192.627 137.705 1.00 89.78  ? 873  GLU C C     1 
ATOM   8733  O  O     . GLU B 1  609 ? 168.277 192.520 138.878 1.00 89.78  ? 873  GLU C O     1 
ATOM   8734  C  CB    . GLU B 1  609 ? 170.942 193.387 137.022 1.00 89.78  ? 873  GLU C CB    1 
ATOM   8735  C  CG    . GLU B 1  609 ? 172.413 193.049 136.863 1.00 89.78  ? 873  GLU C CG    1 
ATOM   8736  C  CD    . GLU B 1  609 ? 173.262 194.272 136.582 1.00 89.78  ? 873  GLU C CD    1 
ATOM   8737  O  OE1   . GLU B 1  609 ? 172.687 195.363 136.386 1.00 89.78  ? 873  GLU C OE1   1 
ATOM   8738  O  OE2   . GLU B 1  609 ? 174.504 194.144 136.558 1.00 89.78  ? 873  GLU C OE2   1 
ATOM   8739  N  N     . GLU B 1  610 ? 167.866 193.146 136.754 1.00 88.62  ? 874  GLU C N     1 
ATOM   8740  C  CA    . GLU B 1  610 ? 166.548 193.677 137.084 1.00 88.62  ? 874  GLU C CA    1 
ATOM   8741  C  C     . GLU B 1  610 ? 165.583 192.595 137.547 1.00 88.62  ? 874  GLU C C     1 
ATOM   8742  O  O     . GLU B 1  610 ? 164.687 192.881 138.352 1.00 88.62  ? 874  GLU C O     1 
ATOM   8743  C  CB    . GLU B 1  610 ? 165.967 194.423 135.884 1.00 88.62  ? 874  GLU C CB    1 
ATOM   8744  C  CG    . GLU B 1  610 ? 166.713 195.703 135.555 1.00 88.62  ? 874  GLU C CG    1 
ATOM   8745  C  CD    . GLU B 1  610 ? 166.129 196.437 134.366 1.00 88.62  ? 874  GLU C CD    1 
ATOM   8746  O  OE1   . GLU B 1  610 ? 165.212 195.890 133.719 1.00 88.62  ? 874  GLU C OE1   1 
ATOM   8747  O  OE2   . GLU B 1  610 ? 166.589 197.562 134.080 1.00 88.62  ? 874  GLU C OE2   1 
ATOM   8748  N  N     . ARG B 1  611 ? 165.738 191.363 137.058 1.00 81.40  ? 875  ARG C N     1 
ATOM   8749  C  CA    . ARG B 1  611 ? 164.893 190.277 137.540 1.00 81.40  ? 875  ARG C CA    1 
ATOM   8750  C  C     . ARG B 1  611 ? 165.143 190.003 139.017 1.00 81.40  ? 875  ARG C C     1 
ATOM   8751  O  O     . ARG B 1  611 ? 164.224 189.594 139.737 1.00 81.40  ? 875  ARG C O     1 
ATOM   8752  C  CB    . ARG B 1  611 ? 165.127 189.017 136.707 1.00 81.40  ? 875  ARG C CB    1 
ATOM   8753  C  CG    . ARG B 1  611 ? 164.885 189.207 135.215 1.00 81.40  ? 875  ARG C CG    1 
ATOM   8754  C  CD    . ARG B 1  611 ? 163.440 189.569 134.915 1.00 81.40  ? 875  ARG C CD    1 
ATOM   8755  N  NE    . ARG B 1  611 ? 162.498 188.512 135.275 1.00 81.40  ? 875  ARG C NE    1 
ATOM   8756  C  CZ    . ARG B 1  611 ? 161.186 188.696 135.378 1.00 81.40  ? 875  ARG C CZ    1 
ATOM   8757  N  NH1   . ARG B 1  611 ? 160.666 189.893 135.144 1.00 81.40  ? 875  ARG C NH1   1 
ATOM   8758  N  NH2   . ARG B 1  611 ? 160.392 187.688 135.707 1.00 81.40  ? 875  ARG C NH2   1 
ATOM   8759  N  N     . HIS B 1  612 ? 166.371 190.233 139.489 1.00 83.00  ? 876  HIS C N     1 
ATOM   8760  C  CA    . HIS B 1  612 ? 166.646 190.131 140.919 1.00 83.00  ? 876  HIS C CA    1 
ATOM   8761  C  C     . HIS B 1  612 ? 165.809 191.132 141.704 1.00 83.00  ? 876  HIS C C     1 
ATOM   8762  O  O     . HIS B 1  612 ? 165.192 190.784 142.717 1.00 83.00  ? 876  HIS C O     1 
ATOM   8763  C  CB    . HIS B 1  612 ? 168.135 190.354 141.191 1.00 83.00  ? 876  HIS C CB    1 
ATOM   8764  C  CG    . HIS B 1  612 ? 169.021 189.280 140.643 1.00 83.00  ? 876  HIS C CG    1 
ATOM   8765  N  ND1   . HIS B 1  612 ? 170.396 189.367 140.669 1.00 83.00  ? 876  HIS C ND1   1 
ATOM   8766  C  CD2   . HIS B 1  612 ? 168.730 188.101 140.045 1.00 83.00  ? 876  HIS C CD2   1 
ATOM   8767  C  CE1   . HIS B 1  612 ? 170.915 188.284 140.119 1.00 83.00  ? 876  HIS C CE1   1 
ATOM   8768  N  NE2   . HIS B 1  612 ? 169.925 187.500 139.731 1.00 83.00  ? 876  HIS C NE2   1 
ATOM   8769  N  N     . GLU B 1  613 ? 165.782 192.388 141.251 1.00 83.08  ? 877  GLU C N     1 
ATOM   8770  C  CA    . GLU B 1  613 ? 164.969 193.403 141.913 1.00 83.08  ? 877  GLU C CA    1 
ATOM   8771  C  C     . GLU B 1  613 ? 163.495 193.026 141.879 1.00 83.08  ? 877  GLU C C     1 
ATOM   8772  O  O     . GLU B 1  613 ? 162.772 193.200 142.868 1.00 83.08  ? 877  GLU C O     1 
ATOM   8773  C  CB    . GLU B 1  613 ? 165.186 194.763 141.250 1.00 83.08  ? 877  GLU C CB    1 
ATOM   8774  C  CG    . GLU B 1  613 ? 166.580 195.333 141.423 1.00 83.08  ? 877  GLU C CG    1 
ATOM   8775  C  CD    . GLU B 1  613 ? 166.748 196.665 140.720 1.00 83.08  ? 877  GLU C CD    1 
ATOM   8776  O  OE1   . GLU B 1  613 ? 165.813 197.082 140.003 1.00 83.08  ? 877  GLU C OE1   1 
ATOM   8777  O  OE2   . GLU B 1  613 ? 167.814 197.295 140.881 1.00 83.08  ? 877  GLU C OE2   1 
ATOM   8778  N  N     . ALA B 1  614 ? 163.031 192.508 140.740 1.00 78.12  ? 878  ALA C N     1 
ATOM   8779  C  CA    . ALA B 1  614 ? 161.635 192.106 140.613 1.00 78.12  ? 878  ALA C CA    1 
ATOM   8780  C  C     . ALA B 1  614 ? 161.284 191.023 141.627 1.00 78.12  ? 878  ALA C C     1 
ATOM   8781  O  O     . ALA B 1  614 ? 160.290 191.130 142.354 1.00 78.12  ? 878  ALA C O     1 
ATOM   8782  C  CB    . ALA B 1  614 ? 161.359 191.627 139.187 1.00 78.12  ? 878  ALA C CB    1 
ATOM   8783  N  N     . LEU B 1  615 ? 162.103 189.970 141.690 1.00 78.12  ? 879  LEU C N     1 
ATOM   8784  C  CA    . LEU B 1  615 ? 161.837 188.875 142.618 1.00 78.12  ? 879  LEU C CA    1 
ATOM   8785  C  C     . LEU B 1  615 ? 161.917 189.340 144.067 1.00 78.12  ? 879  LEU C C     1 
ATOM   8786  O  O     . LEU B 1  615 ? 161.117 188.913 144.909 1.00 78.12  ? 879  LEU C O     1 
ATOM   8787  C  CB    . LEU B 1  615 ? 162.815 187.728 142.374 1.00 78.12  ? 879  LEU C CB    1 
ATOM   8788  C  CG    . LEU B 1  615 ? 162.688 186.986 141.045 1.00 78.12  ? 879  LEU C CG    1 
ATOM   8789  C  CD1   . LEU B 1  615 ? 163.811 185.975 140.900 1.00 78.12  ? 879  LEU C CD1   1 
ATOM   8790  C  CD2   . LEU B 1  615 ? 161.336 186.305 140.945 1.00 78.12  ? 879  LEU C CD2   1 
ATOM   8791  N  N     . ARG B 1  616 ? 162.877 190.214 144.380 1.00 79.00  ? 880  ARG C N     1 
ATOM   8792  C  CA    . ARG B 1  616 ? 163.016 190.682 145.754 1.00 79.00  ? 880  ARG C CA    1 
ATOM   8793  C  C     . ARG B 1  616 ? 161.820 191.524 146.173 1.00 79.00  ? 880  ARG C C     1 
ATOM   8794  O  O     . ARG B 1  616 ? 161.301 191.360 147.282 1.00 79.00  ? 880  ARG C O     1 
ATOM   8795  C  CB    . ARG B 1  616 ? 164.318 191.464 145.915 1.00 79.00  ? 880  ARG C CB    1 
ATOM   8796  C  CG    . ARG B 1  616 ? 165.560 190.596 145.824 1.00 79.00  ? 880  ARG C CG    1 
ATOM   8797  C  CD    . ARG B 1  616 ? 166.828 191.416 145.953 1.00 79.00  ? 880  ARG C CD    1 
ATOM   8798  N  NE    . ARG B 1  616 ? 168.020 190.586 145.808 1.00 79.00  ? 880  ARG C NE    1 
ATOM   8799  C  CZ    . ARG B 1  616 ? 169.263 191.055 145.813 1.00 79.00  ? 880  ARG C CZ    1 
ATOM   8800  N  NH1   . ARG B 1  616 ? 169.481 192.355 145.959 1.00 79.00  ? 880  ARG C NH1   1 
ATOM   8801  N  NH2   . ARG B 1  616 ? 170.288 190.226 145.674 1.00 79.00  ? 880  ARG C NH2   1 
ATOM   8802  N  N     . GLU B 1  617 ? 161.358 192.420 145.298 1.00 77.44  ? 881  GLU C N     1 
ATOM   8803  C  CA    . GLU B 1  617 ? 160.171 193.206 145.617 1.00 77.44  ? 881  GLU C CA    1 
ATOM   8804  C  C     . GLU B 1  617 ? 158.937 192.316 145.726 1.00 77.44  ? 881  GLU C C     1 
ATOM   8805  O  O     . GLU B 1  617 ? 158.074 192.544 146.582 1.00 77.44  ? 881  GLU C O     1 
ATOM   8806  C  CB    . GLU B 1  617 ? 159.963 194.295 144.566 1.00 77.44  ? 881  GLU C CB    1 
ATOM   8807  C  CG    . GLU B 1  617 ? 158.824 195.249 144.879 1.00 77.44  ? 881  GLU C CG    1 
ATOM   8808  C  CD    . GLU B 1  617 ? 158.685 196.351 143.849 1.00 77.44  ? 881  GLU C CD    1 
ATOM   8809  O  OE1   . GLU B 1  617 ? 159.453 196.348 142.863 1.00 77.44  ? 881  GLU C OE1   1 
ATOM   8810  O  OE2   . GLU B 1  617 ? 157.812 197.225 144.029 1.00 77.44  ? 881  GLU C OE2   1 
ATOM   8811  N  N     . LEU B 1  618 ? 158.847 191.288 144.878 1.00 74.42  ? 882  LEU C N     1 
ATOM   8812  C  CA    . LEU B 1  618 ? 157.727 190.353 144.948 1.00 74.42  ? 882  LEU C CA    1 
ATOM   8813  C  C     . LEU B 1  618 ? 157.691 189.648 146.298 1.00 74.42  ? 882  LEU C C     1 
ATOM   8814  O  O     . LEU B 1  618 ? 156.646 189.589 146.961 1.00 74.42  ? 882  LEU C O     1 
ATOM   8815  C  CB    . LEU B 1  618 ? 157.839 189.336 143.810 1.00 74.42  ? 882  LEU C CB    1 
ATOM   8816  C  CG    . LEU B 1  618 ? 156.685 188.368 143.552 1.00 74.42  ? 882  LEU C CG    1 
ATOM   8817  C  CD1   . LEU B 1  618 ? 155.470 189.127 143.052 1.00 74.42  ? 882  LEU C CD1   1 
ATOM   8818  C  CD2   . LEU B 1  618 ? 157.094 187.282 142.564 1.00 74.42  ? 882  LEU C CD2   1 
ATOM   8819  N  N     . MET B 1  619 ? 158.836 189.111 146.728 1.00 76.84  ? 883  MET C N     1 
ATOM   8820  C  CA    . MET B 1  619 ? 158.883 188.412 148.007 1.00 76.84  ? 883  MET C CA    1 
ATOM   8821  C  C     . MET B 1  619 ? 158.662 189.370 149.169 1.00 76.84  ? 883  MET C C     1 
ATOM   8822  O  O     . MET B 1  619 ? 158.056 188.998 150.179 1.00 76.84  ? 883  MET C O     1 
ATOM   8823  C  CB    . MET B 1  619 ? 160.213 187.680 148.164 1.00 76.84  ? 883  MET C CB    1 
ATOM   8824  C  CG    . MET B 1  619 ? 160.292 186.830 149.421 1.00 76.84  ? 883  MET C CG    1 
ATOM   8825  S  SD    . MET B 1  619 ? 159.068 185.507 149.440 1.00 76.84  ? 883  MET C SD    1 
ATOM   8826  C  CE    . MET B 1  619 ? 159.738 184.407 148.198 1.00 76.84  ? 883  MET C CE    1 
ATOM   8827  N  N     . ASP B 1  620 ? 159.142 190.610 149.047 1.00 76.51  ? 884  ASP C N     1 
ATOM   8828  C  CA    . ASP B 1  620 ? 158.910 191.595 150.097 1.00 76.51  ? 884  ASP C CA    1 
ATOM   8829  C  C     . ASP B 1  620 ? 157.424 191.885 150.250 1.00 76.51  ? 884  ASP C C     1 
ATOM   8830  O  O     . ASP B 1  620 ? 156.897 191.922 151.368 1.00 76.51  ? 884  ASP C O     1 
ATOM   8831  C  CB    . ASP B 1  620 ? 159.684 192.877 149.793 1.00 76.51  ? 884  ASP C CB    1 
ATOM   8832  C  CG    . ASP B 1  620 ? 159.595 193.891 150.916 1.00 76.51  ? 884  ASP C CG    1 
ATOM   8833  O  OD1   . ASP B 1  620 ? 160.253 193.686 151.957 1.00 76.51  ? 884  ASP C OD1   1 
ATOM   8834  O  OD2   . ASP B 1  620 ? 158.866 194.893 150.758 1.00 76.51  ? 884  ASP C OD2   1 
ATOM   8835  N  N     . LEU B 1  621 ? 156.728 192.085 149.128 1.00 74.68  ? 885  LEU C N     1 
ATOM   8836  C  CA    . LEU B 1  621 ? 155.286 192.298 149.186 1.00 74.68  ? 885  LEU C CA    1 
ATOM   8837  C  C     . LEU B 1  621 ? 154.573 191.091 149.781 1.00 74.68  ? 885  LEU C C     1 
ATOM   8838  O  O     . LEU B 1  621 ? 153.672 191.241 150.616 1.00 74.68  ? 885  LEU C O     1 
ATOM   8839  C  CB    . LEU B 1  621 ? 154.743 192.607 147.791 1.00 74.68  ? 885  LEU C CB    1 
ATOM   8840  C  CG    . LEU B 1  621 ? 155.187 193.930 147.166 1.00 74.68  ? 885  LEU C CG    1 
ATOM   8841  C  CD1   . LEU B 1  621 ? 154.692 194.035 145.734 1.00 74.68  ? 885  LEU C CD1   1 
ATOM   8842  C  CD2   . LEU B 1  621 ? 154.695 195.104 147.993 1.00 74.68  ? 885  LEU C CD2   1 
ATOM   8843  N  N     . TYR B 1  622 ? 154.972 189.882 149.377 1.00 71.13  ? 886  TYR C N     1 
ATOM   8844  C  CA    . TYR B 1  622 ? 154.307 188.687 149.889 1.00 71.13  ? 886  TYR C CA    1 
ATOM   8845  C  C     . TYR B 1  622 ? 154.511 188.542 151.393 1.00 71.13  ? 886  TYR C C     1 
ATOM   8846  O  O     . TYR B 1  622 ? 153.577 188.200 152.128 1.00 71.13  ? 886  TYR C O     1 
ATOM   8847  C  CB    . TYR B 1  622 ? 154.810 187.444 149.158 1.00 71.13  ? 886  TYR C CB    1 
ATOM   8848  C  CG    . TYR B 1  622 ? 154.128 186.176 149.614 1.00 71.13  ? 886  TYR C CG    1 
ATOM   8849  C  CD1   . TYR B 1  622 ? 152.833 185.880 149.213 1.00 71.13  ? 886  TYR C CD1   1 
ATOM   8850  C  CD2   . TYR B 1  622 ? 154.774 185.280 150.454 1.00 71.13  ? 886  TYR C CD2   1 
ATOM   8851  C  CE1   . TYR B 1  622 ? 152.202 184.725 149.630 1.00 71.13  ? 886  TYR C CE1   1 
ATOM   8852  C  CE2   . TYR B 1  622 ? 154.151 184.123 150.876 1.00 71.13  ? 886  TYR C CE2   1 
ATOM   8853  C  CZ    . TYR B 1  622 ? 152.867 183.851 150.461 1.00 71.13  ? 886  TYR C CZ    1 
ATOM   8854  O  OH    . TYR B 1  622 ? 152.245 182.698 150.881 1.00 71.13  ? 886  TYR C OH    1 
ATOM   8855  N  N     . LEU B 1  623 ? 155.732 188.794 151.870 1.00 72.89  ? 887  LEU C N     1 
ATOM   8856  C  CA    . LEU B 1  623 ? 156.015 188.663 153.294 1.00 72.89  ? 887  LEU C CA    1 
ATOM   8857  C  C     . LEU B 1  623 ? 155.414 189.798 154.111 1.00 72.89  ? 887  LEU C C     1 
ATOM   8858  O  O     . LEU B 1  623 ? 155.189 189.624 155.312 1.00 72.89  ? 887  LEU C O     1 
ATOM   8859  C  CB    . LEU B 1  623 ? 157.524 188.590 153.529 1.00 72.89  ? 887  LEU C CB    1 
ATOM   8860  C  CG    . LEU B 1  623 ? 158.221 187.341 152.987 1.00 72.89  ? 887  LEU C CG    1 
ATOM   8861  C  CD1   . LEU B 1  623 ? 159.727 187.437 153.174 1.00 72.89  ? 887  LEU C CD1   1 
ATOM   8862  C  CD2   . LEU B 1  623 ? 157.673 186.089 153.652 1.00 72.89  ? 887  LEU C CD2   1 
ATOM   8863  N  N     . LYS B 1  624 ? 155.160 190.954 153.497 1.00 73.34  ? 888  LYS C N     1 
ATOM   8864  C  CA    . LYS B 1  624 ? 154.439 192.011 154.193 1.00 73.34  ? 888  LYS C CA    1 
ATOM   8865  C  C     . LYS B 1  624 ? 152.937 191.767 154.213 1.00 73.34  ? 888  LYS C C     1 
ATOM   8866  O  O     . LYS B 1  624 ? 152.250 192.282 155.101 1.00 73.34  ? 888  LYS C O     1 
ATOM   8867  C  CB    . LYS B 1  624 ? 154.731 193.368 153.551 1.00 73.34  ? 888  LYS C CB    1 
ATOM   8868  C  CG    . LYS B 1  624 ? 156.135 193.888 153.810 1.00 73.34  ? 888  LYS C CG    1 
ATOM   8869  C  CD    . LYS B 1  624 ? 156.408 195.171 153.040 1.00 73.34  ? 888  LYS C CD    1 
ATOM   8870  C  CE    . LYS B 1  624 ? 156.071 196.404 153.866 1.00 73.34  ? 888  LYS C CE    1 
ATOM   8871  N  NZ    . LYS B 1  624 ? 154.605 196.586 154.053 1.00 73.34  ? 888  LYS C NZ    1 
ATOM   8872  N  N     . MET B 1  625 ? 152.418 190.999 153.257 1.00 74.72  ? 889  MET C N     1 
ATOM   8873  C  CA    . MET B 1  625 ? 150.993 190.697 153.217 1.00 74.72  ? 889  MET C CA    1 
ATOM   8874  C  C     . MET B 1  625 ? 150.613 189.480 154.051 1.00 74.72  ? 889  MET C C     1 
ATOM   8875  O  O     . MET B 1  625 ? 149.512 189.449 154.611 1.00 74.72  ? 889  MET C O     1 
ATOM   8876  C  CB    . MET B 1  625 ? 150.548 190.478 151.769 1.00 74.72  ? 889  MET C CB    1 
ATOM   8877  C  CG    . MET B 1  625 ? 150.585 191.732 150.917 1.00 74.72  ? 889  MET C CG    1 
ATOM   8878  S  SD    . MET B 1  625 ? 150.270 191.389 149.177 1.00 74.72  ? 889  MET C SD    1 
ATOM   8879  C  CE    . MET B 1  625 ? 148.544 190.929 149.229 1.00 74.72  ? 889  MET C CE    1 
ATOM   8880  N  N     . LYS B 1  626 ? 151.498 188.488 154.154 1.00 71.45  ? 890  LYS C N     1 
ATOM   8881  C  CA    . LYS B 1  626 ? 151.132 187.229 154.802 1.00 71.45  ? 890  LYS C CA    1 
ATOM   8882  C  C     . LYS B 1  626 ? 150.658 187.368 156.247 1.00 71.45  ? 890  LYS C C     1 
ATOM   8883  O  O     . LYS B 1  626 ? 149.631 186.752 156.585 1.00 71.45  ? 890  LYS C O     1 
ATOM   8884  C  CB    . LYS B 1  626 ? 152.309 186.248 154.715 1.00 71.45  ? 890  LYS C CB    1 
ATOM   8885  C  CG    . LYS B 1  626 ? 152.022 184.883 155.316 1.00 71.45  ? 890  LYS C CG    1 
ATOM   8886  C  CD    . LYS B 1  626 ? 153.164 183.914 155.057 1.00 71.45  ? 890  LYS C CD    1 
ATOM   8887  C  CE    . LYS B 1  626 ? 154.386 184.262 155.890 1.00 71.45  ? 890  LYS C CE    1 
ATOM   8888  N  NZ    . LYS B 1  626 ? 154.156 184.028 157.342 1.00 71.45  ? 890  LYS C NZ    1 
ATOM   8889  N  N     . PRO B 1  627 ? 151.322 188.122 157.136 1.00 72.66  ? 891  PRO C N     1 
ATOM   8890  C  CA    . PRO B 1  627 ? 150.862 188.164 158.536 1.00 72.66  ? 891  PRO C CA    1 
ATOM   8891  C  C     . PRO B 1  627 ? 149.442 188.676 158.714 1.00 72.66  ? 891  PRO C C     1 
ATOM   8892  O  O     . PRO B 1  627 ? 148.878 188.530 159.806 1.00 72.66  ? 891  PRO C O     1 
ATOM   8893  C  CB    . PRO B 1  627 ? 151.879 189.097 159.208 1.00 72.66  ? 891  PRO C CB    1 
ATOM   8894  C  CG    . PRO B 1  627 ? 153.085 189.014 158.359 1.00 72.66  ? 891  PRO C CG    1 
ATOM   8895  C  CD    . PRO B 1  627 ? 152.573 188.882 156.962 1.00 72.66  ? 891  PRO C CD    1 
ATOM   8896  N  N     . VAL B 1  628 ? 148.846 189.273 157.682 1.00 71.73  ? 892  VAL C N     1 
ATOM   8897  C  CA    . VAL B 1  628 ? 147.472 189.753 157.795 1.00 71.73  ? 892  VAL C CA    1 
ATOM   8898  C  C     . VAL B 1  628 ? 146.512 188.582 157.968 1.00 71.73  ? 892  VAL C C     1 
ATOM   8899  O  O     . VAL B 1  628 ? 145.685 188.568 158.888 1.00 71.73  ? 892  VAL C O     1 
ATOM   8900  C  CB    . VAL B 1  628 ? 147.100 190.613 156.575 1.00 71.73  ? 892  VAL C CB    1 
ATOM   8901  C  CG1   . VAL B 1  628 ? 145.635 191.011 156.637 1.00 71.73  ? 892  VAL C CG1   1 
ATOM   8902  C  CG2   . VAL B 1  628 ? 147.988 191.844 156.506 1.00 71.73  ? 892  VAL C CG2   1 
ATOM   8903  N  N     . TRP B 1  629 ? 146.636 187.585 157.102 1.00 69.72  ? 893  TRP C N     1 
ATOM   8904  C  CA    . TRP B 1  629 ? 145.755 186.426 157.152 1.00 69.72  ? 893  TRP C CA    1 
ATOM   8905  C  C     . TRP B 1  629 ? 146.342 185.234 157.895 1.00 69.72  ? 893  TRP C C     1 
ATOM   8906  O  O     . TRP B 1  629 ? 145.619 184.310 158.253 1.00 69.72  ? 893  TRP C O     1 
ATOM   8907  C  CB    . TRP B 1  629 ? 145.386 185.993 155.734 1.00 69.72  ? 893  TRP C CB    1 
ATOM   8908  C  CG    . TRP B 1  629 ? 146.345 185.003 155.150 1.00 69.72  ? 893  TRP C CG    1 
ATOM   8909  C  CD1   . TRP B 1  629 ? 146.482 183.692 155.497 1.00 69.72  ? 893  TRP C CD1   1 
ATOM   8910  C  CD2   . TRP B 1  629 ? 147.303 185.246 154.116 1.00 69.72  ? 893  TRP C CD2   1 
ATOM   8911  N  NE1   . TRP B 1  629 ? 147.466 183.103 154.744 1.00 69.72  ? 893  TRP C NE1   1 
ATOM   8912  C  CE2   . TRP B 1  629 ? 147.986 184.036 153.888 1.00 69.72  ? 893  TRP C CE2   1 
ATOM   8913  C  CE3   . TRP B 1  629 ? 147.649 186.367 153.360 1.00 69.72  ? 893  TRP C CE3   1 
ATOM   8914  C  CZ2   . TRP B 1  629 ? 148.992 183.918 152.938 1.00 69.72  ? 893  TRP C CZ2   1 
ATOM   8915  C  CZ3   . TRP B 1  629 ? 148.649 186.247 152.419 1.00 69.72  ? 893  TRP C CZ3   1 
ATOM   8916  C  CH2   . TRP B 1  629 ? 149.308 185.032 152.215 1.00 69.72  ? 893  TRP C CH2   1 
ATOM   8917  N  N     . ARG B 1  630 ? 147.644 185.245 158.142 1.00 72.02  ? 894  ARG C N     1 
ATOM   8918  C  CA    . ARG B 1  630 ? 148.267 184.116 158.825 1.00 72.02  ? 894  ARG C CA    1 
ATOM   8919  C  C     . ARG B 1  630 ? 148.221 184.202 160.347 1.00 72.02  ? 894  ARG C C     1 
ATOM   8920  O  O     . ARG B 1  630 ? 148.293 183.183 161.027 1.00 72.02  ? 894  ARG C O     1 
ATOM   8921  C  CB    . ARG B 1  630 ? 149.710 183.933 158.358 1.00 72.02  ? 894  ARG C CB    1 
ATOM   8922  C  CG    . ARG B 1  630 ? 150.198 182.497 158.432 1.00 72.02  ? 894  ARG C CG    1 
ATOM   8923  C  CD    . ARG B 1  630 ? 149.051 181.536 158.690 1.00 72.02  ? 894  ARG C CD    1 
ATOM   8924  N  NE    . ARG B 1  630 ? 149.336 180.201 158.171 1.00 72.02  ? 894  ARG C NE    1 
ATOM   8925  C  CZ    . ARG B 1  630 ? 148.868 179.076 158.701 1.00 72.02  ? 894  ARG C CZ    1 
ATOM   8926  N  NH1   . ARG B 1  630 ? 148.088 179.119 159.771 1.00 72.02  ? 894  ARG C NH1   1 
ATOM   8927  N  NH2   . ARG B 1  630 ? 149.179 177.908 158.161 1.00 72.02  ? 894  ARG C NH2   1 
ATOM   8928  N  N     . SER B 1  631 ? 148.100 185.412 160.879 1.00 72.62  ? 895  SER C N     1 
ATOM   8929  C  CA    . SER B 1  631 ? 148.070 185.599 162.320 1.00 72.62  ? 895  SER C CA    1 
ATOM   8930  C  C     . SER B 1  631 ? 146.686 185.261 162.870 1.00 72.62  ? 895  SER C C     1 
ATOM   8931  O  O     . SER B 1  631 ? 145.737 184.994 162.129 1.00 72.62  ? 895  SER C O     1 
ATOM   8932  C  CB    . SER B 1  631 ? 148.469 187.031 162.680 1.00 72.62  ? 895  SER C CB    1 
ATOM   8933  O  OG    . SER B 1  631 ? 147.507 187.958 162.210 1.00 72.62  ? 895  SER C OG    1 
ATOM   8934  N  N     . SER B 1  632 ? 146.575 185.279 164.198 1.00 73.91  ? 896  SER C N     1 
ATOM   8935  C  CA    . SER B 1  632 ? 145.325 184.975 164.881 1.00 73.91  ? 896  SER C CA    1 
ATOM   8936  C  C     . SER B 1  632 ? 144.534 186.218 165.264 1.00 73.91  ? 896  SER C C     1 
ATOM   8937  O  O     . SER B 1  632 ? 143.362 186.094 165.636 1.00 73.91  ? 896  SER C O     1 
ATOM   8938  C  CB    . SER B 1  632 ? 145.599 184.140 166.138 1.00 73.91  ? 896  SER C CB    1 
ATOM   8939  O  OG    . SER B 1  632 ? 144.398 183.867 166.837 1.00 73.91  ? 896  SER C OG    1 
ATOM   8940  N  N     . CYS B 1  633 ? 145.139 187.399 165.190 1.00 78.63  ? 897  CYS C N     1 
ATOM   8941  C  CA    . CYS B 1  633 ? 144.449 188.646 165.494 1.00 78.63  ? 897  CYS C CA    1 
ATOM   8942  C  C     . CYS B 1  633 ? 145.166 189.802 164.809 1.00 78.63  ? 897  CYS C C     1 
ATOM   8943  O  O     . CYS B 1  633 ? 145.973 190.496 165.440 1.00 78.63  ? 897  CYS C O     1 
ATOM   8944  C  CB    . CYS B 1  633 ? 144.379 188.875 167.004 1.00 78.63  ? 897  CYS C CB    1 
ATOM   8945  S  SG    . CYS B 1  633 ? 143.463 190.355 167.488 1.00 78.63  ? 897  CYS C SG    1 
ATOM   8946  N  N     . PRO B 1  634 ? 144.904 190.040 163.520 1.00 77.51  ? 898  PRO C N     1 
ATOM   8947  C  CA    . PRO B 1  634 ? 145.620 191.108 162.805 1.00 77.51  ? 898  PRO C CA    1 
ATOM   8948  C  C     . PRO B 1  634 ? 145.276 192.508 163.282 1.00 77.51  ? 898  PRO C C     1 
ATOM   8949  O  O     . PRO B 1  634 ? 146.000 193.450 162.936 1.00 77.51  ? 898  PRO C O     1 
ATOM   8950  C  CB    . PRO B 1  634 ? 145.191 190.900 161.348 1.00 77.51  ? 898  PRO C CB    1 
ATOM   8951  C  CG    . PRO B 1  634 ? 143.861 190.236 161.446 1.00 77.51  ? 898  PRO C CG    1 
ATOM   8952  C  CD    . PRO B 1  634 ? 143.924 189.355 162.661 1.00 77.51  ? 898  PRO C CD    1 
ATOM   8953  N  N     . ALA B 1  635 ? 144.207 192.679 164.058 1.00 76.37  ? 899  ALA C N     1 
ATOM   8954  C  CA    . ALA B 1  635 ? 143.852 193.993 164.575 1.00 76.37  ? 899  ALA C CA    1 
ATOM   8955  C  C     . ALA B 1  635 ? 144.765 194.451 165.703 1.00 76.37  ? 899  ALA C C     1 
ATOM   8956  O  O     . ALA B 1  635 ? 144.762 195.642 166.035 1.00 76.37  ? 899  ALA C O     1 
ATOM   8957  C  CB    . ALA B 1  635 ? 142.399 193.995 165.058 1.00 76.37  ? 899  ALA C CB    1 
ATOM   8958  N  N     . LYS B 1  636 ? 145.542 193.545 166.294 1.00 76.40  ? 900  LYS C N     1 
ATOM   8959  C  CA    . LYS B 1  636 ? 146.464 193.893 167.368 1.00 76.40  ? 900  LYS C CA    1 
ATOM   8960  C  C     . LYS B 1  636 ? 147.874 193.360 167.175 1.00 76.40  ? 900  LYS C C     1 
ATOM   8961  O  O     . LYS B 1  636 ? 148.796 193.878 167.816 1.00 76.40  ? 900  LYS C O     1 
ATOM   8962  C  CB    . LYS B 1  636 ? 145.932 193.392 168.719 1.00 76.40  ? 900  LYS C CB    1 
ATOM   8963  C  CG    . LYS B 1  636 ? 144.670 194.094 169.187 1.00 76.40  ? 900  LYS C CG    1 
ATOM   8964  C  CD    . LYS B 1  636 ? 144.295 193.670 170.597 1.00 76.40  ? 900  LYS C CD    1 
ATOM   8965  C  CE    . LYS B 1  636 ? 143.724 192.263 170.615 1.00 76.40  ? 900  LYS C CE    1 
ATOM   8966  N  NZ    . LYS B 1  636 ? 143.246 191.877 171.971 1.00 76.40  ? 900  LYS C NZ    1 
ATOM   8967  N  N     . GLU B 1  637 ? 148.080 192.354 166.327 1.00 81.95  ? 901  GLU C N     1 
ATOM   8968  C  CA    . GLU B 1  637 ? 149.408 191.805 166.092 1.00 81.95  ? 901  GLU C CA    1 
ATOM   8969  C  C     . GLU B 1  637 ? 150.099 192.414 164.881 1.00 81.95  ? 901  GLU C C     1 
ATOM   8970  O  O     . GLU B 1  637 ? 151.326 192.313 164.773 1.00 81.95  ? 901  GLU C O     1 
ATOM   8971  C  CB    . GLU B 1  637 ? 149.327 190.285 165.919 1.00 81.95  ? 901  GLU C CB    1 
ATOM   8972  C  CG    . GLU B 1  637 ? 148.917 189.547 167.180 1.00 81.95  ? 901  GLU C CG    1 
ATOM   8973  C  CD    . GLU B 1  637 ? 148.832 188.048 166.980 1.00 81.95  ? 901  GLU C CD    1 
ATOM   8974  O  OE1   . GLU B 1  637 ? 148.970 187.591 165.827 1.00 81.95  ? 901  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU B 1  637 ? 148.630 187.327 167.979 1.00 81.95  ? 901  GLU C OE2   1 
ATOM   8976  N  N     . CYS B 1  638 ? 149.350 193.039 163.977 1.00 85.67  ? 902  CYS C N     1 
ATOM   8977  C  CA    . CYS B 1  638 ? 149.924 193.676 162.798 1.00 85.67  ? 902  CYS C CA    1 
ATOM   8978  C  C     . CYS B 1  638 ? 148.970 194.726 162.236 1.00 85.67  ? 902  CYS C C     1 
ATOM   8979  O  O     . CYS B 1  638 ? 148.472 194.579 161.113 1.00 85.67  ? 902  CYS C O     1 
ATOM   8980  C  CB    . CYS B 1  638 ? 150.271 192.621 161.743 1.00 85.67  ? 902  CYS C CB    1 
ATOM   8981  S  SG    . CYS B 1  638 ? 148.886 191.598 161.179 1.00 85.67  ? 902  CYS C SG    1 
ATOM   8982  N  N     . PRO B 1  639 ? 148.701 195.806 162.976 1.00 83.67  ? 903  PRO C N     1 
ATOM   8983  C  CA    . PRO B 1  639 ? 147.775 196.822 162.454 1.00 83.67  ? 903  PRO C CA    1 
ATOM   8984  C  C     . PRO B 1  639 ? 148.336 197.593 161.274 1.00 83.67  ? 903  PRO C C     1 
ATOM   8985  O  O     . PRO B 1  639 ? 147.564 198.019 160.405 1.00 83.67  ? 903  PRO C O     1 
ATOM   8986  C  CB    . PRO B 1  639 ? 147.540 197.735 163.665 1.00 83.67  ? 903  PRO C CB    1 
ATOM   8987  C  CG    . PRO B 1  639 ? 148.785 197.598 164.470 1.00 83.67  ? 903  PRO C CG    1 
ATOM   8988  C  CD    . PRO B 1  639 ? 149.246 196.179 164.293 1.00 83.67  ? 903  PRO C CD    1 
ATOM   8989  N  N     . GLU B 1  640 ? 149.655 197.784 161.216 1.00 87.40  ? 904  GLU C N     1 
ATOM   8990  C  CA    . GLU B 1  640 ? 150.261 198.488 160.090 1.00 87.40  ? 904  GLU C CA    1 
ATOM   8991  C  C     . GLU B 1  640 ? 150.058 197.714 158.793 1.00 87.40  ? 904  GLU C C     1 
ATOM   8992  O  O     . GLU B 1  640 ? 149.665 198.282 157.768 1.00 87.40  ? 904  GLU C O     1 
ATOM   8993  C  CB    . GLU B 1  640 ? 151.748 198.717 160.361 1.00 87.40  ? 904  GLU C CB    1 
ATOM   8994  C  CG    . GLU B 1  640 ? 152.029 199.655 161.521 1.00 87.40  ? 904  GLU C CG    1 
ATOM   8995  C  CD    . GLU B 1  640 ? 151.593 201.078 161.237 1.00 87.40  ? 904  GLU C CD    1 
ATOM   8996  O  OE1   . GLU B 1  640 ? 151.640 201.492 160.059 1.00 87.40  ? 904  GLU C OE1   1 
ATOM   8997  O  OE2   . GLU B 1  640 ? 151.205 201.784 162.191 1.00 87.40  ? 904  GLU C OE2   1 
ATOM   8998  N  N     . SER B 1  641 ? 150.322 196.407 158.823 1.00 81.91  ? 905  SER C N     1 
ATOM   8999  C  CA    . SER B 1  641 ? 150.112 195.580 157.641 1.00 81.91  ? 905  SER C CA    1 
ATOM   9000  C  C     . SER B 1  641 ? 148.635 195.412 157.315 1.00 81.91  ? 905  SER C C     1 
ATOM   9001  O  O     . SER B 1  641 ? 148.294 195.133 156.161 1.00 81.91  ? 905  SER C O     1 
ATOM   9002  C  CB    . SER B 1  641 ? 150.765 194.211 157.835 1.00 81.91  ? 905  SER C CB    1 
ATOM   9003  O  OG    . SER B 1  641 ? 152.171 194.331 157.961 1.00 81.91  ? 905  SER C OG    1 
ATOM   9004  N  N     . LEU B 1  642 ? 147.753 195.576 158.302 1.00 80.12  ? 906  LEU C N     1 
ATOM   9005  C  CA    . LEU B 1  642 ? 146.322 195.448 158.055 1.00 80.12  ? 906  LEU C CA    1 
ATOM   9006  C  C     . LEU B 1  642 ? 145.769 196.691 157.367 1.00 80.12  ? 906  LEU C C     1 
ATOM   9007  O  O     . LEU B 1  642 ? 145.079 196.595 156.346 1.00 80.12  ? 906  LEU C O     1 
ATOM   9008  C  CB    . LEU B 1  642 ? 145.583 195.184 159.369 1.00 80.12  ? 906  LEU C CB    1 
ATOM   9009  C  CG    . LEU B 1  642 ? 144.072 194.971 159.259 1.00 80.12  ? 906  LEU C CG    1 
ATOM   9010  C  CD1   . LEU B 1  642 ? 143.763 193.740 158.423 1.00 80.12  ? 906  LEU C CD1   1 
ATOM   9011  C  CD2   . LEU B 1  642 ? 143.445 194.858 160.639 1.00 80.12  ? 906  LEU C CD2   1 
ATOM   9012  N  N     . CYS B 1  643 ? 146.063 197.871 157.916 1.00 83.17  ? 907  CYS C N     1 
ATOM   9013  C  CA    . CYS B 1  643 ? 145.574 199.114 157.331 1.00 83.17  ? 907  CYS C CA    1 
ATOM   9014  C  C     . CYS B 1  643 ? 146.204 199.418 155.979 1.00 83.17  ? 907  CYS C C     1 
ATOM   9015  O  O     . CYS B 1  643 ? 145.625 200.189 155.206 1.00 83.17  ? 907  CYS C O     1 
ATOM   9016  C  CB    . CYS B 1  643 ? 145.824 200.281 158.288 1.00 83.17  ? 907  CYS C CB    1 
ATOM   9017  S  SG    . CYS B 1  643 ? 147.569 200.657 158.572 1.00 83.17  ? 907  CYS C SG    1 
ATOM   9018  N  N     . GLN B 1  644 ? 147.364 198.838 155.674 1.00 81.45  ? 908  GLN C N     1 
ATOM   9019  C  CA    . GLN B 1  644 ? 148.038 199.049 154.400 1.00 81.45  ? 908  GLN C CA    1 
ATOM   9020  C  C     . GLN B 1  644 ? 147.969 197.827 153.496 1.00 81.45  ? 908  GLN C C     1 
ATOM   9021  O  O     . GLN B 1  644 ? 148.846 197.647 152.645 1.00 81.45  ? 908  GLN C O     1 
ATOM   9022  C  CB    . GLN B 1  644 ? 149.499 199.443 154.634 1.00 81.45  ? 908  GLN C CB    1 
ATOM   9023  C  CG    . GLN B 1  644 ? 149.678 200.762 155.362 1.00 81.45  ? 908  GLN C CG    1 
ATOM   9024  C  CD    . GLN B 1  644 ? 149.200 201.945 154.546 1.00 81.45  ? 908  GLN C CD    1 
ATOM   9025  O  OE1   . GLN B 1  644 ? 149.394 201.995 153.332 1.00 81.45  ? 908  GLN C OE1   1 
ATOM   9026  N  NE2   . GLN B 1  644 ? 148.570 202.907 155.210 1.00 81.45  ? 908  GLN C NE2   1 
ATOM   9027  N  N     . TYR B 1  645 ? 146.955 196.990 153.682 1.00 74.29  ? 909  TYR C N     1 
ATOM   9028  C  CA    . TYR B 1  645 ? 146.821 195.765 152.895 1.00 74.29  ? 909  TYR C CA    1 
ATOM   9029  C  C     . TYR B 1  645 ? 146.345 195.973 151.462 1.00 74.29  ? 909  TYR C C     1 
ATOM   9030  O  O     . TYR B 1  645 ? 146.666 195.182 150.578 1.00 74.29  ? 909  TYR C O     1 
ATOM   9031  C  CB    . TYR B 1  645 ? 145.892 194.782 153.602 1.00 74.29  ? 909  TYR C CB    1 
ATOM   9032  C  CG    . TYR B 1  645 ? 145.948 193.384 153.040 1.00 74.29  ? 909  TYR C CG    1 
ATOM   9033  C  CD1   . TYR B 1  645 ? 146.597 192.369 153.723 1.00 74.29  ? 909  TYR C CD1   1 
ATOM   9034  C  CD2   . TYR B 1  645 ? 145.352 193.079 151.829 1.00 74.29  ? 909  TYR C CD2   1 
ATOM   9035  C  CE1   . TYR B 1  645 ? 146.650 191.088 153.216 1.00 74.29  ? 909  TYR C CE1   1 
ATOM   9036  C  CE2   . TYR B 1  645 ? 145.399 191.799 151.314 1.00 74.29  ? 909  TYR C CE2   1 
ATOM   9037  C  CZ    . TYR B 1  645 ? 146.050 190.809 152.013 1.00 74.29  ? 909  TYR C CZ    1 
ATOM   9038  O  OH    . TYR B 1  645 ? 146.103 189.534 151.509 1.00 74.29  ? 909  TYR C OH    1 
ATOM   9039  N  N     . SER B 1  646 ? 145.575 197.027 151.233 1.00 76.11  ? 910  SER C N     1 
ATOM   9040  C  CA    . SER B 1  646 ? 145.061 197.301 149.895 1.00 76.11  ? 910  SER C CA    1 
ATOM   9041  C  C     . SER B 1  646 ? 146.165 197.783 148.964 1.00 76.11  ? 910  SER C C     1 
ATOM   9042  O  O     . SER B 1  646 ? 146.258 197.334 147.815 1.00 76.11  ? 910  SER C O     1 
ATOM   9043  C  CB    . SER B 1  646 ? 143.933 198.329 149.968 1.00 76.11  ? 910  SER C CB    1 
ATOM   9044  O  OG    . SER B 1  646 ? 142.829 197.821 150.696 1.00 76.11  ? 910  SER C OG    1 
ATOM   9045  N  N     . PHE B 1  647 ? 147.010 198.699 149.441 1.00 77.22  ? 911  PHE C N     1 
ATOM   9046  C  CA    . PHE B 1  647 ? 148.103 199.204 148.616 1.00 77.22  ? 911  PHE C CA    1 
ATOM   9047  C  C     . PHE B 1  647 ? 149.083 198.090 148.266 1.00 77.22  ? 911  PHE C C     1 
ATOM   9048  O  O     . PHE B 1  647 ? 149.550 197.990 147.124 1.00 77.22  ? 911  PHE C O     1 
ATOM   9049  C  CB    . PHE B 1  647 ? 148.816 200.345 149.342 1.00 77.22  ? 911  PHE C CB    1 
ATOM   9050  C  CG    . PHE B 1  647 ? 149.937 200.956 148.556 1.00 77.22  ? 911  PHE C CG    1 
ATOM   9051  C  CD1   . PHE B 1  647 ? 149.673 201.808 147.498 1.00 77.22  ? 911  PHE C CD1   1 
ATOM   9052  C  CD2   . PHE B 1  647 ? 151.255 200.679 148.875 1.00 77.22  ? 911  PHE C CD2   1 
ATOM   9053  C  CE1   . PHE B 1  647 ? 150.703 202.373 146.771 1.00 77.22  ? 911  PHE C CE1   1 
ATOM   9054  C  CE2   . PHE B 1  647 ? 152.290 201.240 148.153 1.00 77.22  ? 911  PHE C CE2   1 
ATOM   9055  C  CZ    . PHE B 1  647 ? 152.014 202.089 147.100 1.00 77.22  ? 911  PHE C CZ    1 
ATOM   9056  N  N     . ASN B 1  648 ? 149.405 197.240 149.244 1.00 76.21  ? 912  ASN C N     1 
ATOM   9057  C  CA    . ASN B 1  648 ? 150.310 196.126 148.987 1.00 76.21  ? 912  ASN C CA    1 
ATOM   9058  C  C     . ASN B 1  648 ? 149.724 195.166 147.962 1.00 76.21  ? 912  ASN C C     1 
ATOM   9059  O  O     . ASN B 1  648 ? 150.432 194.698 147.065 1.00 76.21  ? 912  ASN C O     1 
ATOM   9060  C  CB    . ASN B 1  648 ? 150.625 195.392 150.290 1.00 76.21  ? 912  ASN C CB    1 
ATOM   9061  C  CG    . ASN B 1  648 ? 151.484 196.214 151.229 1.00 76.21  ? 912  ASN C CG    1 
ATOM   9062  O  OD1   . ASN B 1  648 ? 152.427 196.880 150.802 1.00 76.21  ? 912  ASN C OD1   1 
ATOM   9063  N  ND2   . ASN B 1  648 ? 151.164 196.169 152.517 1.00 76.21  ? 912  ASN C ND2   1 
ATOM   9064  N  N     . SER B 1  649 ? 148.426 194.871 148.070 1.00 74.12  ? 913  SER C N     1 
ATOM   9065  C  CA    . SER B 1  649 ? 147.795 193.965 147.116 1.00 74.12  ? 913  SER C CA    1 
ATOM   9066  C  C     . SER B 1  649 ? 147.759 194.571 145.719 1.00 74.12  ? 913  SER C C     1 
ATOM   9067  O  O     . SER B 1  649 ? 147.976 193.869 144.723 1.00 74.12  ? 913  SER C O     1 
ATOM   9068  C  CB    . SER B 1  649 ? 146.384 193.612 147.586 1.00 74.12  ? 913  SER C CB    1 
ATOM   9069  O  OG    . SER B 1  649 ? 145.548 194.755 147.586 1.00 74.12  ? 913  SER C OG    1 
ATOM   9070  N  N     . GLN B 1  650 ? 147.493 195.875 145.624 1.00 75.26  ? 914  GLN C N     1 
ATOM   9071  C  CA    . GLN B 1  650 ? 147.472 196.531 144.321 1.00 75.26  ? 914  GLN C CA    1 
ATOM   9072  C  C     . GLN B 1  650 ? 148.855 196.520 143.680 1.00 75.26  ? 914  GLN C C     1 
ATOM   9073  O  O     . GLN B 1  650 ? 148.992 196.258 142.479 1.00 75.26  ? 914  GLN C O     1 
ATOM   9074  C  CB    . GLN B 1  650 ? 146.948 197.960 144.460 1.00 75.26  ? 914  GLN C CB    1 
ATOM   9075  C  CG    . GLN B 1  650 ? 145.477 198.041 144.835 1.00 75.26  ? 914  GLN C CG    1 
ATOM   9076  C  CD    . GLN B 1  650 ? 144.994 199.467 145.000 1.00 75.26  ? 914  GLN C CD    1 
ATOM   9077  O  OE1   . GLN B 1  650 ? 145.773 200.415 144.894 1.00 75.26  ? 914  GLN C OE1   1 
ATOM   9078  N  NE2   . GLN B 1  650 ? 143.703 199.628 145.265 1.00 75.26  ? 914  GLN C NE2   1 
ATOM   9079  N  N     . ARG B 1  651 ? 149.896 196.794 144.470 1.00 74.41  ? 915  ARG C N     1 
ATOM   9080  C  CA    . ARG B 1  651 ? 151.251 196.755 143.929 1.00 74.41  ? 915  ARG C CA    1 
ATOM   9081  C  C     . ARG B 1  651 ? 151.643 195.335 143.537 1.00 74.41  ? 915  ARG C C     1 
ATOM   9082  O  O     . ARG B 1  651 ? 152.331 195.128 142.531 1.00 74.41  ? 915  ARG C O     1 
ATOM   9083  C  CB    . ARG B 1  651 ? 152.240 197.328 144.944 1.00 74.41  ? 915  ARG C CB    1 
ATOM   9084  C  CG    . ARG B 1  651 ? 153.675 197.353 144.452 1.00 74.41  ? 915  ARG C CG    1 
ATOM   9085  C  CD    . ARG B 1  651 ? 153.833 198.319 143.288 1.00 74.41  ? 915  ARG C CD    1 
ATOM   9086  N  NE    . ARG B 1  651 ? 155.203 198.353 142.784 1.00 74.41  ? 915  ARG C NE    1 
ATOM   9087  C  CZ    . ARG B 1  651 ? 155.675 197.530 141.854 1.00 74.41  ? 915  ARG C CZ    1 
ATOM   9088  N  NH1   . ARG B 1  651 ? 154.887 196.607 141.322 1.00 74.41  ? 915  ARG C NH1   1 
ATOM   9089  N  NH2   . ARG B 1  651 ? 156.935 197.630 141.455 1.00 74.41  ? 915  ARG C NH2   1 
ATOM   9090  N  N     . PHE B 1  652 ? 151.202 194.344 144.314 1.00 69.27  ? 916  PHE C N     1 
ATOM   9091  C  CA    . PHE B 1  652 ? 151.464 192.948 143.982 1.00 69.27  ? 916  PHE C CA    1 
ATOM   9092  C  C     . PHE B 1  652 ? 150.828 192.578 142.648 1.00 69.27  ? 916  PHE C C     1 
ATOM   9093  O  O     . PHE B 1  652 ? 151.462 191.945 141.793 1.00 69.27  ? 916  PHE C O     1 
ATOM   9094  C  CB    . PHE B 1  652 ? 150.932 192.061 145.109 1.00 69.27  ? 916  PHE C CB    1 
ATOM   9095  C  CG    . PHE B 1  652 ? 151.214 190.599 144.932 1.00 69.27  ? 916  PHE C CG    1 
ATOM   9096  C  CD1   . PHE B 1  652 ? 152.465 190.082 145.209 1.00 69.27  ? 916  PHE C CD1   1 
ATOM   9097  C  CD2   . PHE B 1  652 ? 150.220 189.737 144.507 1.00 69.27  ? 916  PHE C CD2   1 
ATOM   9098  C  CE1   . PHE B 1  652 ? 152.716 188.733 145.060 1.00 69.27  ? 916  PHE C CE1   1 
ATOM   9099  C  CE2   . PHE B 1  652 ? 150.467 188.390 144.357 1.00 69.27  ? 916  PHE C CE2   1 
ATOM   9100  C  CZ    . PHE B 1  652 ? 151.718 187.888 144.628 1.00 69.27  ? 916  PHE C CZ    1 
ATOM   9101  N  N     . ALA B 1  653 ? 149.571 192.982 142.448 1.00 72.68  ? 917  ALA C N     1 
ATOM   9102  C  CA    . ALA B 1  653 ? 148.890 192.698 141.189 1.00 72.68  ? 917  ALA C CA    1 
ATOM   9103  C  C     . ALA B 1  653 ? 149.554 193.420 140.023 1.00 72.68  ? 917  ALA C C     1 
ATOM   9104  O  O     . ALA B 1  653 ? 149.705 192.848 138.936 1.00 72.68  ? 917  ALA C O     1 
ATOM   9105  C  CB    . ALA B 1  653 ? 147.417 193.088 141.293 1.00 72.68  ? 917  ALA C CB    1 
ATOM   9106  N  N     . GLU B 1  654 ? 149.956 194.677 140.228 1.00 72.75  ? 918  GLU C N     1 
ATOM   9107  C  CA    . GLU B 1  654 ? 150.636 195.416 139.169 1.00 72.75  ? 918  GLU C CA    1 
ATOM   9108  C  C     . GLU B 1  654 ? 151.963 194.761 138.805 1.00 72.75  ? 918  GLU C C     1 
ATOM   9109  O  O     . GLU B 1  654 ? 152.333 194.703 137.626 1.00 72.75  ? 918  GLU C O     1 
ATOM   9110  C  CB    . GLU B 1  654 ? 150.849 196.866 139.600 1.00 72.75  ? 918  GLU C CB    1 
ATOM   9111  C  CG    . GLU B 1  654 ? 151.477 197.747 138.536 1.00 72.75  ? 918  GLU C CG    1 
ATOM   9112  C  CD    . GLU B 1  654 ? 151.617 199.187 138.986 1.00 72.75  ? 918  GLU C CD    1 
ATOM   9113  O  OE1   . GLU B 1  654 ? 151.241 199.489 140.138 1.00 72.75  ? 918  GLU C OE1   1 
ATOM   9114  O  OE2   . GLU B 1  654 ? 152.103 200.016 138.189 1.00 72.75  ? 918  GLU C OE2   1 
ATOM   9115  N  N     . LEU B 1  655 ? 152.690 194.255 139.804 1.00 71.22  ? 919  LEU C N     1 
ATOM   9116  C  CA    . LEU B 1  655 ? 153.956 193.585 139.530 1.00 71.22  ? 919  LEU C CA    1 
ATOM   9117  C  C     . LEU B 1  655 ? 153.734 192.269 138.797 1.00 71.22  ? 919  LEU C C     1 
ATOM   9118  O  O     . LEU B 1  655 ? 154.527 191.899 137.924 1.00 71.22  ? 919  LEU C O     1 
ATOM   9119  C  CB    . LEU B 1  655 ? 154.719 193.354 140.833 1.00 71.22  ? 919  LEU C CB    1 
ATOM   9120  C  CG    . LEU B 1  655 ? 156.118 192.752 140.710 1.00 71.22  ? 919  LEU C CG    1 
ATOM   9121  C  CD1   . LEU B 1  655 ? 157.027 193.686 139.933 1.00 71.22  ? 919  LEU C CD1   1 
ATOM   9122  C  CD2   . LEU B 1  655 ? 156.694 192.469 142.084 1.00 71.22  ? 919  LEU C CD2   1 
ATOM   9123  N  N     . LEU B 1  656 ? 152.665 191.546 139.141 1.00 72.66  ? 920  LEU C N     1 
ATOM   9124  C  CA    . LEU B 1  656 ? 152.345 190.328 138.402 1.00 72.66  ? 920  LEU C CA    1 
ATOM   9125  C  C     . LEU B 1  656 ? 151.987 190.640 136.955 1.00 72.66  ? 920  LEU C C     1 
ATOM   9126  O  O     . LEU B 1  656 ? 152.369 189.903 136.039 1.00 72.66  ? 920  LEU C O     1 
ATOM   9127  C  CB    . LEU B 1  656 ? 151.196 189.578 139.073 1.00 72.66  ? 920  LEU C CB    1 
ATOM   9128  C  CG    . LEU B 1  656 ? 151.432 188.942 140.439 1.00 72.66  ? 920  LEU C CG    1 
ATOM   9129  C  CD1   . LEU B 1  656 ? 150.135 188.331 140.934 1.00 72.66  ? 920  LEU C CD1   1 
ATOM   9130  C  CD2   . LEU B 1  656 ? 152.532 187.898 140.366 1.00 72.66  ? 920  LEU C CD2   1 
ATOM   9131  N  N     . SER B 1  657 ? 151.252 191.730 136.731 1.00 73.76  ? 921  SER C N     1 
ATOM   9132  C  CA    . SER B 1  657 ? 150.798 192.044 135.380 1.00 73.76  ? 921  SER C CA    1 
ATOM   9133  C  C     . SER B 1  657 ? 151.935 192.571 134.513 1.00 73.76  ? 921  SER C C     1 
ATOM   9134  O  O     . SER B 1  657 ? 152.004 192.262 133.318 1.00 73.76  ? 921  SER C O     1 
ATOM   9135  C  CB    . SER B 1  657 ? 149.654 193.056 135.435 1.00 73.76  ? 921  SER C CB    1 
ATOM   9136  O  OG    . SER B 1  657 ? 148.523 192.508 136.088 1.00 73.76  ? 921  SER C OG    1 
ATOM   9137  N  N     . THR B 1  658 ? 152.837 193.365 135.091 1.00 72.69  ? 922  THR C N     1 
ATOM   9138  C  CA    . THR B 1  658 ? 153.867 194.027 134.290 1.00 72.69  ? 922  THR C CA    1 
ATOM   9139  C  C     . THR B 1  658 ? 155.052 193.105 134.010 1.00 72.69  ? 922  THR C C     1 
ATOM   9140  O  O     . THR B 1  658 ? 155.345 192.785 132.854 1.00 72.69  ? 922  THR C O     1 
ATOM   9141  C  CB    . THR B 1  658 ? 154.331 195.307 134.992 1.00 72.69  ? 922  THR C CB    1 
ATOM   9142  O  OG1   . THR B 1  658 ? 153.219 196.196 135.151 1.00 72.69  ? 922  THR C OG1   1 
ATOM   9143  C  CG2   . THR B 1  658 ? 155.413 195.997 134.178 1.00 72.69  ? 922  THR C CG2   1 
ATOM   9144  N  N     . LYS B 1  659 ? 155.743 192.667 135.063 1.00 72.82  ? 923  LYS C N     1 
ATOM   9145  C  CA    . LYS B 1  659 ? 156.986 191.924 134.872 1.00 72.82  ? 923  LYS C CA    1 
ATOM   9146  C  C     . LYS B 1  659 ? 156.716 190.465 134.526 1.00 72.82  ? 923  LYS C C     1 
ATOM   9147  O  O     . LYS B 1  659 ? 157.314 189.917 133.594 1.00 72.82  ? 923  LYS C O     1 
ATOM   9148  C  CB    . LYS B 1  659 ? 157.855 192.030 136.124 1.00 72.82  ? 923  LYS C CB    1 
ATOM   9149  C  CG    . LYS B 1  659 ? 158.283 193.448 136.460 1.00 72.82  ? 923  LYS C CG    1 
ATOM   9150  C  CD    . LYS B 1  659 ? 159.238 193.996 135.414 1.00 72.82  ? 923  LYS C CD    1 
ATOM   9151  C  CE    . LYS B 1  659 ? 159.727 195.385 135.788 1.00 72.82  ? 923  LYS C CE    1 
ATOM   9152  N  NZ    . LYS B 1  659 ? 160.630 195.951 134.748 1.00 72.82  ? 923  LYS C NZ    1 
ATOM   9153  N  N     . PHE B 1  660 ? 155.817 189.820 135.265 1.00 73.98  ? 924  PHE C N     1 
ATOM   9154  C  CA    . PHE B 1  660 ? 155.526 188.405 135.083 1.00 73.98  ? 924  PHE C CA    1 
ATOM   9155  C  C     . PHE B 1  660 ? 154.396 188.155 134.093 1.00 73.98  ? 924  PHE C C     1 
ATOM   9156  O  O     . PHE B 1  660 ? 153.686 187.150 134.220 1.00 73.98  ? 924  PHE C O     1 
ATOM   9157  C  CB    . PHE B 1  660 ? 155.201 187.763 136.433 1.00 73.98  ? 924  PHE C CB    1 
ATOM   9158  C  CG    . PHE B 1  660 ? 156.368 187.727 137.377 1.00 73.98  ? 924  PHE C CG    1 
ATOM   9159  C  CD1   . PHE B 1  660 ? 157.323 186.730 137.281 1.00 73.98  ? 924  PHE C CD1   1 
ATOM   9160  C  CD2   . PHE B 1  660 ? 156.516 188.698 138.352 1.00 73.98  ? 924  PHE C CD2   1 
ATOM   9161  C  CE1   . PHE B 1  660 ? 158.399 186.698 138.146 1.00 73.98  ? 924  PHE C CE1   1 
ATOM   9162  C  CE2   . PHE B 1  660 ? 157.590 188.671 139.219 1.00 73.98  ? 924  PHE C CE2   1 
ATOM   9163  C  CZ    . PHE B 1  660 ? 158.532 187.670 139.116 1.00 73.98  ? 924  PHE C CZ    1 
ATOM   9164  N  N     . LYS B 1  661 ? 154.217 189.051 133.123 1.00 76.72  ? 925  LYS C N     1 
ATOM   9165  C  CA    . LYS B 1  661 ? 153.180 188.927 132.105 1.00 76.72  ? 925  LYS C CA    1 
ATOM   9166  C  C     . LYS B 1  661 ? 153.300 187.618 131.331 1.00 76.72  ? 925  LYS C C     1 
ATOM   9167  O  O     . LYS B 1  661 ? 152.300 187.093 130.833 1.00 76.72  ? 925  LYS C O     1 
ATOM   9168  C  CB    . LYS B 1  661 ? 153.248 190.118 131.146 1.00 76.72  ? 925  LYS C CB    1 
ATOM   9169  C  CG    . LYS B 1  661 ? 152.140 190.160 130.108 1.00 76.72  ? 925  LYS C CG    1 
ATOM   9170  C  CD    . LYS B 1  661 ? 152.254 191.402 129.240 1.00 76.72  ? 925  LYS C CD    1 
ATOM   9171  C  CE    . LYS B 1  661 ? 151.159 191.444 128.188 1.00 76.72  ? 925  LYS C CE    1 
ATOM   9172  N  NZ    . LYS B 1  661 ? 151.270 192.653 127.326 1.00 76.72  ? 925  LYS C NZ    1 
ATOM   9173  N  N     . TYR B 1  662 ? 154.518 187.080 131.232 1.00 76.63  ? 926  TYR C N     1 
ATOM   9174  C  CA    . TYR B 1  662 ? 154.752 185.868 130.454 1.00 76.63  ? 926  TYR C CA    1 
ATOM   9175  C  C     . TYR B 1  662 ? 154.012 184.653 131.000 1.00 76.63  ? 926  TYR C C     1 
ATOM   9176  O  O     . TYR B 1  662 ? 153.944 183.632 130.307 1.00 76.63  ? 926  TYR C O     1 
ATOM   9177  C  CB    . TYR B 1  662 ? 156.252 185.569 130.389 1.00 76.63  ? 926  TYR C CB    1 
ATOM   9178  C  CG    . TYR B 1  662 ? 156.880 185.264 131.730 1.00 76.63  ? 926  TYR C CG    1 
ATOM   9179  C  CD1   . TYR B 1  662 ? 157.402 186.279 132.520 1.00 76.63  ? 926  TYR C CD1   1 
ATOM   9180  C  CD2   . TYR B 1  662 ? 156.957 183.961 132.204 1.00 76.63  ? 926  TYR C CD2   1 
ATOM   9181  C  CE1   . TYR B 1  662 ? 157.977 186.006 133.745 1.00 76.63  ? 926  TYR C CE1   1 
ATOM   9182  C  CE2   . TYR B 1  662 ? 157.528 183.679 133.428 1.00 76.63  ? 926  TYR C CE2   1 
ATOM   9183  C  CZ    . TYR B 1  662 ? 158.038 184.704 134.193 1.00 76.63  ? 926  TYR C CZ    1 
ATOM   9184  O  OH    . TYR B 1  662 ? 158.609 184.424 135.412 1.00 76.63  ? 926  TYR C OH    1 
ATOM   9185  N  N     . ARG B 1  663 ? 153.466 184.729 132.213 1.00 78.91  ? 927  ARG C N     1 
ATOM   9186  C  CA    . ARG B 1  663 ? 152.753 183.605 132.807 1.00 78.91  ? 927  ARG C CA    1 
ATOM   9187  C  C     . ARG B 1  663 ? 151.349 183.941 133.288 1.00 78.91  ? 927  ARG C C     1 
ATOM   9188  O  O     . ARG B 1  663 ? 150.487 183.054 133.266 1.00 78.91  ? 927  ARG C O     1 
ATOM   9189  C  CB    . ARG B 1  663 ? 153.555 183.025 133.984 1.00 78.91  ? 927  ARG C CB    1 
ATOM   9190  C  CG    . ARG B 1  663 ? 152.954 181.770 134.601 1.00 78.91  ? 927  ARG C CG    1 
ATOM   9191  C  CD    . ARG B 1  663 ? 153.856 181.189 135.677 1.00 78.91  ? 927  ARG C CD    1 
ATOM   9192  N  NE    . ARG B 1  663 ? 153.240 180.045 136.344 1.00 78.91  ? 927  ARG C NE    1 
ATOM   9193  C  CZ    . ARG B 1  663 ? 153.314 178.793 135.905 1.00 78.91  ? 927  ARG C CZ    1 
ATOM   9194  N  NH1   . ARG B 1  663 ? 153.979 178.515 134.792 1.00 78.91  ? 927  ARG C NH1   1 
ATOM   9195  N  NH2   . ARG B 1  663 ? 152.722 177.816 136.579 1.00 78.91  ? 927  ARG C NH2   1 
ATOM   9196  N  N     . TYR B 1  664 ? 151.078 185.177 133.696 1.00 79.61  ? 928  TYR C N     1 
ATOM   9197  C  CA    . TYR B 1  664 ? 149.792 185.562 134.262 1.00 79.61  ? 928  TYR C CA    1 
ATOM   9198  C  C     . TYR B 1  664 ? 149.006 186.444 133.301 1.00 79.61  ? 928  TYR C C     1 
ATOM   9199  O  O     . TYR B 1  664 ? 148.341 187.399 133.708 1.00 79.61  ? 928  TYR C O     1 
ATOM   9200  C  CB    . TYR B 1  664 ? 149.982 186.265 135.603 1.00 79.61  ? 928  TYR C CB    1 
ATOM   9201  C  CG    . TYR B 1  664 ? 150.566 185.369 136.666 1.00 79.61  ? 928  TYR C CG    1 
ATOM   9202  C  CD1   . TYR B 1  664 ? 149.766 184.480 137.370 1.00 79.61  ? 928  TYR C CD1   1 
ATOM   9203  C  CD2   . TYR B 1  664 ? 151.922 185.403 136.956 1.00 79.61  ? 928  TYR C CD2   1 
ATOM   9204  C  CE1   . TYR B 1  664 ? 150.300 183.656 138.339 1.00 79.61  ? 928  TYR C CE1   1 
ATOM   9205  C  CE2   . TYR B 1  664 ? 152.463 184.584 137.922 1.00 79.61  ? 928  TYR C CE2   1 
ATOM   9206  C  CZ    . TYR B 1  664 ? 151.650 183.714 138.609 1.00 79.61  ? 928  TYR C CZ    1 
ATOM   9207  O  OH    . TYR B 1  664 ? 152.194 182.900 139.570 1.00 79.61  ? 928  TYR C OH    1 
ATOM   9208  N  N     . GLU B 1  665 ? 149.075 186.135 132.010 1.00 82.85  ? 929  GLU C N     1 
ATOM   9209  C  CA    . GLU B 1  665 ? 148.321 186.852 130.989 1.00 82.85  ? 929  GLU C CA    1 
ATOM   9210  C  C     . GLU B 1  665 ? 147.136 185.988 130.574 1.00 82.85  ? 929  GLU C C     1 
ATOM   9211  O  O     . GLU B 1  665 ? 147.266 185.121 129.703 1.00 82.85  ? 929  GLU C O     1 
ATOM   9212  C  CB    . GLU B 1  665 ? 149.203 187.192 129.791 1.00 82.85  ? 929  GLU C CB    1 
ATOM   9213  C  CG    . GLU B 1  665 ? 148.501 188.021 128.728 1.00 82.85  ? 929  GLU C CG    1 
ATOM   9214  C  CD    . GLU B 1  665 ? 149.415 188.394 127.579 1.00 82.85  ? 929  GLU C CD    1 
ATOM   9215  O  OE1   . GLU B 1  665 ? 150.596 187.989 127.601 1.00 82.85  ? 929  GLU C OE1   1 
ATOM   9216  O  OE2   . GLU B 1  665 ? 148.953 189.094 126.654 1.00 82.85  ? 929  GLU C OE2   1 
ATOM   9217  N  N     . GLY B 1  666 ? 145.986 186.221 131.200 1.00 81.58  ? 930  GLY C N     1 
ATOM   9218  C  CA    . GLY B 1  666 ? 144.781 185.487 130.886 1.00 81.58  ? 930  GLY C CA    1 
ATOM   9219  C  C     . GLY B 1  666 ? 144.474 184.319 131.797 1.00 81.58  ? 930  GLY C C     1 
ATOM   9220  O  O     . GLY B 1  666 ? 143.430 183.677 131.620 1.00 81.58  ? 930  GLY C O     1 
ATOM   9221  N  N     . LYS B 1  667 ? 145.339 184.020 132.763 1.00 80.67  ? 931  LYS C N     1 
ATOM   9222  C  CA    . LYS B 1  667 ? 145.103 182.905 133.668 1.00 80.67  ? 931  LYS C CA    1 
ATOM   9223  C  C     . LYS B 1  667 ? 145.840 183.156 134.974 1.00 80.67  ? 931  LYS C C     1 
ATOM   9224  O  O     . LYS B 1  667 ? 146.873 183.830 135.001 1.00 80.67  ? 931  LYS C O     1 
ATOM   9225  C  CB    . LYS B 1  667 ? 145.547 181.575 133.048 1.00 80.67  ? 931  LYS C CB    1 
ATOM   9226  C  CG    . LYS B 1  667 ? 147.047 181.446 132.853 1.00 80.67  ? 931  LYS C CG    1 
ATOM   9227  C  CD    . LYS B 1  667 ? 147.407 180.116 132.215 1.00 80.67  ? 931  LYS C CD    1 
ATOM   9228  C  CE    . LYS B 1  667 ? 148.905 180.000 131.990 1.00 80.67  ? 931  LYS C CE    1 
ATOM   9229  N  NZ    . LYS B 1  667 ? 149.653 179.938 133.276 1.00 80.67  ? 931  LYS C NZ    1 
ATOM   9230  N  N     . ILE B 1  668 ? 145.291 182.606 136.057 1.00 77.55  ? 932  ILE C N     1 
ATOM   9231  C  CA    . ILE B 1  668 ? 145.874 182.754 137.386 1.00 77.55  ? 932  ILE C CA    1 
ATOM   9232  C  C     . ILE B 1  668 ? 145.278 181.672 138.274 1.00 77.55  ? 932  ILE C C     1 
ATOM   9233  O  O     . ILE B 1  668 ? 144.197 181.148 137.999 1.00 77.55  ? 932  ILE C O     1 
ATOM   9234  C  CB    . ILE B 1  668 ? 145.619 184.174 137.955 1.00 77.55  ? 932  ILE C CB    1 
ATOM   9235  C  CG1   . ILE B 1  668 ? 146.496 184.430 139.181 1.00 77.55  ? 932  ILE C CG1   1 
ATOM   9236  C  CG2   . ILE B 1  668 ? 144.148 184.361 138.290 1.00 77.55  ? 932  ILE C CG2   1 
ATOM   9237  C  CD1   . ILE B 1  668 ? 146.564 185.878 139.588 1.00 77.55  ? 932  ILE C CD1   1 
ATOM   9238  N  N     . THR B 1  669 ? 145.991 181.327 139.343 1.00 77.33  ? 933  THR C N     1 
ATOM   9239  C  CA    . THR B 1  669 ? 145.549 180.276 140.243 1.00 77.33  ? 933  THR C CA    1 
ATOM   9240  C  C     . THR B 1  669 ? 144.381 180.756 141.104 1.00 77.33  ? 933  THR C C     1 
ATOM   9241  O  O     . THR B 1  669 ? 143.973 181.919 141.064 1.00 77.33  ? 933  THR C O     1 
ATOM   9242  C  CB    . THR B 1  669 ? 146.701 179.808 141.130 1.00 77.33  ? 933  THR C CB    1 
ATOM   9243  O  OG1   . THR B 1  669 ? 147.140 180.891 141.957 1.00 77.33  ? 933  THR C OG1   1 
ATOM   9244  C  CG2   . THR B 1  669 ? 147.864 179.332 140.275 1.00 77.33  ? 933  THR C CG2   1 
ATOM   9245  N  N     . ASN B 1  670 ? 143.841 179.830 141.899 1.00 75.60  ? 934  ASN C N     1 
ATOM   9246  C  CA    . ASN B 1  670 ? 142.687 180.145 142.734 1.00 75.60  ? 934  ASN C CA    1 
ATOM   9247  C  C     . ASN B 1  670 ? 143.095 180.977 143.944 1.00 75.60  ? 934  ASN C C     1 
ATOM   9248  O  O     . ASN B 1  670 ? 142.485 182.015 144.238 1.00 75.60  ? 934  ASN C O     1 
ATOM   9249  C  CB    . ASN B 1  670 ? 142.007 178.854 143.186 1.00 75.60  ? 934  ASN C CB    1 
ATOM   9250  C  CG    . ASN B 1  670 ? 141.413 178.074 142.034 1.00 75.60  ? 934  ASN C CG    1 
ATOM   9251  O  OD1   . ASN B 1  670 ? 140.833 178.647 141.117 1.00 75.60  ? 934  ASN C OD1   1 
ATOM   9252  N  ND2   . ASN B 1  670 ? 141.553 176.755 142.078 1.00 75.60  ? 934  ASN C ND2   1 
ATOM   9253  N  N     . TYR B 1  671 ? 144.085 180.492 144.679 1.00 71.75  ? 935  TYR C N     1 
ATOM   9254  C  CA    . TYR B 1  671 ? 144.517 181.175 145.888 1.00 71.75  ? 935  TYR C CA    1 
ATOM   9255  C  C     . TYR B 1  671 ? 144.953 182.616 145.664 1.00 71.75  ? 935  TYR C C     1 
ATOM   9256  O  O     . TYR B 1  671 ? 144.658 183.487 146.480 1.00 71.75  ? 935  TYR C O     1 
ATOM   9257  C  CB    . TYR B 1  671 ? 145.549 180.341 146.641 1.00 71.75  ? 935  TYR C CB    1 
ATOM   9258  C  CG    . TYR B 1  671 ? 144.898 179.151 147.302 1.00 71.75  ? 935  TYR C CG    1 
ATOM   9259  C  CD1   . TYR B 1  671 ? 143.963 179.326 148.310 1.00 71.75  ? 935  TYR C CD1   1 
ATOM   9260  C  CD2   . TYR B 1  671 ? 145.183 177.860 146.893 1.00 71.75  ? 935  TYR C CD2   1 
ATOM   9261  C  CE1   . TYR B 1  671 ? 143.348 178.248 148.911 1.00 71.75  ? 935  TYR C CE1   1 
ATOM   9262  C  CE2   . TYR B 1  671 ? 144.573 176.774 147.489 1.00 71.75  ? 935  TYR C CE2   1 
ATOM   9263  C  CZ    . TYR B 1  671 ? 143.657 176.976 148.497 1.00 71.75  ? 935  TYR C CZ    1 
ATOM   9264  O  OH    . TYR B 1  671 ? 143.046 175.900 149.094 1.00 71.75  ? 935  TYR C OH    1 
ATOM   9265  N  N     . PHE B 1  672 ? 145.608 182.880 144.542 1.00 69.85  ? 936  PHE C N     1 
ATOM   9266  C  CA    . PHE B 1  672 ? 146.033 184.238 144.246 1.00 69.85  ? 936  PHE C CA    1 
ATOM   9267  C  C     . PHE B 1  672 ? 144.825 185.170 144.261 1.00 69.85  ? 936  PHE C C     1 
ATOM   9268  O  O     . PHE B 1  672 ? 144.864 186.231 144.876 1.00 69.85  ? 936  PHE C O     1 
ATOM   9269  C  CB    . PHE B 1  672 ? 146.768 184.301 142.912 1.00 69.85  ? 936  PHE C CB    1 
ATOM   9270  C  CG    . PHE B 1  672 ? 148.254 184.149 143.040 1.00 69.85  ? 936  PHE C CG    1 
ATOM   9271  C  CD1   . PHE B 1  672 ? 148.848 184.097 144.287 1.00 69.85  ? 936  PHE C CD1   1 
ATOM   9272  C  CD2   . PHE B 1  672 ? 149.056 184.060 141.918 1.00 69.85  ? 936  PHE C CD2   1 
ATOM   9273  C  CE1   . PHE B 1  672 ? 150.216 183.958 144.414 1.00 69.85  ? 936  PHE C CE1   1 
ATOM   9274  C  CE2   . PHE B 1  672 ? 150.425 183.920 142.037 1.00 69.85  ? 936  PHE C CE2   1 
ATOM   9275  C  CZ    . PHE B 1  672 ? 151.005 183.868 143.287 1.00 69.85  ? 936  PHE C CZ    1 
ATOM   9276  N  N     . HIS B 1  673 ? 143.753 184.774 143.582 1.00 71.58  ? 937  HIS C N     1 
ATOM   9277  C  CA    . HIS B 1  673 ? 142.535 185.577 143.564 1.00 71.58  ? 937  HIS C CA    1 
ATOM   9278  C  C     . HIS B 1  673 ? 141.919 185.664 144.953 1.00 71.58  ? 937  HIS C C     1 
ATOM   9279  O  O     . HIS B 1  673 ? 141.518 186.746 145.402 1.00 71.58  ? 937  HIS C O     1 
ATOM   9280  C  CB    . HIS B 1  673 ? 141.533 184.993 142.568 1.00 71.58  ? 937  HIS C CB    1 
ATOM   9281  C  CG    . HIS B 1  673 ? 140.250 185.759 142.482 1.00 71.58  ? 937  HIS C CG    1 
ATOM   9282  N  ND1   . HIS B 1  673 ? 140.155 186.983 141.856 1.00 71.58  ? 937  HIS C ND1   1 
ATOM   9283  C  CD2   . HIS B 1  673 ? 139.010 185.476 142.946 1.00 71.58  ? 937  HIS C CD2   1 
ATOM   9284  C  CE1   . HIS B 1  673 ? 138.911 187.420 141.937 1.00 71.58  ? 937  HIS C CE1   1 
ATOM   9285  N  NE2   . HIS B 1  673 ? 138.196 186.525 142.593 1.00 71.58  ? 937  HIS C NE2   1 
ATOM   9286  N  N     . LYS B 1  674 ? 141.855 184.532 145.639 1.00 72.35  ? 938  LYS C N     1 
ATOM   9287  C  CA    . LYS B 1  674 ? 141.282 184.490 146.975 1.00 72.35  ? 938  LYS C CA    1 
ATOM   9288  C  C     . LYS B 1  674 ? 142.016 185.412 147.938 1.00 72.35  ? 938  LYS C C     1 
ATOM   9289  O  O     . LYS B 1  674 ? 141.404 186.011 148.818 1.00 72.35  ? 938  LYS C O     1 
ATOM   9290  C  CB    . LYS B 1  674 ? 141.316 183.062 147.518 1.00 72.35  ? 938  LYS C CB    1 
ATOM   9291  C  CG    . LYS B 1  674 ? 139.976 182.350 147.490 1.00 72.35  ? 938  LYS C CG    1 
ATOM   9292  C  CD    . LYS B 1  674 ? 140.137 180.879 147.825 1.00 72.35  ? 938  LYS C CD    1 
ATOM   9293  C  CE    . LYS B 1  674 ? 138.846 180.116 147.584 1.00 72.35  ? 938  LYS C CE    1 
ATOM   9294  N  NZ    . LYS B 1  674 ? 139.087 178.827 146.879 1.00 72.35  ? 938  LYS C NZ    1 
ATOM   9295  N  N     . THR B 1  675 ? 143.327 185.532 147.764 1.00 70.92  ? 939  THR C N     1 
ATOM   9296  C  CA    . THR B 1  675 ? 144.141 186.354 148.651 1.00 70.92  ? 939  THR C CA    1 
ATOM   9297  C  C     . THR B 1  675 ? 144.051 187.826 148.277 1.00 70.92  ? 939  THR C C     1 
ATOM   9298  O  O     . THR B 1  675 ? 143.916 188.693 149.148 1.00 70.92  ? 939  THR C O     1 
ATOM   9299  C  CB    . THR B 1  675 ? 145.592 185.879 148.606 1.00 70.92  ? 939  THR C CB    1 
ATOM   9300  O  OG1   . THR B 1  675 ? 145.666 184.517 149.045 1.00 70.92  ? 939  THR C OG1   1 
ATOM   9301  C  CG2   . THR B 1  675 ? 146.462 186.745 149.493 1.00 70.92  ? 939  THR C CG2   1 
ATOM   9302  N  N     . LEU B 1  676 ? 144.123 188.131 146.982 1.00 70.49  ? 940  LEU C N     1 
ATOM   9303  C  CA    . LEU B 1  676 ? 144.197 189.521 146.555 1.00 70.49  ? 940  LEU C CA    1 
ATOM   9304  C  C     . LEU B 1  676 ? 142.837 190.203 146.530 1.00 70.49  ? 940  LEU C C     1 
ATOM   9305  O  O     . LEU B 1  676 ? 142.773 191.436 146.514 1.00 70.49  ? 940  LEU C O     1 
ATOM   9306  C  CB    . LEU B 1  676 ? 144.845 189.606 145.174 1.00 70.49  ? 940  LEU C CB    1 
ATOM   9307  C  CG    . LEU B 1  676 ? 146.315 189.199 145.107 1.00 70.49  ? 940  LEU C CG    1 
ATOM   9308  C  CD1   . LEU B 1  676 ? 146.810 189.205 143.671 1.00 70.49  ? 940  LEU C CD1   1 
ATOM   9309  C  CD2   . LEU B 1  676 ? 147.143 190.127 145.971 1.00 70.49  ? 940  LEU C CD2   1 
ATOM   9310  N  N     . ALA B 1  677 ? 141.745 189.441 146.536 1.00 72.70  ? 941  ALA C N     1 
ATOM   9311  C  CA    . ALA B 1  677 ? 140.432 190.033 146.309 1.00 72.70  ? 941  ALA C CA    1 
ATOM   9312  C  C     . ALA B 1  677 ? 139.545 190.080 147.546 1.00 72.70  ? 941  ALA C C     1 
ATOM   9313  O  O     . ALA B 1  677 ? 138.813 191.058 147.733 1.00 72.70  ? 941  ALA C O     1 
ATOM   9314  C  CB    . ALA B 1  677 ? 139.700 189.273 145.200 1.00 72.70  ? 941  ALA C CB    1 
ATOM   9315  N  N     . HIS B 1  678 ? 139.581 189.056 148.400 1.00 71.53  ? 942  HIS C N     1 
ATOM   9316  C  CA    . HIS B 1  678 ? 138.497 188.850 149.349 1.00 71.53  ? 942  HIS C CA    1 
ATOM   9317  C  C     . HIS B 1  678 ? 138.885 188.960 150.818 1.00 71.53  ? 942  HIS C C     1 
ATOM   9318  O  O     . HIS B 1  678 ? 138.001 189.200 151.646 1.00 71.53  ? 942  HIS C O     1 
ATOM   9319  C  CB    . HIS B 1  678 ? 137.848 187.476 149.111 1.00 71.53  ? 942  HIS C CB    1 
ATOM   9320  C  CG    . HIS B 1  678 ? 137.157 187.350 147.786 1.00 71.53  ? 942  HIS C CG    1 
ATOM   9321  N  ND1   . HIS B 1  678 ? 135.953 187.962 147.514 1.00 71.53  ? 942  HIS C ND1   1 
ATOM   9322  C  CD2   . HIS B 1  678 ? 137.492 186.668 146.664 1.00 71.53  ? 942  HIS C CD2   1 
ATOM   9323  C  CE1   . HIS B 1  678 ? 135.580 187.671 146.281 1.00 71.53  ? 942  HIS C CE1   1 
ATOM   9324  N  NE2   . HIS B 1  678 ? 136.496 186.886 145.743 1.00 71.53  ? 942  HIS C NE2   1 
ATOM   9325  N  N     . VAL B 1  679 ? 140.160 188.813 151.169 1.00 68.13  ? 943  VAL C N     1 
ATOM   9326  C  CA    . VAL B 1  679 ? 140.534 188.681 152.580 1.00 68.13  ? 943  VAL C CA    1 
ATOM   9327  C  C     . VAL B 1  679 ? 140.298 189.938 153.421 1.00 68.13  ? 943  VAL C C     1 
ATOM   9328  O  O     . VAL B 1  679 ? 139.996 189.791 154.612 1.00 68.13  ? 943  VAL C O     1 
ATOM   9329  C  CB    . VAL B 1  679 ? 141.990 188.197 152.731 1.00 68.13  ? 943  VAL C CB    1 
ATOM   9330  C  CG1   . VAL B 1  679 ? 142.165 186.827 152.094 1.00 68.13  ? 943  VAL C CG1   1 
ATOM   9331  C  CG2   . VAL B 1  679 ? 142.974 189.177 152.147 1.00 68.13  ? 943  VAL C CG2   1 
ATOM   9332  N  N     . PRO B 1  680 ? 140.395 191.177 152.910 1.00 67.96  ? 944  PRO C N     1 
ATOM   9333  C  CA    . PRO B 1  680 ? 140.064 192.309 153.795 1.00 67.96  ? 944  PRO C CA    1 
ATOM   9334  C  C     . PRO B 1  680 ? 138.622 192.277 154.265 1.00 67.96  ? 944  PRO C C     1 
ATOM   9335  O  O     . PRO B 1  680 ? 138.344 192.535 155.445 1.00 67.96  ? 944  PRO C O     1 
ATOM   9336  C  CB    . PRO B 1  680 ? 140.347 193.538 152.920 1.00 67.96  ? 944  PRO C CB    1 
ATOM   9337  C  CG    . PRO B 1  680 ? 141.255 193.053 151.853 1.00 67.96  ? 944  PRO C CG    1 
ATOM   9338  C  CD    . PRO B 1  680 ? 140.794 191.665 151.578 1.00 67.96  ? 944  PRO C CD    1 
ATOM   9339  N  N     . GLU B 1  681 ? 137.694 191.963 153.358 1.00 73.82  ? 945  GLU C N     1 
ATOM   9340  C  CA    . GLU B 1  681 ? 136.302 191.770 153.744 1.00 73.82  ? 945  GLU C CA    1 
ATOM   9341  C  C     . GLU B 1  681 ? 136.169 190.629 154.744 1.00 73.82  ? 945  GLU C C     1 
ATOM   9342  O  O     . GLU B 1  681 ? 135.329 190.675 155.648 1.00 73.82  ? 945  GLU C O     1 
ATOM   9343  C  CB    . GLU B 1  681 ? 135.450 191.505 152.501 1.00 73.82  ? 945  GLU C CB    1 
ATOM   9344  C  CG    . GLU B 1  681 ? 133.959 191.367 152.774 1.00 73.82  ? 945  GLU C CG    1 
ATOM   9345  C  CD    . GLU B 1  681 ? 133.153 191.153 151.508 1.00 73.82  ? 945  GLU C CD    1 
ATOM   9346  O  OE1   . GLU B 1  681 ? 133.767 191.086 150.423 1.00 73.82  ? 945  GLU C OE1   1 
ATOM   9347  O  OE2   . GLU B 1  681 ? 131.911 191.053 151.595 1.00 73.82  ? 945  GLU C OE2   1 
ATOM   9348  N  N     . ILE B 1  682 ? 137.012 189.603 154.614 1.00 68.74  ? 946  ILE C N     1 
ATOM   9349  C  CA    . ILE B 1  682 ? 136.925 188.458 155.517 1.00 68.74  ? 946  ILE C CA    1 
ATOM   9350  C  C     . ILE B 1  682 ? 137.333 188.854 156.930 1.00 68.74  ? 946  ILE C C     1 
ATOM   9351  O  O     . ILE B 1  682 ? 136.675 188.477 157.907 1.00 68.74  ? 946  ILE C O     1 
ATOM   9352  C  CB    . ILE B 1  682 ? 137.769 187.288 154.985 1.00 68.74  ? 946  ILE C CB    1 
ATOM   9353  C  CG1   . ILE B 1  682 ? 137.206 186.807 153.650 1.00 68.74  ? 946  ILE C CG1   1 
ATOM   9354  C  CG2   . ILE B 1  682 ? 137.795 186.147 155.987 1.00 68.74  ? 946  ILE C CG2   1 
ATOM   9355  C  CD1   . ILE B 1  682 ? 138.082 185.807 152.953 1.00 68.74  ? 946  ILE C CD1   1 
ATOM   9356  N  N     . ILE B 1  683 ? 138.422 189.617 157.066 1.00 72.45  ? 947  ILE C N     1 
ATOM   9357  C  CA    . ILE B 1  683 ? 138.800 190.114 158.387 1.00 72.45  ? 947  ILE C CA    1 
ATOM   9358  C  C     . ILE B 1  683 ? 137.731 191.053 158.933 1.00 72.45  ? 947  ILE C C     1 
ATOM   9359  O  O     . ILE B 1  683 ? 137.318 190.934 160.092 1.00 72.45  ? 947  ILE C O     1 
ATOM   9360  C  CB    . ILE B 1  683 ? 140.185 190.788 158.365 1.00 72.45  ? 947  ILE C CB    1 
ATOM   9361  C  CG1   . ILE B 1  683 ? 141.294 189.738 158.320 1.00 72.45  ? 947  ILE C CG1   1 
ATOM   9362  C  CG2   . ILE B 1  683 ? 140.382 191.650 159.601 1.00 72.45  ? 947  ILE C CG2   1 
ATOM   9363  C  CD1   . ILE B 1  683 ? 141.791 189.391 156.948 1.00 72.45  ? 947  ILE C CD1   1 
ATOM   9364  N  N     . GLU B 1  684 ? 137.255 191.991 158.110 1.00 77.99  ? 948  GLU C N     1 
ATOM   9365  C  CA    . GLU B 1  684 ? 136.238 192.928 158.577 1.00 77.99  ? 948  GLU C CA    1 
ATOM   9366  C  C     . GLU B 1  684 ? 134.908 192.255 158.898 1.00 77.99  ? 948  GLU C C     1 
ATOM   9367  O  O     . GLU B 1  684 ? 134.078 192.857 159.587 1.00 77.99  ? 948  GLU C O     1 
ATOM   9368  C  CB    . GLU B 1  684 ? 136.027 194.030 157.538 1.00 77.99  ? 948  GLU C CB    1 
ATOM   9369  C  CG    . GLU B 1  684 ? 137.224 194.957 157.374 1.00 77.99  ? 948  GLU C CG    1 
ATOM   9370  C  CD    . GLU B 1  684 ? 136.974 196.051 156.356 1.00 77.99  ? 948  GLU C CD    1 
ATOM   9371  O  OE1   . GLU B 1  684 ? 135.921 196.004 155.687 1.00 77.99  ? 948  GLU C OE1   1 
ATOM   9372  O  OE2   . GLU B 1  684 ? 137.823 196.958 156.228 1.00 77.99  ? 948  GLU C OE2   1 
ATOM   9373  N  N     . ARG B 1  685 ? 134.735 191.012 158.461 1.00 75.69  ? 949  ARG C N     1 
ATOM   9374  C  CA    . ARG B 1  685 ? 133.501 190.273 158.710 1.00 75.69  ? 949  ARG C CA    1 
ATOM   9375  C  C     . ARG B 1  685 ? 133.619 189.316 159.896 1.00 75.69  ? 949  ARG C C     1 
ATOM   9376  O  O     . ARG B 1  685 ? 132.643 189.062 160.598 1.00 75.69  ? 949  ARG C O     1 
ATOM   9377  C  CB    . ARG B 1  685 ? 133.089 189.507 157.452 1.00 75.69  ? 949  ARG C CB    1 
ATOM   9378  C  CG    . ARG B 1  685 ? 132.233 188.281 157.708 1.00 75.69  ? 949  ARG C CG    1 
ATOM   9379  C  CD    . ARG B 1  685 ? 131.437 187.920 156.466 1.00 75.69  ? 949  ARG C CD    1 
ATOM   9380  N  NE    . ARG B 1  685 ? 131.550 186.507 156.112 1.00 75.69  ? 949  ARG C NE    1 
ATOM   9381  C  CZ    . ARG B 1  685 ? 132.678 185.808 156.154 1.00 75.69  ? 949  ARG C CZ    1 
ATOM   9382  N  NH1   . ARG B 1  685 ? 132.679 184.529 155.810 1.00 75.69  ? 949  ARG C NH1   1 
ATOM   9383  N  NH2   . ARG B 1  685 ? 133.807 186.383 156.541 1.00 75.69  ? 949  ARG C NH2   1 
ATOM   9384  N  N     . ASP B 1  686 ? 134.819 188.789 160.111 1.00 77.05  ? 950  ASP C N     1 
ATOM   9385  C  CA    . ASP B 1  686 ? 135.086 187.858 161.201 1.00 77.05  ? 950  ASP C CA    1 
ATOM   9386  C  C     . ASP B 1  686 ? 136.089 188.381 162.214 1.00 77.05  ? 950  ASP C C     1 
ATOM   9387  O  O     . ASP B 1  686 ? 135.799 188.391 163.412 1.00 77.05  ? 950  ASP C O     1 
ATOM   9388  C  CB    . ASP B 1  686 ? 135.596 186.522 160.641 1.00 77.05  ? 950  ASP C CB    1 
ATOM   9389  C  CG    . ASP B 1  686 ? 134.509 185.724 159.959 1.00 77.05  ? 950  ASP C CG    1 
ATOM   9390  O  OD1   . ASP B 1  686 ? 133.341 185.825 160.389 1.00 77.05  ? 950  ASP C OD1   1 
ATOM   9391  O  OD2   . ASP B 1  686 ? 134.818 184.997 158.993 1.00 77.05  ? 950  ASP C OD2   1 
ATOM   9392  N  N     . GLY B 1  687 ? 137.271 188.811 161.765 1.00 76.64  ? 951  GLY C N     1 
ATOM   9393  C  CA    . GLY B 1  687 ? 138.322 189.300 162.632 1.00 76.64  ? 951  GLY C CA    1 
ATOM   9394  C  C     . GLY B 1  687 ? 139.609 188.504 162.540 1.00 76.64  ? 951  GLY C C     1 
ATOM   9395  O  O     . GLY B 1  687 ? 140.671 189.017 162.914 1.00 76.64  ? 951  GLY C O     1 
ATOM   9396  N  N     . SER B 1  688 ? 139.537 187.269 162.051 1.00 71.75  ? 952  SER C N     1 
ATOM   9397  C  CA    . SER B 1  688 ? 140.721 186.430 161.927 1.00 71.75  ? 952  SER C CA    1 
ATOM   9398  C  C     . SER B 1  688 ? 140.452 185.342 160.900 1.00 71.75  ? 952  SER C C     1 
ATOM   9399  O  O     . SER B 1  688 ? 139.303 184.969 160.648 1.00 71.75  ? 952  SER C O     1 
ATOM   9400  C  CB    . SER B 1  688 ? 141.118 185.814 163.272 1.00 71.75  ? 952  SER C CB    1 
ATOM   9401  O  OG    . SER B 1  688 ? 142.247 184.970 163.128 1.00 71.75  ? 952  SER C OG    1 
ATOM   9402  N  N     . ILE B 1  689 ? 141.535 184.839 160.308 1.00 67.96  ? 953  ILE C N     1 
ATOM   9403  C  CA    . ILE B 1  689 ? 141.484 183.755 159.335 1.00 67.96  ? 953  ILE C CA    1 
ATOM   9404  C  C     . ILE B 1  689 ? 142.289 182.550 159.802 1.00 67.96  ? 953  ILE C C     1 
ATOM   9405  O  O     . ILE B 1  689 ? 141.835 181.406 159.696 1.00 67.96  ? 953  ILE C O     1 
ATOM   9406  C  CB    . ILE B 1  689 ? 141.966 184.225 157.944 1.00 67.96  ? 953  ILE C CB    1 
ATOM   9407  C  CG1   . ILE B 1  689 ? 141.036 185.303 157.392 1.00 67.96  ? 953  ILE C CG1   1 
ATOM   9408  C  CG2   . ILE B 1  689 ? 142.056 183.052 156.980 1.00 67.96  ? 953  ILE C CG2   1 
ATOM   9409  C  CD1   . ILE B 1  689 ? 141.556 185.961 156.140 1.00 67.96  ? 953  ILE C CD1   1 
ATOM   9410  N  N     . GLY B 1  690 ? 143.494 182.788 160.326 1.00 69.03  ? 954  GLY C N     1 
ATOM   9411  C  CA    . GLY B 1  690 ? 144.336 181.689 160.765 1.00 69.03  ? 954  GLY C CA    1 
ATOM   9412  C  C     . GLY B 1  690 ? 143.730 180.877 161.892 1.00 69.03  ? 954  GLY C C     1 
ATOM   9413  O  O     . GLY B 1  690 ? 143.991 179.677 162.007 1.00 69.03  ? 954  GLY C O     1 
ATOM   9414  N  N     . ALA B 1  691 ? 142.921 181.515 162.741 1.00 70.30  ? 955  ALA C N     1 
ATOM   9415  C  CA    . ALA B 1  691 ? 142.275 180.789 163.829 1.00 70.30  ? 955  ALA C CA    1 
ATOM   9416  C  C     . ALA B 1  691 ? 141.236 179.811 163.297 1.00 70.30  ? 955  ALA C C     1 
ATOM   9417  O  O     . ALA B 1  691 ? 140.992 178.761 163.902 1.00 70.30  ? 955  ALA C O     1 
ATOM   9418  C  CB    . ALA B 1  691 ? 141.635 181.772 164.809 1.00 70.30  ? 955  ALA C CB    1 
ATOM   9419  N  N     . TRP B 1  692 ? 140.617 180.138 162.164 1.00 70.38  ? 956  TRP C N     1 
ATOM   9420  C  CA    . TRP B 1  692 ? 139.584 179.308 161.561 1.00 70.38  ? 956  TRP C CA    1 
ATOM   9421  C  C     . TRP B 1  692 ? 140.132 178.369 160.492 1.00 70.38  ? 956  TRP C C     1 
ATOM   9422  O  O     . TRP B 1  692 ? 139.398 178.005 159.567 1.00 70.38  ? 956  TRP C O     1 
ATOM   9423  C  CB    . TRP B 1  692 ? 138.487 180.193 160.967 1.00 70.38  ? 956  TRP C CB    1 
ATOM   9424  C  CG    . TRP B 1  692 ? 137.717 180.960 161.991 1.00 70.38  ? 956  TRP C CG    1 
ATOM   9425  C  CD1   . TRP B 1  692 ? 137.939 182.245 162.390 1.00 70.38  ? 956  TRP C CD1   1 
ATOM   9426  C  CD2   . TRP B 1  692 ? 136.591 180.495 162.743 1.00 70.38  ? 956  TRP C CD2   1 
ATOM   9427  N  NE1   . TRP B 1  692 ? 137.025 182.608 163.348 1.00 70.38  ? 956  TRP C NE1   1 
ATOM   9428  C  CE2   . TRP B 1  692 ? 136.186 181.551 163.582 1.00 70.38  ? 956  TRP C CE2   1 
ATOM   9429  C  CE3   . TRP B 1  692 ? 135.888 179.289 162.791 1.00 70.38  ? 956  TRP C CE3   1 
ATOM   9430  C  CZ2   . TRP B 1  692 ? 135.109 181.437 164.457 1.00 70.38  ? 956  TRP C CZ2   1 
ATOM   9431  C  CZ3   . TRP B 1  692 ? 134.820 179.177 163.660 1.00 70.38  ? 956  TRP C CZ3   1 
ATOM   9432  C  CH2   . TRP B 1  692 ? 134.440 180.245 164.481 1.00 70.38  ? 956  TRP C CH2   1 
ATOM   9433  N  N     . ALA B 1  693 ? 141.397 177.971 160.597 1.00 70.53  ? 957  ALA C N     1 
ATOM   9434  C  CA    . ALA B 1  693 ? 142.012 177.092 159.611 1.00 70.53  ? 957  ALA C CA    1 
ATOM   9435  C  C     . ALA B 1  693 ? 141.660 175.639 159.926 1.00 70.53  ? 957  ALA C C     1 
ATOM   9436  O  O     . ALA B 1  693 ? 140.828 175.345 160.789 1.00 70.53  ? 957  ALA C O     1 
ATOM   9437  C  CB    . ALA B 1  693 ? 143.520 177.322 159.567 1.00 70.53  ? 957  ALA C CB    1 
ATOM   9438  N  N     . SER B 1  694 ? 142.299 174.706 159.221 1.00 72.58  ? 958  SER C N     1 
ATOM   9439  C  CA    . SER B 1  694 ? 142.066 173.278 159.401 1.00 72.58  ? 958  SER C CA    1 
ATOM   9440  C  C     . SER B 1  694 ? 143.325 172.566 159.884 1.00 72.58  ? 958  SER C C     1 
ATOM   9441  O  O     . SER B 1  694 ? 143.577 171.417 159.516 1.00 72.58  ? 958  SER C O     1 
ATOM   9442  C  CB    . SER B 1  694 ? 141.561 172.644 158.106 1.00 72.58  ? 958  SER C CB    1 
ATOM   9443  O  OG    . SER B 1  694 ? 142.555 172.687 157.098 1.00 72.58  ? 958  SER C OG    1 
ATOM   9444  N  N     . GLU B 1  695 ? 144.121 173.257 160.690 1.00 76.57  ? 959  GLU C N     1 
ATOM   9445  C  CA    . GLU B 1  695 ? 145.346 172.678 161.217 1.00 76.57  ? 959  GLU C CA    1 
ATOM   9446  C  C     . GLU B 1  695 ? 145.015 171.572 162.208 1.00 76.57  ? 959  GLU C C     1 
ATOM   9447  O  O     . GLU B 1  695 ? 145.528 170.460 162.102 1.00 76.57  ? 959  GLU C O     1 
ATOM   9448  C  CB    . GLU B 1  695 ? 146.205 173.750 161.881 1.00 76.57  ? 959  GLU C CB    1 
ATOM   9449  C  CG    . GLU B 1  695 ? 146.873 174.693 160.896 1.00 76.57  ? 959  GLU C CG    1 
ATOM   9450  C  CD    . GLU B 1  695 ? 148.253 174.224 160.487 1.00 76.57  ? 959  GLU C CD    1 
ATOM   9451  O  OE1   . GLU B 1  695 ? 149.054 175.061 160.024 1.00 76.57  ? 959  GLU C OE1   1 
ATOM   9452  O  OE2   . GLU B 1  695 ? 148.538 173.017 160.626 1.00 76.57  ? 959  GLU C OE2   1 
ATOM   9453  N  N     . GLY B 1  696 ? 144.155 171.878 163.171 1.00 73.10  ? 960  GLY C N     1 
ATOM   9454  C  CA    . GLY B 1  696 ? 143.763 170.891 164.161 1.00 73.10  ? 960  GLY C CA    1 
ATOM   9455  C  C     . GLY B 1  696 ? 143.204 169.635 163.526 1.00 73.10  ? 960  GLY C C     1 
ATOM   9456  O  O     . GLY B 1  696 ? 143.342 168.540 164.071 1.00 73.10  ? 960  GLY C O     1 
ATOM   9457  N  N     . ASN B 1  697 ? 142.589 169.772 162.349 1.00 74.81  ? 961  ASN C N     1 
ATOM   9458  C  CA    . ASN B 1  697 ? 142.096 168.600 161.634 1.00 74.81  ? 961  ASN C CA    1 
ATOM   9459  C  C     . ASN B 1  697 ? 143.242 167.682 161.224 1.00 74.81  ? 961  ASN C C     1 
ATOM   9460  O  O     . ASN B 1  697 ? 143.151 166.459 161.378 1.00 74.81  ? 961  ASN C O     1 
ATOM   9461  C  CB    . ASN B 1  697 ? 141.289 169.035 160.410 1.00 74.81  ? 961  ASN C CB    1 
ATOM   9462  C  CG    . ASN B 1  697 ? 140.329 167.961 159.928 1.00 74.81  ? 961  ASN C CG    1 
ATOM   9463  O  OD1   . ASN B 1  697 ? 139.430 168.232 159.132 1.00 74.81  ? 961  ASN C OD1   1 
ATOM   9464  N  ND2   . ASN B 1  697 ? 140.508 166.739 160.414 1.00 74.81  ? 961  ASN C ND2   1 
ATOM   9465  N  N     . GLN B 1  698 ? 144.337 168.248 160.714 1.00 71.06  ? 962  GLN C N     1 
ATOM   9466  C  CA    . GLN B 1  698 ? 145.467 167.414 160.312 1.00 71.06  ? 962  GLN C CA    1 
ATOM   9467  C  C     . GLN B 1  698 ? 146.171 166.816 161.524 1.00 71.06  ? 962  GLN C C     1 
ATOM   9468  O  O     . GLN B 1  698 ? 146.621 165.661 161.487 1.00 71.06  ? 962  GLN C O     1 
ATOM   9469  C  CB    . GLN B 1  698 ? 146.445 168.226 159.466 1.00 71.06  ? 962  GLN C CB    1 
ATOM   9470  C  CG    . GLN B 1  698 ? 145.854 168.711 158.158 1.00 71.06  ? 962  GLN C CG    1 
ATOM   9471  C  CD    . GLN B 1  698 ? 145.368 167.570 157.290 1.00 71.06  ? 962  GLN C CD    1 
ATOM   9472  O  OE1   . GLN B 1  698 ? 144.167 167.396 157.094 1.00 71.06  ? 962  GLN C OE1   1 
ATOM   9473  N  NE2   . GLN B 1  698 ? 146.299 166.778 156.778 1.00 71.06  ? 962  GLN C NE2   1 
ATOM   9474  N  N     . SER B 1  699 ? 146.278 167.585 162.609 1.00 69.75  ? 963  SER C N     1 
ATOM   9475  C  CA    . SER B 1  699 ? 146.821 167.015 163.838 1.00 69.75  ? 963  SER C CA    1 
ATOM   9476  C  C     . SER B 1  699 ? 145.954 165.861 164.334 1.00 69.75  ? 963  SER C C     1 
ATOM   9477  O  O     . SER B 1  699 ? 146.468 164.844 164.820 1.00 69.75  ? 963  SER C O     1 
ATOM   9478  C  CB    . SER B 1  699 ? 146.951 168.103 164.901 1.00 69.75  ? 963  SER C CB    1 
ATOM   9479  O  OG    . SER B 1  699 ? 147.886 169.091 164.506 1.00 69.75  ? 963  SER C OG    1 
ATOM   9480  N  N     . GLY B 1  700 ? 144.634 165.991 164.192 1.00 69.82  ? 964  GLY C N     1 
ATOM   9481  C  CA    . GLY B 1  700 ? 143.749 164.898 164.547 1.00 69.82  ? 964  GLY C CA    1 
ATOM   9482  C  C     . GLY B 1  700 ? 143.899 163.705 163.625 1.00 69.82  ? 964  GLY C C     1 
ATOM   9483  O  O     . GLY B 1  700 ? 143.739 162.562 164.048 1.00 69.82  ? 964  GLY C O     1 
ATOM   9484  N  N     . ASN B 1  701 ? 144.204 163.954 162.349 1.00 71.49  ? 965  ASN C N     1 
ATOM   9485  C  CA    . ASN B 1  701 ? 144.499 162.848 161.440 1.00 71.49  ? 965  ASN C CA    1 
ATOM   9486  C  C     . ASN B 1  701 ? 145.739 162.088 161.892 1.00 71.49  ? 965  ASN C C     1 
ATOM   9487  O  O     . ASN B 1  701 ? 145.775 160.851 161.845 1.00 71.49  ? 965  ASN C O     1 
ATOM   9488  C  CB    . ASN B 1  701 ? 144.688 163.358 160.010 1.00 71.49  ? 965  ASN C CB    1 
ATOM   9489  C  CG    . ASN B 1  701 ? 143.421 163.939 159.418 1.00 71.49  ? 965  ASN C CG    1 
ATOM   9490  O  OD1   . ASN B 1  701 ? 143.368 165.117 159.068 1.00 71.49  ? 965  ASN C OD1   1 
ATOM   9491  N  ND2   . ASN B 1  701 ? 142.389 163.114 159.304 1.00 71.49  ? 965  ASN C ND2   1 
ATOM   9492  N  N     . LYS B 1  702 ? 146.769 162.815 162.325 1.00 66.59  ? 966  LYS C N     1 
ATOM   9493  C  CA    . LYS B 1  702 ? 147.963 162.160 162.858 1.00 66.59  ? 966  LYS C CA    1 
ATOM   9494  C  C     . LYS B 1  702 ? 147.627 161.335 164.097 1.00 66.59  ? 966  LYS C C     1 
ATOM   9495  O  O     . LYS B 1  702 ? 148.053 160.177 164.230 1.00 66.59  ? 966  LYS C O     1 
ATOM   9496  C  CB    . LYS B 1  702 ? 149.035 163.201 163.178 1.00 66.59  ? 966  LYS C CB    1 
ATOM   9497  C  CG    . LYS B 1  702 ? 150.350 162.607 163.651 1.00 66.59  ? 966  LYS C CG    1 
ATOM   9498  C  CD    . LYS B 1  702 ? 151.392 163.687 163.886 1.00 66.59  ? 966  LYS C CD    1 
ATOM   9499  C  CE    . LYS B 1  702 ? 152.699 163.092 164.381 1.00 66.59  ? 966  LYS C CE    1 
ATOM   9500  N  NZ    . LYS B 1  702 ? 153.725 164.141 164.633 1.00 66.59  ? 966  LYS C NZ    1 
ATOM   9501  N  N     . LEU B 1  703 ? 146.860 161.921 165.020 1.00 67.57  ? 967  LEU C N     1 
ATOM   9502  C  CA    . LEU B 1  703 ? 146.455 161.189 166.217 1.00 67.57  ? 967  LEU C CA    1 
ATOM   9503  C  C     . LEU B 1  703 ? 145.624 159.961 165.862 1.00 67.57  ? 967  LEU C C     1 
ATOM   9504  O  O     . LEU B 1  703 ? 145.723 158.923 166.524 1.00 67.57  ? 967  LEU C O     1 
ATOM   9505  C  CB    . LEU B 1  703 ? 145.678 162.105 167.160 1.00 67.57  ? 967  LEU C CB    1 
ATOM   9506  C  CG    . LEU B 1  703 ? 146.465 163.252 167.794 1.00 67.57  ? 967  LEU C CG    1 
ATOM   9507  C  CD1   . LEU B 1  703 ? 145.540 164.140 168.608 1.00 67.57  ? 967  LEU C CD1   1 
ATOM   9508  C  CD2   . LEU B 1  703 ? 147.595 162.713 168.655 1.00 67.57  ? 967  LEU C CD2   1 
ATOM   9509  N  N     . PHE B 1  704 ? 144.800 160.063 164.819 1.00 69.07  ? 968  PHE C N     1 
ATOM   9510  C  CA    . PHE B 1  704 ? 144.005 158.927 164.366 1.00 69.07  ? 968  PHE C CA    1 
ATOM   9511  C  C     . PHE B 1  704 ? 144.900 157.815 163.840 1.00 69.07  ? 968  PHE C C     1 
ATOM   9512  O  O     . PHE B 1  704 ? 144.692 156.634 164.146 1.00 69.07  ? 968  PHE C O     1 
ATOM   9513  C  CB    . PHE B 1  704 ? 143.027 159.386 163.283 1.00 69.07  ? 968  PHE C CB    1 
ATOM   9514  C  CG    . PHE B 1  704 ? 142.156 158.291 162.742 1.00 69.07  ? 968  PHE C CG    1 
ATOM   9515  C  CD1   . PHE B 1  704 ? 141.046 157.861 163.445 1.00 69.07  ? 968  PHE C CD1   1 
ATOM   9516  C  CD2   . PHE B 1  704 ? 142.449 157.689 161.530 1.00 69.07  ? 968  PHE C CD2   1 
ATOM   9517  C  CE1   . PHE B 1  704 ? 140.241 156.854 162.949 1.00 69.07  ? 968  PHE C CE1   1 
ATOM   9518  C  CE2   . PHE B 1  704 ? 141.648 156.680 161.029 1.00 69.07  ? 968  PHE C CE2   1 
ATOM   9519  C  CZ    . PHE B 1  704 ? 140.543 156.262 161.741 1.00 69.07  ? 968  PHE C CZ    1 
ATOM   9520  N  N     . ARG B 1  705 ? 145.892 158.177 163.024 1.00 67.76  ? 969  ARG C N     1 
ATOM   9521  C  CA    . ARG B 1  705 ? 146.836 157.185 162.520 1.00 67.76  ? 969  ARG C CA    1 
ATOM   9522  C  C     . ARG B 1  705 ? 147.564 156.491 163.662 1.00 67.76  ? 969  ARG C C     1 
ATOM   9523  O  O     . ARG B 1  705 ? 147.837 155.287 163.595 1.00 67.76  ? 969  ARG C O     1 
ATOM   9524  C  CB    . ARG B 1  705 ? 147.839 157.839 161.571 1.00 67.76  ? 969  ARG C CB    1 
ATOM   9525  C  CG    . ARG B 1  705 ? 147.238 158.313 160.266 1.00 67.76  ? 969  ARG C CG    1 
ATOM   9526  C  CD    . ARG B 1  705 ? 148.300 158.889 159.348 1.00 67.76  ? 969  ARG C CD    1 
ATOM   9527  N  NE    . ARG B 1  705 ? 147.717 159.422 158.122 1.00 67.76  ? 969  ARG C NE    1 
ATOM   9528  C  CZ    . ARG B 1  705 ? 147.493 158.701 157.030 1.00 67.76  ? 969  ARG C CZ    1 
ATOM   9529  N  NH1   . ARG B 1  705 ? 147.801 157.412 157.010 1.00 67.76  ? 969  ARG C NH1   1 
ATOM   9530  N  NH2   . ARG B 1  705 ? 146.957 159.267 155.957 1.00 67.76  ? 969  ARG C NH2   1 
ATOM   9531  N  N     . ARG B 1  706 ? 147.886 157.236 164.720 1.00 67.98  ? 970  ARG C N     1 
ATOM   9532  C  CA    . ARG B 1  706 ? 148.578 156.629 165.854 1.00 67.98  ? 970  ARG C CA    1 
ATOM   9533  C  C     . ARG B 1  706 ? 147.649 155.713 166.648 1.00 67.98  ? 970  ARG C C     1 
ATOM   9534  O  O     . ARG B 1  706 ? 148.035 154.604 167.042 1.00 67.98  ? 970  ARG C O     1 
ATOM   9535  C  CB    . ARG B 1  706 ? 149.164 157.720 166.748 1.00 67.98  ? 970  ARG C CB    1 
ATOM   9536  C  CG    . ARG B 1  706 ? 150.008 157.198 167.894 1.00 67.98  ? 970  ARG C CG    1 
ATOM   9537  C  CD    . ARG B 1  706 ? 150.668 158.340 168.647 1.00 67.98  ? 970  ARG C CD    1 
ATOM   9538  N  NE    . ARG B 1  706 ? 151.460 157.867 169.777 1.00 67.98  ? 970  ARG C NE    1 
ATOM   9539  C  CZ    . ARG B 1  706 ? 152.165 158.661 170.575 1.00 67.98  ? 970  ARG C CZ    1 
ATOM   9540  N  NH1   . ARG B 1  706 ? 152.180 159.970 170.365 1.00 67.98  ? 970  ARG C NH1   1 
ATOM   9541  N  NH2   . ARG B 1  706 ? 152.856 158.149 171.582 1.00 67.98  ? 970  ARG C NH2   1 
ATOM   9542  N  N     . PHE B 1  707 ? 146.412 156.158 166.881 1.00 69.23  ? 971  PHE C N     1 
ATOM   9543  C  CA    . PHE B 1  707 ? 145.494 155.412 167.737 1.00 69.23  ? 971  PHE C CA    1 
ATOM   9544  C  C     . PHE B 1  707 ? 145.022 154.133 167.060 1.00 69.23  ? 971  PHE C C     1 
ATOM   9545  O  O     . PHE B 1  707 ? 144.937 153.077 167.697 1.00 69.23  ? 971  PHE C O     1 
ATOM   9546  C  CB    . PHE B 1  707 ? 144.300 156.291 168.114 1.00 69.23  ? 971  PHE C CB    1 
ATOM   9547  C  CG    . PHE B 1  707 ? 144.651 157.434 169.020 1.00 69.23  ? 971  PHE C CG    1 
ATOM   9548  C  CD1   . PHE B 1  707 ? 145.851 157.447 169.709 1.00 69.23  ? 971  PHE C CD1   1 
ATOM   9549  C  CD2   . PHE B 1  707 ? 143.783 158.501 169.175 1.00 69.23  ? 971  PHE C CD2   1 
ATOM   9550  C  CE1   . PHE B 1  707 ? 146.176 158.499 170.539 1.00 69.23  ? 971  PHE C CE1   1 
ATOM   9551  C  CE2   . PHE B 1  707 ? 144.104 159.557 170.005 1.00 69.23  ? 971  PHE C CE2   1 
ATOM   9552  C  CZ    . PHE B 1  707 ? 145.301 159.556 170.687 1.00 69.23  ? 971  PHE C CZ    1 
ATOM   9553  N  N     . ARG B 1  708 ? 144.697 154.210 165.766 1.00 71.60  ? 972  ARG C N     1 
ATOM   9554  C  CA    . ARG B 1  708 ? 144.268 153.023 165.036 1.00 71.60  ? 972  ARG C CA    1 
ATOM   9555  C  C     . ARG B 1  708 ? 145.329 151.933 165.043 1.00 71.60  ? 972  ARG C C     1 
ATOM   9556  O  O     . ARG B 1  708 ? 144.996 150.750 164.917 1.00 71.60  ? 972  ARG C O     1 
ATOM   9557  C  CB    . ARG B 1  708 ? 143.910 153.402 163.596 1.00 71.60  ? 972  ARG C CB    1 
ATOM   9558  C  CG    . ARG B 1  708 ? 143.358 152.260 162.762 1.00 71.60  ? 972  ARG C CG    1 
ATOM   9559  C  CD    . ARG B 1  708 ? 142.991 152.723 161.365 1.00 71.60  ? 972  ARG C CD    1 
ATOM   9560  N  NE    . ARG B 1  708 ? 142.432 151.639 160.564 1.00 71.60  ? 972  ARG C NE    1 
ATOM   9561  C  CZ    . ARG B 1  708 ? 143.158 150.816 159.814 1.00 71.60  ? 972  ARG C CZ    1 
ATOM   9562  N  NH1   . ARG B 1  708 ? 142.567 149.856 159.117 1.00 71.60  ? 972  ARG C NH1   1 
ATOM   9563  N  NH2   . ARG B 1  708 ? 144.475 150.952 159.762 1.00 71.60  ? 972  ARG C NH2   1 
ATOM   9564  N  N     . LYS B 1  709 ? 146.599 152.304 165.211 1.00 71.59  ? 973  LYS C N     1 
ATOM   9565  C  CA    . LYS B 1  709 ? 147.692 151.347 165.189 1.00 71.59  ? 973  LYS C CA    1 
ATOM   9566  C  C     . LYS B 1  709 ? 148.113 150.861 166.567 1.00 71.59  ? 973  LYS C C     1 
ATOM   9567  O  O     . LYS B 1  709 ? 148.502 149.696 166.694 1.00 71.59  ? 973  LYS C O     1 
ATOM   9568  C  CB    . LYS B 1  709 ? 148.911 151.957 164.479 1.00 71.59  ? 973  LYS C CB    1 
ATOM   9569  C  CG    . LYS B 1  709 ? 150.093 151.015 164.329 1.00 71.59  ? 973  LYS C CG    1 
ATOM   9570  C  CD    . LYS B 1  709 ? 151.193 151.646 163.492 1.00 71.59  ? 973  LYS C CD    1 
ATOM   9571  C  CE    . LYS B 1  709 ? 151.911 152.741 164.262 1.00 71.59  ? 973  LYS C CE    1 
ATOM   9572  N  NZ    . LYS B 1  709 ? 153.064 153.292 163.498 1.00 71.59  ? 973  LYS C NZ    1 
ATOM   9573  N  N     . MET B 1  710 ? 148.034 151.702 167.603 1.00 75.21  ? 974  MET C N     1 
ATOM   9574  C  CA    . MET B 1  710 ? 148.551 151.310 168.909 1.00 75.21  ? 974  MET C CA    1 
ATOM   9575  C  C     . MET B 1  710 ? 147.557 151.482 170.054 1.00 75.21  ? 974  MET C C     1 
ATOM   9576  O  O     . MET B 1  710 ? 147.918 151.216 171.207 1.00 75.21  ? 974  MET C O     1 
ATOM   9577  C  CB    . MET B 1  710 ? 149.834 152.087 169.227 1.00 75.21  ? 974  MET C CB    1 
ATOM   9578  C  CG    . MET B 1  710 ? 151.013 151.727 168.336 1.00 75.21  ? 974  MET C CG    1 
ATOM   9579  S  SD    . MET B 1  710 ? 152.527 152.597 168.782 1.00 75.21  ? 974  MET C SD    1 
ATOM   9580  C  CE    . MET B 1  710 ? 152.172 154.238 168.163 1.00 75.21  ? 974  MET C CE    1 
ATOM   9581  N  N     . ASN B 1  711 ? 146.326 151.914 169.787 1.00 76.32  ? 975  ASN C N     1 
ATOM   9582  C  CA    . ASN B 1  711 ? 145.361 152.135 170.862 1.00 76.32  ? 975  ASN C CA    1 
ATOM   9583  C  C     . ASN B 1  711 ? 143.974 151.647 170.467 1.00 76.32  ? 975  ASN C C     1 
ATOM   9584  O  O     . ASN B 1  711 ? 142.970 152.326 170.707 1.00 76.32  ? 975  ASN C O     1 
ATOM   9585  C  CB    . ASN B 1  711 ? 145.314 153.609 171.264 1.00 76.32  ? 975  ASN C CB    1 
ATOM   9586  C  CG    . ASN B 1  711 ? 146.623 154.092 171.854 1.00 76.32  ? 975  ASN C CG    1 
ATOM   9587  O  OD1   . ASN B 1  711 ? 147.298 154.946 171.280 1.00 76.32  ? 975  ASN C OD1   1 
ATOM   9588  N  ND2   . ASN B 1  711 ? 146.990 153.545 173.006 1.00 76.32  ? 975  ASN C ND2   1 
ATOM   9589  N  N     . ALA B 1  712 ? 143.889 150.461 169.868 1.00 76.03  ? 976  ALA C N     1 
ATOM   9590  C  CA    . ALA B 1  712 ? 142.597 149.933 169.455 1.00 76.03  ? 976  ALA C CA    1 
ATOM   9591  C  C     . ALA B 1  712 ? 142.699 148.432 169.238 1.00 76.03  ? 976  ALA C C     1 
ATOM   9592  O  O     . ALA B 1  712 ? 143.785 147.897 169.001 1.00 76.03  ? 976  ALA C O     1 
ATOM   9593  C  CB    . ALA B 1  712 ? 142.093 150.613 168.178 1.00 76.03  ? 976  ALA C CB    1 
ATOM   9594  N  N     . ARG B 1  713 ? 141.552 147.762 169.327 1.00 75.78  ? 977  ARG C N     1 
ATOM   9595  C  CA    . ARG B 1  713 ? 141.482 146.348 168.990 1.00 75.78  ? 977  ARG C CA    1 
ATOM   9596  C  C     . ARG B 1  713 ? 141.644 146.168 167.487 1.00 75.78  ? 977  ARG C C     1 
ATOM   9597  O  O     . ARG B 1  713 ? 140.995 146.857 166.695 1.00 75.78  ? 977  ARG C O     1 
ATOM   9598  C  CB    . ARG B 1  713 ? 140.155 145.752 169.457 1.00 75.78  ? 977  ARG C CB    1 
ATOM   9599  C  CG    . ARG B 1  713 ? 140.037 145.619 170.963 1.00 75.78  ? 977  ARG C CG    1 
ATOM   9600  C  CD    . ARG B 1  713 ? 138.790 144.846 171.363 1.00 75.78  ? 977  ARG C CD    1 
ATOM   9601  N  NE    . ARG B 1  713 ? 137.563 145.566 171.042 1.00 75.78  ? 977  ARG C NE    1 
ATOM   9602  C  CZ    . ARG B 1  713 ? 136.984 146.443 171.854 1.00 75.78  ? 977  ARG C CZ    1 
ATOM   9603  N  NH1   . ARG B 1  713 ? 137.527 146.709 173.032 1.00 75.78  ? 977  ARG C NH1   1 
ATOM   9604  N  NH2   . ARG B 1  713 ? 135.869 147.059 171.489 1.00 75.78  ? 977  ARG C NH2   1 
ATOM   9605  N  N     . GLN B 1  714 ? 142.513 145.237 167.094 1.00 76.23  ? 978  GLN C N     1 
ATOM   9606  C  CA    . GLN B 1  714 ? 142.830 145.021 165.683 1.00 76.23  ? 978  GLN C CA    1 
ATOM   9607  C  C     . GLN B 1  714 ? 141.750 144.131 165.072 1.00 76.23  ? 978  GLN C C     1 
ATOM   9608  O  O     . GLN B 1  714 ? 141.943 142.941 164.815 1.00 76.23  ? 978  GLN C O     1 
ATOM   9609  C  CB    . GLN B 1  714 ? 144.218 144.411 165.535 1.00 76.23  ? 978  GLN C CB    1 
ATOM   9610  C  CG    . GLN B 1  714 ? 145.338 145.294 166.063 1.00 76.23  ? 978  GLN C CG    1 
ATOM   9611  C  CD    . GLN B 1  714 ? 145.434 146.618 165.333 1.00 76.23  ? 978  GLN C CD    1 
ATOM   9612  O  OE1   . GLN B 1  714 ? 145.101 147.668 165.882 1.00 76.23  ? 978  GLN C OE1   1 
ATOM   9613  N  NE2   . GLN B 1  714 ? 145.898 146.577 164.091 1.00 76.23  ? 978  GLN C NE2   1 
ATOM   9614  N  N     . SER B 1  715 ? 140.586 144.731 164.837 1.00 77.84  ? 979  SER C N     1 
ATOM   9615  C  CA    . SER B 1  715 ? 139.466 144.016 164.242 1.00 77.84  ? 979  SER C CA    1 
ATOM   9616  C  C     . SER B 1  715 ? 138.508 145.026 163.630 1.00 77.84  ? 979  SER C C     1 
ATOM   9617  O  O     . SER B 1  715 ? 138.304 146.108 164.186 1.00 77.84  ? 979  SER C O     1 
ATOM   9618  C  CB    . SER B 1  715 ? 138.738 143.152 165.277 1.00 77.84  ? 979  SER C CB    1 
ATOM   9619  O  OG    . SER B 1  715 ? 137.631 142.488 164.694 1.00 77.84  ? 979  SER C OG    1 
ATOM   9620  N  N     . LYS B 1  716 ? 137.922 144.662 162.486 1.00 77.00  ? 980  LYS C N     1 
ATOM   9621  C  CA    . LYS B 1  716 ? 137.004 145.569 161.802 1.00 77.00  ? 980  LYS C CA    1 
ATOM   9622  C  C     . LYS B 1  716 ? 135.769 145.865 162.641 1.00 77.00  ? 980  LYS C C     1 
ATOM   9623  O  O     . LYS B 1  716 ? 135.191 146.952 162.531 1.00 77.00  ? 980  LYS C O     1 
ATOM   9624  C  CB    . LYS B 1  716 ? 136.583 144.978 160.458 1.00 77.00  ? 980  LYS C CB    1 
ATOM   9625  C  CG    . LYS B 1  716 ? 137.685 144.908 159.421 1.00 77.00  ? 980  LYS C CG    1 
ATOM   9626  C  CD    . LYS B 1  716 ? 137.148 144.338 158.121 1.00 77.00  ? 980  LYS C CD    1 
ATOM   9627  C  CE    . LYS B 1  716 ? 138.231 144.245 157.065 1.00 77.00  ? 980  LYS C CE    1 
ATOM   9628  N  NZ    . LYS B 1  716 ? 137.716 143.664 155.795 1.00 77.00  ? 980  LYS C NZ    1 
ATOM   9629  N  N     . CYS B 1  717 ? 135.351 144.918 163.480 1.00 79.92  ? 981  CYS C N     1 
ATOM   9630  C  CA    . CYS B 1  717 ? 134.109 145.081 164.224 1.00 79.92  ? 981  CYS C CA    1 
ATOM   9631  C  C     . CYS B 1  717 ? 134.241 146.063 165.380 1.00 79.92  ? 981  CYS C C     1 
ATOM   9632  O  O     . CYS B 1  717 ? 133.227 146.612 165.826 1.00 79.92  ? 981  CYS C O     1 
ATOM   9633  C  CB    . CYS B 1  717 ? 133.635 143.721 164.742 1.00 79.92  ? 981  CYS C CB    1 
ATOM   9634  S  SG    . CYS B 1  717 ? 132.044 143.737 165.602 1.00 79.92  ? 981  CYS C SG    1 
ATOM   9635  N  N     . TYR B 1  718 ? 135.446 146.280 165.900 1.00 79.14  ? 982  TYR C N     1 
ATOM   9636  C  CA    . TYR B 1  718 ? 135.580 147.182 167.046 1.00 79.14  ? 982  TYR C CA    1 
ATOM   9637  C  C     . TYR B 1  718 ? 136.694 148.219 167.008 1.00 79.14  ? 982  TYR C C     1 
ATOM   9638  O  O     . TYR B 1  718 ? 136.876 148.949 167.980 1.00 79.14  ? 982  TYR C O     1 
ATOM   9639  C  CB    . TYR B 1  718 ? 135.764 146.381 168.338 1.00 79.14  ? 982  TYR C CB    1 
ATOM   9640  C  CG    . TYR B 1  718 ? 134.977 145.101 168.429 1.00 79.14  ? 982  TYR C CG    1 
ATOM   9641  C  CD1   . TYR B 1  718 ? 133.594 145.118 168.505 1.00 79.14  ? 982  TYR C CD1   1 
ATOM   9642  C  CD2   . TYR B 1  718 ? 135.621 143.875 168.468 1.00 79.14  ? 982  TYR C CD2   1 
ATOM   9643  C  CE1   . TYR B 1  718 ? 132.872 143.946 168.602 1.00 79.14  ? 982  TYR C CE1   1 
ATOM   9644  C  CE2   . TYR B 1  718 ? 134.908 142.698 168.565 1.00 79.14  ? 982  TYR C CE2   1 
ATOM   9645  C  CZ    . TYR B 1  718 ? 133.534 142.740 168.631 1.00 79.14  ? 982  TYR C CZ    1 
ATOM   9646  O  OH    . TYR B 1  718 ? 132.818 141.571 168.727 1.00 79.14  ? 982  TYR C OH    1 
ATOM   9647  N  N     . GLU B 1  719 ? 137.440 148.308 165.918 1.00 80.44  ? 983  GLU C N     1 
ATOM   9648  C  CA    . GLU B 1  719 ? 138.539 149.269 165.891 1.00 80.44  ? 983  GLU C CA    1 
ATOM   9649  C  C     . GLU B 1  719 ? 138.033 150.706 165.951 1.00 80.44  ? 983  GLU C C     1 
ATOM   9650  O  O     . GLU B 1  719 ? 138.610 151.547 166.653 1.00 80.44  ? 983  GLU C O     1 
ATOM   9651  C  CB    . GLU B 1  719 ? 139.403 149.049 164.647 1.00 80.44  ? 983  GLU C CB    1 
ATOM   9652  C  CG    . GLU B 1  719 ? 138.687 149.276 163.323 1.00 80.44  ? 983  GLU C CG    1 
ATOM   9653  C  CD    . GLU B 1  719 ? 139.568 148.995 162.124 1.00 80.44  ? 983  GLU C CD    1 
ATOM   9654  O  OE1   . GLU B 1  719 ? 140.742 148.620 162.322 1.00 80.44  ? 983  GLU C OE1   1 
ATOM   9655  O  OE2   . GLU B 1  719 ? 139.084 149.143 160.982 1.00 80.44  ? 983  GLU C OE2   1 
ATOM   9656  N  N     . MET B 1  720 ? 136.948 151.006 165.235 1.00 78.61  ? 984  MET C N     1 
ATOM   9657  C  CA    . MET B 1  720 ? 136.521 152.393 165.095 1.00 78.61  ? 984  MET C CA    1 
ATOM   9658  C  C     . MET B 1  720 ? 135.948 152.932 166.399 1.00 78.61  ? 984  MET C C     1 
ATOM   9659  O  O     . MET B 1  720 ? 136.222 154.078 166.774 1.00 78.61  ? 984  MET C O     1 
ATOM   9660  C  CB    . MET B 1  720 ? 135.503 152.510 163.964 1.00 78.61  ? 984  MET C CB    1 
ATOM   9661  C  CG    . MET B 1  720 ? 136.049 152.073 162.617 1.00 78.61  ? 984  MET C CG    1 
ATOM   9662  S  SD    . MET B 1  720 ? 137.440 153.047 162.012 1.00 78.61  ? 984  MET C SD    1 
ATOM   9663  C  CE    . MET B 1  720 ? 136.612 154.568 161.561 1.00 78.61  ? 984  MET C CE    1 
ATOM   9664  N  N     . GLU B 1  721 ? 135.147 152.125 167.099 1.00 77.97  ? 985  GLU C N     1 
ATOM   9665  C  CA    . GLU B 1  721 ? 134.629 152.543 168.398 1.00 77.97  ? 985  GLU C CA    1 
ATOM   9666  C  C     . GLU B 1  721 ? 135.762 152.812 169.379 1.00 77.97  ? 985  GLU C C     1 
ATOM   9667  O  O     . GLU B 1  721 ? 135.741 153.812 170.107 1.00 77.97  ? 985  GLU C O     1 
ATOM   9668  C  CB    . GLU B 1  721 ? 133.681 151.478 168.950 1.00 77.97  ? 985  GLU C CB    1 
ATOM   9669  C  CG    . GLU B 1  721 ? 133.041 151.838 170.281 1.00 77.97  ? 985  GLU C CG    1 
ATOM   9670  C  CD    . GLU B 1  721 ? 132.076 150.774 170.768 1.00 77.97  ? 985  GLU C CD    1 
ATOM   9671  O  OE1   . GLU B 1  721 ? 131.928 149.745 170.076 1.00 77.97  ? 985  GLU C OE1   1 
ATOM   9672  O  OE2   . GLU B 1  721 ? 131.465 150.966 171.840 1.00 77.97  ? 985  GLU C OE2   1 
ATOM   9673  N  N     . ASP B 1  722 ? 136.766 151.933 169.403 1.00 76.00  ? 986  ASP C N     1 
ATOM   9674  C  CA    . ASP B 1  722 ? 137.898 152.114 170.305 1.00 76.00  ? 986  ASP C CA    1 
ATOM   9675  C  C     . ASP B 1  722 ? 138.658 153.394 169.983 1.00 76.00  ? 986  ASP C C     1 
ATOM   9676  O  O     . ASP B 1  722 ? 138.988 154.174 170.884 1.00 76.00  ? 986  ASP C O     1 
ATOM   9677  C  CB    . ASP B 1  722 ? 138.829 150.905 170.227 1.00 76.00  ? 986  ASP C CB    1 
ATOM   9678  C  CG    . ASP B 1  722 ? 138.202 149.650 170.793 1.00 76.00  ? 986  ASP C CG    1 
ATOM   9679  O  OD1   . ASP B 1  722 ? 137.345 149.766 171.694 1.00 76.00  ? 986  ASP C OD1   1 
ATOM   9680  O  OD2   . ASP B 1  722 ? 138.569 148.548 170.338 1.00 76.00  ? 986  ASP C OD2   1 
ATOM   9681  N  N     . VAL B 1  723 ? 138.948 153.624 168.700 1.00 68.82  ? 987  VAL C N     1 
ATOM   9682  C  CA    . VAL B 1  723 ? 139.689 154.824 168.313 1.00 68.82  ? 987  VAL C CA    1 
ATOM   9683  C  C     . VAL B 1  723 ? 138.894 156.075 168.662 1.00 68.82  ? 987  VAL C C     1 
ATOM   9684  O  O     . VAL B 1  723 ? 139.442 157.054 169.182 1.00 68.82  ? 987  VAL C O     1 
ATOM   9685  C  CB    . VAL B 1  723 ? 140.044 154.783 166.817 1.00 68.82  ? 987  VAL C CB    1 
ATOM   9686  C  CG1   . VAL B 1  723 ? 140.676 156.094 166.398 1.00 68.82  ? 987  VAL C CG1   1 
ATOM   9687  C  CG2   . VAL B 1  723 ? 140.988 153.635 166.532 1.00 68.82  ? 987  VAL C CG2   1 
ATOM   9688  N  N     . LEU B 1  724 ? 137.590 156.063 168.380 1.00 67.01  ? 988  LEU C N     1 
ATOM   9689  C  CA    . LEU B 1  724 ? 136.760 157.229 168.660 1.00 67.01  ? 988  LEU C CA    1 
ATOM   9690  C  C     . LEU B 1  724 ? 136.722 157.528 170.153 1.00 67.01  ? 988  LEU C C     1 
ATOM   9691  O  O     . LEU B 1  724 ? 136.875 158.683 170.571 1.00 67.01  ? 988  LEU C O     1 
ATOM   9692  C  CB    . LEU B 1  724 ? 135.350 157.005 168.114 1.00 67.01  ? 988  LEU C CB    1 
ATOM   9693  C  CG    . LEU B 1  724 ? 134.359 158.159 168.263 1.00 67.01  ? 988  LEU C CG    1 
ATOM   9694  C  CD1   . LEU B 1  724 ? 134.832 159.381 167.494 1.00 67.01  ? 988  LEU C CD1   1 
ATOM   9695  C  CD2   . LEU B 1  724 ? 132.976 157.733 167.802 1.00 67.01  ? 988  LEU C CD2   1 
ATOM   9696  N  N     . LYS B 1  725 ? 136.532 156.495 170.977 1.00 67.56  ? 989  LYS C N     1 
ATOM   9697  C  CA    . LYS B 1  725 ? 136.476 156.704 172.420 1.00 67.56  ? 989  LYS C CA    1 
ATOM   9698  C  C     . LYS B 1  725 ? 137.814 157.199 172.955 1.00 67.56  ? 989  LYS C C     1 
ATOM   9699  O  O     . LYS B 1  725 ? 137.864 158.113 173.788 1.00 67.56  ? 989  LYS C O     1 
ATOM   9700  C  CB    . LYS B 1  725 ? 136.058 155.413 173.120 1.00 67.56  ? 989  LYS C CB    1 
ATOM   9701  C  CG    . LYS B 1  725 ? 135.922 155.546 174.625 1.00 67.56  ? 989  LYS C CG    1 
ATOM   9702  C  CD    . LYS B 1  725 ? 135.368 154.276 175.240 1.00 67.56  ? 989  LYS C CD    1 
ATOM   9703  C  CE    . LYS B 1  725 ? 136.398 153.165 175.212 1.00 67.56  ? 989  LYS C CE    1 
ATOM   9704  N  NZ    . LYS B 1  725 ? 137.536 153.449 176.128 1.00 67.56  ? 989  LYS C NZ    1 
ATOM   9705  N  N     . HIS B 1  726 ? 138.915 156.613 172.478 1.00 68.28  ? 990  HIS C N     1 
ATOM   9706  C  CA    . HIS B 1  726 ? 140.229 157.025 172.957 1.00 68.28  ? 990  HIS C CA    1 
ATOM   9707  C  C     . HIS B 1  726 ? 140.537 158.461 172.555 1.00 68.28  ? 990  HIS C C     1 
ATOM   9708  O  O     . HIS B 1  726 ? 141.105 159.224 173.343 1.00 68.28  ? 990  HIS C O     1 
ATOM   9709  C  CB    . HIS B 1  726 ? 141.304 156.077 172.428 1.00 68.28  ? 990  HIS C CB    1 
ATOM   9710  C  CG    . HIS B 1  726 ? 142.680 156.392 172.922 1.00 68.28  ? 990  HIS C CG    1 
ATOM   9711  N  ND1   . HIS B 1  726 ? 143.087 156.128 174.212 1.00 68.28  ? 990  HIS C ND1   1 
ATOM   9712  C  CD2   . HIS B 1  726 ? 143.744 156.951 172.300 1.00 68.28  ? 990  HIS C CD2   1 
ATOM   9713  C  CE1   . HIS B 1  726 ? 144.342 156.510 174.363 1.00 68.28  ? 990  HIS C CE1   1 
ATOM   9714  N  NE2   . HIS B 1  726 ? 144.765 157.013 173.217 1.00 68.28  ? 990  HIS C NE2   1 
ATOM   9715  N  N     . HIS B 1  727 ? 140.156 158.856 171.338 1.00 66.76  ? 991  HIS C N     1 
ATOM   9716  C  CA    . HIS B 1  727 ? 140.402 160.227 170.906 1.00 66.76  ? 991  HIS C CA    1 
ATOM   9717  C  C     . HIS B 1  727 ? 139.530 161.210 171.677 1.00 66.76  ? 991  HIS C C     1 
ATOM   9718  O  O     . HIS B 1  727 ? 139.981 162.309 172.025 1.00 66.76  ? 991  HIS C O     1 
ATOM   9719  C  CB    . HIS B 1  727 ? 140.167 160.349 169.401 1.00 66.76  ? 991  HIS C CB    1 
ATOM   9720  C  CG    . HIS B 1  727 ? 140.603 161.659 168.823 1.00 66.76  ? 991  HIS C CG    1 
ATOM   9721  N  ND1   . HIS B 1  727 ? 140.276 162.052 167.543 1.00 66.76  ? 991  HIS C ND1   1 
ATOM   9722  C  CD2   . HIS B 1  727 ? 141.343 162.664 169.348 1.00 66.76  ? 991  HIS C CD2   1 
ATOM   9723  C  CE1   . HIS B 1  727 ? 140.793 163.244 167.306 1.00 66.76  ? 991  HIS C CE1   1 
ATOM   9724  N  NE2   . HIS B 1  727 ? 141.444 163.638 168.384 1.00 66.76  ? 991  HIS C NE2   1 
ATOM   9725  N  N     . TRP B 1  728 ? 138.282 160.831 171.963 1.00 65.60  ? 992  TRP C N     1 
ATOM   9726  C  CA    . TRP B 1  728 ? 137.424 161.682 172.780 1.00 65.60  ? 992  TRP C