data_6CIM
# 
_entry.id   6CIM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CIM         
WWPDB D_1000232816 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 6CIK 'Pre-Reaction Complex, RAG1(E962Q)/2-intact/nicked 12/23RSS complex in Mn2+'         unspecified 
PDB 6CIL 'Pre-Reaction Complex, RAG1(E962Q)/2-intact/intact 12/23RSS complex in Mn2+'         unspecified 
PDB 5ZDZ 'Hairpin Forming Complex, RAG1/2-Nicked 12RSS/23RSS complex in Ca2+'                 unspecified 
PDB 5ZE0 'Hairpin Forming Complex, RAG1/2-Nicked(with Dideoxy) 12RSS/23RSS complex in Mg2+'   unspecified 
PDB 5ZE1 'Hairpin Forming Complex, RAG1/2-Nicked 12RSS/23RSS complex in 2mM Mn2+'             unspecified 
PDB 5ZE2 'Hairpin Complex, RAG1/2-hairpin 12RSS/23RSS complex in Mn2+'                        unspecified 
PDB 6CG0 'Hairpin Forming Complex,RAG1/2-Nicked 12RSS/23RSS complex in Ca2+, CryoEM at 3.17A' unspecified 
PDB 6CIJ 'Hairpin Forming Complex,RAG1/2-Nicked 12RSS/23RSS complex in Ca2+, CryoEM at 3.90'  unspecified 
PDB 4WWX '4WWX is apo structure of the same RAG1/2 protein without DNA and HMGB1'             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CIM 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chuenchor, W.' 1 ? 
'Chen, X.'      2 ? 
'Kim, M.S.'     3 ? 
'Gellert, M.'   4 ? 
'Yang, W.'      5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            70 
_citation.language                  ? 
_citation.page_first                358 
_citation.page_last                 370.e4 
_citation.title                     'Cracking the DNA Code for V(D)J Recombination.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2018.03.008 
_citation.pdbx_database_id_PubMed   29628308 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, M.S.'     1 ? 
primary 'Chuenchor, W.' 2 ? 
primary 'Chen, X.'      3 ? 
primary 'Cui, Y.'       4 ? 
primary 'Zhang, X.'     5 ? 
primary 'Zhou, Z.H.'    6 ? 
primary 'Gellert, M.'   7 ? 
primary 'Yang, W.'      8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   105.600 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CIM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     156.678 
_cell.length_a_esd                 ? 
_cell.length_b                     123.562 
_cell.length_b_esd                 ? 
_cell.length_c                     186.286 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CIM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'V(D)J recombination-activating protein 1'     71716.141 2 3.1.-.-,2.3.2.27 E962Q ? ? 
2  polymer     man 'V(D)J recombination-activating protein 2'     40036.484 2 ?                ?     ? ? 
3  polymer     man 'High mobility group protein B1'               18897.885 1 ?                ?     ? ? 
4  polymer     syn 'Nicked 12RSS intermediate reverse strand'     12429.968 1 ?                ?     ? ? 
5  polymer     syn 
;DNA (5'-D(*GP*CP*CP*TP*GP*TP*CP*TP*TP*A)-3')
;
3010.978  1 ?                ?     ? ? 
6  polymer     syn 'Nicked 12RSS intermediate forward strand'     9138.938  1 ?                ?     ? ? 
7  polymer     syn 'Intact 23RSS substrate reverse strand'        17259.041 1 ?                ?     ? ? 
8  polymer     syn 'Intact 23RSS substrate forward strand'        17251.105 1 ?                ?     ? ? 
9  non-polymer syn 'ZINC ION'                                     65.409    2 ?                ?     ? ? 
10 non-polymer syn 'MANGANESE (II) ION'                           54.938    2 ?                ?     ? ? 
11 water       nat water                                          18.015    3 ?                ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 RAG-1                                 
2 RAG-2                                 
3 'High mobility group protein 1,HMG-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;VHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQ
PAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLAS
SVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFS
FTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFR
GTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKP
FIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETV
DAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHV
PEIIERDGSIGAWASEGNQSGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNA
;
;VHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQ
PAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLAS
SVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFS
FTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFR
GTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKP
FIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETV
DAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHV
PEIIERDGSIGAWASEGNQSGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNA
;
A,C ? 
2 'polypeptide(L)'        no no 
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQ
;
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQ
;
B,D ? 
3 'polypeptide(L)'        no no 
;MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP
PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA
AYR
;
;MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP
PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA
AYR
;
N   ? 
4 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DT)(DA)(DA)(DG)(DG)(DG)(DC)(DT)(DG)
(DT)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)
;
CGGGTTTTTGTTAAGGGCTGTATCACTGTGTAAGACAGGC F   ? 
5 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)' GCCTGTCTTA I   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DA)(DG)(DT)(DG)(DA)(DT)(DA)(DC)(DA)(DG)(DC)(DC)(DC)(DT)(DT)(DA)(DA)
(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)(DG)
;
CACAGTGATACAGCCCTTAACAAAAACCCG L   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DC)(DT)(DG)(DG)(DC)(DT)(DT)(DC)(DA)
(DC)(DA)(DC)(DT)(DT)(DG)(DA)(DT)(DT)(DT)(DG)(DC)(DA)(DT)(DC)(DA)(DC)(DT)(DG)(DT)
(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)
;
CGGGTTTTTGTCTGGCTTCACACTTGATTTGCATCACTGTGTAAGACAGGCCAGAT G   ? 
8 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)(DG)
(DT)(DG)(DA)(DT)(DG)(DC)(DA)(DA)(DA)(DT)(DC)(DA)(DA)(DG)(DT)(DG)(DT)(DG)(DA)(DA)
(DG)(DC)(DC)(DA)(DG)(DA)(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)(DG)
;
ATCTGGCCTGTCTTACACAGTGATGCAAATCAAGTGTGAAGCCAGACAAAAACCCG J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   HIS n 
1 3   ILE n 
1 4   ASN n 
1 5   LYS n 
1 6   GLY n 
1 7   GLY n 
1 8   ARG n 
1 9   PRO n 
1 10  ARG n 
1 11  GLN n 
1 12  HIS n 
1 13  LEU n 
1 14  LEU n 
1 15  SER n 
1 16  LEU n 
1 17  THR n 
1 18  ARG n 
1 19  ARG n 
1 20  ALA n 
1 21  GLN n 
1 22  LYS n 
1 23  HIS n 
1 24  ARG n 
1 25  LEU n 
1 26  ARG n 
1 27  GLU n 
1 28  LEU n 
1 29  LYS n 
1 30  ILE n 
1 31  GLN n 
1 32  VAL n 
1 33  LYS n 
1 34  GLU n 
1 35  PHE n 
1 36  ALA n 
1 37  ASP n 
1 38  LYS n 
1 39  GLU n 
1 40  GLU n 
1 41  GLY n 
1 42  GLY n 
1 43  ASP n 
1 44  VAL n 
1 45  LYS n 
1 46  ALA n 
1 47  VAL n 
1 48  CYS n 
1 49  LEU n 
1 50  THR n 
1 51  LEU n 
1 52  PHE n 
1 53  LEU n 
1 54  LEU n 
1 55  ALA n 
1 56  LEU n 
1 57  ARG n 
1 58  ALA n 
1 59  ARG n 
1 60  ASN n 
1 61  GLU n 
1 62  HIS n 
1 63  ARG n 
1 64  GLN n 
1 65  ALA n 
1 66  ASP n 
1 67  GLU n 
1 68  LEU n 
1 69  GLU n 
1 70  ALA n 
1 71  ILE n 
1 72  MET n 
1 73  GLN n 
1 74  GLY n 
1 75  ARG n 
1 76  GLY n 
1 77  SER n 
1 78  GLY n 
1 79  LEU n 
1 80  GLN n 
1 81  PRO n 
1 82  ALA n 
1 83  VAL n 
1 84  CYS n 
1 85  LEU n 
1 86  ALA n 
1 87  ILE n 
1 88  ARG n 
1 89  VAL n 
1 90  ASN n 
1 91  THR n 
1 92  PHE n 
1 93  LEU n 
1 94  SER n 
1 95  CYS n 
1 96  SER n 
1 97  GLN n 
1 98  TYR n 
1 99  HIS n 
1 100 LYS n 
1 101 MET n 
1 102 TYR n 
1 103 ARG n 
1 104 THR n 
1 105 VAL n 
1 106 LYS n 
1 107 ALA n 
1 108 ILE n 
1 109 THR n 
1 110 GLY n 
1 111 ARG n 
1 112 GLN n 
1 113 ILE n 
1 114 PHE n 
1 115 GLN n 
1 116 PRO n 
1 117 LEU n 
1 118 HIS n 
1 119 ALA n 
1 120 LEU n 
1 121 ARG n 
1 122 ASN n 
1 123 ALA n 
1 124 GLU n 
1 125 LYS n 
1 126 VAL n 
1 127 LEU n 
1 128 LEU n 
1 129 PRO n 
1 130 GLY n 
1 131 TYR n 
1 132 HIS n 
1 133 PRO n 
1 134 PHE n 
1 135 GLU n 
1 136 TRP n 
1 137 GLN n 
1 138 PRO n 
1 139 PRO n 
1 140 LEU n 
1 141 LYS n 
1 142 ASN n 
1 143 VAL n 
1 144 SER n 
1 145 SER n 
1 146 ARG n 
1 147 THR n 
1 148 ASP n 
1 149 VAL n 
1 150 GLY n 
1 151 ILE n 
1 152 ILE n 
1 153 ASP n 
1 154 GLY n 
1 155 LEU n 
1 156 SER n 
1 157 GLY n 
1 158 LEU n 
1 159 ALA n 
1 160 SER n 
1 161 SER n 
1 162 VAL n 
1 163 ASP n 
1 164 GLU n 
1 165 TYR n 
1 166 PRO n 
1 167 VAL n 
1 168 ASP n 
1 169 THR n 
1 170 ILE n 
1 171 ALA n 
1 172 LYS n 
1 173 ARG n 
1 174 PHE n 
1 175 ARG n 
1 176 TYR n 
1 177 ASP n 
1 178 SER n 
1 179 ALA n 
1 180 LEU n 
1 181 VAL n 
1 182 SER n 
1 183 ALA n 
1 184 LEU n 
1 185 MET n 
1 186 ASP n 
1 187 MET n 
1 188 GLU n 
1 189 GLU n 
1 190 ASP n 
1 191 ILE n 
1 192 LEU n 
1 193 GLU n 
1 194 GLY n 
1 195 MET n 
1 196 ARG n 
1 197 SER n 
1 198 GLN n 
1 199 ASP n 
1 200 LEU n 
1 201 ASP n 
1 202 ASP n 
1 203 TYR n 
1 204 LEU n 
1 205 ASN n 
1 206 GLY n 
1 207 PRO n 
1 208 PHE n 
1 209 THR n 
1 210 VAL n 
1 211 VAL n 
1 212 VAL n 
1 213 LYS n 
1 214 GLU n 
1 215 SER n 
1 216 CYS n 
1 217 ASP n 
1 218 GLY n 
1 219 MET n 
1 220 GLY n 
1 221 ASP n 
1 222 VAL n 
1 223 SER n 
1 224 GLU n 
1 225 LYS n 
1 226 HIS n 
1 227 GLY n 
1 228 SER n 
1 229 GLY n 
1 230 PRO n 
1 231 ALA n 
1 232 VAL n 
1 233 PRO n 
1 234 GLU n 
1 235 LYS n 
1 236 ALA n 
1 237 VAL n 
1 238 ARG n 
1 239 PHE n 
1 240 SER n 
1 241 PHE n 
1 242 THR n 
1 243 VAL n 
1 244 MET n 
1 245 ARG n 
1 246 ILE n 
1 247 THR n 
1 248 ILE n 
1 249 GLU n 
1 250 HIS n 
1 251 GLY n 
1 252 SER n 
1 253 GLN n 
1 254 ASN n 
1 255 VAL n 
1 256 LYS n 
1 257 VAL n 
1 258 PHE n 
1 259 GLU n 
1 260 GLU n 
1 261 PRO n 
1 262 LYS n 
1 263 PRO n 
1 264 ASN n 
1 265 SER n 
1 266 GLU n 
1 267 LEU n 
1 268 CYS n 
1 269 CYS n 
1 270 LYS n 
1 271 PRO n 
1 272 LEU n 
1 273 CYS n 
1 274 LEU n 
1 275 MET n 
1 276 LEU n 
1 277 ALA n 
1 278 ASP n 
1 279 GLU n 
1 280 SER n 
1 281 ASP n 
1 282 HIS n 
1 283 GLU n 
1 284 THR n 
1 285 LEU n 
1 286 THR n 
1 287 ALA n 
1 288 ILE n 
1 289 LEU n 
1 290 SER n 
1 291 PRO n 
1 292 LEU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLU n 
1 296 ARG n 
1 297 GLU n 
1 298 ALA n 
1 299 MET n 
1 300 LYS n 
1 301 SER n 
1 302 SER n 
1 303 GLU n 
1 304 LEU n 
1 305 THR n 
1 306 LEU n 
1 307 GLU n 
1 308 MET n 
1 309 GLY n 
1 310 GLY n 
1 311 ILE n 
1 312 PRO n 
1 313 ARG n 
1 314 THR n 
1 315 PHE n 
1 316 LYS n 
1 317 PHE n 
1 318 ILE n 
1 319 PHE n 
1 320 ARG n 
1 321 GLY n 
1 322 THR n 
1 323 GLY n 
1 324 TYR n 
1 325 ASP n 
1 326 GLU n 
1 327 LYS n 
1 328 LEU n 
1 329 VAL n 
1 330 ARG n 
1 331 GLU n 
1 332 VAL n 
1 333 GLU n 
1 334 GLY n 
1 335 LEU n 
1 336 GLU n 
1 337 ALA n 
1 338 SER n 
1 339 GLY n 
1 340 SER n 
1 341 VAL n 
1 342 TYR n 
1 343 ILE n 
1 344 CYS n 
1 345 THR n 
1 346 LEU n 
1 347 CYS n 
1 348 ASP n 
1 349 THR n 
1 350 THR n 
1 351 ARG n 
1 352 LEU n 
1 353 GLU n 
1 354 ALA n 
1 355 SER n 
1 356 GLN n 
1 357 ASN n 
1 358 LEU n 
1 359 VAL n 
1 360 PHE n 
1 361 HIS n 
1 362 SER n 
1 363 ILE n 
1 364 THR n 
1 365 ARG n 
1 366 SER n 
1 367 HIS n 
1 368 ALA n 
1 369 GLU n 
1 370 ASN n 
1 371 LEU n 
1 372 GLN n 
1 373 ARG n 
1 374 TYR n 
1 375 GLU n 
1 376 VAL n 
1 377 TRP n 
1 378 ARG n 
1 379 SER n 
1 380 ASN n 
1 381 PRO n 
1 382 TYR n 
1 383 HIS n 
1 384 GLU n 
1 385 SER n 
1 386 VAL n 
1 387 GLU n 
1 388 GLU n 
1 389 LEU n 
1 390 ARG n 
1 391 ASP n 
1 392 ARG n 
1 393 VAL n 
1 394 LYS n 
1 395 GLY n 
1 396 VAL n 
1 397 SER n 
1 398 ALA n 
1 399 LYS n 
1 400 PRO n 
1 401 PHE n 
1 402 ILE n 
1 403 GLU n 
1 404 THR n 
1 405 VAL n 
1 406 PRO n 
1 407 SER n 
1 408 ILE n 
1 409 ASP n 
1 410 ALA n 
1 411 LEU n 
1 412 HIS n 
1 413 CYS n 
1 414 ASP n 
1 415 ILE n 
1 416 GLY n 
1 417 ASN n 
1 418 ALA n 
1 419 ALA n 
1 420 GLU n 
1 421 PHE n 
1 422 TYR n 
1 423 LYS n 
1 424 ILE n 
1 425 PHE n 
1 426 GLN n 
1 427 LEU n 
1 428 GLU n 
1 429 ILE n 
1 430 GLY n 
1 431 GLU n 
1 432 VAL n 
1 433 TYR n 
1 434 LYS n 
1 435 HIS n 
1 436 PRO n 
1 437 ASN n 
1 438 ALA n 
1 439 SER n 
1 440 LYS n 
1 441 GLU n 
1 442 GLU n 
1 443 ARG n 
1 444 LYS n 
1 445 ARG n 
1 446 TRP n 
1 447 GLN n 
1 448 ALA n 
1 449 THR n 
1 450 LEU n 
1 451 ASP n 
1 452 LYS n 
1 453 HIS n 
1 454 LEU n 
1 455 ARG n 
1 456 LYS n 
1 457 ARG n 
1 458 MET n 
1 459 ASN n 
1 460 LEU n 
1 461 LYS n 
1 462 PRO n 
1 463 ILE n 
1 464 MET n 
1 465 ARG n 
1 466 MET n 
1 467 ASN n 
1 468 GLY n 
1 469 ASN n 
1 470 PHE n 
1 471 ALA n 
1 472 ARG n 
1 473 LYS n 
1 474 LEU n 
1 475 MET n 
1 476 THR n 
1 477 GLN n 
1 478 GLU n 
1 479 THR n 
1 480 VAL n 
1 481 ASP n 
1 482 ALA n 
1 483 VAL n 
1 484 CYS n 
1 485 GLU n 
1 486 LEU n 
1 487 ILE n 
1 488 PRO n 
1 489 SER n 
1 490 GLU n 
1 491 GLU n 
1 492 ARG n 
1 493 HIS n 
1 494 GLU n 
1 495 ALA n 
1 496 LEU n 
1 497 ARG n 
1 498 GLU n 
1 499 LEU n 
1 500 MET n 
1 501 ASP n 
1 502 LEU n 
1 503 TYR n 
1 504 LEU n 
1 505 LYS n 
1 506 MET n 
1 507 LYS n 
1 508 PRO n 
1 509 VAL n 
1 510 TRP n 
1 511 ARG n 
1 512 SER n 
1 513 SER n 
1 514 CYS n 
1 515 PRO n 
1 516 ALA n 
1 517 LYS n 
1 518 GLU n 
1 519 CYS n 
1 520 PRO n 
1 521 GLU n 
1 522 SER n 
1 523 LEU n 
1 524 CYS n 
1 525 GLN n 
1 526 TYR n 
1 527 SER n 
1 528 PHE n 
1 529 ASN n 
1 530 SER n 
1 531 GLN n 
1 532 ARG n 
1 533 PHE n 
1 534 ALA n 
1 535 GLU n 
1 536 LEU n 
1 537 LEU n 
1 538 SER n 
1 539 THR n 
1 540 LYS n 
1 541 PHE n 
1 542 LYS n 
1 543 TYR n 
1 544 ARG n 
1 545 TYR n 
1 546 GLU n 
1 547 GLY n 
1 548 LYS n 
1 549 ILE n 
1 550 THR n 
1 551 ASN n 
1 552 TYR n 
1 553 PHE n 
1 554 HIS n 
1 555 LYS n 
1 556 THR n 
1 557 LEU n 
1 558 ALA n 
1 559 HIS n 
1 560 VAL n 
1 561 PRO n 
1 562 GLU n 
1 563 ILE n 
1 564 ILE n 
1 565 GLU n 
1 566 ARG n 
1 567 ASP n 
1 568 GLY n 
1 569 SER n 
1 570 ILE n 
1 571 GLY n 
1 572 ALA n 
1 573 TRP n 
1 574 ALA n 
1 575 SER n 
1 576 GLU n 
1 577 GLY n 
1 578 ASN n 
1 579 GLN n 
1 580 SER n 
1 581 GLY n 
1 582 ASN n 
1 583 LYS n 
1 584 LEU n 
1 585 PHE n 
1 586 ARG n 
1 587 ARG n 
1 588 PHE n 
1 589 ARG n 
1 590 LYS n 
1 591 MET n 
1 592 ASN n 
1 593 ALA n 
1 594 ARG n 
1 595 GLN n 
1 596 SER n 
1 597 LYS n 
1 598 CYS n 
1 599 TYR n 
1 600 GLU n 
1 601 MET n 
1 602 GLU n 
1 603 ASP n 
1 604 VAL n 
1 605 LEU n 
1 606 LYS n 
1 607 HIS n 
1 608 HIS n 
1 609 TRP n 
1 610 LEU n 
1 611 TYR n 
1 612 THR n 
1 613 SER n 
1 614 LYS n 
1 615 TYR n 
1 616 LEU n 
1 617 GLN n 
1 618 LYS n 
1 619 PHE n 
1 620 MET n 
1 621 ASN n 
1 622 ALA n 
1 623 HIS n 
1 624 ASN n 
1 625 ALA n 
2 1   MET n 
2 2   SER n 
2 3   LEU n 
2 4   GLN n 
2 5   MET n 
2 6   VAL n 
2 7   THR n 
2 8   VAL n 
2 9   GLY n 
2 10  HIS n 
2 11  ASN n 
2 12  ILE n 
2 13  ALA n 
2 14  LEU n 
2 15  ILE n 
2 16  GLN n 
2 17  PRO n 
2 18  GLY n 
2 19  PHE n 
2 20  SER n 
2 21  LEU n 
2 22  MET n 
2 23  ASN n 
2 24  PHE n 
2 25  ASP n 
2 26  GLY n 
2 27  GLN n 
2 28  VAL n 
2 29  PHE n 
2 30  PHE n 
2 31  PHE n 
2 32  GLY n 
2 33  GLN n 
2 34  LYS n 
2 35  GLY n 
2 36  TRP n 
2 37  PRO n 
2 38  LYS n 
2 39  ARG n 
2 40  SER n 
2 41  CYS n 
2 42  PRO n 
2 43  THR n 
2 44  GLY n 
2 45  VAL n 
2 46  PHE n 
2 47  HIS n 
2 48  PHE n 
2 49  ASP n 
2 50  ILE n 
2 51  LYS n 
2 52  GLN n 
2 53  ASN n 
2 54  HIS n 
2 55  LEU n 
2 56  LYS n 
2 57  LEU n 
2 58  LYS n 
2 59  PRO n 
2 60  ALA n 
2 61  ILE n 
2 62  PHE n 
2 63  SER n 
2 64  LYS n 
2 65  ASP n 
2 66  SER n 
2 67  CYS n 
2 68  TYR n 
2 69  LEU n 
2 70  PRO n 
2 71  PRO n 
2 72  LEU n 
2 73  ARG n 
2 74  TYR n 
2 75  PRO n 
2 76  ALA n 
2 77  THR n 
2 78  CYS n 
2 79  SER n 
2 80  TYR n 
2 81  LYS n 
2 82  GLY n 
2 83  SER n 
2 84  ILE n 
2 85  ASP n 
2 86  SER n 
2 87  ASP n 
2 88  LYS n 
2 89  HIS n 
2 90  GLN n 
2 91  TYR n 
2 92  ILE n 
2 93  ILE n 
2 94  HIS n 
2 95  GLY n 
2 96  GLY n 
2 97  LYS n 
2 98  THR n 
2 99  PRO n 
2 100 ASN n 
2 101 ASN n 
2 102 GLU n 
2 103 LEU n 
2 104 SER n 
2 105 ASP n 
2 106 LYS n 
2 107 ILE n 
2 108 TYR n 
2 109 ILE n 
2 110 MET n 
2 111 SER n 
2 112 VAL n 
2 113 ALA n 
2 114 CYS n 
2 115 LYS n 
2 116 ASN n 
2 117 ASN n 
2 118 LYS n 
2 119 LYS n 
2 120 VAL n 
2 121 THR n 
2 122 PHE n 
2 123 ARG n 
2 124 CYS n 
2 125 THR n 
2 126 GLU n 
2 127 LYS n 
2 128 ASP n 
2 129 LEU n 
2 130 VAL n 
2 131 GLY n 
2 132 ASP n 
2 133 VAL n 
2 134 PRO n 
2 135 GLU n 
2 136 PRO n 
2 137 ARG n 
2 138 TYR n 
2 139 GLY n 
2 140 HIS n 
2 141 SER n 
2 142 ILE n 
2 143 ASP n 
2 144 VAL n 
2 145 VAL n 
2 146 TYR n 
2 147 SER n 
2 148 ARG n 
2 149 GLY n 
2 150 LYS n 
2 151 SER n 
2 152 MET n 
2 153 GLY n 
2 154 VAL n 
2 155 LEU n 
2 156 PHE n 
2 157 GLY n 
2 158 GLY n 
2 159 ARG n 
2 160 SER n 
2 161 TYR n 
2 162 MET n 
2 163 PRO n 
2 164 SER n 
2 165 THR n 
2 166 GLN n 
2 167 ARG n 
2 168 THR n 
2 169 THR n 
2 170 GLU n 
2 171 LYS n 
2 172 TRP n 
2 173 ASN n 
2 174 SER n 
2 175 VAL n 
2 176 ALA n 
2 177 ASP n 
2 178 CYS n 
2 179 LEU n 
2 180 PRO n 
2 181 HIS n 
2 182 VAL n 
2 183 PHE n 
2 184 LEU n 
2 185 ILE n 
2 186 ASP n 
2 187 PHE n 
2 188 GLU n 
2 189 PHE n 
2 190 GLY n 
2 191 CYS n 
2 192 ALA n 
2 193 THR n 
2 194 SER n 
2 195 TYR n 
2 196 ILE n 
2 197 LEU n 
2 198 PRO n 
2 199 GLU n 
2 200 LEU n 
2 201 GLN n 
2 202 ASP n 
2 203 GLY n 
2 204 LEU n 
2 205 SER n 
2 206 PHE n 
2 207 HIS n 
2 208 VAL n 
2 209 SER n 
2 210 ILE n 
2 211 ALA n 
2 212 ARG n 
2 213 ASN n 
2 214 ASP n 
2 215 THR n 
2 216 VAL n 
2 217 TYR n 
2 218 ILE n 
2 219 LEU n 
2 220 GLY n 
2 221 GLY n 
2 222 HIS n 
2 223 SER n 
2 224 LEU n 
2 225 ALA n 
2 226 SER n 
2 227 ASN n 
2 228 ILE n 
2 229 ARG n 
2 230 PRO n 
2 231 ALA n 
2 232 ASN n 
2 233 LEU n 
2 234 TYR n 
2 235 ARG n 
2 236 ILE n 
2 237 ARG n 
2 238 VAL n 
2 239 ASP n 
2 240 LEU n 
2 241 PRO n 
2 242 LEU n 
2 243 GLY n 
2 244 THR n 
2 245 PRO n 
2 246 ALA n 
2 247 VAL n 
2 248 ASN n 
2 249 CYS n 
2 250 THR n 
2 251 VAL n 
2 252 LEU n 
2 253 PRO n 
2 254 GLY n 
2 255 GLY n 
2 256 ILE n 
2 257 SER n 
2 258 VAL n 
2 259 SER n 
2 260 SER n 
2 261 ALA n 
2 262 ILE n 
2 263 LEU n 
2 264 THR n 
2 265 GLN n 
2 266 THR n 
2 267 ASN n 
2 268 ASN n 
2 269 ASP n 
2 270 GLU n 
2 271 PHE n 
2 272 VAL n 
2 273 ILE n 
2 274 VAL n 
2 275 GLY n 
2 276 GLY n 
2 277 TYR n 
2 278 GLN n 
2 279 LEU n 
2 280 GLU n 
2 281 ASN n 
2 282 GLN n 
2 283 LYS n 
2 284 ARG n 
2 285 MET n 
2 286 VAL n 
2 287 CYS n 
2 288 SER n 
2 289 LEU n 
2 290 VAL n 
2 291 SER n 
2 292 LEU n 
2 293 GLY n 
2 294 ASP n 
2 295 ASN n 
2 296 THR n 
2 297 ILE n 
2 298 GLU n 
2 299 ILE n 
2 300 SER n 
2 301 GLU n 
2 302 MET n 
2 303 GLU n 
2 304 THR n 
2 305 PRO n 
2 306 ASP n 
2 307 TRP n 
2 308 THR n 
2 309 SER n 
2 310 ASP n 
2 311 ILE n 
2 312 LYS n 
2 313 HIS n 
2 314 SER n 
2 315 LYS n 
2 316 ILE n 
2 317 TRP n 
2 318 PHE n 
2 319 GLY n 
2 320 SER n 
2 321 ASN n 
2 322 MET n 
2 323 GLY n 
2 324 ASN n 
2 325 GLY n 
2 326 THR n 
2 327 ILE n 
2 328 PHE n 
2 329 LEU n 
2 330 GLY n 
2 331 ILE n 
2 332 PRO n 
2 333 GLY n 
2 334 ASP n 
2 335 ASN n 
2 336 LYS n 
2 337 GLN n 
2 338 ALA n 
2 339 MET n 
2 340 SER n 
2 341 GLU n 
2 342 ALA n 
2 343 PHE n 
2 344 TYR n 
2 345 PHE n 
2 346 TYR n 
2 347 THR n 
2 348 LEU n 
2 349 ARG n 
2 350 CYS n 
2 351 SER n 
2 352 GLU n 
2 353 GLU n 
2 354 ASP n 
2 355 LEU n 
2 356 SER n 
2 357 GLU n 
2 358 ASP n 
2 359 GLN n 
3 1   MET n 
3 2   GLY n 
3 3   LYS n 
3 4   GLY n 
3 5   ASP n 
3 6   PRO n 
3 7   LYS n 
3 8   LYS n 
3 9   PRO n 
3 10  ARG n 
3 11  GLY n 
3 12  LYS n 
3 13  MET n 
3 14  SER n 
3 15  SER n 
3 16  TYR n 
3 17  ALA n 
3 18  PHE n 
3 19  PHE n 
3 20  VAL n 
3 21  GLN n 
3 22  THR n 
3 23  CYS n 
3 24  ARG n 
3 25  GLU n 
3 26  GLU n 
3 27  HIS n 
3 28  LYS n 
3 29  LYS n 
3 30  LYS n 
3 31  HIS n 
3 32  PRO n 
3 33  ASP n 
3 34  ALA n 
3 35  SER n 
3 36  VAL n 
3 37  ASN n 
3 38  PHE n 
3 39  SER n 
3 40  GLU n 
3 41  PHE n 
3 42  SER n 
3 43  LYS n 
3 44  LYS n 
3 45  CYS n 
3 46  SER n 
3 47  GLU n 
3 48  ARG n 
3 49  TRP n 
3 50  LYS n 
3 51  THR n 
3 52  MET n 
3 53  SER n 
3 54  ALA n 
3 55  LYS n 
3 56  GLU n 
3 57  LYS n 
3 58  GLY n 
3 59  LYS n 
3 60  PHE n 
3 61  GLU n 
3 62  ASP n 
3 63  MET n 
3 64  ALA n 
3 65  LYS n 
3 66  ALA n 
3 67  ASP n 
3 68  LYS n 
3 69  ALA n 
3 70  ARG n 
3 71  TYR n 
3 72  GLU n 
3 73  ARG n 
3 74  GLU n 
3 75  MET n 
3 76  LYS n 
3 77  THR n 
3 78  TYR n 
3 79  ILE n 
3 80  PRO n 
3 81  PRO n 
3 82  LYS n 
3 83  GLY n 
3 84  GLU n 
3 85  THR n 
3 86  LYS n 
3 87  LYS n 
3 88  LYS n 
3 89  PHE n 
3 90  LYS n 
3 91  ASP n 
3 92  PRO n 
3 93  ASN n 
3 94  ALA n 
3 95  PRO n 
3 96  LYS n 
3 97  ARG n 
3 98  PRO n 
3 99  PRO n 
3 100 SER n 
3 101 ALA n 
3 102 PHE n 
3 103 PHE n 
3 104 LEU n 
3 105 PHE n 
3 106 CYS n 
3 107 SER n 
3 108 GLU n 
3 109 TYR n 
3 110 ARG n 
3 111 PRO n 
3 112 LYS n 
3 113 ILE n 
3 114 LYS n 
3 115 GLY n 
3 116 GLU n 
3 117 HIS n 
3 118 PRO n 
3 119 GLY n 
3 120 LEU n 
3 121 SER n 
3 122 ILE n 
3 123 GLY n 
3 124 ASP n 
3 125 VAL n 
3 126 ALA n 
3 127 LYS n 
3 128 LYS n 
3 129 LEU n 
3 130 GLY n 
3 131 GLU n 
3 132 MET n 
3 133 TRP n 
3 134 ASN n 
3 135 ASN n 
3 136 THR n 
3 137 ALA n 
3 138 ALA n 
3 139 ASP n 
3 140 ASP n 
3 141 LYS n 
3 142 GLN n 
3 143 PRO n 
3 144 TYR n 
3 145 GLU n 
3 146 LYS n 
3 147 LYS n 
3 148 ALA n 
3 149 ALA n 
3 150 LYS n 
3 151 LEU n 
3 152 LYS n 
3 153 GLU n 
3 154 LYS n 
3 155 TYR n 
3 156 GLU n 
3 157 LYS n 
3 158 ASP n 
3 159 ILE n 
3 160 ALA n 
3 161 ALA n 
3 162 TYR n 
3 163 ARG n 
4 1   DC  n 
4 2   DG  n 
4 3   DG  n 
4 4   DG  n 
4 5   DT  n 
4 6   DT  n 
4 7   DT  n 
4 8   DT  n 
4 9   DT  n 
4 10  DG  n 
4 11  DT  n 
4 12  DT  n 
4 13  DA  n 
4 14  DA  n 
4 15  DG  n 
4 16  DG  n 
4 17  DG  n 
4 18  DC  n 
4 19  DT  n 
4 20  DG  n 
4 21  DT  n 
4 22  DA  n 
4 23  DT  n 
4 24  DC  n 
4 25  DA  n 
4 26  DC  n 
4 27  DT  n 
4 28  DG  n 
4 29  DT  n 
4 30  DG  n 
4 31  DT  n 
4 32  DA  n 
4 33  DA  n 
4 34  DG  n 
4 35  DA  n 
4 36  DC  n 
4 37  DA  n 
4 38  DG  n 
4 39  DG  n 
4 40  DC  n 
5 1   DG  n 
5 2   DC  n 
5 3   DC  n 
5 4   DT  n 
5 5   DG  n 
5 6   DT  n 
5 7   DC  n 
5 8   DT  n 
5 9   DT  n 
5 10  DA  n 
6 1   DC  n 
6 2   DA  n 
6 3   DC  n 
6 4   DA  n 
6 5   DG  n 
6 6   DT  n 
6 7   DG  n 
6 8   DA  n 
6 9   DT  n 
6 10  DA  n 
6 11  DC  n 
6 12  DA  n 
6 13  DG  n 
6 14  DC  n 
6 15  DC  n 
6 16  DC  n 
6 17  DT  n 
6 18  DT  n 
6 19  DA  n 
6 20  DA  n 
6 21  DC  n 
6 22  DA  n 
6 23  DA  n 
6 24  DA  n 
6 25  DA  n 
6 26  DA  n 
6 27  DC  n 
6 28  DC  n 
6 29  DC  n 
6 30  DG  n 
7 1   DC  n 
7 2   DG  n 
7 3   DG  n 
7 4   DG  n 
7 5   DT  n 
7 6   DT  n 
7 7   DT  n 
7 8   DT  n 
7 9   DT  n 
7 10  DG  n 
7 11  DT  n 
7 12  DC  n 
7 13  DT  n 
7 14  DG  n 
7 15  DG  n 
7 16  DC  n 
7 17  DT  n 
7 18  DT  n 
7 19  DC  n 
7 20  DA  n 
7 21  DC  n 
7 22  DA  n 
7 23  DC  n 
7 24  DT  n 
7 25  DT  n 
7 26  DG  n 
7 27  DA  n 
7 28  DT  n 
7 29  DT  n 
7 30  DT  n 
7 31  DG  n 
7 32  DC  n 
7 33  DA  n 
7 34  DT  n 
7 35  DC  n 
7 36  DA  n 
7 37  DC  n 
7 38  DT  n 
7 39  DG  n 
7 40  DT  n 
7 41  DG  n 
7 42  DT  n 
7 43  DA  n 
7 44  DA  n 
7 45  DG  n 
7 46  DA  n 
7 47  DC  n 
7 48  DA  n 
7 49  DG  n 
7 50  DG  n 
7 51  DC  n 
7 52  DC  n 
7 53  DA  n 
7 54  DG  n 
7 55  DA  n 
7 56  DT  n 
8 1   DA  n 
8 2   DT  n 
8 3   DC  n 
8 4   DT  n 
8 5   DG  n 
8 6   DG  n 
8 7   DC  n 
8 8   DC  n 
8 9   DT  n 
8 10  DG  n 
8 11  DT  n 
8 12  DC  n 
8 13  DT  n 
8 14  DT  n 
8 15  DA  n 
8 16  DC  n 
8 17  DA  n 
8 18  DC  n 
8 19  DA  n 
8 20  DG  n 
8 21  DT  n 
8 22  DG  n 
8 23  DA  n 
8 24  DT  n 
8 25  DG  n 
8 26  DC  n 
8 27  DA  n 
8 28  DA  n 
8 29  DA  n 
8 30  DT  n 
8 31  DC  n 
8 32  DA  n 
8 33  DA  n 
8 34  DG  n 
8 35  DT  n 
8 36  DG  n 
8 37  DT  n 
8 38  DG  n 
8 39  DA  n 
8 40  DA  n 
8 41  DG  n 
8 42  DC  n 
8 43  DC  n 
8 44  DA  n 
8 45  DG  n 
8 46  DA  n 
8 47  DC  n 
8 48  DA  n 
8 49  DA  n 
8 50  DA  n 
8 51  DA  n 
8 52  DA  n 
8 53  DC  n 
8 54  DC  n 
8 55  DC  n 
8 56  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 625 Mouse ? Rag1          ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens'     
9606   ? ? ? ? ? ? ?           ? HEK293T ? ? ? ? ? ? ? 'His(6)-MBP-PreScission' ? pLEXm ? ? 
2 1 sample 'Biological sequence' 1 359 Mouse ? 'Rag2, Rag-2' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Homo sapiens'     
9606   ? ? ? ? ? ? ?           ? HEK293T ? ? ? ? ? ? ? 'His(6)-MBP-PreScission' ? pLEXm ? ? 
3 1 sample 'Biological sequence' 1 163 Human ? 'HMGB1, HMG1' ? ? ? ? ? ? 'Homo sapiens' 9606  ? H ? ? ? ? ? ? 'Escherichia coli' 
469008 ? ? ? ? ? ? 'BL21(DE3)' ? ?       ? ? ? ? ? ? ? ?                        ? ?     ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
4 1 sample 1 40 'Homo sapiens' ? 9606 ? 
5 1 sample 1 10 'Homo sapiens' ? 9606 ? 
6 1 sample 1 30 'Homo sapiens' ? 9606 ? 
7 1 sample 1 56 'Homo sapiens' ? 9606 ? 
8 1 sample 1 56 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAG1_MOUSE  P15919 ? 1 
;VHINKGGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQ
PAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSRTDVGIIDGLSGLAS
SVDEYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFS
FTVMRITIEHGSQNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIPRTFKFIFR
GTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQRYEVWRSNPYHESVEELRDRVKGVSAKP
FIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETV
DAVCELIPSEERHEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHV
PEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNA
;
384 
2 UNP RAG2_MOUSE  P21784 ? 2 
;MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLPPLRYPATCSY
KGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRS
YMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGS
NMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQ
;
1   
3 UNP HMGB1_HUMAN P09429 ? 3 
;MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP
PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA
AYR
;
1   
4 PDB 6CIM        6CIM   ? 4 ? 1   
5 PDB 6CIM        6CIM   ? 5 ? 1   
6 PDB 6CIM        6CIM   ? 6 ? 1   
7 PDB 6CIM        6CIM   ? 7 ? 1   
8 PDB 6CIM        6CIM   ? 8 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6CIM A 1 ? 625 ? P15919 384 ? 1008 ? 384 1008 
2  2 6CIM B 1 ? 359 ? P21784 1   ? 359  ? 1   359  
3  1 6CIM C 1 ? 625 ? P15919 384 ? 1008 ? 384 1008 
4  2 6CIM D 1 ? 359 ? P21784 1   ? 359  ? 1   359  
5  3 6CIM N 1 ? 163 ? P09429 1   ? 163  ? 1   163  
6  4 6CIM F 1 ? 40  ? 6CIM   1   ? 40   ? 1   40   
7  5 6CIM I 1 ? 10  ? 6CIM   7   ? 16   ? 7   16   
8  6 6CIM L 1 ? 30  ? 6CIM   17  ? 46   ? 17  46   
9  7 6CIM G 1 ? 56  ? 6CIM   1   ? 56   ? 1   56   
10 8 6CIM J 1 ? 56  ? 6CIM   2   ? 57   ? 2   57   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6CIM GLN A 579 ? UNP P15919 GLU 962 'engineered mutation' 962 1 
3 6CIM GLN C 579 ? UNP P15919 GLU 962 'engineered mutation' 962 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CIM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.88 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '18% PEG3350, 200 mM KNO3, 50 mM HEPES pH 6.9' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            119.310 
_reflns.entry_id                         6CIM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.60 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       39753 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.00 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                0.119 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.082 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.139 
_reflns.pdbx_Rpim_I_all                  0.072 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.60 
_reflns_shell.d_res_low                   3.66 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1956 
_reflns_shell.percent_possible_all        100.00 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.999 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            0.632 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.164 
_reflns_shell.pdbx_Rpim_I_all             0.593 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.574 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                283.260 
_refine.B_iso_mean                               125.2791 
_refine.B_iso_min                                53.250 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CIM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.6000 
_refine.ls_d_res_low                             38.6930 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     39678 
_refine.ls_number_reflns_R_free                  2049 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.6600 
_refine.ls_percent_reflns_R_free                 5.1600 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2160 
_refine.ls_R_factor_R_free                       0.2537 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2140 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6CIK 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.2000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.6000 
_refine_hist.d_res_low                        38.6930 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               18787 
_refine_hist.pdbx_number_residues_total       2156 
_refine_hist.pdbx_B_iso_mean_ligand           87.58 
_refine_hist.pdbx_B_iso_mean_solvent          87.90 
_refine_hist.pdbx_number_atoms_protein        15215 
_refine_hist.pdbx_number_atoms_nucleic_acid   3565 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL B 2886 10.635 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL D 2886 10.635 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 TORSIONAL F 1641 10.635 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 TORSIONAL G 1641 10.635 ? ? ? ? ? 
5 'X-RAY DIFFRACTION' 3 1 TORSIONAL A 488  10.635 ? ? ? ? ? 
6 'X-RAY DIFFRACTION' 3 2 TORSIONAL C 488  10.635 ? ? ? ? ? 
7 'X-RAY DIFFRACTION' 4 1 TORSIONAL A 268  10.635 ? ? ? ? ? 
8 'X-RAY DIFFRACTION' 4 2 TORSIONAL C 268  10.635 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.6001 3.6837  2551 . 148 2403 96.0000  . . . 0.3491 0.0000 0.3025 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.6837 3.7758  2608 . 130 2478 100.0000 . . . 0.3021 0.0000 0.2683 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.7758 3.8778  2661 . 137 2524 100.0000 . . . 0.3102 0.0000 0.2441 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.8778 3.9918  2666 . 128 2538 100.0000 . . . 0.2549 0.0000 0.2317 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 3.9918 4.1205  2634 . 156 2478 100.0000 . . . 0.2746 0.0000 0.2124 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.1205 4.2676  2633 . 145 2488 100.0000 . . . 0.2583 0.0000 0.1967 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.2676 4.4382  2620 . 138 2482 100.0000 . . . 0.2296 0.0000 0.1902 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.4382 4.6399  2633 . 144 2489 100.0000 . . . 0.2520 0.0000 0.1888 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.6399 4.8841  2668 . 142 2526 100.0000 . . . 0.2459 0.0000 0.1847 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 4.8841 5.1894  2666 . 137 2529 100.0000 . . . 0.2520 0.0000 0.1891 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 5.1894 5.5890  2654 . 122 2532 100.0000 . . . 0.2957 0.0000 0.2132 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 5.5890 6.1494  2639 . 144 2495 100.0000 . . . 0.2559 0.0000 0.2272 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 6.1494 7.0346  2663 . 117 2546 100.0000 . . . 0.2470 0.0000 0.2282 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 7.0346 8.8454  2684 . 128 2556 100.0000 . . . 0.2299 0.0000 0.2144 . . . . . . 15 . . . 
'X-RAY DIFFRACTION' 8.8454 38.6957 2698 . 133 2565 99.0000  . . . 0.2317 0.0000 0.2107 . . . . . . 15 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
1 2 
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
2 1 '(chain F and resid 22 through 28) or (chain L and resid 19 through 25)' 
2 2 '(chain G and resid 33 through 39) or (chain J and resid 19 through 25)' 
3 1 
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
3 2 
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
4 1 '(chain A and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 2)' 
4 2 '(chain C and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 1)' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? B 2   B 46   
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 2 ? B 48  B 50   
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 3 ? B 52  B 57   
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 4 ? B 59  B 117  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 5 ? B 118 B 119  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 6 ? B 1   B 350  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 7 ? B 1   B 350  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 8 ? B 1   B 350  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 1 9 ? B 1   B 350  
;(chain B and (resid 2 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 117 or (resid 118 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 237 or (resid 238 through 239 and (name N or name CA or name C or name O or name CB )) or resid 240 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 or (resid 244 through 246 and (name N or name CA or name C or name O or name CB )) or resid 247 through 266 or (resid 267 and (name N or name CA or name C or name O or name CB )) or resid 268 through 289 or (resid 290 through 292 and (name N or name CA or name C or name O or name CB )) or (resid 296 through 300 and (name N or name CA or name C or name O or name CB )) or resid 301 through 334 or (resid 341 through 342 and (name N or name CA or name C or name O or name CB )) or resid 343 through 350))
;
? ? ? ? ? ? ? ? 
1 2 1 ? D 2   D 37   
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
1 2 2 ? D 38  D 38   
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
1 2 3 ? D 1   D 351  
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
1 2 4 ? D 1   D 351  
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
1 2 5 ? D 1   D 351  
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
1 2 6 ? D 1   D 351  
;(chain D and (resid 2 through 37 or (resid 38 and (name N or name CA or name C or name O or name CB )) or resid 39 through 46 or resid 48 through 50 or resid 52 through 57 or resid 59 through 81 or resid 89 through 116 or (resid 117 through 119 and (name N or name CA or name C or name O or name CB )) or resid 120 through 292 or resid 296 through 334 or resid 341 through 350))
;
? ? ? ? ? ? ? ? 
2 1 1 ? F 22  F 28   '(chain F and resid 22 through 28) or (chain L and resid 19 through 25)' ? ? ? ? ? ? ? ? 
2 1 2 ? L 19  L 25   '(chain F and resid 22 through 28) or (chain L and resid 19 through 25)' ? ? ? ? ? ? ? ? 
2 2 1 ? G 33  G 39   '(chain G and resid 33 through 39) or (chain J and resid 19 through 25)' ? ? ? ? ? ? ? ? 
2 2 2 ? J 19  J 25   '(chain G and resid 33 through 39) or (chain J and resid 19 through 25)' ? ? ? ? ? ? ? ? 
3 1 1 ? A 404 A 410  
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 1 2 ? A 395 A 1007 
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 1 3 ? A 395 A 1007 
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 1 4 ? A 395 A 1007 
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 1 5 ? A 395 A 1007 
;(chain A and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 414 or (resid 415 through 423 and (name N or name CA or name C or name O or name CB )) or resid 424 through 425 or (resid 426 through 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 444 or (resid 445 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or (resid 460 and (name N or name CA or name C or name O or name CB )) or resid 461 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 581 or (resid 582 and (name N or name CA or name C or name O or name CB )) or resid 583 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 2 1 ? C 404 C 410  
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 2 2 ? C 396 C 1007 
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 2 3 ? C 396 C 1007 
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 2 4 ? C 396 C 1007 
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
3 2 5 ? C 396 C 1007 
;(chain C and ((resid 404 through 410 and (name N or name CA or name C or name O or name CB )) or resid 411 through 433 or (resid 434 and (name N or name CA or name C or name O or name CB )) or resid 435 through 438 or (resid 439 through 453 and (name N or name CA or name C or name O or name CB )) or resid 454 through 455 or resid 460 through 493 or resid 495 through 503 or resid 505 through 523 or resid 525 through 528 or (resid 529 and (name N or name CA or name C or name O or name CB )) or resid 530 through 590 or resid 793 through 812))
;
? ? ? ? ? ? ? ? 
4 1 1 ? A 709 A 742  '(chain A and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 2)' ? ? ? ? ? ? ? ? 
4 1 2 ? A 932 A 950  '(chain A and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 2)' ? ? ? ? ? ? ? ? 
4 2 1 ? C 709 C 742  '(chain C and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 1)' ? ? ? ? ? ? ? ? 
4 2 2 ? C 932 C 950  '(chain C and (resid 709 through 742 or resid 932 through 950)) or (chain Z and resid 1)' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                     6CIM 
_struct.title                        'Pre-Reaction Complex, RAG1(E962Q)/2-nicked/intact 12/23RSS complex in Mn2+' 
_struct.pdbx_descriptor              
'V(D)J recombination-activating protein 1, V(D)J recombination-activating protein 2, High mobility group protein B1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CIM 
_struct_keywords.text            'VDJ recombination, RSS, RAG1/2, RECOMBINATION, RECOMBINATION-DNA complex' 
_struct_keywords.pdbx_keywords   RECOMBINATION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 1  ? 
D N N 2  ? 
E N N 3  ? 
F N N 4  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 9  ? 
N N N 10 ? 
O N N 11 ? 
P N N 11 ? 
Q N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 12  ? LEU A 16  ? HIS A 395 LEU A 399  5 ? 5  
HELX_P HELX_P2  AA2 THR A 17  ? GLU A 40  ? THR A 400 GLU A 423  1 ? 24 
HELX_P HELX_P3  AA3 ASP A 43  ? ARG A 59  ? ASP A 426 ARG A 442  1 ? 17 
HELX_P HELX_P4  AA4 GLU A 61  ? GLY A 74  ? GLU A 444 GLY A 457  1 ? 14 
HELX_P HELX_P5  AA5 GLN A 80  ? PHE A 92  ? GLN A 463 PHE A 475  1 ? 13 
HELX_P HELX_P6  AA6 SER A 94  ? GLY A 110 ? SER A 477 GLY A 493  1 ? 17 
HELX_P HELX_P7  AA7 PRO A 116 ? LEU A 128 ? PRO A 499 LEU A 511  1 ? 13 
HELX_P HELX_P8  AA8 ARG A 175 ? MET A 187 ? ARG A 558 MET A 570  1 ? 13 
HELX_P HELX_P9  AA9 MET A 187 ? GLN A 198 ? MET A 570 GLN A 581  1 ? 12 
HELX_P HELX_P10 AB1 ASP A 281 ? LYS A 300 ? ASP A 664 LYS A 683  1 ? 20 
HELX_P HELX_P11 AB2 ASP A 325 ? GLU A 333 ? ASP A 708 GLU A 716  1 ? 9  
HELX_P HELX_P12 AB3 THR A 350 ? ASN A 357 ? THR A 733 ASN A 740  1 ? 8  
HELX_P HELX_P13 AB4 SER A 366 ? ASN A 380 ? SER A 749 ASN A 763  1 ? 15 
HELX_P HELX_P14 AB5 SER A 385 ? LYS A 394 ? SER A 768 LYS A 777  1 ? 10 
HELX_P HELX_P15 AB6 ASP A 409 ? GLY A 430 ? ASP A 792 GLY A 813  1 ? 22 
HELX_P HELX_P16 AB7 SER A 439 ? MET A 458 ? SER A 822 MET A 841  1 ? 20 
HELX_P HELX_P17 AB8 ASN A 467 ? MET A 475 ? ASN A 850 MET A 858  1 ? 9  
HELX_P HELX_P18 AB9 THR A 476 ? GLU A 485 ? THR A 859 GLU A 868  1 ? 10 
HELX_P HELX_P19 AC1 SER A 489 ? SER A 512 ? SER A 872 SER A 895  1 ? 24 
HELX_P HELX_P20 AC2 CYS A 514 ? CYS A 519 ? CYS A 897 CYS A 902  1 ? 6  
HELX_P HELX_P21 AC3 CYS A 519 ? LYS A 540 ? CYS A 902 LYS A 923  1 ? 22 
HELX_P HELX_P22 AC4 THR A 550 ? HIS A 559 ? THR A 933 HIS A 942  1 ? 10 
HELX_P HELX_P23 AC5 HIS A 559 ? GLY A 568 ? HIS A 942 GLY A 951  1 ? 10 
HELX_P HELX_P24 AC6 ILE A 570 ? ALA A 574 ? ILE A 953 ALA A 957  5 ? 5  
HELX_P HELX_P25 AC7 ASN A 578 ? ASN A 592 ? ASN A 961 ASN A 975  1 ? 15 
HELX_P HELX_P26 AC8 SER A 596 ? SER A 613 ? SER A 979 SER A 996  1 ? 18 
HELX_P HELX_P27 AC9 SER A 613 ? ASN A 621 ? SER A 996 ASN A 1004 1 ? 9  
HELX_P HELX_P28 AD1 ASN B 11  ? ILE B 15  ? ASN B 11  ILE B 15   5 ? 5  
HELX_P HELX_P29 AD2 THR B 168 ? TRP B 172 ? THR B 168 TRP B 172  5 ? 5  
HELX_P HELX_P30 AD3 THR B 308 ? SER B 314 ? THR B 308 SER B 314  1 ? 7  
HELX_P HELX_P31 AD4 THR C 17  ? LEU C 25  ? THR C 400 LEU C 408  1 ? 9  
HELX_P HELX_P32 AD5 LEU C 25  ? GLY C 41  ? LEU C 408 GLY C 424  1 ? 17 
HELX_P HELX_P33 AD6 ASP C 43  ? ARG C 59  ? ASP C 426 ARG C 442  1 ? 17 
HELX_P HELX_P34 AD7 GLU C 61  ? GLY C 74  ? GLU C 444 GLY C 457  1 ? 14 
HELX_P HELX_P35 AD8 GLN C 80  ? THR C 91  ? GLN C 463 THR C 474  1 ? 12 
HELX_P HELX_P36 AD9 SER C 94  ? GLY C 110 ? SER C 477 GLY C 493  1 ? 17 
HELX_P HELX_P37 AE1 PRO C 116 ? LEU C 128 ? PRO C 499 LEU C 511  1 ? 13 
HELX_P HELX_P38 AE2 ARG C 175 ? MET C 187 ? ARG C 558 MET C 570  1 ? 13 
HELX_P HELX_P39 AE3 MET C 187 ? GLN C 198 ? MET C 570 GLN C 581  1 ? 12 
HELX_P HELX_P40 AE4 ASP C 281 ? LYS C 300 ? ASP C 664 LYS C 683  1 ? 20 
HELX_P HELX_P41 AE5 ASP C 325 ? GLU C 333 ? ASP C 708 GLU C 716  1 ? 9  
HELX_P HELX_P42 AE6 THR C 350 ? LEU C 358 ? THR C 733 LEU C 741  1 ? 9  
HELX_P HELX_P43 AE7 SER C 366 ? ASN C 380 ? SER C 749 ASN C 763  1 ? 15 
HELX_P HELX_P44 AE8 SER C 385 ? LYS C 394 ? SER C 768 LYS C 777  1 ? 10 
HELX_P HELX_P45 AE9 ASP C 409 ? GLU C 431 ? ASP C 792 GLU C 814  1 ? 23 
HELX_P HELX_P46 AF1 VAL C 432 ? HIS C 435 ? VAL C 815 HIS C 818  5 ? 4  
HELX_P HELX_P47 AF2 SER C 439 ? ASN C 459 ? SER C 822 ASN C 842  1 ? 21 
HELX_P HELX_P48 AF3 ASN C 467 ? MET C 475 ? ASN C 850 MET C 858  1 ? 9  
HELX_P HELX_P49 AF4 THR C 476 ? GLU C 485 ? THR C 859 GLU C 868  1 ? 10 
HELX_P HELX_P50 AF5 SER C 489 ? SER C 512 ? SER C 872 SER C 895  1 ? 24 
HELX_P HELX_P51 AF6 CYS C 514 ? CYS C 519 ? CYS C 897 CYS C 902  1 ? 6  
HELX_P HELX_P52 AF7 CYS C 519 ? LYS C 540 ? CYS C 902 LYS C 923  1 ? 22 
HELX_P HELX_P53 AF8 PHE C 541 ? TYR C 545 ? PHE C 924 TYR C 928  5 ? 5  
HELX_P HELX_P54 AF9 THR C 550 ? HIS C 559 ? THR C 933 HIS C 942  1 ? 10 
HELX_P HELX_P55 AG1 HIS C 559 ? GLY C 568 ? HIS C 942 GLY C 951  1 ? 10 
HELX_P HELX_P56 AG2 GLN C 579 ? ALA C 593 ? GLN C 962 ALA C 976  1 ? 15 
HELX_P HELX_P57 AG3 TYR C 599 ? THR C 612 ? TYR C 982 THR C 995  1 ? 14 
HELX_P HELX_P58 AG4 SER C 613 ? ASN C 621 ? SER C 996 ASN C 1004 1 ? 9  
HELX_P HELX_P59 AG5 ASN D 11  ? ILE D 15  ? ASN D 11  ILE D 15   5 ? 5  
HELX_P HELX_P60 AG6 THR D 168 ? TRP D 172 ? THR D 168 TRP D 172  5 ? 5  
HELX_P HELX_P61 AG7 THR D 308 ? SER D 314 ? THR D 308 SER D 314  1 ? 7  
HELX_P HELX_P62 AG8 VAL E 20  ? HIS E 31  ? VAL N 20  HIS N 31   1 ? 12 
HELX_P HELX_P63 AG9 ASN E 37  ? ARG E 48  ? ASN N 37  ARG N 48   1 ? 12 
HELX_P HELX_P64 AH1 SER E 100 ? HIS E 117 ? SER N 100 HIS N 117  1 ? 18 
HELX_P HELX_P65 AH2 SER E 121 ? THR E 136 ? SER N 121 THR N 136  1 ? 16 
HELX_P HELX_P66 AH3 LYS E 141 ? ASP E 158 ? LYS N 141 ASP N 158  1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A ASP 217 OD1 ? ? ? 1_555 L MN .  MN ? ? A ASP 600 A MN 1102 1_555 ? ? ? ? ? ? ?               2.235 ? 
metalc2   metalc ? ? A ASP 325 OD2 ? ? ? 1_555 L MN .  MN ? ? A ASP 708 A MN 1102 1_555 ? ? ? ? ? ? ?               2.160 ? 
metalc3   metalc ? ? A CYS 344 SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 727 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.310 ? 
metalc4   metalc ? ? A CYS 347 SG  ? ? ? 1_555 K ZN .  ZN ? ? A CYS 730 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.306 ? 
metalc5   metalc ? ? A HIS 554 NE2 ? ? ? 1_555 K ZN .  ZN ? ? A HIS 937 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.067 ? 
metalc6   metalc ? ? A HIS 559 NE2 ? ? ? 1_555 K ZN .  ZN ? ? A HIS 942 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.076 ? 
metalc7   metalc ? ? C ASP 217 OD1 ? ? ? 1_555 N MN .  MN ? ? C ASP 600 C MN 1102 1_555 ? ? ? ? ? ? ?               2.230 ? 
metalc8   metalc ? ? C ASP 325 OD2 ? ? ? 1_555 N MN .  MN ? ? C ASP 708 C MN 1102 1_555 ? ? ? ? ? ? ?               2.138 ? 
metalc9   metalc ? ? C CYS 344 SG  ? ? ? 1_555 M ZN .  ZN ? ? C CYS 727 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.295 ? 
metalc10  metalc ? ? C CYS 347 SG  ? ? ? 1_555 M ZN .  ZN ? ? C CYS 730 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.293 ? 
metalc11  metalc ? ? C HIS 554 NE2 ? ? ? 1_555 M ZN .  ZN ? ? C HIS 937 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.014 ? 
metalc12  metalc ? ? C HIS 559 NE2 ? ? ? 1_555 M ZN .  ZN ? ? C HIS 942 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.016 ? 
hydrog1   hydrog ? ? F DT  6   N3  ? ? ? 1_555 H DA 25 N1 ? ? F DT  6   L DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? F DT  6   O4  ? ? ? 1_555 H DA 25 N6 ? ? F DT  6   L DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? F DT  7   N3  ? ? ? 1_555 H DA 24 N1 ? ? F DT  7   L DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? F DT  7   O4  ? ? ? 1_555 H DA 24 N6 ? ? F DT  7   L DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? F DT  8   N3  ? ? ? 1_555 H DA 23 N1 ? ? F DT  8   L DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? F DT  8   O4  ? ? ? 1_555 H DA 23 N6 ? ? F DT  8   L DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? F DT  9   N3  ? ? ? 1_555 H DA 22 N1 ? ? F DT  9   L DA 38   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog8   hydrog ? ? F DG  10  N1  ? ? ? 1_555 H DC 21 N3 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? F DG  10  N2  ? ? ? 1_555 H DC 21 O2 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? F DG  10  O6  ? ? ? 1_555 H DC 21 N4 ? ? F DG  10  L DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? F DT  11  N3  ? ? ? 1_555 H DA 20 N1 ? ? F DT  11  L DA 36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog12  hydrog ? ? F DT  12  N3  ? ? ? 1_555 H DA 19 N1 ? ? F DT  12  L DA 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? F DT  12  O4  ? ? ? 1_555 H DA 19 N6 ? ? F DT  12  L DA 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? F DA  13  N1  ? ? ? 1_555 H DT 18 N3 ? ? F DA  13  L DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? F DA  13  N6  ? ? ? 1_555 H DT 18 O4 ? ? F DA  13  L DT 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? F DA  14  N1  ? ? ? 1_555 H DT 17 N3 ? ? F DA  14  L DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? F DA  14  N6  ? ? ? 1_555 H DT 17 O4 ? ? F DA  14  L DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? F DG  15  N1  ? ? ? 1_555 H DC 16 N3 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? F DG  15  N2  ? ? ? 1_555 H DC 16 O2 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? F DG  15  O6  ? ? ? 1_555 H DC 16 N4 ? ? F DG  15  L DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? F DG  16  N1  ? ? ? 1_555 H DC 15 N3 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? F DG  16  N2  ? ? ? 1_555 H DC 15 O2 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? F DG  16  O6  ? ? ? 1_555 H DC 15 N4 ? ? F DG  16  L DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? F DG  17  N1  ? ? ? 1_555 H DC 14 N3 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? F DG  17  N2  ? ? ? 1_555 H DC 14 O2 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? F DG  17  O6  ? ? ? 1_555 H DC 14 N4 ? ? F DG  17  L DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? F DC  18  N3  ? ? ? 1_555 H DG 13 N1 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? F DC  18  N4  ? ? ? 1_555 H DG 13 O6 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? F DC  18  O2  ? ? ? 1_555 H DG 13 N2 ? ? F DC  18  L DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? F DT  19  N3  ? ? ? 1_555 H DA 12 N1 ? ? F DT  19  L DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? F DT  19  O4  ? ? ? 1_555 H DA 12 N6 ? ? F DT  19  L DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? F DG  20  N1  ? ? ? 1_555 H DC 11 N3 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? F DG  20  N2  ? ? ? 1_555 H DC 11 O2 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? F DG  20  O6  ? ? ? 1_555 H DC 11 N4 ? ? F DG  20  L DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? F DT  21  N3  ? ? ? 1_555 H DA 10 N1 ? ? F DT  21  L DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? F DT  21  O4  ? ? ? 1_555 H DA 10 N6 ? ? F DT  21  L DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? F DA  22  N1  ? ? ? 1_555 H DT 9  N3 ? ? F DA  22  L DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? F DA  22  N6  ? ? ? 1_555 H DT 9  O4 ? ? F DA  22  L DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? F DT  23  N3  ? ? ? 1_555 H DA 8  N1 ? ? F DT  23  L DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? F DT  23  O4  ? ? ? 1_555 H DA 8  N6 ? ? F DT  23  L DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? F DC  24  N3  ? ? ? 1_555 H DG 7  N1 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? F DC  24  N4  ? ? ? 1_555 H DG 7  O6 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? F DC  24  O2  ? ? ? 1_555 H DG 7  N2 ? ? F DC  24  L DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? F DA  25  N1  ? ? ? 1_555 H DT 6  N3 ? ? F DA  25  L DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? F DA  25  N6  ? ? ? 1_555 H DT 6  O4 ? ? F DA  25  L DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? F DC  26  N3  ? ? ? 1_555 H DG 5  N1 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? F DC  26  N4  ? ? ? 1_555 H DG 5  O6 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? F DC  26  O2  ? ? ? 1_555 H DG 5  N2 ? ? F DC  26  L DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? F DT  27  N3  ? ? ? 1_555 H DA 4  N1 ? ? F DT  27  L DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? F DT  27  O4  ? ? ? 1_555 H DA 4  N6 ? ? F DT  27  L DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? F DG  28  N1  ? ? ? 1_555 H DC 3  N3 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? F DG  28  N2  ? ? ? 1_555 H DC 3  O2 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? F DG  28  O6  ? ? ? 1_555 H DC 3  N4 ? ? F DG  28  L DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? F DT  29  N3  ? ? ? 1_555 H DA 2  N1 ? ? F DT  29  L DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? F DT  29  O4  ? ? ? 1_555 H DA 2  N6 ? ? F DT  29  L DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? F DG  30  N1  ? ? ? 1_555 H DC 1  N3 ? ? F DG  30  L DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? F DG  30  N2  ? ? ? 1_555 H DC 1  O2 ? ? F DG  30  L DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? F DG  30  O6  ? ? ? 1_555 H DC 1  N4 ? ? F DG  30  L DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? F DT  31  N3  ? ? ? 1_555 G DA 10 N1 ? ? F DT  31  I DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? F DT  31  O4  ? ? ? 1_555 G DA 10 N6 ? ? F DT  31  I DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? F DA  32  N1  ? ? ? 1_555 G DT 9  N3 ? ? F DA  32  I DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? F DA  32  N6  ? ? ? 1_555 G DT 9  O4 ? ? F DA  32  I DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? F DA  33  N1  ? ? ? 1_555 G DT 8  N3 ? ? F DA  33  I DT 14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog64  hydrog ? ? F DG  34  N1  ? ? ? 1_555 G DC 7  N3 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? F DG  34  N2  ? ? ? 1_555 G DC 7  O2 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? F DG  34  O6  ? ? ? 1_555 G DC 7  N4 ? ? F DG  34  I DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? F DA  35  N1  ? ? ? 1_555 G DT 6  N3 ? ? F DA  35  I DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? F DA  35  N6  ? ? ? 1_555 G DT 6  O4 ? ? F DA  35  I DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? F DC  36  N3  ? ? ? 1_555 G DG 5  N1 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? F DC  36  N4  ? ? ? 1_555 G DG 5  O6 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? F DC  36  O2  ? ? ? 1_555 G DG 5  N2 ? ? F DC  36  I DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? F DA  37  N1  ? ? ? 1_555 G DT 4  N3 ? ? F DA  37  I DT 10   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog73  hydrog ? ? F DG  38  N1  ? ? ? 1_555 G DC 3  N3 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? F DG  38  N2  ? ? ? 1_555 G DC 3  O2 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? F DG  38  O6  ? ? ? 1_555 G DC 3  N4 ? ? F DG  38  I DC 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? F DG  39  N2  ? ? ? 1_555 G DC 2  O2 ? ? F DG  39  I DC 8    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog77  hydrog ? ? I DG  3   N1  ? ? ? 1_555 J DC 54 N3 ? ? G DG  3   J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DG  3   N2  ? ? ? 1_555 J DC 54 O2 ? ? G DG  3   J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  3   O6  ? ? ? 1_555 J DC 54 N4 ? ? G DG  3   J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DG  4   N1  ? ? ? 1_555 J DC 53 N3 ? ? G DG  4   J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DG  4   N2  ? ? ? 1_555 J DC 53 O2 ? ? G DG  4   J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DG  4   O6  ? ? ? 1_555 J DC 53 N4 ? ? G DG  4   J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  5   N3  ? ? ? 1_555 J DA 52 N1 ? ? G DT  5   J DA 53   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog84  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA 51 N1 ? ? G DT  6   J DA 52   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog85  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA 49 N1 ? ? G DT  8   J DA 50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog86  hydrog ? ? I DT  9   N3  ? ? ? 1_555 J DA 48 N1 ? ? G DT  9   J DA 49   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog87  hydrog ? ? I DG  10  N2  ? ? ? 1_555 J DC 47 O2 ? ? G DG  10  J DC 48   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog88  hydrog ? ? I DT  11  N3  ? ? ? 1_555 J DA 46 N1 ? ? G DT  11  J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DT  11  O4  ? ? ? 1_555 J DA 46 N6 ? ? G DT  11  J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG 45 N2 ? ? G DC  12  J DG 46   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog91  hydrog ? ? I DT  13  N3  ? ? ? 1_555 J DA 44 N1 ? ? G DT  13  J DA 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DT  13  O4  ? ? ? 1_555 J DA 44 N6 ? ? G DT  13  J DA 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG  14  N1  ? ? ? 1_555 J DC 43 N3 ? ? G DG  14  J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DG  14  N2  ? ? ? 1_555 J DC 43 O2 ? ? G DG  14  J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DG  14  O6  ? ? ? 1_555 J DC 43 N4 ? ? G DG  14  J DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC 42 N3 ? ? G DG  15  J DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC 42 O2 ? ? G DG  15  J DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC 42 N4 ? ? G DG  15  J DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG 41 N2 ? ? G DC  16  J DG 42   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog100 hydrog ? ? I DT  17  N3  ? ? ? 1_555 J DA 40 N1 ? ? G DT  17  J DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT  17  O4  ? ? ? 1_555 J DA 40 N6 ? ? G DT  17  J DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DT  18  N3  ? ? ? 1_555 J DA 39 N1 ? ? G DT  18  J DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  18  O4  ? ? ? 1_555 J DA 39 N6 ? ? G DT  18  J DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  19  N3  ? ? ? 1_555 J DG 38 N1 ? ? G DC  19  J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DC  19  N4  ? ? ? 1_555 J DG 38 O6 ? ? G DC  19  J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DC  19  O2  ? ? ? 1_555 J DG 38 N2 ? ? G DC  19  J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  20  N1  ? ? ? 1_555 J DT 37 N3 ? ? G DA  20  J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DA  20  N6  ? ? ? 1_555 J DT 37 O4 ? ? G DA  20  J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  21  N3  ? ? ? 1_555 J DG 36 N1 ? ? G DC  21  J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  21  N4  ? ? ? 1_555 J DG 36 O6 ? ? G DC  21  J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  21  O2  ? ? ? 1_555 J DG 36 N2 ? ? G DC  21  J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DA  22  N1  ? ? ? 1_555 J DT 35 N3 ? ? G DA  22  J DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DA  22  N6  ? ? ? 1_555 J DT 35 O4 ? ? G DA  22  J DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  23  N3  ? ? ? 1_555 J DG 34 N1 ? ? G DC  23  J DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  23  N4  ? ? ? 1_555 J DG 34 O6 ? ? G DC  23  J DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DC  23  O2  ? ? ? 1_555 J DG 34 N2 ? ? G DC  23  J DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DT  24  N3  ? ? ? 1_555 J DA 33 N1 ? ? G DT  24  J DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DT  24  O4  ? ? ? 1_555 J DA 33 N6 ? ? G DT  24  J DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DT  25  N3  ? ? ? 1_555 J DA 32 N1 ? ? G DT  25  J DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DT  25  O4  ? ? ? 1_555 J DA 32 N6 ? ? G DT  25  J DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  26  N1  ? ? ? 1_555 J DC 31 N3 ? ? G DG  26  J DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  26  N2  ? ? ? 1_555 J DC 31 O2 ? ? G DG  26  J DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DG  26  O6  ? ? ? 1_555 J DC 31 N4 ? ? G DG  26  J DC 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT 30 N3 ? ? G DA  27  J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT 30 O4 ? ? G DA  27  J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DT  28  N3  ? ? ? 1_555 J DA 29 N1 ? ? G DT  28  J DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DT  28  O4  ? ? ? 1_555 J DA 29 N6 ? ? G DT  28  J DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DT  29  N3  ? ? ? 1_555 J DA 28 N1 ? ? G DT  29  J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DT  29  O4  ? ? ? 1_555 J DA 28 N6 ? ? G DT  29  J DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DT  30  N3  ? ? ? 1_555 J DA 27 N1 ? ? G DT  30  J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DT  30  O4  ? ? ? 1_555 J DA 27 N6 ? ? G DT  30  J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC 26 N3 ? ? G DG  31  J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC 26 O2 ? ? G DG  31  J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  31  O6  ? ? ? 1_555 J DC 26 N4 ? ? G DG  31  J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DC  32  N3  ? ? ? 1_555 J DG 25 N1 ? ? G DC  32  J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  32  N4  ? ? ? 1_555 J DG 25 O6 ? ? G DC  32  J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  32  O2  ? ? ? 1_555 J DG 25 N2 ? ? G DC  32  J DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DA  33  N1  ? ? ? 1_555 J DT 24 N3 ? ? G DA  33  J DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  33  N6  ? ? ? 1_555 J DT 24 O4 ? ? G DA  33  J DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA 23 N1 ? ? G DT  34  J DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA 23 N6 ? ? G DT  34  J DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DC  35  N3  ? ? ? 1_555 J DG 22 N1 ? ? G DC  35  J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DC  35  N4  ? ? ? 1_555 J DG 22 O6 ? ? G DC  35  J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DC  35  O2  ? ? ? 1_555 J DG 22 N2 ? ? G DC  35  J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA  36  N1  ? ? ? 1_555 J DT 21 N3 ? ? G DA  36  J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA  36  N6  ? ? ? 1_555 J DT 21 O4 ? ? G DA  36  J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DC  37  N3  ? ? ? 1_555 J DG 20 N1 ? ? G DC  37  J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DC  37  N4  ? ? ? 1_555 J DG 20 O6 ? ? G DC  37  J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DC  37  O2  ? ? ? 1_555 J DG 20 N2 ? ? G DC  37  J DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA 19 N1 ? ? G DT  38  J DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA 19 N6 ? ? G DT  38  J DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC 18 N3 ? ? G DG  39  J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC 18 O2 ? ? G DG  39  J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC 18 N4 ? ? G DG  39  J DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT  40  N3  ? ? ? 1_555 J DA 17 N1 ? ? G DT  40  J DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT  40  O4  ? ? ? 1_555 J DA 17 N6 ? ? G DT  40  J DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DG  41  N1  ? ? ? 1_555 J DC 16 N3 ? ? G DG  41  J DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DG  41  N2  ? ? ? 1_555 J DC 16 O2 ? ? G DG  41  J DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  41  O6  ? ? ? 1_555 J DC 16 N4 ? ? G DG  41  J DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DT  42  N3  ? ? ? 1_555 J DA 15 N1 ? ? G DT  42  J DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  42  O4  ? ? ? 1_555 J DA 15 N6 ? ? G DT  42  J DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  44  N1  ? ? ? 1_555 J DT 13 N3 ? ? G DA  44  J DT 14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog163 hydrog ? ? I DG  45  N1  ? ? ? 1_555 J DC 12 N3 ? ? G DG  45  J DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  45  N2  ? ? ? 1_555 J DC 12 O2 ? ? G DG  45  J DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  45  O6  ? ? ? 1_555 J DC 12 N4 ? ? G DG  45  J DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DA  46  N1  ? ? ? 1_555 J DT 11 N3 ? ? G DA  46  J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  46  N6  ? ? ? 1_555 J DT 11 O4 ? ? G DA  46  J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG 10 N1 ? ? G DC  47  J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG 10 O6 ? ? G DC  47  J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG 10 N2 ? ? G DC  47  J DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  49  N2  ? ? ? 1_555 J DC 8  O2 ? ? G DG  49  J DC 9    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog172 hydrog ? ? I DG  50  N2  ? ? ? 1_555 J DC 7  O2 ? ? G DG  50  J DC 8    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog173 hydrog ? ? I DC  51  N3  ? ? ? 1_555 J DG 6  N1 ? ? G DC  51  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DC  51  N4  ? ? ? 1_555 J DG 6  O6 ? ? G DC  51  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DC  51  O2  ? ? ? 1_555 J DG 6  N2 ? ? G DC  51  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DC  52  N3  ? ? ? 1_555 J DG 5  N1 ? ? G DC  52  J DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  52  N4  ? ? ? 1_555 J DG 5  O6 ? ? G DC  52  J DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  52  O2  ? ? ? 1_555 J DG 5  N2 ? ? G DC  52  J DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DG  54  N2  ? ? ? 1_555 J DC 3  O2 ? ? G DG  54  J DC 4    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog180 hydrog ? ? I DG  54  N2  ? ? ? 1_555 J DT 4  O2 ? ? G DG  54  J DT 5    1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 137 A . ? GLN 520 A PRO 138 A ? PRO 521 A 1 0.47 
2 GLN 137 C . ? GLN 520 C PRO 138 C ? PRO 521 C 1 0.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 8 ? 
AA4 ? 5 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 8 ? 
AB1 ? 6 ? 
AB2 ? 8 ? 
AB3 ? 5 ? 
AB4 ? 5 ? 
AB5 ? 2 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? parallel      
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AA9 6 7 ? anti-parallel 
AA9 7 8 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB2 7 8 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 134 ? GLN A 137 ? PHE A 517 GLN A 520 
AA1 2 GLU A 303 ? MET A 308 ? GLU A 686 MET A 691 
AA1 3 ILE A 311 ? GLY A 323 ? ILE A 694 GLY A 706 
AA1 4 PHE A 208 ? ASP A 221 ? PHE A 591 ASP A 604 
AA1 5 LYS A 235 ? GLU A 249 ? LYS A 618 GLU A 632 
AA1 6 LYS A 270 ? MET A 275 ? LYS A 653 MET A 658 
AA1 7 ALA A 171 ? PHE A 174 ? ALA A 554 PHE A 557 
AA1 8 ILE A 151 ? ASP A 153 ? ILE A 534 ASP A 536 
AA2 1 PHE A 134 ? GLN A 137 ? PHE A 517 GLN A 520 
AA2 2 GLU A 303 ? MET A 308 ? GLU A 686 MET A 691 
AA2 3 ILE A 311 ? GLY A 323 ? ILE A 694 GLY A 706 
AA2 4 PHE A 208 ? ASP A 221 ? PHE A 591 ASP A 604 
AA2 5 LYS A 235 ? GLU A 249 ? LYS A 618 GLU A 632 
AA2 6 ASN A 254 ? GLU A 259 ? ASN A 637 GLU A 642 
AA3 1 SER B 20  ? PHE B 24  ? SER B 20  PHE B 24  
AA3 2 GLN B 27  ? PHE B 31  ? GLN B 27  PHE B 31  
AA3 3 VAL B 45  ? LYS B 51  ? VAL B 45  LYS B 51  
AA3 4 HIS B 54  ? PRO B 59  ? HIS B 54  PRO B 59  
AA3 5 LEU B 3   ? VAL B 8   ? LEU B 3   VAL B 8   
AA3 6 PHE B 343 ? ARG B 349 ? PHE B 343 ARG B 349 
AA3 7 THR B 326 ? PRO B 332 ? THR B 326 PRO B 332 
AA3 8 PHE B 318 ? ASN B 321 ? PHE B 318 ASN B 321 
AA4 1 ILE B 61  ? PHE B 62  ? ILE B 61  PHE B 62  
AA4 2 VAL B 120 ? LYS B 127 ? VAL B 120 LYS B 127 
AA4 3 ILE B 107 ? LYS B 115 ? ILE B 107 LYS B 115 
AA4 4 GLN B 90  ? HIS B 94  ? GLN B 90  HIS B 94  
AA4 5 ALA B 76  ? TYR B 80  ? ALA B 76  TYR B 80  
AA5 1 VAL B 130 ? GLY B 131 ? VAL B 130 GLY B 131 
AA5 2 CYS B 191 ? TYR B 195 ? CYS B 191 TYR B 195 
AA5 3 VAL B 182 ? ASP B 186 ? VAL B 182 ASP B 186 
AA5 4 LYS B 150 ? PHE B 156 ? LYS B 150 PHE B 156 
AA5 5 SER B 141 ? SER B 147 ? SER B 141 SER B 147 
AA6 1 ARG B 159 ? TYR B 161 ? ARG B 159 TYR B 161 
AA6 2 VAL B 175 ? ASP B 177 ? VAL B 175 ASP B 177 
AA7 1 VAL B 208 ? ARG B 212 ? VAL B 208 ARG B 212 
AA7 2 THR B 215 ? LEU B 219 ? THR B 215 LEU B 219 
AA7 3 LEU B 233 ? ASP B 239 ? LEU B 233 ASP B 239 
AA7 4 ALA B 246 ? LEU B 252 ? ALA B 246 LEU B 252 
AA8 1 ILE B 262 ? ASN B 267 ? ILE B 262 ASN B 267 
AA8 2 GLU B 270 ? VAL B 274 ? GLU B 270 VAL B 274 
AA8 3 CYS B 287 ? LEU B 292 ? CYS B 287 LEU B 292 
AA8 4 ILE B 297 ? MET B 302 ? ILE B 297 MET B 302 
AA9 1 PHE C 134 ? GLN C 137 ? PHE C 517 GLN C 520 
AA9 2 GLU C 303 ? MET C 308 ? GLU C 686 MET C 691 
AA9 3 ILE C 311 ? GLY C 323 ? ILE C 694 GLY C 706 
AA9 4 PHE C 208 ? ASP C 221 ? PHE C 591 ASP C 604 
AA9 5 LYS C 235 ? HIS C 250 ? LYS C 618 HIS C 633 
AA9 6 LYS C 270 ? MET C 275 ? LYS C 653 MET C 658 
AA9 7 ALA C 171 ? PHE C 174 ? ALA C 554 PHE C 557 
AA9 8 ILE C 151 ? ASP C 153 ? ILE C 534 ASP C 536 
AB1 1 PHE C 134 ? GLN C 137 ? PHE C 517 GLN C 520 
AB1 2 GLU C 303 ? MET C 308 ? GLU C 686 MET C 691 
AB1 3 ILE C 311 ? GLY C 323 ? ILE C 694 GLY C 706 
AB1 4 PHE C 208 ? ASP C 221 ? PHE C 591 ASP C 604 
AB1 5 LYS C 235 ? HIS C 250 ? LYS C 618 HIS C 633 
AB1 6 GLN C 253 ? GLU C 259 ? GLN C 636 GLU C 642 
AB2 1 SER D 20  ? PHE D 24  ? SER D 20  PHE D 24  
AB2 2 GLN D 27  ? PHE D 31  ? GLN D 27  PHE D 31  
AB2 3 VAL D 45  ? LYS D 51  ? VAL D 45  LYS D 51  
AB2 4 HIS D 54  ? PRO D 59  ? HIS D 54  PRO D 59  
AB2 5 LEU D 3   ? VAL D 8   ? LEU D 3   VAL D 8   
AB2 6 PHE D 343 ? ARG D 349 ? PHE D 343 ARG D 349 
AB2 7 THR D 326 ? PRO D 332 ? THR D 326 PRO D 332 
AB2 8 PHE D 318 ? ASN D 321 ? PHE D 318 ASN D 321 
AB3 1 ILE D 61  ? PHE D 62  ? ILE D 61  PHE D 62  
AB3 2 LYS D 119 ? LYS D 127 ? LYS D 119 LYS D 127 
AB3 3 ILE D 107 ? ASN D 116 ? ILE D 107 ASN D 116 
AB3 4 GLN D 90  ? HIS D 94  ? GLN D 90  HIS D 94  
AB3 5 ALA D 76  ? TYR D 80  ? ALA D 76  TYR D 80  
AB4 1 VAL D 130 ? GLY D 131 ? VAL D 130 GLY D 131 
AB4 2 CYS D 191 ? TYR D 195 ? CYS D 191 TYR D 195 
AB4 3 VAL D 182 ? ASP D 186 ? VAL D 182 ASP D 186 
AB4 4 LYS D 150 ? PHE D 156 ? LYS D 150 PHE D 156 
AB4 5 SER D 141 ? SER D 147 ? SER D 141 SER D 147 
AB5 1 ARG D 159 ? TYR D 161 ? ARG D 159 TYR D 161 
AB5 2 VAL D 175 ? ASP D 177 ? VAL D 175 ASP D 177 
AB6 1 VAL D 208 ? ARG D 212 ? VAL D 208 ARG D 212 
AB6 2 THR D 215 ? LEU D 219 ? THR D 215 LEU D 219 
AB6 3 LEU D 233 ? ASP D 239 ? LEU D 233 ASP D 239 
AB6 4 ALA D 246 ? LEU D 252 ? ALA D 246 LEU D 252 
AB7 1 ILE D 262 ? THR D 266 ? ILE D 262 THR D 266 
AB7 2 GLU D 270 ? VAL D 274 ? GLU D 270 VAL D 274 
AB7 3 CYS D 287 ? SER D 291 ? CYS D 287 SER D 291 
AB7 4 GLU D 298 ? MET D 302 ? GLU D 298 MET D 302 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 135 ? N GLU A 518 O THR A 305 ? O THR A 688 
AA1 2 3 N MET A 308 ? N MET A 691 O ILE A 311 ? O ILE A 694 
AA1 3 4 O GLY A 323 ? O GLY A 706 N GLU A 214 ? N GLU A 597 
AA1 4 5 N VAL A 211 ? N VAL A 594 O MET A 244 ? O MET A 627 
AA1 5 6 N PHE A 239 ? N PHE A 622 O CYS A 273 ? O CYS A 656 
AA1 6 7 O LEU A 272 ? O LEU A 655 N PHE A 174 ? N PHE A 557 
AA1 7 8 O ARG A 173 ? O ARG A 556 N ILE A 152 ? N ILE A 535 
AA2 1 2 N GLU A 135 ? N GLU A 518 O THR A 305 ? O THR A 688 
AA2 2 3 N MET A 308 ? N MET A 691 O ILE A 311 ? O ILE A 694 
AA2 3 4 O GLY A 323 ? O GLY A 706 N GLU A 214 ? N GLU A 597 
AA2 4 5 N VAL A 211 ? N VAL A 594 O MET A 244 ? O MET A 627 
AA2 5 6 N ILE A 248 ? N ILE A 631 O VAL A 255 ? O VAL A 638 
AA3 1 2 N SER B 20  ? N SER B 20  O PHE B 31  ? O PHE B 31  
AA3 2 3 N VAL B 28  ? N VAL B 28  O PHE B 48  ? O PHE B 48  
AA3 3 4 N HIS B 47  ? N HIS B 47  O LYS B 58  ? O LYS B 58  
AA3 4 5 O LEU B 55  ? O LEU B 55  N THR B 7   ? N THR B 7   
AA3 5 6 N GLN B 4   ? N GLN B 4   O THR B 347 ? O THR B 347 
AA3 6 7 O TYR B 346 ? O TYR B 346 N LEU B 329 ? N LEU B 329 
AA3 7 8 O PHE B 328 ? O PHE B 328 N SER B 320 ? N SER B 320 
AA4 1 2 N ILE B 61  ? N ILE B 61  O PHE B 122 ? O PHE B 122 
AA4 2 3 O THR B 121 ? O THR B 121 N CYS B 114 ? N CYS B 114 
AA4 3 4 O TYR B 108 ? O TYR B 108 N ILE B 93  ? N ILE B 93  
AA4 4 5 O GLN B 90  ? O GLN B 90  N TYR B 80  ? N TYR B 80  
AA5 1 2 N VAL B 130 ? N VAL B 130 O ALA B 192 ? O ALA B 192 
AA5 2 3 O THR B 193 ? O THR B 193 N LEU B 184 ? N LEU B 184 
AA5 3 4 O ILE B 185 ? O ILE B 185 N GLY B 153 ? N GLY B 153 
AA5 4 5 O MET B 152 ? O MET B 152 N VAL B 145 ? N VAL B 145 
AA6 1 2 N SER B 160 ? N SER B 160 O ALA B 176 ? O ALA B 176 
AA7 1 2 N ILE B 210 ? N ILE B 210 O TYR B 217 ? O TYR B 217 
AA7 2 3 N ILE B 218 ? N ILE B 218 O TYR B 234 ? O TYR B 234 
AA7 3 4 N ARG B 237 ? N ARG B 237 O ASN B 248 ? O ASN B 248 
AA8 1 2 N ILE B 262 ? N ILE B 262 O VAL B 274 ? O VAL B 274 
AA8 2 3 N PHE B 271 ? N PHE B 271 O VAL B 290 ? O VAL B 290 
AA8 3 4 N LEU B 289 ? N LEU B 289 O SER B 300 ? O SER B 300 
AA9 1 2 N GLU C 135 ? N GLU C 518 O THR C 305 ? O THR C 688 
AA9 2 3 N LEU C 306 ? N LEU C 689 O ARG C 313 ? O ARG C 696 
AA9 3 4 O THR C 314 ? O THR C 697 N PHE C 208 ? N PHE C 591 
AA9 4 5 N MET C 219 ? N MET C 602 O ALA C 236 ? O ALA C 619 
AA9 5 6 N PHE C 241 ? N PHE C 624 O LYS C 270 ? O LYS C 653 
AA9 6 7 O LEU C 274 ? O LEU C 657 N LYS C 172 ? N LYS C 555 
AA9 7 8 O ARG C 173 ? O ARG C 556 N ILE C 152 ? N ILE C 535 
AB1 1 2 N GLU C 135 ? N GLU C 518 O THR C 305 ? O THR C 688 
AB1 2 3 N LEU C 306 ? N LEU C 689 O ARG C 313 ? O ARG C 696 
AB1 3 4 O THR C 314 ? O THR C 697 N PHE C 208 ? N PHE C 591 
AB1 4 5 N MET C 219 ? N MET C 602 O ALA C 236 ? O ALA C 619 
AB1 5 6 N ILE C 246 ? N ILE C 629 O VAL C 257 ? O VAL C 640 
AB2 1 2 N PHE D 24  ? N PHE D 24  O GLN D 27  ? O GLN D 27  
AB2 2 3 N VAL D 28  ? N VAL D 28  O PHE D 48  ? O PHE D 48  
AB2 3 4 N HIS D 47  ? N HIS D 47  O LYS D 58  ? O LYS D 58  
AB2 4 5 O LEU D 55  ? O LEU D 55  N THR D 7   ? N THR D 7   
AB2 5 6 N VAL D 6   ? N VAL D 6   O PHE D 345 ? O PHE D 345 
AB2 6 7 O LEU D 348 ? O LEU D 348 N ILE D 327 ? N ILE D 327 
AB2 7 8 O PHE D 328 ? O PHE D 328 N SER D 320 ? N SER D 320 
AB3 1 2 N ILE D 61  ? N ILE D 61  O PHE D 122 ? O PHE D 122 
AB3 2 3 O THR D 121 ? O THR D 121 N CYS D 114 ? N CYS D 114 
AB3 3 4 O TYR D 108 ? O TYR D 108 N ILE D 93  ? N ILE D 93  
AB3 4 5 O GLN D 90  ? O GLN D 90  N TYR D 80  ? N TYR D 80  
AB4 1 2 N VAL D 130 ? N VAL D 130 O ALA D 192 ? O ALA D 192 
AB4 2 3 O TYR D 195 ? O TYR D 195 N VAL D 182 ? N VAL D 182 
AB4 3 4 O PHE D 183 ? O PHE D 183 N LEU D 155 ? N LEU D 155 
AB4 4 5 O MET D 152 ? O MET D 152 N VAL D 145 ? N VAL D 145 
AB5 1 2 N SER D 160 ? N SER D 160 O ALA D 176 ? O ALA D 176 
AB6 1 2 N ILE D 210 ? N ILE D 210 O TYR D 217 ? O TYR D 217 
AB6 2 3 N ILE D 218 ? N ILE D 218 O TYR D 234 ? O TYR D 234 
AB6 3 4 N ARG D 237 ? N ARG D 237 O ASN D 248 ? O ASN D 248 
AB7 1 2 N THR D 264 ? N THR D 264 O VAL D 272 ? O VAL D 272 
AB7 2 3 N PHE D 271 ? N PHE D 271 O VAL D 290 ? O VAL D 290 
AB7 3 4 N SER D 291 ? N SER D 291 O GLU D 298 ? O GLU D 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1101 ? 4 'binding site for residue ZN A 1101' 
AC2 Software A MN 1102 ? 2 'binding site for residue MN A 1102' 
AC3 Software C ZN 1101 ? 4 'binding site for residue ZN C 1101' 
AC4 Software C MN 1102 ? 3 'binding site for residue MN C 1102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 344 ? CYS A 727 . ? 1_555 ? 
2  AC1 4 CYS A 347 ? CYS A 730 . ? 1_555 ? 
3  AC1 4 HIS A 554 ? HIS A 937 . ? 1_555 ? 
4  AC1 4 HIS A 559 ? HIS A 942 . ? 1_555 ? 
5  AC2 2 ASP A 217 ? ASP A 600 . ? 1_555 ? 
6  AC2 2 ASP A 325 ? ASP A 708 . ? 1_555 ? 
7  AC3 4 CYS C 344 ? CYS C 727 . ? 1_555 ? 
8  AC3 4 CYS C 347 ? CYS C 730 . ? 1_555 ? 
9  AC3 4 HIS C 554 ? HIS C 937 . ? 1_555 ? 
10 AC3 4 HIS C 559 ? HIS C 942 . ? 1_555 ? 
11 AC4 3 ASP C 217 ? ASP C 600 . ? 1_555 ? 
12 AC4 3 GLU C 279 ? GLU C 662 . ? 1_555 ? 
13 AC4 3 ASP C 325 ? ASP C 708 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CIM 
_atom_sites.fract_transf_matrix[1][1]   0.006383 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001783 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008093 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005574 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1  12  ? -49.424 38.212  70.357  1.00 180.57 ? 395  HIS A N     1 
ATOM   2     C  CA    . HIS A 1  12  ? -50.327 37.085  70.585  1.00 178.87 ? 395  HIS A CA    1 
ATOM   3     C  C     . HIS A 1  12  ? -50.178 36.486  71.981  1.00 175.02 ? 395  HIS A C     1 
ATOM   4     O  O     . HIS A 1  12  ? -49.079 36.463  72.542  1.00 172.42 ? 395  HIS A O     1 
ATOM   5     C  CB    . HIS A 1  12  ? -50.092 35.991  69.534  1.00 154.98 ? 395  HIS A CB    1 
ATOM   6     N  N     . LEU A 1  13  ? -51.291 35.980  72.524  1.00 182.46 ? 396  LEU A N     1 
ATOM   7     C  CA    . LEU A 1  13  ? -51.251 35.369  73.850  1.00 181.11 ? 396  LEU A CA    1 
ATOM   8     C  C     . LEU A 1  13  ? -50.131 34.345  73.950  1.00 176.99 ? 396  LEU A C     1 
ATOM   9     O  O     . LEU A 1  13  ? -49.372 34.347  74.925  1.00 174.92 ? 396  LEU A O     1 
ATOM   10    C  CB    . LEU A 1  13  ? -52.601 34.720  74.196  1.00 149.11 ? 396  LEU A CB    1 
ATOM   11    N  N     . LEU A 1  14  ? -50.002 33.456  72.962  1.00 163.75 ? 397  LEU A N     1 
ATOM   12    C  CA    . LEU A 1  14  ? -49.058 32.370  73.186  1.00 167.61 ? 397  LEU A CA    1 
ATOM   13    C  C     . LEU A 1  14  ? -47.616 32.844  73.000  1.00 165.66 ? 397  LEU A C     1 
ATOM   14    O  O     . LEU A 1  14  ? -46.685 32.151  73.426  1.00 169.49 ? 397  LEU A O     1 
ATOM   15    C  CB    . LEU A 1  14  ? -49.423 31.145  72.322  1.00 128.53 ? 397  LEU A CB    1 
ATOM   16    N  N     . SER A 1  15  ? -47.411 34.051  72.463  1.00 161.13 ? 398  SER A N     1 
ATOM   17    C  CA    . SER A 1  15  ? -46.054 34.590  72.401  1.00 161.61 ? 398  SER A CA    1 
ATOM   18    C  C     . SER A 1  15  ? -45.552 34.971  73.781  1.00 166.05 ? 398  SER A C     1 
ATOM   19    O  O     . SER A 1  15  ? -44.374 34.769  74.095  1.00 168.32 ? 398  SER A O     1 
ATOM   20    C  CB    . SER A 1  15  ? -45.985 35.803  71.468  1.00 154.85 ? 398  SER A CB    1 
ATOM   21    N  N     . LEU A 1  16  ? -46.425 35.515  74.614  1.00 162.15 ? 399  LEU A N     1 
ATOM   22    C  CA    . LEU A 1  16  ? -46.014 36.129  75.866  1.00 161.49 ? 399  LEU A CA    1 
ATOM   23    C  C     . LEU A 1  16  ? -45.892 35.069  76.972  1.00 163.60 ? 399  LEU A C     1 
ATOM   24    O  O     . LEU A 1  16  ? -46.328 33.930  76.822  1.00 158.03 ? 399  LEU A O     1 
ATOM   25    C  CB    . LEU A 1  16  ? -46.991 37.267  76.211  1.00 170.60 ? 399  LEU A CB    1 
ATOM   26    N  N     . THR A 1  17  ? -45.235 35.450  78.073  1.00 163.53 ? 400  THR A N     1 
ATOM   27    C  CA    . THR A 1  17  ? -44.945 34.553  79.188  1.00 162.32 ? 400  THR A CA    1 
ATOM   28    C  C     . THR A 1  17  ? -46.107 34.456  80.166  1.00 160.82 ? 400  THR A C     1 
ATOM   29    O  O     . THR A 1  17  ? -47.010 35.293  80.183  1.00 156.88 ? 400  THR A O     1 
ATOM   30    C  CB    . THR A 1  17  ? -43.708 35.008  79.959  1.00 153.82 ? 400  THR A CB    1 
ATOM   31    N  N     . ARG A 1  18  ? -46.035 33.440  81.030  1.00 150.52 ? 401  ARG A N     1 
ATOM   32    C  CA    . ARG A 1  18  ? -47.143 33.105  81.918  1.00 149.15 ? 401  ARG A CA    1 
ATOM   33    C  C     . ARG A 1  18  ? -47.621 34.299  82.752  1.00 152.23 ? 401  ARG A C     1 
ATOM   34    O  O     . ARG A 1  18  ? -48.831 34.511  82.913  1.00 156.46 ? 401  ARG A O     1 
ATOM   35    C  CB    . ARG A 1  18  ? -46.738 31.933  82.825  1.00 138.35 ? 401  ARG A CB    1 
ATOM   36    N  N     . ARG A 1  19  ? -46.688 35.083  83.305  1.00 151.08 ? 402  ARG A N     1 
ATOM   37    C  CA    . ARG A 1  19  ? -47.085 36.291  84.031  1.00 152.89 ? 402  ARG A CA    1 
ATOM   38    C  C     . ARG A 1  19  ? -47.858 37.241  83.125  1.00 157.88 ? 402  ARG A C     1 
ATOM   39    O  O     . ARG A 1  19  ? -48.824 37.897  83.545  1.00 159.11 ? 402  ARG A O     1 
ATOM   40    C  CB    . ARG A 1  19  ? -45.853 37.005  84.594  1.00 175.41 ? 402  ARG A CB    1 
ATOM   41    N  N     . ALA A 1  20  ? -47.431 37.325  81.860  1.00 163.48 ? 403  ALA A N     1 
ATOM   42    C  CA    . ALA A 1  20  ? -48.050 38.239  80.905  1.00 164.30 ? 403  ALA A CA    1 
ATOM   43    C  C     . ALA A 1  20  ? -49.421 37.740  80.484  1.00 162.30 ? 403  ALA A C     1 
ATOM   44    O  O     . ALA A 1  20  ? -50.377 38.519  80.361  1.00 170.15 ? 403  ALA A O     1 
ATOM   45    C  CB    . ALA A 1  20  ? -47.155 38.398  79.672  1.00 162.91 ? 403  ALA A CB    1 
ATOM   46    N  N     . GLN A 1  21  ? -49.525 36.444  80.215  1.00 152.30 ? 404  GLN A N     1 
ATOM   47    C  CA    . GLN A 1  21  ? -50.804 35.901  79.791  1.00 155.63 ? 404  GLN A CA    1 
ATOM   48    C  C     . GLN A 1  21  ? -51.823 36.007  80.922  1.00 159.28 ? 404  GLN A C     1 
ATOM   49    O  O     . GLN A 1  21  ? -52.991 36.354  80.698  1.00 157.44 ? 404  GLN A O     1 
ATOM   50    C  CB    . GLN A 1  21  ? -50.606 34.453  79.347  1.00 177.24 ? 404  GLN A CB    1 
ATOM   51    C  CG    . GLN A 1  21  ? -49.271 34.109  78.638  1.00 178.50 ? 404  GLN A CG    1 
ATOM   52    C  CD    . GLN A 1  21  ? -49.190 32.616  78.400  1.00 168.18 ? 404  GLN A CD    1 
ATOM   53    O  OE1   . GLN A 1  21  ? -50.014 32.086  77.664  1.00 175.52 ? 404  GLN A OE1   1 
ATOM   54    N  NE2   . GLN A 1  21  ? -48.278 31.918  79.089  1.00 160.64 ? 404  GLN A NE2   1 
ATOM   55    N  N     . LYS A 1  22  ? -51.385 35.725  82.153  1.00 159.32 ? 405  LYS A N     1 
ATOM   56    C  CA    . LYS A 1  22  ? -52.226 35.968  83.321  1.00 153.89 ? 405  LYS A CA    1 
ATOM   57    C  C     . LYS A 1  22  ? -52.667 37.440  83.389  1.00 159.37 ? 405  LYS A C     1 
ATOM   58    O  O     . LYS A 1  22  ? -53.828 37.726  83.699  1.00 158.40 ? 405  LYS A O     1 
ATOM   59    C  CB    . LYS A 1  22  ? -51.507 35.488  84.591  1.00 141.01 ? 405  LYS A CB    1 
ATOM   60    N  N     . HIS A 1  23  ? -51.767 38.392  83.101  1.00 155.32 ? 406  HIS A N     1 
ATOM   61    C  CA    . HIS A 1  23  ? -52.182 39.799  83.074  1.00 154.61 ? 406  HIS A CA    1 
ATOM   62    C  C     . HIS A 1  23  ? -53.285 40.019  82.043  1.00 154.88 ? 406  HIS A C     1 
ATOM   63    O  O     . HIS A 1  23  ? -54.329 40.609  82.345  1.00 165.36 ? 406  HIS A O     1 
ATOM   64    C  CB    . HIS A 1  23  ? -50.991 40.713  82.758  1.00 155.29 ? 406  HIS A CB    1 
ATOM   65    N  N     . ARG A 1  24  ? -53.043 39.585  80.803  1.00 149.12 ? 407  ARG A N     1 
ATOM   66    C  CA    . ARG A 1  24  ? -53.981 39.790  79.697  1.00 157.24 ? 407  ARG A CA    1 
ATOM   67    C  C     . ARG A 1  24  ? -55.302 39.042  79.863  1.00 157.51 ? 407  ARG A C     1 
ATOM   68    O  O     . ARG A 1  24  ? -56.262 39.337  79.141  1.00 149.27 ? 407  ARG A O     1 
ATOM   69    C  CB    . ARG A 1  24  ? -53.343 39.364  78.375  1.00 147.69 ? 407  ARG A CB    1 
ATOM   70    N  N     . LEU A 1  25  ? -55.368 38.046  80.738  1.00 154.14 ? 408  LEU A N     1 
ATOM   71    C  CA    . LEU A 1  25  ? -56.609 37.303  80.906  1.00 153.48 ? 408  LEU A CA    1 
ATOM   72    C  C     . LEU A 1  25  ? -57.261 37.439  82.280  1.00 159.15 ? 408  LEU A C     1 
ATOM   73    O  O     . LEU A 1  25  ? -58.312 36.824  82.497  1.00 162.41 ? 408  LEU A O     1 
ATOM   74    C  CB    . LEU A 1  25  ? -56.362 35.826  80.588  1.00 147.83 ? 408  LEU A CB    1 
ATOM   75    N  N     . ARG A 1  26  ? -56.687 38.228  83.199  1.00 159.70 ? 409  ARG A N     1 
ATOM   76    C  CA    . ARG A 1  26  ? -57.214 38.322  84.564  1.00 165.06 ? 409  ARG A CA    1 
ATOM   77    C  C     . ARG A 1  26  ? -58.721 38.591  84.626  1.00 170.22 ? 409  ARG A C     1 
ATOM   78    O  O     . ARG A 1  26  ? -59.425 38.012  85.469  1.00 168.83 ? 409  ARG A O     1 
ATOM   79    C  CB    . ARG A 1  26  ? -56.453 39.408  85.333  1.00 162.98 ? 409  ARG A CB    1 
ATOM   80    N  N     . GLU A 1  27  ? -59.234 39.465  83.752  1.00 168.55 ? 410  GLU A N     1 
ATOM   81    C  CA    . GLU A 1  27  ? -60.649 39.838  83.807  1.00 166.42 ? 410  GLU A CA    1 
ATOM   82    C  C     . GLU A 1  27  ? -61.544 38.638  83.523  1.00 164.33 ? 410  GLU A C     1 
ATOM   83    O  O     . GLU A 1  27  ? -62.487 38.340  84.280  1.00 158.76 ? 410  GLU A O     1 
ATOM   84    C  CB    . GLU A 1  27  ? -60.925 40.964  82.810  1.00 159.49 ? 410  GLU A CB    1 
ATOM   85    N  N     . LEU A 1  28  ? -61.261 37.936  82.425  1.00 163.39 ? 411  LEU A N     1 
ATOM   86    C  CA    . LEU A 1  28  ? -62.011 36.730  82.121  1.00 157.32 ? 411  LEU A CA    1 
ATOM   87    C  C     . LEU A 1  28  ? -61.795 35.660  83.189  1.00 154.07 ? 411  LEU A C     1 
ATOM   88    O  O     . LEU A 1  28  ? -62.720 34.906  83.490  1.00 155.76 ? 411  LEU A O     1 
ATOM   89    C  CB    . LEU A 1  28  ? -61.634 36.223  80.724  1.00 155.60 ? 411  LEU A CB    1 
ATOM   90    C  CG    . LEU A 1  28  ? -62.261 34.901  80.269  1.00 159.39 ? 411  LEU A CG    1 
ATOM   91    C  CD1   . LEU A 1  28  ? -63.769 35.034  80.250  1.00 157.97 ? 411  LEU A CD1   1 
ATOM   92    C  CD2   . LEU A 1  28  ? -61.739 34.434  78.897  1.00 163.74 ? 411  LEU A CD2   1 
ATOM   93    N  N     . LYS A 1  29  ? -60.614 35.614  83.823  1.00 156.64 ? 412  LYS A N     1 
ATOM   94    C  CA    . LYS A 1  29  ? -60.404 34.619  84.876  1.00 152.55 ? 412  LYS A CA    1 
ATOM   95    C  C     . LYS A 1  29  ? -61.352 34.864  86.039  1.00 157.68 ? 412  LYS A C     1 
ATOM   96    O  O     . LYS A 1  29  ? -61.938 33.922  86.588  1.00 155.00 ? 412  LYS A O     1 
ATOM   97    C  CB    . LYS A 1  29  ? -58.955 34.632  85.360  1.00 142.26 ? 412  LYS A CB    1 
ATOM   98    N  N     . ILE A 1  30  ? -61.507 36.132  86.427  1.00 168.11 ? 413  ILE A N     1 
ATOM   99    C  CA    . ILE A 1  30  ? -62.420 36.489  87.511  1.00 159.82 ? 413  ILE A CA    1 
ATOM   100   C  C     . ILE A 1  30  ? -63.867 36.187  87.124  1.00 156.32 ? 413  ILE A C     1 
ATOM   101   O  O     . ILE A 1  30  ? -64.645 35.642  87.927  1.00 152.92 ? 413  ILE A O     1 
ATOM   102   C  CB    . ILE A 1  30  ? -62.221 37.968  87.890  1.00 144.74 ? 413  ILE A CB    1 
ATOM   103   N  N     . GLN A 1  31  ? -64.245 36.500  85.878  1.00 154.76 ? 414  GLN A N     1 
ATOM   104   C  CA    . GLN A 1  31  ? -65.608 36.208  85.439  1.00 150.32 ? 414  GLN A CA    1 
ATOM   105   C  C     . GLN A 1  31  ? -65.878 34.706  85.462  1.00 152.70 ? 414  GLN A C     1 
ATOM   106   O  O     . GLN A 1  31  ? -66.965 34.262  85.862  1.00 144.60 ? 414  GLN A O     1 
ATOM   107   C  CB    . GLN A 1  31  ? -65.848 36.784  84.044  1.00 141.41 ? 414  GLN A CB    1 
ATOM   108   N  N     . VAL A 1  32  ? -64.888 33.907  85.053  1.00 161.11 ? 415  VAL A N     1 
ATOM   109   C  CA    . VAL A 1  32  ? -65.040 32.455  85.022  1.00 159.03 ? 415  VAL A CA    1 
ATOM   110   C  C     . VAL A 1  32  ? -65.129 31.895  86.435  1.00 156.13 ? 415  VAL A C     1 
ATOM   111   O  O     . VAL A 1  32  ? -65.915 30.979  86.699  1.00 157.81 ? 415  VAL A O     1 
ATOM   112   C  CB    . VAL A 1  32  ? -63.890 31.807  84.226  1.00 160.53 ? 415  VAL A CB    1 
ATOM   113   C  CG1   . VAL A 1  32  ? -63.840 30.305  84.461  1.00 156.25 ? 415  VAL A CG1   1 
ATOM   114   C  CG2   . VAL A 1  32  ? -64.048 32.085  82.745  1.00 159.06 ? 415  VAL A CG2   1 
ATOM   115   N  N     . LYS A 1  33  ? -64.328 32.426  87.364  1.00 156.36 ? 416  LYS A N     1 
ATOM   116   C  CA    . LYS A 1  33  ? -64.425 31.960  88.744  1.00 153.97 ? 416  LYS A CA    1 
ATOM   117   C  C     . LYS A 1  33  ? -65.813 32.239  89.296  1.00 157.76 ? 416  LYS A C     1 
ATOM   118   O  O     . LYS A 1  33  ? -66.406 31.391  89.981  1.00 160.77 ? 416  LYS A O     1 
ATOM   119   C  CB    . LYS A 1  33  ? -63.355 32.627  89.609  1.00 143.94 ? 416  LYS A CB    1 
ATOM   120   N  N     . GLU A 1  34  ? -66.365 33.409  88.963  1.00 155.58 ? 417  GLU A N     1 
ATOM   121   C  CA    . GLU A 1  34  ? -67.731 33.728  89.366  1.00 159.68 ? 417  GLU A CA    1 
ATOM   122   C  C     . GLU A 1  34  ? -68.728 32.720  88.796  1.00 159.69 ? 417  GLU A C     1 
ATOM   123   O  O     . GLU A 1  34  ? -69.585 32.193  89.520  1.00 152.82 ? 417  GLU A O     1 
ATOM   124   C  CB    . GLU A 1  34  ? -68.083 35.148  88.924  1.00 158.88 ? 417  GLU A CB    1 
ATOM   125   N  N     . PHE A 1  35  ? -68.642 32.461  87.485  1.00 162.26 ? 418  PHE A N     1 
ATOM   126   C  CA    . PHE A 1  35  ? -69.561 31.524  86.837  1.00 157.34 ? 418  PHE A CA    1 
ATOM   127   C  C     . PHE A 1  35  ? -69.468 30.131  87.449  1.00 156.55 ? 418  PHE A C     1 
ATOM   128   O  O     . PHE A 1  35  ? -70.486 29.448  87.619  1.00 156.86 ? 418  PHE A O     1 
ATOM   129   C  CB    . PHE A 1  35  ? -69.268 31.462  85.337  1.00 148.96 ? 418  PHE A CB    1 
ATOM   130   N  N     . ALA A 1  36  ? -68.252 29.693  87.774  1.00 160.57 ? 419  ALA A N     1 
ATOM   131   C  CA    . ALA A 1  36  ? -68.046 28.357  88.326  1.00 161.04 ? 419  ALA A CA    1 
ATOM   132   C  C     . ALA A 1  36  ? -68.648 28.239  89.715  1.00 164.08 ? 419  ALA A C     1 
ATOM   133   O  O     . ALA A 1  36  ? -69.324 27.250  90.032  1.00 161.37 ? 419  ALA A O     1 
ATOM   134   C  CB    . ALA A 1  36  ? -66.553 28.033  88.365  1.00 164.03 ? 419  ALA A CB    1 
ATOM   135   N  N     . ASP A 1  37  ? -68.383 29.230  90.571  1.00 167.21 ? 420  ASP A N     1 
ATOM   136   C  CA    . ASP A 1  37  ? -68.948 29.209  91.914  1.00 167.01 ? 420  ASP A CA    1 
ATOM   137   C  C     . ASP A 1  37  ? -70.470 29.311  91.899  1.00 167.36 ? 420  ASP A C     1 
ATOM   138   O  O     . ASP A 1  37  ? -71.139 28.678  92.725  1.00 166.96 ? 420  ASP A O     1 
ATOM   139   C  CB    . ASP A 1  37  ? -68.343 30.342  92.744  1.00 167.79 ? 420  ASP A CB    1 
ATOM   140   C  CG    . ASP A 1  37  ? -66.824 30.245  92.857  1.00 164.60 ? 420  ASP A CG    1 
ATOM   141   O  OD1   . ASP A 1  37  ? -66.298 29.117  92.954  1.00 165.42 ? 420  ASP A OD1   1 
ATOM   142   O  OD2   . ASP A 1  37  ? -66.154 31.301  92.860  1.00 162.21 ? 420  ASP A OD2   1 
ATOM   143   N  N     . LYS A 1  38  ? -71.042 30.086  90.966  1.00 168.47 ? 421  LYS A N     1 
ATOM   144   C  CA    . LYS A 1  38  ? -72.493 30.264  90.936  1.00 166.03 ? 421  LYS A CA    1 
ATOM   145   C  C     . LYS A 1  38  ? -73.235 29.124  90.244  1.00 168.92 ? 421  LYS A C     1 
ATOM   146   O  O     . LYS A 1  38  ? -74.428 28.938  90.505  1.00 164.82 ? 421  LYS A O     1 
ATOM   147   C  CB    . LYS A 1  38  ? -72.853 31.590  90.250  1.00 149.15 ? 421  LYS A CB    1 
ATOM   148   N  N     . GLU A 1  39  ? -72.582 28.375  89.356  1.00 173.42 ? 422  GLU A N     1 
ATOM   149   C  CA    . GLU A 1  39  ? -73.267 27.331  88.602  1.00 170.12 ? 422  GLU A CA    1 
ATOM   150   C  C     . GLU A 1  39  ? -72.666 25.941  88.744  1.00 167.39 ? 422  GLU A C     1 
ATOM   151   O  O     . GLU A 1  39  ? -73.415 24.964  88.714  1.00 165.35 ? 422  GLU A O     1 
ATOM   152   C  CB    . GLU A 1  39  ? -73.304 27.699  87.108  1.00 171.73 ? 422  GLU A CB    1 
ATOM   153   N  N     . GLU A 1  40  ? -71.354 25.813  88.921  1.00 175.41 ? 423  GLU A N     1 
ATOM   154   C  CA    . GLU A 1  40  ? -70.728 24.499  88.844  1.00 174.38 ? 423  GLU A CA    1 
ATOM   155   C  C     . GLU A 1  40  ? -69.988 24.125  90.120  1.00 170.19 ? 423  GLU A C     1 
ATOM   156   O  O     . GLU A 1  40  ? -69.166 23.204  90.106  1.00 167.14 ? 423  GLU A O     1 
ATOM   157   C  CB    . GLU A 1  40  ? -69.788 24.421  87.635  1.00 160.10 ? 423  GLU A CB    1 
ATOM   158   N  N     . GLY A 1  41  ? -70.266 24.810  91.223  1.00 169.58 ? 424  GLY A N     1 
ATOM   159   C  CA    . GLY A 1  41  ? -69.674 24.429  92.487  1.00 174.87 ? 424  GLY A CA    1 
ATOM   160   C  C     . GLY A 1  41  ? -68.200 24.716  92.629  1.00 174.60 ? 424  GLY A C     1 
ATOM   161   O  O     . GLY A 1  41  ? -67.523 24.046  93.413  1.00 177.59 ? 424  GLY A O     1 
ATOM   162   N  N     . GLY A 1  42  ? -67.672 25.677  91.880  1.00 168.54 ? 425  GLY A N     1 
ATOM   163   C  CA    . GLY A 1  42  ? -66.297 26.095  92.058  1.00 171.39 ? 425  GLY A CA    1 
ATOM   164   C  C     . GLY A 1  42  ? -65.247 25.318  91.294  1.00 176.22 ? 425  GLY A C     1 
ATOM   165   O  O     . GLY A 1  42  ? -64.056 25.461  91.600  1.00 176.56 ? 425  GLY A O     1 
ATOM   166   N  N     . ASP A 1  43  ? -65.640 24.499  90.316  1.00 172.99 ? 426  ASP A N     1 
ATOM   167   C  CA    . ASP A 1  43  ? -64.682 23.696  89.552  1.00 165.07 ? 426  ASP A CA    1 
ATOM   168   C  C     . ASP A 1  43  ? -64.188 24.493  88.347  1.00 159.30 ? 426  ASP A C     1 
ATOM   169   O  O     . ASP A 1  43  ? -64.679 24.360  87.225  1.00 156.95 ? 426  ASP A O     1 
ATOM   170   C  CB    . ASP A 1  43  ? -65.295 22.367  89.132  1.00 159.14 ? 426  ASP A CB    1 
ATOM   171   C  CG    . ASP A 1  43  ? -64.244 21.303  88.904  1.00 160.13 ? 426  ASP A CG    1 
ATOM   172   O  OD1   . ASP A 1  43  ? -63.111 21.665  88.523  1.00 163.57 ? 426  ASP A OD1   1 
ATOM   173   O  OD2   . ASP A 1  43  ? -64.542 20.110  89.118  1.00 161.40 ? 426  ASP A OD2   1 
ATOM   174   N  N     . VAL A 1  44  ? -63.204 25.357  88.601  1.00 157.17 ? 427  VAL A N     1 
ATOM   175   C  CA    . VAL A 1  44  ? -62.598 26.127  87.517  1.00 156.00 ? 427  VAL A CA    1 
ATOM   176   C  C     . VAL A 1  44  ? -61.902 25.190  86.538  1.00 158.48 ? 427  VAL A C     1 
ATOM   177   O  O     . VAL A 1  44  ? -61.948 25.390  85.315  1.00 154.67 ? 427  VAL A O     1 
ATOM   178   C  CB    . VAL A 1  44  ? -61.633 27.180  88.093  1.00 156.34 ? 427  VAL A CB    1 
ATOM   179   C  CG1   . VAL A 1  44  ? -60.801 27.830  86.997  1.00 149.87 ? 427  VAL A CG1   1 
ATOM   180   C  CG2   . VAL A 1  44  ? -62.414 28.231  88.850  1.00 164.26 ? 427  VAL A CG2   1 
ATOM   181   N  N     . LYS A 1  45  ? -61.244 24.152  87.062  1.00 162.48 ? 428  LYS A N     1 
ATOM   182   C  CA    . LYS A 1  45  ? -60.539 23.201  86.209  1.00 157.09 ? 428  LYS A CA    1 
ATOM   183   C  C     . LYS A 1  45  ? -61.480 22.579  85.187  1.00 154.48 ? 428  LYS A C     1 
ATOM   184   O  O     . LYS A 1  45  ? -61.214 22.610  83.980  1.00 166.64 ? 428  LYS A O     1 
ATOM   185   C  CB    . LYS A 1  45  ? -59.890 22.111  87.066  1.00 154.00 ? 428  LYS A CB    1 
ATOM   186   C  CG    . LYS A 1  45  ? -59.197 21.020  86.264  1.00 153.95 ? 428  LYS A CG    1 
ATOM   187   C  CD    . LYS A 1  45  ? -59.216 19.684  86.993  1.00 161.01 ? 428  LYS A CD    1 
ATOM   188   C  CE    . LYS A 1  45  ? -60.642 19.156  87.107  1.00 168.04 ? 428  LYS A CE    1 
ATOM   189   N  NZ    . LYS A 1  45  ? -60.744 17.820  87.763  1.00 158.03 ? 428  LYS A NZ    1 
ATOM   190   N  N     . ALA A 1  46  ? -62.600 22.024  85.657  1.00 153.10 ? 429  ALA A N     1 
ATOM   191   C  CA    . ALA A 1  46  ? -63.529 21.340  84.762  1.00 151.13 ? 429  ALA A CA    1 
ATOM   192   C  C     . ALA A 1  46  ? -64.165 22.298  83.767  1.00 149.49 ? 429  ALA A C     1 
ATOM   193   O  O     . ALA A 1  46  ? -64.364 21.952  82.596  1.00 149.72 ? 429  ALA A O     1 
ATOM   194   C  CB    . ALA A 1  46  ? -64.610 20.627  85.570  1.00 148.85 ? 429  ALA A CB    1 
ATOM   195   N  N     . VAL A 1  47  ? -64.496 23.509  84.207  1.00 152.33 ? 430  VAL A N     1 
ATOM   196   C  CA    . VAL A 1  47  ? -65.169 24.428  83.302  1.00 151.02 ? 430  VAL A CA    1 
ATOM   197   C  C     . VAL A 1  47  ? -64.222 24.872  82.198  1.00 152.60 ? 430  VAL A C     1 
ATOM   198   O  O     . VAL A 1  47  ? -64.599 24.904  81.020  1.00 155.35 ? 430  VAL A O     1 
ATOM   199   C  CB    . VAL A 1  47  ? -65.773 25.618  84.070  1.00 149.73 ? 430  VAL A CB    1 
ATOM   200   C  CG1   . VAL A 1  47  ? -64.706 26.551  84.618  1.00 153.69 ? 430  VAL A CG1   1 
ATOM   201   C  CG2   . VAL A 1  47  ? -66.724 26.361  83.170  1.00 148.20 ? 430  VAL A CG2   1 
ATOM   202   N  N     . CYS A 1  48  ? -62.965 25.167  82.545  1.00 148.79 ? 431  CYS A N     1 
ATOM   203   C  CA    . CYS A 1  48  ? -62.007 25.575  81.526  1.00 149.00 ? 431  CYS A CA    1 
ATOM   204   C  C     . CYS A 1  48  ? -61.710 24.423  80.578  1.00 153.02 ? 431  CYS A C     1 
ATOM   205   O  O     . CYS A 1  48  ? -61.590 24.629  79.363  1.00 158.95 ? 431  CYS A O     1 
ATOM   206   C  CB    . CYS A 1  48  ? -60.727 26.087  82.179  1.00 156.63 ? 431  CYS A CB    1 
ATOM   207   S  SG    . CYS A 1  48  ? -60.926 27.659  83.050  1.00 175.18 ? 431  CYS A SG    1 
ATOM   208   N  N     . LEU A 1  49  ? -61.615 23.200  81.110  1.00 155.34 ? 432  LEU A N     1 
ATOM   209   C  CA    . LEU A 1  49  ? -61.428 22.031  80.257  1.00 152.02 ? 432  LEU A CA    1 
ATOM   210   C  C     . LEU A 1  49  ? -62.565 21.896  79.253  1.00 153.79 ? 432  LEU A C     1 
ATOM   211   O  O     . LEU A 1  49  ? -62.327 21.687  78.058  1.00 164.44 ? 432  LEU A O     1 
ATOM   212   C  CB    . LEU A 1  49  ? -61.319 20.763  81.108  1.00 150.16 ? 432  LEU A CB    1 
ATOM   213   C  CG    . LEU A 1  49  ? -61.332 19.432  80.342  1.00 150.46 ? 432  LEU A CG    1 
ATOM   214   C  CD1   . LEU A 1  49  ? -60.094 19.279  79.472  1.00 153.56 ? 432  LEU A CD1   1 
ATOM   215   C  CD2   . LEU A 1  49  ? -61.476 18.231  81.265  1.00 154.27 ? 432  LEU A CD2   1 
ATOM   216   N  N     . THR A 1  50  ? -63.813 21.997  79.717  1.00 148.47 ? 433  THR A N     1 
ATOM   217   C  CA    . THR A 1  50  ? -64.933 21.819  78.797  1.00 148.92 ? 433  THR A CA    1 
ATOM   218   C  C     . THR A 1  50  ? -64.995 22.946  77.777  1.00 147.30 ? 433  THR A C     1 
ATOM   219   O  O     . THR A 1  50  ? -65.269 22.706  76.592  1.00 150.78 ? 433  THR A O     1 
ATOM   220   C  CB    . THR A 1  50  ? -66.249 21.726  79.560  1.00 151.84 ? 433  THR A CB    1 
ATOM   221   O  OG1   . THR A 1  50  ? -66.074 20.893  80.712  1.00 165.65 ? 433  THR A OG1   1 
ATOM   222   C  CG2   . THR A 1  50  ? -67.328 21.119  78.662  1.00 142.30 ? 433  THR A CG2   1 
ATOM   223   N  N     . LEU A 1  51  ? -64.737 24.178  78.215  1.00 149.49 ? 434  LEU A N     1 
ATOM   224   C  CA    . LEU A 1  51  ? -64.715 25.295  77.283  1.00 147.98 ? 434  LEU A CA    1 
ATOM   225   C  C     . LEU A 1  51  ? -63.706 25.039  76.174  1.00 154.79 ? 434  LEU A C     1 
ATOM   226   O  O     . LEU A 1  51  ? -64.026 25.178  74.989  1.00 157.83 ? 434  LEU A O     1 
ATOM   227   C  CB    . LEU A 1  51  ? -64.402 26.597  78.023  1.00 157.26 ? 434  LEU A CB    1 
ATOM   228   N  N     . PHE A 1  52  ? -62.489 24.611  76.544  1.00 159.90 ? 435  PHE A N     1 
ATOM   229   C  CA    . PHE A 1  52  ? -61.427 24.397  75.557  1.00 160.34 ? 435  PHE A CA    1 
ATOM   230   C  C     . PHE A 1  52  ? -61.723 23.207  74.644  1.00 157.33 ? 435  PHE A C     1 
ATOM   231   O  O     . PHE A 1  52  ? -61.417 23.252  73.448  1.00 154.22 ? 435  PHE A O     1 
ATOM   232   C  CB    . PHE A 1  52  ? -60.083 24.206  76.265  1.00 161.76 ? 435  PHE A CB    1 
ATOM   233   C  CG    . PHE A 1  52  ? -58.903 24.074  75.328  1.00 165.81 ? 435  PHE A CG    1 
ATOM   234   C  CD1   . PHE A 1  52  ? -58.795 24.862  74.192  1.00 166.34 ? 435  PHE A CD1   1 
ATOM   235   C  CD2   . PHE A 1  52  ? -57.903 23.146  75.582  1.00 165.88 ? 435  PHE A CD2   1 
ATOM   236   C  CE1   . PHE A 1  52  ? -57.705 24.729  73.338  1.00 164.70 ? 435  PHE A CE1   1 
ATOM   237   C  CE2   . PHE A 1  52  ? -56.815 23.011  74.728  1.00 162.22 ? 435  PHE A CE2   1 
ATOM   238   C  CZ    . PHE A 1  52  ? -56.718 23.801  73.608  1.00 158.13 ? 435  PHE A CZ    1 
ATOM   239   N  N     . LEU A 1  53  ? -62.282 22.122  75.189  1.00 154.19 ? 436  LEU A N     1 
ATOM   240   C  CA    . LEU A 1  53  ? -62.654 20.971  74.363  1.00 158.71 ? 436  LEU A CA    1 
ATOM   241   C  C     . LEU A 1  53  ? -63.705 21.348  73.322  1.00 159.56 ? 436  LEU A C     1 
ATOM   242   O  O     . LEU A 1  53  ? -63.605 20.964  72.148  1.00 158.38 ? 436  LEU A O     1 
ATOM   243   C  CB    . LEU A 1  53  ? -63.169 19.834  75.249  1.00 149.96 ? 436  LEU A CB    1 
ATOM   244   C  CG    . LEU A 1  53  ? -62.152 19.020  76.060  1.00 151.67 ? 436  LEU A CG    1 
ATOM   245   C  CD1   . LEU A 1  53  ? -62.846 17.897  76.807  1.00 147.34 ? 436  LEU A CD1   1 
ATOM   246   C  CD2   . LEU A 1  53  ? -61.019 18.464  75.204  1.00 155.14 ? 436  LEU A CD2   1 
ATOM   247   N  N     . LEU A 1  54  ? -64.736 22.089  73.740  1.00 159.56 ? 437  LEU A N     1 
ATOM   248   C  CA    . LEU A 1  54  ? -65.785 22.489  72.802  1.00 159.86 ? 437  LEU A CA    1 
ATOM   249   C  C     . LEU A 1  54  ? -65.282 23.515  71.792  1.00 161.84 ? 437  LEU A C     1 
ATOM   250   O  O     . LEU A 1  54  ? -65.741 23.523  70.644  1.00 165.28 ? 437  LEU A O     1 
ATOM   251   C  CB    . LEU A 1  54  ? -67.016 23.001  73.550  1.00 157.89 ? 437  LEU A CB    1 
ATOM   252   C  CG    . LEU A 1  54  ? -67.949 21.958  74.183  1.00 151.95 ? 437  LEU A CG    1 
ATOM   253   C  CD1   . LEU A 1  54  ? -67.221 20.754  74.757  1.00 143.76 ? 437  LEU A CD1   1 
ATOM   254   C  CD2   . LEU A 1  54  ? -68.819 22.606  75.248  1.00 159.46 ? 437  LEU A CD2   1 
ATOM   255   N  N     . ALA A 1  55  ? -64.374 24.403  72.200  1.00 156.73 ? 438  ALA A N     1 
ATOM   256   C  CA    . ALA A 1  55  ? -63.739 25.294  71.237  1.00 158.03 ? 438  ALA A CA    1 
ATOM   257   C  C     . ALA A 1  55  ? -62.934 24.502  70.213  1.00 169.63 ? 438  ALA A C     1 
ATOM   258   O  O     . ALA A 1  55  ? -62.969 24.809  69.015  1.00 171.86 ? 438  ALA A O     1 
ATOM   259   C  CB    . ALA A 1  55  ? -62.855 26.310  71.958  1.00 159.81 ? 438  ALA A CB    1 
ATOM   260   N  N     . LEU A 1  56  ? -62.171 23.502  70.675  1.00 172.80 ? 439  LEU A N     1 
ATOM   261   C  CA    . LEU A 1  56  ? -61.426 22.631  69.769  1.00 162.37 ? 439  LEU A CA    1 
ATOM   262   C  C     . LEU A 1  56  ? -62.356 21.945  68.780  1.00 161.43 ? 439  LEU A C     1 
ATOM   263   O  O     . LEU A 1  56  ? -62.071 21.882  67.580  1.00 169.97 ? 439  LEU A O     1 
ATOM   264   C  CB    . LEU A 1  56  ? -60.630 21.601  70.569  1.00 155.66 ? 439  LEU A CB    1 
ATOM   265   N  N     . ARG A 1  57  ? -63.474 21.412  69.273  1.00 154.32 ? 440  ARG A N     1 
ATOM   266   C  CA    . ARG A 1  57  ? -64.451 20.799  68.381  1.00 159.84 ? 440  ARG A CA    1 
ATOM   267   C  C     . ARG A 1  57  ? -65.039 21.814  67.404  1.00 167.74 ? 440  ARG A C     1 
ATOM   268   O  O     . ARG A 1  57  ? -65.412 21.451  66.282  1.00 168.11 ? 440  ARG A O     1 
ATOM   269   C  CB    . ARG A 1  57  ? -65.565 20.141  69.194  1.00 156.95 ? 440  ARG A CB    1 
ATOM   270   N  N     . ALA A 1  58  ? -65.148 23.081  67.814  1.00 174.86 ? 441  ALA A N     1 
ATOM   271   C  CA    . ALA A 1  58  ? -65.698 24.108  66.929  1.00 175.36 ? 441  ALA A CA    1 
ATOM   272   C  C     . ALA A 1  58  ? -64.792 24.392  65.734  1.00 172.93 ? 441  ALA A C     1 
ATOM   273   O  O     . ALA A 1  58  ? -65.283 24.561  64.611  1.00 173.60 ? 441  ALA A O     1 
ATOM   274   C  CB    . ALA A 1  58  ? -65.957 25.392  67.718  1.00 175.54 ? 441  ALA A CB    1 
ATOM   275   N  N     . ARG A 1  59  ? -63.469 24.430  65.945  1.00 172.47 ? 442  ARG A N     1 
ATOM   276   C  CA    . ARG A 1  59  ? -62.502 24.696  64.880  1.00 172.64 ? 442  ARG A CA    1 
ATOM   277   C  C     . ARG A 1  59  ? -62.182 23.454  64.054  1.00 181.45 ? 442  ARG A C     1 
ATOM   278   O  O     . ARG A 1  59  ? -61.186 23.446  63.312  1.00 178.55 ? 442  ARG A O     1 
ATOM   279   C  CB    . ARG A 1  59  ? -61.211 25.283  65.464  1.00 158.16 ? 442  ARG A CB    1 
ATOM   280   N  N     . ASN A 1  60  ? -63.013 22.414  64.181  1.00 180.82 ? 443  ASN A N     1 
ATOM   281   C  CA    . ASN A 1  60  ? -62.871 21.146  63.469  1.00 177.69 ? 443  ASN A CA    1 
ATOM   282   C  C     . ASN A 1  60  ? -61.580 20.401  63.811  1.00 176.42 ? 443  ASN A C     1 
ATOM   283   O  O     . ASN A 1  60  ? -61.129 19.564  63.028  1.00 177.46 ? 443  ASN A O     1 
ATOM   284   C  CB    . ASN A 1  60  ? -62.968 21.355  61.951  1.00 169.85 ? 443  ASN A CB    1 
ATOM   285   N  N     . GLU A 1  61  ? -60.964 20.692  64.953  1.00 174.91 ? 444  GLU A N     1 
ATOM   286   C  CA    . GLU A 1  61  ? -59.719 20.037  65.360  1.00 167.75 ? 444  GLU A CA    1 
ATOM   287   C  C     . GLU A 1  61  ? -59.992 18.927  66.379  1.00 159.97 ? 444  GLU A C     1 
ATOM   288   O  O     . GLU A 1  61  ? -59.474 18.936  67.492  1.00 160.84 ? 444  GLU A O     1 
ATOM   289   C  CB    . GLU A 1  61  ? -58.737 21.067  65.913  1.00 163.39 ? 444  GLU A CB    1 
ATOM   290   N  N     . HIS A 1  62  ? -60.786 17.932  65.963  1.00 159.41 ? 445  HIS A N     1 
ATOM   291   C  CA    . HIS A 1  62  ? -61.208 16.868  66.875  1.00 159.22 ? 445  HIS A CA    1 
ATOM   292   C  C     . HIS A 1  62  ? -60.035 16.069  67.431  1.00 158.80 ? 445  HIS A C     1 
ATOM   293   O  O     . HIS A 1  62  ? -60.128 15.542  68.544  1.00 157.44 ? 445  HIS A O     1 
ATOM   294   C  CB    . HIS A 1  62  ? -62.164 15.899  66.179  1.00 161.80 ? 445  HIS A CB    1 
ATOM   295   C  CG    . HIS A 1  62  ? -63.404 16.538  65.645  1.00 162.80 ? 445  HIS A CG    1 
ATOM   296   N  ND1   . HIS A 1  62  ? -64.450 16.919  66.454  1.00 162.79 ? 445  HIS A ND1   1 
ATOM   297   C  CD2   . HIS A 1  62  ? -63.777 16.836  64.379  1.00 167.61 ? 445  HIS A CD2   1 
ATOM   298   C  CE1   . HIS A 1  62  ? -65.410 17.439  65.711  1.00 169.56 ? 445  HIS A CE1   1 
ATOM   299   N  NE2   . HIS A 1  62  ? -65.028 17.400  64.447  1.00 168.65 ? 445  HIS A NE2   1 
ATOM   300   N  N     . ARG A 1  63  ? -58.951 15.927  66.659  1.00 161.65 ? 446  ARG A N     1 
ATOM   301   C  CA    . ARG A 1  63  ? -57.836 15.074  67.068  1.00 160.49 ? 446  ARG A CA    1 
ATOM   302   C  C     . ARG A 1  63  ? -57.231 15.531  68.389  1.00 157.57 ? 446  ARG A C     1 
ATOM   303   O  O     . ARG A 1  63  ? -57.075 14.734  69.326  1.00 168.98 ? 446  ARG A O     1 
ATOM   304   C  CB    . ARG A 1  63  ? -56.770 15.047  65.970  1.00 156.52 ? 446  ARG A CB    1 
ATOM   305   N  N     . GLN A 1  64  ? -56.859 16.805  68.477  1.00 149.27 ? 447  GLN A N     1 
ATOM   306   C  CA    . GLN A 1  64  ? -56.243 17.280  69.708  1.00 151.30 ? 447  GLN A CA    1 
ATOM   307   C  C     . GLN A 1  64  ? -57.223 17.236  70.877  1.00 159.02 ? 447  GLN A C     1 
ATOM   308   O  O     . GLN A 1  64  ? -56.812 16.975  72.013  1.00 161.09 ? 447  GLN A O     1 
ATOM   309   C  CB    . GLN A 1  64  ? -55.683 18.683  69.500  1.00 148.55 ? 447  GLN A CB    1 
ATOM   310   C  CG    . GLN A 1  64  ? -54.521 18.705  68.526  1.00 148.80 ? 447  GLN A CG    1 
ATOM   311   C  CD    . GLN A 1  64  ? -53.925 20.077  68.369  1.00 152.09 ? 447  GLN A CD    1 
ATOM   312   O  OE1   . GLN A 1  64  ? -54.622 21.079  68.490  1.00 160.66 ? 447  GLN A OE1   1 
ATOM   313   N  NE2   . GLN A 1  64  ? -52.625 20.133  68.095  1.00 151.88 ? 447  GLN A NE2   1 
ATOM   314   N  N     . ALA A 1  65  ? -58.518 17.451  70.616  1.00 163.09 ? 448  ALA A N     1 
ATOM   315   C  CA    . ALA A 1  65  ? -59.526 17.386  71.678  1.00 163.07 ? 448  ALA A CA    1 
ATOM   316   C  C     . ALA A 1  65  ? -59.687 15.972  72.231  1.00 160.10 ? 448  ALA A C     1 
ATOM   317   O  O     . ALA A 1  65  ? -59.793 15.782  73.448  1.00 155.12 ? 448  ALA A O     1 
ATOM   318   C  CB    . ALA A 1  65  ? -60.867 17.904  71.159  1.00 165.04 ? 448  ALA A CB    1 
ATOM   319   N  N     . ASP A 1  66  ? -59.733 14.971  71.354  1.00 160.54 ? 449  ASP A N     1 
ATOM   320   C  CA    . ASP A 1  66  ? -59.808 13.588  71.809  1.00 156.54 ? 449  ASP A CA    1 
ATOM   321   C  C     . ASP A 1  66  ? -58.547 13.180  72.551  1.00 152.67 ? 449  ASP A C     1 
ATOM   322   O  O     . ASP A 1  66  ? -58.618 12.442  73.538  1.00 154.64 ? 449  ASP A O     1 
ATOM   323   C  CB    . ASP A 1  66  ? -60.067 12.677  70.620  1.00 157.07 ? 449  ASP A CB    1 
ATOM   324   C  CG    . ASP A 1  66  ? -61.399 12.958  69.984  1.00 161.39 ? 449  ASP A CG    1 
ATOM   325   O  OD1   . ASP A 1  66  ? -62.376 13.080  70.751  1.00 158.24 ? 449  ASP A OD1   1 
ATOM   326   O  OD2   . ASP A 1  66  ? -61.472 13.090  68.742  1.00 163.26 ? 449  ASP A OD2   1 
ATOM   327   N  N     . GLU A 1  67  ? -57.382 13.650  72.095  1.00 154.28 ? 450  GLU A N     1 
ATOM   328   C  CA    . GLU A 1  67  ? -56.154 13.337  72.820  1.00 155.98 ? 450  GLU A CA    1 
ATOM   329   C  C     . GLU A 1  67  ? -56.161 13.978  74.207  1.00 160.60 ? 450  GLU A C     1 
ATOM   330   O  O     . GLU A 1  67  ? -55.758 13.347  75.195  1.00 158.20 ? 450  GLU A O     1 
ATOM   331   C  CB    . GLU A 1  67  ? -54.936 13.793  72.016  1.00 152.92 ? 450  GLU A CB    1 
ATOM   332   N  N     . LEU A 1  68  ? -56.656 15.217  74.308  1.00 161.70 ? 451  LEU A N     1 
ATOM   333   C  CA    . LEU A 1  68  ? -56.815 15.845  75.615  1.00 156.46 ? 451  LEU A CA    1 
ATOM   334   C  C     . LEU A 1  68  ? -57.786 15.059  76.481  1.00 158.77 ? 451  LEU A C     1 
ATOM   335   O  O     . LEU A 1  68  ? -57.544 14.865  77.678  1.00 164.60 ? 451  LEU A O     1 
ATOM   336   C  CB    . LEU A 1  68  ? -57.296 17.285  75.455  1.00 146.88 ? 451  LEU A CB    1 
ATOM   337   N  N     . GLU A 1  69  ? -58.896 14.604  75.890  1.00 154.20 ? 452  GLU A N     1 
ATOM   338   C  CA    . GLU A 1  69  ? -59.861 13.797  76.628  1.00 155.19 ? 452  GLU A CA    1 
ATOM   339   C  C     . GLU A 1  69  ? -59.235 12.522  77.166  1.00 156.63 ? 452  GLU A C     1 
ATOM   340   O  O     . GLU A 1  69  ? -59.462 12.149  78.322  1.00 158.07 ? 452  GLU A O     1 
ATOM   341   C  CB    . GLU A 1  69  ? -61.040 13.440  75.729  1.00 154.39 ? 452  GLU A CB    1 
ATOM   342   C  CG    . GLU A 1  69  ? -62.073 14.521  75.586  1.00 157.45 ? 452  GLU A CG    1 
ATOM   343   C  CD    . GLU A 1  69  ? -63.317 14.010  74.899  1.00 163.41 ? 452  GLU A CD    1 
ATOM   344   O  OE1   . GLU A 1  69  ? -63.391 12.788  74.658  1.00 168.62 ? 452  GLU A OE1   1 
ATOM   345   O  OE2   . GLU A 1  69  ? -64.217 14.819  74.598  1.00 162.66 ? 452  GLU A OE2   1 
ATOM   346   N  N     . ALA A 1  70  ? -58.437 11.845  76.345  1.00 158.04 ? 453  ALA A N     1 
ATOM   347   C  CA    . ALA A 1  70  ? -57.828 10.602  76.790  1.00 157.80 ? 453  ALA A CA    1 
ATOM   348   C  C     . ALA A 1  70  ? -56.776 10.842  77.861  1.00 160.50 ? 453  ALA A C     1 
ATOM   349   O  O     . ALA A 1  70  ? -56.634 10.022  78.773  1.00 161.99 ? 453  ALA A O     1 
ATOM   350   C  CB    . ALA A 1  70  ? -57.219 9.860   75.602  1.00 155.97 ? 453  ALA A CB    1 
ATOM   351   N  N     . ILE A 1  71  ? -56.048 11.960  77.787  1.00 157.05 ? 454  ILE A N     1 
ATOM   352   C  CA    . ILE A 1  71  ? -55.035 12.207  78.812  1.00 161.86 ? 454  ILE A CA    1 
ATOM   353   C  C     . ILE A 1  71  ? -55.670 12.671  80.124  1.00 162.89 ? 454  ILE A C     1 
ATOM   354   O  O     . ILE A 1  71  ? -55.122 12.416  81.204  1.00 160.33 ? 454  ILE A O     1 
ATOM   355   C  CB    . ILE A 1  71  ? -53.960 13.188  78.309  1.00 159.05 ? 454  ILE A CB    1 
ATOM   356   C  CG1   . ILE A 1  71  ? -52.637 12.953  79.048  1.00 159.42 ? 454  ILE A CG1   1 
ATOM   357   C  CG2   . ILE A 1  71  ? -54.396 14.625  78.487  1.00 163.32 ? 454  ILE A CG2   1 
ATOM   358   C  CD1   . ILE A 1  71  ? -52.054 11.572  78.839  1.00 159.37 ? 454  ILE A CD1   1 
ATOM   359   N  N     . MET A 1  72  ? -56.824 13.344  80.066  1.00 163.67 ? 455  MET A N     1 
ATOM   360   C  CA    . MET A 1  72  ? -57.521 13.706  81.300  1.00 166.15 ? 455  MET A CA    1 
ATOM   361   C  C     . MET A 1  72  ? -58.206 12.502  81.928  1.00 165.41 ? 455  MET A C     1 
ATOM   362   O  O     . MET A 1  72  ? -58.139 12.312  83.148  1.00 168.97 ? 455  MET A O     1 
ATOM   363   C  CB    . MET A 1  72  ? -58.526 14.824  81.039  1.00 161.38 ? 455  MET A CB    1 
ATOM   364   C  CG    . MET A 1  72  ? -57.876 16.145  80.689  1.00 160.41 ? 455  MET A CG    1 
ATOM   365   S  SD    . MET A 1  72  ? -56.901 16.773  82.077  1.00 165.43 ? 455  MET A SD    1 
ATOM   366   C  CE    . MET A 1  72  ? -55.222 16.453  81.560  1.00 163.42 ? 455  MET A CE    1 
ATOM   367   N  N     . GLN A 1  73  ? -58.872 11.675  81.122  1.00 161.03 ? 456  GLN A N     1 
ATOM   368   C  CA    . GLN A 1  73  ? -59.379 10.417  81.654  1.00 162.16 ? 456  GLN A CA    1 
ATOM   369   C  C     . GLN A 1  73  ? -58.253 9.511   82.131  1.00 169.35 ? 456  GLN A C     1 
ATOM   370   O  O     . GLN A 1  73  ? -58.501 8.589   82.914  1.00 171.84 ? 456  GLN A O     1 
ATOM   371   C  CB    . GLN A 1  73  ? -60.208 9.686   80.600  1.00 164.67 ? 456  GLN A CB    1 
ATOM   372   C  CG    . GLN A 1  73  ? -61.369 10.476  80.044  1.00 164.09 ? 456  GLN A CG    1 
ATOM   373   C  CD    . GLN A 1  73  ? -61.943 9.831   78.799  1.00 171.05 ? 456  GLN A CD    1 
ATOM   374   O  OE1   . GLN A 1  73  ? -62.603 8.797   78.874  1.00 172.97 ? 456  GLN A OE1   1 
ATOM   375   N  NE2   . GLN A 1  73  ? -61.674 10.429  77.642  1.00 171.41 ? 456  GLN A NE2   1 
ATOM   376   N  N     . GLY A 1  74  ? -57.023 9.748   81.677  1.00 171.71 ? 457  GLY A N     1 
ATOM   377   C  CA    . GLY A 1  74  ? -55.921 8.869   82.007  1.00 170.88 ? 457  GLY A CA    1 
ATOM   378   C  C     . GLY A 1  74  ? -56.012 7.477   81.428  1.00 173.40 ? 457  GLY A C     1 
ATOM   379   O  O     . GLY A 1  74  ? -55.229 6.610   81.825  1.00 178.52 ? 457  GLY A O     1 
ATOM   380   N  N     . ARG A 1  75  ? -56.945 7.230   80.506  1.00 171.48 ? 458  ARG A N     1 
ATOM   381   C  CA    . ARG A 1  75  ? -57.056 5.926   79.859  1.00 173.08 ? 458  ARG A CA    1 
ATOM   382   C  C     . ARG A 1  75  ? -55.759 5.580   79.132  1.00 175.47 ? 458  ARG A C     1 
ATOM   383   O  O     . ARG A 1  75  ? -55.358 6.277   78.195  1.00 164.92 ? 458  ARG A O     1 
ATOM   384   C  CB    . ARG A 1  75  ? -58.230 5.930   78.882  1.00 167.74 ? 458  ARG A CB    1 
ATOM   385   N  N     . GLY A 1  76  ? -55.114 4.494   79.561  1.00 174.02 ? 459  GLY A N     1 
ATOM   386   C  CA    . GLY A 1  76  ? -53.810 4.129   79.018  1.00 164.45 ? 459  GLY A CA    1 
ATOM   387   C  C     . GLY A 1  76  ? -53.904 3.486   77.640  1.00 158.33 ? 459  GLY A C     1 
ATOM   388   O  O     . GLY A 1  76  ? -54.785 2.672   77.363  1.00 157.58 ? 459  GLY A O     1 
ATOM   389   N  N     . SER A 1  77  ? -52.966 3.863   76.772  1.00 149.38 ? 460  SER A N     1 
ATOM   390   C  CA    . SER A 1  77  ? -52.874 3.319   75.418  1.00 144.80 ? 460  SER A CA    1 
ATOM   391   C  C     . SER A 1  77  ? -51.776 2.259   75.415  1.00 142.98 ? 460  SER A C     1 
ATOM   392   O  O     . SER A 1  77  ? -50.587 2.582   75.357  1.00 146.96 ? 460  SER A O     1 
ATOM   393   C  CB    . SER A 1  77  ? -52.591 4.423   74.403  1.00 131.41 ? 460  SER A CB    1 
ATOM   394   O  OG    . SER A 1  77  ? -51.403 5.130   74.727  1.00 128.03 ? 460  SER A OG    1 
ATOM   395   N  N     . GLY A 1  78  ? -52.171 0.991   75.477  1.00 122.74 ? 461  GLY A N     1 
ATOM   396   C  CA    . GLY A 1  78  ? -51.196 -0.074  75.358  1.00 101.93 ? 461  GLY A CA    1 
ATOM   397   C  C     . GLY A 1  78  ? -51.725 -1.209  74.514  1.00 104.68 ? 461  GLY A C     1 
ATOM   398   O  O     . GLY A 1  78  ? -52.780 -1.766  74.822  1.00 125.45 ? 461  GLY A O     1 
ATOM   399   N  N     . LEU A 1  79  ? -51.033 -1.552  73.435  1.00 88.67  ? 462  LEU A N     1 
ATOM   400   C  CA    . LEU A 1  79  ? -51.477 -2.665  72.604  1.00 93.65  ? 462  LEU A CA    1 
ATOM   401   C  C     . LEU A 1  79  ? -51.062 -3.999  73.221  1.00 93.40  ? 462  LEU A C     1 
ATOM   402   O  O     . LEU A 1  79  ? -49.898 -4.187  73.597  1.00 92.58  ? 462  LEU A O     1 
ATOM   403   C  CB    . LEU A 1  79  ? -50.913 -2.528  71.193  1.00 84.23  ? 462  LEU A CB    1 
ATOM   404   C  CG    . LEU A 1  79  ? -51.397 -1.336  70.378  1.00 77.11  ? 462  LEU A CG    1 
ATOM   405   C  CD1   . LEU A 1  79  ? -50.500 -1.164  69.189  1.00 82.21  ? 462  LEU A CD1   1 
ATOM   406   C  CD2   . LEU A 1  79  ? -52.821 -1.567  69.909  1.00 79.93  ? 462  LEU A CD2   1 
ATOM   407   N  N     . GLN A 1  80  ? -52.010 -4.924  73.331  1.00 86.75  ? 463  GLN A N     1 
ATOM   408   C  CA    . GLN A 1  80  ? -51.658 -6.260  73.789  1.00 95.26  ? 463  GLN A CA    1 
ATOM   409   C  C     . GLN A 1  80  ? -50.715 -6.934  72.792  1.00 83.05  ? 463  GLN A C     1 
ATOM   410   O  O     . GLN A 1  80  ? -50.825 -6.708  71.579  1.00 85.06  ? 463  GLN A O     1 
ATOM   411   C  CB    . GLN A 1  80  ? -52.909 -7.113  74.035  1.00 105.74 ? 463  GLN A CB    1 
ATOM   412   C  CG    . GLN A 1  80  ? -53.901 -6.481  75.035  1.00 115.40 ? 463  GLN A CG    1 
ATOM   413   C  CD    . GLN A 1  80  ? -53.310 -6.317  76.446  1.00 123.76 ? 463  GLN A CD    1 
ATOM   414   O  OE1   . GLN A 1  80  ? -52.714 -7.255  76.999  1.00 115.85 ? 463  GLN A OE1   1 
ATOM   415   N  NE2   . GLN A 1  80  ? -53.467 -5.121  77.025  1.00 121.14 ? 463  GLN A NE2   1 
ATOM   416   N  N     . PRO A 1  81  ? -49.740 -7.714  73.272  1.00 79.81  ? 464  PRO A N     1 
ATOM   417   C  CA    . PRO A 1  81  ? -48.793 -8.360  72.353  1.00 77.70  ? 464  PRO A CA    1 
ATOM   418   C  C     . PRO A 1  81  ? -49.467 -9.113  71.225  1.00 79.61  ? 464  PRO A C     1 
ATOM   419   O  O     . PRO A 1  81  ? -48.882 -9.252  70.142  1.00 77.80  ? 464  PRO A O     1 
ATOM   420   C  CB    . PRO A 1  81  ? -48.001 -9.300  73.271  1.00 73.28  ? 464  PRO A CB    1 
ATOM   421   C  CG    . PRO A 1  81  ? -48.840 -9.452  74.475  1.00 77.57  ? 464  PRO A CG    1 
ATOM   422   C  CD    . PRO A 1  81  ? -49.525 -8.152  74.657  1.00 80.44  ? 464  PRO A CD    1 
ATOM   423   N  N     . ALA A 1  82  ? -50.678 -9.627  71.453  1.00 83.10  ? 465  ALA A N     1 
ATOM   424   C  CA    . ALA A 1  82  ? -51.395 -10.320 70.391  1.00 79.15  ? 465  ALA A CA    1 
ATOM   425   C  C     . ALA A 1  82  ? -51.756 -9.369  69.260  1.00 70.99  ? 465  ALA A C     1 
ATOM   426   O  O     . ALA A 1  82  ? -51.721 -9.751  68.089  1.00 72.71  ? 465  ALA A O     1 
ATOM   427   C  CB    . ALA A 1  82  ? -52.636 -11.006 70.963  1.00 91.18  ? 465  ALA A CB    1 
ATOM   428   N  N     . VAL A 1  83  ? -52.100 -8.123  69.586  1.00 71.58  ? 466  VAL A N     1 
ATOM   429   C  CA    . VAL A 1  83  ? -52.402 -7.147  68.542  1.00 74.50  ? 466  VAL A CA    1 
ATOM   430   C  C     . VAL A 1  83  ? -51.135 -6.745  67.801  1.00 76.50  ? 466  VAL A C     1 
ATOM   431   O  O     . VAL A 1  83  ? -51.152 -6.506  66.579  1.00 75.75  ? 466  VAL A O     1 
ATOM   432   C  CB    . VAL A 1  83  ? -53.101 -5.913  69.129  1.00 75.13  ? 466  VAL A CB    1 
ATOM   433   C  CG1   . VAL A 1  83  ? -53.306 -4.888  68.049  1.00 75.47  ? 466  VAL A CG1   1 
ATOM   434   C  CG2   . VAL A 1  83  ? -54.429 -6.291  69.737  1.00 91.31  ? 466  VAL A CG2   1 
ATOM   435   N  N     . CYS A 1  84  ? -50.022 -6.620  68.537  1.00 78.50  ? 467  CYS A N     1 
ATOM   436   C  CA    . CYS A 1  84  ? -48.731 -6.358  67.901  1.00 81.34  ? 467  CYS A CA    1 
ATOM   437   C  C     . CYS A 1  84  ? -48.375 -7.451  66.907  1.00 69.76  ? 467  CYS A C     1 
ATOM   438   O  O     . CYS A 1  84  ? -47.894 -7.172  65.805  1.00 67.30  ? 467  CYS A O     1 
ATOM   439   C  CB    . CYS A 1  84  ? -47.626 -6.232  68.955  1.00 81.46  ? 467  CYS A CB    1 
ATOM   440   S  SG    . CYS A 1  84  ? -47.874 -4.973  70.212  1.00 87.69  ? 467  CYS A SG    1 
ATOM   441   N  N     . LEU A 1  85  ? -48.577 -8.704  67.301  1.00 70.21  ? 468  LEU A N     1 
ATOM   442   C  CA    . LEU A 1  85  ? -48.395 -9.817  66.384  1.00 69.89  ? 468  LEU A CA    1 
ATOM   443   C  C     . LEU A 1  85  ? -49.330 -9.702  65.194  1.00 67.66  ? 468  LEU A C     1 
ATOM   444   O  O     . LEU A 1  85  ? -48.955 -10.035 64.073  1.00 71.79  ? 468  LEU A O     1 
ATOM   445   C  CB    . LEU A 1  85  ? -48.633 -11.141 67.098  1.00 73.50  ? 468  LEU A CB    1 
ATOM   446   C  CG    . LEU A 1  85  ? -48.341 -12.348 66.218  1.00 71.52  ? 468  LEU A CG    1 
ATOM   447   C  CD1   . LEU A 1  85  ? -46.885 -12.322 65.767  1.00 76.58  ? 468  LEU A CD1   1 
ATOM   448   C  CD2   . LEU A 1  85  ? -48.676 -13.619 66.946  1.00 76.44  ? 468  LEU A CD2   1 
ATOM   449   N  N     . ALA A 1  86  ? -50.579 -9.311  65.425  1.00 65.73  ? 469  ALA A N     1 
ATOM   450   C  CA    . ALA A 1  86  ? -51.521 -9.211  64.316  1.00 70.49  ? 469  ALA A CA    1 
ATOM   451   C  C     . ALA A 1  86  ? -51.028 -8.241  63.260  1.00 73.12  ? 469  ALA A C     1 
ATOM   452   O  O     . ALA A 1  86  ? -51.020 -8.559  62.065  1.00 77.78  ? 469  ALA A O     1 
ATOM   453   C  CB    . ALA A 1  86  ? -52.884 -8.773  64.836  1.00 67.09  ? 469  ALA A CB    1 
ATOM   454   N  N     . ILE A 1  87  ? -50.571 -7.070  63.702  1.00 81.57  ? 470  ILE A N     1 
ATOM   455   C  CA    . ILE A 1  87  ? -50.053 -6.040  62.799  1.00 79.74  ? 470  ILE A CA    1 
ATOM   456   C  C     . ILE A 1  87  ? -48.764 -6.511  62.121  1.00 72.19  ? 470  ILE A C     1 
ATOM   457   O  O     . ILE A 1  87  ? -48.629 -6.441  60.892  1.00 70.35  ? 470  ILE A O     1 
ATOM   458   C  CB    . ILE A 1  87  ? -49.861 -4.731  63.580  1.00 73.70  ? 470  ILE A CB    1 
ATOM   459   C  CG1   . ILE A 1  87  ? -51.221 -4.229  64.049  1.00 67.97  ? 470  ILE A CG1   1 
ATOM   460   C  CG2   . ILE A 1  87  ? -49.177 -3.684  62.722  1.00 79.46  ? 470  ILE A CG2   1 
ATOM   461   C  CD1   . ILE A 1  87  ? -51.096 -3.077  64.966  1.00 79.96  ? 470  ILE A CD1   1 
ATOM   462   N  N     . ARG A 1  88  ? -47.791 -6.980  62.912  1.00 71.64  ? 471  ARG A N     1 
ATOM   463   C  CA    . ARG A 1  88  ? -46.554 -7.497  62.342  1.00 60.68  ? 471  ARG A CA    1 
ATOM   464   C  C     . ARG A 1  88  ? -46.842 -8.544  61.283  1.00 67.42  ? 471  ARG A C     1 
ATOM   465   O  O     . ARG A 1  88  ? -46.290 -8.490  60.186  1.00 76.79  ? 471  ARG A O     1 
ATOM   466   C  CB    . ARG A 1  88  ? -45.652 -8.094  63.426  1.00 64.83  ? 471  ARG A CB    1 
ATOM   467   C  CG    . ARG A 1  88  ? -44.211 -8.324  62.969  1.00 61.18  ? 471  ARG A CG    1 
ATOM   468   C  CD    . ARG A 1  88  ? -43.330 -8.961  64.025  1.00 62.55  ? 471  ARG A CD    1 
ATOM   469   N  NE    . ARG A 1  88  ? -43.722 -10.344 64.200  1.00 82.25  ? 471  ARG A NE    1 
ATOM   470   C  CZ    . ARG A 1  88  ? -43.399 -11.316 63.351  1.00 108.96 ? 471  ARG A CZ    1 
ATOM   471   N  NH1   . ARG A 1  88  ? -42.659 -11.045 62.271  1.00 95.50  ? 471  ARG A NH1   1 
ATOM   472   N  NH2   . ARG A 1  88  ? -43.818 -12.566 63.573  1.00 114.13 ? 471  ARG A NH2   1 
ATOM   473   N  N     . VAL A 1  89  ? -47.646 -9.550  61.611  1.00 69.46  ? 472  VAL A N     1 
ATOM   474   C  CA    . VAL A 1  89  ? -47.949 -10.587 60.632  1.00 74.79  ? 472  VAL A CA    1 
ATOM   475   C  C     . VAL A 1  89  ? -48.629 -9.991  59.406  1.00 74.91  ? 472  VAL A C     1 
ATOM   476   O  O     . VAL A 1  89  ? -48.253 -10.272 58.261  1.00 80.76  ? 472  VAL A O     1 
ATOM   477   C  CB    . VAL A 1  89  ? -48.792 -11.706 61.261  1.00 73.75  ? 472  VAL A CB    1 
ATOM   478   C  CG1   . VAL A 1  89  ? -49.287 -12.626 60.165  1.00 69.54  ? 472  VAL A CG1   1 
ATOM   479   C  CG2   . VAL A 1  89  ? -47.944 -12.491 62.270  1.00 76.41  ? 472  VAL A CG2   1 
ATOM   480   N  N     . ASN A 1  90  ? -49.656 -9.187  59.616  1.00 74.75  ? 473  ASN A N     1 
ATOM   481   C  CA    . ASN A 1  90  ? -50.474 -8.813  58.481  1.00 78.68  ? 473  ASN A CA    1 
ATOM   482   C  C     . ASN A 1  90  ? -49.866 -7.701  57.628  1.00 87.83  ? 473  ASN A C     1 
ATOM   483   O  O     . ASN A 1  90  ? -50.418 -7.405  56.564  1.00 93.08  ? 473  ASN A O     1 
ATOM   484   C  CB    . ASN A 1  90  ? -51.863 -8.408  58.971  1.00 87.64  ? 473  ASN A CB    1 
ATOM   485   C  CG    . ASN A 1  90  ? -52.970 -8.923  58.070  1.00 102.92 ? 473  ASN A CG    1 
ATOM   486   O  OD1   . ASN A 1  90  ? -53.524 -8.178  57.256  1.00 112.41 ? 473  ASN A OD1   1 
ATOM   487   N  ND2   . ASN A 1  90  ? -53.303 -10.201 58.213  1.00 99.05  ? 473  ASN A ND2   1 
ATOM   488   N  N     . THR A 1  91  ? -48.760 -7.075  58.043  1.00 87.22  ? 474  THR A N     1 
ATOM   489   C  CA    . THR A 1  91  ? -48.069 -6.108  57.190  1.00 78.54  ? 474  THR A CA    1 
ATOM   490   C  C     . THR A 1  91  ? -46.692 -6.575  56.744  1.00 78.22  ? 474  THR A C     1 
ATOM   491   O  O     . THR A 1  91  ? -45.962 -5.798  56.120  1.00 77.34  ? 474  THR A O     1 
ATOM   492   C  CB    . THR A 1  91  ? -47.962 -4.746  57.880  1.00 78.16  ? 474  THR A CB    1 
ATOM   493   O  OG1   . THR A 1  91  ? -47.178 -4.858  59.071  1.00 72.32  ? 474  THR A OG1   1 
ATOM   494   C  CG2   . THR A 1  91  ? -49.337 -4.238  58.227  1.00 79.98  ? 474  THR A CG2   1 
ATOM   495   N  N     . PHE A 1  92  ? -46.326 -7.825  57.038  1.00 77.77  ? 475  PHE A N     1 
ATOM   496   C  CA    . PHE A 1  92  ? -45.109 -8.454  56.520  1.00 72.96  ? 475  PHE A CA    1 
ATOM   497   C  C     . PHE A 1  92  ? -43.833 -7.816  57.050  1.00 66.12  ? 475  PHE A C     1 
ATOM   498   O  O     . PHE A 1  92  ? -42.802 -7.828  56.389  1.00 72.29  ? 475  PHE A O     1 
ATOM   499   C  CB    . PHE A 1  92  ? -45.114 -8.448  54.997  1.00 76.51  ? 475  PHE A CB    1 
ATOM   500   C  CG    . PHE A 1  92  ? -46.315 -9.102  54.404  1.00 87.02  ? 475  PHE A CG    1 
ATOM   501   C  CD1   . PHE A 1  92  ? -46.354 -10.476 54.242  1.00 82.33  ? 475  PHE A CD1   1 
ATOM   502   C  CD2   . PHE A 1  92  ? -47.429 -8.352  54.046  1.00 95.41  ? 475  PHE A CD2   1 
ATOM   503   C  CE1   . PHE A 1  92  ? -47.460 -11.087 53.691  1.00 81.21  ? 475  PHE A CE1   1 
ATOM   504   C  CE2   . PHE A 1  92  ? -48.544 -8.961  53.508  1.00 98.28  ? 475  PHE A CE2   1 
ATOM   505   C  CZ    . PHE A 1  92  ? -48.557 -10.333 53.328  1.00 86.77  ? 475  PHE A CZ    1 
ATOM   506   N  N     . LEU A 1  93  ? -43.878 -7.253  58.237  1.00 60.92  ? 476  LEU A N     1 
ATOM   507   C  CA    . LEU A 1  93  ? -42.680 -6.693  58.826  1.00 58.40  ? 476  LEU A CA    1 
ATOM   508   C  C     . LEU A 1  93  ? -41.785 -7.804  59.349  1.00 60.94  ? 476  LEU A C     1 
ATOM   509   O  O     . LEU A 1  93  ? -42.258 -8.714  60.028  1.00 69.54  ? 476  LEU A O     1 
ATOM   510   C  CB    . LEU A 1  93  ? -43.056 -5.746  59.958  1.00 61.53  ? 476  LEU A CB    1 
ATOM   511   C  CG    . LEU A 1  93  ? -43.662 -4.419  59.525  1.00 59.68  ? 476  LEU A CG    1 
ATOM   512   C  CD1   . LEU A 1  93  ? -44.287 -3.828  60.739  1.00 69.25  ? 476  LEU A CD1   1 
ATOM   513   C  CD2   . LEU A 1  93  ? -42.636 -3.473  58.946  1.00 64.60  ? 476  LEU A CD2   1 
ATOM   514   N  N     . SER A 1  94  ? -40.499 -7.745  59.020  1.00 64.13  ? 477  SER A N     1 
ATOM   515   C  CA    . SER A 1  94  ? -39.522 -8.619  59.660  1.00 67.86  ? 477  SER A CA    1 
ATOM   516   C  C     . SER A 1  94  ? -39.324 -8.218  61.118  1.00 70.03  ? 477  SER A C     1 
ATOM   517   O  O     . SER A 1  94  ? -39.820 -7.193  61.578  1.00 70.94  ? 477  SER A O     1 
ATOM   518   C  CB    . SER A 1  94  ? -38.173 -8.569  58.945  1.00 76.46  ? 477  SER A CB    1 
ATOM   519   O  OG    . SER A 1  94  ? -37.495 -7.351  59.198  1.00 76.12  ? 477  SER A OG    1 
ATOM   520   N  N     . CYS A 1  95  ? -38.590 -9.050  61.860  1.00 68.04  ? 478  CYS A N     1 
ATOM   521   C  CA    . CYS A 1  95  ? -38.299 -8.706  63.249  1.00 68.82  ? 478  CYS A CA    1 
ATOM   522   C  C     . CYS A 1  95  ? -37.510 -7.418  63.368  1.00 77.25  ? 478  CYS A C     1 
ATOM   523   O  O     . CYS A 1  95  ? -37.783 -6.601  64.251  1.00 72.52  ? 478  CYS A O     1 
ATOM   524   C  CB    . CYS A 1  95  ? -37.549 -9.820  63.947  1.00 69.66  ? 478  CYS A CB    1 
ATOM   525   S  SG    . CYS A 1  95  ? -38.624 -11.172 64.225  1.00 90.83  ? 478  CYS A SG    1 
ATOM   526   N  N     . SER A 1  96  ? -36.509 -7.226  62.511  1.00 85.59  ? 479  SER A N     1 
ATOM   527   C  CA    . SER A 1  96  ? -35.694 -6.016  62.594  1.00 77.47  ? 479  SER A CA    1 
ATOM   528   C  C     . SER A 1  96  ? -36.540 -4.771  62.383  1.00 72.49  ? 479  SER A C     1 
ATOM   529   O  O     . SER A 1  96  ? -36.453 -3.819  63.161  1.00 77.81  ? 479  SER A O     1 
ATOM   530   C  CB    . SER A 1  96  ? -34.551 -6.092  61.579  1.00 81.01  ? 479  SER A CB    1 
ATOM   531   O  OG    . SER A 1  96  ? -33.758 -7.264  61.795  1.00 113.68 ? 479  SER A OG    1 
ATOM   532   N  N     . GLN A 1  97  ? -37.396 -4.784  61.359  1.00 65.25  ? 480  GLN A N     1 
ATOM   533   C  CA    . GLN A 1  97  ? -38.228 -3.624  61.032  1.00 71.39  ? 480  GLN A CA    1 
ATOM   534   C  C     . GLN A 1  97  ? -39.248 -3.338  62.133  1.00 73.76  ? 480  GLN A C     1 
ATOM   535   O  O     . GLN A 1  97  ? -39.466 -2.171  62.520  1.00 74.71  ? 480  GLN A O     1 
ATOM   536   C  CB    . GLN A 1  97  ? -38.923 -3.864  59.688  1.00 73.28  ? 480  GLN A CB    1 
ATOM   537   C  CG    . GLN A 1  97  ? -37.974 -4.250  58.569  1.00 76.49  ? 480  GLN A CG    1 
ATOM   538   C  CD    . GLN A 1  97  ? -36.905 -3.193  58.308  1.00 95.74  ? 480  GLN A CD    1 
ATOM   539   O  OE1   . GLN A 1  97  ? -37.136 -2.001  58.521  1.00 93.99  ? 480  GLN A OE1   1 
ATOM   540   N  NE2   . GLN A 1  97  ? -35.714 -3.631  57.885  1.00 106.73 ? 480  GLN A NE2   1 
ATOM   541   N  N     . TYR A 1  98  ? -39.901 -4.391  62.630  1.00 67.65  ? 481  TYR A N     1 
ATOM   542   C  CA    . TYR A 1  98  ? -40.781 -4.213  63.775  1.00 68.39  ? 481  TYR A CA    1 
ATOM   543   C  C     . TYR A 1  98  ? -40.013 -3.629  64.954  1.00 69.82  ? 481  TYR A C     1 
ATOM   544   O  O     . TYR A 1  98  ? -40.507 -2.724  65.627  1.00 72.35  ? 481  TYR A O     1 
ATOM   545   C  CB    . TYR A 1  98  ? -41.456 -5.527  64.185  1.00 72.42  ? 481  TYR A CB    1 
ATOM   546   C  CG    . TYR A 1  98  ? -42.339 -5.334  65.408  1.00 59.10  ? 481  TYR A CG    1 
ATOM   547   C  CD1   . TYR A 1  98  ? -43.649 -4.911  65.279  1.00 56.00  ? 481  TYR A CD1   1 
ATOM   548   C  CD2   . TYR A 1  98  ? -41.839 -5.514  66.686  1.00 59.76  ? 481  TYR A CD2   1 
ATOM   549   C  CE1   . TYR A 1  98  ? -44.433 -4.705  66.380  1.00 63.13  ? 481  TYR A CE1   1 
ATOM   550   C  CE2   . TYR A 1  98  ? -42.618 -5.297  67.791  1.00 64.29  ? 481  TYR A CE2   1 
ATOM   551   C  CZ    . TYR A 1  98  ? -43.915 -4.894  67.635  1.00 61.49  ? 481  TYR A CZ    1 
ATOM   552   O  OH    . TYR A 1  98  ? -44.697 -4.683  68.745  1.00 65.06  ? 481  TYR A OH    1 
ATOM   553   N  N     . HIS A 1  99  ? -38.804 -4.129  65.221  1.00 63.66  ? 482  HIS A N     1 
ATOM   554   C  CA    . HIS A 1  99  ? -38.051 -3.637  66.363  1.00 65.42  ? 482  HIS A CA    1 
ATOM   555   C  C     . HIS A 1  99  ? -37.734 -2.161  66.231  1.00 69.18  ? 482  HIS A C     1 
ATOM   556   O  O     . HIS A 1  99  ? -37.810 -1.416  67.212  1.00 78.55  ? 482  HIS A O     1 
ATOM   557   C  CB    . HIS A 1  99  ? -36.739 -4.378  66.504  1.00 61.89  ? 482  HIS A CB    1 
ATOM   558   C  CG    . HIS A 1  99  ? -35.872 -3.802  67.568  1.00 65.80  ? 482  HIS A CG    1 
ATOM   559   N  ND1   . HIS A 1  99  ? -36.195 -3.882  68.904  1.00 68.76  ? 482  HIS A ND1   1 
ATOM   560   C  CD2   . HIS A 1  99  ? -34.746 -3.053  67.495  1.00 67.61  ? 482  HIS A CD2   1 
ATOM   561   C  CE1   . HIS A 1  99  ? -35.270 -3.261  69.613  1.00 80.26  ? 482  HIS A CE1   1 
ATOM   562   N  NE2   . HIS A 1  99  ? -34.379 -2.747  68.782  1.00 71.70  ? 482  HIS A NE2   1 
ATOM   563   N  N     . LYS A 1  100 ? -37.353 -1.721  65.030  1.00 77.21  ? 483  LYS A N     1 
ATOM   564   C  CA    . LYS A 1  100 ? -37.087 -0.299  64.811  1.00 73.99  ? 483  LYS A CA    1 
ATOM   565   C  C     . LYS A 1  100 ? -38.319 0.538   65.102  1.00 77.33  ? 483  LYS A C     1 
ATOM   566   O  O     . LYS A 1  100 ? -38.234 1.575   65.773  1.00 72.02  ? 483  LYS A O     1 
ATOM   567   C  CB    . LYS A 1  100 ? -36.603 -0.046  63.385  1.00 67.73  ? 483  LYS A CB    1 
ATOM   568   C  CG    . LYS A 1  100 ? -35.154 -0.370  63.180  1.00 86.26  ? 483  LYS A CG    1 
ATOM   569   C  CD    . LYS A 1  100 ? -34.826 -0.692  61.734  1.00 83.44  ? 483  LYS A CD    1 
ATOM   570   C  CE    . LYS A 1  100 ? -35.231 0.418   60.780  1.00 90.86  ? 483  LYS A CE    1 
ATOM   571   N  NZ    . LYS A 1  100 ? -34.920 0.036   59.377  1.00 95.35  ? 483  LYS A NZ    1 
ATOM   572   N  N     . MET A 1  101 ? -39.481 0.104   64.594  1.00 80.29  ? 484  MET A N     1 
ATOM   573   C  CA    . MET A 1  101 ? -40.704 0.868   64.832  1.00 68.08  ? 484  MET A CA    1 
ATOM   574   C  C     . MET A 1  101 ? -41.067 0.882   66.311  1.00 68.90  ? 484  MET A C     1 
ATOM   575   O  O     . MET A 1  101 ? -41.476 1.915   66.854  1.00 71.51  ? 484  MET A O     1 
ATOM   576   C  CB    . MET A 1  101 ? -41.844 0.284   64.017  1.00 66.41  ? 484  MET A CB    1 
ATOM   577   C  CG    . MET A 1  101 ? -43.115 1.095   64.065  1.00 73.38  ? 484  MET A CG    1 
ATOM   578   S  SD    . MET A 1  101 ? -44.494 0.231   63.291  1.00 90.90  ? 484  MET A SD    1 
ATOM   579   C  CE    . MET A 1  101 ? -44.753 -1.106  64.471  1.00 73.21  ? 484  MET A CE    1 
ATOM   580   N  N     . TYR A 1  102 ? -40.957 -0.269  66.968  1.00 73.50  ? 485  TYR A N     1 
ATOM   581   C  CA    . TYR A 1  102 ? -41.240 -0.343  68.394  1.00 75.64  ? 485  TYR A CA    1 
ATOM   582   C  C     . TYR A 1  102 ? -40.363 0.617   69.171  1.00 74.17  ? 485  TYR A C     1 
ATOM   583   O  O     . TYR A 1  102 ? -40.866 1.499   69.875  1.00 78.32  ? 485  TYR A O     1 
ATOM   584   C  CB    . TYR A 1  102 ? -41.029 -1.768  68.906  1.00 73.67  ? 485  TYR A CB    1 
ATOM   585   C  CG    . TYR A 1  102 ? -40.707 -1.847  70.382  1.00 71.79  ? 485  TYR A CG    1 
ATOM   586   C  CD1   . TYR A 1  102 ? -39.391 -1.971  70.833  1.00 73.88  ? 485  TYR A CD1   1 
ATOM   587   C  CD2   . TYR A 1  102 ? -41.717 -1.830  71.322  1.00 71.09  ? 485  TYR A CD2   1 
ATOM   588   C  CE1   . TYR A 1  102 ? -39.102 -2.056  72.182  1.00 74.72  ? 485  TYR A CE1   1 
ATOM   589   C  CE2   . TYR A 1  102 ? -41.440 -1.921  72.665  1.00 76.24  ? 485  TYR A CE2   1 
ATOM   590   C  CZ    . TYR A 1  102 ? -40.137 -2.034  73.099  1.00 75.76  ? 485  TYR A CZ    1 
ATOM   591   O  OH    . TYR A 1  102 ? -39.895 -2.124  74.455  1.00 72.38  ? 485  TYR A OH    1 
ATOM   592   N  N     . ARG A 1  103 ? -39.046 0.486   69.018  1.00 73.94  ? 486  ARG A N     1 
ATOM   593   C  CA    . ARG A 1  103 ? -38.148 1.280   69.836  1.00 73.45  ? 486  ARG A CA    1 
ATOM   594   C  C     . ARG A 1  103 ? -38.336 2.756   69.532  1.00 79.63  ? 486  ARG A C     1 
ATOM   595   O  O     . ARG A 1  103 ? -38.279 3.593   70.440  1.00 78.78  ? 486  ARG A O     1 
ATOM   596   C  CB    . ARG A 1  103 ? -36.703 0.825   69.631  1.00 72.45  ? 486  ARG A CB    1 
ATOM   597   C  CG    . ARG A 1  103 ? -35.738 1.927   69.208  1.00 88.62  ? 486  ARG A CG    1 
ATOM   598   C  CD    . ARG A 1  103 ? -34.971 1.565   67.931  1.00 92.01  ? 486  ARG A CD    1 
ATOM   599   N  NE    . ARG A 1  103 ? -34.019 0.468   68.124  1.00 107.67 ? 486  ARG A NE    1 
ATOM   600   C  CZ    . ARG A 1  103 ? -32.931 0.258   67.374  1.00 113.20 ? 486  ARG A CZ    1 
ATOM   601   N  NH1   . ARG A 1  103 ? -32.636 1.075   66.356  1.00 102.35 ? 486  ARG A NH1   1 
ATOM   602   N  NH2   . ARG A 1  103 ? -32.141 -0.788  67.633  1.00 104.57 ? 486  ARG A NH2   1 
ATOM   603   N  N     . THR A 1  104 ? -38.650 3.096   68.278  1.00 81.96  ? 487  THR A N     1 
ATOM   604   C  CA    . THR A 1  104 ? -38.846 4.503   67.959  1.00 72.21  ? 487  THR A CA    1 
ATOM   605   C  C     . THR A 1  104 ? -40.095 5.045   68.633  1.00 65.06  ? 487  THR A C     1 
ATOM   606   O  O     . THR A 1  104 ? -40.028 6.061   69.327  1.00 71.87  ? 487  THR A O     1 
ATOM   607   C  CB    . THR A 1  104 ? -38.922 4.700   66.440  1.00 78.95  ? 487  THR A CB    1 
ATOM   608   O  OG1   . THR A 1  104 ? -37.607 4.628   65.866  1.00 77.96  ? 487  THR A OG1   1 
ATOM   609   C  CG2   . THR A 1  104 ? -39.561 6.025   66.092  1.00 66.52  ? 487  THR A CG2   1 
ATOM   610   N  N     . VAL A 1  105 ? -41.234 4.362   68.491  1.00 67.17  ? 488  VAL A N     1 
ATOM   611   C  CA    . VAL A 1  105 ? -42.445 4.891   69.111  1.00 68.83  ? 488  VAL A CA    1 
ATOM   612   C  C     . VAL A 1  105 ? -42.273 4.964   70.621  1.00 74.12  ? 488  VAL A C     1 
ATOM   613   O  O     . VAL A 1  105 ? -42.706 5.931   71.258  1.00 80.80  ? 488  VAL A O     1 
ATOM   614   C  CB    . VAL A 1  105 ? -43.691 4.086   68.699  1.00 70.06  ? 488  VAL A CB    1 
ATOM   615   C  CG1   . VAL A 1  105 ? -44.837 4.395   69.612  1.00 71.42  ? 488  VAL A CG1   1 
ATOM   616   C  CG2   . VAL A 1  105 ? -44.112 4.484   67.312  1.00 64.41  ? 488  VAL A CG2   1 
ATOM   617   N  N     . LYS A 1  106 ? -41.625 3.964   71.221  1.00 80.31  ? 489  LYS A N     1 
ATOM   618   C  CA    . LYS A 1  106 ? -41.433 3.999   72.669  1.00 78.90  ? 489  LYS A CA    1 
ATOM   619   C  C     . LYS A 1  106 ? -40.528 5.147   73.088  1.00 81.27  ? 489  LYS A C     1 
ATOM   620   O  O     . LYS A 1  106 ? -40.735 5.745   74.149  1.00 86.97  ? 489  LYS A O     1 
ATOM   621   C  CB    . LYS A 1  106 ? -40.848 2.691   73.179  1.00 83.74  ? 489  LYS A CB    1 
ATOM   622   C  CG    . LYS A 1  106 ? -40.672 2.632   74.701  1.00 80.38  ? 489  LYS A CG    1 
ATOM   623   C  CD    . LYS A 1  106 ? -40.027 1.298   75.089  1.00 80.61  ? 489  LYS A CD    1 
ATOM   624   C  CE    . LYS A 1  106 ? -39.684 1.178   76.570  1.00 84.59  ? 489  LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1  106 ? -39.100 -0.171  76.896  1.00 87.30  ? 489  LYS A NZ    1 
ATOM   626   N  N     . ALA A 1  107 ? -39.487 5.439   72.302  1.00 79.95  ? 490  ALA A N     1 
ATOM   627   C  CA    . ALA A 1  107 ? -38.564 6.508   72.678  1.00 85.54  ? 490  ALA A CA    1 
ATOM   628   C  C     . ALA A 1  107 ? -39.195 7.886   72.515  1.00 81.41  ? 490  ALA A C     1 
ATOM   629   O  O     . ALA A 1  107 ? -38.961 8.784   73.331  1.00 95.25  ? 490  ALA A O     1 
ATOM   630   C  CB    . ALA A 1  107 ? -37.290 6.413   71.839  1.00 83.06  ? 490  ALA A CB    1 
ATOM   631   N  N     . ILE A 1  108 ? -40.012 8.070   71.486  1.00 79.87  ? 491  ILE A N     1 
ATOM   632   C  CA    . ILE A 1  108 ? -40.544 9.398   71.199  1.00 67.63  ? 491  ILE A CA    1 
ATOM   633   C  C     . ILE A 1  108 ? -41.814 9.664   71.981  1.00 83.56  ? 491  ILE A C     1 
ATOM   634   O  O     . ILE A 1  108 ? -42.070 10.793  72.395  1.00 108.93 ? 491  ILE A O     1 
ATOM   635   C  CB    . ILE A 1  108 ? -40.757 9.555   69.687  1.00 67.54  ? 491  ILE A CB    1 
ATOM   636   C  CG1   . ILE A 1  108 ? -39.439 9.911   69.029  1.00 62.11  ? 491  ILE A CG1   1 
ATOM   637   C  CG2   . ILE A 1  108 ? -41.779 10.624  69.378  1.00 67.17  ? 491  ILE A CG2   1 
ATOM   638   C  CD1   . ILE A 1  108 ? -39.563 10.107  67.560  1.00 72.46  ? 491  ILE A CD1   1 
ATOM   639   N  N     . THR A 1  109 ? -42.646 8.674   72.229  1.00 81.63  ? 492  THR A N     1 
ATOM   640   C  CA    . THR A 1  109 ? -43.797 8.994   73.052  1.00 85.30  ? 492  THR A CA    1 
ATOM   641   C  C     . THR A 1  109 ? -43.559 8.715   74.521  1.00 87.02  ? 492  THR A C     1 
ATOM   642   O  O     . THR A 1  109 ? -44.436 9.008   75.336  1.00 97.96  ? 492  THR A O     1 
ATOM   643   C  CB    . THR A 1  109 ? -45.030 8.238   72.579  1.00 92.99  ? 492  THR A CB    1 
ATOM   644   O  OG1   . THR A 1  109 ? -44.846 6.842   72.831  1.00 88.99  ? 492  THR A OG1   1 
ATOM   645   C  CG2   . THR A 1  109 ? -45.269 8.490   71.100  1.00 88.62  ? 492  THR A CG2   1 
ATOM   646   N  N     . GLY A 1  110 ? -42.405 8.156   74.879  1.00 83.28  ? 493  GLY A N     1 
ATOM   647   C  CA    . GLY A 1  110 ? -42.158 7.744   76.241  1.00 84.54  ? 493  GLY A CA    1 
ATOM   648   C  C     . GLY A 1  110 ? -43.008 6.590   76.710  1.00 85.91  ? 493  GLY A C     1 
ATOM   649   O  O     . GLY A 1  110 ? -42.683 5.989   77.739  1.00 90.18  ? 493  GLY A O     1 
ATOM   650   N  N     . ARG A 1  111 ? -44.068 6.243   75.982  1.00 88.11  ? 494  ARG A N     1 
ATOM   651   C  CA    . ARG A 1  111 ? -44.999 5.189   76.352  1.00 93.64  ? 494  ARG A CA    1 
ATOM   652   C  C     . ARG A 1  111 ? -44.758 3.955   75.490  1.00 94.08  ? 494  ARG A C     1 
ATOM   653   O  O     . ARG A 1  111 ? -44.319 4.057   74.341  1.00 86.45  ? 494  ARG A O     1 
ATOM   654   C  CB    . ARG A 1  111 ? -46.444 5.664   76.191  1.00 91.48  ? 494  ARG A CB    1 
ATOM   655   C  CG    . ARG A 1  111 ? -46.634 7.109   76.554  1.00 105.42 ? 494  ARG A CG    1 
ATOM   656   C  CD    . ARG A 1  111 ? -48.097 7.471   76.736  1.00 132.03 ? 494  ARG A CD    1 
ATOM   657   N  NE    . ARG A 1  111 ? -48.314 8.054   78.058  1.00 145.38 ? 494  ARG A NE    1 
ATOM   658   C  CZ    . ARG A 1  111 ? -47.965 9.292   78.393  1.00 144.84 ? 494  ARG A CZ    1 
ATOM   659   N  NH1   . ARG A 1  111 ? -47.388 10.085  77.499  1.00 136.47 ? 494  ARG A NH1   1 
ATOM   660   N  NH2   . ARG A 1  111 ? -48.191 9.735   79.623  1.00 146.93 ? 494  ARG A NH2   1 
ATOM   661   N  N     . GLN A 1  112 ? -45.052 2.781   76.048  1.00 88.29  ? 495  GLN A N     1 
ATOM   662   C  CA    . GLN A 1  112 ? -44.769 1.531   75.347  1.00 79.51  ? 495  GLN A CA    1 
ATOM   663   C  C     . GLN A 1  112 ? -46.036 1.042   74.638  1.00 82.59  ? 495  GLN A C     1 
ATOM   664   O  O     . GLN A 1  112 ? -46.688 0.077   75.043  1.00 84.60  ? 495  GLN A O     1 
ATOM   665   C  CB    . GLN A 1  112 ? -44.210 0.502   76.322  1.00 68.85  ? 495  GLN A CB    1 
ATOM   666   C  CG    . GLN A 1  112 ? -43.826 -0.841  75.728  1.00 69.71  ? 495  GLN A CG    1 
ATOM   667   C  CD    . GLN A 1  112 ? -42.963 -1.675  76.682  1.00 82.32  ? 495  GLN A CD    1 
ATOM   668   O  OE1   . GLN A 1  112 ? -41.867 -1.272  77.072  1.00 89.02  ? 495  GLN A OE1   1 
ATOM   669   N  NE2   . GLN A 1  112 ? -43.492 -2.818  77.106  1.00 84.73  ? 495  GLN A NE2   1 
ATOM   670   N  N     . ILE A 1  113 ? -46.372 1.737   73.541  1.00 76.30  ? 496  ILE A N     1 
ATOM   671   C  CA    . ILE A 1  113 ? -47.558 1.393   72.756  1.00 80.58  ? 496  ILE A CA    1 
ATOM   672   C  C     . ILE A 1  113 ? -47.403 0.011   72.120  1.00 91.88  ? 496  ILE A C     1 
ATOM   673   O  O     . ILE A 1  113 ? -48.259 -0.866  72.296  1.00 99.36  ? 496  ILE A O     1 
ATOM   674   C  CB    . ILE A 1  113 ? -47.836 2.466   71.685  1.00 80.00  ? 496  ILE A CB    1 
ATOM   675   C  CG1   . ILE A 1  113 ? -48.178 3.800   72.324  1.00 90.93  ? 496  ILE A CG1   1 
ATOM   676   C  CG2   . ILE A 1  113 ? -48.954 2.041   70.738  1.00 87.80  ? 496  ILE A CG2   1 
ATOM   677   C  CD1   . ILE A 1  113 ? -46.990 4.645   72.528  1.00 93.86  ? 496  ILE A CD1   1 
ATOM   678   N  N     . PHE A 1  114 ? -46.309 -0.219  71.390  1.00 75.17  ? 497  PHE A N     1 
ATOM   679   C  CA    . PHE A 1  114 ? -46.053 -1.557  70.873  1.00 78.58  ? 497  PHE A CA    1 
ATOM   680   C  C     . PHE A 1  114 ? -45.253 -2.381  71.877  1.00 82.10  ? 497  PHE A C     1 
ATOM   681   O  O     . PHE A 1  114 ? -44.476 -1.841  72.669  1.00 84.74  ? 497  PHE A O     1 
ATOM   682   C  CB    . PHE A 1  114 ? -45.303 -1.518  69.543  1.00 73.94  ? 497  PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  114 ? -46.112 -0.988  68.404  1.00 74.52  ? 497  PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  114 ? -46.978 -1.816  67.716  1.00 80.26  ? 497  PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  114 ? -45.954 0.309   67.969  1.00 78.56  ? 497  PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  114 ? -47.719 -1.334  66.652  1.00 83.27  ? 497  PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  114 ? -46.685 0.794   66.901  1.00 81.09  ? 497  PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  114 ? -47.568 -0.025  66.245  1.00 80.65  ? 497  PHE A CZ    1 
ATOM   689   N  N     . GLN A 1  115 ? -45.457 -3.706  71.844  1.00 73.23  ? 498  GLN A N     1 
ATOM   690   C  CA    . GLN A 1  115 ? -44.733 -4.561  72.770  1.00 70.81  ? 498  GLN A CA    1 
ATOM   691   C  C     . GLN A 1  115 ? -43.438 -5.049  72.142  1.00 65.96  ? 498  GLN A C     1 
ATOM   692   O  O     . GLN A 1  115 ? -43.266 -4.993  70.924  1.00 72.43  ? 498  GLN A O     1 
ATOM   693   C  CB    . GLN A 1  115 ? -45.613 -5.734  73.202  1.00 78.51  ? 498  GLN A CB    1 
ATOM   694   C  CG    . GLN A 1  115 ? -46.886 -5.307  73.960  1.00 92.54  ? 498  GLN A CG    1 
ATOM   695   C  CD    . GLN A 1  115 ? -46.642 -4.240  75.025  1.00 92.83  ? 498  GLN A CD    1 
ATOM   696   O  OE1   . GLN A 1  115 ? -45.899 -4.463  75.989  1.00 94.89  ? 498  GLN A OE1   1 
ATOM   697   N  NE2   . GLN A 1  115 ? -47.232 -3.063  74.828  1.00 82.28  ? 498  GLN A NE2   1 
ATOM   698   N  N     . PRO A 1  116 ? -42.475 -5.458  72.957  1.00 61.28  ? 499  PRO A N     1 
ATOM   699   C  CA    . PRO A 1  116 ? -41.194 -5.935  72.417  1.00 69.05  ? 499  PRO A CA    1 
ATOM   700   C  C     . PRO A 1  116 ? -41.325 -7.291  71.725  1.00 72.62  ? 499  PRO A C     1 
ATOM   701   O  O     . PRO A 1  116 ? -42.353 -7.966  71.770  1.00 75.73  ? 499  PRO A O     1 
ATOM   702   C  CB    . PRO A 1  116 ? -40.296 -6.012  73.653  1.00 69.64  ? 499  PRO A CB    1 
ATOM   703   C  CG    . PRO A 1  116 ? -41.230 -5.974  74.820  1.00 80.86  ? 499  PRO A CG    1 
ATOM   704   C  CD    . PRO A 1  116 ? -42.425 -5.219  74.405  1.00 67.42  ? 499  PRO A CD    1 
ATOM   705   N  N     . LEU A 1  117 ? -40.243 -7.693  71.062  1.00 75.95  ? 500  LEU A N     1 
ATOM   706   C  CA    . LEU A 1  117 ? -40.305 -8.868  70.194  1.00 77.34  ? 500  LEU A CA    1 
ATOM   707   C  C     . LEU A 1  117 ? -40.534 -10.154 70.969  1.00 78.85  ? 500  LEU A C     1 
ATOM   708   O  O     . LEU A 1  117 ? -41.144 -11.096 70.444  1.00 89.72  ? 500  LEU A O     1 
ATOM   709   C  CB    . LEU A 1  117 ? -39.034 -8.990  69.370  1.00 77.52  ? 500  LEU A CB    1 
ATOM   710   C  CG    . LEU A 1  117 ? -38.950 -8.060  68.177  1.00 69.33  ? 500  LEU A CG    1 
ATOM   711   C  CD1   . LEU A 1  117 ? -37.545 -8.195  67.697  1.00 78.88  ? 500  LEU A CD1   1 
ATOM   712   C  CD2   . LEU A 1  117 ? -39.940 -8.487  67.102  1.00 72.44  ? 500  LEU A CD2   1 
ATOM   713   N  N     . HIS A 1  118 ? -39.986 -10.258 72.179  1.00 78.99  ? 501  HIS A N     1 
ATOM   714   C  CA    . HIS A 1  118 ? -40.172 -11.500 72.919  1.00 84.16  ? 501  HIS A CA    1 
ATOM   715   C  C     . HIS A 1  118 ? -41.634 -11.690 73.298  1.00 80.08  ? 501  HIS A C     1 
ATOM   716   O  O     . HIS A 1  118 ? -42.138 -12.825 73.323  1.00 98.62  ? 501  HIS A O     1 
ATOM   717   C  CB    . HIS A 1  118 ? -39.300 -11.519 74.174  1.00 94.06  ? 501  HIS A CB    1 
ATOM   718   C  CG    . HIS A 1  118 ? -39.877 -10.733 75.311  1.00 106.62 ? 501  HIS A CG    1 
ATOM   719   N  ND1   . HIS A 1  118 ? -39.640 -9.385  75.485  1.00 104.19 ? 501  HIS A ND1   1 
ATOM   720   C  CD2   . HIS A 1  118 ? -40.702 -11.106 76.321  1.00 98.94  ? 501  HIS A CD2   1 
ATOM   721   C  CE1   . HIS A 1  118 ? -40.287 -8.963  76.559  1.00 98.33  ? 501  HIS A CE1   1 
ATOM   722   N  NE2   . HIS A 1  118 ? -40.940 -9.986  77.083  1.00 102.40 ? 501  HIS A NE2   1 
ATOM   723   N  N     . ALA A 1  119 ? -42.337 -10.589 73.558  1.00 69.31  ? 502  ALA A N     1 
ATOM   724   C  CA    . ALA A 1  119 ? -43.750 -10.691 73.872  1.00 75.36  ? 502  ALA A CA    1 
ATOM   725   C  C     . ALA A 1  119 ? -44.521 -11.217 72.685  1.00 73.24  ? 502  ALA A C     1 
ATOM   726   O  O     . ALA A 1  119 ? -45.437 -12.029 72.841  1.00 85.05  ? 502  ALA A O     1 
ATOM   727   C  CB    . ALA A 1  119 ? -44.295 -9.335  74.298  1.00 86.99  ? 502  ALA A CB    1 
ATOM   728   N  N     . LEU A 1  120 ? -44.152 -10.785 71.488  1.00 68.63  ? 503  LEU A N     1 
ATOM   729   C  CA    . LEU A 1  120 ? -44.834 -11.288 70.303  1.00 74.77  ? 503  LEU A CA    1 
ATOM   730   C  C     . LEU A 1  120 ? -44.534 -12.763 70.047  1.00 85.76  ? 503  LEU A C     1 
ATOM   731   O  O     . LEU A 1  120 ? -45.423 -13.499 69.610  1.00 89.68  ? 503  LEU A O     1 
ATOM   732   C  CB    . LEU A 1  120 ? -44.478 -10.463 69.078  1.00 73.78  ? 503  LEU A CB    1 
ATOM   733   C  CG    . LEU A 1  120 ? -45.332 -9.216  68.970  1.00 69.68  ? 503  LEU A CG    1 
ATOM   734   C  CD1   . LEU A 1  120 ? -44.966 -8.253  70.051  1.00 68.48  ? 503  LEU A CD1   1 
ATOM   735   C  CD2   . LEU A 1  120 ? -45.145 -8.592  67.639  1.00 75.41  ? 503  LEU A CD2   1 
ATOM   736   N  N     . ARG A 1  121 ? -43.283 -13.203 70.248  1.00 80.09  ? 504  ARG A N     1 
ATOM   737   C  CA    . ARG A 1  121 ? -42.966 -14.626 70.118  1.00 78.40  ? 504  ARG A CA    1 
ATOM   738   C  C     . ARG A 1  121 ? -43.848 -15.455 71.044  1.00 86.80  ? 504  ARG A C     1 
ATOM   739   O  O     . ARG A 1  121 ? -44.450 -16.473 70.643  1.00 100.64 ? 504  ARG A O     1 
ATOM   740   C  CB    . ARG A 1  121 ? -41.485 -14.852 70.448  1.00 76.86  ? 504  ARG A CB    1 
ATOM   741   C  CG    . ARG A 1  121 ? -40.847 -16.192 70.000  1.00 90.72  ? 504  ARG A CG    1 
ATOM   742   C  CD    . ARG A 1  121 ? -39.440 -15.916 69.340  1.00 116.23 ? 504  ARG A CD    1 
ATOM   743   N  NE    . ARG A 1  121 ? -38.704 -14.750 69.884  1.00 124.03 ? 504  ARG A NE    1 
ATOM   744   C  CZ    . ARG A 1  121 ? -38.358 -13.657 69.188  1.00 107.00 ? 504  ARG A CZ    1 
ATOM   745   N  NH1   . ARG A 1  121 ? -38.671 -13.542 67.899  1.00 97.09  ? 504  ARG A NH1   1 
ATOM   746   N  NH2   . ARG A 1  121 ? -37.691 -12.670 69.779  1.00 97.55  ? 504  ARG A NH2   1 
ATOM   747   N  N     . ASN A 1  122 ? -43.936 -15.023 72.305  1.00 87.76  ? 505  ASN A N     1 
ATOM   748   C  CA    . ASN A 1  122 ? -44.759 -15.749 73.264  1.00 85.43  ? 505  ASN A CA    1 
ATOM   749   C  C     . ASN A 1  122 ? -46.220 -15.781 72.830  1.00 77.17  ? 505  ASN A C     1 
ATOM   750   O  O     . ASN A 1  122 ? -46.883 -16.822 72.929  1.00 83.34  ? 505  ASN A O     1 
ATOM   751   C  CB    . ASN A 1  122 ? -44.610 -15.108 74.634  1.00 84.66  ? 505  ASN A CB    1 
ATOM   752   C  CG    . ASN A 1  122 ? -44.826 -16.086 75.770  1.00 117.90 ? 505  ASN A CG    1 
ATOM   753   O  OD1   . ASN A 1  122 ? -45.873 -16.071 76.423  1.00 124.62 ? 505  ASN A OD1   1 
ATOM   754   N  ND2   . ASN A 1  122 ? -43.825 -16.930 76.031  1.00 119.35 ? 505  ASN A ND2   1 
ATOM   755   N  N     . ALA A 1  123 ? -46.730 -14.662 72.314  1.00 75.69  ? 506  ALA A N     1 
ATOM   756   C  CA    . ALA A 1  123 ? -48.096 -14.664 71.808  1.00 70.80  ? 506  ALA A CA    1 
ATOM   757   C  C     . ALA A 1  123 ? -48.226 -15.539 70.582  1.00 71.46  ? 506  ALA A C     1 
ATOM   758   O  O     . ALA A 1  123 ? -49.317 -16.031 70.292  1.00 83.22  ? 506  ALA A O     1 
ATOM   759   C  CB    . ALA A 1  123 ? -48.576 -13.253 71.484  1.00 77.23  ? 506  ALA A CB    1 
ATOM   760   N  N     . GLU A 1  124 ? -47.151 -15.708 69.823  1.00 79.41  ? 507  GLU A N     1 
ATOM   761   C  CA    . GLU A 1  124 ? -47.218 -16.656 68.724  1.00 78.85  ? 507  GLU A CA    1 
ATOM   762   C  C     . GLU A 1  124 ? -47.499 -18.041 69.264  1.00 81.09  ? 507  GLU A C     1 
ATOM   763   O  O     . GLU A 1  124 ? -48.353 -18.753 68.727  1.00 88.17  ? 507  GLU A O     1 
ATOM   764   C  CB    . GLU A 1  124 ? -45.918 -16.675 67.917  1.00 89.84  ? 507  GLU A CB    1 
ATOM   765   C  CG    . GLU A 1  124 ? -45.738 -15.585 66.866  1.00 96.43  ? 507  GLU A CG    1 
ATOM   766   C  CD    . GLU A 1  124 ? -44.298 -15.508 66.380  1.00 100.27 ? 507  GLU A CD    1 
ATOM   767   O  OE1   . GLU A 1  124 ? -43.490 -16.385 66.764  1.00 105.36 ? 507  GLU A OE1   1 
ATOM   768   O  OE2   . GLU A 1  124 ? -43.961 -14.546 65.657  1.00 97.80  ? 507  GLU A OE2   1 
ATOM   769   N  N     . LYS A 1  125 ? -46.843 -18.410 70.374  1.00 83.52  ? 508  LYS A N     1 
ATOM   770   C  CA    . LYS A 1  125 ? -46.967 -19.798 70.842  1.00 87.08  ? 508  LYS A CA    1 
ATOM   771   C  C     . LYS A 1  125 ? -48.421 -20.232 71.019  1.00 78.49  ? 508  LYS A C     1 
ATOM   772   O  O     . LYS A 1  125 ? -48.771 -21.379 70.715  1.00 87.44  ? 508  LYS A O     1 
ATOM   773   C  CB    . LYS A 1  125 ? -46.211 -20.024 72.138  1.00 86.29  ? 508  LYS A CB    1 
ATOM   774   C  CG    . LYS A 1  125 ? -44.761 -19.806 72.028  1.00 81.41  ? 508  LYS A CG    1 
ATOM   775   C  CD    . LYS A 1  125 ? -44.157 -20.114 73.348  1.00 99.43  ? 508  LYS A CD    1 
ATOM   776   C  CE    . LYS A 1  125 ? -42.684 -19.877 73.302  1.00 114.62 ? 508  LYS A CE    1 
ATOM   777   N  NZ    . LYS A 1  125 ? -42.097 -19.882 74.661  1.00 127.18 ? 508  LYS A NZ    1 
ATOM   778   N  N     . VAL A 1  126 ? -49.280 -19.333 71.498  1.00 67.51  ? 509  VAL A N     1 
ATOM   779   C  CA    . VAL A 1  126 ? -50.682 -19.678 71.705  1.00 79.34  ? 509  VAL A CA    1 
ATOM   780   C  C     . VAL A 1  126 ? -51.382 -20.011 70.391  1.00 81.12  ? 509  VAL A C     1 
ATOM   781   O  O     . VAL A 1  126 ? -52.188 -20.951 70.314  1.00 77.35  ? 509  VAL A O     1 
ATOM   782   C  CB    . VAL A 1  126 ? -51.385 -18.518 72.425  1.00 76.25  ? 509  VAL A CB    1 
ATOM   783   C  CG1   . VAL A 1  126 ? -52.860 -18.869 72.731  1.00 87.17  ? 509  VAL A CG1   1 
ATOM   784   C  CG2   . VAL A 1  126 ? -50.613 -18.155 73.678  1.00 80.25  ? 509  VAL A CG2   1 
ATOM   785   N  N     . LEU A 1  127 ? -51.076 -19.268 69.336  1.00 72.98  ? 510  LEU A N     1 
ATOM   786   C  CA    . LEU A 1  127 ? -51.850 -19.353 68.104  1.00 77.10  ? 510  LEU A CA    1 
ATOM   787   C  C     . LEU A 1  127 ? -51.401 -20.459 67.168  1.00 77.48  ? 510  LEU A C     1 
ATOM   788   O  O     . LEU A 1  127 ? -52.099 -20.721 66.181  1.00 80.84  ? 510  LEU A O     1 
ATOM   789   C  CB    . LEU A 1  127 ? -51.765 -18.028 67.365  1.00 69.66  ? 510  LEU A CB    1 
ATOM   790   C  CG    . LEU A 1  127 ? -52.171 -16.965 68.359  1.00 66.06  ? 510  LEU A CG    1 
ATOM   791   C  CD1   . LEU A 1  127 ? -51.630 -15.641 67.949  1.00 74.22  ? 510  LEU A CD1   1 
ATOM   792   C  CD2   . LEU A 1  127 ? -53.676 -16.937 68.337  1.00 67.91  ? 510  LEU A CD2   1 
ATOM   793   N  N     . LEU A 1  128 ? -50.221 -21.127 67.458  1.00 82.04  ? 511  LEU A N     1 
ATOM   794   C  CA    . LEU A 1  128 ? -49.554 -22.186 66.714  1.00 75.66  ? 511  LEU A CA    1 
ATOM   795   C  C     . LEU A 1  128 ? -49.975 -23.563 67.197  1.00 72.70  ? 511  LEU A C     1 
ATOM   796   O  O     . LEU A 1  128 ? -50.340 -23.727 68.360  1.00 78.85  ? 511  LEU A O     1 
ATOM   797   C  CB    . LEU A 1  128 ? -48.049 -22.063 66.857  1.00 74.11  ? 511  LEU A CB    1 
ATOM   798   C  CG    . LEU A 1  128 ? -47.551 -20.872 66.086  1.00 69.35  ? 511  LEU A CG    1 
ATOM   799   C  CD1   . LEU A 1  128 ? -46.092 -20.732 66.352  1.00 73.91  ? 511  LEU A CD1   1 
ATOM   800   C  CD2   . LEU A 1  128 ? -47.838 -21.158 64.635  1.00 70.46  ? 511  LEU A CD2   1 
ATOM   801   N  N     . PRO A 1  129 ? -49.925 -24.570 66.324  1.00 74.39  ? 512  PRO A N     1 
ATOM   802   C  CA    . PRO A 1  129 ? -50.200 -25.928 66.778  1.00 70.59  ? 512  PRO A CA    1 
ATOM   803   C  C     . PRO A 1  129 ? -49.236 -26.327 67.881  1.00 72.93  ? 512  PRO A C     1 
ATOM   804   O  O     . PRO A 1  129 ? -48.098 -25.863 67.946  1.00 77.85  ? 512  PRO A O     1 
ATOM   805   C  CB    . PRO A 1  129 ? -50.004 -26.765 65.516  1.00 70.91  ? 512  PRO A CB    1 
ATOM   806   C  CG    . PRO A 1  129 ? -50.224 -25.807 64.382  1.00 66.00  ? 512  PRO A CG    1 
ATOM   807   C  CD    . PRO A 1  129 ? -49.709 -24.508 64.866  1.00 71.97  ? 512  PRO A CD    1 
ATOM   808   N  N     . GLY A 1  130 ? -49.724 -27.164 68.781  1.00 78.98  ? 513  GLY A N     1 
ATOM   809   C  CA    . GLY A 1  130 ? -48.910 -27.663 69.864  1.00 90.28  ? 513  GLY A CA    1 
ATOM   810   C  C     . GLY A 1  130 ? -49.025 -26.945 71.191  1.00 87.60  ? 513  GLY A C     1 
ATOM   811   O  O     . GLY A 1  130 ? -48.139 -27.111 72.037  1.00 89.58  ? 513  GLY A O     1 
ATOM   812   N  N     . TYR A 1  131 ? -50.043 -26.120 71.391  1.00 77.24  ? 514  TYR A N     1 
ATOM   813   C  CA    . TYR A 1  131 ? -50.137 -25.340 72.614  1.00 82.40  ? 514  TYR A CA    1 
ATOM   814   C  C     . TYR A 1  131 ? -51.210 -25.836 73.563  1.00 91.90  ? 514  TYR A C     1 
ATOM   815   O  O     . TYR A 1  131 ? -50.963 -26.005 74.762  1.00 95.87  ? 514  TYR A O     1 
ATOM   816   C  CB    . TYR A 1  131 ? -50.396 -23.876 72.274  1.00 88.28  ? 514  TYR A CB    1 
ATOM   817   C  CG    . TYR A 1  131 ? -50.568 -23.024 73.491  1.00 84.25  ? 514  TYR A CG    1 
ATOM   818   C  CD1   . TYR A 1  131 ? -51.821 -22.571 73.876  1.00 85.17  ? 514  TYR A CD1   1 
ATOM   819   C  CD2   . TYR A 1  131 ? -49.466 -22.637 74.234  1.00 84.82  ? 514  TYR A CD2   1 
ATOM   820   C  CE1   . TYR A 1  131 ? -51.968 -21.768 74.989  1.00 90.18  ? 514  TYR A CE1   1 
ATOM   821   C  CE2   . TYR A 1  131 ? -49.600 -21.849 75.346  1.00 94.83  ? 514  TYR A CE2   1 
ATOM   822   C  CZ    . TYR A 1  131 ? -50.852 -21.411 75.722  1.00 91.77  ? 514  TYR A CZ    1 
ATOM   823   O  OH    . TYR A 1  131 ? -50.978 -20.613 76.832  1.00 103.37 ? 514  TYR A OH    1 
ATOM   824   N  N     . HIS A 1  132 ? -52.380 -26.035 73.067  1.00 90.76  ? 515  HIS A N     1 
ATOM   825   C  CA    . HIS A 1  132 ? -53.440 -26.510 73.933  1.00 87.46  ? 515  HIS A CA    1 
ATOM   826   C  C     . HIS A 1  132 ? -53.389 -28.032 74.073  1.00 105.32 ? 515  HIS A C     1 
ATOM   827   O  O     . HIS A 1  132 ? -52.837 -28.732 73.207  1.00 111.21 ? 515  HIS A O     1 
ATOM   828   C  CB    . HIS A 1  132 ? -54.784 -26.093 73.375  1.00 79.08  ? 515  HIS A CB    1 
ATOM   829   C  CG    . HIS A 1  132 ? -54.938 -24.622 73.278  1.00 81.79  ? 515  HIS A CG    1 
ATOM   830   N  ND1   . HIS A 1  132 ? -54.972 -23.964 72.071  1.00 93.76  ? 515  HIS A ND1   1 
ATOM   831   C  CD2   . HIS A 1  132 ? -55.024 -23.669 74.231  1.00 95.12  ? 515  HIS A CD2   1 
ATOM   832   C  CE1   . HIS A 1  132 ? -55.107 -22.667 72.281  1.00 96.51  ? 515  HIS A CE1   1 
ATOM   833   N  NE2   . HIS A 1  132 ? -55.138 -22.461 73.584  1.00 106.82 ? 515  HIS A NE2   1 
ATOM   834   N  N     . PRO A 1  133 ? -53.898 -28.563 75.181  1.00 87.63  ? 516  PRO A N     1 
ATOM   835   C  CA    . PRO A 1  133 ? -54.051 -30.012 75.311  1.00 87.75  ? 516  PRO A CA    1 
ATOM   836   C  C     . PRO A 1  133 ? -55.372 -30.521 74.761  1.00 84.92  ? 516  PRO A C     1 
ATOM   837   O  O     . PRO A 1  133 ? -56.363 -29.794 74.668  1.00 83.24  ? 516  PRO A O     1 
ATOM   838   C  CB    . PRO A 1  133 ? -53.988 -30.220 76.827  1.00 82.49  ? 516  PRO A CB    1 
ATOM   839   C  CG    . PRO A 1  133 ? -54.574 -28.982 77.362  1.00 80.08  ? 516  PRO A CG    1 
ATOM   840   C  CD    . PRO A 1  133 ? -54.107 -27.879 76.466  1.00 81.13  ? 516  PRO A CD    1 
ATOM   841   N  N     . PHE A 1  134 ? -55.364 -31.803 74.397  1.00 93.11  ? 517  PHE A N     1 
ATOM   842   C  CA    . PHE A 1  134 ? -56.546 -32.436 73.827  1.00 103.10 ? 517  PHE A CA    1 
ATOM   843   C  C     . PHE A 1  134 ? -56.462 -33.952 74.044  1.00 106.48 ? 517  PHE A C     1 
ATOM   844   O  O     . PHE A 1  134 ? -55.428 -34.484 74.463  1.00 96.23  ? 517  PHE A O     1 
ATOM   845   C  CB    . PHE A 1  134 ? -56.690 -32.056 72.346  1.00 88.63  ? 517  PHE A CB    1 
ATOM   846   C  CG    . PHE A 1  134 ? -55.505 -32.431 71.507  1.00 88.65  ? 517  PHE A CG    1 
ATOM   847   C  CD1   . PHE A 1  134 ? -55.522 -33.614 70.791  1.00 94.17  ? 517  PHE A CD1   1 
ATOM   848   C  CD2   . PHE A 1  134 ? -54.387 -31.611 71.418  1.00 85.90  ? 517  PHE A CD2   1 
ATOM   849   C  CE1   . PHE A 1  134 ? -54.458 -33.992 70.004  1.00 90.09  ? 517  PHE A CE1   1 
ATOM   850   C  CE2   . PHE A 1  134 ? -53.309 -31.982 70.624  1.00 94.93  ? 517  PHE A CE2   1 
ATOM   851   C  CZ    . PHE A 1  134 ? -53.348 -33.183 69.915  1.00 95.47  ? 517  PHE A CZ    1 
ATOM   852   N  N     . GLU A 1  135 ? -57.581 -34.645 73.772  1.00 107.93 ? 518  GLU A N     1 
ATOM   853   C  CA    . GLU A 1  135 ? -57.631 -36.106 73.828  1.00 101.12 ? 518  GLU A CA    1 
ATOM   854   C  C     . GLU A 1  135 ? -58.517 -36.634 72.713  1.00 102.73 ? 518  GLU A C     1 
ATOM   855   O  O     . GLU A 1  135 ? -59.559 -36.046 72.405  1.00 101.98 ? 518  GLU A O     1 
ATOM   856   C  CB    . GLU A 1  135 ? -58.247 -36.647 75.112  1.00 115.73 ? 518  GLU A CB    1 
ATOM   857   C  CG    . GLU A 1  135 ? -57.589 -36.283 76.405  1.00 128.89 ? 518  GLU A CG    1 
ATOM   858   C  CD    . GLU A 1  135 ? -58.521 -36.536 77.583  1.00 144.22 ? 518  GLU A CD    1 
ATOM   859   O  OE1   . GLU A 1  135 ? -59.758 -36.634 77.368  1.00 137.36 ? 518  GLU A OE1   1 
ATOM   860   O  OE2   . GLU A 1  135 ? -58.014 -36.631 78.722  1.00 156.38 ? 518  GLU A OE2   1 
ATOM   861   N  N     . TRP A 1  136 ? -58.167 -37.815 72.207  1.00 100.56 ? 519  TRP A N     1 
ATOM   862   C  CA    . TRP A 1  136 ? -58.971 -38.530 71.222  1.00 101.86 ? 519  TRP A CA    1 
ATOM   863   C  C     . TRP A 1  136 ? -59.535 -39.789 71.857  1.00 105.31 ? 519  TRP A C     1 
ATOM   864   O  O     . TRP A 1  136 ? -58.795 -40.577 72.458  1.00 107.19 ? 519  TRP A O     1 
ATOM   865   C  CB    . TRP A 1  136 ? -58.161 -38.919 69.980  1.00 93.68  ? 519  TRP A CB    1 
ATOM   866   C  CG    . TRP A 1  136 ? -57.829 -37.766 69.142  1.00 87.28  ? 519  TRP A CG    1 
ATOM   867   C  CD1   . TRP A 1  136 ? -56.694 -37.018 69.185  1.00 86.65  ? 519  TRP A CD1   1 
ATOM   868   C  CD2   . TRP A 1  136 ? -58.667 -37.173 68.151  1.00 84.07  ? 519  TRP A CD2   1 
ATOM   869   N  NE1   . TRP A 1  136 ? -56.767 -36.005 68.269  1.00 87.08  ? 519  TRP A NE1   1 
ATOM   870   C  CE2   . TRP A 1  136 ? -57.971 -36.080 67.621  1.00 84.57  ? 519  TRP A CE2   1 
ATOM   871   C  CE3   . TRP A 1  136 ? -59.936 -37.468 67.652  1.00 87.94  ? 519  TRP A CE3   1 
ATOM   872   C  CZ2   . TRP A 1  136 ? -58.502 -35.278 66.621  1.00 97.30  ? 519  TRP A CZ2   1 
ATOM   873   C  CZ3   . TRP A 1  136 ? -60.456 -36.669 66.653  1.00 91.02  ? 519  TRP A CZ3   1 
ATOM   874   C  CH2   . TRP A 1  136 ? -59.744 -35.589 66.152  1.00 88.75  ? 519  TRP A CH2   1 
ATOM   875   N  N     . GLN A 1  137 ? -60.838 -39.985 71.718  1.00 107.28 ? 520  GLN A N     1 
ATOM   876   C  CA    . GLN A 1  137 ? -61.498 -41.152 72.295  1.00 103.69 ? 520  GLN A CA    1 
ATOM   877   C  C     . GLN A 1  137 ? -62.225 -41.921 71.208  1.00 96.01  ? 520  GLN A C     1 
ATOM   878   O  O     . GLN A 1  137 ? -63.196 -41.406 70.618  1.00 100.53 ? 520  GLN A O     1 
ATOM   879   C  CB    . GLN A 1  137 ? -62.455 -40.736 73.404  1.00 106.85 ? 520  GLN A CB    1 
ATOM   880   C  CG    . GLN A 1  137 ? -61.711 -40.327 74.653  1.00 112.71 ? 520  GLN A CG    1 
ATOM   881   C  CD    . GLN A 1  137 ? -62.594 -39.617 75.650  1.00 129.97 ? 520  GLN A CD    1 
ATOM   882   O  OE1   . GLN A 1  137 ? -63.698 -39.176 75.319  1.00 131.88 ? 520  GLN A OE1   1 
ATOM   883   N  NE2   . GLN A 1  137 ? -62.112 -39.497 76.884  1.00 131.83 ? 520  GLN A NE2   1 
ATOM   884   N  N     . PRO A 1  138 ? -61.757 -43.112 70.857  1.00 87.95  ? 521  PRO A N     1 
ATOM   885   C  CA    . PRO A 1  138 ? -60.581 -43.726 71.472  1.00 84.52  ? 521  PRO A CA    1 
ATOM   886   C  C     . PRO A 1  138 ? -59.318 -43.172 70.837  1.00 88.57  ? 521  PRO A C     1 
ATOM   887   O  O     . PRO A 1  138 ? -59.430 -42.531 69.794  1.00 97.25  ? 521  PRO A O     1 
ATOM   888   C  CB    . PRO A 1  138 ? -60.758 -45.210 71.171  1.00 95.70  ? 521  PRO A CB    1 
ATOM   889   C  CG    . PRO A 1  138 ? -61.710 -45.274 69.994  1.00 104.31 ? 521  PRO A CG    1 
ATOM   890   C  CD    . PRO A 1  138 ? -62.270 -43.905 69.732  1.00 99.01  ? 521  PRO A CD    1 
ATOM   891   N  N     . PRO A 1  139 ? -58.170 -43.343 71.484  1.00 84.77  ? 522  PRO A N     1 
ATOM   892   C  CA    . PRO A 1  139 ? -56.905 -42.840 70.923  1.00 95.65  ? 522  PRO A CA    1 
ATOM   893   C  C     . PRO A 1  139 ? -56.738 -43.213 69.450  1.00 96.74  ? 522  PRO A C     1 
ATOM   894   O  O     . PRO A 1  139 ? -57.127 -44.302 69.024  1.00 97.68  ? 522  PRO A O     1 
ATOM   895   C  CB    . PRO A 1  139 ? -55.855 -43.525 71.802  1.00 89.26  ? 522  PRO A CB    1 
ATOM   896   C  CG    . PRO A 1  139 ? -56.548 -43.666 73.115  1.00 82.70  ? 522  PRO A CG    1 
ATOM   897   C  CD    . PRO A 1  139 ? -57.984 -43.968 72.801  1.00 81.71  ? 522  PRO A CD    1 
ATOM   898   N  N     . LEU A 1  140 ? -56.141 -42.304 68.668  1.00 95.44  ? 523  LEU A N     1 
ATOM   899   C  CA    . LEU A 1  140 ? -56.059 -42.473 67.216  1.00 99.93  ? 523  LEU A CA    1 
ATOM   900   C  C     . LEU A 1  140 ? -55.125 -43.633 66.879  1.00 93.19  ? 523  LEU A C     1 
ATOM   901   O  O     . LEU A 1  140 ? -54.110 -43.842 67.547  1.00 91.90  ? 523  LEU A O     1 
ATOM   902   C  CB    . LEU A 1  140 ? -55.552 -41.180 66.545  1.00 99.21  ? 523  LEU A CB    1 
ATOM   903   C  CG    . LEU A 1  140 ? -56.441 -39.911 66.629  1.00 94.49  ? 523  LEU A CG    1 
ATOM   904   C  CD1   . LEU A 1  140 ? -55.844 -38.554 66.145  1.00 91.63  ? 523  LEU A CD1   1 
ATOM   905   C  CD2   . LEU A 1  140 ? -57.753 -40.172 65.907  1.00 91.75  ? 523  LEU A CD2   1 
ATOM   906   N  N     . LYS A 1  141 ? -55.468 -44.384 65.838  1.00 96.20  ? 524  LYS A N     1 
ATOM   907   C  CA    . LYS A 1  141 ? -54.637 -45.508 65.421  1.00 108.44 ? 524  LYS A CA    1 
ATOM   908   C  C     . LYS A 1  141 ? -53.345 -45.000 64.780  1.00 105.16 ? 524  LYS A C     1 
ATOM   909   O  O     . LYS A 1  141 ? -53.399 -44.245 63.802  1.00 102.79 ? 524  LYS A O     1 
ATOM   910   C  CB    . LYS A 1  141 ? -55.404 -46.396 64.452  1.00 124.29 ? 524  LYS A CB    1 
ATOM   911   C  CG    . LYS A 1  141 ? -54.611 -47.542 63.877  1.00 126.97 ? 524  LYS A CG    1 
ATOM   912   C  CD    . LYS A 1  141 ? -55.381 -48.142 62.740  1.00 142.22 ? 524  LYS A CD    1 
ATOM   913   C  CE    . LYS A 1  141 ? -56.729 -48.675 63.216  1.00 158.09 ? 524  LYS A CE    1 
ATOM   914   N  NZ    . LYS A 1  141 ? -57.495 -49.266 62.080  1.00 166.87 ? 524  LYS A NZ    1 
ATOM   915   N  N     . ASN A 1  142 ? -52.202 -45.402 65.335  1.00 101.43 ? 525  ASN A N     1 
ATOM   916   C  CA    . ASN A 1  142 ? -50.868 -45.135 64.786  1.00 106.69 ? 525  ASN A CA    1 
ATOM   917   C  C     . ASN A 1  142 ? -50.477 -43.652 64.828  1.00 102.24 ? 525  ASN A C     1 
ATOM   918   O  O     . ASN A 1  142 ? -49.487 -43.241 64.193  1.00 91.74  ? 525  ASN A O     1 
ATOM   919   C  CB    . ASN A 1  142 ? -50.745 -45.668 63.349  1.00 100.41 ? 525  ASN A CB    1 
ATOM   920   C  CG    . ASN A 1  142 ? -50.745 -47.197 63.278  1.00 108.21 ? 525  ASN A CG    1 
ATOM   921   O  OD1   . ASN A 1  142 ? -50.687 -47.878 64.311  1.00 115.39 ? 525  ASN A OD1   1 
ATOM   922   N  ND2   . ASN A 1  142 ? -50.838 -47.736 62.072  1.00 112.24 ? 525  ASN A ND2   1 
ATOM   923   N  N     . VAL A 1  143 ? -51.204 -42.836 65.594  1.00 105.90 ? 526  VAL A N     1 
ATOM   924   C  CA    . VAL A 1  143 ? -50.898 -41.425 65.795  1.00 92.96  ? 526  VAL A CA    1 
ATOM   925   C  C     . VAL A 1  143 ? -50.518 -41.240 67.254  1.00 90.63  ? 526  VAL A C     1 
ATOM   926   O  O     . VAL A 1  143 ? -51.204 -41.747 68.149  1.00 102.81 ? 526  VAL A O     1 
ATOM   927   C  CB    . VAL A 1  143 ? -52.093 -40.517 65.435  1.00 89.92  ? 526  VAL A CB    1 
ATOM   928   C  CG1   . VAL A 1  143 ? -51.720 -39.073 65.671  1.00 91.92  ? 526  VAL A CG1   1 
ATOM   929   C  CG2   . VAL A 1  143 ? -52.522 -40.721 64.000  1.00 91.98  ? 526  VAL A CG2   1 
ATOM   930   N  N     . SER A 1  144 ? -49.443 -40.495 67.491  1.00 90.56  ? 527  SER A N     1 
ATOM   931   C  CA    . SER A 1  144 ? -48.987 -40.244 68.854  1.00 88.82  ? 527  SER A CA    1 
ATOM   932   C  C     . SER A 1  144 ? -50.046 -39.478 69.654  1.00 95.77  ? 527  SER A C     1 
ATOM   933   O  O     . SER A 1  144 ? -50.872 -38.745 69.100  1.00 103.47 ? 527  SER A O     1 
ATOM   934   C  CB    . SER A 1  144 ? -47.663 -39.477 68.831  1.00 95.03  ? 527  SER A CB    1 
ATOM   935   O  OG    . SER A 1  144 ? -47.310 -39.049 70.130  1.00 104.17 ? 527  SER A OG    1 
ATOM   936   N  N     . SER A 1  145 ? -50.059 -39.701 70.968  1.00 96.71  ? 528  SER A N     1 
ATOM   937   C  CA    . SER A 1  145 ? -50.938 -38.971 71.877  1.00 98.47  ? 528  SER A CA    1 
ATOM   938   C  C     . SER A 1  145 ? -50.318 -37.698 72.439  1.00 104.46 ? 528  SER A C     1 
ATOM   939   O  O     . SER A 1  145 ? -51.000 -36.974 73.172  1.00 104.58 ? 528  SER A O     1 
ATOM   940   C  CB    . SER A 1  145 ? -51.369 -39.878 73.027  1.00 110.34 ? 528  SER A CB    1 
ATOM   941   O  OG    . SER A 1  145 ? -50.236 -40.358 73.725  1.00 121.82 ? 528  SER A OG    1 
ATOM   942   N  N     . ARG A 1  146 ? -49.047 -37.426 72.136  1.00 113.03 ? 529  ARG A N     1 
ATOM   943   C  CA    . ARG A 1  146 ? -48.404 -36.192 72.573  1.00 97.72  ? 529  ARG A CA    1 
ATOM   944   C  C     . ARG A 1  146 ? -49.128 -34.993 71.976  1.00 92.40  ? 529  ARG A C     1 
ATOM   945   O  O     . ARG A 1  146 ? -49.516 -35.015 70.804  1.00 89.94  ? 529  ARG A O     1 
ATOM   946   C  CB    . ARG A 1  146 ? -46.938 -36.188 72.151  1.00 103.72 ? 529  ARG A CB    1 
ATOM   947   C  CG    . ARG A 1  146 ? -46.135 -37.322 72.723  1.00 113.38 ? 529  ARG A CG    1 
ATOM   948   C  CD    . ARG A 1  146 ? -45.738 -36.992 74.120  1.00 117.58 ? 529  ARG A CD    1 
ATOM   949   N  NE    . ARG A 1  146 ? -44.850 -35.842 74.135  1.00 131.64 ? 529  ARG A NE    1 
ATOM   950   C  CZ    . ARG A 1  146 ? -44.480 -35.219 75.245  1.00 141.59 ? 529  ARG A CZ    1 
ATOM   951   N  NH1   . ARG A 1  146 ? -43.661 -34.176 75.183  1.00 145.85 ? 529  ARG A NH1   1 
ATOM   952   N  NH2   . ARG A 1  146 ? -44.936 -35.641 76.418  1.00 142.69 ? 529  ARG A NH2   1 
ATOM   953   N  N     . THR A 1  147 ? -49.375 -33.974 72.802  1.00 90.65  ? 530  THR A N     1 
ATOM   954   C  CA    . THR A 1  147 ? -50.080 -32.778 72.360  1.00 96.66  ? 530  THR A CA    1 
ATOM   955   C  C     . THR A 1  147 ? -49.167 -31.576 72.162  1.00 97.50  ? 530  THR A C     1 
ATOM   956   O  O     . THR A 1  147 ? -49.624 -30.549 71.644  1.00 100.92 ? 530  THR A O     1 
ATOM   957   C  CB    . THR A 1  147 ? -51.185 -32.398 73.356  1.00 94.29  ? 530  THR A CB    1 
ATOM   958   O  OG1   . THR A 1  147 ? -50.609 -32.087 74.633  1.00 94.36  ? 530  THR A OG1   1 
ATOM   959   C  CG2   . THR A 1  147 ? -52.191 -33.530 73.500  1.00 92.69  ? 530  THR A CG2   1 
ATOM   960   N  N     . ASP A 1  148 ? -47.901 -31.673 72.553  1.00 95.64  ? 531  ASP A N     1 
ATOM   961   C  CA    . ASP A 1  148 ? -46.959 -30.570 72.395  1.00 93.90  ? 531  ASP A CA    1 
ATOM   962   C  C     . ASP A 1  148 ? -46.152 -30.674 71.111  1.00 98.74  ? 531  ASP A C     1 
ATOM   963   O  O     . ASP A 1  148 ? -44.968 -30.323 71.120  1.00 114.77 ? 531  ASP A O     1 
ATOM   964   C  CB    . ASP A 1  148 ? -46.042 -30.483 73.612  1.00 101.24 ? 531  ASP A CB    1 
ATOM   965   C  CG    . ASP A 1  148 ? -45.120 -31.684 73.744  1.00 118.44 ? 531  ASP A CG    1 
ATOM   966   O  OD1   . ASP A 1  148 ? -45.342 -32.691 73.040  1.00 121.69 ? 531  ASP A OD1   1 
ATOM   967   O  OD2   . ASP A 1  148 ? -44.158 -31.611 74.545  1.00 123.43 ? 531  ASP A OD2   1 
ATOM   968   N  N     . VAL A 1  149 ? -46.720 -31.176 70.010  1.00 98.58  ? 532  VAL A N     1 
ATOM   969   C  CA    . VAL A 1  149 ? -46.002 -31.285 68.739  1.00 103.86 ? 532  VAL A CA    1 
ATOM   970   C  C     . VAL A 1  149 ? -46.314 -30.046 67.920  1.00 104.01 ? 532  VAL A C     1 
ATOM   971   O  O     . VAL A 1  149 ? -47.480 -29.647 67.797  1.00 104.39 ? 532  VAL A O     1 
ATOM   972   C  CB    . VAL A 1  149 ? -46.386 -32.549 67.949  1.00 94.59  ? 532  VAL A CB    1 
ATOM   973   C  CG1   . VAL A 1  149 ? -45.761 -33.782 68.555  1.00 97.96  ? 532  VAL A CG1   1 
ATOM   974   C  CG2   . VAL A 1  149 ? -47.903 -32.667 67.842  1.00 97.77  ? 532  VAL A CG2   1 
ATOM   975   N  N     . GLY A 1  150 ? -45.275 -29.433 67.368  1.00 88.17  ? 533  GLY A N     1 
ATOM   976   C  CA    . GLY A 1  150 ? -45.501 -28.281 66.543  1.00 90.19  ? 533  GLY A CA    1 
ATOM   977   C  C     . GLY A 1  150 ? -45.179 -28.608 65.110  1.00 88.34  ? 533  GLY A C     1 
ATOM   978   O  O     . GLY A 1  150 ? -45.819 -29.475 64.502  1.00 84.93  ? 533  GLY A O     1 
ATOM   979   N  N     . ILE A 1  151 ? -44.187 -27.908 64.564  1.00 94.92  ? 534  ILE A N     1 
ATOM   980   C  CA    . ILE A 1  151 ? -43.727 -28.180 63.213  1.00 86.62  ? 534  ILE A CA    1 
ATOM   981   C  C     . ILE A 1  151 ? -42.949 -29.484 63.203  1.00 80.35  ? 534  ILE A C     1 
ATOM   982   O  O     . ILE A 1  151 ? -42.060 -29.711 64.031  1.00 82.37  ? 534  ILE A O     1 
ATOM   983   C  CB    . ILE A 1  151 ? -42.892 -27.006 62.678  1.00 78.68  ? 534  ILE A CB    1 
ATOM   984   C  CG1   . ILE A 1  151 ? -43.776 -25.776 62.473  1.00 67.11  ? 534  ILE A CG1   1 
ATOM   985   C  CG2   . ILE A 1  151 ? -42.217 -27.376 61.376  1.00 82.67  ? 534  ILE A CG2   1 
ATOM   986   C  CD1   . ILE A 1  151 ? -43.051 -24.582 61.884  1.00 78.24  ? 534  ILE A CD1   1 
ATOM   987   N  N     . ILE A 1  152 ? -43.266 -30.342 62.262  1.00 77.15  ? 535  ILE A N     1 
ATOM   988   C  CA    . ILE A 1  152 ? -42.618 -31.631 62.158  1.00 82.25  ? 535  ILE A CA    1 
ATOM   989   C  C     . ILE A 1  152 ? -42.021 -31.695 60.764  1.00 87.18  ? 535  ILE A C     1 
ATOM   990   O  O     . ILE A 1  152 ? -42.462 -30.993 59.842  1.00 79.13  ? 535  ILE A O     1 
ATOM   991   C  CB    . ILE A 1  152 ? -43.614 -32.794 62.391  1.00 88.13  ? 535  ILE A CB    1 
ATOM   992   C  CG1   . ILE A 1  152 ? -44.477 -32.544 63.627  1.00 101.67 ? 535  ILE A CG1   1 
ATOM   993   C  CG2   . ILE A 1  152 ? -42.888 -34.110 62.572  1.00 95.27  ? 535  ILE A CG2   1 
ATOM   994   C  CD1   . ILE A 1  152 ? -43.698 -32.621 64.935  1.00 113.70 ? 535  ILE A CD1   1 
ATOM   995   N  N     . ASP A 1  153 ? -40.961 -32.485 60.637  1.00 84.37  ? 536  ASP A N     1 
ATOM   996   C  CA    . ASP A 1  153 ? -40.328 -32.668 59.346  1.00 86.52  ? 536  ASP A CA    1 
ATOM   997   C  C     . ASP A 1  153 ? -41.287 -33.377 58.401  1.00 79.58  ? 536  ASP A C     1 
ATOM   998   O  O     . ASP A 1  153 ? -41.895 -34.387 58.765  1.00 85.09  ? 536  ASP A O     1 
ATOM   999   C  CB    . ASP A 1  153 ? -39.036 -33.455 59.492  1.00 89.64  ? 536  ASP A CB    1 
ATOM   1000  C  CG    . ASP A 1  153 ? -38.438 -33.844 58.141  1.00 106.62 ? 536  ASP A CG    1 
ATOM   1001  O  OD1   . ASP A 1  153 ? -38.517 -35.039 57.769  1.00 98.81  ? 536  ASP A OD1   1 
ATOM   1002  O  OD2   . ASP A 1  153 ? -37.932 -32.937 57.426  1.00 107.16 ? 536  ASP A OD2   1 
ATOM   1003  N  N     . GLY A 1  154 ? -41.469 -32.801 57.210  1.00 77.62  ? 537  GLY A N     1 
ATOM   1004  C  CA    . GLY A 1  154 ? -42.412 -33.305 56.225  1.00 79.53  ? 537  GLY A CA    1 
ATOM   1005  C  C     . GLY A 1  154 ? -42.042 -34.635 55.599  1.00 82.49  ? 537  GLY A C     1 
ATOM   1006  O  O     . GLY A 1  154 ? -42.921 -35.308 55.050  1.00 81.46  ? 537  GLY A O     1 
ATOM   1007  N  N     . LEU A 1  155 ? -40.764 -35.020 55.649  1.00 78.02  ? 538  LEU A N     1 
ATOM   1008  C  CA    . LEU A 1  155 ? -40.355 -36.337 55.174  1.00 83.59  ? 538  LEU A CA    1 
ATOM   1009  C  C     . LEU A 1  155 ? -40.784 -37.464 56.105  1.00 90.48  ? 538  LEU A C     1 
ATOM   1010  O  O     . LEU A 1  155 ? -40.729 -38.636 55.701  1.00 89.40  ? 538  LEU A O     1 
ATOM   1011  C  CB    . LEU A 1  155 ? -38.847 -36.412 54.970  1.00 84.46  ? 538  LEU A CB    1 
ATOM   1012  C  CG    . LEU A 1  155 ? -38.207 -35.754 53.759  1.00 81.97  ? 538  LEU A CG    1 
ATOM   1013  C  CD1   . LEU A 1  155 ? -38.776 -34.382 53.510  1.00 96.83  ? 538  LEU A CD1   1 
ATOM   1014  C  CD2   . LEU A 1  155 ? -36.706 -35.695 53.994  1.00 90.45  ? 538  LEU A CD2   1 
ATOM   1015  N  N     . SER A 1  156 ? -41.176 -37.148 57.338  1.00 89.63  ? 539  SER A N     1 
ATOM   1016  C  CA    . SER A 1  156 ? -41.687 -38.147 58.266  1.00 81.61  ? 539  SER A CA    1 
ATOM   1017  C  C     . SER A 1  156 ? -40.707 -39.315 58.373  1.00 82.34  ? 539  SER A C     1 
ATOM   1018  O  O     . SER A 1  156 ? -41.052 -40.482 58.181  1.00 81.55  ? 539  SER A O     1 
ATOM   1019  C  CB    . SER A 1  156 ? -43.090 -38.596 57.852  1.00 78.95  ? 539  SER A CB    1 
ATOM   1020  O  OG    . SER A 1  156 ? -43.985 -37.492 57.784  1.00 73.00  ? 539  SER A OG    1 
ATOM   1021  N  N     . GLY A 1  157 ? -39.444 -38.970 58.618  1.00 88.54  ? 540  GLY A N     1 
ATOM   1022  C  CA    . GLY A 1  157 ? -38.399 -39.957 58.800  1.00 85.62  ? 540  GLY A CA    1 
ATOM   1023  C  C     . GLY A 1  157 ? -37.960 -40.655 57.540  1.00 84.86  ? 540  GLY A C     1 
ATOM   1024  O  O     . GLY A 1  157 ? -37.311 -41.702 57.623  1.00 83.40  ? 540  GLY A O     1 
ATOM   1025  N  N     . LEU A 1  158 ? -38.289 -40.098 56.374  1.00 79.85  ? 541  LEU A N     1 
ATOM   1026  C  CA    . LEU A 1  158 ? -37.889 -40.687 55.104  1.00 80.83  ? 541  LEU A CA    1 
ATOM   1027  C  C     . LEU A 1  158 ? -36.390 -40.911 55.061  1.00 84.59  ? 541  LEU A C     1 
ATOM   1028  O  O     . LEU A 1  158 ? -35.603 -40.029 55.411  1.00 90.65  ? 541  LEU A O     1 
ATOM   1029  C  CB    . LEU A 1  158 ? -38.304 -39.785 53.949  1.00 81.94  ? 541  LEU A CB    1 
ATOM   1030  C  CG    . LEU A 1  158 ? -38.041 -40.387 52.579  1.00 77.14  ? 541  LEU A CG    1 
ATOM   1031  C  CD1   . LEU A 1  158 ? -38.898 -41.619 52.385  1.00 83.88  ? 541  LEU A CD1   1 
ATOM   1032  C  CD2   . LEU A 1  158 ? -38.314 -39.348 51.518  1.00 88.78  ? 541  LEU A CD2   1 
ATOM   1033  N  N     . ALA A 1  159 ? -36.008 -42.108 54.634  1.00 95.11  ? 542  ALA A N     1 
ATOM   1034  C  CA    . ALA A 1  159 ? -34.607 -42.484 54.609  1.00 96.20  ? 542  ALA A CA    1 
ATOM   1035  C  C     . ALA A 1  159 ? -33.856 -41.567 53.663  1.00 94.19  ? 542  ALA A C     1 
ATOM   1036  O  O     . ALA A 1  159 ? -34.374 -41.166 52.615  1.00 87.48  ? 542  ALA A O     1 
ATOM   1037  C  CB    . ALA A 1  159 ? -34.452 -43.944 54.184  1.00 103.40 ? 542  ALA A CB    1 
ATOM   1038  N  N     . SER A 1  160 ? -32.657 -41.170 54.086  1.00 102.03 ? 543  SER A N     1 
ATOM   1039  C  CA    . SER A 1  160 ? -31.857 -40.220 53.336  1.00 110.76 ? 543  SER A CA    1 
ATOM   1040  C  C     . SER A 1  160 ? -30.438 -40.693 53.042  1.00 114.60 ? 543  SER A C     1 
ATOM   1041  O  O     . SER A 1  160 ? -29.669 -39.932 52.443  1.00 109.28 ? 543  SER A O     1 
ATOM   1042  C  CB    . SER A 1  160 ? -31.793 -38.886 54.089  1.00 113.99 ? 543  SER A CB    1 
ATOM   1043  O  OG    . SER A 1  160 ? -31.427 -39.102 55.443  1.00 118.36 ? 543  SER A OG    1 
ATOM   1044  N  N     . SER A 1  161 ? -30.069 -41.916 53.421  1.00 112.60 ? 544  SER A N     1 
ATOM   1045  C  CA    . SER A 1  161 ? -28.716 -42.388 53.155  1.00 112.88 ? 544  SER A CA    1 
ATOM   1046  C  C     . SER A 1  161 ? -28.448 -42.458 51.650  1.00 109.38 ? 544  SER A C     1 
ATOM   1047  O  O     . SER A 1  161 ? -29.365 -42.520 50.825  1.00 108.99 ? 544  SER A O     1 
ATOM   1048  C  CB    . SER A 1  161 ? -28.478 -43.756 53.800  1.00 122.77 ? 544  SER A CB    1 
ATOM   1049  O  OG    . SER A 1  161 ? -28.948 -44.815 52.983  1.00 114.53 ? 544  SER A OG    1 
ATOM   1050  N  N     . VAL A 1  162 ? -27.158 -42.442 51.303  1.00 107.91 ? 545  VAL A N     1 
ATOM   1051  C  CA    . VAL A 1  162 ? -26.713 -42.429 49.908  1.00 106.38 ? 545  VAL A CA    1 
ATOM   1052  C  C     . VAL A 1  162 ? -27.140 -43.667 49.129  1.00 102.54 ? 545  VAL A C     1 
ATOM   1053  O  O     . VAL A 1  162 ? -27.187 -43.638 47.893  1.00 97.63  ? 545  VAL A O     1 
ATOM   1054  C  CB    . VAL A 1  162 ? -25.179 -42.262 49.856  1.00 108.85 ? 545  VAL A CB    1 
ATOM   1055  C  CG1   . VAL A 1  162 ? -24.478 -43.567 50.180  1.00 104.23 ? 545  VAL A CG1   1 
ATOM   1056  C  CG2   . VAL A 1  162 ? -24.763 -41.752 48.505  1.00 117.78 ? 545  VAL A CG2   1 
ATOM   1057  N  N     . ASP A 1  163 ? -27.424 -44.766 49.830  1.00 108.74 ? 546  ASP A N     1 
ATOM   1058  C  CA    . ASP A 1  163 ? -27.882 -46.004 49.202  1.00 104.93 ? 546  ASP A CA    1 
ATOM   1059  C  C     . ASP A 1  163 ? -29.330 -45.895 48.746  1.00 106.36 ? 546  ASP A C     1 
ATOM   1060  O  O     . ASP A 1  163 ? -29.713 -46.463 47.714  1.00 100.27 ? 546  ASP A O     1 
ATOM   1061  C  CB    . ASP A 1  163 ? -27.755 -47.145 50.205  1.00 102.23 ? 546  ASP A CB    1 
ATOM   1062  C  CG    . ASP A 1  163 ? -26.357 -47.306 50.723  1.00 108.70 ? 546  ASP A CG    1 
ATOM   1063  O  OD1   . ASP A 1  163 ? -25.442 -47.534 49.906  1.00 104.43 ? 546  ASP A OD1   1 
ATOM   1064  O  OD2   . ASP A 1  163 ? -26.174 -47.148 51.952  1.00 117.74 ? 546  ASP A OD2   1 
ATOM   1065  N  N     . GLU A 1  164 ? -30.150 -45.201 49.534  1.00 99.11  ? 547  GLU A N     1 
ATOM   1066  C  CA    . GLU A 1  164 ? -31.581 -45.111 49.316  1.00 88.19  ? 547  GLU A CA    1 
ATOM   1067  C  C     . GLU A 1  164 ? -31.877 -44.242 48.102  1.00 91.85  ? 547  GLU A C     1 
ATOM   1068  O  O     . GLU A 1  164 ? -30.984 -43.740 47.416  1.00 101.46 ? 547  GLU A O     1 
ATOM   1069  C  CB    . GLU A 1  164 ? -32.268 -44.534 50.550  1.00 93.12  ? 547  GLU A CB    1 
ATOM   1070  C  CG    . GLU A 1  164 ? -31.923 -45.215 51.865  1.00 101.49 ? 547  GLU A CG    1 
ATOM   1071  C  CD    . GLU A 1  164 ? -32.906 -46.303 52.272  1.00 110.35 ? 547  GLU A CD    1 
ATOM   1072  O  OE1   . GLU A 1  164 ? -32.624 -46.990 53.280  1.00 114.50 ? 547  GLU A OE1   1 
ATOM   1073  O  OE2   . GLU A 1  164 ? -33.953 -46.472 51.596  1.00 109.31 ? 547  GLU A OE2   1 
ATOM   1074  N  N     . TYR A 1  165 ? -33.160 -44.099 47.820  1.00 93.64  ? 548  TYR A N     1 
ATOM   1075  C  CA    . TYR A 1  165 ? -33.593 -43.188 46.778  1.00 88.81  ? 548  TYR A CA    1 
ATOM   1076  C  C     . TYR A 1  165 ? -33.190 -41.758 47.143  1.00 99.45  ? 548  TYR A C     1 
ATOM   1077  O  O     . TYR A 1  165 ? -33.284 -41.365 48.314  1.00 101.44 ? 548  TYR A O     1 
ATOM   1078  C  CB    . TYR A 1  165 ? -35.101 -43.304 46.610  1.00 83.82  ? 548  TYR A CB    1 
ATOM   1079  C  CG    . TYR A 1  165 ? -35.608 -42.847 45.291  1.00 82.34  ? 548  TYR A CG    1 
ATOM   1080  C  CD1   . TYR A 1  165 ? -35.330 -43.563 44.135  1.00 83.87  ? 548  TYR A CD1   1 
ATOM   1081  C  CD2   . TYR A 1  165 ? -36.429 -41.748 45.203  1.00 78.27  ? 548  TYR A CD2   1 
ATOM   1082  C  CE1   . TYR A 1  165 ? -35.818 -43.158 42.912  1.00 81.43  ? 548  TYR A CE1   1 
ATOM   1083  C  CE2   . TYR A 1  165 ? -36.931 -41.337 43.996  1.00 88.09  ? 548  TYR A CE2   1 
ATOM   1084  C  CZ    . TYR A 1  165 ? -36.627 -42.042 42.854  1.00 89.49  ? 548  TYR A CZ    1 
ATOM   1085  O  OH    . TYR A 1  165 ? -37.141 -41.607 41.663  1.00 90.16  ? 548  TYR A OH    1 
ATOM   1086  N  N     . PRO A 1  166 ? -32.738 -40.954 46.179  1.00 98.43  ? 549  PRO A N     1 
ATOM   1087  C  CA    . PRO A 1  166 ? -32.265 -39.603 46.514  1.00 96.92  ? 549  PRO A CA    1 
ATOM   1088  C  C     . PRO A 1  166 ? -33.411 -38.661 46.882  1.00 99.01  ? 549  PRO A C     1 
ATOM   1089  O  O     . PRO A 1  166 ? -34.384 -38.514 46.138  1.00 95.50  ? 549  PRO A O     1 
ATOM   1090  C  CB    . PRO A 1  166 ? -31.538 -39.161 45.237  1.00 97.87  ? 549  PRO A CB    1 
ATOM   1091  C  CG    . PRO A 1  166 ? -32.112 -39.990 44.153  1.00 90.95  ? 549  PRO A CG    1 
ATOM   1092  C  CD    . PRO A 1  166 ? -32.446 -41.312 44.781  1.00 90.39  ? 549  PRO A CD    1 
ATOM   1093  N  N     . VAL A 1  167 ? -33.277 -38.015 48.039  1.00 100.49 ? 550  VAL A N     1 
ATOM   1094  C  CA    . VAL A 1  167 ? -34.278 -37.096 48.573  1.00 97.52  ? 550  VAL A CA    1 
ATOM   1095  C  C     . VAL A 1  167 ? -33.855 -35.680 48.200  1.00 103.56 ? 550  VAL A C     1 
ATOM   1096  O  O     . VAL A 1  167 ? -32.861 -35.157 48.715  1.00 101.42 ? 550  VAL A O     1 
ATOM   1097  C  CB    . VAL A 1  167 ? -34.426 -37.264 50.091  1.00 102.30 ? 550  VAL A CB    1 
ATOM   1098  C  CG1   . VAL A 1  167 ? -35.331 -36.190 50.678  1.00 100.01 ? 550  VAL A CG1   1 
ATOM   1099  C  CG2   . VAL A 1  167 ? -34.948 -38.659 50.411  1.00 105.79 ? 550  VAL A CG2   1 
ATOM   1100  N  N     . ASP A 1  168 ? -34.594 -35.063 47.282  1.00 106.26 ? 551  ASP A N     1 
ATOM   1101  C  CA    . ASP A 1  168 ? -34.234 -33.758 46.744  1.00 107.93 ? 551  ASP A CA    1 
ATOM   1102  C  C     . ASP A 1  168 ? -35.159 -32.640 47.194  1.00 107.77 ? 551  ASP A C     1 
ATOM   1103  O  O     . ASP A 1  168 ? -35.128 -31.555 46.602  1.00 111.05 ? 551  ASP A O     1 
ATOM   1104  C  CB    . ASP A 1  168 ? -34.190 -33.824 45.217  1.00 121.78 ? 551  ASP A CB    1 
ATOM   1105  C  CG    . ASP A 1  168 ? -33.046 -34.687 44.708  1.00 136.71 ? 551  ASP A CG    1 
ATOM   1106  O  OD1   . ASP A 1  168 ? -32.049 -34.831 45.454  1.00 136.83 ? 551  ASP A OD1   1 
ATOM   1107  O  OD2   . ASP A 1  168 ? -33.155 -35.241 43.587  1.00 141.58 ? 551  ASP A OD2   1 
ATOM   1108  N  N     . THR A 1  169 ? -35.980 -32.867 48.220  1.00 110.60 ? 552  THR A N     1 
ATOM   1109  C  CA    . THR A 1  169 ? -37.021 -31.918 48.584  1.00 98.43  ? 552  THR A CA    1 
ATOM   1110  C  C     . THR A 1  169 ? -36.935 -31.602 50.074  1.00 85.88  ? 552  THR A C     1 
ATOM   1111  O  O     . THR A 1  169 ? -36.419 -32.385 50.880  1.00 74.06  ? 552  THR A O     1 
ATOM   1112  C  CB    . THR A 1  169 ? -38.432 -32.433 48.197  1.00 92.94  ? 552  THR A CB    1 
ATOM   1113  O  OG1   . THR A 1  169 ? -38.949 -33.305 49.206  1.00 92.09  ? 552  THR A OG1   1 
ATOM   1114  C  CG2   . THR A 1  169 ? -38.391 -33.193 46.864  1.00 94.97  ? 552  THR A CG2   1 
ATOM   1115  N  N     . ILE A 1  170 ? -37.399 -30.401 50.409  1.00 89.58  ? 553  ILE A N     1 
ATOM   1116  C  CA    . ILE A 1  170 ? -37.522 -29.926 51.780  1.00 89.82  ? 553  ILE A CA    1 
ATOM   1117  C  C     . ILE A 1  170 ? -39.000 -29.699 52.020  1.00 77.81  ? 553  ILE A C     1 
ATOM   1118  O  O     . ILE A 1  170 ? -39.687 -29.109 51.178  1.00 76.88  ? 553  ILE A O     1 
ATOM   1119  C  CB    . ILE A 1  170 ? -36.718 -28.627 52.020  1.00 81.18  ? 553  ILE A CB    1 
ATOM   1120  C  CG1   . ILE A 1  170 ? -35.232 -28.838 51.716  1.00 92.78  ? 553  ILE A CG1   1 
ATOM   1121  C  CG2   . ILE A 1  170 ? -36.875 -28.127 53.456  1.00 82.88  ? 553  ILE A CG2   1 
ATOM   1122  C  CD1   . ILE A 1  170 ? -34.462 -29.604 52.795  1.00 93.59  ? 553  ILE A CD1   1 
ATOM   1123  N  N     . ALA A 1  171 ? -39.500 -30.205 53.137  1.00 73.48  ? 554  ALA A N     1 
ATOM   1124  C  CA    . ALA A 1  171 ? -40.915 -30.076 53.428  1.00 75.18  ? 554  ALA A CA    1 
ATOM   1125  C  C     . ALA A 1  171 ? -41.086 -30.011 54.926  1.00 73.92  ? 554  ALA A C     1 
ATOM   1126  O  O     . ALA A 1  171 ? -40.212 -30.449 55.682  1.00 78.13  ? 554  ALA A O     1 
ATOM   1127  C  CB    . ALA A 1  171 ? -41.750 -31.229 52.879  1.00 82.01  ? 554  ALA A CB    1 
ATOM   1128  N  N     . LYS A 1  172 ? -42.168 -29.362 55.340  1.00 67.02  ? 555  LYS A N     1 
ATOM   1129  C  CA    . LYS A 1  172 ? -42.530 -29.276 56.741  1.00 65.86  ? 555  LYS A CA    1 
ATOM   1130  C  C     . LYS A 1  172 ? -44.039 -29.362 56.876  1.00 65.94  ? 555  LYS A C     1 
ATOM   1131  O  O     . LYS A 1  172 ? -44.779 -29.058 55.936  1.00 65.40  ? 555  LYS A O     1 
ATOM   1132  C  CB    . LYS A 1  172 ? -41.982 -28.013 57.372  1.00 60.89  ? 555  LYS A CB    1 
ATOM   1133  C  CG    . LYS A 1  172 ? -40.474 -27.993 57.435  1.00 66.18  ? 555  LYS A CG    1 
ATOM   1134  C  CD    . LYS A 1  172 ? -39.987 -28.963 58.482  1.00 74.46  ? 555  LYS A CD    1 
ATOM   1135  C  CE    . LYS A 1  172 ? -38.485 -29.049 58.472  1.00 79.48  ? 555  LYS A CE    1 
ATOM   1136  N  NZ    . LYS A 1  172 ? -38.085 -29.897 57.324  1.00 71.10  ? 555  LYS A NZ    1 
ATOM   1137  N  N     . ARG A 1  173 ? -44.495 -29.876 58.010  1.00 72.00  ? 556  ARG A N     1 
ATOM   1138  C  CA    . ARG A 1  173 ? -45.927 -30.027 58.175  1.00 65.25  ? 556  ARG A CA    1 
ATOM   1139  C  C     . ARG A 1  173 ? -46.291 -29.978 59.648  1.00 67.01  ? 556  ARG A C     1 
ATOM   1140  O  O     . ARG A 1  173 ? -45.454 -30.161 60.528  1.00 68.01  ? 556  ARG A O     1 
ATOM   1141  C  CB    . ARG A 1  173 ? -46.404 -31.320 57.560  1.00 75.08  ? 556  ARG A CB    1 
ATOM   1142  C  CG    . ARG A 1  173 ? -45.940 -32.526 58.341  1.00 85.64  ? 556  ARG A CG    1 
ATOM   1143  C  CD    . ARG A 1  173 ? -46.498 -33.769 57.731  1.00 81.27  ? 556  ARG A CD    1 
ATOM   1144  N  NE    . ARG A 1  173 ? -46.081 -34.948 58.460  1.00 87.22  ? 556  ARG A NE    1 
ATOM   1145  C  CZ    . ARG A 1  173 ? -46.884 -35.574 59.313  1.00 94.32  ? 556  ARG A CZ    1 
ATOM   1146  N  NH1   . ARG A 1  173 ? -48.109 -35.097 59.536  1.00 83.98  ? 556  ARG A NH1   1 
ATOM   1147  N  NH2   . ARG A 1  173 ? -46.474 -36.672 59.939  1.00 99.42  ? 556  ARG A NH2   1 
ATOM   1148  N  N     . PHE A 1  174 ? -47.580 -29.848 59.899  1.00 65.03  ? 557  PHE A N     1 
ATOM   1149  C  CA    . PHE A 1  174 ? -48.139 -30.027 61.228  1.00 70.57  ? 557  PHE A CA    1 
ATOM   1150  C  C     . PHE A 1  174 ? -48.738 -31.420 61.363  1.00 87.51  ? 557  PHE A C     1 
ATOM   1151  O  O     . PHE A 1  174 ? -49.061 -32.083 60.375  1.00 91.87  ? 557  PHE A O     1 
ATOM   1152  C  CB    . PHE A 1  174 ? -49.220 -28.993 61.501  1.00 73.36  ? 557  PHE A CB    1 
ATOM   1153  C  CG    . PHE A 1  174 ? -48.718 -27.590 61.562  1.00 82.52  ? 557  PHE A CG    1 
ATOM   1154  C  CD1   . PHE A 1  174 ? -47.609 -27.276 62.325  1.00 79.41  ? 557  PHE A CD1   1 
ATOM   1155  C  CD2   . PHE A 1  174 ? -49.385 -26.573 60.900  1.00 76.46  ? 557  PHE A CD2   1 
ATOM   1156  C  CE1   . PHE A 1  174 ? -47.160 -25.986 62.401  1.00 73.85  ? 557  PHE A CE1   1 
ATOM   1157  C  CE2   . PHE A 1  174 ? -48.941 -25.293 60.972  1.00 74.17  ? 557  PHE A CE2   1 
ATOM   1158  C  CZ    . PHE A 1  174 ? -47.826 -24.997 61.721  1.00 77.80  ? 557  PHE A CZ    1 
ATOM   1159  N  N     . ARG A 1  175 ? -48.897 -31.875 62.598  1.00 86.55  ? 558  ARG A N     1 
ATOM   1160  C  CA    . ARG A 1  175 ? -49.700 -33.077 62.771  1.00 91.32  ? 558  ARG A CA    1 
ATOM   1161  C  C     . ARG A 1  175 ? -51.179 -32.730 62.637  1.00 78.69  ? 558  ARG A C     1 
ATOM   1162  O  O     . ARG A 1  175 ? -51.666 -31.789 63.266  1.00 82.87  ? 558  ARG A O     1 
ATOM   1163  C  CB    . ARG A 1  175 ? -49.400 -33.764 64.099  1.00 94.78  ? 558  ARG A CB    1 
ATOM   1164  C  CG    . ARG A 1  175 ? -49.272 -35.292 63.973  1.00 85.83  ? 558  ARG A CG    1 
ATOM   1165  C  CD    . ARG A 1  175 ? -48.969 -35.924 65.316  1.00 84.50  ? 558  ARG A CD    1 
ATOM   1166  N  NE    . ARG A 1  175 ? -50.015 -35.614 66.282  1.00 78.31  ? 558  ARG A NE    1 
ATOM   1167  C  CZ    . ARG A 1  175 ? -49.860 -35.665 67.601  1.00 83.15  ? 558  ARG A CZ    1 
ATOM   1168  N  NH1   . ARG A 1  175 ? -48.685 -36.011 68.127  1.00 85.89  ? 558  ARG A NH1   1 
ATOM   1169  N  NH2   . ARG A 1  175 ? -50.879 -35.352 68.396  1.00 78.32  ? 558  ARG A NH2   1 
ATOM   1170  N  N     . TYR A 1  176 ? -51.876 -33.506 61.804  1.00 71.51  ? 559  TYR A N     1 
ATOM   1171  C  CA    . TYR A 1  176 ? -53.196 -33.146 61.302  1.00 63.54  ? 559  TYR A CA    1 
ATOM   1172  C  C     . TYR A 1  176 ? -54.189 -32.911 62.435  1.00 76.07  ? 559  TYR A C     1 
ATOM   1173  O  O     . TYR A 1  176 ? -54.972 -31.949 62.405  1.00 73.91  ? 559  TYR A O     1 
ATOM   1174  C  CB    . TYR A 1  176 ? -53.670 -34.268 60.374  1.00 69.50  ? 559  TYR A CB    1 
ATOM   1175  C  CG    . TYR A 1  176 ? -54.710 -33.873 59.369  1.00 62.62  ? 559  TYR A CG    1 
ATOM   1176  C  CD1   . TYR A 1  176 ? -55.677 -32.949 59.689  1.00 59.59  ? 559  TYR A CD1   1 
ATOM   1177  C  CD2   . TYR A 1  176 ? -54.692 -34.385 58.080  1.00 62.08  ? 559  TYR A CD2   1 
ATOM   1178  C  CE1   . TYR A 1  176 ? -56.613 -32.571 58.798  1.00 64.05  ? 559  TYR A CE1   1 
ATOM   1179  C  CE2   . TYR A 1  176 ? -55.641 -33.993 57.155  1.00 65.86  ? 559  TYR A CE2   1 
ATOM   1180  C  CZ    . TYR A 1  176 ? -56.596 -33.078 57.533  1.00 62.77  ? 559  TYR A CZ    1 
ATOM   1181  O  OH    . TYR A 1  176 ? -57.566 -32.646 56.670  1.00 70.77  ? 559  TYR A OH    1 
ATOM   1182  N  N     . ASP A 1  177 ? -54.188 -33.786 63.437  1.00 80.62  ? 560  ASP A N     1 
ATOM   1183  C  CA    . ASP A 1  177 ? -55.060 -33.580 64.585  1.00 84.76  ? 560  ASP A CA    1 
ATOM   1184  C  C     . ASP A 1  177 ? -54.654 -32.322 65.337  1.00 83.21  ? 560  ASP A C     1 
ATOM   1185  O  O     . ASP A 1  177 ? -55.501 -31.505 65.716  1.00 82.45  ? 560  ASP A O     1 
ATOM   1186  C  CB    . ASP A 1  177 ? -54.999 -34.797 65.499  1.00 79.89  ? 560  ASP A CB    1 
ATOM   1187  C  CG    . ASP A 1  177 ? -53.616 -35.022 66.058  1.00 88.28  ? 560  ASP A CG    1 
ATOM   1188  O  OD1   . ASP A 1  177 ? -52.645 -34.614 65.370  1.00 89.44  ? 560  ASP A OD1   1 
ATOM   1189  O  OD2   . ASP A 1  177 ? -53.501 -35.597 67.170  1.00 91.76  ? 560  ASP A OD2   1 
ATOM   1190  N  N     . SER A 1  178 ? -53.349 -32.172 65.579  1.00 90.89  ? 561  SER A N     1 
ATOM   1191  C  CA    . SER A 1  178 ? -52.832 -31.013 66.296  1.00 86.24  ? 561  SER A CA    1 
ATOM   1192  C  C     . SER A 1  178 ? -53.234 -29.718 65.592  1.00 74.92  ? 561  SER A C     1 
ATOM   1193  O  O     . SER A 1  178 ? -53.697 -28.768 66.236  1.00 65.80  ? 561  SER A O     1 
ATOM   1194  C  CB    . SER A 1  178 ? -51.307 -31.160 66.432  1.00 82.57  ? 561  SER A CB    1 
ATOM   1195  O  OG    . SER A 1  178 ? -50.719 -30.206 67.298  1.00 95.97  ? 561  SER A OG    1 
ATOM   1196  N  N     . ALA A 1  179 ? -53.117 -29.693 64.260  1.00 73.77  ? 562  ALA A N     1 
ATOM   1197  C  CA    . ALA A 1  179 ? -53.544 -28.533 63.480  1.00 73.12  ? 562  ALA A CA    1 
ATOM   1198  C  C     . ALA A 1  179 ? -55.046 -28.306 63.580  1.00 78.69  ? 562  ALA A C     1 
ATOM   1199  O  O     . ALA A 1  179 ? -55.508 -27.158 63.604  1.00 75.90  ? 562  ALA A O     1 
ATOM   1200  C  CB    . ALA A 1  179 ? -53.126 -28.686 62.012  1.00 71.22  ? 562  ALA A CB    1 
ATOM   1201  N  N     . LEU A 1  180 ? -55.828 -29.384 63.609  1.00 79.11  ? 563  LEU A N     1 
ATOM   1202  C  CA    . LEU A 1  180 ? -57.269 -29.243 63.798  1.00 79.17  ? 563  LEU A CA    1 
ATOM   1203  C  C     . LEU A 1  180 ? -57.598 -28.610 65.158  1.00 82.07  ? 563  LEU A C     1 
ATOM   1204  O  O     . LEU A 1  180 ? -58.515 -27.777 65.272  1.00 85.08  ? 563  LEU A O     1 
ATOM   1205  C  CB    . LEU A 1  180 ? -57.914 -30.605 63.615  1.00 74.10  ? 563  LEU A CB    1 
ATOM   1206  C  CG    . LEU A 1  180 ? -58.276 -30.715 62.136  1.00 82.15  ? 563  LEU A CG    1 
ATOM   1207  C  CD1   . LEU A 1  180 ? -58.611 -32.123 61.698  1.00 82.84  ? 563  LEU A CD1   1 
ATOM   1208  C  CD2   . LEU A 1  180 ? -59.444 -29.760 61.895  1.00 77.57  ? 563  LEU A CD2   1 
ATOM   1209  N  N     . VAL A 1  181 ? -56.865 -29.009 66.210  1.00 76.07  ? 564  VAL A N     1 
ATOM   1210  C  CA    . VAL A 1  181 ? -57.015 -28.403 67.536  1.00 68.80  ? 564  VAL A CA    1 
ATOM   1211  C  C     . VAL A 1  181 ? -56.677 -26.917 67.488  1.00 77.15  ? 564  VAL A C     1 
ATOM   1212  O  O     . VAL A 1  181 ? -57.355 -26.075 68.097  1.00 78.46  ? 564  VAL A O     1 
ATOM   1213  C  CB    . VAL A 1  181 ? -56.120 -29.123 68.556  1.00 71.97  ? 564  VAL A CB    1 
ATOM   1214  C  CG1   . VAL A 1  181 ? -56.211 -28.455 69.906  1.00 91.65  ? 564  VAL A CG1   1 
ATOM   1215  C  CG2   . VAL A 1  181 ? -56.494 -30.567 68.687  1.00 84.36  ? 564  VAL A CG2   1 
ATOM   1216  N  N     . SER A 1  182 ? -55.547 -26.583 66.862  1.00 81.81  ? 565  SER A N     1 
ATOM   1217  C  CA    . SER A 1  182 ? -55.138 -25.185 66.839  1.00 77.50  ? 565  SER A CA    1 
ATOM   1218  C  C     . SER A 1  182 ? -56.163 -24.344 66.100  1.00 71.96  ? 565  SER A C     1 
ATOM   1219  O  O     . SER A 1  182 ? -56.521 -23.248 66.551  1.00 82.31  ? 565  SER A O     1 
ATOM   1220  C  CB    . SER A 1  182 ? -53.765 -25.030 66.187  1.00 78.53  ? 565  SER A CB    1 
ATOM   1221  O  OG    . SER A 1  182 ? -53.274 -23.705 66.350  1.00 75.97  ? 565  SER A OG    1 
ATOM   1222  N  N     . ALA A 1  183 ? -56.697 -24.871 64.999  1.00 65.81  ? 566  ALA A N     1 
ATOM   1223  C  CA    . ALA A 1  183 ? -57.670 -24.110 64.229  1.00 68.36  ? 566  ALA A CA    1 
ATOM   1224  C  C     . ALA A 1  183 ? -58.956 -23.896 65.022  1.00 71.33  ? 566  ALA A C     1 
ATOM   1225  O  O     . ALA A 1  183 ? -59.536 -22.799 65.008  1.00 75.13  ? 566  ALA A O     1 
ATOM   1226  C  CB    . ALA A 1  183 ? -57.973 -24.836 62.920  1.00 76.66  ? 566  ALA A CB    1 
ATOM   1227  N  N     . LEU A 1  184 ? -59.404 -24.932 65.736  1.00 79.09  ? 567  LEU A N     1 
ATOM   1228  C  CA    . LEU A 1  184 ? -60.626 -24.824 66.525  1.00 84.15  ? 567  LEU A CA    1 
ATOM   1229  C  C     . LEU A 1  184 ? -60.473 -23.805 67.642  1.00 76.81  ? 567  LEU A C     1 
ATOM   1230  O  O     . LEU A 1  184 ? -61.358 -22.960 67.856  1.00 75.62  ? 567  LEU A O     1 
ATOM   1231  C  CB    . LEU A 1  184 ? -60.968 -26.193 67.095  1.00 77.87  ? 567  LEU A CB    1 
ATOM   1232  C  CG    . LEU A 1  184 ? -61.641 -27.082 66.067  1.00 67.56  ? 567  LEU A CG    1 
ATOM   1233  C  CD1   . LEU A 1  184 ? -61.949 -28.402 66.698  1.00 76.09  ? 567  LEU A CD1   1 
ATOM   1234  C  CD2   . LEU A 1  184 ? -62.892 -26.399 65.529  1.00 68.60  ? 567  LEU A CD2   1 
ATOM   1235  N  N     . MET A 1  185 ? -59.354 -23.872 68.366  1.00 74.65  ? 568  MET A N     1 
ATOM   1236  C  CA    . MET A 1  185 ? -59.128 -22.902 69.424  1.00 74.44  ? 568  MET A CA    1 
ATOM   1237  C  C     . MET A 1  185 ? -59.074 -21.490 68.864  1.00 84.37  ? 568  MET A C     1 
ATOM   1238  O  O     . MET A 1  185 ? -59.604 -20.553 69.473  1.00 92.26  ? 568  MET A O     1 
ATOM   1239  C  CB    . MET A 1  185 ? -57.840 -23.242 70.156  1.00 78.56  ? 568  MET A CB    1 
ATOM   1240  C  CG    . MET A 1  185 ? -57.903 -24.539 70.927  1.00 80.96  ? 568  MET A CG    1 
ATOM   1241  S  SD    . MET A 1  185 ? -59.197 -24.527 72.175  1.00 113.52 ? 568  MET A SD    1 
ATOM   1242  C  CE    . MET A 1  185 ? -58.434 -23.489 73.408  1.00 98.66  ? 568  MET A CE    1 
ATOM   1243  N  N     . ASP A 1  186 ? -58.484 -21.326 67.675  1.00 85.68  ? 569  ASP A N     1 
ATOM   1244  C  CA    . ASP A 1  186 ? -58.500 -20.028 67.007  1.00 74.76  ? 569  ASP A CA    1 
ATOM   1245  C  C     . ASP A 1  186 ? -59.935 -19.536 66.814  1.00 80.54  ? 569  ASP A C     1 
ATOM   1246  O  O     . ASP A 1  186 ? -60.264 -18.415 67.190  1.00 85.04  ? 569  ASP A O     1 
ATOM   1247  C  CB    . ASP A 1  186 ? -57.757 -20.149 65.666  1.00 87.13  ? 569  ASP A CB    1 
ATOM   1248  C  CG    . ASP A 1  186 ? -57.719 -18.828 64.856  1.00 95.28  ? 569  ASP A CG    1 
ATOM   1249  O  OD1   . ASP A 1  186 ? -57.964 -18.920 63.623  1.00 87.88  ? 569  ASP A OD1   1 
ATOM   1250  O  OD2   . ASP A 1  186 ? -57.451 -17.724 65.401  1.00 92.48  ? 569  ASP A OD2   1 
ATOM   1251  N  N     . MET A 1  187 ? -60.840 -20.397 66.338  1.00 86.88  ? 570  MET A N     1 
ATOM   1252  C  CA    . MET A 1  187 ? -62.194 -19.903 66.078  1.00 91.34  ? 570  MET A CA    1 
ATOM   1253  C  C     . MET A 1  187 ? -63.123 -20.002 67.279  1.00 91.38  ? 570  MET A C     1 
ATOM   1254  O  O     . MET A 1  187 ? -64.329 -19.815 67.119  1.00 97.89  ? 570  MET A O     1 
ATOM   1255  C  CB    . MET A 1  187 ? -62.817 -20.605 64.879  1.00 89.23  ? 570  MET A CB    1 
ATOM   1256  C  CG    . MET A 1  187 ? -62.480 -22.076 64.739  1.00 86.65  ? 570  MET A CG    1 
ATOM   1257  S  SD    . MET A 1  187 ? -63.375 -22.588 63.280  1.00 96.75  ? 570  MET A SD    1 
ATOM   1258  C  CE    . MET A 1  187 ? -62.736 -21.414 62.111  1.00 93.50  ? 570  MET A CE    1 
ATOM   1259  N  N     . GLU A 1  188 ? -62.593 -20.330 68.461  1.00 92.03  ? 571  GLU A N     1 
ATOM   1260  C  CA    . GLU A 1  188 ? -63.415 -20.360 69.674  1.00 94.57  ? 571  GLU A CA    1 
ATOM   1261  C  C     . GLU A 1  188 ? -64.378 -19.179 69.835  1.00 85.97  ? 571  GLU A C     1 
ATOM   1262  O  O     . GLU A 1  188 ? -65.553 -19.364 70.173  1.00 86.68  ? 571  GLU A O     1 
ATOM   1263  C  CB    . GLU A 1  188 ? -62.487 -20.422 70.883  1.00 94.36  ? 571  GLU A CB    1 
ATOM   1264  C  CG    . GLU A 1  188 ? -63.204 -20.273 72.190  1.00 96.27  ? 571  GLU A CG    1 
ATOM   1265  C  CD    . GLU A 1  188 ? -62.253 -20.269 73.371  1.00 108.06 ? 571  GLU A CD    1 
ATOM   1266  O  OE1   . GLU A 1  188 ? -62.309 -21.212 74.189  1.00 121.05 ? 571  GLU A OE1   1 
ATOM   1267  O  OE2   . GLU A 1  188 ? -61.439 -19.321 73.481  1.00 118.34 ? 571  GLU A OE2   1 
ATOM   1268  N  N     . GLU A 1  189 ? -63.887 -17.947 69.679  1.00 92.85  ? 572  GLU A N     1 
ATOM   1269  C  CA    . GLU A 1  189 ? -64.789 -16.817 69.885  1.00 101.55 ? 572  GLU A CA    1 
ATOM   1270  C  C     . GLU A 1  189 ? -65.927 -16.841 68.874  1.00 100.72 ? 572  GLU A C     1 
ATOM   1271  O  O     . GLU A 1  189 ? -67.073 -16.542 69.222  1.00 107.06 ? 572  GLU A O     1 
ATOM   1272  C  CB    . GLU A 1  189 ? -64.057 -15.463 69.817  1.00 115.44 ? 572  GLU A CB    1 
ATOM   1273  C  CG    . GLU A 1  189 ? -63.168 -15.105 71.023  1.00 127.79 ? 572  GLU A CG    1 
ATOM   1274  C  CD    . GLU A 1  189 ? -62.638 -13.642 71.028  1.00 142.10 ? 572  GLU A CD    1 
ATOM   1275  O  OE1   . GLU A 1  189 ? -61.855 -13.286 71.950  1.00 144.62 ? 572  GLU A OE1   1 
ATOM   1276  O  OE2   . GLU A 1  189 ? -62.992 -12.849 70.122  1.00 135.56 ? 572  GLU A OE2   1 
ATOM   1277  N  N     . ASP A 1  190 ? -65.640 -17.218 67.619  1.00 94.87  ? 573  ASP A N     1 
ATOM   1278  C  CA    . ASP A 1  190 ? -66.709 -17.259 66.624  1.00 96.38  ? 573  ASP A CA    1 
ATOM   1279  C  C     . ASP A 1  190 ? -67.691 -18.379 66.921  1.00 92.40  ? 573  ASP A C     1 
ATOM   1280  O  O     . ASP A 1  190 ? -68.888 -18.228 66.672  1.00 98.38  ? 573  ASP A O     1 
ATOM   1281  C  CB    . ASP A 1  190 ? -66.164 -17.441 65.205  1.00 103.69 ? 573  ASP A CB    1 
ATOM   1282  C  CG    . ASP A 1  190 ? -65.204 -16.344 64.775  1.00 111.95 ? 573  ASP A CG    1 
ATOM   1283  O  OD1   . ASP A 1  190 ? -64.071 -16.285 65.302  1.00 111.86 ? 573  ASP A OD1   1 
ATOM   1284  O  OD2   . ASP A 1  190 ? -65.581 -15.550 63.883  1.00 124.00 ? 573  ASP A OD2   1 
ATOM   1285  N  N     . ILE A 1  191 ? -67.210 -19.489 67.479  1.00 87.64  ? 574  ILE A N     1 
ATOM   1286  C  CA    . ILE A 1  191 ? -68.105 -20.592 67.818  1.00 90.14  ? 574  ILE A CA    1 
ATOM   1287  C  C     . ILE A 1  191 ? -69.046 -20.167 68.940  1.00 95.92  ? 574  ILE A C     1 
ATOM   1288  O  O     . ILE A 1  191 ? -70.263 -20.357 68.854  1.00 99.84  ? 574  ILE A O     1 
ATOM   1289  C  CB    . ILE A 1  191 ? -67.305 -21.855 68.202  1.00 90.88  ? 574  ILE A CB    1 
ATOM   1290  C  CG1   . ILE A 1  191 ? -66.497 -22.405 67.019  1.00 88.57  ? 574  ILE A CG1   1 
ATOM   1291  C  CG2   . ILE A 1  191 ? -68.226 -22.968 68.738  1.00 88.53  ? 574  ILE A CG2   1 
ATOM   1292  C  CD1   . ILE A 1  191 ? -65.610 -23.599 67.382  1.00 82.08  ? 574  ILE A CD1   1 
ATOM   1293  N  N     . LEU A 1  192 ? -68.500 -19.577 70.000  1.00 98.83  ? 575  LEU A N     1 
ATOM   1294  C  CA    . LEU A 1  192 ? -69.348 -19.113 71.100  1.00 89.79  ? 575  LEU A CA    1 
ATOM   1295  C  C     . LEU A 1  192 ? -70.324 -18.049 70.599  1.00 94.87  ? 575  LEU A C     1 
ATOM   1296  O  O     . LEU A 1  192 ? -71.524 -18.131 70.864  1.00 109.83 ? 575  LEU A O     1 
ATOM   1297  C  CB    . LEU A 1  192 ? -68.487 -18.615 72.269  1.00 89.30  ? 575  LEU A CB    1 
ATOM   1298  C  CG    . LEU A 1  192 ? -67.436 -19.617 72.782  1.00 95.47  ? 575  LEU A CG    1 
ATOM   1299  C  CD1   . LEU A 1  192 ? -66.740 -19.031 73.980  1.00 111.87 ? 575  LEU A CD1   1 
ATOM   1300  C  CD2   . LEU A 1  192 ? -67.949 -21.019 73.100  1.00 84.35  ? 575  LEU A CD2   1 
ATOM   1301  N  N     . GLU A 1  193 ? -69.847 -17.070 69.819  1.00 99.17  ? 576  GLU A N     1 
ATOM   1302  C  CA    . GLU A 1  193 ? -70.759 -16.051 69.302  1.00 100.57 ? 576  GLU A CA    1 
ATOM   1303  C  C     . GLU A 1  193 ? -71.804 -16.648 68.363  1.00 104.84 ? 576  GLU A C     1 
ATOM   1304  O  O     . GLU A 1  193 ? -72.926 -16.137 68.281  1.00 108.10 ? 576  GLU A O     1 
ATOM   1305  C  CB    . GLU A 1  193 ? -69.997 -14.950 68.560  1.00 111.86 ? 576  GLU A CB    1 
ATOM   1306  C  CG    . GLU A 1  193 ? -70.875 -13.725 68.280  1.00 134.18 ? 576  GLU A CG    1 
ATOM   1307  C  CD    . GLU A 1  193 ? -70.527 -13.029 66.972  1.00 147.68 ? 576  GLU A CD    1 
ATOM   1308  O  OE1   . GLU A 1  193 ? -69.464 -13.343 66.394  1.00 139.60 ? 576  GLU A OE1   1 
ATOM   1309  O  OE2   . GLU A 1  193 ? -71.321 -12.167 66.522  1.00 152.07 ? 576  GLU A OE2   1 
ATOM   1310  N  N     . GLY A 1  194 ? -71.458 -17.715 67.639  1.00 109.04 ? 577  GLY A N     1 
ATOM   1311  C  CA    . GLY A 1  194 ? -72.414 -18.332 66.741  1.00 106.96 ? 577  GLY A CA    1 
ATOM   1312  C  C     . GLY A 1  194 ? -73.487 -19.098 67.481  1.00 111.28 ? 577  GLY A C     1 
ATOM   1313  O  O     . GLY A 1  194 ? -74.647 -19.104 67.066  1.00 116.04 ? 577  GLY A O     1 
ATOM   1314  N  N     . MET A 1  195 ? -73.108 -19.798 68.555  1.00 107.36 ? 578  MET A N     1 
ATOM   1315  C  CA    . MET A 1  195 ? -74.112 -20.403 69.432  1.00 109.84 ? 578  MET A CA    1 
ATOM   1316  C  C     . MET A 1  195 ? -75.026 -19.345 70.047  1.00 121.77 ? 578  MET A C     1 
ATOM   1317  O  O     . MET A 1  195 ? -76.245 -19.537 70.124  1.00 129.69 ? 578  MET A O     1 
ATOM   1318  C  CB    . MET A 1  195 ? -73.467 -21.253 70.526  1.00 105.03 ? 578  MET A CB    1 
ATOM   1319  C  CG    . MET A 1  195 ? -72.886 -22.555 70.043  1.00 101.48 ? 578  MET A CG    1 
ATOM   1320  S  SD    . MET A 1  195 ? -72.101 -23.455 71.390  1.00 94.67  ? 578  MET A SD    1 
ATOM   1321  C  CE    . MET A 1  195 ? -71.191 -22.122 72.156  1.00 111.32 ? 578  MET A CE    1 
ATOM   1322  N  N     . ARG A 1  196 ? -74.451 -18.238 70.531  1.00 114.14 ? 579  ARG A N     1 
ATOM   1323  C  CA    . ARG A 1  196 ? -75.275 -17.150 71.052  1.00 107.80 ? 579  ARG A CA    1 
ATOM   1324  C  C     . ARG A 1  196 ? -76.248 -16.630 69.999  1.00 108.25 ? 579  ARG A C     1 
ATOM   1325  O  O     . ARG A 1  196 ? -77.435 -16.435 70.283  1.00 118.14 ? 579  ARG A O     1 
ATOM   1326  C  CB    . ARG A 1  196 ? -74.387 -16.039 71.620  1.00 105.92 ? 579  ARG A CB    1 
ATOM   1327  C  CG    . ARG A 1  196 ? -73.939 -16.334 73.052  1.00 105.72 ? 579  ARG A CG    1 
ATOM   1328  C  CD    . ARG A 1  196 ? -73.172 -15.206 73.747  1.00 105.98 ? 579  ARG A CD    1 
ATOM   1329  N  NE    . ARG A 1  196 ? -71.742 -15.497 73.846  1.00 103.93 ? 579  ARG A NE    1 
ATOM   1330  C  CZ    . ARG A 1  196 ? -70.773 -14.939 73.121  1.00 116.74 ? 579  ARG A CZ    1 
ATOM   1331  N  NH1   . ARG A 1  196 ? -69.513 -15.315 73.323  1.00 118.89 ? 579  ARG A NH1   1 
ATOM   1332  N  NH2   . ARG A 1  196 ? -71.041 -14.008 72.209  1.00 118.52 ? 579  ARG A NH2   1 
ATOM   1333  N  N     . SER A 1  197 ? -75.767 -16.384 68.777  1.00 115.27 ? 580  SER A N     1 
ATOM   1334  C  CA    . SER A 1  197 ? -76.636 -15.813 67.749  1.00 116.80 ? 580  SER A CA    1 
ATOM   1335  C  C     . SER A 1  197 ? -77.736 -16.776 67.316  1.00 116.59 ? 580  SER A C     1 
ATOM   1336  O  O     . SER A 1  197 ? -78.732 -16.327 66.740  1.00 118.29 ? 580  SER A O     1 
ATOM   1337  C  CB    . SER A 1  197 ? -75.819 -15.354 66.530  1.00 117.00 ? 580  SER A CB    1 
ATOM   1338  O  OG    . SER A 1  197 ? -75.542 -16.415 65.633  1.00 122.08 ? 580  SER A OG    1 
ATOM   1339  N  N     . GLN A 1  198 ? -77.580 -18.078 67.586  1.00 117.56 ? 581  GLN A N     1 
ATOM   1340  C  CA    . GLN A 1  198 ? -78.602 -19.089 67.336  1.00 120.70 ? 581  GLN A CA    1 
ATOM   1341  C  C     . GLN A 1  198 ? -79.462 -19.378 68.559  1.00 126.66 ? 581  GLN A C     1 
ATOM   1342  O  O     . GLN A 1  198 ? -80.197 -20.372 68.559  1.00 129.85 ? 581  GLN A O     1 
ATOM   1343  C  CB    . GLN A 1  198 ? -77.956 -20.392 66.856  1.00 116.77 ? 581  GLN A CB    1 
ATOM   1344  C  CG    . GLN A 1  198 ? -77.505 -20.396 65.402  1.00 120.75 ? 581  GLN A CG    1 
ATOM   1345  C  CD    . GLN A 1  198 ? -78.664 -20.285 64.427  1.00 121.43 ? 581  GLN A CD    1 
ATOM   1346  O  OE1   . GLN A 1  198 ? -79.362 -21.261 64.164  1.00 132.76 ? 581  GLN A OE1   1 
ATOM   1347  N  NE2   . GLN A 1  198 ? -78.875 -19.091 63.890  1.00 117.00 ? 581  GLN A NE2   1 
ATOM   1348  N  N     . ASP A 1  199 ? -79.391 -18.534 69.594  1.00 131.61 ? 582  ASP A N     1 
ATOM   1349  C  CA    . ASP A 1  199 ? -80.169 -18.701 70.825  1.00 133.58 ? 582  ASP A CA    1 
ATOM   1350  C  C     . ASP A 1  199 ? -79.804 -19.998 71.555  1.00 127.58 ? 582  ASP A C     1 
ATOM   1351  O  O     . ASP A 1  199 ? -80.674 -20.717 72.051  1.00 134.43 ? 582  ASP A O     1 
ATOM   1352  C  CB    . ASP A 1  199 ? -81.679 -18.610 70.557  1.00 142.86 ? 582  ASP A CB    1 
ATOM   1353  C  CG    . ASP A 1  199 ? -82.111 -17.234 69.998  1.00 150.65 ? 582  ASP A CG    1 
ATOM   1354  O  OD1   . ASP A 1  199 ? -81.684 -16.177 70.532  1.00 140.61 ? 582  ASP A OD1   1 
ATOM   1355  O  OD2   . ASP A 1  199 ? -82.891 -17.214 69.016  1.00 155.73 ? 582  ASP A OD2   1 
ATOM   1356  N  N     . LEU A 1  200 ? -78.526 -20.360 71.531  1.00 121.01 ? 583  LEU A N     1 
ATOM   1357  C  CA    . LEU A 1  200 ? -78.000 -21.491 72.281  1.00 120.69 ? 583  LEU A CA    1 
ATOM   1358  C  C     . LEU A 1  200 ? -77.027 -21.005 73.357  1.00 122.02 ? 583  LEU A C     1 
ATOM   1359  O  O     . LEU A 1  200 ? -76.573 -19.858 73.353  1.00 127.17 ? 583  LEU A O     1 
ATOM   1360  C  CB    . LEU A 1  200 ? -77.330 -22.492 71.336  1.00 127.85 ? 583  LEU A CB    1 
ATOM   1361  C  CG    . LEU A 1  200 ? -78.225 -23.587 70.747  1.00 126.23 ? 583  LEU A CG    1 
ATOM   1362  C  CD1   . LEU A 1  200 ? -79.339 -23.003 69.901  1.00 124.66 ? 583  LEU A CD1   1 
ATOM   1363  C  CD2   . LEU A 1  200 ? -77.394 -24.543 69.921  1.00 124.17 ? 583  LEU A CD2   1 
ATOM   1364  N  N     . ASP A 1  201 ? -76.677 -21.906 74.268  1.00 118.91 ? 584  ASP A N     1 
ATOM   1365  C  CA    . ASP A 1  201 ? -75.892 -21.557 75.448  1.00 128.34 ? 584  ASP A CA    1 
ATOM   1366  C  C     . ASP A 1  201 ? -74.387 -21.634 75.214  1.00 126.37 ? 584  ASP A C     1 
ATOM   1367  O  O     . ASP A 1  201 ? -73.899 -22.544 74.545  1.00 138.82 ? 584  ASP A O     1 
ATOM   1368  C  CB    . ASP A 1  201 ? -76.275 -22.477 76.608  1.00 137.46 ? 584  ASP A CB    1 
ATOM   1369  C  CG    . ASP A 1  201 ? -77.115 -21.771 77.654  1.00 147.81 ? 584  ASP A CG    1 
ATOM   1370  O  OD1   . ASP A 1  201 ? -76.773 -20.620 78.019  1.00 157.67 ? 584  ASP A OD1   1 
ATOM   1371  O  OD2   . ASP A 1  201 ? -78.091 -22.380 78.150  1.00 144.30 ? 584  ASP A OD2   1 
ATOM   1372  N  N     . ASP A 1  202 ? -73.653 -20.667 75.780  1.00 126.45 ? 585  ASP A N     1 
ATOM   1373  C  CA    . ASP A 1  202 ? -72.192 -20.681 75.701  1.00 123.94 ? 585  ASP A CA    1 
ATOM   1374  C  C     . ASP A 1  202 ? -71.608 -21.959 76.293  1.00 121.31 ? 585  ASP A C     1 
ATOM   1375  O  O     . ASP A 1  202 ? -70.626 -22.500 75.771  1.00 117.93 ? 585  ASP A O     1 
ATOM   1376  C  CB    . ASP A 1  202 ? -71.605 -19.457 76.413  1.00 127.37 ? 585  ASP A CB    1 
ATOM   1377  C  CG    . ASP A 1  202 ? -71.507 -18.239 75.506  1.00 130.99 ? 585  ASP A CG    1 
ATOM   1378  O  OD1   . ASP A 1  202 ? -70.955 -17.196 75.937  1.00 124.30 ? 585  ASP A OD1   1 
ATOM   1379  O  OD2   . ASP A 1  202 ? -72.024 -18.318 74.372  1.00 131.36 ? 585  ASP A OD2   1 
ATOM   1380  N  N     . TYR A 1  203 ? -72.177 -22.439 77.401  1.00 125.14 ? 586  TYR A N     1 
ATOM   1381  C  CA    . TYR A 1  203 ? -71.584 -23.543 78.151  1.00 126.12 ? 586  TYR A CA    1 
ATOM   1382  C  C     . TYR A 1  203 ? -71.993 -24.916 77.631  1.00 134.74 ? 586  TYR A C     1 
ATOM   1383  O  O     . TYR A 1  203 ? -71.526 -25.928 78.177  1.00 135.45 ? 586  TYR A O     1 
ATOM   1384  C  CB    . TYR A 1  203 ? -71.963 -23.455 79.627  1.00 132.14 ? 586  TYR A CB    1 
ATOM   1385  C  CG    . TYR A 1  203 ? -73.435 -23.252 79.858  1.00 140.62 ? 586  TYR A CG    1 
ATOM   1386  C  CD1   . TYR A 1  203 ? -74.334 -24.313 79.775  1.00 142.59 ? 586  TYR A CD1   1 
ATOM   1387  C  CD2   . TYR A 1  203 ? -73.937 -21.986 80.096  1.00 151.01 ? 586  TYR A CD2   1 
ATOM   1388  C  CE1   . TYR A 1  203 ? -75.685 -24.119 79.974  1.00 143.94 ? 586  TYR A CE1   1 
ATOM   1389  C  CE2   . TYR A 1  203 ? -75.281 -21.778 80.292  1.00 151.62 ? 586  TYR A CE2   1 
ATOM   1390  C  CZ    . TYR A 1  203 ? -76.149 -22.848 80.243  1.00 147.57 ? 586  TYR A CZ    1 
ATOM   1391  O  OH    . TYR A 1  203 ? -77.486 -22.603 80.429  1.00 144.68 ? 586  TYR A OH    1 
ATOM   1392  N  N     . LEU A 1  204 ? -72.925 -24.979 76.678  1.00 135.44 ? 587  LEU A N     1 
ATOM   1393  C  CA    . LEU A 1  204 ? -73.338 -26.253 76.097  1.00 129.99 ? 587  LEU A CA    1 
ATOM   1394  C  C     . LEU A 1  204 ? -72.142 -26.975 75.485  1.00 124.09 ? 587  LEU A C     1 
ATOM   1395  O  O     . LEU A 1  204 ? -71.289 -26.355 74.845  1.00 130.62 ? 587  LEU A O     1 
ATOM   1396  C  CB    . LEU A 1  204 ? -74.417 -26.008 75.045  1.00 119.31 ? 587  LEU A CB    1 
ATOM   1397  C  CG    . LEU A 1  204 ? -75.058 -27.223 74.389  1.00 126.99 ? 587  LEU A CG    1 
ATOM   1398  C  CD1   . LEU A 1  204 ? -75.390 -28.293 75.419  1.00 127.73 ? 587  LEU A CD1   1 
ATOM   1399  C  CD2   . LEU A 1  204 ? -76.302 -26.751 73.657  1.00 131.57 ? 587  LEU A CD2   1 
ATOM   1400  N  N     . ASN A 1  205 ? -72.102 -28.299 75.634  1.00 116.04 ? 588  ASN A N     1 
ATOM   1401  C  CA    . ASN A 1  205 ? -70.963 -29.069 75.148  1.00 118.81 ? 588  ASN A CA    1 
ATOM   1402  C  C     . ASN A 1  205 ? -71.329 -30.220 74.218  1.00 125.19 ? 588  ASN A C     1 
ATOM   1403  O  O     . ASN A 1  205 ? -70.437 -31.000 73.857  1.00 116.73 ? 588  ASN A O     1 
ATOM   1404  C  CB    . ASN A 1  205 ? -70.168 -29.652 76.321  1.00 119.18 ? 588  ASN A CB    1 
ATOM   1405  C  CG    . ASN A 1  205 ? -70.947 -30.710 77.057  1.00 129.71 ? 588  ASN A CG    1 
ATOM   1406  O  OD1   . ASN A 1  205 ? -72.109 -30.494 77.398  1.00 139.26 ? 588  ASN A OD1   1 
ATOM   1407  N  ND2   . ASN A 1  205 ? -70.335 -31.876 77.270  1.00 112.12 ? 588  ASN A ND2   1 
ATOM   1408  N  N     . GLY A 1  206 ? -72.609 -30.384 73.868  1.00 126.19 ? 589  GLY A N     1 
ATOM   1409  C  CA    . GLY A 1  206 ? -73.053 -31.481 73.036  1.00 123.25 ? 589  GLY A CA    1 
ATOM   1410  C  C     . GLY A 1  206 ? -72.261 -31.574 71.749  1.00 123.21 ? 589  GLY A C     1 
ATOM   1411  O  O     . GLY A 1  206 ? -71.726 -30.572 71.262  1.00 128.46 ? 589  GLY A O     1 
ATOM   1412  N  N     . PRO A 1  207 ? -72.212 -32.770 71.152  1.00 127.31 ? 590  PRO A N     1 
ATOM   1413  C  CA    . PRO A 1  207 ? -71.228 -33.054 70.086  1.00 121.62 ? 590  PRO A CA    1 
ATOM   1414  C  C     . PRO A 1  207 ? -71.299 -32.080 68.918  1.00 118.12 ? 590  PRO A C     1 
ATOM   1415  O  O     . PRO A 1  207 ? -72.328 -31.954 68.247  1.00 120.67 ? 590  PRO A O     1 
ATOM   1416  C  CB    . PRO A 1  207 ? -71.591 -34.480 69.651  1.00 107.30 ? 590  PRO A CB    1 
ATOM   1417  C  CG    . PRO A 1  207 ? -72.235 -35.072 70.839  1.00 124.24 ? 590  PRO A CG    1 
ATOM   1418  C  CD    . PRO A 1  207 ? -73.029 -33.954 71.457  1.00 123.27 ? 590  PRO A CD    1 
ATOM   1419  N  N     . PHE A 1  208 ? -70.189 -31.382 68.684  1.00 102.28 ? 591  PHE A N     1 
ATOM   1420  C  CA    . PHE A 1  208 ? -70.073 -30.533 67.514  1.00 102.99 ? 591  PHE A CA    1 
ATOM   1421  C  C     . PHE A 1  208 ? -69.558 -31.350 66.344  1.00 98.78  ? 591  PHE A C     1 
ATOM   1422  O  O     . PHE A 1  208 ? -68.755 -32.274 66.504  1.00 92.55  ? 591  PHE A O     1 
ATOM   1423  C  CB    . PHE A 1  208 ? -69.109 -29.368 67.744  1.00 102.01 ? 591  PHE A CB    1 
ATOM   1424  C  CG    . PHE A 1  208 ? -69.553 -28.375 68.775  1.00 95.10  ? 591  PHE A CG    1 
ATOM   1425  C  CD1   . PHE A 1  208 ? -69.123 -28.485 70.086  1.00 95.94  ? 591  PHE A CD1   1 
ATOM   1426  C  CD2   . PHE A 1  208 ? -70.350 -27.305 68.423  1.00 99.70  ? 591  PHE A CD2   1 
ATOM   1427  C  CE1   . PHE A 1  208 ? -69.502 -27.566 71.034  1.00 96.93  ? 591  PHE A CE1   1 
ATOM   1428  C  CE2   . PHE A 1  208 ? -70.738 -26.371 69.368  1.00 101.97 ? 591  PHE A CE2   1 
ATOM   1429  C  CZ    . PHE A 1  208 ? -70.314 -26.503 70.677  1.00 105.63 ? 591  PHE A CZ    1 
ATOM   1430  N  N     . THR A 1  209 ? -69.999 -30.976 65.155  1.00 99.70  ? 592  THR A N     1 
ATOM   1431  C  CA    . THR A 1  209 ? -69.536 -31.593 63.927  1.00 96.31  ? 592  THR A CA    1 
ATOM   1432  C  C     . THR A 1  209 ? -68.837 -30.544 63.082  1.00 94.52  ? 592  THR A C     1 
ATOM   1433  O  O     . THR A 1  209 ? -69.350 -29.432 62.911  1.00 97.12  ? 592  THR A O     1 
ATOM   1434  C  CB    . THR A 1  209 ? -70.692 -32.226 63.171  1.00 98.35  ? 592  THR A CB    1 
ATOM   1435  O  OG1   . THR A 1  209 ? -71.213 -33.295 63.966  1.00 113.16 ? 592  THR A OG1   1 
ATOM   1436  C  CG2   . THR A 1  209 ? -70.216 -32.789 61.851  1.00 90.36  ? 592  THR A CG2   1 
ATOM   1437  N  N     . VAL A 1  210 ? -67.664 -30.905 62.575  1.00 94.65  ? 593  VAL A N     1 
ATOM   1438  C  CA    . VAL A 1  210 ? -66.791 -30.018 61.821  1.00 88.02  ? 593  VAL A CA    1 
ATOM   1439  C  C     . VAL A 1  210 ? -66.689 -30.575 60.408  1.00 85.98  ? 593  VAL A C     1 
ATOM   1440  O  O     . VAL A 1  210 ? -66.201 -31.694 60.209  1.00 89.57  ? 593  VAL A O     1 
ATOM   1441  C  CB    . VAL A 1  210 ? -65.404 -29.919 62.465  1.00 86.94  ? 593  VAL A CB    1 
ATOM   1442  C  CG1   . VAL A 1  210 ? -64.615 -28.821 61.811  1.00 93.20  ? 593  VAL A CG1   1 
ATOM   1443  C  CG2   . VAL A 1  210 ? -65.498 -29.719 63.981  1.00 79.83  ? 593  VAL A CG2   1 
ATOM   1444  N  N     . VAL A 1  211 ? -67.123 -29.802 59.416  1.00 86.11  ? 594  VAL A N     1 
ATOM   1445  C  CA    . VAL A 1  211 ? -66.972 -30.191 58.019  1.00 81.19  ? 594  VAL A CA    1 
ATOM   1446  C  C     . VAL A 1  211 ? -65.681 -29.542 57.520  1.00 81.71  ? 594  VAL A C     1 
ATOM   1447  O  O     . VAL A 1  211 ? -65.620 -28.335 57.296  1.00 91.66  ? 594  VAL A O     1 
ATOM   1448  C  CB    . VAL A 1  211 ? -68.185 -29.779 57.184  1.00 85.05  ? 594  VAL A CB    1 
ATOM   1449  C  CG1   . VAL A 1  211 ? -68.115 -30.397 55.811  1.00 90.42  ? 594  VAL A CG1   1 
ATOM   1450  C  CG2   . VAL A 1  211 ? -69.461 -30.188 57.876  1.00 91.20  ? 594  VAL A CG2   1 
ATOM   1451  N  N     . VAL A 1  212 ? -64.638 -30.343 57.357  1.00 75.18  ? 595  VAL A N     1 
ATOM   1452  C  CA    . VAL A 1  212 ? -63.323 -29.865 56.946  1.00 75.62  ? 595  VAL A CA    1 
ATOM   1453  C  C     . VAL A 1  212 ? -63.174 -30.074 55.447  1.00 73.95  ? 595  VAL A C     1 
ATOM   1454  O  O     . VAL A 1  212 ? -63.272 -31.207 54.969  1.00 89.09  ? 595  VAL A O     1 
ATOM   1455  C  CB    . VAL A 1  212 ? -62.212 -30.609 57.713  1.00 80.45  ? 595  VAL A CB    1 
ATOM   1456  C  CG1   . VAL A 1  212 ? -60.854 -30.376 57.075  1.00 79.35  ? 595  VAL A CG1   1 
ATOM   1457  C  CG2   . VAL A 1  212 ? -62.201 -30.194 59.178  1.00 82.60  ? 595  VAL A CG2   1 
ATOM   1458  N  N     . LYS A 1  213 ? -62.943 -29.002 54.695  1.00 79.21  ? 596  LYS A N     1 
ATOM   1459  C  CA    . LYS A 1  213 ? -62.618 -29.132 53.275  1.00 80.89  ? 596  LYS A CA    1 
ATOM   1460  C  C     . LYS A 1  213 ? -61.113 -29.303 53.118  1.00 81.11  ? 596  LYS A C     1 
ATOM   1461  O  O     . LYS A 1  213 ? -60.345 -28.446 53.562  1.00 84.00  ? 596  LYS A O     1 
ATOM   1462  C  CB    . LYS A 1  213 ? -63.096 -27.921 52.473  1.00 81.08  ? 596  LYS A CB    1 
ATOM   1463  C  CG    . LYS A 1  213 ? -62.266 -27.644 51.209  1.00 89.36  ? 596  LYS A CG    1 
ATOM   1464  C  CD    . LYS A 1  213 ? -62.971 -26.712 50.204  1.00 97.22  ? 596  LYS A CD    1 
ATOM   1465  C  CE    . LYS A 1  213 ? -62.534 -25.246 50.316  1.00 103.91 ? 596  LYS A CE    1 
ATOM   1466  N  NZ    . LYS A 1  213 ? -63.273 -24.346 49.365  1.00 103.93 ? 596  LYS A NZ    1 
ATOM   1467  N  N     . GLU A 1  214 ? -60.692 -30.392 52.470  1.00 77.33  ? 597  GLU A N     1 
ATOM   1468  C  CA    . GLU A 1  214 ? -59.283 -30.654 52.188  1.00 77.66  ? 597  GLU A CA    1 
ATOM   1469  C  C     . GLU A 1  214 ? -58.890 -30.140 50.805  1.00 86.34  ? 597  GLU A C     1 
ATOM   1470  O  O     . GLU A 1  214 ? -59.668 -30.225 49.852  1.00 88.72  ? 597  GLU A O     1 
ATOM   1471  C  CB    . GLU A 1  214 ? -58.966 -32.144 52.280  1.00 80.81  ? 597  GLU A CB    1 
ATOM   1472  C  CG    . GLU A 1  214 ? -58.249 -32.534 53.550  1.00 85.75  ? 597  GLU A CG    1 
ATOM   1473  C  CD    . GLU A 1  214 ? -57.883 -34.009 53.620  1.00 96.46  ? 597  GLU A CD    1 
ATOM   1474  O  OE1   . GLU A 1  214 ? -57.840 -34.683 52.563  1.00 90.63  ? 597  GLU A OE1   1 
ATOM   1475  O  OE2   . GLU A 1  214 ? -57.637 -34.481 54.752  1.00 97.99  ? 597  GLU A OE2   1 
ATOM   1476  N  N     . SER A 1  215 ? -57.665 -29.607 50.704  1.00 91.93  ? 598  SER A N     1 
ATOM   1477  C  CA    . SER A 1  215 ? -57.148 -29.050 49.455  1.00 86.46  ? 598  SER A CA    1 
ATOM   1478  C  C     . SER A 1  215 ? -55.682 -29.426 49.255  1.00 80.16  ? 598  SER A C     1 
ATOM   1479  O  O     . SER A 1  215 ? -54.973 -29.790 50.194  1.00 84.84  ? 598  SER A O     1 
ATOM   1480  C  CB    . SER A 1  215 ? -57.296 -27.512 49.386  1.00 86.70  ? 598  SER A CB    1 
ATOM   1481  O  OG    . SER A 1  215 ? -58.519 -27.059 49.955  1.00 98.58  ? 598  SER A OG    1 
ATOM   1482  N  N     . CYS A 1  216 ? -55.242 -29.322 47.999  1.00 75.01  ? 599  CYS A N     1 
ATOM   1483  C  CA    . CYS A 1  216 ? -53.866 -29.563 47.588  1.00 65.89  ? 599  CYS A CA    1 
ATOM   1484  C  C     . CYS A 1  216 ? -53.675 -29.057 46.167  1.00 74.35  ? 599  CYS A C     1 
ATOM   1485  O  O     . CYS A 1  216 ? -54.475 -29.355 45.279  1.00 76.52  ? 599  CYS A O     1 
ATOM   1486  C  CB    . CYS A 1  216 ? -53.499 -31.039 47.657  1.00 63.92  ? 599  CYS A CB    1 
ATOM   1487  S  SG    . CYS A 1  216 ? -51.768 -31.340 47.299  1.00 72.62  ? 599  CYS A SG    1 
ATOM   1488  N  N     . ASP A 1  217 ? -52.614 -28.291 45.964  1.00 74.56  ? 600  ASP A N     1 
ATOM   1489  C  CA    . ASP A 1  217 ? -52.341 -27.760 44.646  1.00 79.96  ? 600  ASP A CA    1 
ATOM   1490  C  C     . ASP A 1  217 ? -50.839 -27.543 44.556  1.00 86.24  ? 600  ASP A C     1 
ATOM   1491  O  O     . ASP A 1  217 ? -50.154 -27.429 45.579  1.00 78.45  ? 600  ASP A O     1 
ATOM   1492  C  CB    . ASP A 1  217 ? -53.133 -26.467 44.407  1.00 81.61  ? 600  ASP A CB    1 
ATOM   1493  C  CG    . ASP A 1  217 ? -53.211 -26.081 42.937  1.00 95.88  ? 600  ASP A CG    1 
ATOM   1494  O  OD1   . ASP A 1  217 ? -52.877 -26.930 42.068  1.00 102.66 ? 600  ASP A OD1   1 
ATOM   1495  O  OD2   . ASP A 1  217 ? -53.607 -24.931 42.640  1.00 104.50 ? 600  ASP A OD2   1 
ATOM   1496  N  N     . GLY A 1  218 ? -50.330 -27.578 43.327  1.00 97.72  ? 601  GLY A N     1 
ATOM   1497  C  CA    . GLY A 1  218 ? -49.021 -27.040 43.059  1.00 96.12  ? 601  GLY A CA    1 
ATOM   1498  C  C     . GLY A 1  218 ? -49.075 -25.530 42.938  1.00 100.01 ? 601  GLY A C     1 
ATOM   1499  O  O     . GLY A 1  218 ? -50.096 -24.938 42.572  1.00 94.93  ? 601  GLY A O     1 
ATOM   1500  N  N     . MET A 1  219 ? -47.951 -24.909 43.266  1.00 94.53  ? 602  MET A N     1 
ATOM   1501  C  CA    . MET A 1  219 ? -47.820 -23.466 43.267  1.00 96.65  ? 602  MET A CA    1 
ATOM   1502  C  C     . MET A 1  219 ? -46.917 -22.999 42.130  1.00 109.60 ? 602  MET A C     1 
ATOM   1503  O  O     . MET A 1  219 ? -46.295 -21.938 42.220  1.00 119.28 ? 602  MET A O     1 
ATOM   1504  C  CB    . MET A 1  219 ? -47.299 -22.992 44.621  1.00 90.24  ? 602  MET A CB    1 
ATOM   1505  C  CG    . MET A 1  219 ? -48.334 -23.000 45.747  1.00 86.01  ? 602  MET A CG    1 
ATOM   1506  S  SD    . MET A 1  219 ? -47.579 -22.762 47.380  1.00 105.14 ? 602  MET A SD    1 
ATOM   1507  C  CE    . MET A 1  219 ? -48.961 -22.207 48.391  1.00 95.67  ? 602  MET A CE    1 
ATOM   1508  N  N     . GLY A 1  220 ? -46.852 -23.782 41.052  1.00 106.42 ? 603  GLY A N     1 
ATOM   1509  C  CA    . GLY A 1  220 ? -46.087 -23.375 39.895  1.00 112.04 ? 603  GLY A CA    1 
ATOM   1510  C  C     . GLY A 1  220 ? -44.660 -23.098 40.306  1.00 114.48 ? 603  GLY A C     1 
ATOM   1511  O  O     . GLY A 1  220 ? -44.101 -23.770 41.179  1.00 118.67 ? 603  GLY A O     1 
ATOM   1512  N  N     . ASP A 1  221 ? -44.075 -22.060 39.716  1.00 117.88 ? 604  ASP A N     1 
ATOM   1513  C  CA    . ASP A 1  221 ? -42.710 -21.701 40.064  1.00 114.70 ? 604  ASP A CA    1 
ATOM   1514  C  C     . ASP A 1  221 ? -42.670 -20.869 41.337  1.00 106.14 ? 604  ASP A C     1 
ATOM   1515  O  O     . ASP A 1  221 ? -43.552 -20.046 41.600  1.00 107.12 ? 604  ASP A O     1 
ATOM   1516  C  CB    . ASP A 1  221 ? -42.024 -20.936 38.934  1.00 111.98 ? 604  ASP A CB    1 
ATOM   1517  C  CG    . ASP A 1  221 ? -40.526 -21.179 38.910  1.00 117.51 ? 604  ASP A CG    1 
ATOM   1518  O  OD1   . ASP A 1  221 ? -39.940 -21.298 37.812  1.00 127.96 ? 604  ASP A OD1   1 
ATOM   1519  O  OD2   . ASP A 1  221 ? -39.937 -21.301 40.004  1.00 122.50 ? 604  ASP A OD2   1 
ATOM   1520  N  N     . VAL A 1  222 ? -41.624 -21.104 42.128  1.00 106.49 ? 605  VAL A N     1 
ATOM   1521  C  CA    . VAL A 1  222 ? -41.357 -20.355 43.346  1.00 103.68 ? 605  VAL A CA    1 
ATOM   1522  C  C     . VAL A 1  222 ? -39.970 -19.727 43.338  1.00 119.91 ? 605  VAL A C     1 
ATOM   1523  O  O     . VAL A 1  222 ? -39.629 -18.983 44.261  1.00 123.01 ? 605  VAL A O     1 
ATOM   1524  C  CB    . VAL A 1  222 ? -41.549 -21.271 44.577  1.00 101.04 ? 605  VAL A CB    1 
ATOM   1525  C  CG1   . VAL A 1  222 ? -41.360 -20.540 45.892  1.00 100.81 ? 605  VAL A CG1   1 
ATOM   1526  C  CG2   . VAL A 1  222 ? -42.933 -21.885 44.547  1.00 96.68  ? 605  VAL A CG2   1 
ATOM   1527  N  N     . SER A 1  223 ? -39.180 -19.946 42.286  1.00 126.56 ? 606  SER A N     1 
ATOM   1528  C  CA    . SER A 1  223 ? -37.786 -19.522 42.279  1.00 115.91 ? 606  SER A CA    1 
ATOM   1529  C  C     . SER A 1  223 ? -37.652 -18.022 42.456  1.00 128.55 ? 606  SER A C     1 
ATOM   1530  O  O     . SER A 1  223 ? -38.458 -17.243 41.945  1.00 127.91 ? 606  SER A O     1 
ATOM   1531  C  CB    . SER A 1  223 ? -37.112 -19.920 40.969  1.00 110.89 ? 606  SER A CB    1 
ATOM   1532  O  OG    . SER A 1  223 ? -37.590 -21.165 40.509  1.00 124.37 ? 606  SER A OG    1 
ATOM   1533  N  N     . GLU A 1  224 ? -36.618 -17.626 43.184  1.00 132.68 ? 607  GLU A N     1 
ATOM   1534  C  CA    . GLU A 1  224 ? -36.088 -16.277 43.104  1.00 140.10 ? 607  GLU A CA    1 
ATOM   1535  C  C     . GLU A 1  224 ? -34.799 -16.321 42.289  1.00 141.14 ? 607  GLU A C     1 
ATOM   1536  O  O     . GLU A 1  224 ? -33.950 -17.192 42.495  1.00 138.67 ? 607  GLU A O     1 
ATOM   1537  C  CB    . GLU A 1  224 ? -35.846 -15.684 44.497  1.00 131.61 ? 607  GLU A CB    1 
ATOM   1538  C  CG    . GLU A 1  224 ? -37.105 -15.525 45.355  1.00 132.78 ? 607  GLU A CG    1 
ATOM   1539  C  CD    . GLU A 1  224 ? -38.104 -14.505 44.798  1.00 136.81 ? 607  GLU A CD    1 
ATOM   1540  O  OE1   . GLU A 1  224 ? -37.671 -13.492 44.207  1.00 137.02 ? 607  GLU A OE1   1 
ATOM   1541  O  OE2   . GLU A 1  224 ? -39.330 -14.721 44.953  1.00 132.69 ? 607  GLU A OE2   1 
ATOM   1542  N  N     . LYS A 1  225 ? -34.672 -15.403 41.336  1.00 141.28 ? 608  LYS A N     1 
ATOM   1543  C  CA    . LYS A 1  225 ? -33.580 -15.467 40.380  1.00 150.57 ? 608  LYS A CA    1 
ATOM   1544  C  C     . LYS A 1  225 ? -32.998 -14.078 40.168  1.00 164.68 ? 608  LYS A C     1 
ATOM   1545  O  O     . LYS A 1  225 ? -33.714 -13.072 40.212  1.00 163.33 ? 608  LYS A O     1 
ATOM   1546  C  CB    . LYS A 1  225 ? -34.046 -16.057 39.042  1.00 148.53 ? 608  LYS A CB    1 
ATOM   1547  N  N     . HIS A 1  226 ? -31.687 -14.034 39.937  1.00 162.49 ? 609  HIS A N     1 
ATOM   1548  C  CA    . HIS A 1  226 ? -31.006 -12.777 39.643  1.00 159.01 ? 609  HIS A CA    1 
ATOM   1549  C  C     . HIS A 1  226 ? -31.365 -12.277 38.242  1.00 162.88 ? 609  HIS A C     1 
ATOM   1550  O  O     . HIS A 1  226 ? -31.778 -13.052 37.375  1.00 160.50 ? 609  HIS A O     1 
ATOM   1551  C  CB    . HIS A 1  226 ? -29.488 -12.945 39.777  1.00 159.08 ? 609  HIS A CB    1 
ATOM   1552  N  N     . GLY A 1  229 ? -33.249 -15.336 31.631  1.00 154.63 ? 612  GLY A N     1 
ATOM   1553  C  CA    . GLY A 1  229 ? -31.939 -15.843 31.993  1.00 156.12 ? 612  GLY A CA    1 
ATOM   1554  C  C     . GLY A 1  229 ? -31.983 -17.318 32.326  1.00 162.41 ? 612  GLY A C     1 
ATOM   1555  O  O     . GLY A 1  229 ? -32.960 -17.993 32.000  1.00 164.92 ? 612  GLY A O     1 
ATOM   1556  N  N     . PRO A 1  230 ? -30.931 -17.820 32.983  1.00 167.53 ? 613  PRO A N     1 
ATOM   1557  C  CA    . PRO A 1  230 ? -30.827 -19.264 33.306  1.00 168.24 ? 613  PRO A CA    1 
ATOM   1558  C  C     . PRO A 1  230 ? -31.653 -19.656 34.527  1.00 171.37 ? 613  PRO A C     1 
ATOM   1559  O  O     . PRO A 1  230 ? -31.143 -20.069 35.581  1.00 166.16 ? 613  PRO A O     1 
ATOM   1560  C  CB    . PRO A 1  230 ? -29.321 -19.438 33.528  1.00 159.60 ? 613  PRO A CB    1 
ATOM   1561  C  CG    . PRO A 1  230 ? -28.878 -18.121 34.072  1.00 161.24 ? 613  PRO A CG    1 
ATOM   1562  C  CD    . PRO A 1  230 ? -29.732 -17.071 33.400  1.00 161.27 ? 613  PRO A CD    1 
ATOM   1563  N  N     . ALA A 1  231 ? -32.974 -19.545 34.387  1.00 169.39 ? 614  ALA A N     1 
ATOM   1564  C  CA    . ALA A 1  231 ? -33.894 -19.758 35.498  1.00 157.97 ? 614  ALA A CA    1 
ATOM   1565  C  C     . ALA A 1  231 ? -34.087 -21.253 35.727  1.00 152.79 ? 614  ALA A C     1 
ATOM   1566  O  O     . ALA A 1  231 ? -34.726 -21.934 34.921  1.00 154.78 ? 614  ALA A O     1 
ATOM   1567  C  CB    . ALA A 1  231 ? -35.226 -19.067 35.218  1.00 150.02 ? 614  ALA A CB    1 
ATOM   1568  N  N     . VAL A 1  232 ? -33.530 -21.767 36.819  1.00 152.27 ? 615  VAL A N     1 
ATOM   1569  C  CA    . VAL A 1  232 ? -33.835 -23.126 37.263  1.00 150.84 ? 615  VAL A CA    1 
ATOM   1570  C  C     . VAL A 1  232 ? -35.169 -23.075 37.993  1.00 148.98 ? 615  VAL A C     1 
ATOM   1571  O  O     . VAL A 1  232 ? -35.278 -22.383 39.016  1.00 155.11 ? 615  VAL A O     1 
ATOM   1572  C  CB    . VAL A 1  232 ? -32.731 -23.694 38.170  1.00 151.71 ? 615  VAL A CB    1 
ATOM   1573  C  CG1   . VAL A 1  232 ? -33.184 -25.004 38.801  1.00 144.27 ? 615  VAL A CG1   1 
ATOM   1574  C  CG2   . VAL A 1  232 ? -31.451 -23.893 37.383  1.00 158.22 ? 615  VAL A CG2   1 
ATOM   1575  N  N     . PRO A 1  233 ? -36.201 -23.768 37.519  1.00 140.75 ? 616  PRO A N     1 
ATOM   1576  C  CA    . PRO A 1  233 ? -37.505 -23.689 38.187  1.00 130.42 ? 616  PRO A CA    1 
ATOM   1577  C  C     . PRO A 1  233 ? -37.479 -24.385 39.542  1.00 124.14 ? 616  PRO A C     1 
ATOM   1578  O  O     . PRO A 1  233 ? -36.640 -25.250 39.811  1.00 120.77 ? 616  PRO A O     1 
ATOM   1579  C  CB    . PRO A 1  233 ? -38.446 -24.399 37.210  1.00 121.75 ? 616  PRO A CB    1 
ATOM   1580  C  CG    . PRO A 1  233 ? -37.557 -25.394 36.521  1.00 133.61 ? 616  PRO A CG    1 
ATOM   1581  C  CD    . PRO A 1  233 ? -36.206 -24.722 36.396  1.00 136.83 ? 616  PRO A CD    1 
ATOM   1582  N  N     . GLU A 1  234 ? -38.404 -23.976 40.409  1.00 112.95 ? 617  GLU A N     1 
ATOM   1583  C  CA    . GLU A 1  234 ? -38.568 -24.572 41.733  1.00 109.55 ? 617  GLU A CA    1 
ATOM   1584  C  C     . GLU A 1  234 ? -40.057 -24.572 42.035  1.00 101.56 ? 617  GLU A C     1 
ATOM   1585  O  O     . GLU A 1  234 ? -40.644 -23.513 42.268  1.00 102.60 ? 617  GLU A O     1 
ATOM   1586  C  CB    . GLU A 1  234 ? -37.780 -23.810 42.805  1.00 115.66 ? 617  GLU A CB    1 
ATOM   1587  C  CG    . GLU A 1  234 ? -37.727 -24.496 44.179  1.00 109.76 ? 617  GLU A CG    1 
ATOM   1588  C  CD    . GLU A 1  234 ? -36.527 -24.065 45.029  1.00 109.02 ? 617  GLU A CD    1 
ATOM   1589  O  OE1   . GLU A 1  234 ? -36.210 -22.853 45.068  1.00 109.36 ? 617  GLU A OE1   1 
ATOM   1590  O  OE2   . GLU A 1  234 ? -35.898 -24.946 45.661  1.00 112.83 ? 617  GLU A OE2   1 
ATOM   1591  N  N     . LYS A 1  235 ? -40.662 -25.748 42.012  1.00 97.49  ? 618  LYS A N     1 
ATOM   1592  C  CA    . LYS A 1  235 ? -42.092 -25.879 42.206  1.00 98.49  ? 618  LYS A CA    1 
ATOM   1593  C  C     . LYS A 1  235 ? -42.402 -26.228 43.660  1.00 91.95  ? 618  LYS A C     1 
ATOM   1594  O  O     . LYS A 1  235 ? -41.545 -26.726 44.398  1.00 93.53  ? 618  LYS A O     1 
ATOM   1595  C  CB    . LYS A 1  235 ? -42.656 -26.938 41.259  1.00 102.11 ? 618  LYS A CB    1 
ATOM   1596  C  CG    . LYS A 1  235 ? -41.945 -27.009 39.918  1.00 101.49 ? 618  LYS A CG    1 
ATOM   1597  C  CD    . LYS A 1  235 ? -42.939 -27.247 38.802  1.00 109.80 ? 618  LYS A CD    1 
ATOM   1598  C  CE    . LYS A 1  235 ? -43.631 -25.940 38.435  1.00 128.84 ? 618  LYS A CE    1 
ATOM   1599  N  NZ    . LYS A 1  235 ? -44.686 -26.104 37.395  1.00 143.65 ? 618  LYS A NZ    1 
ATOM   1600  N  N     . ALA A 1  236 ? -43.635 -25.940 44.075  1.00 86.78  ? 619  ALA A N     1 
ATOM   1601  C  CA    . ALA A 1  236 ? -44.073 -26.219 45.434  1.00 80.76  ? 619  ALA A CA    1 
ATOM   1602  C  C     . ALA A 1  236 ? -45.458 -26.840 45.437  1.00 81.60  ? 619  ALA A C     1 
ATOM   1603  O  O     . ALA A 1  236 ? -46.256 -26.650 44.514  1.00 82.65  ? 619  ALA A O     1 
ATOM   1604  C  CB    . ALA A 1  236 ? -44.092 -24.963 46.306  1.00 82.28  ? 619  ALA A CB    1 
ATOM   1605  N  N     . VAL A 1  237 ? -45.728 -27.570 46.512  1.00 81.23  ? 620  VAL A N     1 
ATOM   1606  C  CA    . VAL A 1  237 ? -47.015 -28.191 46.778  1.00 74.12  ? 620  VAL A CA    1 
ATOM   1607  C  C     . VAL A 1  237 ? -47.483 -27.743 48.151  1.00 77.24  ? 620  VAL A C     1 
ATOM   1608  O  O     . VAL A 1  237 ? -46.723 -27.807 49.129  1.00 75.70  ? 620  VAL A O     1 
ATOM   1609  C  CB    . VAL A 1  237 ? -46.914 -29.723 46.729  1.00 76.88  ? 620  VAL A CB    1 
ATOM   1610  C  CG1   . VAL A 1  237 ? -48.276 -30.357 46.899  1.00 90.10  ? 620  VAL A CG1   1 
ATOM   1611  C  CG2   . VAL A 1  237 ? -46.258 -30.163 45.452  1.00 89.86  ? 620  VAL A CG2   1 
ATOM   1612  N  N     . ARG A 1  238 ? -48.739 -27.297 48.221  1.00 72.16  ? 621  ARG A N     1 
ATOM   1613  C  CA    . ARG A 1  238 ? -49.367 -26.854 49.456  1.00 71.19  ? 621  ARG A CA    1 
ATOM   1614  C  C     . ARG A 1  238 ? -50.549 -27.748 49.773  1.00 76.46  ? 621  ARG A C     1 
ATOM   1615  O  O     . ARG A 1  238 ? -51.467 -27.873 48.957  1.00 80.15  ? 621  ARG A O     1 
ATOM   1616  C  CB    . ARG A 1  238 ? -49.845 -25.424 49.346  1.00 80.83  ? 621  ARG A CB    1 
ATOM   1617  C  CG    . ARG A 1  238 ? -50.993 -25.100 50.289  1.00 98.46  ? 621  ARG A CG    1 
ATOM   1618  C  CD    . ARG A 1  238 ? -51.742 -23.824 49.918  1.00 90.20  ? 621  ARG A CD    1 
ATOM   1619  N  NE    . ARG A 1  238 ? -52.379 -23.959 48.613  1.00 100.71 ? 621  ARG A NE    1 
ATOM   1620  C  CZ    . ARG A 1  238 ? -53.461 -24.705 48.376  1.00 102.35 ? 621  ARG A CZ    1 
ATOM   1621  N  NH1   . ARG A 1  238 ? -54.044 -25.391 49.353  1.00 97.77  ? 621  ARG A NH1   1 
ATOM   1622  N  NH2   . ARG A 1  238 ? -53.970 -24.769 47.154  1.00 104.09 ? 621  ARG A NH2   1 
ATOM   1623  N  N     . PHE A 1  239 ? -50.516 -28.367 50.954  1.00 76.17  ? 622  PHE A N     1 
ATOM   1624  C  CA    . PHE A 1  239 ? -51.577 -29.238 51.454  1.00 83.38  ? 622  PHE A CA    1 
ATOM   1625  C  C     . PHE A 1  239 ? -52.283 -28.512 52.593  1.00 82.86  ? 622  PHE A C     1 
ATOM   1626  O  O     . PHE A 1  239 ? -51.664 -28.225 53.627  1.00 74.31  ? 622  PHE A O     1 
ATOM   1627  C  CB    . PHE A 1  239 ? -51.018 -30.578 51.935  1.00 77.77  ? 622  PHE A CB    1 
ATOM   1628  C  CG    . PHE A 1  239 ? -52.061 -31.658 52.099  1.00 80.91  ? 622  PHE A CG    1 
ATOM   1629  C  CD1   . PHE A 1  239 ? -52.550 -31.995 53.350  1.00 81.20  ? 622  PHE A CD1   1 
ATOM   1630  C  CD2   . PHE A 1  239 ? -52.536 -32.349 51.000  1.00 85.96  ? 622  PHE A CD2   1 
ATOM   1631  C  CE1   . PHE A 1  239 ? -53.496 -33.002 53.508  1.00 85.82  ? 622  PHE A CE1   1 
ATOM   1632  C  CE2   . PHE A 1  239 ? -53.487 -33.357 51.144  1.00 91.23  ? 622  PHE A CE2   1 
ATOM   1633  C  CZ    . PHE A 1  239 ? -53.972 -33.682 52.404  1.00 91.09  ? 622  PHE A CZ    1 
ATOM   1634  N  N     . SER A 1  240 ? -53.576 -28.243 52.414  1.00 79.20  ? 623  SER A N     1 
ATOM   1635  C  CA    . SER A 1  240 ? -54.308 -27.323 53.267  1.00 72.73  ? 623  SER A CA    1 
ATOM   1636  C  C     . SER A 1  240 ? -55.649 -27.907 53.660  1.00 82.13  ? 623  SER A C     1 
ATOM   1637  O  O     . SER A 1  240 ? -56.123 -28.877 53.066  1.00 93.51  ? 623  SER A O     1 
ATOM   1638  C  CB    . SER A 1  240 ? -54.557 -25.997 52.559  1.00 76.08  ? 623  SER A CB    1 
ATOM   1639  O  OG    . SER A 1  240 ? -53.350 -25.314 52.326  1.00 85.44  ? 623  SER A OG    1 
ATOM   1640  N  N     . PHE A 1  241 ? -56.276 -27.269 54.649  1.00 85.34  ? 624  PHE A N     1 
ATOM   1641  C  CA    . PHE A 1  241 ? -57.639 -27.601 55.035  1.00 83.29  ? 624  PHE A CA    1 
ATOM   1642  C  C     . PHE A 1  241 ? -58.388 -26.341 55.443  1.00 81.13  ? 624  PHE A C     1 
ATOM   1643  O  O     . PHE A 1  241 ? -57.796 -25.392 55.958  1.00 81.50  ? 624  PHE A O     1 
ATOM   1644  C  CB    . PHE A 1  241 ? -57.674 -28.643 56.157  1.00 71.98  ? 624  PHE A CB    1 
ATOM   1645  C  CG    . PHE A 1  241 ? -57.303 -28.123 57.515  1.00 66.26  ? 624  PHE A CG    1 
ATOM   1646  C  CD1   . PHE A 1  241 ? -58.248 -27.500 58.319  1.00 67.94  ? 624  PHE A CD1   1 
ATOM   1647  C  CD2   . PHE A 1  241 ? -56.034 -28.338 58.025  1.00 69.13  ? 624  PHE A CD2   1 
ATOM   1648  C  CE1   . PHE A 1  241 ? -57.921 -27.066 59.582  1.00 61.90  ? 624  PHE A CE1   1 
ATOM   1649  C  CE2   . PHE A 1  241 ? -55.699 -27.910 59.290  1.00 67.41  ? 624  PHE A CE2   1 
ATOM   1650  C  CZ    . PHE A 1  241 ? -56.643 -27.273 60.070  1.00 63.14  ? 624  PHE A CZ    1 
ATOM   1651  N  N     . THR A 1  242 ? -59.706 -26.363 55.244  1.00 79.70  ? 625  THR A N     1 
ATOM   1652  C  CA    . THR A 1  242 ? -60.565 -25.204 55.488  1.00 83.44  ? 625  THR A CA    1 
ATOM   1653  C  C     . THR A 1  242 ? -61.797 -25.643 56.274  1.00 83.39  ? 625  THR A C     1 
ATOM   1654  O  O     . THR A 1  242 ? -62.661 -26.330 55.722  1.00 92.17  ? 625  THR A O     1 
ATOM   1655  C  CB    . THR A 1  242 ? -60.984 -24.563 54.163  1.00 89.19  ? 625  THR A CB    1 
ATOM   1656  O  OG1   . THR A 1  242 ? -59.828 -24.339 53.341  1.00 90.02  ? 625  THR A OG1   1 
ATOM   1657  C  CG2   . THR A 1  242 ? -61.753 -23.254 54.398  1.00 83.77  ? 625  THR A CG2   1 
ATOM   1658  N  N     . VAL A 1  243 ? -61.905 -25.229 57.541  1.00 81.10  ? 626  VAL A N     1 
ATOM   1659  C  CA    . VAL A 1  243 ? -63.124 -25.450 58.327  1.00 85.62  ? 626  VAL A CA    1 
ATOM   1660  C  C     . VAL A 1  243 ? -64.311 -24.763 57.652  1.00 89.19  ? 626  VAL A C     1 
ATOM   1661  O  O     . VAL A 1  243 ? -64.382 -23.530 57.602  1.00 90.97  ? 626  VAL A O     1 
ATOM   1662  C  CB    . VAL A 1  243 ? -62.954 -24.938 59.770  1.00 77.55  ? 626  VAL A CB    1 
ATOM   1663  C  CG1   . VAL A 1  243 ? -64.258 -25.037 60.538  1.00 74.54  ? 626  VAL A CG1   1 
ATOM   1664  C  CG2   . VAL A 1  243 ? -61.842 -25.687 60.489  1.00 74.00  ? 626  VAL A CG2   1 
ATOM   1665  N  N     . MET A 1  244 ? -65.256 -25.553 57.141  1.00 83.17  ? 627  MET A N     1 
ATOM   1666  C  CA    . MET A 1  244 ? -66.338 -25.046 56.304  1.00 83.63  ? 627  MET A CA    1 
ATOM   1667  C  C     . MET A 1  244 ? -67.575 -24.687 57.106  1.00 83.44  ? 627  MET A C     1 
ATOM   1668  O  O     . MET A 1  244 ? -68.209 -23.654 56.854  1.00 87.34  ? 627  MET A O     1 
ATOM   1669  C  CB    . MET A 1  244 ? -66.711 -26.087 55.249  1.00 86.22  ? 627  MET A CB    1 
ATOM   1670  C  CG    . MET A 1  244 ? -65.674 -26.243 54.203  1.00 84.88  ? 627  MET A CG    1 
ATOM   1671  S  SD    . MET A 1  244 ? -65.528 -24.664 53.384  1.00 95.69  ? 627  MET A SD    1 
ATOM   1672  C  CE    . MET A 1  244 ? -67.004 -24.753 52.371  1.00 108.19 ? 627  MET A CE    1 
ATOM   1673  N  N     . ARG A 1  245 ? -67.951 -25.550 58.038  1.00 81.74  ? 628  ARG A N     1 
ATOM   1674  C  CA    . ARG A 1  245 ? -69.053 -25.250 58.927  1.00 87.73  ? 628  ARG A CA    1 
ATOM   1675  C  C     . ARG A 1  245 ? -68.939 -26.142 60.148  1.00 85.12  ? 628  ARG A C     1 
ATOM   1676  O  O     . ARG A 1  245 ? -68.369 -27.239 60.093  1.00 81.86  ? 628  ARG A O     1 
ATOM   1677  C  CB    . ARG A 1  245 ? -70.413 -25.437 58.247  1.00 90.27  ? 628  ARG A CB    1 
ATOM   1678  C  CG    . ARG A 1  245 ? -70.650 -26.809 57.686  1.00 92.34  ? 628  ARG A CG    1 
ATOM   1679  C  CD    . ARG A 1  245 ? -72.052 -26.925 57.115  1.00 103.87 ? 628  ARG A CD    1 
ATOM   1680  N  NE    . ARG A 1  245 ? -72.090 -27.789 55.936  1.00 121.10 ? 628  ARG A NE    1 
ATOM   1681  C  CZ    . ARG A 1  245 ? -71.983 -27.353 54.679  1.00 137.39 ? 628  ARG A CZ    1 
ATOM   1682  N  NH1   . ARG A 1  245 ? -71.828 -26.051 54.420  1.00 131.50 ? 628  ARG A NH1   1 
ATOM   1683  N  NH2   . ARG A 1  245 ? -72.034 -28.223 53.673  1.00 137.61 ? 628  ARG A NH2   1 
ATOM   1684  N  N     . ILE A 1  246 ? -69.442 -25.622 61.259  1.00 82.67  ? 629  ILE A N     1 
ATOM   1685  C  CA    . ILE A 1  246 ? -69.555 -26.353 62.507  1.00 82.36  ? 629  ILE A CA    1 
ATOM   1686  C  C     . ILE A 1  246 ? -71.009 -26.328 62.918  1.00 87.21  ? 629  ILE A C     1 
ATOM   1687  O  O     . ILE A 1  246 ? -71.626 -25.258 62.975  1.00 98.27  ? 629  ILE A O     1 
ATOM   1688  C  CB    . ILE A 1  246 ? -68.692 -25.759 63.629  1.00 80.97  ? 629  ILE A CB    1 
ATOM   1689  C  CG1   . ILE A 1  246 ? -67.320 -25.368 63.114  1.00 79.78  ? 629  ILE A CG1   1 
ATOM   1690  C  CG2   . ILE A 1  246 ? -68.546 -26.778 64.749  1.00 94.19  ? 629  ILE A CG2   1 
ATOM   1691  C  CD1   . ILE A 1  246 ? -66.357 -25.083 64.222  1.00 76.24  ? 629  ILE A CD1   1 
ATOM   1692  N  N     . THR A 1  247 ? -71.543 -27.497 63.218  1.00 101.05 ? 630  THR A N     1 
ATOM   1693  C  CA    . THR A 1  247 ? -72.914 -27.632 63.668  1.00 107.10 ? 630  THR A CA    1 
ATOM   1694  C  C     . THR A 1  247 ? -72.938 -28.296 65.037  1.00 115.52 ? 630  THR A C     1 
ATOM   1695  O  O     . THR A 1  247 ? -71.968 -28.929 65.465  1.00 110.91 ? 630  THR A O     1 
ATOM   1696  C  CB    . THR A 1  247 ? -73.747 -28.443 62.669  1.00 118.86 ? 630  THR A CB    1 
ATOM   1697  O  OG1   . THR A 1  247 ? -73.149 -29.737 62.478  1.00 111.14 ? 630  THR A OG1   1 
ATOM   1698  C  CG2   . THR A 1  247 ? -73.845 -27.698 61.332  1.00 112.84 ? 630  THR A CG2   1 
ATOM   1699  N  N     . ILE A 1  248 ? -74.068 -28.142 65.723  1.00 114.86 ? 631  ILE A N     1 
ATOM   1700  C  CA    . ILE A 1  248 ? -74.287 -28.765 67.020  1.00 113.59 ? 631  ILE A CA    1 
ATOM   1701  C  C     . ILE A 1  248 ? -75.621 -29.497 66.991  1.00 125.07 ? 631  ILE A C     1 
ATOM   1702  O  O     . ILE A 1  248 ? -76.611 -28.987 66.455  1.00 123.41 ? 631  ILE A O     1 
ATOM   1703  C  CB    . ILE A 1  248 ? -74.244 -27.733 68.164  1.00 105.61 ? 631  ILE A CB    1 
ATOM   1704  C  CG1   . ILE A 1  248 ? -74.190 -28.439 69.506  1.00 108.50 ? 631  ILE A CG1   1 
ATOM   1705  C  CG2   . ILE A 1  248 ? -75.443 -26.834 68.137  1.00 96.03  ? 631  ILE A CG2   1 
ATOM   1706  C  CD1   . ILE A 1  248 ? -73.919 -27.493 70.625  1.00 110.25 ? 631  ILE A CD1   1 
ATOM   1707  N  N     . GLU A 1  249 ? -75.635 -30.709 67.545  1.00 127.79 ? 632  GLU A N     1 
ATOM   1708  C  CA    . GLU A 1  249 ? -76.845 -31.517 67.607  1.00 121.82 ? 632  GLU A CA    1 
ATOM   1709  C  C     . GLU A 1  249 ? -77.641 -31.088 68.831  1.00 126.72 ? 632  GLU A C     1 
ATOM   1710  O  O     . GLU A 1  249 ? -77.231 -31.347 69.968  1.00 127.49 ? 632  GLU A O     1 
ATOM   1711  C  CB    . GLU A 1  249 ? -76.492 -32.999 67.663  1.00 135.35 ? 632  GLU A CB    1 
ATOM   1712  C  CG    . GLU A 1  249 ? -77.696 -33.934 67.606  1.00 147.52 ? 632  GLU A CG    1 
ATOM   1713  C  CD    . GLU A 1  249 ? -77.358 -35.369 67.999  1.00 153.88 ? 632  GLU A CD    1 
ATOM   1714  O  OE1   . GLU A 1  249 ? -76.172 -35.762 67.903  1.00 146.46 ? 632  GLU A OE1   1 
ATOM   1715  O  OE2   . GLU A 1  249 ? -78.285 -36.102 68.410  1.00 154.46 ? 632  GLU A OE2   1 
ATOM   1716  N  N     . HIS A 1  250 ? -78.763 -30.393 68.602  1.00 137.40 ? 633  HIS A N     1 
ATOM   1717  C  CA    . HIS A 1  250 ? -79.619 -29.856 69.667  1.00 141.67 ? 633  HIS A CA    1 
ATOM   1718  C  C     . HIS A 1  250 ? -81.029 -30.348 69.374  1.00 147.87 ? 633  HIS A C     1 
ATOM   1719  O  O     . HIS A 1  250 ? -81.876 -29.593 68.886  1.00 143.59 ? 633  HIS A O     1 
ATOM   1720  C  CB    . HIS A 1  250 ? -79.556 -28.333 69.738  1.00 128.79 ? 633  HIS A CB    1 
ATOM   1721  C  CG    . HIS A 1  250 ? -79.971 -27.772 71.060  1.00 125.89 ? 633  HIS A CG    1 
ATOM   1722  N  ND1   . HIS A 1  250 ? -81.064 -26.948 71.212  1.00 126.76 ? 633  HIS A ND1   1 
ATOM   1723  C  CD2   . HIS A 1  250 ? -79.431 -27.912 72.293  1.00 130.71 ? 633  HIS A CD2   1 
ATOM   1724  C  CE1   . HIS A 1  250 ? -81.181 -26.605 72.483  1.00 136.66 ? 633  HIS A CE1   1 
ATOM   1725  N  NE2   . HIS A 1  250 ? -80.202 -27.178 73.160  1.00 135.85 ? 633  HIS A NE2   1 
ATOM   1726  N  N     . GLY A 1  251 ? -81.268 -31.621 69.685  1.00 149.73 ? 634  GLY A N     1 
ATOM   1727  C  CA    . GLY A 1  251 ? -82.488 -32.302 69.311  1.00 150.13 ? 634  GLY A CA    1 
ATOM   1728  C  C     . GLY A 1  251 ? -82.202 -33.409 68.322  1.00 154.51 ? 634  GLY A C     1 
ATOM   1729  O  O     . GLY A 1  251 ? -81.131 -34.027 68.362  1.00 152.37 ? 634  GLY A O     1 
ATOM   1730  N  N     . SER A 1  252 ? -83.166 -33.693 67.444  1.00 154.89 ? 635  SER A N     1 
ATOM   1731  C  CA    . SER A 1  252 ? -82.874 -34.328 66.167  1.00 162.12 ? 635  SER A CA    1 
ATOM   1732  C  C     . SER A 1  252 ? -82.517 -33.291 65.104  1.00 167.57 ? 635  SER A C     1 
ATOM   1733  O  O     . SER A 1  252 ? -82.679 -33.546 63.898  1.00 164.84 ? 635  SER A O     1 
ATOM   1734  C  CB    . SER A 1  252 ? -84.051 -35.203 65.725  1.00 161.85 ? 635  SER A CB    1 
ATOM   1735  O  OG    . SER A 1  252 ? -84.126 -36.384 66.511  1.00 152.87 ? 635  SER A OG    1 
ATOM   1736  N  N     . GLN A 1  253 ? -82.035 -32.119 65.542  1.00 161.25 ? 636  GLN A N     1 
ATOM   1737  C  CA    . GLN A 1  253 ? -81.703 -30.985 64.690  1.00 143.09 ? 636  GLN A CA    1 
ATOM   1738  C  C     . GLN A 1  253 ? -80.215 -30.661 64.781  1.00 134.55 ? 636  GLN A C     1 
ATOM   1739  O  O     . GLN A 1  253 ? -79.584 -30.807 65.836  1.00 127.04 ? 636  GLN A O     1 
ATOM   1740  C  CB    . GLN A 1  253 ? -82.514 -29.728 65.065  1.00 136.90 ? 636  GLN A CB    1 
ATOM   1741  C  CG    . GLN A 1  253 ? -84.034 -29.887 65.009  1.00 153.93 ? 636  GLN A CG    1 
ATOM   1742  C  CD    . GLN A 1  253 ? -84.596 -30.597 66.229  1.00 156.52 ? 636  GLN A CD    1 
ATOM   1743  O  OE1   . GLN A 1  253 ? -83.890 -30.807 67.211  1.00 149.59 ? 636  GLN A OE1   1 
ATOM   1744  N  NE2   . GLN A 1  253 ? -85.870 -30.974 66.167  1.00 153.11 ? 636  GLN A NE2   1 
ATOM   1745  N  N     . ASN A 1  254 ? -79.666 -30.213 63.654  1.00 129.89 ? 637  ASN A N     1 
ATOM   1746  C  CA    . ASN A 1  254 ? -78.261 -29.839 63.528  1.00 124.05 ? 637  ASN A CA    1 
ATOM   1747  C  C     . ASN A 1  254 ? -78.211 -28.332 63.305  1.00 127.38 ? 637  ASN A C     1 
ATOM   1748  O  O     . ASN A 1  254 ? -78.435 -27.854 62.188  1.00 129.44 ? 637  ASN A O     1 
ATOM   1749  C  CB    . ASN A 1  254 ? -77.592 -30.601 62.388  1.00 123.81 ? 637  ASN A CB    1 
ATOM   1750  C  CG    . ASN A 1  254 ? -77.306 -32.047 62.743  1.00 134.69 ? 637  ASN A CG    1 
ATOM   1751  O  OD1   . ASN A 1  254 ? -76.992 -32.369 63.894  1.00 138.11 ? 637  ASN A OD1   1 
ATOM   1752  N  ND2   . ASN A 1  254 ? -77.412 -32.930 61.754  1.00 136.98 ? 637  ASN A ND2   1 
ATOM   1753  N  N     . VAL A 1  255 ? -77.932 -27.586 64.375  1.00 126.94 ? 638  VAL A N     1 
ATOM   1754  C  CA    . VAL A 1  255 ? -77.906 -26.126 64.333  1.00 117.56 ? 638  VAL A CA    1 
ATOM   1755  C  C     . VAL A 1  255 ? -76.540 -25.664 63.842  1.00 118.99 ? 638  VAL A C     1 
ATOM   1756  O  O     . VAL A 1  255 ? -75.499 -26.087 64.362  1.00 116.81 ? 638  VAL A O     1 
ATOM   1757  C  CB    . VAL A 1  255 ? -78.230 -25.525 65.710  1.00 115.99 ? 638  VAL A CB    1 
ATOM   1758  C  CG1   . VAL A 1  255 ? -78.263 -24.017 65.630  1.00 112.53 ? 638  VAL A CG1   1 
ATOM   1759  C  CG2   . VAL A 1  255 ? -79.562 -26.039 66.196  1.00 127.15 ? 638  VAL A CG2   1 
ATOM   1760  N  N     . LYS A 1  256 ? -76.552 -24.788 62.840  1.00 116.17 ? 639  LYS A N     1 
ATOM   1761  C  CA    . LYS A 1  256 ? -75.344 -24.290 62.190  1.00 105.95 ? 639  LYS A CA    1 
ATOM   1762  C  C     . LYS A 1  256 ? -74.815 -23.117 63.009  1.00 102.67 ? 639  LYS A C     1 
ATOM   1763  O  O     . LYS A 1  256 ? -75.281 -21.980 62.872  1.00 104.08 ? 639  LYS A O     1 
ATOM   1764  C  CB    . LYS A 1  256 ? -75.656 -23.885 60.752  1.00 113.38 ? 639  LYS A CB    1 
ATOM   1765  C  CG    . LYS A 1  256 ? -74.435 -23.638 59.876  1.00 114.61 ? 639  LYS A CG    1 
ATOM   1766  C  CD    . LYS A 1  256 ? -74.803 -22.878 58.610  1.00 109.60 ? 639  LYS A CD    1 
ATOM   1767  C  CE    . LYS A 1  256 ? -75.814 -23.655 57.786  1.00 116.50 ? 639  LYS A CE    1 
ATOM   1768  N  NZ    . LYS A 1  256 ? -75.199 -24.915 57.296  1.00 129.37 ? 639  LYS A NZ    1 
ATOM   1769  N  N     . VAL A 1  257 ? -73.839 -23.395 63.879  1.00 97.92  ? 640  VAL A N     1 
ATOM   1770  C  CA    . VAL A 1  257 ? -73.258 -22.349 64.715  1.00 97.72  ? 640  VAL A CA    1 
ATOM   1771  C  C     . VAL A 1  257 ? -72.078 -21.654 64.050  1.00 97.02  ? 640  VAL A C     1 
ATOM   1772  O  O     . VAL A 1  257 ? -71.709 -20.548 64.476  1.00 99.09  ? 640  VAL A O     1 
ATOM   1773  C  CB    . VAL A 1  257 ? -72.832 -22.911 66.089  1.00 101.17 ? 640  VAL A CB    1 
ATOM   1774  C  CG1   . VAL A 1  257 ? -73.954 -23.729 66.688  1.00 108.07 ? 640  VAL A CG1   1 
ATOM   1775  C  CG2   . VAL A 1  257 ? -71.569 -23.744 65.985  1.00 93.94  ? 640  VAL A CG2   1 
ATOM   1776  N  N     . PHE A 1  258 ? -71.479 -22.253 63.016  1.00 97.03  ? 641  PHE A N     1 
ATOM   1777  C  CA    . PHE A 1  258 ? -70.405 -21.589 62.288  1.00 85.85  ? 641  PHE A CA    1 
ATOM   1778  C  C     . PHE A 1  258 ? -70.455 -21.957 60.814  1.00 82.06  ? 641  PHE A C     1 
ATOM   1779  O  O     . PHE A 1  258 ? -70.643 -23.125 60.478  1.00 90.53  ? 641  PHE A O     1 
ATOM   1780  C  CB    . PHE A 1  258 ? -69.042 -21.962 62.874  1.00 86.17  ? 641  PHE A CB    1 
ATOM   1781  C  CG    . PHE A 1  258 ? -67.890 -21.466 62.062  1.00 86.30  ? 641  PHE A CG    1 
ATOM   1782  C  CD1   . PHE A 1  258 ? -67.489 -20.146 62.131  1.00 89.80  ? 641  PHE A CD1   1 
ATOM   1783  C  CD2   . PHE A 1  258 ? -67.222 -22.313 61.215  1.00 85.46  ? 641  PHE A CD2   1 
ATOM   1784  C  CE1   . PHE A 1  258 ? -66.441 -19.693 61.376  1.00 89.32  ? 641  PHE A CE1   1 
ATOM   1785  C  CE2   . PHE A 1  258 ? -66.180 -21.864 60.458  1.00 85.46  ? 641  PHE A CE2   1 
ATOM   1786  C  CZ    . PHE A 1  258 ? -65.789 -20.550 60.537  1.00 85.79  ? 641  PHE A CZ    1 
ATOM   1787  N  N     . GLU A 1  259 ? -70.264 -20.964 59.947  1.00 88.95  ? 642  GLU A N     1 
ATOM   1788  C  CA    . GLU A 1  259 ? -70.150 -21.184 58.509  1.00 91.23  ? 642  GLU A CA    1 
ATOM   1789  C  C     . GLU A 1  259 ? -69.200 -20.150 57.924  1.00 100.07 ? 642  GLU A C     1 
ATOM   1790  O  O     . GLU A 1  259 ? -69.469 -18.943 57.987  1.00 93.56  ? 642  GLU A O     1 
ATOM   1791  C  CB    . GLU A 1  259 ? -71.507 -21.113 57.816  1.00 97.96  ? 642  GLU A CB    1 
ATOM   1792  C  CG    . GLU A 1  259 ? -71.431 -21.425 56.343  1.00 106.24 ? 642  GLU A CG    1 
ATOM   1793  C  CD    . GLU A 1  259 ? -72.660 -22.159 55.849  1.00 126.12 ? 642  GLU A CD    1 
ATOM   1794  O  OE1   . GLU A 1  259 ? -72.571 -23.389 55.613  1.00 121.01 ? 642  GLU A OE1   1 
ATOM   1795  O  OE2   . GLU A 1  259 ? -73.719 -21.503 55.713  1.00 128.95 ? 642  GLU A OE2   1 
ATOM   1796  N  N     . GLU A 1  260 ? -68.108 -20.642 57.346  1.00 96.69  ? 643  GLU A N     1 
ATOM   1797  C  CA    . GLU A 1  260 ? -67.043 -19.833 56.764  1.00 98.08  ? 643  GLU A CA    1 
ATOM   1798  C  C     . GLU A 1  260 ? -67.574 -18.850 55.730  1.00 99.84  ? 643  GLU A C     1 
ATOM   1799  O  O     . GLU A 1  260 ? -68.057 -19.278 54.671  1.00 104.31 ? 643  GLU A O     1 
ATOM   1800  C  CB    . GLU A 1  260 ? -66.016 -20.742 56.107  1.00 99.90  ? 643  GLU A CB    1 
ATOM   1801  C  CG    . GLU A 1  260 ? -64.999 -19.990 55.304  1.00 104.37 ? 643  GLU A CG    1 
ATOM   1802  C  CD    . GLU A 1  260 ? -64.257 -18.982 56.147  1.00 104.80 ? 643  GLU A CD    1 
ATOM   1803  O  OE1   . GLU A 1  260 ? -63.855 -19.350 57.274  1.00 110.12 ? 643  GLU A OE1   1 
ATOM   1804  O  OE2   . GLU A 1  260 ? -64.094 -17.823 55.688  1.00 109.83 ? 643  GLU A OE2   1 
ATOM   1805  N  N     . PRO A 1  261 ? -67.466 -17.565 55.959  1.00 93.81  ? 644  PRO A N     1 
ATOM   1806  C  CA    . PRO A 1  261 ? -68.126 -16.608 55.069  1.00 91.23  ? 644  PRO A CA    1 
ATOM   1807  C  C     . PRO A 1  261 ? -67.514 -16.573 53.683  1.00 91.73  ? 644  PRO A C     1 
ATOM   1808  O  O     . PRO A 1  261 ? -68.232 -16.451 52.689  1.00 94.20  ? 644  PRO A O     1 
ATOM   1809  C  CB    . PRO A 1  261 ? -67.947 -15.277 55.803  1.00 96.57  ? 644  PRO A CB    1 
ATOM   1810  C  CG    . PRO A 1  261 ? -66.731 -15.487 56.645  1.00 100.04 ? 644  PRO A CG    1 
ATOM   1811  C  CD    . PRO A 1  261 ? -66.792 -16.908 57.085  1.00 97.02  ? 644  PRO A CD    1 
ATOM   1812  N  N     . LYS A 1  262 ? -66.195 -16.685 53.597  1.00 90.81  ? 645  LYS A N     1 
ATOM   1813  C  CA    . LYS A 1  262 ? -65.473 -16.553 52.333  1.00 102.10 ? 645  LYS A CA    1 
ATOM   1814  C  C     . LYS A 1  262 ? -64.663 -17.827 52.154  1.00 98.30  ? 645  LYS A C     1 
ATOM   1815  O  O     . LYS A 1  262 ? -63.453 -17.853 52.407  1.00 102.46 ? 645  LYS A O     1 
ATOM   1816  C  CB    . LYS A 1  262 ? -64.600 -15.292 52.319  1.00 108.39 ? 645  LYS A CB    1 
ATOM   1817  C  CG    . LYS A 1  262 ? -65.379 -13.968 52.245  1.00 112.95 ? 645  LYS A CG    1 
ATOM   1818  C  CD    . LYS A 1  262 ? -64.472 -12.736 52.387  1.00 123.45 ? 645  LYS A CD    1 
ATOM   1819  C  CE    . LYS A 1  262 ? -63.863 -12.608 53.790  1.00 130.03 ? 645  LYS A CE    1 
ATOM   1820  N  NZ    . LYS A 1  262 ? -63.152 -11.306 54.010  1.00 132.24 ? 645  LYS A NZ    1 
ATOM   1821  N  N     . PRO A 1  263 ? -65.301 -18.910 51.705  1.00 102.77 ? 646  PRO A N     1 
ATOM   1822  C  CA    . PRO A 1  263 ? -64.658 -20.228 51.801  1.00 97.55  ? 646  PRO A CA    1 
ATOM   1823  C  C     . PRO A 1  263 ? -63.484 -20.409 50.853  1.00 102.79 ? 646  PRO A C     1 
ATOM   1824  O  O     . PRO A 1  263 ? -62.614 -21.249 51.129  1.00 92.33  ? 646  PRO A O     1 
ATOM   1825  C  CB    . PRO A 1  263 ? -65.805 -21.198 51.492  1.00 94.51  ? 646  PRO A CB    1 
ATOM   1826  C  CG    . PRO A 1  263 ? -66.739 -20.412 50.635  1.00 109.19 ? 646  PRO A CG    1 
ATOM   1827  C  CD    . PRO A 1  263 ? -66.621 -18.971 51.057  1.00 107.66 ? 646  PRO A CD    1 
ATOM   1828  N  N     . ASN A 1  264 ? -63.414 -19.636 49.768  1.00 109.49 ? 647  ASN A N     1 
ATOM   1829  C  CA    . ASN A 1  264 ? -62.307 -19.701 48.820  1.00 110.70 ? 647  ASN A CA    1 
ATOM   1830  C  C     . ASN A 1  264 ? -61.216 -18.676 49.101  1.00 108.47 ? 647  ASN A C     1 
ATOM   1831  O  O     . ASN A 1  264 ? -60.278 -18.569 48.307  1.00 121.91 ? 647  ASN A O     1 
ATOM   1832  C  CB    . ASN A 1  264 ? -62.811 -19.497 47.383  1.00 118.86 ? 647  ASN A CB    1 
ATOM   1833  C  CG    . ASN A 1  264 ? -63.583 -20.687 46.846  1.00 125.15 ? 647  ASN A CG    1 
ATOM   1834  O  OD1   . ASN A 1  264 ? -63.073 -21.803 46.792  1.00 123.32 ? 647  ASN A OD1   1 
ATOM   1835  N  ND2   . ASN A 1  264 ? -64.825 -20.451 46.446  1.00 133.40 ? 647  ASN A ND2   1 
ATOM   1836  N  N     . SER A 1  265 ? -61.318 -17.916 50.187  1.00 103.86 ? 648  SER A N     1 
ATOM   1837  C  CA    . SER A 1  265 ? -60.290 -16.935 50.500  1.00 102.14 ? 648  SER A CA    1 
ATOM   1838  C  C     . SER A 1  265 ? -59.005 -17.615 50.952  1.00 91.34  ? 648  SER A C     1 
ATOM   1839  O  O     . SER A 1  265 ? -59.018 -18.722 51.493  1.00 91.45  ? 648  SER A O     1 
ATOM   1840  C  CB    . SER A 1  265 ? -60.764 -15.974 51.589  1.00 103.28 ? 648  SER A CB    1 
ATOM   1841  O  OG    . SER A 1  265 ? -59.681 -15.187 52.058  1.00 104.83 ? 648  SER A OG    1 
ATOM   1842  N  N     . GLU A 1  266 ? -57.883 -16.933 50.719  1.00 95.29  ? 649  GLU A N     1 
ATOM   1843  C  CA    . GLU A 1  266 ? -56.609 -17.384 51.254  1.00 95.24  ? 649  GLU A CA    1 
ATOM   1844  C  C     . GLU A 1  266 ? -56.503 -17.136 52.745  1.00 89.67  ? 649  GLU A C     1 
ATOM   1845  O  O     . GLU A 1  266 ? -55.529 -17.578 53.363  1.00 94.91  ? 649  GLU A O     1 
ATOM   1846  C  CB    . GLU A 1  266 ? -55.451 -16.687 50.548  1.00 101.46 ? 649  GLU A CB    1 
ATOM   1847  C  CG    . GLU A 1  266 ? -55.364 -15.213 50.850  1.00 109.26 ? 649  GLU A CG    1 
ATOM   1848  C  CD    . GLU A 1  266 ? -56.125 -14.381 49.847  1.00 124.76 ? 649  GLU A CD    1 
ATOM   1849  O  OE1   . GLU A 1  266 ? -56.963 -14.966 49.122  1.00 125.43 ? 649  GLU A OE1   1 
ATOM   1850  O  OE2   . GLU A 1  266 ? -55.870 -13.155 49.771  1.00 124.81 ? 649  GLU A OE2   1 
ATOM   1851  N  N     . LEU A 1  267 ? -57.479 -16.440 53.326  1.00 84.52  ? 650  LEU A N     1 
ATOM   1852  C  CA    . LEU A 1  267 ? -57.445 -16.114 54.744  1.00 82.23  ? 650  LEU A CA    1 
ATOM   1853  C  C     . LEU A 1  267 ? -57.784 -17.308 55.618  1.00 83.68  ? 650  LEU A C     1 
ATOM   1854  O  O     . LEU A 1  267 ? -57.289 -17.405 56.743  1.00 89.54  ? 650  LEU A O     1 
ATOM   1855  C  CB    . LEU A 1  267 ? -58.425 -14.993 55.040  1.00 89.11  ? 650  LEU A CB    1 
ATOM   1856  C  CG    . LEU A 1  267 ? -58.059 -13.624 54.492  1.00 99.48  ? 650  LEU A CG    1 
ATOM   1857  C  CD1   . LEU A 1  267 ? -59.201 -12.662 54.806  1.00 104.42 ? 650  LEU A CD1   1 
ATOM   1858  C  CD2   . LEU A 1  267 ? -56.724 -13.141 55.082  1.00 99.67  ? 650  LEU A CD2   1 
ATOM   1859  N  N     . CYS A 1  268 ? -58.639 -18.207 55.142  1.00 87.26  ? 651  CYS A N     1 
ATOM   1860  C  CA    . CYS A 1  268 ? -59.076 -19.344 55.945  1.00 93.38  ? 651  CYS A CA    1 
ATOM   1861  C  C     . CYS A 1  268 ? -58.534 -20.675 55.435  1.00 89.61  ? 651  CYS A C     1 
ATOM   1862  O  O     . CYS A 1  268 ? -59.012 -21.734 55.862  1.00 86.19  ? 651  CYS A O     1 
ATOM   1863  C  CB    . CYS A 1  268 ? -60.606 -19.385 56.011  1.00 95.97  ? 651  CYS A CB    1 
ATOM   1864  S  SG    . CYS A 1  268 ? -61.401 -19.273 54.402  1.00 102.67 ? 651  CYS A SG    1 
ATOM   1865  N  N     . CYS A 1  269 ? -57.540 -20.652 54.554  1.00 84.75  ? 652  CYS A N     1 
ATOM   1866  C  CA    . CYS A 1  269 ? -56.993 -21.865 53.956  1.00 71.88  ? 652  CYS A CA    1 
ATOM   1867  C  C     . CYS A 1  269 ? -55.745 -22.263 54.737  1.00 70.79  ? 652  CYS A C     1 
ATOM   1868  O  O     . CYS A 1  269 ? -54.611 -22.043 54.306  1.00 70.51  ? 652  CYS A O     1 
ATOM   1869  C  CB    . CYS A 1  269 ? -56.713 -21.632 52.482  1.00 81.04  ? 652  CYS A CB    1 
ATOM   1870  S  SG    . CYS A 1  269 ? -55.863 -22.967 51.694  1.00 104.23 ? 652  CYS A SG    1 
ATOM   1871  N  N     . LYS A 1  270 ? -55.966 -22.889 55.887  1.00 75.23  ? 653  LYS A N     1 
ATOM   1872  C  CA    . LYS A 1  270 ? -54.899 -23.134 56.853  1.00 68.53  ? 653  LYS A CA    1 
ATOM   1873  C  C     . LYS A 1  270 ? -53.876 -24.090 56.280  1.00 67.24  ? 653  LYS A C     1 
ATOM   1874  O  O     . LYS A 1  270 ? -54.205 -25.238 55.977  1.00 80.68  ? 653  LYS A O     1 
ATOM   1875  C  CB    . LYS A 1  270 ? -55.453 -23.678 58.165  1.00 63.98  ? 653  LYS A CB    1 
ATOM   1876  C  CG    . LYS A 1  270 ? -56.596 -22.841 58.686  1.00 76.12  ? 653  LYS A CG    1 
ATOM   1877  C  CD    . LYS A 1  270 ? -56.742 -22.932 60.182  1.00 68.13  ? 653  LYS A CD    1 
ATOM   1878  C  CE    . LYS A 1  270 ? -55.695 -22.101 60.856  1.00 75.44  ? 653  LYS A CE    1 
ATOM   1879  N  NZ    . LYS A 1  270 ? -56.250 -20.774 61.207  1.00 80.05  ? 653  LYS A NZ    1 
ATOM   1880  N  N     . PRO A 1  271 ? -52.630 -23.666 56.132  1.00 68.97  ? 654  PRO A N     1 
ATOM   1881  C  CA    . PRO A 1  271 ? -51.590 -24.530 55.569  1.00 69.79  ? 654  PRO A CA    1 
ATOM   1882  C  C     . PRO A 1  271 ? -51.239 -25.641 56.547  1.00 69.80  ? 654  PRO A C     1 
ATOM   1883  O  O     . PRO A 1  271 ? -50.936 -25.376 57.716  1.00 64.31  ? 654  PRO A O     1 
ATOM   1884  C  CB    . PRO A 1  271 ? -50.417 -23.570 55.372  1.00 77.72  ? 654  PRO A CB    1 
ATOM   1885  C  CG    . PRO A 1  271 ? -50.594 -22.598 56.535  1.00 80.76  ? 654  PRO A CG    1 
ATOM   1886  C  CD    . PRO A 1  271 ? -52.091 -22.391 56.617  1.00 73.75  ? 654  PRO A CD    1 
ATOM   1887  N  N     . LEU A 1  272 ? -51.242 -26.886 56.047  1.00 62.51  ? 655  LEU A N     1 
ATOM   1888  C  CA    . LEU A 1  272 ? -50.962 -28.082 56.833  1.00 62.30  ? 655  LEU A CA    1 
ATOM   1889  C  C     . LEU A 1  272 ? -49.617 -28.719 56.490  1.00 61.25  ? 655  LEU A C     1 
ATOM   1890  O  O     . LEU A 1  272 ? -48.934 -29.256 57.372  1.00 58.44  ? 655  LEU A O     1 
ATOM   1891  C  CB    . LEU A 1  272 ? -52.098 -29.087 56.627  1.00 65.24  ? 655  LEU A CB    1 
ATOM   1892  C  CG    . LEU A 1  272 ? -52.172 -30.310 57.540  1.00 72.61  ? 655  LEU A CG    1 
ATOM   1893  C  CD1   . LEU A 1  272 ? -51.637 -29.943 58.903  1.00 71.50  ? 655  LEU A CD1   1 
ATOM   1894  C  CD2   . LEU A 1  272 ? -53.614 -30.816 57.642  1.00 75.52  ? 655  LEU A CD2   1 
ATOM   1895  N  N     . CYS A 1  273 ? -49.221 -28.666 55.220  1.00 61.30  ? 656  CYS A N     1 
ATOM   1896  C  CA    . CYS A 1  273 ? -47.913 -29.152 54.803  1.00 63.33  ? 656  CYS A CA    1 
ATOM   1897  C  C     . CYS A 1  273 ? -47.419 -28.333 53.621  1.00 71.46  ? 656  CYS A C     1 
ATOM   1898  O  O     . CYS A 1  273 ? -48.131 -28.206 52.621  1.00 82.06  ? 656  CYS A O     1 
ATOM   1899  C  CB    . CYS A 1  273 ? -47.964 -30.618 54.412  1.00 66.82  ? 656  CYS A CB    1 
ATOM   1900  S  SG    . CYS A 1  273 ? -46.347 -31.276 53.887  1.00 71.04  ? 656  CYS A SG    1 
ATOM   1901  N  N     . LEU A 1  274 ? -46.212 -27.774 53.735  1.00 69.85  ? 657  LEU A N     1 
ATOM   1902  C  CA    . LEU A 1  274 ? -45.562 -27.076 52.629  1.00 68.88  ? 657  LEU A CA    1 
ATOM   1903  C  C     . LEU A 1  274 ? -44.375 -27.893 52.145  1.00 68.44  ? 657  LEU A C     1 
ATOM   1904  O  O     . LEU A 1  274 ? -43.520 -28.278 52.951  1.00 70.45  ? 657  LEU A O     1 
ATOM   1905  C  CB    . LEU A 1  274 ? -45.101 -25.677 53.048  1.00 70.64  ? 657  LEU A CB    1 
ATOM   1906  C  CG    . LEU A 1  274 ? -46.265 -24.715 53.288  1.00 83.19  ? 657  LEU A CG    1 
ATOM   1907  C  CD1   . LEU A 1  274 ? -45.814 -23.345 53.835  1.00 88.19  ? 657  LEU A CD1   1 
ATOM   1908  C  CD2   . LEU A 1  274 ? -47.107 -24.574 52.005  1.00 90.41  ? 657  LEU A CD2   1 
ATOM   1909  N  N     . MET A 1  275 ? -44.306 -28.151 50.833  1.00 69.47  ? 658  MET A N     1 
ATOM   1910  C  CA    . MET A 1  275 ? -43.180 -28.914 50.307  1.00 72.65  ? 658  MET A CA    1 
ATOM   1911  C  C     . MET A 1  275 ? -42.635 -28.306 49.023  1.00 74.38  ? 658  MET A C     1 
ATOM   1912  O  O     . MET A 1  275 ? -43.395 -27.795 48.199  1.00 78.99  ? 658  MET A O     1 
ATOM   1913  C  CB    . MET A 1  275 ? -43.576 -30.357 50.049  1.00 78.73  ? 658  MET A CB    1 
ATOM   1914  C  CG    . MET A 1  275 ? -44.509 -30.540 48.896  1.00 80.24  ? 658  MET A CG    1 
ATOM   1915  S  SD    . MET A 1  275 ? -45.126 -32.233 48.884  1.00 110.88 ? 658  MET A SD    1 
ATOM   1916  C  CE    . MET A 1  275 ? -46.667 -32.008 49.754  1.00 85.10  ? 658  MET A CE    1 
ATOM   1917  N  N     . LEU A 1  276 ? -41.311 -28.376 48.854  1.00 79.65  ? 659  LEU A N     1 
ATOM   1918  C  CA    . LEU A 1  276 ? -40.643 -27.978 47.610  1.00 79.71  ? 659  LEU A CA    1 
ATOM   1919  C  C     . LEU A 1  276 ? -40.452 -29.211 46.727  1.00 89.56  ? 659  LEU A C     1 
ATOM   1920  O  O     . LEU A 1  276 ? -39.391 -29.840 46.724  1.00 91.12  ? 659  LEU A O     1 
ATOM   1921  C  CB    . LEU A 1  276 ? -39.314 -27.299 47.906  1.00 88.20  ? 659  LEU A CB    1 
ATOM   1922  C  CG    . LEU A 1  276 ? -39.454 -25.886 48.437  1.00 79.72  ? 659  LEU A CG    1 
ATOM   1923  C  CD1   . LEU A 1  276 ? -38.121 -25.182 48.406  1.00 84.84  ? 659  LEU A CD1   1 
ATOM   1924  C  CD2   . LEU A 1  276 ? -40.465 -25.177 47.583  1.00 80.12  ? 659  LEU A CD2   1 
ATOM   1925  N  N     . ALA A 1  277 ? -41.486 -29.542 45.954  1.00 81.70  ? 660  ALA A N     1 
ATOM   1926  C  CA    . ALA A 1  277 ? -41.486 -30.726 45.102  1.00 80.08  ? 660  ALA A CA    1 
ATOM   1927  C  C     . ALA A 1  277 ? -42.543 -30.549 44.022  1.00 78.72  ? 660  ALA A C     1 
ATOM   1928  O  O     . ALA A 1  277 ? -43.441 -29.716 44.144  1.00 79.43  ? 660  ALA A O     1 
ATOM   1929  C  CB    . ALA A 1  277 ? -41.741 -32.002 45.913  1.00 72.92  ? 660  ALA A CB    1 
ATOM   1930  N  N     . ASP A 1  278 ? -42.426 -31.342 42.959  1.00 74.41  ? 661  ASP A N     1 
ATOM   1931  C  CA    . ASP A 1  278 ? -43.317 -31.222 41.812  1.00 78.93  ? 661  ASP A CA    1 
ATOM   1932  C  C     . ASP A 1  278 ? -44.592 -32.004 42.076  1.00 82.05  ? 661  ASP A C     1 
ATOM   1933  O  O     . ASP A 1  278 ? -44.537 -33.162 42.490  1.00 93.55  ? 661  ASP A O     1 
ATOM   1934  C  CB    . ASP A 1  278 ? -42.626 -31.728 40.542  1.00 94.51  ? 661  ASP A CB    1 
ATOM   1935  C  CG    . ASP A 1  278 ? -43.433 -31.451 39.263  1.00 108.92 ? 661  ASP A CG    1 
ATOM   1936  O  OD1   . ASP A 1  278 ? -44.450 -30.717 39.312  1.00 105.68 ? 661  ASP A OD1   1 
ATOM   1937  O  OD2   . ASP A 1  278 ? -43.049 -31.976 38.194  1.00 105.13 ? 661  ASP A OD2   1 
ATOM   1938  N  N     . GLU A 1  279 ? -45.741 -31.373 41.846  1.00 83.40  ? 662  GLU A N     1 
ATOM   1939  C  CA    . GLU A 1  279 ? -46.983 -32.114 41.997  1.00 81.92  ? 662  GLU A CA    1 
ATOM   1940  C  C     . GLU A 1  279 ? -47.051 -33.311 41.059  1.00 94.37  ? 662  GLU A C     1 
ATOM   1941  O  O     . GLU A 1  279 ? -47.796 -34.252 41.341  1.00 100.07 ? 662  GLU A O     1 
ATOM   1942  C  CB    . GLU A 1  279 ? -48.181 -31.195 41.774  1.00 86.57  ? 662  GLU A CB    1 
ATOM   1943  C  CG    . GLU A 1  279 ? -48.444 -30.796 40.337  1.00 93.97  ? 662  GLU A CG    1 
ATOM   1944  C  CD    . GLU A 1  279 ? -49.675 -29.905 40.225  1.00 97.35  ? 662  GLU A CD    1 
ATOM   1945  O  OE1   . GLU A 1  279 ? -49.524 -28.667 40.171  1.00 103.97 ? 662  GLU A OE1   1 
ATOM   1946  O  OE2   . GLU A 1  279 ? -50.803 -30.436 40.230  1.00 99.89  ? 662  GLU A OE2   1 
ATOM   1947  N  N     . SER A 1  280 ? -46.282 -33.314 39.968  1.00 92.94  ? 663  SER A N     1 
ATOM   1948  C  CA    . SER A 1  280 ? -46.242 -34.463 39.071  1.00 89.05  ? 663  SER A CA    1 
ATOM   1949  C  C     . SER A 1  280 ? -45.217 -35.507 39.487  1.00 89.01  ? 663  SER A C     1 
ATOM   1950  O  O     . SER A 1  280 ? -45.061 -36.504 38.778  1.00 101.00 ? 663  SER A O     1 
ATOM   1951  C  CB    . SER A 1  280 ? -45.951 -34.020 37.634  1.00 96.94  ? 663  SER A CB    1 
ATOM   1952  O  OG    . SER A 1  280 ? -47.114 -33.496 37.015  1.00 108.06 ? 663  SER A OG    1 
ATOM   1953  N  N     . ASP A 1  281 ? -44.523 -35.317 40.608  1.00 86.81  ? 664  ASP A N     1 
ATOM   1954  C  CA    . ASP A 1  281 ? -43.474 -36.245 41.033  1.00 80.02  ? 664  ASP A CA    1 
ATOM   1955  C  C     . ASP A 1  281 ? -44.064 -37.244 42.006  1.00 80.24  ? 664  ASP A C     1 
ATOM   1956  O  O     . ASP A 1  281 ? -43.945 -37.099 43.217  1.00 83.45  ? 664  ASP A O     1 
ATOM   1957  C  CB    . ASP A 1  281 ? -42.318 -35.517 41.689  1.00 86.91  ? 664  ASP A CB    1 
ATOM   1958  C  CG    . ASP A 1  281 ? -41.318 -36.479 42.270  1.00 84.68  ? 664  ASP A CG    1 
ATOM   1959  O  OD1   . ASP A 1  281 ? -41.321 -37.647 41.836  1.00 80.79  ? 664  ASP A OD1   1 
ATOM   1960  O  OD2   . ASP A 1  281 ? -40.550 -36.080 43.165  1.00 97.63  ? 664  ASP A OD2   1 
ATOM   1961  N  N     . HIS A 1  282 ? -44.634 -38.311 41.469  1.00 87.52  ? 665  HIS A N     1 
ATOM   1962  C  CA    . HIS A 1  282 ? -45.539 -39.128 42.259  1.00 77.20  ? 665  HIS A CA    1 
ATOM   1963  C  C     . HIS A 1  282 ? -44.862 -39.750 43.477  1.00 73.41  ? 665  HIS A C     1 
ATOM   1964  O  O     . HIS A 1  282 ? -45.481 -39.829 44.544  1.00 74.55  ? 665  HIS A O     1 
ATOM   1965  C  CB    . HIS A 1  282 ? -46.129 -40.191 41.362  1.00 83.16  ? 665  HIS A CB    1 
ATOM   1966  C  CG    . HIS A 1  282 ? -47.478 -40.647 41.791  1.00 78.73  ? 665  HIS A CG    1 
ATOM   1967  N  ND1   . HIS A 1  282 ? -48.627 -39.947 41.503  1.00 79.39  ? 665  HIS A ND1   1 
ATOM   1968  C  CD2   . HIS A 1  282 ? -47.862 -41.739 42.492  1.00 91.60  ? 665  HIS A CD2   1 
ATOM   1969  C  CE1   . HIS A 1  282 ? -49.664 -40.593 42.009  1.00 90.02  ? 665  HIS A CE1   1 
ATOM   1970  N  NE2   . HIS A 1  282 ? -49.228 -41.682 42.614  1.00 90.62  ? 665  HIS A NE2   1 
ATOM   1971  N  N     . GLU A 1  283 ? -43.592 -40.159 43.345  1.00 72.22  ? 666  GLU A N     1 
ATOM   1972  C  CA    . GLU A 1  283 ? -42.872 -40.834 44.430  1.00 73.12  ? 666  GLU A CA    1 
ATOM   1973  C  C     . GLU A 1  283 ? -42.776 -39.952 45.662  1.00 78.05  ? 666  GLU A C     1 
ATOM   1974  O  O     . GLU A 1  283 ? -43.077 -40.385 46.785  1.00 81.49  ? 666  GLU A O     1 
ATOM   1975  C  CB    . GLU A 1  283 ? -41.463 -41.215 43.974  1.00 81.59  ? 666  GLU A CB    1 
ATOM   1976  C  CG    . GLU A 1  283 ? -41.361 -42.379 42.985  1.00 92.37  ? 666  GLU A CG    1 
ATOM   1977  C  CD    . GLU A 1  283 ? -41.879 -42.057 41.591  1.00 93.00  ? 666  GLU A CD    1 
ATOM   1978  O  OE1   . GLU A 1  283 ? -41.851 -42.959 40.721  1.00 91.41  ? 666  GLU A OE1   1 
ATOM   1979  O  OE2   . GLU A 1  283 ? -42.319 -40.909 41.368  1.00 100.01 ? 666  GLU A OE2   1 
ATOM   1980  N  N     . THR A 1  284 ? -42.382 -38.694 45.458  1.00 82.68  ? 667  THR A N     1 
ATOM   1981  C  CA    . THR A 1  284 ? -42.273 -37.739 46.553  1.00 76.70  ? 667  THR A CA    1 
ATOM   1982  C  C     . THR A 1  284 ? -43.635 -37.275 47.038  1.00 72.59  ? 667  THR A C     1 
ATOM   1983  O  O     . THR A 1  284 ? -43.838 -37.090 48.240  1.00 69.02  ? 667  THR A O     1 
ATOM   1984  C  CB    . THR A 1  284 ? -41.455 -36.556 46.088  1.00 71.80  ? 667  THR A CB    1 
ATOM   1985  O  OG1   . THR A 1  284 ? -40.275 -37.048 45.448  1.00 80.15  ? 667  THR A OG1   1 
ATOM   1986  C  CG2   . THR A 1  284 ? -41.076 -35.667 47.257  1.00 89.18  ? 667  THR A CG2   1 
ATOM   1987  N  N     . LEU A 1  285 ? -44.572 -37.052 46.122  1.00 73.96  ? 668  LEU A N     1 
ATOM   1988  C  CA    . LEU A 1  285 ? -45.906 -36.658 46.542  1.00 66.13  ? 668  LEU A CA    1 
ATOM   1989  C  C     . LEU A 1  285 ? -46.472 -37.670 47.527  1.00 74.86  ? 668  LEU A C     1 
ATOM   1990  O  O     . LEU A 1  285 ? -46.941 -37.300 48.612  1.00 79.73  ? 668  LEU A O     1 
ATOM   1991  C  CB    . LEU A 1  285 ? -46.822 -36.499 45.329  1.00 73.08  ? 668  LEU A CB    1 
ATOM   1992  C  CG    . LEU A 1  285 ? -48.183 -35.889 45.639  1.00 71.08  ? 668  LEU A CG    1 
ATOM   1993  C  CD1   . LEU A 1  285 ? -47.980 -34.542 46.308  1.00 71.67  ? 668  LEU A CD1   1 
ATOM   1994  C  CD2   . LEU A 1  285 ? -49.046 -35.767 44.384  1.00 75.03  ? 668  LEU A CD2   1 
ATOM   1995  N  N     . THR A 1  286 ? -46.383 -38.965 47.193  1.00 75.64  ? 669  THR A N     1 
ATOM   1996  C  CA    . THR A 1  286 ? -46.970 -39.978 48.069  1.00 79.39  ? 669  THR A CA    1 
ATOM   1997  C  C     . THR A 1  286 ? -46.153 -40.154 49.342  1.00 73.19  ? 669  THR A C     1 
ATOM   1998  O  O     . THR A 1  286 ? -46.730 -40.333 50.421  1.00 76.51  ? 669  THR A O     1 
ATOM   1999  C  CB    . THR A 1  286 ? -47.124 -41.325 47.357  1.00 75.20  ? 669  THR A CB    1 
ATOM   2000  O  OG1   . THR A 1  286 ? -45.838 -41.816 46.976  1.00 77.58  ? 669  THR A OG1   1 
ATOM   2001  C  CG2   . THR A 1  286 ? -48.026 -41.203 46.135  1.00 75.23  ? 669  THR A CG2   1 
ATOM   2002  N  N     . ALA A 1  287 ? -44.820 -40.068 49.254  1.00 74.97  ? 670  ALA A N     1 
ATOM   2003  C  CA    . ALA A 1  287 ? -44.009 -40.173 50.465  1.00 73.49  ? 670  ALA A CA    1 
ATOM   2004  C  C     . ALA A 1  287 ? -44.312 -39.054 51.461  1.00 74.97  ? 670  ALA A C     1 
ATOM   2005  O  O     . ALA A 1  287 ? -44.316 -39.285 52.676  1.00 75.07  ? 670  ALA A O     1 
ATOM   2006  C  CB    . ALA A 1  287 ? -42.525 -40.160 50.112  1.00 76.72  ? 670  ALA A CB    1 
ATOM   2007  N  N     . ILE A 1  288 ? -44.548 -37.831 50.978  1.00 78.56  ? 671  ILE A N     1 
ATOM   2008  C  CA    . ILE A 1  288 ? -44.787 -36.720 51.897  1.00 72.48  ? 671  ILE A CA    1 
ATOM   2009  C  C     . ILE A 1  288 ? -46.221 -36.750 52.413  1.00 70.01  ? 671  ILE A C     1 
ATOM   2010  O  O     . ILE A 1  288 ? -46.457 -36.552 53.607  1.00 76.26  ? 671  ILE A O     1 
ATOM   2011  C  CB    . ILE A 1  288 ? -44.437 -35.373 51.223  1.00 78.87  ? 671  ILE A CB    1 
ATOM   2012  C  CG1   . ILE A 1  288 ? -42.947 -35.293 50.881  1.00 72.01  ? 671  ILE A CG1   1 
ATOM   2013  C  CG2   . ILE A 1  288 ? -44.754 -34.195 52.133  1.00 85.44  ? 671  ILE A CG2   1 
ATOM   2014  C  CD1   . ILE A 1  288 ? -42.041 -35.212 52.104  1.00 72.83  ? 671  ILE A CD1   1 
ATOM   2015  N  N     . LEU A 1  289 ? -47.190 -37.054 51.543  1.00 67.05  ? 672  LEU A N     1 
ATOM   2016  C  CA    . LEU A 1  289 ? -48.590 -36.915 51.915  1.00 69.65  ? 672  LEU A CA    1 
ATOM   2017  C  C     . LEU A 1  289 ? -49.155 -38.126 52.656  1.00 82.18  ? 672  LEU A C     1 
ATOM   2018  O  O     . LEU A 1  289 ? -50.161 -37.985 53.362  1.00 86.60  ? 672  LEU A O     1 
ATOM   2019  C  CB    . LEU A 1  289 ? -49.432 -36.658 50.670  1.00 67.08  ? 672  LEU A CB    1 
ATOM   2020  C  CG    . LEU A 1  289 ? -49.290 -35.302 50.003  1.00 74.25  ? 672  LEU A CG    1 
ATOM   2021  C  CD1   . LEU A 1  289 ? -50.421 -35.068 49.005  1.00 85.15  ? 672  LEU A CD1   1 
ATOM   2022  C  CD2   . LEU A 1  289 ? -49.294 -34.247 51.068  1.00 76.73  ? 672  LEU A CD2   1 
ATOM   2023  N  N     . SER A 1  290 ? -48.575 -39.321 52.501  1.00 81.31  ? 673  SER A N     1 
ATOM   2024  C  CA    . SER A 1  290 ? -49.169 -40.512 53.109  1.00 73.24  ? 673  SER A CA    1 
ATOM   2025  C  C     . SER A 1  290 ? -49.345 -40.403 54.620  1.00 77.35  ? 673  SER A C     1 
ATOM   2026  O  O     . SER A 1  290 ? -50.424 -40.770 55.113  1.00 90.34  ? 673  SER A O     1 
ATOM   2027  C  CB    . SER A 1  290 ? -48.328 -41.727 52.695  1.00 74.95  ? 673  SER A CB    1 
ATOM   2028  O  OG    . SER A 1  290 ? -48.282 -41.823 51.279  1.00 81.44  ? 673  SER A OG    1 
ATOM   2029  N  N     . PRO A 1  291 ? -48.373 -39.898 55.398  1.00 69.67  ? 674  PRO A N     1 
ATOM   2030  C  CA    . PRO A 1  291 ? -48.600 -39.709 56.845  1.00 68.78  ? 674  PRO A CA    1 
ATOM   2031  C  C     . PRO A 1  291 ? -49.753 -38.784 57.197  1.00 73.18  ? 674  PRO A C     1 
ATOM   2032  O  O     . PRO A 1  291 ? -50.496 -39.044 58.158  1.00 85.02  ? 674  PRO A O     1 
ATOM   2033  C  CB    . PRO A 1  291 ? -47.271 -39.125 57.320  1.00 66.77  ? 674  PRO A CB    1 
ATOM   2034  C  CG    . PRO A 1  291 ? -46.289 -39.652 56.374  1.00 70.04  ? 674  PRO A CG    1 
ATOM   2035  C  CD    . PRO A 1  291 ? -46.954 -39.736 55.051  1.00 66.72  ? 674  PRO A CD    1 
ATOM   2036  N  N     . LEU A 1  292 ? -49.914 -37.689 56.463  1.00 76.07  ? 675  LEU A N     1 
ATOM   2037  C  CA    . LEU A 1  292 ? -51.096 -36.862 56.663  1.00 84.15  ? 675  LEU A CA    1 
ATOM   2038  C  C     . LEU A 1  292 ? -52.363 -37.678 56.424  1.00 85.33  ? 675  LEU A C     1 
ATOM   2039  O  O     . LEU A 1  292 ? -53.302 -37.628 57.229  1.00 87.94  ? 675  LEU A O     1 
ATOM   2040  C  CB    . LEU A 1  292 ? -51.062 -35.629 55.748  1.00 85.61  ? 675  LEU A CB    1 
ATOM   2041  C  CG    . LEU A 1  292 ? -49.962 -34.584 55.943  1.00 81.94  ? 675  LEU A CG    1 
ATOM   2042  C  CD1   . LEU A 1  292 ? -49.989 -33.633 54.800  1.00 80.09  ? 675  LEU A CD1   1 
ATOM   2043  C  CD2   . LEU A 1  292 ? -50.158 -33.837 57.226  1.00 81.81  ? 675  LEU A CD2   1 
ATOM   2044  N  N     . ILE A 1  293 ? -52.413 -38.440 55.323  1.00 83.79  ? 676  ILE A N     1 
ATOM   2045  C  CA    . ILE A 1  293 ? -53.649 -39.157 55.020  1.00 82.17  ? 676  ILE A CA    1 
ATOM   2046  C  C     . ILE A 1  293 ? -53.944 -40.144 56.128  1.00 82.01  ? 676  ILE A C     1 
ATOM   2047  O  O     . ILE A 1  293 ? -55.102 -40.339 56.511  1.00 86.44  ? 676  ILE A O     1 
ATOM   2048  C  CB    . ILE A 1  293 ? -53.584 -39.847 53.647  1.00 79.67  ? 676  ILE A CB    1 
ATOM   2049  C  CG1   . ILE A 1  293 ? -53.187 -38.855 52.559  1.00 70.37  ? 676  ILE A CG1   1 
ATOM   2050  C  CG2   . ILE A 1  293 ? -54.955 -40.439 53.322  1.00 88.42  ? 676  ILE A CG2   1 
ATOM   2051  C  CD1   . ILE A 1  293 ? -54.249 -37.819 52.273  1.00 85.83  ? 676  ILE A CD1   1 
ATOM   2052  N  N     . ALA A 1  294 ? -52.891 -40.749 56.682  1.00 84.23  ? 677  ALA A N     1 
ATOM   2053  C  CA    . ALA A 1  294 ? -53.039 -41.719 57.761  1.00 84.06  ? 677  ALA A CA    1 
ATOM   2054  C  C     . ALA A 1  294 ? -53.617 -41.081 59.018  1.00 79.38  ? 677  ALA A C     1 
ATOM   2055  O  O     . ALA A 1  294 ? -54.528 -41.642 59.644  1.00 88.63  ? 677  ALA A O     1 
ATOM   2056  C  CB    . ALA A 1  294 ? -51.688 -42.366 58.058  1.00 85.13  ? 677  ALA A CB    1 
ATOM   2057  N  N     . GLU A 1  295 ? -53.094 -39.923 59.422  1.00 77.86  ? 678  GLU A N     1 
ATOM   2058  C  CA    . GLU A 1  295 ? -53.717 -39.236 60.552  1.00 79.61  ? 678  GLU A CA    1 
ATOM   2059  C  C     . GLU A 1  295 ? -55.165 -38.861 60.240  1.00 79.72  ? 678  GLU A C     1 
ATOM   2060  O  O     . GLU A 1  295 ? -56.029 -38.904 61.124  1.00 78.48  ? 678  GLU A O     1 
ATOM   2061  C  CB    . GLU A 1  295 ? -52.911 -38.000 60.937  1.00 76.65  ? 678  GLU A CB    1 
ATOM   2062  C  CG    . GLU A 1  295 ? -51.494 -38.299 61.385  1.00 78.10  ? 678  GLU A CG    1 
ATOM   2063  C  CD    . GLU A 1  295 ? -50.504 -37.157 61.093  1.00 90.50  ? 678  GLU A CD    1 
ATOM   2064  O  OE1   . GLU A 1  295 ? -50.922 -36.084 60.592  1.00 97.55  ? 678  GLU A OE1   1 
ATOM   2065  O  OE2   . GLU A 1  295 ? -49.291 -37.338 61.361  1.00 95.87  ? 678  GLU A OE2   1 
ATOM   2066  N  N     . ARG A 1  296 ? -55.463 -38.528 58.984  1.00 79.03  ? 679  ARG A N     1 
ATOM   2067  C  CA    . ARG A 1  296 ? -56.820 -38.114 58.632  1.00 84.72  ? 679  ARG A CA    1 
ATOM   2068  C  C     . ARG A 1  296 ? -57.791 -39.275 58.751  1.00 92.67  ? 679  ARG A C     1 
ATOM   2069  O  O     . ARG A 1  296 ? -58.872 -39.160 59.352  1.00 101.69 ? 679  ARG A O     1 
ATOM   2070  C  CB    . ARG A 1  296 ? -56.821 -37.549 57.217  1.00 84.23  ? 679  ARG A CB    1 
ATOM   2071  C  CG    . ARG A 1  296 ? -58.132 -37.651 56.478  1.00 91.79  ? 679  ARG A CG    1 
ATOM   2072  C  CD    . ARG A 1  296 ? -57.865 -37.465 54.986  1.00 102.36 ? 679  ARG A CD    1 
ATOM   2073  N  NE    . ARG A 1  296 ? -59.069 -37.282 54.180  1.00 113.70 ? 679  ARG A NE    1 
ATOM   2074  C  CZ    . ARG A 1  296 ? -59.498 -38.159 53.277  1.00 120.99 ? 679  ARG A CZ    1 
ATOM   2075  N  NH1   . ARG A 1  296 ? -58.816 -39.287 53.065  1.00 113.21 ? 679  ARG A NH1   1 
ATOM   2076  N  NH2   . ARG A 1  296 ? -60.605 -37.905 52.583  1.00 118.44 ? 679  ARG A NH2   1 
ATOM   2077  N  N     . GLU A 1  297 ? -57.404 -40.410 58.180  1.00 89.59  ? 680  GLU A N     1 
ATOM   2078  C  CA    . GLU A 1  297 ? -58.129 -41.660 58.347  1.00 89.14  ? 680  GLU A CA    1 
ATOM   2079  C  C     . GLU A 1  297 ? -58.366 -41.968 59.823  1.00 92.88  ? 680  GLU A C     1 
ATOM   2080  O  O     . GLU A 1  297 ? -59.512 -42.130 60.262  1.00 91.38  ? 680  GLU A O     1 
ATOM   2081  C  CB    . GLU A 1  297 ? -57.336 -42.781 57.673  1.00 102.23 ? 680  GLU A CB    1 
ATOM   2082  C  CG    . GLU A 1  297 ? -58.182 -43.741 56.878  1.00 118.22 ? 680  GLU A CG    1 
ATOM   2083  C  CD    . GLU A 1  297 ? -58.957 -43.049 55.767  1.00 119.43 ? 680  GLU A CD    1 
ATOM   2084  O  OE1   . GLU A 1  297 ? -58.376 -42.186 55.072  1.00 123.38 ? 680  GLU A OE1   1 
ATOM   2085  O  OE2   . GLU A 1  297 ? -60.151 -43.372 55.591  1.00 129.21 ? 680  GLU A OE2   1 
ATOM   2086  N  N     . ALA A 1  298 ? -57.282 -42.024 60.613  1.00 88.88  ? 681  ALA A N     1 
ATOM   2087  C  CA    . ALA A 1  298 ? -57.401 -42.330 62.041  1.00 94.21  ? 681  ALA A CA    1 
ATOM   2088  C  C     . ALA A 1  298 ? -58.426 -41.439 62.732  1.00 90.34  ? 681  ALA A C     1 
ATOM   2089  O  O     . ALA A 1  298 ? -59.217 -41.911 63.560  1.00 93.08  ? 681  ALA A O     1 
ATOM   2090  C  CB    . ALA A 1  298 ? -56.042 -42.197 62.733  1.00 84.28  ? 681  ALA A CB    1 
ATOM   2091  N  N     . MET A 1  299 ? -58.428 -40.145 62.412  1.00 87.93  ? 682  MET A N     1 
ATOM   2092  C  CA    . MET A 1  299 ? -59.408 -39.257 63.029  1.00 89.15  ? 682  MET A CA    1 
ATOM   2093  C  C     . MET A 1  299 ? -60.828 -39.567 62.576  1.00 90.71  ? 682  MET A C     1 
ATOM   2094  O  O     . MET A 1  299 ? -61.785 -39.215 63.274  1.00 97.20  ? 682  MET A O     1 
ATOM   2095  C  CB    . MET A 1  299 ? -59.089 -37.795 62.711  1.00 98.75  ? 682  MET A CB    1 
ATOM   2096  C  CG    . MET A 1  299 ? -57.954 -37.176 63.490  1.00 90.87  ? 682  MET A CG    1 
ATOM   2097  S  SD    . MET A 1  299 ? -57.732 -35.467 63.006  1.00 92.76  ? 682  MET A SD    1 
ATOM   2098  C  CE    . MET A 1  299 ? -57.083 -35.618 61.357  1.00 83.49  ? 682  MET A CE    1 
ATOM   2099  N  N     . LYS A 1  300 ? -60.998 -40.149 61.386  1.00 84.17  ? 683  LYS A N     1 
ATOM   2100  C  CA    . LYS A 1  300 ? -62.369 -40.467 60.991  1.00 89.72  ? 683  LYS A CA    1 
ATOM   2101  C  C     . LYS A 1  300 ? -63.063 -41.432 61.955  1.00 101.16 ? 683  LYS A C     1 
ATOM   2102  O  O     . LYS A 1  300 ? -64.282 -41.619 61.844  1.00 99.72  ? 683  LYS A O     1 
ATOM   2103  C  CB    . LYS A 1  300 ? -62.418 -41.066 59.592  1.00 82.46  ? 683  LYS A CB    1 
ATOM   2104  C  CG    . LYS A 1  300 ? -61.684 -40.280 58.561  1.00 88.30  ? 683  LYS A CG    1 
ATOM   2105  C  CD    . LYS A 1  300 ? -62.487 -40.173 57.283  1.00 94.91  ? 683  LYS A CD    1 
ATOM   2106  C  CE    . LYS A 1  300 ? -61.803 -40.893 56.141  1.00 103.37 ? 683  LYS A CE    1 
ATOM   2107  N  NZ    . LYS A 1  300 ? -62.252 -40.363 54.824  1.00 112.98 ? 683  LYS A NZ    1 
ATOM   2108  N  N     . SER A 1  301 ? -62.332 -42.037 62.896  1.00 94.75  ? 684  SER A N     1 
ATOM   2109  C  CA    . SER A 1  301 ? -62.906 -43.040 63.783  1.00 91.54  ? 684  SER A CA    1 
ATOM   2110  C  C     . SER A 1  301 ? -62.707 -42.689 65.248  1.00 94.09  ? 684  SER A C     1 
ATOM   2111  O  O     . SER A 1  301 ? -62.290 -43.547 66.032  1.00 98.93  ? 684  SER A O     1 
ATOM   2112  C  CB    . SER A 1  301 ? -62.271 -44.404 63.500  1.00 101.93 ? 684  SER A CB    1 
ATOM   2113  O  OG    . SER A 1  301 ? -62.414 -44.753 62.135  1.00 110.40 ? 684  SER A OG    1 
ATOM   2114  N  N     . SER A 1  302 ? -62.994 -41.452 65.637  1.00 95.95  ? 685  SER A N     1 
ATOM   2115  C  CA    . SER A 1  302 ? -62.765 -41.062 67.025  1.00 100.97 ? 685  SER A CA    1 
ATOM   2116  C  C     . SER A 1  302 ? -63.389 -39.692 67.263  1.00 96.85  ? 685  SER A C     1 
ATOM   2117  O  O     . SER A 1  302 ? -63.770 -38.994 66.317  1.00 102.22 ? 685  SER A O     1 
ATOM   2118  C  CB    . SER A 1  302 ? -61.265 -41.049 67.357  1.00 97.60  ? 685  SER A CB    1 
ATOM   2119  O  OG    . SER A 1  302 ? -61.018 -40.739 68.714  1.00 95.32  ? 685  SER A OG    1 
ATOM   2120  N  N     . GLU A 1  303 ? -63.517 -39.327 68.538  1.00 96.37  ? 686  GLU A N     1 
ATOM   2121  C  CA    . GLU A 1  303 ? -64.088 -38.043 68.922  1.00 99.26  ? 686  GLU A CA    1 
ATOM   2122  C  C     . GLU A 1  303 ? -63.054 -37.238 69.694  1.00 96.65  ? 686  GLU A C     1 
ATOM   2123  O  O     . GLU A 1  303 ? -62.349 -37.783 70.554  1.00 92.33  ? 686  GLU A O     1 
ATOM   2124  C  CB    . GLU A 1  303 ? -65.354 -38.211 69.761  1.00 110.76 ? 686  GLU A CB    1 
ATOM   2125  C  CG    . GLU A 1  303 ? -66.493 -38.883 69.014  1.00 129.03 ? 686  GLU A CG    1 
ATOM   2126  C  CD    . GLU A 1  303 ? -67.774 -38.943 69.831  1.00 147.73 ? 686  GLU A CD    1 
ATOM   2127  O  OE1   . GLU A 1  303 ? -68.023 -37.990 70.607  1.00 132.96 ? 686  GLU A OE1   1 
ATOM   2128  O  OE2   . GLU A 1  303 ? -68.523 -39.942 69.697  1.00 149.36 ? 686  GLU A OE2   1 
ATOM   2129  N  N     . LEU A 1  304 ? -62.970 -35.942 69.378  1.00 106.83 ? 687  LEU A N     1 
ATOM   2130  C  CA    . LEU A 1  304 ? -61.983 -35.052 69.978  1.00 98.25  ? 687  LEU A CA    1 
ATOM   2131  C  C     . LEU A 1  304 ? -62.608 -34.345 71.167  1.00 96.24  ? 687  LEU A C     1 
ATOM   2132  O  O     . LEU A 1  304 ? -63.660 -33.719 71.031  1.00 89.82  ? 687  LEU A O     1 
ATOM   2133  C  CB    . LEU A 1  304 ? -61.488 -34.018 68.964  1.00 88.03  ? 687  LEU A CB    1 
ATOM   2134  C  CG    . LEU A 1  304 ? -60.496 -32.967 69.470  1.00 87.04  ? 687  LEU A CG    1 
ATOM   2135  C  CD1   . LEU A 1  304 ? -59.083 -33.513 69.625  1.00 86.64  ? 687  LEU A CD1   1 
ATOM   2136  C  CD2   . LEU A 1  304 ? -60.493 -31.781 68.551  1.00 90.95  ? 687  LEU A CD2   1 
ATOM   2137  N  N     . THR A 1  305 ? -61.970 -34.453 72.327  1.00 98.45  ? 688  THR A N     1 
ATOM   2138  C  CA    . THR A 1  305 ? -62.354 -33.677 73.492  1.00 102.28 ? 688  THR A CA    1 
ATOM   2139  C  C     . THR A 1  305 ? -61.274 -32.648 73.752  1.00 102.63 ? 688  THR A C     1 
ATOM   2140  O  O     . THR A 1  305 ? -60.077 -32.976 73.771  1.00 95.62  ? 688  THR A O     1 
ATOM   2141  C  CB    . THR A 1  305 ? -62.545 -34.548 74.726  1.00 110.50 ? 688  THR A CB    1 
ATOM   2142  O  OG1   . THR A 1  305 ? -61.288 -35.145 75.062  1.00 122.74 ? 688  THR A OG1   1 
ATOM   2143  C  CG2   . THR A 1  305 ? -63.567 -35.631 74.454  1.00 111.53 ? 688  THR A CG2   1 
ATOM   2144  N  N     . LEU A 1  306 ? -61.720 -31.412 73.955  1.00 100.67 ? 689  LEU A N     1 
ATOM   2145  C  CA    . LEU A 1  306 ? -60.851 -30.245 74.016  1.00 97.49  ? 689  LEU A CA    1 
ATOM   2146  C  C     . LEU A 1  306 ? -61.546 -29.202 74.874  1.00 98.76  ? 689  LEU A C     1 
ATOM   2147  O  O     . LEU A 1  306 ? -62.762 -29.049 74.775  1.00 103.90 ? 689  LEU A O     1 
ATOM   2148  C  CB    . LEU A 1  306 ? -60.585 -29.711 72.604  1.00 94.53  ? 689  LEU A CB    1 
ATOM   2149  C  CG    . LEU A 1  306 ? -59.972 -28.326 72.427  1.00 94.50  ? 689  LEU A CG    1 
ATOM   2150  C  CD1   . LEU A 1  306 ? -58.586 -28.250 73.041  1.00 95.17  ? 689  LEU A CD1   1 
ATOM   2151  C  CD2   . LEU A 1  306 ? -59.921 -28.015 70.951  1.00 89.84  ? 689  LEU A CD2   1 
ATOM   2152  N  N     . GLU A 1  307 ? -60.796 -28.498 75.713  1.00 99.81  ? 690  GLU A N     1 
ATOM   2153  C  CA    . GLU A 1  307 ? -61.398 -27.549 76.643  1.00 102.96 ? 690  GLU A CA    1 
ATOM   2154  C  C     . GLU A 1  307 ? -61.521 -26.178 75.984  1.00 108.63 ? 690  GLU A C     1 
ATOM   2155  O  O     . GLU A 1  307 ? -60.521 -25.614 75.533  1.00 117.32 ? 690  GLU A O     1 
ATOM   2156  C  CB    . GLU A 1  307 ? -60.579 -27.455 77.931  1.00 110.73 ? 690  GLU A CB    1 
ATOM   2157  C  CG    . GLU A 1  307 ? -61.173 -26.492 78.963  1.00 121.06 ? 690  GLU A CG    1 
ATOM   2158  C  CD    . GLU A 1  307 ? -60.757 -26.798 80.401  1.00 139.83 ? 690  GLU A CD    1 
ATOM   2159  O  OE1   . GLU A 1  307 ? -60.329 -27.942 80.683  1.00 144.46 ? 690  GLU A OE1   1 
ATOM   2160  O  OE2   . GLU A 1  307 ? -60.867 -25.884 81.252  1.00 140.35 ? 690  GLU A OE2   1 
ATOM   2161  N  N     . MET A 1  308 ? -62.742 -25.636 75.941  1.00 104.97 ? 691  MET A N     1 
ATOM   2162  C  CA    . MET A 1  308 ? -63.002 -24.319 75.371  1.00 102.59 ? 691  MET A CA    1 
ATOM   2163  C  C     . MET A 1  308 ? -63.840 -23.514 76.354  1.00 104.38 ? 691  MET A C     1 
ATOM   2164  O  O     . MET A 1  308 ? -64.860 -24.005 76.849  1.00 108.95 ? 691  MET A O     1 
ATOM   2165  C  CB    . MET A 1  308 ? -63.723 -24.435 74.030  1.00 101.00 ? 691  MET A CB    1 
ATOM   2166  C  CG    . MET A 1  308 ? -62.883 -24.096 72.811  1.00 104.66 ? 691  MET A CG    1 
ATOM   2167  S  SD    . MET A 1  308 ? -63.711 -24.654 71.303  1.00 110.97 ? 691  MET A SD    1 
ATOM   2168  C  CE    . MET A 1  308 ? -65.275 -23.772 71.416  1.00 94.13  ? 691  MET A CE    1 
ATOM   2169  N  N     . GLY A 1  309 ? -63.411 -22.287 76.640  1.00 106.25 ? 692  GLY A N     1 
ATOM   2170  C  CA    . GLY A 1  309 ? -64.055 -21.483 77.667  1.00 107.53 ? 692  GLY A CA    1 
ATOM   2171  C  C     . GLY A 1  309 ? -64.288 -22.188 78.987  1.00 113.63 ? 692  GLY A C     1 
ATOM   2172  O  O     . GLY A 1  309 ? -65.282 -21.899 79.659  1.00 117.08 ? 692  GLY A O     1 
ATOM   2173  N  N     . GLY A 1  310 ? -63.405 -23.107 79.385  1.00 118.96 ? 693  GLY A N     1 
ATOM   2174  C  CA    . GLY A 1  310 ? -63.563 -23.838 80.624  1.00 111.36 ? 693  GLY A CA    1 
ATOM   2175  C  C     . GLY A 1  310 ? -64.361 -25.120 80.514  1.00 111.16 ? 693  GLY A C     1 
ATOM   2176  O  O     . GLY A 1  310 ? -64.202 -26.005 81.360  1.00 113.00 ? 693  GLY A O     1 
ATOM   2177  N  N     . ILE A 1  311 ? -65.193 -25.253 79.494  1.00 109.31 ? 694  ILE A N     1 
ATOM   2178  C  CA    . ILE A 1  311 ? -66.050 -26.421 79.317  1.00 104.48 ? 694  ILE A CA    1 
ATOM   2179  C  C     . ILE A 1  311 ? -65.384 -27.375 78.332  1.00 102.44 ? 694  ILE A C     1 
ATOM   2180  O  O     . ILE A 1  311 ? -65.034 -26.950 77.223  1.00 112.64 ? 694  ILE A O     1 
ATOM   2181  C  CB    . ILE A 1  311 ? -67.446 -26.018 78.813  1.00 109.93 ? 694  ILE A CB    1 
ATOM   2182  C  CG1   . ILE A 1  311 ? -68.151 -25.131 79.846  1.00 116.84 ? 694  ILE A CG1   1 
ATOM   2183  C  CG2   . ILE A 1  311 ? -68.262 -27.263 78.477  1.00 110.40 ? 694  ILE A CG2   1 
ATOM   2184  C  CD1   . ILE A 1  311 ? -67.917 -23.647 79.654  1.00 111.58 ? 694  ILE A CD1   1 
ATOM   2185  N  N     . PRO A 1  312 ? -65.163 -28.637 78.693  1.00 95.28  ? 695  PRO A N     1 
ATOM   2186  C  CA    . PRO A 1  312 ? -64.766 -29.614 77.680  1.00 99.01  ? 695  PRO A CA    1 
ATOM   2187  C  C     . PRO A 1  312 ? -65.860 -29.736 76.641  1.00 99.50  ? 695  PRO A C     1 
ATOM   2188  O  O     . PRO A 1  312 ? -67.049 -29.719 76.963  1.00 100.75 ? 695  PRO A O     1 
ATOM   2189  C  CB    . PRO A 1  312 ? -64.594 -30.912 78.477  1.00 95.01  ? 695  PRO A CB    1 
ATOM   2190  C  CG    . PRO A 1  312 ? -64.321 -30.463 79.865  1.00 98.21  ? 695  PRO A CG    1 
ATOM   2191  C  CD    . PRO A 1  312 ? -65.146 -29.217 80.042  1.00 104.54 ? 695  PRO A CD    1 
ATOM   2192  N  N     . ARG A 1  313 ? -65.451 -29.814 75.381  1.00 99.60  ? 696  ARG A N     1 
ATOM   2193  C  CA    . ARG A 1  313 ? -66.365 -30.037 74.280  1.00 101.20 ? 696  ARG A CA    1 
ATOM   2194  C  C     . ARG A 1  313 ? -65.865 -31.243 73.498  1.00 102.88 ? 696  ARG A C     1 
ATOM   2195  O  O     . ARG A 1  313 ? -64.701 -31.658 73.621  1.00 102.95 ? 696  ARG A O     1 
ATOM   2196  C  CB    . ARG A 1  313 ? -66.470 -28.803 73.377  1.00 88.96  ? 696  ARG A CB    1 
ATOM   2197  C  CG    . ARG A 1  313 ? -66.195 -27.498 74.098  1.00 89.10  ? 696  ARG A CG    1 
ATOM   2198  C  CD    . ARG A 1  313 ? -67.428 -26.982 74.818  1.00 95.81  ? 696  ARG A CD    1 
ATOM   2199  N  NE    . ARG A 1  313 ? -67.201 -25.665 75.412  1.00 107.62 ? 696  ARG A NE    1 
ATOM   2200  C  CZ    . ARG A 1  313 ? -68.108 -24.690 75.453  1.00 109.90 ? 696  ARG A CZ    1 
ATOM   2201  N  NH1   . ARG A 1  313 ? -67.808 -23.524 76.016  1.00 115.26 ? 696  ARG A NH1   1 
ATOM   2202  N  NH2   . ARG A 1  313 ? -69.308 -24.870 74.917  1.00 106.65 ? 696  ARG A NH2   1 
ATOM   2203  N  N     . THR A 1  314 ? -66.765 -31.814 72.701  1.00 99.23  ? 697  THR A N     1 
ATOM   2204  C  CA    . THR A 1  314 ? -66.429 -32.921 71.824  1.00 94.77  ? 697  THR A CA    1 
ATOM   2205  C  C     . THR A 1  314 ? -66.761 -32.546 70.385  1.00 87.02  ? 697  THR A C     1 
ATOM   2206  O  O     . THR A 1  314 ? -67.762 -31.874 70.109  1.00 86.56  ? 697  THR A O     1 
ATOM   2207  C  CB    . THR A 1  314 ? -67.152 -34.210 72.248  1.00 104.37 ? 697  THR A CB    1 
ATOM   2208  O  OG1   . THR A 1  314 ? -68.574 -34.036 72.158  1.00 112.88 ? 697  THR A OG1   1 
ATOM   2209  C  CG2   . THR A 1  314 ? -66.777 -34.569 73.677  1.00 96.65  ? 697  THR A CG2   1 
ATOM   2210  N  N     . PHE A 1  315 ? -65.893 -32.979 69.480  1.00 88.34  ? 698  PHE A N     1 
ATOM   2211  C  CA    . PHE A 1  315 ? -65.944 -32.619 68.075  1.00 88.76  ? 698  PHE A CA    1 
ATOM   2212  C  C     . PHE A 1  315 ? -65.827 -33.886 67.246  1.00 83.63  ? 698  PHE A C     1 
ATOM   2213  O  O     . PHE A 1  315 ? -64.962 -34.729 67.514  1.00 81.86  ? 698  PHE A O     1 
ATOM   2214  C  CB    . PHE A 1  315 ? -64.817 -31.639 67.715  1.00 96.62  ? 698  PHE A CB    1 
ATOM   2215  C  CG    . PHE A 1  315 ? -64.887 -30.318 68.458  1.00 92.03  ? 698  PHE A CG    1 
ATOM   2216  C  CD1   . PHE A 1  315 ? -65.694 -29.289 67.991  1.00 90.04  ? 698  PHE A CD1   1 
ATOM   2217  C  CD2   . PHE A 1  315 ? -64.134 -30.107 69.608  1.00 81.60  ? 698  PHE A CD2   1 
ATOM   2218  C  CE1   . PHE A 1  315 ? -65.766 -28.092 68.659  1.00 82.74  ? 698  PHE A CE1   1 
ATOM   2219  C  CE2   . PHE A 1  315 ? -64.199 -28.910 70.277  1.00 82.90  ? 698  PHE A CE2   1 
ATOM   2220  C  CZ    . PHE A 1  315 ? -65.017 -27.900 69.801  1.00 83.50  ? 698  PHE A CZ    1 
ATOM   2221  N  N     . LYS A 1  316 ? -66.725 -34.027 66.274  1.00 89.75  ? 699  LYS A N     1 
ATOM   2222  C  CA    . LYS A 1  316 ? -66.694 -35.087 65.279  1.00 93.32  ? 699  LYS A CA    1 
ATOM   2223  C  C     . LYS A 1  316 ? -66.399 -34.456 63.925  1.00 94.67  ? 699  LYS A C     1 
ATOM   2224  O  O     . LYS A 1  316 ? -66.965 -33.410 63.588  1.00 99.64  ? 699  LYS A O     1 
ATOM   2225  C  CB    . LYS A 1  316 ? -68.033 -35.842 65.231  1.00 102.12 ? 699  LYS A CB    1 
ATOM   2226  C  CG    . LYS A 1  316 ? -68.202 -36.964 66.251  1.00 104.96 ? 699  LYS A CG    1 
ATOM   2227  C  CD    . LYS A 1  316 ? -69.362 -37.873 65.858  1.00 122.86 ? 699  LYS A CD    1 
ATOM   2228  C  CE    . LYS A 1  316 ? -69.154 -39.293 66.385  1.00 139.54 ? 699  LYS A CE    1 
ATOM   2229  N  NZ    . LYS A 1  316 ? -70.166 -40.267 65.884  1.00 141.02 ? 699  LYS A NZ    1 
ATOM   2230  N  N     . PHE A 1  317 ? -65.515 -35.078 63.149  1.00 88.02  ? 700  PHE A N     1 
ATOM   2231  C  CA    . PHE A 1  317 ? -65.023 -34.466 61.922  1.00 85.01  ? 700  PHE A CA    1 
ATOM   2232  C  C     . PHE A 1  317 ? -65.531 -35.192 60.682  1.00 84.44  ? 700  PHE A C     1 
ATOM   2233  O  O     . PHE A 1  317 ? -65.789 -36.396 60.705  1.00 85.51  ? 700  PHE A O     1 
ATOM   2234  C  CB    . PHE A 1  317 ? -63.499 -34.438 61.905  1.00 94.31  ? 700  PHE A CB    1 
ATOM   2235  C  CG    . PHE A 1  317 ? -62.904 -33.525 62.927  1.00 86.20  ? 700  PHE A CG    1 
ATOM   2236  C  CD1   . PHE A 1  317 ? -62.857 -32.154 62.708  1.00 89.50  ? 700  PHE A CD1   1 
ATOM   2237  C  CD2   . PHE A 1  317 ? -62.384 -34.042 64.105  1.00 84.39  ? 700  PHE A CD2   1 
ATOM   2238  C  CE1   . PHE A 1  317 ? -62.306 -31.309 63.643  1.00 79.94  ? 700  PHE A CE1   1 
ATOM   2239  C  CE2   . PHE A 1  317 ? -61.829 -33.206 65.048  1.00 83.43  ? 700  PHE A CE2   1 
ATOM   2240  C  CZ    . PHE A 1  317 ? -61.789 -31.835 64.816  1.00 89.59  ? 700  PHE A CZ    1 
ATOM   2241  N  N     . ILE A 1  318 ? -65.653 -34.441 59.592  1.00 85.71  ? 701  ILE A N     1 
ATOM   2242  C  CA    . ILE A 1  318 ? -66.086 -34.943 58.291  1.00 83.32  ? 701  ILE A CA    1 
ATOM   2243  C  C     . ILE A 1  318 ? -65.112 -34.332 57.293  1.00 83.69  ? 701  ILE A C     1 
ATOM   2244  O  O     . ILE A 1  318 ? -65.208 -33.139 56.981  1.00 92.29  ? 701  ILE A O     1 
ATOM   2245  C  CB    . ILE A 1  318 ? -67.531 -34.542 57.955  1.00 81.26  ? 701  ILE A CB    1 
ATOM   2246  C  CG1   . ILE A 1  318 ? -68.537 -35.072 58.959  1.00 81.44  ? 701  ILE A CG1   1 
ATOM   2247  C  CG2   . ILE A 1  318 ? -67.955 -35.089 56.624  1.00 81.46  ? 701  ILE A CG2   1 
ATOM   2248  C  CD1   . ILE A 1  318 ? -69.953 -34.623 58.580  1.00 78.46  ? 701  ILE A CD1   1 
ATOM   2249  N  N     . PHE A 1  319 ? -64.165 -35.121 56.799  1.00 78.57  ? 702  PHE A N     1 
ATOM   2250  C  CA    . PHE A 1  319 ? -63.193 -34.606 55.842  1.00 77.85  ? 702  PHE A CA    1 
ATOM   2251  C  C     . PHE A 1  319 ? -63.713 -34.780 54.426  1.00 80.07  ? 702  PHE A C     1 
ATOM   2252  O  O     . PHE A 1  319 ? -64.131 -35.872 54.047  1.00 95.00  ? 702  PHE A O     1 
ATOM   2253  C  CB    . PHE A 1  319 ? -61.857 -35.322 55.981  1.00 83.17  ? 702  PHE A CB    1 
ATOM   2254  C  CG    . PHE A 1  319 ? -61.282 -35.249 57.340  1.00 80.96  ? 702  PHE A CG    1 
ATOM   2255  C  CD1   . PHE A 1  319 ? -60.520 -34.171 57.725  1.00 84.53  ? 702  PHE A CD1   1 
ATOM   2256  C  CD2   . PHE A 1  319 ? -61.506 -36.264 58.232  1.00 87.50  ? 702  PHE A CD2   1 
ATOM   2257  C  CE1   . PHE A 1  319 ? -59.985 -34.116 58.985  1.00 89.13  ? 702  PHE A CE1   1 
ATOM   2258  C  CE2   . PHE A 1  319 ? -60.982 -36.221 59.489  1.00 91.36  ? 702  PHE A CE2   1 
ATOM   2259  C  CZ    . PHE A 1  319 ? -60.218 -35.152 59.876  1.00 86.52  ? 702  PHE A CZ    1 
ATOM   2260  N  N     . ARG A 1  320 ? -63.670 -33.716 53.639  1.00 74.60  ? 703  ARG A N     1 
ATOM   2261  C  CA    . ARG A 1  320 ? -64.173 -33.772 52.273  1.00 83.28  ? 703  ARG A CA    1 
ATOM   2262  C  C     . ARG A 1  320 ? -63.141 -33.173 51.326  1.00 83.93  ? 703  ARG A C     1 
ATOM   2263  O  O     . ARG A 1  320 ? -63.031 -31.951 51.207  1.00 80.33  ? 703  ARG A O     1 
ATOM   2264  C  CB    . ARG A 1  320 ? -65.511 -33.054 52.156  1.00 85.18  ? 703  ARG A CB    1 
ATOM   2265  C  CG    . ARG A 1  320 ? -66.690 -33.784 52.761  1.00 79.69  ? 703  ARG A CG    1 
ATOM   2266  C  CD    . ARG A 1  320 ? -67.888 -32.843 52.761  1.00 96.79  ? 703  ARG A CD    1 
ATOM   2267  N  NE    . ARG A 1  320 ? -68.899 -33.265 51.800  1.00 106.01 ? 703  ARG A NE    1 
ATOM   2268  C  CZ    . ARG A 1  320 ? -69.110 -32.686 50.623  1.00 109.51 ? 703  ARG A CZ    1 
ATOM   2269  N  NH1   . ARG A 1  320 ? -68.386 -31.639 50.255  1.00 109.53 ? 703  ARG A NH1   1 
ATOM   2270  N  NH2   . ARG A 1  320 ? -70.051 -33.155 49.814  1.00 115.21 ? 703  ARG A NH2   1 
ATOM   2271  N  N     . GLY A 1  321 ? -62.408 -34.034 50.633  1.00 90.37  ? 704  GLY A N     1 
ATOM   2272  C  CA    . GLY A 1  321 ? -61.373 -33.592 49.718  1.00 91.66  ? 704  GLY A CA    1 
ATOM   2273  C  C     . GLY A 1  321 ? -61.871 -33.017 48.413  1.00 87.64  ? 704  GLY A C     1 
ATOM   2274  O  O     . GLY A 1  321 ? -61.835 -33.674 47.369  1.00 96.62  ? 704  GLY A O     1 
ATOM   2275  N  N     . THR A 1  322 ? -62.314 -31.770 48.464  1.00 84.73  ? 705  THR A N     1 
ATOM   2276  C  CA    . THR A 1  322 ? -62.817 -31.058 47.306  1.00 87.94  ? 705  THR A CA    1 
ATOM   2277  C  C     . THR A 1  322 ? -61.816 -30.069 46.714  1.00 88.81  ? 705  THR A C     1 
ATOM   2278  O  O     . THR A 1  322 ? -61.980 -29.677 45.555  1.00 95.42  ? 705  THR A O     1 
ATOM   2279  C  CB    . THR A 1  322 ? -64.105 -30.323 47.696  1.00 105.81 ? 705  THR A CB    1 
ATOM   2280  O  OG1   . THR A 1  322 ? -63.849 -29.547 48.874  1.00 112.81 ? 705  THR A OG1   1 
ATOM   2281  C  CG2   . THR A 1  322 ? -65.228 -31.314 48.017  1.00 98.41  ? 705  THR A CG2   1 
ATOM   2282  N  N     . GLY A 1  323 ? -60.781 -29.670 47.458  1.00 83.15  ? 706  GLY A N     1 
ATOM   2283  C  CA    . GLY A 1  323 ? -59.779 -28.765 46.934  1.00 80.99  ? 706  GLY A CA    1 
ATOM   2284  C  C     . GLY A 1  323 ? -58.721 -29.452 46.100  1.00 82.01  ? 706  GLY A C     1 
ATOM   2285  O  O     . GLY A 1  323 ? -57.536 -29.417 46.428  1.00 86.50  ? 706  GLY A O     1 
ATOM   2286  N  N     . TYR A 1  324 ? -59.134 -30.082 45.012  1.00 71.21  ? 707  TYR A N     1 
ATOM   2287  C  CA    . TYR A 1  324 ? -58.205 -30.694 44.078  1.00 73.78  ? 707  TYR A CA    1 
ATOM   2288  C  C     . TYR A 1  324 ? -58.691 -30.369 42.682  1.00 79.21  ? 707  TYR A C     1 
ATOM   2289  O  O     . TYR A 1  324 ? -59.841 -30.675 42.341  1.00 77.85  ? 707  TYR A O     1 
ATOM   2290  C  CB    . TYR A 1  324 ? -58.131 -32.203 44.270  1.00 90.56  ? 707  TYR A CB    1 
ATOM   2291  C  CG    . TYR A 1  324 ? -57.629 -32.724 45.600  1.00 78.87  ? 707  TYR A CG    1 
ATOM   2292  C  CD1   . TYR A 1  324 ? -58.461 -32.777 46.713  1.00 75.46  ? 707  TYR A CD1   1 
ATOM   2293  C  CD2   . TYR A 1  324 ? -56.350 -33.247 45.712  1.00 71.00  ? 707  TYR A CD2   1 
ATOM   2294  C  CE1   . TYR A 1  324 ? -58.015 -33.295 47.903  1.00 68.84  ? 707  TYR A CE1   1 
ATOM   2295  C  CE2   . TYR A 1  324 ? -55.902 -33.763 46.893  1.00 73.61  ? 707  TYR A CE2   1 
ATOM   2296  C  CZ    . TYR A 1  324 ? -56.734 -33.787 47.986  1.00 69.93  ? 707  TYR A CZ    1 
ATOM   2297  O  OH    . TYR A 1  324 ? -56.268 -34.313 49.162  1.00 62.98  ? 707  TYR A OH    1 
ATOM   2298  N  N     . ASP A 1  325 ? -57.837 -29.721 41.891  1.00 80.80  ? 708  ASP A N     1 
ATOM   2299  C  CA    . ASP A 1  325 ? -58.191 -29.506 40.500  1.00 89.40  ? 708  ASP A CA    1 
ATOM   2300  C  C     . ASP A 1  325 ? -58.081 -30.828 39.756  1.00 87.85  ? 708  ASP A C     1 
ATOM   2301  O  O     . ASP A 1  325 ? -57.545 -31.807 40.274  1.00 87.12  ? 708  ASP A O     1 
ATOM   2302  C  CB    . ASP A 1  325 ? -57.333 -28.406 39.855  1.00 99.93  ? 708  ASP A CB    1 
ATOM   2303  C  CG    . ASP A 1  325 ? -55.836 -28.739 39.774  1.00 103.66 ? 708  ASP A CG    1 
ATOM   2304  O  OD1   . ASP A 1  325 ? -55.449 -29.884 39.459  1.00 105.81 ? 708  ASP A OD1   1 
ATOM   2305  O  OD2   . ASP A 1  325 ? -55.030 -27.799 39.964  1.00 105.70 ? 708  ASP A OD2   1 
ATOM   2306  N  N     . GLU A 1  326 ? -58.631 -30.869 38.542  1.00 85.40  ? 709  GLU A N     1 
ATOM   2307  C  CA    . GLU A 1  326 ? -58.759 -32.151 37.862  1.00 79.88  ? 709  GLU A CA    1 
ATOM   2308  C  C     . GLU A 1  326 ? -57.425 -32.882 37.779  1.00 81.98  ? 709  GLU A C     1 
ATOM   2309  O  O     . GLU A 1  326 ? -57.358 -34.090 38.021  1.00 86.97  ? 709  GLU A O     1 
ATOM   2310  C  CB    . GLU A 1  326 ? -59.357 -31.975 36.471  1.00 82.96  ? 709  GLU A CB    1 
ATOM   2311  C  CG    . GLU A 1  326 ? -59.457 -33.333 35.790  1.00 102.01 ? 709  GLU A CG    1 
ATOM   2312  C  CD    . GLU A 1  326 ? -60.358 -33.375 34.568  1.00 122.47 ? 709  GLU A CD    1 
ATOM   2313  O  OE1   . GLU A 1  326 ? -59.851 -33.567 33.427  1.00 121.23 ? 709  GLU A OE1   1 
ATOM   2314  O  OE2   . GLU A 1  326 ? -61.587 -33.229 34.777  1.00 126.41 ? 709  GLU A OE2   1 
ATOM   2315  N  N     . LYS A 1  327 ? -56.347 -32.173 37.427  1.00 88.29  ? 710  LYS A N     1 
ATOM   2316  C  CA    . LYS A 1  327 ? -55.056 -32.845 37.262  1.00 93.06  ? 710  LYS A CA    1 
ATOM   2317  C  C     . LYS A 1  327 ? -54.646 -33.596 38.524  1.00 86.35  ? 710  LYS A C     1 
ATOM   2318  O  O     . LYS A 1  327 ? -54.240 -34.762 38.469  1.00 93.46  ? 710  LYS A O     1 
ATOM   2319  C  CB    . LYS A 1  327 ? -53.974 -31.840 36.877  1.00 95.93  ? 710  LYS A CB    1 
ATOM   2320  C  CG    . LYS A 1  327 ? -52.600 -32.474 36.759  1.00 106.25 ? 710  LYS A CG    1 
ATOM   2321  C  CD    . LYS A 1  327 ? -51.531 -31.420 36.568  1.00 122.20 ? 710  LYS A CD    1 
ATOM   2322  C  CE    . LYS A 1  327 ? -50.166 -31.963 36.973  1.00 130.33 ? 710  LYS A CE    1 
ATOM   2323  N  NZ    . LYS A 1  327 ? -49.111 -30.910 36.886  1.00 133.90 ? 710  LYS A NZ    1 
ATOM   2324  N  N     . LEU A 1  328 ? -54.810 -32.965 39.678  1.00 78.64  ? 711  LEU A N     1 
ATOM   2325  C  CA    . LEU A 1  328 ? -54.393 -33.595 40.917  1.00 79.54  ? 711  LEU A CA    1 
ATOM   2326  C  C     . LEU A 1  328 ? -55.378 -34.685 41.332  1.00 86.84  ? 711  LEU A C     1 
ATOM   2327  O  O     . LEU A 1  328 ? -54.973 -35.709 41.895  1.00 92.54  ? 711  LEU A O     1 
ATOM   2328  C  CB    . LEU A 1  328 ? -54.264 -32.542 42.004  1.00 78.10  ? 711  LEU A CB    1 
ATOM   2329  C  CG    . LEU A 1  328 ? -53.234 -32.898 43.062  1.00 77.22  ? 711  LEU A CG    1 
ATOM   2330  C  CD1   . LEU A 1  328 ? -51.971 -33.437 42.396  1.00 80.27  ? 711  LEU A CD1   1 
ATOM   2331  C  CD2   . LEU A 1  328 ? -52.901 -31.693 43.910  1.00 81.32  ? 711  LEU A CD2   1 
ATOM   2332  N  N     . VAL A 1  329 ? -56.677 -34.478 41.079  1.00 86.34  ? 712  VAL A N     1 
ATOM   2333  C  CA    . VAL A 1  329 ? -57.664 -35.548 41.259  1.00 80.91  ? 712  VAL A CA    1 
ATOM   2334  C  C     . VAL A 1  329 ? -57.209 -36.800 40.532  1.00 86.24  ? 712  VAL A C     1 
ATOM   2335  O  O     . VAL A 1  329 ? -57.088 -37.882 41.119  1.00 88.66  ? 712  VAL A O     1 
ATOM   2336  C  CB    . VAL A 1  329 ? -59.056 -35.117 40.762  1.00 80.83  ? 712  VAL A CB    1 
ATOM   2337  C  CG1   . VAL A 1  329 ? -59.950 -36.352 40.557  1.00 76.18  ? 712  VAL A CG1   1 
ATOM   2338  C  CG2   . VAL A 1  329 ? -59.702 -34.167 41.735  1.00 85.14  ? 712  VAL A CG2   1 
ATOM   2339  N  N     . ARG A 1  330 ? -57.011 -36.666 39.219  1.00 80.96  ? 713  ARG A N     1 
ATOM   2340  C  CA    . ARG A 1  330 ? -56.602 -37.792 38.393  1.00 79.44  ? 713  ARG A CA    1 
ATOM   2341  C  C     . ARG A 1  330 ? -55.311 -38.408 38.904  1.00 83.75  ? 713  ARG A C     1 
ATOM   2342  O  O     . ARG A 1  330 ? -55.154 -39.632 38.873  1.00 87.87  ? 713  ARG A O     1 
ATOM   2343  C  CB    . ARG A 1  330 ? -56.436 -37.350 36.945  1.00 83.93  ? 713  ARG A CB    1 
ATOM   2344  C  CG    . ARG A 1  330 ? -57.662 -36.704 36.339  1.00 86.44  ? 713  ARG A CG    1 
ATOM   2345  C  CD    . ARG A 1  330 ? -57.478 -36.535 34.845  1.00 93.04  ? 713  ARG A CD    1 
ATOM   2346  N  NE    . ARG A 1  330 ? -58.120 -37.604 34.098  1.00 92.41  ? 713  ARG A NE    1 
ATOM   2347  C  CZ    . ARG A 1  330 ? -59.293 -37.468 33.495  1.00 92.60  ? 713  ARG A CZ    1 
ATOM   2348  N  NH1   . ARG A 1  330 ? -59.931 -36.307 33.543  1.00 92.65  ? 713  ARG A NH1   1 
ATOM   2349  N  NH2   . ARG A 1  330 ? -59.814 -38.484 32.831  1.00 91.50  ? 713  ARG A NH2   1 
ATOM   2350  N  N     . GLU A 1  331 ? -54.358 -37.581 39.346  1.00 82.05  ? 714  GLU A N     1 
ATOM   2351  C  CA    . GLU A 1  331 ? -53.092 -38.150 39.794  1.00 81.88  ? 714  GLU A CA    1 
ATOM   2352  C  C     . GLU A 1  331 ? -53.260 -38.984 41.058  1.00 85.08  ? 714  GLU A C     1 
ATOM   2353  O  O     . GLU A 1  331 ? -52.758 -40.114 41.136  1.00 88.96  ? 714  GLU A O     1 
ATOM   2354  C  CB    . GLU A 1  331 ? -52.040 -37.074 40.042  1.00 85.40  ? 714  GLU A CB    1 
ATOM   2355  C  CG    . GLU A 1  331 ? -50.729 -37.726 40.512  1.00 99.44  ? 714  GLU A CG    1 
ATOM   2356  C  CD    . GLU A 1  331 ? -49.477 -37.014 40.037  1.00 108.56 ? 714  GLU A CD    1 
ATOM   2357  O  OE1   . GLU A 1  331 ? -49.601 -35.893 39.487  1.00 120.24 ? 714  GLU A OE1   1 
ATOM   2358  O  OE2   . GLU A 1  331 ? -48.376 -37.614 40.148  1.00 117.81 ? 714  GLU A OE2   1 
ATOM   2359  N  N     . VAL A 1  332 ? -53.961 -38.458 42.061  1.00 80.98  ? 715  VAL A N     1 
ATOM   2360  C  CA    . VAL A 1  332 ? -54.019 -39.170 43.335  1.00 84.16  ? 715  VAL A CA    1 
ATOM   2361  C  C     . VAL A 1  332 ? -55.070 -40.282 43.378  1.00 92.23  ? 715  VAL A C     1 
ATOM   2362  O  O     . VAL A 1  332 ? -55.002 -41.144 44.273  1.00 86.88  ? 715  VAL A O     1 
ATOM   2363  C  CB    . VAL A 1  332 ? -54.278 -38.178 44.472  1.00 69.06  ? 715  VAL A CB    1 
ATOM   2364  C  CG1   . VAL A 1  332 ? -53.155 -37.186 44.524  1.00 71.56  ? 715  VAL A CG1   1 
ATOM   2365  C  CG2   . VAL A 1  332 ? -55.604 -37.505 44.255  1.00 77.02  ? 715  VAL A CG2   1 
ATOM   2366  N  N     . GLU A 1  333 ? -56.037 -40.293 42.444  1.00 89.22  ? 716  GLU A N     1 
ATOM   2367  C  CA    . GLU A 1  333 ? -57.101 -41.297 42.377  1.00 86.26  ? 716  GLU A CA    1 
ATOM   2368  C  C     . GLU A 1  333 ? -56.841 -42.381 41.322  1.00 78.50  ? 716  GLU A C     1 
ATOM   2369  O  O     . GLU A 1  333 ? -57.747 -43.167 41.017  1.00 84.38  ? 716  GLU A O     1 
ATOM   2370  C  CB    . GLU A 1  333 ? -58.473 -40.652 42.094  1.00 80.32  ? 716  GLU A CB    1 
ATOM   2371  C  CG    . GLU A 1  333 ? -59.165 -39.839 43.205  1.00 85.68  ? 716  GLU A CG    1 
ATOM   2372  C  CD    . GLU A 1  333 ? -60.252 -40.611 43.997  1.00 99.10  ? 716  GLU A CD    1 
ATOM   2373  O  OE1   . GLU A 1  333 ? -61.424 -40.145 44.178  1.00 95.14  ? 716  GLU A OE1   1 
ATOM   2374  O  OE2   . GLU A 1  333 ? -59.882 -41.703 44.449  1.00 98.30  ? 716  GLU A OE2   1 
ATOM   2375  N  N     . GLY A 1  334 ? -55.620 -42.466 40.799  1.00 76.63  ? 717  GLY A N     1 
ATOM   2376  C  CA    . GLY A 1  334 ? -55.197 -43.491 39.856  1.00 83.07  ? 717  GLY A CA    1 
ATOM   2377  C  C     . GLY A 1  334 ? -55.645 -43.342 38.415  1.00 81.99  ? 717  GLY A C     1 
ATOM   2378  O  O     . GLY A 1  334 ? -55.284 -44.181 37.581  1.00 76.19  ? 717  GLY A O     1 
ATOM   2379  N  N     . LEU A 1  335 ? -56.334 -42.262 38.060  1.00 79.85  ? 718  LEU A N     1 
ATOM   2380  C  CA    . LEU A 1  335 ? -56.859 -42.181 36.703  1.00 85.66  ? 718  LEU A CA    1 
ATOM   2381  C  C     . LEU A 1  335 ? -55.780 -41.763 35.691  1.00 95.87  ? 718  LEU A C     1 
ATOM   2382  O  O     . LEU A 1  335 ? -54.646 -41.417 36.038  1.00 90.46  ? 718  LEU A O     1 
ATOM   2383  C  CB    . LEU A 1  335 ? -58.054 -41.233 36.642  1.00 80.21  ? 718  LEU A CB    1 
ATOM   2384  C  CG    . LEU A 1  335 ? -59.175 -41.589 37.610  1.00 84.69  ? 718  LEU A CG    1 
ATOM   2385  C  CD1   . LEU A 1  335 ? -59.061 -40.721 38.802  1.00 88.71  ? 718  LEU A CD1   1 
ATOM   2386  C  CD2   . LEU A 1  335 ? -60.539 -41.421 36.963  1.00 94.05  ? 718  LEU A CD2   1 
ATOM   2387  N  N     . GLU A 1  336 ? -56.134 -41.859 34.408  1.00 91.54  ? 719  GLU A N     1 
ATOM   2388  C  CA    . GLU A 1  336 ? -55.245 -41.445 33.328  1.00 96.09  ? 719  GLU A CA    1 
ATOM   2389  C  C     . GLU A 1  336 ? -55.153 -39.922 33.249  1.00 107.14 ? 719  GLU A C     1 
ATOM   2390  O  O     . GLU A 1  336 ? -55.889 -39.180 33.916  1.00 107.05 ? 719  GLU A O     1 
ATOM   2391  C  CB    . GLU A 1  336 ? -55.697 -42.008 31.985  1.00 100.33 ? 719  GLU A CB    1 
ATOM   2392  C  CG    . GLU A 1  336 ? -55.630 -43.558 31.890  1.00 112.20 ? 719  GLU A CG    1 
ATOM   2393  C  CD    . GLU A 1  336 ? -56.065 -44.083 30.524  1.00 114.51 ? 719  GLU A CD    1 
ATOM   2394  O  OE1   . GLU A 1  336 ? -55.869 -45.292 30.220  1.00 115.28 ? 719  GLU A OE1   1 
ATOM   2395  O  OE2   . GLU A 1  336 ? -56.684 -43.284 29.789  1.00 117.36 ? 719  GLU A OE2   1 
ATOM   2396  N  N     . ALA A 1  337 ? -54.202 -39.465 32.429  1.00 110.17 ? 720  ALA A N     1 
ATOM   2397  C  CA    . ALA A 1  337 ? -53.970 -38.049 32.180  1.00 111.94 ? 720  ALA A CA    1 
ATOM   2398  C  C     . ALA A 1  337 ? -55.128 -37.445 31.371  1.00 123.04 ? 720  ALA A C     1 
ATOM   2399  O  O     . ALA A 1  337 ? -55.873 -38.143 30.670  1.00 123.30 ? 720  ALA A O     1 
ATOM   2400  C  CB    . ALA A 1  337 ? -52.626 -37.864 31.474  1.00 112.31 ? 720  ALA A CB    1 
ATOM   2401  N  N     . SER A 1  338 ? -55.234 -36.114 31.437  1.00 118.00 ? 721  SER A N     1 
ATOM   2402  C  CA    . SER A 1  338 ? -56.468 -35.431 31.047  1.00 119.57 ? 721  SER A CA    1 
ATOM   2403  C  C     . SER A 1  338 ? -56.824 -35.646 29.585  1.00 128.15 ? 721  SER A C     1 
ATOM   2404  O  O     . SER A 1  338 ? -58.000 -35.530 29.214  1.00 136.75 ? 721  SER A O     1 
ATOM   2405  C  CB    . SER A 1  338 ? -56.365 -33.943 31.348  1.00 119.63 ? 721  SER A CB    1 
ATOM   2406  O  OG    . SER A 1  338 ? -56.227 -33.746 32.746  1.00 125.35 ? 721  SER A OG    1 
ATOM   2407  N  N     . GLY A 1  339 ? -55.830 -35.929 28.739  1.00 123.78 ? 722  GLY A N     1 
ATOM   2408  C  CA    . GLY A 1  339 ? -56.061 -36.190 27.325  1.00 129.66 ? 722  GLY A CA    1 
ATOM   2409  C  C     . GLY A 1  339 ? -56.734 -37.518 27.017  1.00 130.19 ? 722  GLY A C     1 
ATOM   2410  O  O     . GLY A 1  339 ? -56.920 -37.849 25.840  1.00 131.07 ? 722  GLY A O     1 
ATOM   2411  N  N     . SER A 1  340 ? -57.098 -38.286 28.044  1.00 124.65 ? 723  SER A N     1 
ATOM   2412  C  CA    . SER A 1  340 ? -57.638 -39.626 27.857  1.00 119.02 ? 723  SER A CA    1 
ATOM   2413  C  C     . SER A 1  340 ? -59.011 -39.582 27.191  1.00 114.57 ? 723  SER A C     1 
ATOM   2414  O  O     . SER A 1  340 ? -59.667 -38.540 27.119  1.00 114.35 ? 723  SER A O     1 
ATOM   2415  C  CB    . SER A 1  340 ? -57.749 -40.346 29.196  1.00 115.06 ? 723  SER A CB    1 
ATOM   2416  O  OG    . SER A 1  340 ? -58.211 -41.667 28.992  1.00 115.69 ? 723  SER A OG    1 
ATOM   2417  N  N     . VAL A 1  341 ? -59.467 -40.749 26.726  1.00 107.83 ? 724  VAL A N     1 
ATOM   2418  C  CA    . VAL A 1  341 ? -60.855 -40.863 26.273  1.00 105.42 ? 724  VAL A CA    1 
ATOM   2419  C  C     . VAL A 1  341 ? -61.827 -40.809 27.444  1.00 109.76 ? 724  VAL A C     1 
ATOM   2420  O  O     . VAL A 1  341 ? -62.957 -40.329 27.296  1.00 110.53 ? 724  VAL A O     1 
ATOM   2421  C  CB    . VAL A 1  341 ? -61.062 -42.144 25.448  1.00 103.40 ? 724  VAL A CB    1 
ATOM   2422  C  CG1   . VAL A 1  341 ? -60.365 -42.024 24.120  1.00 112.34 ? 724  VAL A CG1   1 
ATOM   2423  C  CG2   . VAL A 1  341 ? -60.546 -43.347 26.211  1.00 104.15 ? 724  VAL A CG2   1 
ATOM   2424  N  N     . TYR A 1  342 ? -61.423 -41.312 28.607  1.00 104.64 ? 725  TYR A N     1 
ATOM   2425  C  CA    . TYR A 1  342 ? -62.231 -41.274 29.825  1.00 96.26  ? 725  TYR A CA    1 
ATOM   2426  C  C     . TYR A 1  342 ? -62.145 -39.878 30.440  1.00 101.51 ? 725  TYR A C     1 
ATOM   2427  O  O     . TYR A 1  342 ? -61.278 -39.591 31.274  1.00 108.13 ? 725  TYR A O     1 
ATOM   2428  C  CB    . TYR A 1  342 ? -61.748 -42.340 30.793  1.00 96.70  ? 725  TYR A CB    1 
ATOM   2429  C  CG    . TYR A 1  342 ? -61.825 -43.732 30.221  1.00 95.59  ? 725  TYR A CG    1 
ATOM   2430  C  CD1   . TYR A 1  342 ? -63.049 -44.317 29.939  1.00 99.37  ? 725  TYR A CD1   1 
ATOM   2431  C  CD2   . TYR A 1  342 ? -60.676 -44.467 29.973  1.00 99.94  ? 725  TYR A CD2   1 
ATOM   2432  C  CE1   . TYR A 1  342 ? -63.128 -45.590 29.431  1.00 90.84  ? 725  TYR A CE1   1 
ATOM   2433  C  CE2   . TYR A 1  342 ? -60.745 -45.741 29.465  1.00 92.77  ? 725  TYR A CE2   1 
ATOM   2434  C  CZ    . TYR A 1  342 ? -61.978 -46.292 29.197  1.00 91.39  ? 725  TYR A CZ    1 
ATOM   2435  O  OH    . TYR A 1  342 ? -62.077 -47.559 28.686  1.00 108.07 ? 725  TYR A OH    1 
ATOM   2436  N  N     . ILE A 1  343 ? -63.055 -38.995 30.025  1.00 90.69  ? 726  ILE A N     1 
ATOM   2437  C  CA    . ILE A 1  343 ? -62.912 -37.583 30.344  1.00 93.06  ? 726  ILE A CA    1 
ATOM   2438  C  C     . ILE A 1  343 ? -63.450 -37.244 31.729  1.00 97.15  ? 726  ILE A C     1 
ATOM   2439  O  O     . ILE A 1  343 ? -63.033 -36.237 32.318  1.00 107.93 ? 726  ILE A O     1 
ATOM   2440  C  CB    . ILE A 1  343 ? -63.603 -36.713 29.291  1.00 93.75  ? 726  ILE A CB    1 
ATOM   2441  C  CG1   . ILE A 1  343 ? -65.121 -36.866 29.365  1.00 91.25  ? 726  ILE A CG1   1 
ATOM   2442  C  CG2   . ILE A 1  343 ? -63.102 -37.085 27.918  1.00 102.74 ? 726  ILE A CG2   1 
ATOM   2443  C  CD1   . ILE A 1  343 ? -65.889 -36.043 28.350  1.00 93.92  ? 726  ILE A CD1   1 
ATOM   2444  N  N     . CYS A 1  344 ? -64.389 -38.017 32.281  1.00 101.87 ? 727  CYS A N     1 
ATOM   2445  C  CA    . CYS A 1  344 ? -65.034 -37.610 33.525  1.00 98.54  ? 727  CYS A CA    1 
ATOM   2446  C  C     . CYS A 1  344 ? -64.399 -38.350 34.696  1.00 92.66  ? 727  CYS A C     1 
ATOM   2447  O  O     . CYS A 1  344 ? -64.097 -39.553 34.609  1.00 94.11  ? 727  CYS A O     1 
ATOM   2448  C  CB    . CYS A 1  344 ? -66.543 -37.845 33.493  1.00 89.06  ? 727  CYS A CB    1 
ATOM   2449  S  SG    . CYS A 1  344 ? -67.491 -37.109 34.823  1.00 86.68  ? 727  CYS A SG    1 
ATOM   2450  N  N     . THR A 1  345 ? -64.203 -37.627 35.788  1.00 98.56  ? 728  THR A N     1 
ATOM   2451  C  CA    . THR A 1  345 ? -63.700 -38.223 37.009  1.00 89.32  ? 728  THR A CA    1 
ATOM   2452  C  C     . THR A 1  345 ? -64.840 -38.611 37.942  1.00 88.20  ? 728  THR A C     1 
ATOM   2453  O  O     . THR A 1  345 ? -64.580 -39.044 39.066  1.00 89.11  ? 728  THR A O     1 
ATOM   2454  C  CB    . THR A 1  345 ? -62.722 -37.267 37.700  1.00 90.79  ? 728  THR A CB    1 
ATOM   2455  O  OG1   . THR A 1  345 ? -63.433 -36.132 38.236  1.00 101.01 ? 728  THR A OG1   1 
ATOM   2456  C  CG2   . THR A 1  345 ? -61.706 -36.741 36.716  1.00 98.65  ? 728  THR A CG2   1 
ATOM   2457  N  N     . LEU A 1  346 ? -66.096 -38.460 37.491  1.00 83.52  ? 729  LEU A N     1 
ATOM   2458  C  CA    . LEU A 1  346 ? -67.275 -38.910 38.225  1.00 86.22  ? 729  LEU A CA    1 
ATOM   2459  C  C     . LEU A 1  346 ? -67.933 -40.158 37.651  1.00 85.14  ? 729  LEU A C     1 
ATOM   2460  O  O     . LEU A 1  346 ? -68.675 -40.823 38.374  1.00 88.33  ? 729  LEU A O     1 
ATOM   2461  C  CB    . LEU A 1  346 ? -68.331 -37.794 38.290  1.00 87.15  ? 729  LEU A CB    1 
ATOM   2462  C  CG    . LEU A 1  346 ? -68.281 -36.685 39.324  1.00 84.32  ? 729  LEU A CG    1 
ATOM   2463  C  CD1   . LEU A 1  346 ? -66.897 -36.157 39.393  1.00 93.89  ? 729  LEU A CD1   1 
ATOM   2464  C  CD2   . LEU A 1  346 ? -69.195 -35.606 38.890  1.00 87.48  ? 729  LEU A CD2   1 
ATOM   2465  N  N     . CYS A 1  347 ? -67.680 -40.487 36.392  1.00 79.82  ? 730  CYS A N     1 
ATOM   2466  C  CA    . CYS A 1  347 ? -68.311 -41.609 35.723  1.00 87.02  ? 730  CYS A CA    1 
ATOM   2467  C  C     . CYS A 1  347 ? -67.331 -42.193 34.731  1.00 91.25  ? 730  CYS A C     1 
ATOM   2468  O  O     . CYS A 1  347 ? -66.232 -41.670 34.520  1.00 98.17  ? 730  CYS A O     1 
ATOM   2469  C  CB    . CYS A 1  347 ? -69.594 -41.215 34.993  1.00 85.36  ? 730  CYS A CB    1 
ATOM   2470  S  SG    . CYS A 1  347 ? -69.317 -39.988 33.682  1.00 84.58  ? 730  CYS A SG    1 
ATOM   2471  N  N     . ASP A 1  348 ? -67.764 -43.272 34.090  1.00 88.93  ? 731  ASP A N     1 
ATOM   2472  C  CA    . ASP A 1  348 ? -66.912 -44.030 33.197  1.00 87.45  ? 731  ASP A CA    1 
ATOM   2473  C  C     . ASP A 1  348 ? -67.089 -43.646 31.735  1.00 88.52  ? 731  ASP A C     1 
ATOM   2474  O  O     . ASP A 1  348 ? -66.711 -44.435 30.865  1.00 90.82  ? 731  ASP A O     1 
ATOM   2475  C  CB    . ASP A 1  348 ? -67.203 -45.518 33.353  1.00 103.83 ? 731  ASP A CB    1 
ATOM   2476  C  CG    . ASP A 1  348 ? -66.927 -46.021 34.739  1.00 102.29 ? 731  ASP A CG    1 
ATOM   2477  O  OD1   . ASP A 1  348 ? -67.323 -47.163 35.054  1.00 107.70 ? 731  ASP A OD1   1 
ATOM   2478  O  OD2   . ASP A 1  348 ? -66.369 -45.236 35.531  1.00 104.58 ? 731  ASP A OD2   1 
ATOM   2479  N  N     . THR A 1  349 ? -67.682 -42.488 31.433  1.00 86.07  ? 732  THR A N     1 
ATOM   2480  C  CA    . THR A 1  349 ? -67.986 -42.183 30.038  1.00 89.84  ? 732  THR A CA    1 
ATOM   2481  C  C     . THR A 1  349 ? -66.698 -41.903 29.267  1.00 89.49  ? 732  THR A C     1 
ATOM   2482  O  O     . THR A 1  349 ? -65.714 -41.404 29.819  1.00 90.51  ? 732  THR A O     1 
ATOM   2483  C  CB    . THR A 1  349 ? -68.935 -40.980 29.934  1.00 88.48  ? 732  THR A CB    1 
ATOM   2484  O  OG1   . THR A 1  349 ? -69.385 -40.813 28.579  1.00 96.89  ? 732  THR A OG1   1 
ATOM   2485  C  CG2   . THR A 1  349 ? -68.222 -39.726 30.349  1.00 89.16  ? 732  THR A CG2   1 
ATOM   2486  N  N     . THR A 1  350 ? -66.702 -42.249 27.983  1.00 89.31  ? 733  THR A N     1 
ATOM   2487  C  CA    . THR A 1  350 ? -65.656 -41.799 27.073  1.00 92.00  ? 733  THR A CA    1 
ATOM   2488  C  C     . THR A 1  350 ? -66.076 -40.484 26.425  1.00 94.24  ? 733  THR A C     1 
ATOM   2489  O  O     . THR A 1  350 ? -67.222 -40.062 26.534  1.00 96.73  ? 733  THR A O     1 
ATOM   2490  C  CB    . THR A 1  350 ? -65.356 -42.837 25.993  1.00 95.66  ? 733  THR A CB    1 
ATOM   2491  O  OG1   . THR A 1  350 ? -66.541 -43.110 25.233  1.00 98.82  ? 733  THR A OG1   1 
ATOM   2492  C  CG2   . THR A 1  350 ? -64.882 -44.130 26.632  1.00 97.71  ? 733  THR A CG2   1 
ATOM   2493  N  N     . ARG A 1  351 ? -65.124 -39.818 25.767  1.00 93.30  ? 734  ARG A N     1 
ATOM   2494  C  CA    . ARG A 1  351 ? -65.437 -38.568 25.073  1.00 94.45  ? 734  ARG A CA    1 
ATOM   2495  C  C     . ARG A 1  351 ? -66.522 -38.776 24.011  1.00 92.35  ? 734  ARG A C     1 
ATOM   2496  O  O     . ARG A 1  351 ? -67.454 -37.970 23.892  1.00 97.65  ? 734  ARG A O     1 
ATOM   2497  C  CB    . ARG A 1  351 ? -64.164 -37.987 24.451  1.00 109.48 ? 734  ARG A CB    1 
ATOM   2498  C  CG    . ARG A 1  351 ? -64.243 -36.527 23.967  1.00 105.26 ? 734  ARG A CG    1 
ATOM   2499  C  CD    . ARG A 1  351 ? -62.941 -36.060 23.290  1.00 107.09 ? 734  ARG A CD    1 
ATOM   2500  N  NE    . ARG A 1  351 ? -61.885 -35.684 24.236  1.00 115.72 ? 734  ARG A NE    1 
ATOM   2501  C  CZ    . ARG A 1  351 ? -60.826 -36.430 24.550  1.00 123.43 ? 734  ARG A CZ    1 
ATOM   2502  N  NH1   . ARG A 1  351 ? -59.933 -35.970 25.424  1.00 122.24 ? 734  ARG A NH1   1 
ATOM   2503  N  NH2   . ARG A 1  351 ? -60.646 -37.622 23.987  1.00 122.72 ? 734  ARG A NH2   1 
ATOM   2504  N  N     . LEU A 1  352 ? -66.407 -39.848 23.215  1.00 97.30  ? 735  LEU A N     1 
ATOM   2505  C  CA    . LEU A 1  352 ? -67.432 -40.158 22.215  1.00 97.63  ? 735  LEU A CA    1 
ATOM   2506  C  C     . LEU A 1  352 ? -68.782 -40.409 22.871  1.00 90.48  ? 735  LEU A C     1 
ATOM   2507  O  O     . LEU A 1  352 ? -69.805 -39.835 22.474  1.00 87.72  ? 735  LEU A O     1 
ATOM   2508  C  CB    . LEU A 1  352 ? -67.007 -41.372 21.382  1.00 97.99  ? 735  LEU A CB    1 
ATOM   2509  C  CG    . LEU A 1  352 ? -67.896 -41.764 20.199  1.00 92.51  ? 735  LEU A CG    1 
ATOM   2510  C  CD1   . LEU A 1  352 ? -68.270 -40.536 19.422  1.00 96.34  ? 735  LEU A CD1   1 
ATOM   2511  C  CD2   . LEU A 1  352 ? -67.183 -42.762 19.318  1.00 96.47  ? 735  LEU A CD2   1 
ATOM   2512  N  N     . GLU A 1  353 ? -68.802 -41.296 23.862  1.00 95.61  ? 736  GLU A N     1 
ATOM   2513  C  CA    . GLU A 1  353 ? -70.027 -41.600 24.594  1.00 95.00  ? 736  GLU A CA    1 
ATOM   2514  C  C     . GLU A 1  353 ? -70.646 -40.329 25.144  1.00 86.77  ? 736  GLU A C     1 
ATOM   2515  O  O     . GLU A 1  353 ? -71.845 -40.097 24.985  1.00 90.71  ? 736  GLU A O     1 
ATOM   2516  C  CB    . GLU A 1  353 ? -69.729 -42.612 25.703  1.00 95.24  ? 736  GLU A CB    1 
ATOM   2517  C  CG    . GLU A 1  353 ? -69.777 -44.069 25.236  1.00 103.43 ? 736  GLU A CG    1 
ATOM   2518  C  CD    . GLU A 1  353 ? -69.206 -45.004 26.272  1.00 102.14 ? 736  GLU A CD    1 
ATOM   2519  O  OE1   . GLU A 1  353 ? -68.773 -46.118 25.893  1.00 106.01 ? 736  GLU A OE1   1 
ATOM   2520  O  OE2   . GLU A 1  353 ? -69.243 -44.649 27.467  1.00 93.35  ? 736  GLU A OE2   1 
ATOM   2521  N  N     . ALA A 1  354 ? -69.832 -39.485 25.788  1.00 96.94  ? 737  ALA A N     1 
ATOM   2522  C  CA    . ALA A 1  354 ? -70.332 -38.245 26.381  1.00 94.52  ? 737  ALA A CA    1 
ATOM   2523  C  C     . ALA A 1  354 ? -70.868 -37.262 25.334  1.00 88.32  ? 737  ALA A C     1 
ATOM   2524  O  O     . ALA A 1  354 ? -71.796 -36.495 25.624  1.00 88.38  ? 737  ALA A O     1 
ATOM   2525  C  CB    . ALA A 1  354 ? -69.222 -37.614 27.226  1.00 91.09  ? 737  ALA A CB    1 
ATOM   2526  N  N     . SER A 1  355 ? -70.312 -37.278 24.121  1.00 89.78  ? 738  SER A N     1 
ATOM   2527  C  CA    . SER A 1  355 ? -70.764 -36.389 23.050  1.00 92.76  ? 738  SER A CA    1 
ATOM   2528  C  C     . SER A 1  355 ? -72.083 -36.829 22.431  1.00 95.03  ? 738  SER A C     1 
ATOM   2529  O  O     . SER A 1  355 ? -72.856 -35.981 21.968  1.00 92.63  ? 738  SER A O     1 
ATOM   2530  C  CB    . SER A 1  355 ? -69.701 -36.311 21.955  1.00 113.41 ? 738  SER A CB    1 
ATOM   2531  O  OG    . SER A 1  355 ? -69.374 -37.608 21.467  1.00 116.97 ? 738  SER A OG    1 
ATOM   2532  N  N     . GLN A 1  356 ? -72.302 -38.146 22.326  1.00 101.34 ? 739  GLN A N     1 
ATOM   2533  C  CA    . GLN A 1  356 ? -73.549 -38.670 21.768  1.00 95.25  ? 739  GLN A CA    1 
ATOM   2534  C  C     . GLN A 1  356 ? -74.648 -38.705 22.829  1.00 95.86  ? 739  GLN A C     1 
ATOM   2535  O  O     . GLN A 1  356 ? -75.775 -38.256 22.589  1.00 102.15 ? 739  GLN A O     1 
ATOM   2536  C  CB    . GLN A 1  356 ? -73.301 -40.073 21.196  1.00 97.28  ? 739  GLN A CB    1 
ATOM   2537  C  CG    . GLN A 1  356 ? -72.041 -40.212 20.348  1.00 96.49  ? 739  GLN A CG    1 
ATOM   2538  C  CD    . GLN A 1  356 ? -71.835 -41.631 19.807  1.00 102.25 ? 739  GLN A CD    1 
ATOM   2539  O  OE1   . GLN A 1  356 ? -72.182 -42.628 20.458  1.00 107.50 ? 739  GLN A OE1   1 
ATOM   2540  N  NE2   . GLN A 1  356 ? -71.300 -41.719 18.594  1.00 100.53 ? 739  GLN A NE2   1 
ATOM   2541  N  N     . ASN A 1  357 ? -74.336 -39.290 23.991  1.00 97.47  ? 740  ASN A N     1 
ATOM   2542  C  CA    . ASN A 1  357 ? -75.201 -39.272 25.163  1.00 92.04  ? 740  ASN A CA    1 
ATOM   2543  C  C     . ASN A 1  357 ? -74.889 -37.985 25.906  1.00 98.75  ? 740  ASN A C     1 
ATOM   2544  O  O     . ASN A 1  357 ? -73.882 -37.915 26.610  1.00 112.19 ? 740  ASN A O     1 
ATOM   2545  C  CB    . ASN A 1  357 ? -74.966 -40.471 26.073  1.00 87.60  ? 740  ASN A CB    1 
ATOM   2546  C  CG    . ASN A 1  357 ? -75.911 -40.457 27.270  1.00 97.74  ? 740  ASN A CG    1 
ATOM   2547  O  OD1   . ASN A 1  357 ? -76.612 -39.471 27.499  1.00 101.37 ? 740  ASN A OD1   1 
ATOM   2548  N  ND2   . ASN A 1  357 ? -75.957 -41.558 28.019  1.00 110.09 ? 740  ASN A ND2   1 
ATOM   2549  N  N     . LEU A 1  358 ? -75.766 -36.993 25.810  1.00 99.20  ? 741  LEU A N     1 
ATOM   2550  C  CA    . LEU A 1  358 ? -75.463 -35.690 26.399  1.00 99.41  ? 741  LEU A CA    1 
ATOM   2551  C  C     . LEU A 1  358 ? -75.818 -35.540 27.882  1.00 100.20 ? 741  LEU A C     1 
ATOM   2552  O  O     . LEU A 1  358 ? -75.053 -34.904 28.619  1.00 96.52  ? 741  LEU A O     1 
ATOM   2553  C  CB    . LEU A 1  358 ? -76.128 -34.574 25.588  1.00 96.89  ? 741  LEU A CB    1 
ATOM   2554  C  CG    . LEU A 1  358 ? -75.132 -33.459 25.284  1.00 87.34  ? 741  LEU A CG    1 
ATOM   2555  C  CD1   . LEU A 1  358 ? -73.876 -34.068 24.677  1.00 91.89  ? 741  LEU A CD1   1 
ATOM   2556  C  CD2   . LEU A 1  358 ? -75.763 -32.515 24.277  1.00 100.33 ? 741  LEU A CD2   1 
ATOM   2557  N  N     . VAL A 1  359 ? -76.957 -36.049 28.348  1.00 94.63  ? 742  VAL A N     1 
ATOM   2558  C  CA    . VAL A 1  359 ? -77.448 -35.687 29.677  1.00 88.85  ? 742  VAL A CA    1 
ATOM   2559  C  C     . VAL A 1  359 ? -77.515 -36.866 30.642  1.00 89.88  ? 742  VAL A C     1 
ATOM   2560  O  O     . VAL A 1  359 ? -77.450 -36.693 31.862  1.00 89.63  ? 742  VAL A O     1 
ATOM   2561  C  CB    . VAL A 1  359 ? -78.837 -35.027 29.569  1.00 92.22  ? 742  VAL A CB    1 
ATOM   2562  C  CG1   . VAL A 1  359 ? -79.479 -34.795 30.947  1.00 92.43  ? 742  VAL A CG1   1 
ATOM   2563  C  CG2   . VAL A 1  359 ? -78.729 -33.745 28.813  1.00 97.79  ? 742  VAL A CG2   1 
ATOM   2564  N  N     . PHE A 1  360 ? -77.655 -38.074 30.133  1.00 91.87  ? 743  PHE A N     1 
ATOM   2565  C  CA    . PHE A 1  360 ? -77.935 -39.172 31.048  1.00 90.40  ? 743  PHE A CA    1 
ATOM   2566  C  C     . PHE A 1  360 ? -76.655 -39.894 31.457  1.00 96.08  ? 743  PHE A C     1 
ATOM   2567  O  O     . PHE A 1  360 ? -76.296 -40.933 30.898  1.00 93.48  ? 743  PHE A O     1 
ATOM   2568  C  CB    . PHE A 1  360 ? -78.964 -40.091 30.420  1.00 93.83  ? 743  PHE A CB    1 
ATOM   2569  C  CG    . PHE A 1  360 ? -80.303 -39.455 30.315  1.00 89.32  ? 743  PHE A CG    1 
ATOM   2570  C  CD1   . PHE A 1  360 ? -81.034 -39.187 31.459  1.00 85.37  ? 743  PHE A CD1   1 
ATOM   2571  C  CD2   . PHE A 1  360 ? -80.817 -39.085 29.098  1.00 84.03  ? 743  PHE A CD2   1 
ATOM   2572  C  CE1   . PHE A 1  360 ? -82.262 -38.590 31.381  1.00 88.72  ? 743  PHE A CE1   1 
ATOM   2573  C  CE2   . PHE A 1  360 ? -82.050 -38.493 29.014  1.00 90.92  ? 743  PHE A CE2   1 
ATOM   2574  C  CZ    . PHE A 1  360 ? -82.775 -38.243 30.160  1.00 90.95  ? 743  PHE A CZ    1 
ATOM   2575  N  N     . HIS A 1  361 ? -75.954 -39.330 32.454  1.00 92.04  ? 744  HIS A N     1 
ATOM   2576  C  CA    . HIS A 1  361 ? -74.876 -40.022 33.165  1.00 90.92  ? 744  HIS A CA    1 
ATOM   2577  C  C     . HIS A 1  361 ? -75.057 -39.839 34.675  1.00 86.86  ? 744  HIS A C     1 
ATOM   2578  O  O     . HIS A 1  361 ? -75.754 -38.931 35.128  1.00 87.06  ? 744  HIS A O     1 
ATOM   2579  C  CB    . HIS A 1  361 ? -73.481 -39.527 32.732  1.00 89.58  ? 744  HIS A CB    1 
ATOM   2580  C  CG    . HIS A 1  361 ? -73.195 -39.688 31.266  1.00 93.69  ? 744  HIS A CG    1 
ATOM   2581  N  ND1   . HIS A 1  361 ? -73.767 -38.884 30.304  1.00 93.99  ? 744  HIS A ND1   1 
ATOM   2582  C  CD2   . HIS A 1  361 ? -72.382 -40.547 30.600  1.00 92.02  ? 744  HIS A CD2   1 
ATOM   2583  C  CE1   . HIS A 1  361 ? -73.330 -39.244 29.111  1.00 87.47  ? 744  HIS A CE1   1 
ATOM   2584  N  NE2   . HIS A 1  361 ? -72.484 -40.248 29.262  1.00 88.70  ? 744  HIS A NE2   1 
ATOM   2585  N  N     . SER A 1  362 ? -74.419 -40.715 35.461  1.00 90.82  ? 745  SER A N     1 
ATOM   2586  C  CA    . SER A 1  362 ? -74.543 -40.690 36.918  1.00 82.30  ? 745  SER A CA    1 
ATOM   2587  C  C     . SER A 1  362 ? -73.169 -40.812 37.572  1.00 81.96  ? 745  SER A C     1 
ATOM   2588  O  O     . SER A 1  362 ? -72.217 -41.305 36.969  1.00 89.49  ? 745  SER A O     1 
ATOM   2589  C  CB    . SER A 1  362 ? -75.460 -41.813 37.423  1.00 91.44  ? 745  SER A CB    1 
ATOM   2590  O  OG    . SER A 1  362 ? -76.749 -41.727 36.842  1.00 100.83 ? 745  SER A OG    1 
ATOM   2591  N  N     . ILE A 1  363 ? -73.076 -40.377 38.828  1.00 79.98  ? 746  ILE A N     1 
ATOM   2592  C  CA    . ILE A 1  363 ? -71.806 -40.343 39.556  1.00 81.21  ? 746  ILE A CA    1 
ATOM   2593  C  C     . ILE A 1  363 ? -71.521 -41.758 40.056  1.00 82.43  ? 746  ILE A C     1 
ATOM   2594  O  O     . ILE A 1  363 ? -72.023 -42.167 41.101  1.00 98.16  ? 746  ILE A O     1 
ATOM   2595  C  CB    . ILE A 1  363 ? -71.840 -39.326 40.699  1.00 84.84  ? 746  ILE A CB    1 
ATOM   2596  C  CG1   . ILE A 1  363 ? -72.062 -37.925 40.137  1.00 89.07  ? 746  ILE A CG1   1 
ATOM   2597  C  CG2   . ILE A 1  363 ? -70.540 -39.321 41.500  1.00 90.40  ? 746  ILE A CG2   1 
ATOM   2598  C  CD1   . ILE A 1  363 ? -71.951 -36.814 41.169  1.00 93.15  ? 746  ILE A CD1   1 
ATOM   2599  N  N     . THR A 1  364 ? -70.706 -42.514 39.307  1.00 78.79  ? 747  THR A N     1 
ATOM   2600  C  CA    . THR A 1  364 ? -70.442 -43.919 39.596  1.00 80.13  ? 747  THR A CA    1 
ATOM   2601  C  C     . THR A 1  364 ? -69.039 -44.201 40.090  1.00 85.98  ? 747  THR A C     1 
ATOM   2602  O  O     . THR A 1  364 ? -68.820 -45.245 40.705  1.00 89.26  ? 747  THR A O     1 
ATOM   2603  C  CB    . THR A 1  364 ? -70.664 -44.792 38.353  1.00 94.91  ? 747  THR A CB    1 
ATOM   2604  O  OG1   . THR A 1  364 ? -69.526 -44.687 37.478  1.00 91.63  ? 747  THR A OG1   1 
ATOM   2605  C  CG2   . THR A 1  364 ? -71.919 -44.366 37.609  1.00 100.00 ? 747  THR A CG2   1 
ATOM   2606  N  N     . ARG A 1  365 ? -68.080 -43.340 39.806  1.00 78.11  ? 748  ARG A N     1 
ATOM   2607  C  CA    . ARG A 1  365 ? -66.759 -43.594 40.341  1.00 80.98  ? 748  ARG A CA    1 
ATOM   2608  C  C     . ARG A 1  365 ? -66.747 -43.366 41.851  1.00 81.02  ? 748  ARG A C     1 
ATOM   2609  O  O     . ARG A 1  365 ? -67.565 -42.626 42.409  1.00 74.38  ? 748  ARG A O     1 
ATOM   2610  C  CB    . ARG A 1  365 ? -65.725 -42.708 39.653  1.00 85.16  ? 748  ARG A CB    1 
ATOM   2611  C  CG    . ARG A 1  365 ? -65.809 -42.754 38.152  1.00 80.36  ? 748  ARG A CG    1 
ATOM   2612  C  CD    . ARG A 1  365 ? -64.539 -42.226 37.544  1.00 82.21  ? 748  ARG A CD    1 
ATOM   2613  N  NE    . ARG A 1  365 ? -63.723 -43.292 36.976  1.00 93.99  ? 748  ARG A NE    1 
ATOM   2614  C  CZ    . ARG A 1  365 ? -63.564 -43.498 35.670  1.00 97.38  ? 748  ARG A CZ    1 
ATOM   2615  N  NH1   . ARG A 1  365 ? -64.152 -42.707 34.770  1.00 88.33  ? 748  ARG A NH1   1 
ATOM   2616  N  NH2   . ARG A 1  365 ? -62.802 -44.502 35.258  1.00 97.71  ? 748  ARG A NH2   1 
ATOM   2617  N  N     . SER A 1  366 ? -65.799 -44.021 42.518  1.00 79.46  ? 749  SER A N     1 
ATOM   2618  C  CA    . SER A 1  366 ? -65.592 -43.881 43.955  1.00 75.11  ? 749  SER A CA    1 
ATOM   2619  C  C     . SER A 1  366 ? -64.196 -44.391 44.281  1.00 73.49  ? 749  SER A C     1 
ATOM   2620  O  O     . SER A 1  366 ? -63.603 -45.129 43.494  1.00 72.66  ? 749  SER A O     1 
ATOM   2621  C  CB    . SER A 1  366 ? -66.616 -44.667 44.741  1.00 76.60  ? 749  SER A CB    1 
ATOM   2622  O  OG    . SER A 1  366 ? -66.153 -45.991 44.891  1.00 80.63  ? 749  SER A OG    1 
ATOM   2623  N  N     . HIS A 1  367 ? -63.688 -44.018 45.461  1.00 74.75  ? 750  HIS A N     1 
ATOM   2624  C  CA    . HIS A 1  367 ? -62.332 -44.428 45.823  1.00 74.03  ? 750  HIS A CA    1 
ATOM   2625  C  C     . HIS A 1  367 ? -62.223 -45.933 45.928  1.00 75.32  ? 750  HIS A C     1 
ATOM   2626  O  O     . HIS A 1  367 ? -61.188 -46.510 45.575  1.00 86.92  ? 750  HIS A O     1 
ATOM   2627  C  CB    . HIS A 1  367 ? -61.883 -43.813 47.151  1.00 84.94  ? 750  HIS A CB    1 
ATOM   2628  C  CG    . HIS A 1  367 ? -60.432 -44.042 47.447  1.00 74.79  ? 750  HIS A CG    1 
ATOM   2629  N  ND1   . HIS A 1  367 ? -59.431 -43.583 46.620  1.00 72.70  ? 750  HIS A ND1   1 
ATOM   2630  C  CD2   . HIS A 1  367 ? -59.812 -44.692 48.462  1.00 76.10  ? 750  HIS A CD2   1 
ATOM   2631  C  CE1   . HIS A 1  367 ? -58.257 -43.938 47.112  1.00 76.92  ? 750  HIS A CE1   1 
ATOM   2632  N  NE2   . HIS A 1  367 ? -58.459 -44.611 48.230  1.00 77.30  ? 750  HIS A NE2   1 
ATOM   2633  N  N     . ALA A 1  368 ? -63.271 -46.581 46.429  1.00 76.48  ? 751  ALA A N     1 
ATOM   2634  C  CA    . ALA A 1  368 ? -63.275 -48.034 46.537  1.00 76.65  ? 751  ALA A CA    1 
ATOM   2635  C  C     . ALA A 1  368 ? -63.262 -48.689 45.163  1.00 75.89  ? 751  ALA A C     1 
ATOM   2636  O  O     . ALA A 1  368 ? -62.420 -49.550 44.888  1.00 74.94  ? 751  ALA A O     1 
ATOM   2637  C  CB    . ALA A 1  368 ? -64.491 -48.486 47.336  1.00 88.05  ? 751  ALA A CB    1 
ATOM   2638  N  N     . GLU A 1  369 ? -64.206 -48.308 44.296  1.00 76.53  ? 752  GLU A N     1 
ATOM   2639  C  CA    . GLU A 1  369 ? -64.231 -48.845 42.941  1.00 69.39  ? 752  GLU A CA    1 
ATOM   2640  C  C     . GLU A 1  369 ? -62.879 -48.686 42.280  1.00 70.28  ? 752  GLU A C     1 
ATOM   2641  O  O     . GLU A 1  369 ? -62.391 -49.616 41.641  1.00 69.29  ? 752  GLU A O     1 
ATOM   2642  C  CB    . GLU A 1  369 ? -65.314 -48.157 42.101  1.00 81.39  ? 752  GLU A CB    1 
ATOM   2643  C  CG    . GLU A 1  369 ? -65.096 -48.260 40.570  1.00 89.00  ? 752  GLU A CG    1 
ATOM   2644  C  CD    . GLU A 1  369 ? -66.285 -47.762 39.724  1.00 96.64  ? 752  GLU A CD    1 
ATOM   2645  O  OE1   . GLU A 1  369 ? -67.259 -48.536 39.541  1.00 109.57 ? 752  GLU A OE1   1 
ATOM   2646  O  OE2   . GLU A 1  369 ? -66.243 -46.608 39.232  1.00 88.91  ? 752  GLU A OE2   1 
ATOM   2647  N  N     . ASN A 1  370 ? -62.248 -47.517 42.454  1.00 82.93  ? 753  ASN A N     1 
ATOM   2648  C  CA    . ASN A 1  370 ? -60.965 -47.218 41.809  1.00 85.36  ? 753  ASN A CA    1 
ATOM   2649  C  C     . ASN A 1  370 ? -59.832 -48.073 42.382  1.00 76.30  ? 753  ASN A C     1 
ATOM   2650  O  O     . ASN A 1  370 ? -58.958 -48.540 41.634  1.00 78.84  ? 753  ASN A O     1 
ATOM   2651  C  CB    . ASN A 1  370 ? -60.638 -45.717 41.937  1.00 73.47  ? 753  ASN A CB    1 
ATOM   2652  C  CG    . ASN A 1  370 ? -61.455 -44.827 40.975  1.00 79.21  ? 753  ASN A CG    1 
ATOM   2653  O  OD1   . ASN A 1  370 ? -62.190 -45.310 40.102  1.00 87.25  ? 753  ASN A OD1   1 
ATOM   2654  N  ND2   . ASN A 1  370 ? -61.296 -43.511 41.126  1.00 87.61  ? 753  ASN A ND2   1 
ATOM   2655  N  N     . LEU A 1  371 ? -59.819 -48.286 43.701  1.00 71.65  ? 754  LEU A N     1 
ATOM   2656  C  CA    . LEU A 1  371 ? -58.896 -49.265 44.259  1.00 70.32  ? 754  LEU A CA    1 
ATOM   2657  C  C     . LEU A 1  371 ? -59.132 -50.623 43.626  1.00 73.31  ? 754  LEU A C     1 
ATOM   2658  O  O     . LEU A 1  371 ? -58.183 -51.336 43.249  1.00 77.27  ? 754  LEU A O     1 
ATOM   2659  C  CB    . LEU A 1  371 ? -59.075 -49.347 45.768  1.00 71.96  ? 754  LEU A CB    1 
ATOM   2660  C  CG    . LEU A 1  371 ? -58.417 -48.235 46.562  1.00 67.18  ? 754  LEU A CG    1 
ATOM   2661  C  CD1   . LEU A 1  371 ? -59.163 -47.981 47.856  1.00 74.40  ? 754  LEU A CD1   1 
ATOM   2662  C  CD2   . LEU A 1  371 ? -57.000 -48.639 46.859  1.00 75.49  ? 754  LEU A CD2   1 
ATOM   2663  N  N     . GLN A 1  372 ? -60.404 -50.982 43.474  1.00 68.73  ? 755  GLN A N     1 
ATOM   2664  C  CA    . GLN A 1  372 ? -60.743 -52.283 42.922  1.00 81.59  ? 755  GLN A CA    1 
ATOM   2665  C  C     . GLN A 1  372 ? -60.254 -52.400 41.486  1.00 80.90  ? 755  GLN A C     1 
ATOM   2666  O  O     . GLN A 1  372 ? -59.691 -53.424 41.081  1.00 77.01  ? 755  GLN A O     1 
ATOM   2667  C  CB    . GLN A 1  372 ? -62.254 -52.507 42.994  1.00 82.16  ? 755  GLN A CB    1 
ATOM   2668  C  CG    . GLN A 1  372 ? -62.659 -53.857 42.449  1.00 80.28  ? 755  GLN A CG    1 
ATOM   2669  C  CD    . GLN A 1  372 ? -61.929 -54.971 43.170  1.00 95.03  ? 755  GLN A CD    1 
ATOM   2670  O  OE1   . GLN A 1  372 ? -61.449 -55.918 42.548  1.00 94.17  ? 755  GLN A OE1   1 
ATOM   2671  N  NE2   . GLN A 1  372 ? -61.831 -54.855 44.497  1.00 97.63  ? 755  GLN A NE2   1 
ATOM   2672  N  N     . ARG A 1  373 ? -60.461 -51.348 40.705  1.00 71.78  ? 756  ARG A N     1 
ATOM   2673  C  CA    . ARG A 1  373 ? -60.108 -51.410 39.304  1.00 65.23  ? 756  ARG A CA    1 
ATOM   2674  C  C     . ARG A 1  373 ? -58.616 -51.473 39.138  1.00 70.34  ? 756  ARG A C     1 
ATOM   2675  O  O     . ARG A 1  373 ? -58.135 -52.141 38.221  1.00 70.88  ? 756  ARG A O     1 
ATOM   2676  C  CB    . ARG A 1  373 ? -60.685 -50.223 38.559  1.00 58.47  ? 756  ARG A CB    1 
ATOM   2677  C  CG    . ARG A 1  373 ? -62.158 -50.351 38.407  1.00 64.49  ? 756  ARG A CG    1 
ATOM   2678  C  CD    . ARG A 1  373 ? -62.770 -49.130 37.820  1.00 73.36  ? 756  ARG A CD    1 
ATOM   2679  N  NE    . ARG A 1  373 ? -64.079 -49.466 37.292  1.00 83.09  ? 756  ARG A NE    1 
ATOM   2680  C  CZ    . ARG A 1  373 ? -64.904 -48.602 36.718  1.00 89.13  ? 756  ARG A CZ    1 
ATOM   2681  N  NH1   . ARG A 1  373 ? -64.567 -47.322 36.604  1.00 86.64  ? 756  ARG A NH1   1 
ATOM   2682  N  NH2   . ARG A 1  373 ? -66.076 -49.027 36.262  1.00 101.52 ? 756  ARG A NH2   1 
ATOM   2683  N  N     . TYR A 1  374 ? -57.857 -50.787 40.004  1.00 74.23  ? 757  TYR A N     1 
ATOM   2684  C  CA    . TYR A 1  374 ? -56.413 -50.980 39.935  1.00 71.71  ? 757  TYR A CA    1 
ATOM   2685  C  C     . TYR A 1  374 ? -56.061 -52.427 40.209  1.00 72.66  ? 757  TYR A C     1 
ATOM   2686  O  O     . TYR A 1  374 ? -55.193 -52.994 39.542  1.00 68.10  ? 757  TYR A O     1 
ATOM   2687  C  CB    . TYR A 1  374 ? -55.634 -50.089 40.900  1.00 59.57  ? 757  TYR A CB    1 
ATOM   2688  C  CG    . TYR A 1  374 ? -54.199 -50.565 40.966  1.00 56.97  ? 757  TYR A CG    1 
ATOM   2689  C  CD1   . TYR A 1  374 ? -53.366 -50.439 39.874  1.00 60.16  ? 757  TYR A CD1   1 
ATOM   2690  C  CD2   . TYR A 1  374 ? -53.698 -51.209 42.091  1.00 74.00  ? 757  TYR A CD2   1 
ATOM   2691  C  CE1   . TYR A 1  374 ? -52.052 -50.911 39.907  1.00 67.49  ? 757  TYR A CE1   1 
ATOM   2692  C  CE2   . TYR A 1  374 ? -52.374 -51.685 42.135  1.00 71.45  ? 757  TYR A CE2   1 
ATOM   2693  C  CZ    . TYR A 1  374 ? -51.561 -51.530 41.039  1.00 59.41  ? 757  TYR A CZ    1 
ATOM   2694  O  OH    . TYR A 1  374 ? -50.262 -51.980 41.057  1.00 53.25  ? 757  TYR A OH    1 
ATOM   2695  N  N     . GLU A 1  375 ? -56.699 -53.042 41.201  1.00 75.08  ? 758  GLU A N     1 
ATOM   2696  C  CA    . GLU A 1  375 ? -56.363 -54.435 41.444  1.00 70.82  ? 758  GLU A CA    1 
ATOM   2697  C  C     . GLU A 1  375 ? -56.730 -55.307 40.249  1.00 71.32  ? 758  GLU A C     1 
ATOM   2698  O  O     . GLU A 1  375 ? -55.995 -56.242 39.902  1.00 79.60  ? 758  GLU A O     1 
ATOM   2699  C  CB    . GLU A 1  375 ? -57.035 -54.933 42.708  1.00 68.97  ? 758  GLU A CB    1 
ATOM   2700  C  CG    . GLU A 1  375 ? -56.482 -56.282 43.118  1.00 86.80  ? 758  GLU A CG    1 
ATOM   2701  C  CD    . GLU A 1  375 ? -54.957 -56.314 43.099  1.00 88.73  ? 758  GLU A CD    1 
ATOM   2702  O  OE1   . GLU A 1  375 ? -54.388 -57.318 42.605  1.00 79.47  ? 758  GLU A OE1   1 
ATOM   2703  O  OE2   . GLU A 1  375 ? -54.330 -55.335 43.574  1.00 85.97  ? 758  GLU A OE2   1 
ATOM   2704  N  N     . VAL A 1  376 ? -57.853 -55.007 39.594  1.00 74.22  ? 759  VAL A N     1 
ATOM   2705  C  CA    . VAL A 1  376 ? -58.219 -55.749 38.389  1.00 69.55  ? 759  VAL A CA    1 
ATOM   2706  C  C     . VAL A 1  376 ? -57.160 -55.562 37.316  1.00 73.37  ? 759  VAL A C     1 
ATOM   2707  O  O     . VAL A 1  376 ? -56.722 -56.527 36.688  1.00 78.26  ? 759  VAL A O     1 
ATOM   2708  C  CB    . VAL A 1  376 ? -59.600 -55.325 37.867  1.00 73.17  ? 759  VAL A CB    1 
ATOM   2709  C  CG1   . VAL A 1  376 ? -59.930 -56.110 36.614  1.00 67.34  ? 759  VAL A CG1   1 
ATOM   2710  C  CG2   . VAL A 1  376 ? -60.675 -55.476 38.956  1.00 82.86  ? 759  VAL A CG2   1 
ATOM   2711  N  N     . TRP A 1  377 ? -56.753 -54.307 37.078  1.00 70.52  ? 760  TRP A N     1 
ATOM   2712  C  CA    . TRP A 1  377 ? -55.680 -54.010 36.135  1.00 68.93  ? 760  TRP A CA    1 
ATOM   2713  C  C     . TRP A 1  377 ? -54.398 -54.757 36.475  1.00 70.55  ? 760  TRP A C     1 
ATOM   2714  O  O     . TRP A 1  377 ? -53.655 -55.168 35.580  1.00 70.47  ? 760  TRP A O     1 
ATOM   2715  C  CB    . TRP A 1  377 ? -55.374 -52.503 36.101  1.00 73.64  ? 760  TRP A CB    1 
ATOM   2716  C  CG    . TRP A 1  377 ? -54.093 -52.235 35.282  1.00 77.86  ? 760  TRP A CG    1 
ATOM   2717  C  CD1   . TRP A 1  377 ? -52.795 -52.316 35.715  1.00 72.43  ? 760  TRP A CD1   1 
ATOM   2718  C  CD2   . TRP A 1  377 ? -54.018 -51.936 33.881  1.00 69.44  ? 760  TRP A CD2   1 
ATOM   2719  N  NE1   . TRP A 1  377 ? -51.934 -52.072 34.676  1.00 68.86  ? 760  TRP A NE1   1 
ATOM   2720  C  CE2   . TRP A 1  377 ? -52.661 -51.838 33.542  1.00 71.88  ? 760  TRP A CE2   1 
ATOM   2721  C  CE3   . TRP A 1  377 ? -54.974 -51.735 32.885  1.00 71.47  ? 760  TRP A CE3   1 
ATOM   2722  C  CZ2   . TRP A 1  377 ? -52.242 -51.550 32.262  1.00 73.99  ? 760  TRP A CZ2   1 
ATOM   2723  C  CZ3   . TRP A 1  377 ? -54.560 -51.455 31.628  1.00 76.38  ? 760  TRP A CZ3   1 
ATOM   2724  C  CH2   . TRP A 1  377 ? -53.208 -51.363 31.318  1.00 77.14  ? 760  TRP A CH2   1 
ATOM   2725  N  N     . ARG A 1  378 ? -54.088 -54.887 37.751  1.00 70.44  ? 761  ARG A N     1 
ATOM   2726  C  CA    . ARG A 1  378 ? -52.795 -55.438 38.112  1.00 73.13  ? 761  ARG A CA    1 
ATOM   2727  C  C     . ARG A 1  378 ? -52.779 -56.946 37.954  1.00 81.84  ? 761  ARG A C     1 
ATOM   2728  O  O     . ARG A 1  378 ? -51.781 -57.508 37.493  1.00 86.69  ? 761  ARG A O     1 
ATOM   2729  C  CB    . ARG A 1  378 ? -52.449 -55.055 39.546  1.00 75.06  ? 761  ARG A CB    1 
ATOM   2730  C  CG    . ARG A 1  378 ? -51.201 -55.698 40.069  1.00 76.23  ? 761  ARG A CG    1 
ATOM   2731  C  CD    . ARG A 1  378 ? -51.309 -55.760 41.554  1.00 77.94  ? 761  ARG A CD    1 
ATOM   2732  N  NE    . ARG A 1  378 ? -50.584 -56.909 42.059  1.00 95.05  ? 761  ARG A NE    1 
ATOM   2733  C  CZ    . ARG A 1  378 ? -51.065 -58.146 42.083  1.00 91.60  ? 761  ARG A CZ    1 
ATOM   2734  N  NH1   . ARG A 1  378 ? -52.289 -58.414 41.634  1.00 92.43  ? 761  ARG A NH1   1 
ATOM   2735  N  NH2   . ARG A 1  378 ? -50.310 -59.121 42.562  1.00 94.15  ? 761  ARG A NH2   1 
ATOM   2736  N  N     . SER A 1  379 ? -53.871 -57.613 38.333  1.00 79.47  ? 762  SER A N     1 
ATOM   2737  C  CA    . SER A 1  379 ? -53.908 -59.069 38.348  1.00 77.35  ? 762  SER A CA    1 
ATOM   2738  C  C     . SER A 1  379 ? -54.366 -59.667 37.030  1.00 83.37  ? 762  SER A C     1 
ATOM   2739  O  O     . SER A 1  379 ? -54.149 -60.860 36.800  1.00 89.50  ? 762  SER A O     1 
ATOM   2740  C  CB    . SER A 1  379 ? -54.828 -59.562 39.464  1.00 82.69  ? 762  SER A CB    1 
ATOM   2741  O  OG    . SER A 1  379 ? -56.162 -59.158 39.219  1.00 82.85  ? 762  SER A OG    1 
ATOM   2742  N  N     . ASN A 1  380 ? -54.980 -58.867 36.171  1.00 84.63  ? 763  ASN A N     1 
ATOM   2743  C  CA    . ASN A 1  380 ? -55.557 -59.280 34.900  1.00 82.23  ? 763  ASN A CA    1 
ATOM   2744  C  C     . ASN A 1  380 ? -56.289 -60.595 35.046  1.00 91.06  ? 763  ASN A C     1 
ATOM   2745  O  O     . ASN A 1  380 ? -55.853 -61.597 34.485  1.00 93.12  ? 763  ASN A O     1 
ATOM   2746  C  CB    . ASN A 1  380 ? -54.498 -59.432 33.821  1.00 81.22  ? 763  ASN A CB    1 
ATOM   2747  C  CG    . ASN A 1  380 ? -55.111 -59.555 32.465  1.00 84.65  ? 763  ASN A CG    1 
ATOM   2748  O  OD1   . ASN A 1  380 ? -56.315 -59.315 32.309  1.00 87.30  ? 763  ASN A OD1   1 
ATOM   2749  N  ND2   . ASN A 1  380 ? -54.303 -59.926 31.467  1.00 78.28  ? 763  ASN A ND2   1 
ATOM   2750  N  N     . PRO A 1  381 ? -57.381 -60.653 35.799  1.00 85.28  ? 764  PRO A N     1 
ATOM   2751  C  CA    . PRO A 1  381 ? -57.917 -61.963 36.176  1.00 89.11  ? 764  PRO A CA    1 
ATOM   2752  C  C     . PRO A 1  381 ? -58.621 -62.710 35.056  1.00 94.40  ? 764  PRO A C     1 
ATOM   2753  O  O     . PRO A 1  381 ? -58.775 -63.931 35.175  1.00 91.13  ? 764  PRO A O     1 
ATOM   2754  C  CB    . PRO A 1  381 ? -58.889 -61.625 37.308  1.00 90.94  ? 764  PRO A CB    1 
ATOM   2755  C  CG    . PRO A 1  381 ? -59.325 -60.249 37.006  1.00 83.89  ? 764  PRO A CG    1 
ATOM   2756  C  CD    . PRO A 1  381 ? -58.123 -59.554 36.434  1.00 79.55  ? 764  PRO A CD    1 
ATOM   2757  N  N     . TYR A 1  382 ? -59.043 -62.035 33.981  1.00 94.88  ? 765  TYR A N     1 
ATOM   2758  C  CA    . TYR A 1  382 ? -59.700 -62.683 32.851  1.00 85.88  ? 765  TYR A CA    1 
ATOM   2759  C  C     . TYR A 1  382 ? -58.810 -62.725 31.619  1.00 84.68  ? 765  TYR A C     1 
ATOM   2760  O  O     . TYR A 1  382 ? -59.309 -62.740 30.490  1.00 87.71  ? 765  TYR A O     1 
ATOM   2761  C  CB    . TYR A 1  382 ? -61.022 -61.988 32.553  1.00 90.49  ? 765  TYR A CB    1 
ATOM   2762  C  CG    . TYR A 1  382 ? -61.898 -61.981 33.770  1.00 86.95  ? 765  TYR A CG    1 
ATOM   2763  C  CD1   . TYR A 1  382 ? -61.919 -60.889 34.608  1.00 86.53  ? 765  TYR A CD1   1 
ATOM   2764  C  CD2   . TYR A 1  382 ? -62.669 -63.086 34.103  1.00 88.08  ? 765  TYR A CD2   1 
ATOM   2765  C  CE1   . TYR A 1  382 ? -62.695 -60.876 35.723  1.00 92.02  ? 765  TYR A CE1   1 
ATOM   2766  C  CE2   . TYR A 1  382 ? -63.452 -63.084 35.219  1.00 88.78  ? 765  TYR A CE2   1 
ATOM   2767  C  CZ    . TYR A 1  382 ? -63.462 -61.969 36.030  1.00 94.44  ? 765  TYR A CZ    1 
ATOM   2768  O  OH    . TYR A 1  382 ? -64.235 -61.917 37.167  1.00 100.01 ? 765  TYR A OH    1 
ATOM   2769  N  N     . HIS A 1  383 ? -57.496 -62.740 31.846  1.00 90.70  ? 766  HIS A N     1 
ATOM   2770  C  CA    . HIS A 1  383 ? -56.418 -62.828 30.868  1.00 88.57  ? 766  HIS A CA    1 
ATOM   2771  C  C     . HIS A 1  383 ? -56.774 -62.120 29.565  1.00 93.03  ? 766  HIS A C     1 
ATOM   2772  O  O     . HIS A 1  383 ? -56.987 -62.755 28.528  1.00 100.71 ? 766  HIS A O     1 
ATOM   2773  C  CB    . HIS A 1  383 ? -56.032 -64.297 30.655  1.00 86.96  ? 766  HIS A CB    1 
ATOM   2774  C  CG    . HIS A 1  383 ? -55.548 -64.994 31.904  1.00 97.71  ? 766  HIS A CG    1 
ATOM   2775  N  ND1   . HIS A 1  383 ? -54.911 -66.216 31.873  1.00 104.90 ? 766  HIS A ND1   1 
ATOM   2776  C  CD2   . HIS A 1  383 ? -55.614 -64.645 33.215  1.00 105.11 ? 766  HIS A CD2   1 
ATOM   2777  C  CE1   . HIS A 1  383 ? -54.604 -66.588 33.106  1.00 104.61 ? 766  HIS A CE1   1 
ATOM   2778  N  NE2   . HIS A 1  383 ? -55.019 -65.653 33.940  1.00 102.04 ? 766  HIS A NE2   1 
ATOM   2779  N  N     . GLU A 1  384 ? -56.825 -60.791 29.629  1.00 94.34  ? 767  GLU A N     1 
ATOM   2780  C  CA    . GLU A 1  384 ? -57.240 -59.911 28.549  1.00 88.60  ? 767  GLU A CA    1 
ATOM   2781  C  C     . GLU A 1  384 ? -56.053 -59.188 27.932  1.00 93.26  ? 767  GLU A C     1 
ATOM   2782  O  O     . GLU A 1  384 ? -54.999 -59.023 28.551  1.00 92.62  ? 767  GLU A O     1 
ATOM   2783  C  CB    . GLU A 1  384 ? -58.240 -58.880 29.062  1.00 85.82  ? 767  GLU A CB    1 
ATOM   2784  C  CG    . GLU A 1  384 ? -59.659 -59.354 28.997  1.00 98.88  ? 767  GLU A CG    1 
ATOM   2785  C  CD    . GLU A 1  384 ? -60.566 -58.672 30.000  1.00 97.09  ? 767  GLU A CD    1 
ATOM   2786  O  OE1   . GLU A 1  384 ? -60.197 -58.605 31.201  1.00 94.16  ? 767  GLU A OE1   1 
ATOM   2787  O  OE2   . GLU A 1  384 ? -61.652 -58.211 29.578  1.00 93.14  ? 767  GLU A OE2   1 
ATOM   2788  N  N     . SER A 1  385 ? -56.244 -58.757 26.689  1.00 100.30 ? 768  SER A N     1 
ATOM   2789  C  CA    . SER A 1  385 ? -55.307 -57.857 26.036  1.00 94.09  ? 768  SER A CA    1 
ATOM   2790  C  C     . SER A 1  385 ? -55.367 -56.473 26.673  1.00 95.65  ? 768  SER A C     1 
ATOM   2791  O  O     . SER A 1  385 ? -56.323 -56.123 27.373  1.00 101.13 ? 768  SER A O     1 
ATOM   2792  C  CB    . SER A 1  385 ? -55.637 -57.728 24.558  1.00 102.51 ? 768  SER A CB    1 
ATOM   2793  O  OG    . SER A 1  385 ? -56.571 -56.671 24.378  1.00 100.00 ? 768  SER A OG    1 
ATOM   2794  N  N     . VAL A 1  386 ? -54.349 -55.658 26.387  1.00 93.20  ? 769  VAL A N     1 
ATOM   2795  C  CA    . VAL A 1  386 ? -54.245 -54.369 27.063  1.00 88.65  ? 769  VAL A CA    1 
ATOM   2796  C  C     . VAL A 1  386 ? -55.430 -53.478 26.713  1.00 100.37 ? 769  VAL A C     1 
ATOM   2797  O  O     . VAL A 1  386 ? -55.948 -52.760 27.573  1.00 107.40 ? 769  VAL A O     1 
ATOM   2798  C  CB    . VAL A 1  386 ? -52.899 -53.696 26.748  1.00 85.31  ? 769  VAL A CB    1 
ATOM   2799  C  CG1   . VAL A 1  386 ? -52.752 -53.452 25.249  1.00 105.55 ? 769  VAL A CG1   1 
ATOM   2800  C  CG2   . VAL A 1  386 ? -52.726 -52.410 27.558  1.00 97.52  ? 769  VAL A CG2   1 
ATOM   2801  N  N     . GLU A 1  387 ? -55.907 -53.526 25.466  1.00 102.78 ? 770  GLU A N     1 
ATOM   2802  C  CA    . GLU A 1  387 ? -57.070 -52.715 25.111  1.00 104.08 ? 770  GLU A CA    1 
ATOM   2803  C  C     . GLU A 1  387 ? -58.311 -53.204 25.848  1.00 107.37 ? 770  GLU A C     1 
ATOM   2804  O  O     . GLU A 1  387 ? -59.089 -52.404 26.384  1.00 108.36 ? 770  GLU A O     1 
ATOM   2805  C  CB    . GLU A 1  387 ? -57.300 -52.736 23.599  1.00 106.29 ? 770  GLU A CB    1 
ATOM   2806  C  CG    . GLU A 1  387 ? -56.147 -52.172 22.779  1.00 118.18 ? 770  GLU A CG    1 
ATOM   2807  C  CD    . GLU A 1  387 ? -55.039 -53.191 22.504  1.00 127.22 ? 770  GLU A CD    1 
ATOM   2808  O  OE1   . GLU A 1  387 ? -55.121 -54.334 23.011  1.00 116.99 ? 770  GLU A OE1   1 
ATOM   2809  O  OE2   . GLU A 1  387 ? -54.083 -52.841 21.773  1.00 141.57 ? 770  GLU A OE2   1 
ATOM   2810  N  N     . GLU A 1  388 ? -58.497 -54.526 25.909  1.00 97.17  ? 771  GLU A N     1 
ATOM   2811  C  CA    . GLU A 1  388 ? -59.648 -55.070 26.615  1.00 95.10  ? 771  GLU A CA    1 
ATOM   2812  C  C     . GLU A 1  388 ? -59.539 -54.825 28.115  1.00 96.50  ? 771  GLU A C     1 
ATOM   2813  O  O     . GLU A 1  388 ? -60.522 -54.442 28.755  1.00 96.33  ? 771  GLU A O     1 
ATOM   2814  C  CB    . GLU A 1  388 ? -59.793 -56.560 26.309  1.00 101.06 ? 771  GLU A CB    1 
ATOM   2815  C  CG    . GLU A 1  388 ? -59.899 -56.892 24.814  1.00 109.09 ? 771  GLU A CG    1 
ATOM   2816  C  CD    . GLU A 1  388 ? -59.871 -58.402 24.523  1.00 131.08 ? 771  GLU A CD    1 
ATOM   2817  O  OE1   . GLU A 1  388 ? -59.658 -59.204 25.467  1.00 118.10 ? 771  GLU A OE1   1 
ATOM   2818  O  OE2   . GLU A 1  388 ? -60.059 -58.786 23.345  1.00 141.58 ? 771  GLU A OE2   1 
ATOM   2819  N  N     . LEU A 1  389 ? -58.354 -55.029 28.691  1.00 93.49  ? 772  LEU A N     1 
ATOM   2820  C  CA    . LEU A 1  389 ? -58.177 -54.779 30.118  1.00 87.17  ? 772  LEU A CA    1 
ATOM   2821  C  C     . LEU A 1  389 ? -58.472 -53.323 30.453  1.00 89.38  ? 772  LEU A C     1 
ATOM   2822  O  O     . LEU A 1  389 ? -59.206 -53.025 31.405  1.00 88.89  ? 772  LEU A O     1 
ATOM   2823  C  CB    . LEU A 1  389 ? -56.758 -55.157 30.534  1.00 78.93  ? 772  LEU A CB    1 
ATOM   2824  C  CG    . LEU A 1  389 ? -56.337 -54.901 31.968  1.00 73.90  ? 772  LEU A CG    1 
ATOM   2825  C  CD1   . LEU A 1  389 ? -57.231 -55.657 32.886  1.00 73.23  ? 772  LEU A CD1   1 
ATOM   2826  C  CD2   . LEU A 1  389 ? -54.921 -55.354 32.133  1.00 73.68  ? 772  LEU A CD2   1 
ATOM   2827  N  N     . ARG A 1  390 ? -57.909 -52.402 29.662  1.00 90.15  ? 773  ARG A N     1 
ATOM   2828  C  CA    . ARG A 1  390 ? -58.133 -50.972 29.849  1.00 86.73  ? 773  ARG A CA    1 
ATOM   2829  C  C     . ARG A 1  390 ? -59.605 -50.632 29.724  1.00 86.95  ? 773  ARG A C     1 
ATOM   2830  O  O     . ARG A 1  390 ? -60.135 -49.840 30.505  1.00 96.50  ? 773  ARG A O     1 
ATOM   2831  C  CB    . ARG A 1  390 ? -57.311 -50.180 28.828  1.00 98.90  ? 773  ARG A CB    1 
ATOM   2832  C  CG    . ARG A 1  390 ? -57.533 -48.664 28.839  1.00 114.57 ? 773  ARG A CG    1 
ATOM   2833  C  CD    . ARG A 1  390 ? -56.387 -47.900 28.157  1.00 116.66 ? 773  ARG A CD    1 
ATOM   2834  N  NE    . ARG A 1  390 ? -56.608 -46.454 28.210  1.00 124.62 ? 773  ARG A NE    1 
ATOM   2835  C  CZ    . ARG A 1  390 ? -57.179 -45.744 27.238  1.00 127.11 ? 773  ARG A CZ    1 
ATOM   2836  N  NH1   . ARG A 1  390 ? -57.350 -44.434 27.383  1.00 122.47 ? 773  ARG A NH1   1 
ATOM   2837  N  NH2   . ARG A 1  390 ? -57.576 -46.337 26.116  1.00 121.97 ? 773  ARG A NH2   1 
ATOM   2838  N  N     . ASP A 1  391 ? -60.281 -51.206 28.734  1.00 89.02  ? 774  ASP A N     1 
ATOM   2839  C  CA    . ASP A 1  391 ? -61.723 -51.031 28.660  1.00 96.31  ? 774  ASP A CA    1 
ATOM   2840  C  C     . ASP A 1  391 ? -62.391 -51.522 29.937  1.00 96.29  ? 774  ASP A C     1 
ATOM   2841  O  O     . ASP A 1  391 ? -63.300 -50.868 30.463  1.00 97.73  ? 774  ASP A O     1 
ATOM   2842  C  CB    . ASP A 1  391 ? -62.284 -51.769 27.448  1.00 109.09 ? 774  ASP A CB    1 
ATOM   2843  C  CG    . ASP A 1  391 ? -63.722 -51.384 27.140  1.00 122.50 ? 774  ASP A CG    1 
ATOM   2844  O  OD1   . ASP A 1  391 ? -64.254 -51.883 26.126  1.00 138.29 ? 774  ASP A OD1   1 
ATOM   2845  O  OD2   . ASP A 1  391 ? -64.315 -50.574 27.889  1.00 118.71 ? 774  ASP A OD2   1 
ATOM   2846  N  N     . ARG A 1  392 ? -61.945 -52.668 30.463  1.00 98.26  ? 775  ARG A N     1 
ATOM   2847  C  CA    . ARG A 1  392 ? -62.611 -53.245 31.629  1.00 99.06  ? 775  ARG A CA    1 
ATOM   2848  C  C     . ARG A 1  392 ? -62.497 -52.334 32.838  1.00 90.84  ? 775  ARG A C     1 
ATOM   2849  O  O     . ARG A 1  392 ? -63.488 -52.097 33.538  1.00 91.20  ? 775  ARG A O     1 
ATOM   2850  C  CB    . ARG A 1  392 ? -62.042 -54.622 31.972  1.00 94.85  ? 775  ARG A CB    1 
ATOM   2851  C  CG    . ARG A 1  392 ? -62.595 -55.165 33.297  1.00 87.50  ? 775  ARG A CG    1 
ATOM   2852  C  CD    . ARG A 1  392 ? -61.978 -56.495 33.674  1.00 92.03  ? 775  ARG A CD    1 
ATOM   2853  N  NE    . ARG A 1  392 ? -62.183 -57.486 32.628  1.00 99.87  ? 775  ARG A NE    1 
ATOM   2854  C  CZ    . ARG A 1  392 ? -63.234 -58.292 32.570  1.00 98.44  ? 775  ARG A CZ    1 
ATOM   2855  N  NH1   . ARG A 1  392 ? -64.172 -58.226 33.502  1.00 95.38  ? 775  ARG A NH1   1 
ATOM   2856  N  NH2   . ARG A 1  392 ? -63.349 -59.165 31.580  1.00 111.41 ? 775  ARG A NH2   1 
ATOM   2857  N  N     . VAL A 1  393 ? -61.292 -51.812 33.098  1.00 93.28  ? 776  VAL A N     1 
ATOM   2858  C  CA    . VAL A 1  393 ? -61.046 -51.017 34.299  1.00 84.60  ? 776  VAL A CA    1 
ATOM   2859  C  C     . VAL A 1  393 ? -61.295 -49.531 34.098  1.00 79.09  ? 776  VAL A C     1 
ATOM   2860  O  O     . VAL A 1  393 ? -60.966 -48.743 34.994  1.00 83.02  ? 776  VAL A O     1 
ATOM   2861  C  CB    . VAL A 1  393 ? -59.600 -51.181 34.816  1.00 79.30  ? 776  VAL A CB    1 
ATOM   2862  C  CG1   . VAL A 1  393 ? -59.303 -52.637 35.208  1.00 74.85  ? 776  VAL A CG1   1 
ATOM   2863  C  CG2   . VAL A 1  393 ? -58.616 -50.674 33.772  1.00 84.38  ? 776  VAL A CG2   1 
ATOM   2864  N  N     . LYS A 1  394 ? -61.832 -49.119 32.947  1.00 81.89  ? 777  LYS A N     1 
ATOM   2865  C  CA    . LYS A 1  394 ? -62.248 -47.733 32.712  1.00 83.24  ? 777  LYS A CA    1 
ATOM   2866  C  C     . LYS A 1  394 ? -61.137 -46.722 33.027  1.00 86.65  ? 777  LYS A C     1 
ATOM   2867  O  O     . LYS A 1  394 ? -61.374 -45.659 33.605  1.00 78.73  ? 777  LYS A O     1 
ATOM   2868  C  CB    . LYS A 1  394 ? -63.521 -47.427 33.497  1.00 84.15  ? 777  LYS A CB    1 
ATOM   2869  C  CG    . LYS A 1  394 ? -64.675 -48.317 33.103  1.00 83.62  ? 777  LYS A CG    1 
ATOM   2870  C  CD    . LYS A 1  394 ? -64.851 -48.291 31.593  1.00 91.25  ? 777  LYS A CD    1 
ATOM   2871  C  CE    . LYS A 1  394 ? -65.938 -49.252 31.138  1.00 109.58 ? 777  LYS A CE    1 
ATOM   2872  N  NZ    . LYS A 1  394 ? -65.895 -49.478 29.658  1.00 112.68 ? 777  LYS A NZ    1 
ATOM   2873  N  N     . GLY A 1  395 ? -59.906 -47.057 32.644  1.00 89.83  ? 778  GLY A N     1 
ATOM   2874  C  CA    . GLY A 1  395 ? -58.786 -46.148 32.739  1.00 84.38  ? 778  GLY A CA    1 
ATOM   2875  C  C     . GLY A 1  395 ? -58.135 -46.036 34.097  1.00 80.83  ? 778  GLY A C     1 
ATOM   2876  O  O     . GLY A 1  395 ? -57.252 -45.192 34.274  1.00 84.64  ? 778  GLY A O     1 
ATOM   2877  N  N     . VAL A 1  396 ? -58.527 -46.845 35.073  1.00 78.84  ? 779  VAL A N     1 
ATOM   2878  C  CA    . VAL A 1  396 ? -57.876 -46.815 36.381  1.00 76.69  ? 779  VAL A CA    1 
ATOM   2879  C  C     . VAL A 1  396 ? -56.699 -47.780 36.278  1.00 76.51  ? 779  VAL A C     1 
ATOM   2880  O  O     . VAL A 1  396 ? -56.824 -48.974 36.506  1.00 79.66  ? 779  VAL A O     1 
ATOM   2881  C  CB    . VAL A 1  396 ? -58.842 -47.153 37.513  1.00 75.47  ? 779  VAL A CB    1 
ATOM   2882  C  CG1   . VAL A 1  396 ? -58.133 -47.164 38.857  1.00 72.40  ? 779  VAL A CG1   1 
ATOM   2883  C  CG2   . VAL A 1  396 ? -59.985 -46.134 37.516  1.00 82.12  ? 779  VAL A CG2   1 
ATOM   2884  N  N     . SER A 1  397 ? -55.542 -47.248 35.881  1.00 79.03  ? 780  SER A N     1 
ATOM   2885  C  CA    . SER A 1  397 ? -54.354 -48.047 35.606  1.00 75.87  ? 780  SER A CA    1 
ATOM   2886  C  C     . SER A 1  397 ? -53.236 -47.831 36.617  1.00 73.53  ? 780  SER A C     1 
ATOM   2887  O  O     . SER A 1  397 ? -52.110 -48.280 36.389  1.00 79.92  ? 780  SER A O     1 
ATOM   2888  C  CB    . SER A 1  397 ? -53.838 -47.741 34.203  1.00 80.15  ? 780  SER A CB    1 
ATOM   2889  O  OG    . SER A 1  397 ? -54.837 -48.027 33.246  1.00 93.39  ? 780  SER A OG    1 
ATOM   2890  N  N     . ALA A 1  398 ? -53.509 -47.149 37.721  1.00 76.19  ? 781  ALA A N     1 
ATOM   2891  C  CA    . ALA A 1  398 ? -52.541 -47.008 38.796  1.00 66.38  ? 781  ALA A CA    1 
ATOM   2892  C  C     . ALA A 1  398 ? -53.296 -46.962 40.108  1.00 70.48  ? 781  ALA A C     1 
ATOM   2893  O  O     . ALA A 1  398 ? -54.494 -46.679 40.147  1.00 78.69  ? 781  ALA A O     1 
ATOM   2894  C  CB    . ALA A 1  398 ? -51.686 -45.761 38.646  1.00 70.43  ? 781  ALA A CB    1 
ATOM   2895  N  N     . LYS A 1  399 ? -52.600 -47.252 41.184  1.00 68.10  ? 782  LYS A N     1 
ATOM   2896  C  CA    . LYS A 1  399 ? -53.287 -47.389 42.458  1.00 68.95  ? 782  LYS A CA    1 
ATOM   2897  C  C     . LYS A 1  399 ? -53.631 -46.016 43.021  1.00 75.31  ? 782  LYS A C     1 
ATOM   2898  O  O     . LYS A 1  399 ? -52.721 -45.210 43.243  1.00 87.73  ? 782  LYS A O     1 
ATOM   2899  C  CB    . LYS A 1  399 ? -52.420 -48.141 43.438  1.00 68.45  ? 782  LYS A CB    1 
ATOM   2900  C  CG    . LYS A 1  399 ? -53.157 -48.537 44.671  1.00 70.55  ? 782  LYS A CG    1 
ATOM   2901  C  CD    . LYS A 1  399 ? -52.261 -49.316 45.587  1.00 78.83  ? 782  LYS A CD    1 
ATOM   2902  C  CE    . LYS A 1  399 ? -53.025 -49.787 46.805  1.00 84.05  ? 782  LYS A CE    1 
ATOM   2903  N  NZ    . LYS A 1  399 ? -52.161 -50.571 47.726  1.00 99.67  ? 782  LYS A NZ    1 
ATOM   2904  N  N     . PRO A 1  400 ? -54.906 -45.705 43.276  1.00 68.12  ? 783  PRO A N     1 
ATOM   2905  C  CA    . PRO A 1  400 ? -55.225 -44.429 43.920  1.00 77.44  ? 783  PRO A CA    1 
ATOM   2906  C  C     . PRO A 1  400 ? -54.647 -44.390 45.326  1.00 85.47  ? 783  PRO A C     1 
ATOM   2907  O  O     . PRO A 1  400 ? -54.464 -45.425 45.976  1.00 80.27  ? 783  PRO A O     1 
ATOM   2908  C  CB    . PRO A 1  400 ? -56.761 -44.414 43.960  1.00 75.86  ? 783  PRO A CB    1 
ATOM   2909  C  CG    . PRO A 1  400 ? -57.202 -45.490 43.083  1.00 72.15  ? 783  PRO A CG    1 
ATOM   2910  C  CD    . PRO A 1  400 ? -56.114 -46.519 43.102  1.00 73.24  ? 783  PRO A CD    1 
ATOM   2911  N  N     . PHE A 1  401 ? -54.360 -43.168 45.811  1.00 85.53  ? 784  PHE A N     1 
ATOM   2912  C  CA    . PHE A 1  401 ? -53.891 -43.043 47.187  1.00 83.43  ? 784  PHE A CA    1 
ATOM   2913  C  C     . PHE A 1  401 ? -54.483 -41.883 47.970  1.00 76.23  ? 784  PHE A C     1 
ATOM   2914  O  O     . PHE A 1  401 ? -54.088 -41.685 49.119  1.00 79.68  ? 784  PHE A O     1 
ATOM   2915  C  CB    . PHE A 1  401 ? -52.351 -42.966 47.228  1.00 82.15  ? 784  PHE A CB    1 
ATOM   2916  C  CG    . PHE A 1  401 ? -51.783 -41.574 47.170  1.00 82.02  ? 784  PHE A CG    1 
ATOM   2917  C  CD1   . PHE A 1  401 ? -51.675 -40.909 45.961  1.00 85.65  ? 784  PHE A CD1   1 
ATOM   2918  C  CD2   . PHE A 1  401 ? -51.280 -40.971 48.317  1.00 79.88  ? 784  PHE A CD2   1 
ATOM   2919  C  CE1   . PHE A 1  401 ? -51.119 -39.642 45.904  1.00 81.76  ? 784  PHE A CE1   1 
ATOM   2920  C  CE2   . PHE A 1  401 ? -50.725 -39.709 48.274  1.00 80.80  ? 784  PHE A CE2   1 
ATOM   2921  C  CZ    . PHE A 1  401 ? -50.642 -39.037 47.065  1.00 80.31  ? 784  PHE A CZ    1 
ATOM   2922  N  N     . ILE A 1  402 ? -55.440 -41.147 47.425  1.00 74.67  ? 785  ILE A N     1 
ATOM   2923  C  CA    . ILE A 1  402 ? -56.166 -40.148 48.199  1.00 79.95  ? 785  ILE A CA    1 
ATOM   2924  C  C     . ILE A 1  402 ? -57.629 -40.190 47.799  1.00 90.39  ? 785  ILE A C     1 
ATOM   2925  O  O     . ILE A 1  402 ? -57.952 -40.164 46.606  1.00 94.61  ? 785  ILE A O     1 
ATOM   2926  C  CB    . ILE A 1  402 ? -55.606 -38.731 47.998  1.00 79.43  ? 785  ILE A CB    1 
ATOM   2927  C  CG1   . ILE A 1  402 ? -54.246 -38.607 48.679  1.00 80.07  ? 785  ILE A CG1   1 
ATOM   2928  C  CG2   . ILE A 1  402 ? -56.575 -37.704 48.559  1.00 87.81  ? 785  ILE A CG2   1 
ATOM   2929  C  CD1   . ILE A 1  402 ? -53.664 -37.236 48.614  1.00 86.67  ? 785  ILE A CD1   1 
ATOM   2930  N  N     . GLU A 1  403 ? -58.513 -40.263 48.790  1.00 85.82  ? 786  GLU A N     1 
ATOM   2931  C  CA    . GLU A 1  403 ? -59.935 -40.168 48.501  1.00 94.17  ? 786  GLU A CA    1 
ATOM   2932  C  C     . GLU A 1  403 ? -60.300 -38.698 48.311  1.00 96.09  ? 786  GLU A C     1 
ATOM   2933  O  O     . GLU A 1  403 ? -60.088 -37.873 49.207  1.00 94.62  ? 786  GLU A O     1 
ATOM   2934  C  CB    . GLU A 1  403 ? -60.744 -40.807 49.625  1.00 99.02  ? 786  GLU A CB    1 
ATOM   2935  C  CG    . GLU A 1  403 ? -62.247 -40.863 49.395  1.00 100.95 ? 786  GLU A CG    1 
ATOM   2936  C  CD    . GLU A 1  403 ? -62.973 -41.377 50.619  1.00 115.28 ? 786  GLU A CD    1 
ATOM   2937  O  OE1   . GLU A 1  403 ? -62.299 -41.581 51.657  1.00 116.64 ? 786  GLU A OE1   1 
ATOM   2938  O  OE2   . GLU A 1  403 ? -64.206 -41.579 50.543  1.00 130.55 ? 786  GLU A OE2   1 
ATOM   2939  N  N     . THR A 1  404 ? -60.818 -38.364 47.134  1.00 91.88  ? 787  THR A N     1 
ATOM   2940  C  CA    . THR A 1  404 ? -61.206 -37.006 46.808  1.00 83.99  ? 787  THR A CA    1 
ATOM   2941  C  C     . THR A 1  404 ? -62.690 -36.964 46.483  1.00 91.47  ? 787  THR A C     1 
ATOM   2942  O  O     . THR A 1  404 ? -63.362 -37.992 46.357  1.00 98.02  ? 787  THR A O     1 
ATOM   2943  C  CB    . THR A 1  404 ? -60.397 -36.452 45.631  1.00 87.55  ? 787  THR A CB    1 
ATOM   2944  O  OG1   . THR A 1  404 ? -60.841 -37.052 44.412  1.00 87.39  ? 787  THR A OG1   1 
ATOM   2945  C  CG2   . THR A 1  404 ? -58.928 -36.737 45.822  1.00 92.26  ? 787  THR A CG2   1 
ATOM   2946  N  N     . VAL A 1  405 ? -63.193 -35.743 46.363  1.00 87.99  ? 788  VAL A N     1 
ATOM   2947  C  CA    . VAL A 1  405 ? -64.583 -35.479 46.018  1.00 83.58  ? 788  VAL A CA    1 
ATOM   2948  C  C     . VAL A 1  405 ? -64.562 -34.468 44.875  1.00 88.48  ? 788  VAL A C     1 
ATOM   2949  O  O     . VAL A 1  405 ? -64.811 -33.273 45.101  1.00 95.14  ? 788  VAL A O     1 
ATOM   2950  C  CB    . VAL A 1  405 ? -65.353 -34.979 47.249  1.00 85.14  ? 788  VAL A CB    1 
ATOM   2951  C  CG1   . VAL A 1  405 ? -66.824 -34.829 46.949  1.00 98.95  ? 788  VAL A CG1   1 
ATOM   2952  C  CG2   . VAL A 1  405 ? -65.157 -35.951 48.388  1.00 87.93  ? 788  VAL A CG2   1 
ATOM   2953  N  N     . PRO A 1  406 ? -64.224 -34.881 43.647  1.00 87.23  ? 789  PRO A N     1 
ATOM   2954  C  CA    . PRO A 1  406 ? -64.150 -33.916 42.544  1.00 88.46  ? 789  PRO A CA    1 
ATOM   2955  C  C     . PRO A 1  406 ? -65.496 -33.268 42.266  1.00 104.95 ? 789  PRO A C     1 
ATOM   2956  O  O     . PRO A 1  406 ? -66.556 -33.898 42.360  1.00 96.66  ? 789  PRO A O     1 
ATOM   2957  C  CB    . PRO A 1  406 ? -63.679 -34.758 41.352  1.00 82.64  ? 789  PRO A CB    1 
ATOM   2958  C  CG    . PRO A 1  406 ? -63.963 -36.145 41.731  1.00 89.93  ? 789  PRO A CG    1 
ATOM   2959  C  CD    . PRO A 1  406 ? -63.794 -36.216 43.216  1.00 91.33  ? 789  PRO A CD    1 
ATOM   2960  N  N     . SER A 1  407 ? -65.426 -31.992 41.903  1.00 106.05 ? 790  SER A N     1 
ATOM   2961  C  CA    . SER A 1  407 ? -66.596 -31.151 41.705  1.00 100.79 ? 790  SER A CA    1 
ATOM   2962  C  C     . SER A 1  407 ? -66.376 -30.324 40.446  1.00 108.66 ? 790  SER A C     1 
ATOM   2963  O  O     . SER A 1  407 ? -65.564 -30.660 39.576  1.00 108.21 ? 790  SER A O     1 
ATOM   2964  C  CB    . SER A 1  407 ? -66.828 -30.267 42.935  1.00 102.86 ? 790  SER A CB    1 
ATOM   2965  O  OG    . SER A 1  407 ? -67.924 -29.400 42.713  1.00 117.30 ? 790  SER A OG    1 
ATOM   2966  N  N     . ILE A 1  408 ? -67.112 -29.224 40.341  1.00 109.44 ? 791  ILE A N     1 
ATOM   2967  C  CA    . ILE A 1  408 ? -66.926 -28.251 39.276  1.00 121.74 ? 791  ILE A CA    1 
ATOM   2968  C  C     . ILE A 1  408 ? -67.158 -26.871 39.876  1.00 127.14 ? 791  ILE A C     1 
ATOM   2969  O  O     . ILE A 1  408 ? -67.867 -26.722 40.878  1.00 130.18 ? 791  ILE A O     1 
ATOM   2970  C  CB    . ILE A 1  408 ? -67.862 -28.520 38.072  1.00 114.14 ? 791  ILE A CB    1 
ATOM   2971  C  CG1   . ILE A 1  408 ? -67.415 -27.700 36.859  1.00 117.57 ? 791  ILE A CG1   1 
ATOM   2972  C  CG2   . ILE A 1  408 ? -69.314 -28.226 38.429  1.00 110.31 ? 791  ILE A CG2   1 
ATOM   2973  C  CD1   . ILE A 1  408 ? -68.322 -27.843 35.664  1.00 110.70 ? 791  ILE A CD1   1 
ATOM   2974  N  N     . ASP A 1  409 ? -66.524 -25.861 39.289  1.00 129.05 ? 792  ASP A N     1 
ATOM   2975  C  CA    . ASP A 1  409 ? -66.743 -24.500 39.745  1.00 135.99 ? 792  ASP A CA    1 
ATOM   2976  C  C     . ASP A 1  409 ? -67.794 -23.829 38.862  1.00 139.82 ? 792  ASP A C     1 
ATOM   2977  O  O     . ASP A 1  409 ? -68.012 -24.226 37.713  1.00 142.40 ? 792  ASP A O     1 
ATOM   2978  C  CB    . ASP A 1  409 ? -65.430 -23.690 39.801  1.00 144.09 ? 792  ASP A CB    1 
ATOM   2979  C  CG    . ASP A 1  409 ? -64.696 -23.578 38.467  1.00 143.84 ? 792  ASP A CG    1 
ATOM   2980  O  OD1   . ASP A 1  409 ? -65.228 -23.969 37.407  1.00 144.31 ? 792  ASP A OD1   1 
ATOM   2981  O  OD2   . ASP A 1  409 ? -63.549 -23.067 38.502  1.00 146.50 ? 792  ASP A OD2   1 
ATOM   2982  N  N     . ALA A 1  410 ? -68.494 -22.845 39.440  1.00 133.99 ? 793  ALA A N     1 
ATOM   2983  C  CA    . ALA A 1  410 ? -69.509 -22.118 38.685  1.00 127.35 ? 793  ALA A CA    1 
ATOM   2984  C  C     . ALA A 1  410 ? -68.930 -21.541 37.399  1.00 128.42 ? 793  ALA A C     1 
ATOM   2985  O  O     . ALA A 1  410 ? -69.632 -21.439 36.387  1.00 127.98 ? 793  ALA A O     1 
ATOM   2986  C  CB    . ALA A 1  410 ? -70.120 -21.020 39.557  1.00 125.76 ? 793  ALA A CB    1 
ATOM   2987  N  N     . LEU A 1  411 ? -67.636 -21.215 37.415  1.00 123.79 ? 794  LEU A N     1 
ATOM   2988  C  CA    . LEU A 1  411 ? -66.970 -20.591 36.275  1.00 127.57 ? 794  LEU A CA    1 
ATOM   2989  C  C     . LEU A 1  411 ? -67.008 -21.464 35.016  1.00 131.35 ? 794  LEU A C     1 
ATOM   2990  O  O     . LEU A 1  411 ? -67.331 -20.977 33.922  1.00 127.72 ? 794  LEU A O     1 
ATOM   2991  C  CB    . LEU A 1  411 ? -65.533 -20.265 36.679  1.00 126.35 ? 794  LEU A CB    1 
ATOM   2992  C  CG    . LEU A 1  411 ? -64.638 -19.493 35.723  1.00 132.38 ? 794  LEU A CG    1 
ATOM   2993  C  CD1   . LEU A 1  411 ? -65.343 -18.237 35.303  1.00 124.04 ? 794  LEU A CD1   1 
ATOM   2994  C  CD2   . LEU A 1  411 ? -63.326 -19.165 36.406  1.00 140.73 ? 794  LEU A CD2   1 
ATOM   2995  N  N     . HIS A 1  412 ? -66.653 -22.752 35.143  1.00 127.68 ? 795  HIS A N     1 
ATOM   2996  C  CA    . HIS A 1  412 ? -66.484 -23.611 33.966  1.00 124.93 ? 795  HIS A CA    1 
ATOM   2997  C  C     . HIS A 1  412 ? -67.806 -23.988 33.309  1.00 121.94 ? 795  HIS A C     1 
ATOM   2998  O  O     . HIS A 1  412 ? -67.840 -24.232 32.097  1.00 118.79 ? 795  HIS A O     1 
ATOM   2999  C  CB    . HIS A 1  412 ? -65.692 -24.870 34.324  1.00 126.49 ? 795  HIS A CB    1 
ATOM   3000  C  CG    . HIS A 1  412 ? -64.234 -24.617 34.541  1.00 134.01 ? 795  HIS A CG    1 
ATOM   3001  N  ND1   . HIS A 1  412 ? -63.700 -24.327 35.778  1.00 140.96 ? 795  HIS A ND1   1 
ATOM   3002  C  CD2   . HIS A 1  412 ? -63.204 -24.560 33.667  1.00 140.24 ? 795  HIS A CD2   1 
ATOM   3003  C  CE1   . HIS A 1  412 ? -62.399 -24.130 35.660  1.00 144.48 ? 795  HIS A CE1   1 
ATOM   3004  N  NE2   . HIS A 1  412 ? -62.072 -24.267 34.388  1.00 148.89 ? 795  HIS A NE2   1 
ATOM   3005  N  N     . CYS A 1  413 ? -68.896 -24.036 34.076  1.00 123.94 ? 796  CYS A N     1 
ATOM   3006  C  CA    . CYS A 1  413 ? -70.216 -24.213 33.477  1.00 123.53 ? 796  CYS A CA    1 
ATOM   3007  C  C     . CYS A 1  413 ? -70.480 -23.113 32.452  1.00 124.48 ? 796  CYS A C     1 
ATOM   3008  O  O     . CYS A 1  413 ? -70.770 -23.375 31.270  1.00 122.79 ? 796  CYS A O     1 
ATOM   3009  C  CB    . CYS A 1  413 ? -71.285 -24.183 34.578  1.00 122.18 ? 796  CYS A CB    1 
ATOM   3010  S  SG    . CYS A 1  413 ? -70.946 -25.182 36.059  1.00 133.43 ? 796  CYS A SG    1 
ATOM   3011  N  N     . ASP A 1  414 ? -70.353 -21.863 32.909  1.00 127.54 ? 797  ASP A N     1 
ATOM   3012  C  CA    . ASP A 1  414 ? -70.498 -20.684 32.065  1.00 127.87 ? 797  ASP A CA    1 
ATOM   3013  C  C     . ASP A 1  414 ? -69.547 -20.732 30.879  1.00 124.25 ? 797  ASP A C     1 
ATOM   3014  O  O     . ASP A 1  414 ? -69.926 -20.409 29.747  1.00 118.44 ? 797  ASP A O     1 
ATOM   3015  C  CB    . ASP A 1  414 ? -70.225 -19.437 32.901  1.00 126.31 ? 797  ASP A CB    1 
ATOM   3016  C  CG    . ASP A 1  414 ? -71.407 -19.045 33.757  1.00 134.93 ? 797  ASP A CG    1 
ATOM   3017  O  OD1   . ASP A 1  414 ? -72.404 -19.798 33.762  1.00 139.75 ? 797  ASP A OD1   1 
ATOM   3018  O  OD2   . ASP A 1  414 ? -71.351 -17.980 34.409  1.00 138.85 ? 797  ASP A OD2   1 
ATOM   3019  N  N     . ILE A 1  415 ? -68.296 -21.111 31.132  1.00 121.18 ? 798  ILE A N     1 
ATOM   3020  C  CA    . ILE A 1  415 ? -67.285 -21.103 30.082  1.00 118.36 ? 798  ILE A CA    1 
ATOM   3021  C  C     . ILE A 1  415 ? -67.653 -22.086 28.976  1.00 125.66 ? 798  ILE A C     1 
ATOM   3022  O  O     . ILE A 1  415 ? -67.622 -21.745 27.787  1.00 128.97 ? 798  ILE A O     1 
ATOM   3023  C  CB    . ILE A 1  415 ? -65.912 -21.438 30.682  1.00 122.54 ? 798  ILE A CB    1 
ATOM   3024  C  CG1   . ILE A 1  415 ? -65.461 -20.344 31.642  1.00 130.71 ? 798  ILE A CG1   1 
ATOM   3025  C  CG2   . ILE A 1  415 ? -64.878 -21.627 29.583  1.00 118.57 ? 798  ILE A CG2   1 
ATOM   3026  C  CD1   . ILE A 1  415 ? -64.176 -20.689 32.347  1.00 134.26 ? 798  ILE A CD1   1 
ATOM   3027  N  N     . GLY A 1  416 ? -67.977 -23.331 29.354  1.00 130.79 ? 799  GLY A N     1 
ATOM   3028  C  CA    . GLY A 1  416 ? -68.328 -24.337 28.360  1.00 123.70 ? 799  GLY A CA    1 
ATOM   3029  C  C     . GLY A 1  416 ? -69.556 -23.956 27.559  1.00 128.49 ? 799  GLY A C     1 
ATOM   3030  O  O     . GLY A 1  416 ? -69.563 -24.054 26.319  1.00 129.35 ? 799  GLY A O     1 
ATOM   3031  N  N     . ASN A 1  417 ? -70.600 -23.482 28.254  1.00 126.87 ? 800  ASN A N     1 
ATOM   3032  C  CA    . ASN A 1  417 ? -71.811 -23.047 27.566  1.00 125.32 ? 800  ASN A CA    1 
ATOM   3033  C  C     . ASN A 1  417 ? -71.498 -21.936 26.570  1.00 133.73 ? 800  ASN A C     1 
ATOM   3034  O  O     . ASN A 1  417 ? -71.994 -21.942 25.435  1.00 132.37 ? 800  ASN A O     1 
ATOM   3035  C  CB    . ASN A 1  417 ? -72.846 -22.561 28.580  1.00 124.48 ? 800  ASN A CB    1 
ATOM   3036  C  CG    . ASN A 1  417 ? -73.603 -23.688 29.253  1.00 127.87 ? 800  ASN A CG    1 
ATOM   3037  O  OD1   . ASN A 1  417 ? -74.186 -24.545 28.588  1.00 132.19 ? 800  ASN A OD1   1 
ATOM   3038  N  ND2   . ASN A 1  417 ? -73.619 -23.679 30.582  1.00 130.68 ? 800  ASN A ND2   1 
ATOM   3039  N  N     . ALA A 1  418 ? -70.690 -20.956 26.992  1.00 130.90 ? 801  ALA A N     1 
ATOM   3040  C  CA    . ALA A 1  418 ? -70.380 -19.828 26.125  1.00 127.28 ? 801  ALA A CA    1 
ATOM   3041  C  C     . ALA A 1  418 ? -69.547 -20.245 24.928  1.00 130.47 ? 801  ALA A C     1 
ATOM   3042  O  O     . ALA A 1  418 ? -69.739 -19.718 23.833  1.00 140.76 ? 801  ALA A O     1 
ATOM   3043  C  CB    . ALA A 1  418 ? -69.654 -18.751 26.908  1.00 134.64 ? 801  ALA A CB    1 
ATOM   3044  N  N     . ALA A 1  419 ? -68.583 -21.144 25.121  1.00 126.99 ? 802  ALA A N     1 
ATOM   3045  C  CA    . ALA A 1  419 ? -67.817 -21.634 23.982  1.00 125.49 ? 802  ALA A CA    1 
ATOM   3046  C  C     . ALA A 1  419 ? -68.743 -22.249 22.946  1.00 133.74 ? 802  ALA A C     1 
ATOM   3047  O  O     . ALA A 1  419 ? -68.644 -21.951 21.741  1.00 142.96 ? 802  ALA A O     1 
ATOM   3048  C  CB    . ALA A 1  419 ? -66.782 -22.654 24.447  1.00 123.57 ? 802  ALA A CB    1 
ATOM   3049  N  N     . GLU A 1  420 ? -69.686 -23.073 23.410  1.00 136.02 ? 803  GLU A N     1 
ATOM   3050  C  CA    . GLU A 1  420 ? -70.624 -23.697 22.485  1.00 137.19 ? 803  GLU A CA    1 
ATOM   3051  C  C     . GLU A 1  420 ? -71.502 -22.655 21.794  1.00 137.11 ? 803  GLU A C     1 
ATOM   3052  O  O     . GLU A 1  420 ? -71.717 -22.722 20.577  1.00 144.23 ? 803  GLU A O     1 
ATOM   3053  C  CB    . GLU A 1  420 ? -71.466 -24.741 23.215  1.00 140.12 ? 803  GLU A CB    1 
ATOM   3054  C  CG    . GLU A 1  420 ? -71.072 -26.174 22.877  1.00 132.90 ? 803  GLU A CG    1 
ATOM   3055  C  CD    . GLU A 1  420 ? -70.751 -26.342 21.406  1.00 145.21 ? 803  GLU A CD    1 
ATOM   3056  O  OE1   . GLU A 1  420 ? -71.676 -26.234 20.572  1.00 149.13 ? 803  GLU A OE1   1 
ATOM   3057  O  OE2   . GLU A 1  420 ? -69.564 -26.554 21.085  1.00 149.80 ? 803  GLU A OE2   1 
ATOM   3058  N  N     . PHE A 1  421 ? -72.020 -21.681 22.553  1.00 132.03 ? 804  PHE A N     1 
ATOM   3059  C  CA    . PHE A 1  421 ? -72.875 -20.654 21.956  1.00 142.55 ? 804  PHE A CA    1 
ATOM   3060  C  C     . PHE A 1  421 ? -72.117 -19.788 20.948  1.00 151.85 ? 804  PHE A C     1 
ATOM   3061  O  O     . PHE A 1  421 ? -72.679 -19.374 19.929  1.00 154.16 ? 804  PHE A O     1 
ATOM   3062  C  CB    . PHE A 1  421 ? -73.488 -19.771 23.041  1.00 137.59 ? 804  PHE A CB    1 
ATOM   3063  C  CG    . PHE A 1  421 ? -74.810 -20.251 23.536  1.00 136.23 ? 804  PHE A CG    1 
ATOM   3064  C  CD1   . PHE A 1  421 ? -74.899 -21.359 24.355  1.00 134.47 ? 804  PHE A CD1   1 
ATOM   3065  C  CD2   . PHE A 1  421 ? -75.973 -19.608 23.151  1.00 141.46 ? 804  PHE A CD2   1 
ATOM   3066  C  CE1   . PHE A 1  421 ? -76.125 -21.806 24.801  1.00 134.79 ? 804  PHE A CE1   1 
ATOM   3067  C  CE2   . PHE A 1  421 ? -77.204 -20.051 23.589  1.00 142.97 ? 804  PHE A CE2   1 
ATOM   3068  C  CZ    . PHE A 1  421 ? -77.281 -21.150 24.415  1.00 140.10 ? 804  PHE A CZ    1 
ATOM   3069  N  N     . TYR A 1  422 ? -70.850 -19.479 21.232  1.00 152.04 ? 805  TYR A N     1 
ATOM   3070  C  CA    . TYR A 1  422 ? -70.019 -18.713 20.307  1.00 145.11 ? 805  TYR A CA    1 
ATOM   3071  C  C     . TYR A 1  422 ? -69.842 -19.463 18.992  1.00 147.17 ? 805  TYR A C     1 
ATOM   3072  O  O     . TYR A 1  422 ? -69.995 -18.891 17.900  1.00 152.45 ? 805  TYR A O     1 
ATOM   3073  C  CB    . TYR A 1  422 ? -68.674 -18.429 20.983  1.00 153.80 ? 805  TYR A CB    1 
ATOM   3074  C  CG    . TYR A 1  422 ? -67.684 -17.562 20.238  1.00 165.94 ? 805  TYR A CG    1 
ATOM   3075  C  CD1   . TYR A 1  422 ? -67.849 -16.180 20.166  1.00 164.90 ? 805  TYR A CD1   1 
ATOM   3076  C  CD2   . TYR A 1  422 ? -66.550 -18.120 19.655  1.00 169.18 ? 805  TYR A CD2   1 
ATOM   3077  C  CE1   . TYR A 1  422 ? -66.929 -15.382 19.500  1.00 166.20 ? 805  TYR A CE1   1 
ATOM   3078  C  CE2   . TYR A 1  422 ? -65.625 -17.331 18.993  1.00 175.20 ? 805  TYR A CE2   1 
ATOM   3079  C  CZ    . TYR A 1  422 ? -65.820 -15.968 18.915  1.00 175.88 ? 805  TYR A CZ    1 
ATOM   3080  O  OH    . TYR A 1  422 ? -64.895 -15.201 18.251  1.00 180.77 ? 805  TYR A OH    1 
ATOM   3081  N  N     . LYS A 1  423 ? -69.518 -20.756 19.081  1.00 141.28 ? 806  LYS A N     1 
ATOM   3082  C  CA    . LYS A 1  423 ? -69.375 -21.548 17.867  1.00 143.18 ? 806  LYS A CA    1 
ATOM   3083  C  C     . LYS A 1  423 ? -70.697 -21.612 17.100  1.00 144.50 ? 806  LYS A C     1 
ATOM   3084  O  O     . LYS A 1  423 ? -70.715 -21.542 15.860  1.00 148.48 ? 806  LYS A O     1 
ATOM   3085  C  CB    . LYS A 1  423 ? -68.865 -22.942 18.225  1.00 147.19 ? 806  LYS A CB    1 
ATOM   3086  C  CG    . LYS A 1  423 ? -68.149 -23.643 17.095  1.00 160.42 ? 806  LYS A CG    1 
ATOM   3087  C  CD    . LYS A 1  423 ? -66.769 -23.030 16.900  1.00 166.95 ? 806  LYS A CD    1 
ATOM   3088  C  CE    . LYS A 1  423 ? -66.032 -23.646 15.724  1.00 176.19 ? 806  LYS A CE    1 
ATOM   3089  N  NZ    . LYS A 1  423 ? -66.788 -23.504 14.445  1.00 177.22 ? 806  LYS A NZ    1 
ATOM   3090  N  N     . ILE A 1  424 ? -71.814 -21.745 17.827  1.00 144.93 ? 807  ILE A N     1 
ATOM   3091  C  CA    . ILE A 1  424 ? -73.141 -21.759 17.202  1.00 152.63 ? 807  ILE A CA    1 
ATOM   3092  C  C     . ILE A 1  424 ? -73.427 -20.433 16.501  1.00 156.56 ? 807  ILE A C     1 
ATOM   3093  O  O     . ILE A 1  424 ? -74.022 -20.407 15.418  1.00 165.02 ? 807  ILE A O     1 
ATOM   3094  C  CB    . ILE A 1  424 ? -74.236 -22.101 18.238  1.00 150.10 ? 807  ILE A CB    1 
ATOM   3095  C  CG1   . ILE A 1  424 ? -74.178 -23.576 18.645  1.00 146.36 ? 807  ILE A CG1   1 
ATOM   3096  C  CG2   . ILE A 1  424 ? -75.627 -21.791 17.701  1.00 148.17 ? 807  ILE A CG2   1 
ATOM   3097  C  CD1   . ILE A 1  424 ? -75.250 -23.964 19.649  1.00 139.58 ? 807  ILE A CD1   1 
ATOM   3098  N  N     . PHE A 1  425 ? -73.059 -19.314 17.129  1.00 153.47 ? 808  PHE A N     1 
ATOM   3099  C  CA    . PHE A 1  425 ? -73.247 -18.003 16.512  1.00 152.43 ? 808  PHE A CA    1 
ATOM   3100  C  C     . PHE A 1  425 ? -72.502 -17.913 15.181  1.00 159.91 ? 808  PHE A C     1 
ATOM   3101  O  O     . PHE A 1  425 ? -73.068 -17.490 14.160  1.00 157.78 ? 808  PHE A O     1 
ATOM   3102  C  CB    . PHE A 1  425 ? -72.786 -16.907 17.477  1.00 146.66 ? 808  PHE A CB    1 
ATOM   3103  C  CG    . PHE A 1  425 ? -73.699 -16.707 18.658  1.00 144.78 ? 808  PHE A CG    1 
ATOM   3104  C  CD1   . PHE A 1  425 ? -75.018 -17.120 18.610  1.00 148.58 ? 808  PHE A CD1   1 
ATOM   3105  C  CD2   . PHE A 1  425 ? -73.242 -16.095 19.813  1.00 142.10 ? 808  PHE A CD2   1 
ATOM   3106  C  CE1   . PHE A 1  425 ? -75.859 -16.932 19.692  1.00 140.72 ? 808  PHE A CE1   1 
ATOM   3107  C  CE2   . PHE A 1  425 ? -74.081 -15.904 20.894  1.00 134.23 ? 808  PHE A CE2   1 
ATOM   3108  C  CZ    . PHE A 1  425 ? -75.389 -16.325 20.832  1.00 130.18 ? 808  PHE A CZ    1 
ATOM   3109  N  N     . GLN A 1  426 ? -71.219 -18.302 15.180  1.00 162.63 ? 809  GLN A N     1 
ATOM   3110  C  CA    . GLN A 1  426 ? -70.440 -18.253 13.941  1.00 158.72 ? 809  GLN A CA    1 
ATOM   3111  C  C     . GLN A 1  426 ? -71.052 -19.136 12.856  1.00 165.36 ? 809  GLN A C     1 
ATOM   3112  O  O     . GLN A 1  426 ? -71.076 -18.756 11.681  1.00 172.53 ? 809  GLN A O     1 
ATOM   3113  C  CB    . GLN A 1  426 ? -68.998 -18.709 14.170  1.00 163.16 ? 809  GLN A CB    1 
ATOM   3114  C  CG    . GLN A 1  426 ? -68.139 -17.951 15.162  1.00 169.28 ? 809  GLN A CG    1 
ATOM   3115  C  CD    . GLN A 1  426 ? -66.786 -18.636 15.329  1.00 174.24 ? 809  GLN A CD    1 
ATOM   3116  O  OE1   . GLN A 1  426 ? -66.089 -18.896 14.347  1.00 175.44 ? 809  GLN A OE1   1 
ATOM   3117  N  NE2   . GLN A 1  426 ? -66.430 -18.970 16.564  1.00 173.00 ? 809  GLN A NE2   1 
ATOM   3118  N  N     . LEU A 1  427 ? -71.528 -20.333 13.224  1.00 169.41 ? 810  LEU A N     1 
ATOM   3119  C  CA    . LEU A 1  427 ? -72.073 -21.245 12.214  1.00 169.54 ? 810  LEU A CA    1 
ATOM   3120  C  C     . LEU A 1  427 ? -73.455 -20.821 11.718  1.00 169.53 ? 810  LEU A C     1 
ATOM   3121  O  O     . LEU A 1  427 ? -73.816 -21.112 10.570  1.00 168.93 ? 810  LEU A O     1 
ATOM   3122  C  CB    . LEU A 1  427 ? -72.121 -22.666 12.769  1.00 163.68 ? 810  LEU A CB    1 
ATOM   3123  C  CG    . LEU A 1  427 ? -70.742 -23.264 13.060  1.00 169.02 ? 810  LEU A CG    1 
ATOM   3124  C  CD1   . LEU A 1  427 ? -70.825 -24.689 13.620  1.00 167.70 ? 810  LEU A CD1   1 
ATOM   3125  C  CD2   . LEU A 1  427 ? -69.863 -23.211 11.818  1.00 179.45 ? 810  LEU A CD2   1 
ATOM   3126  N  N     . GLU A 1  428 ? -74.258 -20.194 12.582  1.00 166.35 ? 811  GLU A N     1 
ATOM   3127  C  CA    . GLU A 1  428 ? -75.566 -19.675 12.194  1.00 168.83 ? 811  GLU A CA    1 
ATOM   3128  C  C     . GLU A 1  428 ? -75.452 -18.424 11.331  1.00 173.94 ? 811  GLU A C     1 
ATOM   3129  O  O     . GLU A 1  428 ? -76.380 -18.102 10.576  1.00 174.73 ? 811  GLU A O     1 
ATOM   3130  C  CB    . GLU A 1  428 ? -76.395 -19.387 13.440  1.00 167.28 ? 811  GLU A CB    1 
ATOM   3131  C  CG    . GLU A 1  428 ? -77.866 -19.626 13.251  1.00 168.66 ? 811  GLU A CG    1 
ATOM   3132  C  CD    . GLU A 1  428 ? -78.270 -21.084 13.425  1.00 167.91 ? 811  GLU A CD    1 
ATOM   3133  O  OE1   . GLU A 1  428 ? -77.414 -21.997 13.378  1.00 163.96 ? 811  GLU A OE1   1 
ATOM   3134  O  OE2   . GLU A 1  428 ? -79.468 -21.321 13.633  1.00 172.76 ? 811  GLU A OE2   1 
ATOM   3135  N  N     . ILE A 1  429 ? -74.363 -17.669 11.484  1.00 172.03 ? 812  ILE A N     1 
ATOM   3136  C  CA    . ILE A 1  429 ? -74.125 -16.564 10.562  1.00 174.95 ? 812  ILE A CA    1 
ATOM   3137  C  C     . ILE A 1  429 ? -73.795 -17.097 9.169   1.00 183.45 ? 812  ILE A C     1 
ATOM   3138  O  O     . ILE A 1  429 ? -74.144 -16.476 8.155   1.00 186.01 ? 812  ILE A O     1 
ATOM   3139  C  CB    . ILE A 1  429 ? -73.016 -15.650 11.118  1.00 177.08 ? 812  ILE A CB    1 
ATOM   3140  C  CG1   . ILE A 1  429 ? -73.619 -14.638 12.097  1.00 175.76 ? 812  ILE A CG1   1 
ATOM   3141  C  CG2   . ILE A 1  429 ? -72.230 -14.966 9.991   1.00 179.36 ? 812  ILE A CG2   1 
ATOM   3142  C  CD1   . ILE A 1  429 ? -72.615 -14.014 13.028  1.00 176.60 ? 812  ILE A CD1   1 
ATOM   3143  N  N     . GLY A 1  430 ? -73.158 -18.264 9.090   1.00 180.48 ? 813  GLY A N     1 
ATOM   3144  C  CA    . GLY A 1  430 ? -72.786 -18.891 7.841   1.00 175.98 ? 813  GLY A CA    1 
ATOM   3145  C  C     . GLY A 1  430 ? -73.801 -19.861 7.291   1.00 176.65 ? 813  GLY A C     1 
ATOM   3146  O  O     . GLY A 1  430 ? -73.539 -20.501 6.264   1.00 182.25 ? 813  GLY A O     1 
ATOM   3147  N  N     . GLU A 1  431 ? -74.944 -19.997 7.969   1.00 171.71 ? 814  GLU A N     1 
ATOM   3148  C  CA    . GLU A 1  431 ? -76.081 -20.779 7.494   1.00 174.88 ? 814  GLU A CA    1 
ATOM   3149  C  C     . GLU A 1  431 ? -75.663 -22.209 7.146   1.00 182.94 ? 814  GLU A C     1 
ATOM   3150  O  O     . GLU A 1  431 ? -76.032 -22.760 6.105   1.00 187.98 ? 814  GLU A O     1 
ATOM   3151  C  CB    . GLU A 1  431 ? -76.761 -20.073 6.319   1.00 172.30 ? 814  GLU A CB    1 
ATOM   3152  N  N     . VAL A 1  432 ? -74.868 -22.802 8.046   1.00 183.95 ? 815  VAL A N     1 
ATOM   3153  C  CA    . VAL A 1  432 ? -74.377 -24.169 7.892   1.00 178.54 ? 815  VAL A CA    1 
ATOM   3154  C  C     . VAL A 1  432 ? -75.522 -25.171 8.009   1.00 177.43 ? 815  VAL A C     1 
ATOM   3155  O  O     . VAL A 1  432 ? -75.455 -26.271 7.442   1.00 180.17 ? 815  VAL A O     1 
ATOM   3156  C  CB    . VAL A 1  432 ? -73.261 -24.440 8.922   1.00 174.23 ? 815  VAL A CB    1 
ATOM   3157  C  CG1   . VAL A 1  432 ? -72.715 -25.850 8.776   1.00 176.22 ? 815  VAL A CG1   1 
ATOM   3158  C  CG2   . VAL A 1  432 ? -72.138 -23.422 8.771   1.00 175.07 ? 815  VAL A CG2   1 
ATOM   3159  N  N     . TYR A 1  433 ? -76.592 -24.811 8.727   1.00 175.29 ? 816  TYR A N     1 
ATOM   3160  C  CA    . TYR A 1  433 ? -77.836 -25.579 8.678   1.00 175.96 ? 816  TYR A CA    1 
ATOM   3161  C  C     . TYR A 1  433 ? -78.298 -25.825 7.247   1.00 180.04 ? 816  TYR A C     1 
ATOM   3162  O  O     . TYR A 1  433 ? -79.027 -26.791 6.992   1.00 171.63 ? 816  TYR A O     1 
ATOM   3163  C  CB    . TYR A 1  433 ? -78.945 -24.837 9.445   1.00 168.47 ? 816  TYR A CB    1 
ATOM   3164  N  N     . LYS A 1  434 ? -77.875 -24.970 6.318   1.00 185.76 ? 817  LYS A N     1 
ATOM   3165  C  CA    . LYS A 1  434 ? -78.287 -24.985 4.925   1.00 183.42 ? 817  LYS A CA    1 
ATOM   3166  C  C     . LYS A 1  434 ? -77.152 -25.330 3.971   1.00 187.82 ? 817  LYS A C     1 
ATOM   3167  O  O     . LYS A 1  434 ? -77.399 -25.970 2.945   1.00 190.55 ? 817  LYS A O     1 
ATOM   3168  C  CB    . LYS A 1  434 ? -78.874 -23.611 4.570   1.00 185.95 ? 817  LYS A CB    1 
ATOM   3169  C  CG    . LYS A 1  434 ? -79.255 -23.372 3.135   1.00 196.46 ? 817  LYS A CG    1 
ATOM   3170  C  CD    . LYS A 1  434 ? -80.042 -22.066 3.031   1.00 199.90 ? 817  LYS A CD    1 
ATOM   3171  C  CE    . LYS A 1  434 ? -79.460 -21.122 1.986   1.00 200.84 ? 817  LYS A CE    1 
ATOM   3172  N  NZ    . LYS A 1  434 ? -80.390 -20.005 1.659   1.00 194.23 ? 817  LYS A NZ    1 
ATOM   3173  N  N     . HIS A 1  435 ? -75.920 -24.937 4.300   1.00 189.97 ? 818  HIS A N     1 
ATOM   3174  C  CA    . HIS A 1  435 ? -74.727 -25.269 3.514   1.00 189.01 ? 818  HIS A CA    1 
ATOM   3175  C  C     . HIS A 1  435 ? -73.791 -26.153 4.318   1.00 184.10 ? 818  HIS A C     1 
ATOM   3176  O  O     . HIS A 1  435 ? -73.220 -25.691 5.325   1.00 183.60 ? 818  HIS A O     1 
ATOM   3177  C  CB    . HIS A 1  435 ? -73.974 -24.013 3.082   1.00 186.65 ? 818  HIS A CB    1 
ATOM   3178  C  CG    . HIS A 1  435 ? -74.806 -23.047 2.312   1.00 194.90 ? 818  HIS A CG    1 
ATOM   3179  N  ND1   . HIS A 1  435 ? -75.642 -22.135 2.921   1.00 198.07 ? 818  HIS A ND1   1 
ATOM   3180  C  CD2   . HIS A 1  435 ? -74.938 -22.852 0.980   1.00 198.41 ? 818  HIS A CD2   1 
ATOM   3181  C  CE1   . HIS A 1  435 ? -76.247 -21.413 1.996   1.00 198.94 ? 818  HIS A CE1   1 
ATOM   3182  N  NE2   . HIS A 1  435 ? -75.842 -21.831 0.810   1.00 204.06 ? 818  HIS A NE2   1 
ATOM   3183  N  N     . PRO A 1  436 ? -73.573 -27.404 3.910   1.00 183.95 ? 819  PRO A N     1 
ATOM   3184  C  CA    . PRO A 1  436 ? -72.657 -28.262 4.679   1.00 187.07 ? 819  PRO A CA    1 
ATOM   3185  C  C     . PRO A 1  436 ? -71.211 -27.796 4.640   1.00 183.12 ? 819  PRO A C     1 
ATOM   3186  O  O     . PRO A 1  436 ? -70.561 -27.718 5.692   1.00 184.35 ? 819  PRO A O     1 
ATOM   3187  C  CB    . PRO A 1  436 ? -72.835 -29.639 4.022   1.00 185.45 ? 819  PRO A CB    1 
ATOM   3188  C  CG    . PRO A 1  436 ? -74.165 -29.564 3.324   1.00 184.39 ? 819  PRO A CG    1 
ATOM   3189  C  CD    . PRO A 1  436 ? -74.287 -28.148 2.860   1.00 182.17 ? 819  PRO A CD    1 
ATOM   3190  N  N     . ASN A 1  437 ? -70.682 -27.478 3.465   1.00 181.18 ? 820  ASN A N     1 
ATOM   3191  C  CA    . ASN A 1  437 ? -69.267 -27.176 3.328   1.00 183.77 ? 820  ASN A CA    1 
ATOM   3192  C  C     . ASN A 1  437 ? -69.016 -25.677 3.397   1.00 187.00 ? 820  ASN A C     1 
ATOM   3193  O  O     . ASN A 1  437 ? -69.879 -24.861 3.060   1.00 186.76 ? 820  ASN A O     1 
ATOM   3194  C  CB    . ASN A 1  437 ? -68.710 -27.717 2.013   1.00 185.40 ? 820  ASN A CB    1 
ATOM   3195  C  CG    . ASN A 1  437 ? -67.202 -27.854 2.039   1.00 184.33 ? 820  ASN A CG    1 
ATOM   3196  O  OD1   . ASN A 1  437 ? -66.563 -27.594 3.060   1.00 181.66 ? 820  ASN A OD1   1 
ATOM   3197  N  ND2   . ASN A 1  437 ? -66.626 -28.275 0.919   1.00 177.54 ? 820  ASN A ND2   1 
ATOM   3198  N  N     . ALA A 1  438 ? -67.807 -25.329 3.832   1.00 189.50 ? 821  ALA A N     1 
ATOM   3199  C  CA    . ALA A 1  438 ? -67.348 -23.949 3.839   1.00 192.13 ? 821  ALA A CA    1 
ATOM   3200  C  C     . ALA A 1  438 ? -65.830 -23.940 3.928   1.00 195.46 ? 821  ALA A C     1 
ATOM   3201  O  O     . ALA A 1  438 ? -65.244 -24.690 4.714   1.00 197.02 ? 821  ALA A O     1 
ATOM   3202  C  CB    . ALA A 1  438 ? -67.950 -23.162 5.003   1.00 190.14 ? 821  ALA A CB    1 
ATOM   3203  N  N     . SER A 1  439 ? -65.202 -23.089 3.120   1.00 195.51 ? 822  SER A N     1 
ATOM   3204  C  CA    . SER A 1  439 ? -63.756 -22.956 3.153   1.00 196.79 ? 822  SER A CA    1 
ATOM   3205  C  C     . SER A 1  439 ? -63.314 -22.310 4.466   1.00 192.62 ? 822  SER A C     1 
ATOM   3206  O  O     . SER A 1  439 ? -64.129 -21.885 5.291   1.00 188.36 ? 822  SER A O     1 
ATOM   3207  C  CB    . SER A 1  439 ? -63.266 -22.141 1.952   1.00 198.81 ? 822  SER A CB    1 
ATOM   3208  O  OG    . SER A 1  439 ? -63.988 -20.927 1.811   1.00 198.53 ? 822  SER A OG    1 
ATOM   3209  N  N     . LYS A 1  440 ? -61.995 -22.251 4.664   1.00 191.70 ? 823  LYS A N     1 
ATOM   3210  C  CA    . LYS A 1  440 ? -61.462 -21.527 5.814   1.00 192.55 ? 823  LYS A CA    1 
ATOM   3211  C  C     . LYS A 1  440 ? -61.796 -20.041 5.732   1.00 197.11 ? 823  LYS A C     1 
ATOM   3212  O  O     . LYS A 1  440 ? -62.109 -19.408 6.749   1.00 192.26 ? 823  LYS A O     1 
ATOM   3213  C  CB    . LYS A 1  440 ? -59.951 -21.726 5.912   1.00 188.66 ? 823  LYS A CB    1 
ATOM   3214  C  CG    . LYS A 1  440 ? -59.300 -20.825 6.952   1.00 192.56 ? 823  LYS A CG    1 
ATOM   3215  C  CD    . LYS A 1  440 ? -57.791 -20.990 6.996   1.00 188.67 ? 823  LYS A CD    1 
ATOM   3216  C  CE    . LYS A 1  440 ? -57.221 -20.429 8.294   1.00 196.37 ? 823  LYS A CE    1 
ATOM   3217  N  NZ    . LYS A 1  440 ? -57.747 -21.129 9.502   1.00 201.82 ? 823  LYS A NZ    1 
ATOM   3218  N  N     . GLU A 1  441 ? -61.738 -19.468 4.524   1.00 202.69 ? 824  GLU A N     1 
ATOM   3219  C  CA    . GLU A 1  441 ? -62.013 -18.042 4.356   1.00 204.44 ? 824  GLU A CA    1 
ATOM   3220  C  C     . GLU A 1  441 ? -63.450 -17.700 4.731   1.00 197.20 ? 824  GLU A C     1 
ATOM   3221  O  O     . GLU A 1  441 ? -63.706 -16.669 5.366   1.00 197.35 ? 824  GLU A O     1 
ATOM   3222  C  CB    . GLU A 1  441 ? -61.723 -17.610 2.916   1.00 206.40 ? 824  GLU A CB    1 
ATOM   3223  C  CG    . GLU A 1  441 ? -60.247 -17.392 2.594   1.00 210.81 ? 824  GLU A CG    1 
ATOM   3224  C  CD    . GLU A 1  441 ? -59.543 -18.662 2.148   1.00 216.78 ? 824  GLU A CD    1 
ATOM   3225  O  OE1   . GLU A 1  441 ? -60.175 -19.741 2.172   1.00 210.12 ? 824  GLU A OE1   1 
ATOM   3226  O  OE2   . GLU A 1  441 ? -58.356 -18.578 1.767   1.00 222.92 ? 824  GLU A OE2   1 
ATOM   3227  N  N     . GLU A 1  442 ? -64.403 -18.549 4.342   1.00 193.02 ? 825  GLU A N     1 
ATOM   3228  C  CA    . GLU A 1  442 ? -65.803 -18.276 4.650   1.00 189.88 ? 825  GLU A CA    1 
ATOM   3229  C  C     . GLU A 1  442 ? -66.038 -18.259 6.157   1.00 192.84 ? 825  GLU A C     1 
ATOM   3230  O  O     . GLU A 1  442 ? -66.704 -17.360 6.684   1.00 192.40 ? 825  GLU A O     1 
ATOM   3231  C  CB    . GLU A 1  442 ? -66.698 -19.309 3.960   1.00 189.87 ? 825  GLU A CB    1 
ATOM   3232  C  CG    . GLU A 1  442 ? -67.839 -18.702 3.155   1.00 188.09 ? 825  GLU A CG    1 
ATOM   3233  C  CD    . GLU A 1  442 ? -68.422 -19.666 2.133   1.00 191.70 ? 825  GLU A CD    1 
ATOM   3234  O  OE1   . GLU A 1  442 ? -68.198 -20.889 2.254   1.00 195.36 ? 825  GLU A OE1   1 
ATOM   3235  O  OE2   . GLU A 1  442 ? -69.103 -19.198 1.200   1.00 199.06 ? 825  GLU A OE2   1 
ATOM   3236  N  N     . ARG A 1  443 ? -65.467 -19.232 6.876   1.00 194.87 ? 826  ARG A N     1 
ATOM   3237  C  CA    . ARG A 1  443 ? -65.647 -19.288 8.326   1.00 191.94 ? 826  ARG A CA    1 
ATOM   3238  C  C     . ARG A 1  443 ? -64.932 -18.131 9.021   1.00 190.55 ? 826  ARG A C     1 
ATOM   3239  O  O     . ARG A 1  443 ? -65.440 -17.580 10.010  1.00 187.16 ? 826  ARG A O     1 
ATOM   3240  C  CB    . ARG A 1  443 ? -65.146 -20.632 8.866   1.00 192.66 ? 826  ARG A CB    1 
ATOM   3241  C  CG    . ARG A 1  443 ? -65.660 -21.856 8.107   1.00 192.29 ? 826  ARG A CG    1 
ATOM   3242  C  CD    . ARG A 1  443 ? -65.045 -23.151 8.635   1.00 192.16 ? 826  ARG A CD    1 
ATOM   3243  N  NE    . ARG A 1  443 ? -66.018 -23.958 9.366   1.00 193.59 ? 826  ARG A NE    1 
ATOM   3244  C  CZ    . ARG A 1  443 ? -66.738 -24.940 8.828   1.00 193.74 ? 826  ARG A CZ    1 
ATOM   3245  N  NH1   . ARG A 1  443 ? -66.593 -25.252 7.546   1.00 196.63 ? 826  ARG A NH1   1 
ATOM   3246  N  NH2   . ARG A 1  443 ? -67.605 -25.613 9.575   1.00 186.06 ? 826  ARG A NH2   1 
ATOM   3247  N  N     . LYS A 1  444 ? -63.749 -17.754 8.521   1.00 191.60 ? 827  LYS A N     1 
ATOM   3248  C  CA    . LYS A 1  444 ? -63.036 -16.606 9.075   1.00 189.80 ? 827  LYS A CA    1 
ATOM   3249  C  C     . LYS A 1  444 ? -63.839 -15.323 8.905   1.00 186.63 ? 827  LYS A C     1 
ATOM   3250  O  O     . LYS A 1  444 ? -63.876 -14.482 9.811   1.00 176.85 ? 827  LYS A O     1 
ATOM   3251  C  CB    . LYS A 1  444 ? -61.665 -16.465 8.411   1.00 192.82 ? 827  LYS A CB    1 
ATOM   3252  C  CG    . LYS A 1  444 ? -60.647 -17.535 8.788   1.00 190.94 ? 827  LYS A CG    1 
ATOM   3253  C  CD    . LYS A 1  444 ? -59.335 -17.318 8.048   1.00 195.30 ? 827  LYS A CD    1 
ATOM   3254  C  CE    . LYS A 1  444 ? -58.780 -15.927 8.311   1.00 198.28 ? 827  LYS A CE    1 
ATOM   3255  N  NZ    . LYS A 1  444 ? -57.510 -15.693 7.574   1.00 205.80 ? 827  LYS A NZ    1 
ATOM   3256  N  N     . ARG A 1  445 ? -64.492 -15.154 7.747   1.00 193.22 ? 828  ARG A N     1 
ATOM   3257  C  CA    . ARG A 1  445 ? -65.336 -13.980 7.540   1.00 191.72 ? 828  ARG A CA    1 
ATOM   3258  C  C     . ARG A 1  445 ? -66.595 -14.030 8.400   1.00 188.87 ? 828  ARG A C     1 
ATOM   3259  O  O     . ARG A 1  445 ? -67.069 -12.983 8.855   1.00 187.70 ? 828  ARG A O     1 
ATOM   3260  C  CB    . ARG A 1  445 ? -65.702 -13.835 6.059   1.00 190.74 ? 828  ARG A CB    1 
ATOM   3261  C  CG    . ARG A 1  445 ? -64.637 -13.123 5.231   1.00 190.29 ? 828  ARG A CG    1 
ATOM   3262  C  CD    . ARG A 1  445 ? -65.193 -12.605 3.913   1.00 187.62 ? 828  ARG A CD    1 
ATOM   3263  N  NE    . ARG A 1  445 ? -65.655 -13.688 3.052   1.00 189.15 ? 828  ARG A NE    1 
ATOM   3264  C  CZ    . ARG A 1  445 ? -64.859 -14.410 2.270   1.00 188.63 ? 828  ARG A CZ    1 
ATOM   3265  N  NH1   . ARG A 1  445 ? -63.555 -14.170 2.244   1.00 182.26 ? 828  ARG A NH1   1 
ATOM   3266  N  NH2   . ARG A 1  445 ? -65.367 -15.376 1.517   1.00 187.28 ? 828  ARG A NH2   1 
ATOM   3267  N  N     . TRP A 1  446 ? -67.144 -15.228 8.634   1.00 186.67 ? 829  TRP A N     1 
ATOM   3268  C  CA    . TRP A 1  446 ? -68.246 -15.381 9.586   1.00 183.05 ? 829  TRP A CA    1 
ATOM   3269  C  C     . TRP A 1  446 ? -67.845 -14.889 10.972  1.00 184.00 ? 829  TRP A C     1 
ATOM   3270  O  O     . TRP A 1  446 ? -68.582 -14.131 11.622  1.00 177.13 ? 829  TRP A O     1 
ATOM   3271  C  CB    . TRP A 1  446 ? -68.668 -16.846 9.681   1.00 184.41 ? 829  TRP A CB    1 
ATOM   3272  C  CG    . TRP A 1  446 ? -69.134 -17.478 8.422   1.00 184.62 ? 829  TRP A CG    1 
ATOM   3273  C  CD1   . TRP A 1  446 ? -69.514 -16.854 7.273   1.00 185.21 ? 829  TRP A CD1   1 
ATOM   3274  C  CD2   . TRP A 1  446 ? -69.274 -18.882 8.183   1.00 186.28 ? 829  TRP A CD2   1 
ATOM   3275  N  NE1   . TRP A 1  446 ? -69.879 -17.784 6.330   1.00 185.95 ? 829  TRP A NE1   1 
ATOM   3276  C  CE2   . TRP A 1  446 ? -69.735 -19.037 6.864   1.00 185.63 ? 829  TRP A CE2   1 
ATOM   3277  C  CE3   . TRP A 1  446 ? -69.050 -20.025 8.959   1.00 183.98 ? 829  TRP A CE3   1 
ATOM   3278  C  CZ2   . TRP A 1  446 ? -69.986 -20.285 6.305   1.00 185.01 ? 829  TRP A CZ2   1 
ATOM   3279  C  CZ3   . TRP A 1  446 ? -69.293 -21.261 8.400   1.00 182.70 ? 829  TRP A CZ3   1 
ATOM   3280  C  CH2   . TRP A 1  446 ? -69.762 -21.381 7.091   1.00 181.76 ? 829  TRP A CH2   1 
ATOM   3281  N  N     . GLN A 1  447 ? -66.685 -15.350 11.456  1.00 185.05 ? 830  GLN A N     1 
ATOM   3282  C  CA    . GLN A 1  447 ? -66.212 -14.938 12.775  1.00 186.39 ? 830  GLN A CA    1 
ATOM   3283  C  C     . GLN A 1  447 ? -65.910 -13.442 12.816  1.00 186.43 ? 830  GLN A C     1 
ATOM   3284  O  O     . GLN A 1  447 ? -66.187 -12.776 13.820  1.00 182.90 ? 830  GLN A O     1 
ATOM   3285  C  CB    . GLN A 1  447 ? -64.977 -15.747 13.183  1.00 186.79 ? 830  GLN A CB    1 
ATOM   3286  C  CG    . GLN A 1  447 ? -64.432 -15.353 14.564  1.00 187.43 ? 830  GLN A CG    1 
ATOM   3287  C  CD    . GLN A 1  447 ? -63.213 -16.153 14.998  1.00 187.60 ? 830  GLN A CD    1 
ATOM   3288  O  OE1   . GLN A 1  447 ? -63.336 -17.166 15.688  1.00 185.65 ? 830  GLN A OE1   1 
ATOM   3289  N  NE2   . GLN A 1  447 ? -62.027 -15.685 14.615  1.00 186.49 ? 830  GLN A NE2   1 
ATOM   3290  N  N     . ALA A 1  448 ? -65.334 -12.895 11.740  1.00 184.47 ? 831  ALA A N     1 
ATOM   3291  C  CA    . ALA A 1  448 ? -65.086 -11.457 11.690  1.00 179.36 ? 831  ALA A CA    1 
ATOM   3292  C  C     . ALA A 1  448 ? -66.390 -10.671 11.756  1.00 179.43 ? 831  ALA A C     1 
ATOM   3293  O  O     . ALA A 1  448 ? -66.484 -9.667  12.472  1.00 175.10 ? 831  ALA A O     1 
ATOM   3294  C  CB    . ALA A 1  448 ? -64.307 -11.101 10.425  1.00 180.06 ? 831  ALA A CB    1 
ATOM   3295  N  N     . THR A 1  449 ? -67.404 -11.113 11.006  1.00 178.98 ? 832  THR A N     1 
ATOM   3296  C  CA    . THR A 1  449 ? -68.729 -10.506 11.080  1.00 176.24 ? 832  THR A CA    1 
ATOM   3297  C  C     . THR A 1  449 ? -69.261 -10.522 12.511  1.00 182.32 ? 832  THR A C     1 
ATOM   3298  O  O     . THR A 1  449 ? -69.703 -9.490  13.031  1.00 179.37 ? 832  THR A O     1 
ATOM   3299  C  CB    . THR A 1  449 ? -69.683 -11.241 10.130  1.00 172.39 ? 832  THR A CB    1 
ATOM   3300  O  OG1   . THR A 1  449 ? -69.162 -11.197 8.797   1.00 171.62 ? 832  THR A OG1   1 
ATOM   3301  C  CG2   . THR A 1  449 ? -71.063 -10.608 10.141  1.00 169.68 ? 832  THR A CG2   1 
ATOM   3302  N  N     . LEU A 1  450 ? -69.210 -11.687 13.172  1.00 184.71 ? 833  LEU A N     1 
ATOM   3303  C  CA    . LEU A 1  450 ? -69.748 -11.786 14.531  1.00 182.05 ? 833  LEU A CA    1 
ATOM   3304  C  C     . LEU A 1  450 ? -68.989 -10.888 15.505  1.00 180.37 ? 833  LEU A C     1 
ATOM   3305  O  O     . LEU A 1  450 ? -69.601 -10.217 16.345  1.00 178.56 ? 833  LEU A O     1 
ATOM   3306  C  CB    . LEU A 1  450 ? -69.715 -13.235 15.023  1.00 183.05 ? 833  LEU A CB    1 
ATOM   3307  C  CG    . LEU A 1  450 ? -70.063 -13.426 16.507  1.00 176.24 ? 833  LEU A CG    1 
ATOM   3308  C  CD1   . LEU A 1  450 ? -71.488 -12.970 16.799  1.00 168.22 ? 833  LEU A CD1   1 
ATOM   3309  C  CD2   . LEU A 1  450 ? -69.852 -14.870 16.953  1.00 169.82 ? 833  LEU A CD2   1 
ATOM   3310  N  N     . ASP A 1  451 ? -67.657 -10.866 15.413  1.00 182.95 ? 834  ASP A N     1 
ATOM   3311  C  CA    . ASP A 1  451 ? -66.852 -10.073 16.340  1.00 185.02 ? 834  ASP A CA    1 
ATOM   3312  C  C     . ASP A 1  451 ? -67.081 -8.579  16.129  1.00 185.39 ? 834  ASP A C     1 
ATOM   3313  O  O     . ASP A 1  451 ? -67.232 -7.817  17.095  1.00 177.79 ? 834  ASP A O     1 
ATOM   3314  C  CB    . ASP A 1  451 ? -65.372 -10.425 16.178  1.00 184.16 ? 834  ASP A CB    1 
ATOM   3315  C  CG    . ASP A 1  451 ? -65.073 -11.881 16.509  1.00 187.32 ? 834  ASP A CG    1 
ATOM   3316  O  OD1   . ASP A 1  451 ? -65.835 -12.488 17.293  1.00 188.81 ? 834  ASP A OD1   1 
ATOM   3317  O  OD2   . ASP A 1  451 ? -64.070 -12.419 15.989  1.00 189.77 ? 834  ASP A OD2   1 
ATOM   3318  N  N     . LYS A 1  452 ? -67.105 -8.142  14.863  1.00 187.13 ? 835  LYS A N     1 
ATOM   3319  C  CA    . LYS A 1  452 ? -67.433 -6.753  14.552  1.00 185.20 ? 835  LYS A CA    1 
ATOM   3320  C  C     . LYS A 1  452 ? -68.806 -6.369  15.090  1.00 181.47 ? 835  LYS A C     1 
ATOM   3321  O  O     . LYS A 1  452 ? -68.967 -5.300  15.689  1.00 174.18 ? 835  LYS A O     1 
ATOM   3322  C  CB    . LYS A 1  452 ? -67.383 -6.530  13.038  1.00 179.68 ? 835  LYS A CB    1 
ATOM   3323  C  CG    . LYS A 1  452 ? -66.109 -5.898  12.511  1.00 175.39 ? 835  LYS A CG    1 
ATOM   3324  C  CD    . LYS A 1  452 ? -66.233 -5.626  11.020  1.00 170.15 ? 835  LYS A CD    1 
ATOM   3325  C  CE    . LYS A 1  452 ? -64.966 -5.013  10.462  1.00 168.64 ? 835  LYS A CE    1 
ATOM   3326  N  NZ    . LYS A 1  452 ? -64.958 -5.040  8.975   1.00 167.70 ? 835  LYS A NZ    1 
ATOM   3327  N  N     . HIS A 1  453 ? -69.812 -7.227  14.883  1.00 183.12 ? 836  HIS A N     1 
ATOM   3328  C  CA    . HIS A 1  453 ? -71.174 -6.893  15.291  1.00 179.75 ? 836  HIS A CA    1 
ATOM   3329  C  C     . HIS A 1  453 ? -71.328 -6.872  16.809  1.00 181.16 ? 836  HIS A C     1 
ATOM   3330  O  O     . HIS A 1  453 ? -72.088 -6.051  17.340  1.00 178.36 ? 836  HIS A O     1 
ATOM   3331  C  CB    . HIS A 1  453 ? -72.157 -7.881  14.659  1.00 178.88 ? 836  HIS A CB    1 
ATOM   3332  C  CG    . HIS A 1  453 ? -73.581 -7.416  14.677  1.00 177.73 ? 836  HIS A CG    1 
ATOM   3333  N  ND1   . HIS A 1  453 ? -74.617 -8.198  15.143  1.00 175.25 ? 836  HIS A ND1   1 
ATOM   3334  C  CD2   . HIS A 1  453 ? -74.139 -6.247  14.287  1.00 178.47 ? 836  HIS A CD2   1 
ATOM   3335  C  CE1   . HIS A 1  453 ? -75.751 -7.529  15.038  1.00 169.49 ? 836  HIS A CE1   1 
ATOM   3336  N  NE2   . HIS A 1  453 ? -75.489 -6.342  14.523  1.00 174.56 ? 836  HIS A NE2   1 
ATOM   3337  N  N     . LEU A 1  454 ? -70.627 -7.760  17.523  1.00 183.35 ? 837  LEU A N     1 
ATOM   3338  C  CA    . LEU A 1  454 ? -70.647 -7.705  18.982  1.00 181.96 ? 837  LEU A CA    1 
ATOM   3339  C  C     . LEU A 1  454 ? -69.934 -6.459  19.491  1.00 185.56 ? 837  LEU A C     1 
ATOM   3340  O  O     . LEU A 1  454 ? -70.392 -5.827  20.449  1.00 182.48 ? 837  LEU A O     1 
ATOM   3341  C  CB    . LEU A 1  454 ? -70.018 -8.964  19.579  1.00 182.90 ? 837  LEU A CB    1 
ATOM   3342  C  CG    . LEU A 1  454 ? -70.787 -10.276 19.407  1.00 181.60 ? 837  LEU A CG    1 
ATOM   3343  C  CD1   . LEU A 1  454 ? -69.950 -11.461 19.881  1.00 182.12 ? 837  LEU A CD1   1 
ATOM   3344  C  CD2   . LEU A 1  454 ? -72.123 -10.221 20.138  1.00 170.81 ? 837  LEU A CD2   1 
ATOM   3345  N  N     . ARG A 1  455 ? -68.808 -6.089  18.864  1.00 187.39 ? 838  ARG A N     1 
ATOM   3346  C  CA    . ARG A 1  455 ? -68.123 -4.853  19.241  1.00 190.53 ? 838  ARG A CA    1 
ATOM   3347  C  C     . ARG A 1  455 ? -68.982 -3.624  18.956  1.00 188.38 ? 838  ARG A C     1 
ATOM   3348  O  O     . ARG A 1  455 ? -68.906 -2.628  19.687  1.00 184.06 ? 838  ARG A O     1 
ATOM   3349  C  CB    . ARG A 1  455 ? -66.782 -4.747  18.504  1.00 187.06 ? 838  ARG A CB    1 
ATOM   3350  C  CG    . ARG A 1  455 ? -65.973 -3.480  18.823  1.00 178.52 ? 838  ARG A CG    1 
ATOM   3351  C  CD    . ARG A 1  455 ? -64.828 -3.270  17.836  1.00 174.57 ? 838  ARG A CD    1 
ATOM   3352  N  NE    . ARG A 1  455 ? -63.726 -4.203  18.054  1.00 177.21 ? 838  ARG A NE    1 
ATOM   3353  C  CZ    . ARG A 1  455 ? -62.947 -4.681  17.087  1.00 182.41 ? 838  ARG A CZ    1 
ATOM   3354  N  NH1   . ARG A 1  455 ? -63.154 -4.329  15.824  1.00 187.07 ? 838  ARG A NH1   1 
ATOM   3355  N  NH2   . ARG A 1  455 ? -61.968 -5.525  17.380  1.00 178.14 ? 838  ARG A NH2   1 
ATOM   3356  N  N     . LYS A 1  456 ? -69.812 -3.681  17.911  1.00 188.44 ? 839  LYS A N     1 
ATOM   3357  C  CA    . LYS A 1  456 ? -70.623 -2.531  17.521  1.00 180.55 ? 839  LYS A CA    1 
ATOM   3358  C  C     . LYS A 1  456 ? -71.853 -2.377  18.412  1.00 180.26 ? 839  LYS A C     1 
ATOM   3359  O  O     . LYS A 1  456 ? -72.060 -1.321  19.017  1.00 186.16 ? 839  LYS A O     1 
ATOM   3360  C  CB    . LYS A 1  456 ? -71.031 -2.657  16.050  1.00 180.48 ? 839  LYS A CB    1 
ATOM   3361  C  CG    . LYS A 1  456 ? -72.011 -1.595  15.566  1.00 174.77 ? 839  LYS A CG    1 
ATOM   3362  C  CD    . LYS A 1  456 ? -71.989 -1.466  14.041  1.00 179.90 ? 839  LYS A CD    1 
ATOM   3363  C  CE    . LYS A 1  456 ? -70.911 -0.486  13.578  1.00 177.78 ? 839  LYS A CE    1 
ATOM   3364  N  NZ    . LYS A 1  456 ? -70.892 -0.290  12.098  1.00 165.09 ? 839  LYS A NZ    1 
ATOM   3365  N  N     . ARG A 1  457 ? -72.684 -3.419  18.506  1.00 180.93 ? 840  ARG A N     1 
ATOM   3366  C  CA    . ARG A 1  457 ? -73.954 -3.289  19.216  1.00 177.16 ? 840  ARG A CA    1 
ATOM   3367  C  C     . ARG A 1  457 ? -73.875 -3.669  20.691  1.00 178.99 ? 840  ARG A C     1 
ATOM   3368  O  O     . ARG A 1  457 ? -74.653 -3.141  21.495  1.00 171.57 ? 840  ARG A O     1 
ATOM   3369  C  CB    . ARG A 1  457 ? -75.031 -4.137  18.535  1.00 171.95 ? 840  ARG A CB    1 
ATOM   3370  C  CG    . ARG A 1  457 ? -75.228 -3.809  17.070  1.00 171.43 ? 840  ARG A CG    1 
ATOM   3371  C  CD    . ARG A 1  457 ? -76.695 -3.809  16.687  1.00 165.82 ? 840  ARG A CD    1 
ATOM   3372  N  NE    . ARG A 1  457 ? -77.261 -2.463  16.614  1.00 172.55 ? 840  ARG A NE    1 
ATOM   3373  C  CZ    . ARG A 1  457 ? -78.285 -2.038  17.346  1.00 166.44 ? 840  ARG A CZ    1 
ATOM   3374  N  NH1   . ARG A 1  457 ? -78.865 -2.858  18.208  1.00 158.02 ? 840  ARG A NH1   1 
ATOM   3375  N  NH2   . ARG A 1  457 ? -78.732 -0.797  17.207  1.00 164.28 ? 840  ARG A NH2   1 
ATOM   3376  N  N     . MET A 1  458 ? -72.967 -4.570  21.067  1.00 186.09 ? 841  MET A N     1 
ATOM   3377  C  CA    . MET A 1  458 ? -72.849 -5.035  22.444  1.00 185.72 ? 841  MET A CA    1 
ATOM   3378  C  C     . MET A 1  458 ? -71.604 -4.515  23.150  1.00 187.10 ? 841  MET A C     1 
ATOM   3379  O  O     . MET A 1  458 ? -71.403 -4.828  24.331  1.00 181.63 ? 841  MET A O     1 
ATOM   3380  C  CB    . MET A 1  458 ? -72.854 -6.569  22.493  1.00 185.89 ? 841  MET A CB    1 
ATOM   3381  C  CG    . MET A 1  458 ? -74.152 -7.210  22.030  1.00 187.11 ? 841  MET A CG    1 
ATOM   3382  S  SD    . MET A 1  458 ? -75.565 -6.712  23.030  1.00 227.62 ? 841  MET A SD    1 
ATOM   3383  C  CE    . MET A 1  458 ? -75.011 -7.187  24.668  1.00 177.45 ? 841  MET A CE    1 
ATOM   3384  N  N     . ASN A 1  459 ? -70.760 -3.745  22.459  1.00 190.54 ? 842  ASN A N     1 
ATOM   3385  C  CA    . ASN A 1  459 ? -69.539 -3.176  23.037  1.00 195.75 ? 842  ASN A CA    1 
ATOM   3386  C  C     . ASN A 1  459 ? -68.612 -4.268  23.574  1.00 194.60 ? 842  ASN A C     1 
ATOM   3387  O  O     . ASN A 1  459 ? -67.927 -4.080  24.585  1.00 194.49 ? 842  ASN A O     1 
ATOM   3388  C  CB    . ASN A 1  459 ? -69.877 -2.150  24.129  1.00 195.69 ? 842  ASN A CB    1 
ATOM   3389  C  CG    . ASN A 1  459 ? -68.723 -1.204  24.434  1.00 197.09 ? 842  ASN A CG    1 
ATOM   3390  O  OD1   . ASN A 1  459 ? -67.831 -1.001  23.610  1.00 199.56 ? 842  ASN A OD1   1 
ATOM   3391  N  ND2   . ASN A 1  459 ? -68.742 -0.616  25.626  1.00 195.94 ? 842  ASN A ND2   1 
ATOM   3392  N  N     . LEU A 1  460 ? -68.574 -5.415  22.892  1.00 190.63 ? 843  LEU A N     1 
ATOM   3393  C  CA    . LEU A 1  460 ? -67.822 -6.581  23.344  1.00 184.54 ? 843  LEU A CA    1 
ATOM   3394  C  C     . LEU A 1  460 ? -66.521 -6.687  22.555  1.00 181.86 ? 843  LEU A C     1 
ATOM   3395  O  O     . LEU A 1  460 ? -66.537 -6.935  21.344  1.00 180.96 ? 843  LEU A O     1 
ATOM   3396  C  CB    . LEU A 1  460 ? -68.653 -7.853  23.193  1.00 183.55 ? 843  LEU A CB    1 
ATOM   3397  C  CG    . LEU A 1  460 ? -69.869 -7.964  24.117  1.00 189.29 ? 843  LEU A CG    1 
ATOM   3398  C  CD1   . LEU A 1  460 ? -70.456 -9.368  24.088  1.00 184.52 ? 843  LEU A CD1   1 
ATOM   3399  C  CD2   . LEU A 1  460 ? -69.509 -7.564  25.538  1.00 184.27 ? 843  LEU A CD2   1 
ATOM   3400  N  N     . LYS A 1  461 ? -65.402 -6.510  23.252  1.00 180.75 ? 844  LYS A N     1 
ATOM   3401  C  CA    . LYS A 1  461 ? -64.097 -6.713  22.646  1.00 180.47 ? 844  LYS A CA    1 
ATOM   3402  C  C     . LYS A 1  461 ? -63.982 -8.148  22.139  1.00 180.83 ? 844  LYS A C     1 
ATOM   3403  O  O     . LYS A 1  461 ? -64.482 -9.076  22.786  1.00 182.48 ? 844  LYS A O     1 
ATOM   3404  C  CB    . LYS A 1  461 ? -62.987 -6.433  23.664  1.00 180.71 ? 844  LYS A CB    1 
ATOM   3405  C  CG    . LYS A 1  461 ? -63.113 -7.250  24.947  1.00 186.85 ? 844  LYS A CG    1 
ATOM   3406  C  CD    . LYS A 1  461 ? -61.768 -7.464  25.627  1.00 190.58 ? 844  LYS A CD    1 
ATOM   3407  C  CE    . LYS A 1  461 ? -61.913 -8.403  26.820  1.00 192.95 ? 844  LYS A CE    1 
ATOM   3408  N  NZ    . LYS A 1  461 ? -60.620 -8.684  27.505  1.00 190.15 ? 844  LYS A NZ    1 
ATOM   3409  N  N     . PRO A 1  462 ? -63.356 -8.372  20.988  1.00 182.61 ? 845  PRO A N     1 
ATOM   3410  C  CA    . PRO A 1  462 ? -63.040 -9.746  20.594  1.00 182.42 ? 845  PRO A CA    1 
ATOM   3411  C  C     . PRO A 1  462 ? -61.905 -10.284 21.447  1.00 184.25 ? 845  PRO A C     1 
ATOM   3412  O  O     . PRO A 1  462 ? -61.058 -9.533  21.937  1.00 185.97 ? 845  PRO A O     1 
ATOM   3413  C  CB    . PRO A 1  462 ? -62.618 -9.608  19.128  1.00 182.16 ? 845  PRO A CB    1 
ATOM   3414  C  CG    . PRO A 1  462 ? -62.047 -8.239  19.055  1.00 184.32 ? 845  PRO A CG    1 
ATOM   3415  C  CD    . PRO A 1  462 ? -62.881 -7.395  19.993  1.00 184.28 ? 845  PRO A CD    1 
ATOM   3416  N  N     . ILE A 1  463 ? -61.891 -11.601 21.622  1.00 185.07 ? 846  ILE A N     1 
ATOM   3417  C  CA    . ILE A 1  463 ? -60.854 -12.267 22.400  1.00 183.91 ? 846  ILE A CA    1 
ATOM   3418  C  C     . ILE A 1  463 ? -60.337 -13.460 21.607  1.00 182.14 ? 846  ILE A C     1 
ATOM   3419  O  O     . ILE A 1  463 ? -61.112 -14.174 20.963  1.00 179.70 ? 846  ILE A O     1 
ATOM   3420  C  CB    . ILE A 1  463 ? -61.384 -12.717 23.773  1.00 183.58 ? 846  ILE A CB    1 
ATOM   3421  C  CG1   . ILE A 1  463 ? -62.652 -13.535 23.583  1.00 181.52 ? 846  ILE A CG1   1 
ATOM   3422  C  CG2   . ILE A 1  463 ? -61.689 -11.517 24.654  1.00 179.85 ? 846  ILE A CG2   1 
ATOM   3423  C  CD1   . ILE A 1  463 ? -62.920 -14.469 24.718  1.00 178.81 ? 846  ILE A CD1   1 
ATOM   3424  N  N     . MET A 1  464 ? -59.023 -13.678 21.658  1.00 187.74 ? 847  MET A N     1 
ATOM   3425  C  CA    . MET A 1  464 ? -58.394 -14.834 21.025  1.00 188.09 ? 847  MET A CA    1 
ATOM   3426  C  C     . MET A 1  464 ? -58.323 -16.053 21.931  1.00 184.80 ? 847  MET A C     1 
ATOM   3427  O  O     . MET A 1  464 ? -57.823 -17.097 21.512  1.00 179.74 ? 847  MET A O     1 
ATOM   3428  C  CB    . MET A 1  464 ? -56.972 -14.499 20.566  1.00 188.42 ? 847  MET A CB    1 
ATOM   3429  C  CG    . MET A 1  464 ? -56.879 -13.335 19.589  1.00 190.09 ? 847  MET A CG    1 
ATOM   3430  S  SD    . MET A 1  464 ? -55.213 -12.901 19.028  1.00 204.06 ? 847  MET A SD    1 
ATOM   3431  C  CE    . MET A 1  464 ? -54.764 -14.389 18.144  1.00 180.91 ? 847  MET A CE    1 
ATOM   3432  N  N     . ARG A 1  465 ? -58.771 -15.927 23.165  1.00 186.92 ? 848  ARG A N     1 
ATOM   3433  C  CA    . ARG A 1  465 ? -58.636 -16.983 24.137  1.00 182.86 ? 848  ARG A CA    1 
ATOM   3434  C  C     . ARG A 1  465 ? -59.868 -16.976 25.012  1.00 177.42 ? 848  ARG A C     1 
ATOM   3435  O  O     . ARG A 1  465 ? -60.304 -15.916 25.471  1.00 182.33 ? 848  ARG A O     1 
ATOM   3436  C  CB    . ARG A 1  465 ? -57.382 -16.800 24.998  1.00 192.27 ? 848  ARG A CB    1 
ATOM   3437  C  CG    . ARG A 1  465 ? -57.296 -17.676 26.263  1.00 193.18 ? 848  ARG A CG    1 
ATOM   3438  C  CD    . ARG A 1  465 ? -56.080 -17.305 27.157  1.00 199.43 ? 848  ARG A CD    1 
ATOM   3439  N  NE    . ARG A 1  465 ? -55.904 -18.220 28.285  1.00 199.47 ? 848  ARG A NE    1 
ATOM   3440  C  CZ    . ARG A 1  465 ? -56.554 -18.119 29.440  1.00 197.28 ? 848  ARG A CZ    1 
ATOM   3441  N  NH1   . ARG A 1  465 ? -57.432 -17.143 29.628  1.00 201.98 ? 848  ARG A NH1   1 
ATOM   3442  N  NH2   . ARG A 1  465 ? -56.321 -18.993 30.409  1.00 186.54 ? 848  ARG A NH2   1 
ATOM   3443  N  N     . MET A 1  466 ? -60.396 -18.176 25.277  1.00 174.54 ? 849  MET A N     1 
ATOM   3444  C  CA    . MET A 1  466 ? -61.589 -18.286 26.105  1.00 177.70 ? 849  MET A CA    1 
ATOM   3445  C  C     . MET A 1  466 ? -61.278 -17.794 27.498  1.00 174.45 ? 849  MET A C     1 
ATOM   3446  O  O     . MET A 1  466 ? -60.133 -17.866 27.941  1.00 178.02 ? 849  MET A O     1 
ATOM   3447  C  CB    . MET A 1  466 ? -62.062 -19.723 26.172  1.00 180.18 ? 849  MET A CB    1 
ATOM   3448  C  CG    . MET A 1  466 ? -63.568 -19.879 26.025  1.00 173.63 ? 849  MET A CG    1 
ATOM   3449  S  SD    . MET A 1  466 ? -64.477 -18.412 26.584  1.00 187.49 ? 849  MET A SD    1 
ATOM   3450  C  CE    . MET A 1  466 ? -65.784 -18.268 25.360  1.00 156.62 ? 849  MET A CE    1 
ATOM   3451  N  N     . ASN A 1  467 ? -62.300 -17.274 28.175  1.00 166.28 ? 850  ASN A N     1 
ATOM   3452  C  CA    . ASN A 1  467 ? -62.145 -16.632 29.477  1.00 163.75 ? 850  ASN A CA    1 
ATOM   3453  C  C     . ASN A 1  467 ? -63.523 -16.418 30.101  1.00 152.45 ? 850  ASN A C     1 
ATOM   3454  O  O     . ASN A 1  467 ? -64.552 -16.539 29.433  1.00 152.22 ? 850  ASN A O     1 
ATOM   3455  C  CB    . ASN A 1  467 ? -61.381 -15.314 29.338  1.00 168.67 ? 850  ASN A CB    1 
ATOM   3456  C  CG    . ASN A 1  467 ? -62.243 -14.111 29.634  1.00 171.15 ? 850  ASN A CG    1 
ATOM   3457  O  OD1   . ASN A 1  467 ? -62.899 -13.568 28.747  1.00 170.64 ? 850  ASN A OD1   1 
ATOM   3458  N  ND2   . ASN A 1  467 ? -62.265 -13.698 30.900  1.00 172.39 ? 850  ASN A ND2   1 
ATOM   3459  N  N     . GLY A 1  468 ? -63.525 -16.064 31.390  1.00 143.95 ? 851  GLY A N     1 
ATOM   3460  C  CA    . GLY A 1  468 ? -64.760 -16.100 32.165  1.00 152.52 ? 851  GLY A CA    1 
ATOM   3461  C  C     . GLY A 1  468 ? -65.740 -14.987 31.833  1.00 161.77 ? 851  GLY A C     1 
ATOM   3462  O  O     . GLY A 1  468 ? -66.929 -15.237 31.617  1.00 165.69 ? 851  GLY A O     1 
ATOM   3463  N  N     . ASN A 1  469 ? -65.269 -13.739 31.816  1.00 168.30 ? 852  ASN A N     1 
ATOM   3464  C  CA    . ASN A 1  469 ? -66.204 -12.619 31.727  1.00 165.90 ? 852  ASN A CA    1 
ATOM   3465  C  C     . ASN A 1  469 ? -66.694 -12.377 30.302  1.00 159.49 ? 852  ASN A C     1 
ATOM   3466  O  O     . ASN A 1  469 ? -67.773 -11.807 30.121  1.00 153.44 ? 852  ASN A O     1 
ATOM   3467  C  CB    . ASN A 1  469 ? -65.571 -11.353 32.309  1.00 169.52 ? 852  ASN A CB    1 
ATOM   3468  C  CG    . ASN A 1  469 ? -64.353 -10.896 31.530  1.00 179.42 ? 852  ASN A CG    1 
ATOM   3469  O  OD1   . ASN A 1  469 ? -63.812 -11.639 30.708  1.00 180.78 ? 852  ASN A OD1   1 
ATOM   3470  N  ND2   . ASN A 1  469 ? -63.909 -9.668  31.790  1.00 176.80 ? 852  ASN A ND2   1 
ATOM   3471  N  N     . PHE A 1  470 ? -65.931 -12.798 29.287  1.00 157.71 ? 853  PHE A N     1 
ATOM   3472  C  CA    . PHE A 1  470 ? -66.487 -12.887 27.938  1.00 159.24 ? 853  PHE A CA    1 
ATOM   3473  C  C     . PHE A 1  470 ? -67.708 -13.793 27.928  1.00 163.15 ? 853  PHE A C     1 
ATOM   3474  O  O     . PHE A 1  470 ? -68.744 -13.460 27.343  1.00 156.96 ? 853  PHE A O     1 
ATOM   3475  C  CB    . PHE A 1  470 ? -65.434 -13.412 26.959  1.00 163.05 ? 853  PHE A CB    1 
ATOM   3476  C  CG    . PHE A 1  470 ? -65.926 -13.547 25.535  1.00 164.39 ? 853  PHE A CG    1 
ATOM   3477  C  CD1   . PHE A 1  470 ? -65.860 -12.477 24.666  1.00 165.38 ? 853  PHE A CD1   1 
ATOM   3478  C  CD2   . PHE A 1  470 ? -66.421 -14.754 25.059  1.00 169.70 ? 853  PHE A CD2   1 
ATOM   3479  C  CE1   . PHE A 1  470 ? -66.296 -12.595 23.358  1.00 167.07 ? 853  PHE A CE1   1 
ATOM   3480  C  CE2   . PHE A 1  470 ? -66.857 -14.875 23.748  1.00 165.07 ? 853  PHE A CE2   1 
ATOM   3481  C  CZ    . PHE A 1  470 ? -66.796 -13.796 22.900  1.00 166.30 ? 853  PHE A CZ    1 
ATOM   3482  N  N     . ALA A 1  471 ? -67.593 -14.958 28.569  1.00 165.55 ? 854  ALA A N     1 
ATOM   3483  C  CA    . ALA A 1  471 ? -68.742 -15.836 28.741  1.00 159.00 ? 854  ALA A CA    1 
ATOM   3484  C  C     . ALA A 1  471 ? -69.879 -15.114 29.455  1.00 152.00 ? 854  ALA A C     1 
ATOM   3485  O  O     . ALA A 1  471 ? -71.024 -15.122 28.990  1.00 154.34 ? 854  ALA A O     1 
ATOM   3486  C  CB    . ALA A 1  471 ? -68.322 -17.087 29.513  1.00 156.56 ? 854  ALA A CB    1 
ATOM   3487  N  N     . ARG A 1  472 ? -69.574 -14.474 30.585  1.00 152.87 ? 855  ARG A N     1 
ATOM   3488  C  CA    . ARG A 1  472 ? -70.615 -13.814 31.367  1.00 158.53 ? 855  ARG A CA    1 
ATOM   3489  C  C     . ARG A 1  472 ? -71.343 -12.747 30.555  1.00 155.11 ? 855  ARG A C     1 
ATOM   3490  O  O     . ARG A 1  472 ? -72.576 -12.663 30.594  1.00 152.12 ? 855  ARG A O     1 
ATOM   3491  C  CB    . ARG A 1  472 ? -70.010 -13.218 32.635  1.00 166.75 ? 855  ARG A CB    1 
ATOM   3492  C  CG    . ARG A 1  472 ? -69.541 -14.275 33.621  1.00 167.24 ? 855  ARG A CG    1 
ATOM   3493  C  CD    . ARG A 1  472 ? -68.806 -13.664 34.792  1.00 175.34 ? 855  ARG A CD    1 
ATOM   3494  N  NE    . ARG A 1  472 ? -69.623 -12.689 35.508  1.00 185.57 ? 855  ARG A NE    1 
ATOM   3495  C  CZ    . ARG A 1  472 ? -70.332 -12.955 36.601  1.00 185.33 ? 855  ARG A CZ    1 
ATOM   3496  N  NH1   . ARG A 1  472 ? -70.332 -14.178 37.122  1.00 174.54 ? 855  ARG A NH1   1 
ATOM   3497  N  NH2   . ARG A 1  472 ? -71.038 -11.990 37.177  1.00 187.74 ? 855  ARG A NH2   1 
ATOM   3498  N  N     . LYS A 1  473 ? -70.605 -11.933 29.805  1.00 153.11 ? 856  LYS A N     1 
ATOM   3499  C  CA    . LYS A 1  473 ? -71.226 -10.881 29.011  1.00 155.99 ? 856  LYS A CA    1 
ATOM   3500  C  C     . LYS A 1  473 ? -71.882 -11.398 27.737  1.00 153.90 ? 856  LYS A C     1 
ATOM   3501  O  O     . LYS A 1  473 ? -72.799 -10.747 27.224  1.00 147.35 ? 856  LYS A O     1 
ATOM   3502  C  CB    . LYS A 1  473 ? -70.192 -9.816  28.648  1.00 160.77 ? 856  LYS A CB    1 
ATOM   3503  C  CG    . LYS A 1  473 ? -69.610 -9.077  29.837  1.00 164.63 ? 856  LYS A CG    1 
ATOM   3504  C  CD    . LYS A 1  473 ? -68.664 -7.978  29.384  1.00 169.29 ? 856  LYS A CD    1 
ATOM   3505  C  CE    . LYS A 1  473 ? -68.150 -7.163  30.561  1.00 172.76 ? 856  LYS A CE    1 
ATOM   3506  N  NZ    . LYS A 1  473 ? -67.201 -6.097  30.129  1.00 168.69 ? 856  LYS A NZ    1 
ATOM   3507  N  N     . LEU A 1  474 ? -71.442 -12.545 27.215  1.00 151.88 ? 857  LEU A N     1 
ATOM   3508  C  CA    . LEU A 1  474 ? -71.993 -13.048 25.962  1.00 146.65 ? 857  LEU A CA    1 
ATOM   3509  C  C     . LEU A 1  474 ? -73.261 -13.859 26.186  1.00 151.24 ? 857  LEU A C     1 
ATOM   3510  O  O     . LEU A 1  474 ? -74.124 -13.903 25.303  1.00 150.27 ? 857  LEU A O     1 
ATOM   3511  C  CB    . LEU A 1  474 ? -70.949 -13.891 25.221  1.00 140.55 ? 857  LEU A CB    1 
ATOM   3512  C  CG    . LEU A 1  474 ? -71.355 -14.507 23.876  1.00 135.85 ? 857  LEU A CG    1 
ATOM   3513  C  CD1   . LEU A 1  474 ? -71.864 -13.450 22.921  1.00 143.95 ? 857  LEU A CD1   1 
ATOM   3514  C  CD2   . LEU A 1  474 ? -70.216 -15.296 23.240  1.00 138.25 ? 857  LEU A CD2   1 
ATOM   3515  N  N     . MET A 1  475 ? -73.398 -14.498 27.349  1.00 151.76 ? 858  MET A N     1 
ATOM   3516  C  CA    . MET A 1  475 ? -74.570 -15.320 27.648  1.00 144.11 ? 858  MET A CA    1 
ATOM   3517  C  C     . MET A 1  475 ? -75.704 -14.430 28.169  1.00 149.24 ? 858  MET A C     1 
ATOM   3518  O  O     . MET A 1  475 ? -76.091 -14.467 29.340  1.00 150.92 ? 858  MET A O     1 
ATOM   3519  C  CB    . MET A 1  475 ? -74.204 -16.426 28.635  1.00 141.88 ? 858  MET A CB    1 
ATOM   3520  C  CG    . MET A 1  475 ? -73.139 -17.446 28.152  1.00 133.79 ? 858  MET A CG    1 
ATOM   3521  S  SD    . MET A 1  475 ? -73.510 -18.421 26.671  1.00 125.90 ? 858  MET A SD    1 
ATOM   3522  C  CE    . MET A 1  475 ? -72.820 -17.404 25.378  1.00 138.23 ? 858  MET A CE    1 
ATOM   3523  N  N     . THR A 1  476 ? -76.245 -13.613 27.256  1.00 155.02 ? 859  THR A N     1 
ATOM   3524  C  CA    . THR A 1  476 ? -77.394 -12.749 27.528  1.00 157.64 ? 859  THR A CA    1 
ATOM   3525  C  C     . THR A 1  476 ? -78.350 -12.776 26.339  1.00 157.84 ? 859  THR A C     1 
ATOM   3526  O  O     . THR A 1  476 ? -77.925 -12.954 25.193  1.00 157.60 ? 859  THR A O     1 
ATOM   3527  C  CB    . THR A 1  476 ? -76.968 -11.296 27.807  1.00 156.95 ? 859  THR A CB    1 
ATOM   3528  O  OG1   . THR A 1  476 ? -75.855 -11.285 28.710  1.00 163.40 ? 859  THR A OG1   1 
ATOM   3529  C  CG2   . THR A 1  476 ? -78.124 -10.501 28.414  1.00 152.27 ? 859  THR A CG2   1 
ATOM   3530  N  N     . GLN A 1  477 ? -79.651 -12.592 26.616  1.00 152.54 ? 860  GLN A N     1 
ATOM   3531  C  CA    . GLN A 1  477 ? -80.643 -12.578 25.539  1.00 154.19 ? 860  GLN A CA    1 
ATOM   3532  C  C     . GLN A 1  477 ? -80.417 -11.405 24.591  1.00 164.08 ? 860  GLN A C     1 
ATOM   3533  O  O     . GLN A 1  477 ? -80.753 -11.481 23.399  1.00 170.38 ? 860  GLN A O     1 
ATOM   3534  C  CB    . GLN A 1  477 ? -82.059 -12.524 26.116  1.00 138.96 ? 860  GLN A CB    1 
ATOM   3535  C  CG    . GLN A 1  477 ? -83.097 -13.249 25.272  1.00 147.21 ? 860  GLN A CG    1 
ATOM   3536  C  CD    . GLN A 1  477 ? -82.984 -14.762 25.392  1.00 164.64 ? 860  GLN A CD    1 
ATOM   3537  O  OE1   . GLN A 1  477 ? -82.755 -15.465 24.400  1.00 169.51 ? 860  GLN A OE1   1 
ATOM   3538  N  NE2   . GLN A 1  477 ? -83.149 -15.272 26.612  1.00 161.56 ? 860  GLN A NE2   1 
ATOM   3539  N  N     . GLU A 1  478 ? -79.853 -10.314 25.111  1.00 162.46 ? 861  GLU A N     1 
ATOM   3540  C  CA    . GLU A 1  478 ? -79.501 -9.170  24.280  1.00 162.63 ? 861  GLU A CA    1 
ATOM   3541  C  C     . GLU A 1  478 ? -78.532 -9.566  23.172  1.00 164.86 ? 861  GLU A C     1 
ATOM   3542  O  O     . GLU A 1  478 ? -78.703 -9.170  22.009  1.00 167.41 ? 861  GLU A O     1 
ATOM   3543  C  CB    . GLU A 1  478 ? -78.900 -8.088  25.168  1.00 168.14 ? 861  GLU A CB    1 
ATOM   3544  C  CG    . GLU A 1  478 ? -78.762 -6.740  24.524  1.00 182.49 ? 861  GLU A CG    1 
ATOM   3545  C  CD    . GLU A 1  478 ? -78.147 -5.734  25.469  1.00 191.22 ? 861  GLU A CD    1 
ATOM   3546  O  OE1   . GLU A 1  478 ? -77.928 -6.089  26.649  1.00 190.78 ? 861  GLU A OE1   1 
ATOM   3547  O  OE2   . GLU A 1  478 ? -77.880 -4.594  25.036  1.00 193.45 ? 861  GLU A OE2   1 
ATOM   3548  N  N     . THR A 1  479 ? -77.502 -10.346 23.514  1.00 157.47 ? 862  THR A N     1 
ATOM   3549  C  CA    . THR A 1  479 ? -76.570 -10.819 22.499  1.00 153.06 ? 862  THR A CA    1 
ATOM   3550  C  C     . THR A 1  479 ? -77.265 -11.705 21.482  1.00 153.12 ? 862  THR A C     1 
ATOM   3551  O  O     . THR A 1  479 ? -76.861 -11.747 20.316  1.00 157.94 ? 862  THR A O     1 
ATOM   3552  C  CB    . THR A 1  479 ? -75.417 -11.585 23.144  1.00 160.82 ? 862  THR A CB    1 
ATOM   3553  O  OG1   . THR A 1  479 ? -75.941 -12.697 23.880  1.00 161.88 ? 862  THR A OG1   1 
ATOM   3554  C  CG2   . THR A 1  479 ? -74.631 -10.690 24.092  1.00 162.24 ? 862  THR A CG2   1 
ATOM   3555  N  N     . VAL A 1  480 ? -78.309 -12.420 21.896  1.00 156.40 ? 863  VAL A N     1 
ATOM   3556  C  CA    . VAL A 1  480 ? -79.021 -13.259 20.943  1.00 155.14 ? 863  VAL A CA    1 
ATOM   3557  C  C     . VAL A 1  480 ? -79.790 -12.398 19.952  1.00 163.24 ? 863  VAL A C     1 
ATOM   3558  O  O     . VAL A 1  480 ? -79.815 -12.692 18.754  1.00 167.06 ? 863  VAL A O     1 
ATOM   3559  C  CB    . VAL A 1  480 ? -79.939 -14.254 21.672  1.00 152.89 ? 863  VAL A CB    1 
ATOM   3560  C  CG1   . VAL A 1  480 ? -80.615 -15.168 20.666  1.00 155.43 ? 863  VAL A CG1   1 
ATOM   3561  C  CG2   . VAL A 1  480 ? -79.134 -15.067 22.654  1.00 153.07 ? 863  VAL A CG2   1 
ATOM   3562  N  N     . ASP A 1  481 ? -80.418 -11.317 20.427  1.00 167.74 ? 864  ASP A N     1 
ATOM   3563  C  CA    . ASP A 1  481 ? -81.054 -10.372 19.505  1.00 166.26 ? 864  ASP A CA    1 
ATOM   3564  C  C     . ASP A 1  481 ? -80.031 -9.790  18.534  1.00 162.62 ? 864  ASP A C     1 
ATOM   3565  O  O     . ASP A 1  481 ? -80.283 -9.669  17.322  1.00 161.91 ? 864  ASP A O     1 
ATOM   3566  C  CB    . ASP A 1  481 ? -81.741 -9.250  20.287  1.00 166.64 ? 864  ASP A CB    1 
ATOM   3567  C  CG    . ASP A 1  481 ? -82.839 -9.753  21.208  1.00 167.19 ? 864  ASP A CG    1 
ATOM   3568  O  OD1   . ASP A 1  481 ? -83.218 -10.939 21.108  1.00 167.35 ? 864  ASP A OD1   1 
ATOM   3569  O  OD2   . ASP A 1  481 ? -83.324 -8.954  22.038  1.00 170.46 ? 864  ASP A OD2   1 
ATOM   3570  N  N     . ALA A 1  482 ? -78.863 -9.420  19.062  1.00 162.20 ? 865  ALA A N     1 
ATOM   3571  C  CA    . ALA A 1  482 ? -77.784 -8.916  18.222  1.00 162.92 ? 865  ALA A CA    1 
ATOM   3572  C  C     . ALA A 1  482 ? -77.440 -9.909  17.112  1.00 165.80 ? 865  ALA A C     1 
ATOM   3573  O  O     . ALA A 1  482 ? -77.476 -9.570  15.926  1.00 167.24 ? 865  ALA A O     1 
ATOM   3574  C  CB    . ALA A 1  482 ? -76.559 -8.603  19.086  1.00 167.20 ? 865  ALA A CB    1 
ATOM   3575  N  N     . VAL A 1  483 ? -77.134 -11.157 17.478  1.00 163.28 ? 866  VAL A N     1 
ATOM   3576  C  CA    . VAL A 1  483 ? -76.716 -12.140 16.477  1.00 162.02 ? 866  VAL A CA    1 
ATOM   3577  C  C     . VAL A 1  483 ? -77.859 -12.494 15.527  1.00 164.54 ? 866  VAL A C     1 
ATOM   3578  O  O     . VAL A 1  483 ? -77.622 -12.822 14.357  1.00 161.92 ? 866  VAL A O     1 
ATOM   3579  C  CB    . VAL A 1  483 ? -76.146 -13.392 17.170  1.00 159.52 ? 866  VAL A CB    1 
ATOM   3580  C  CG1   . VAL A 1  483 ? -75.716 -14.433 16.139  1.00 159.27 ? 866  VAL A CG1   1 
ATOM   3581  C  CG2   . VAL A 1  483 ? -74.977 -13.007 18.068  1.00 161.06 ? 866  VAL A CG2   1 
ATOM   3582  N  N     . CYS A 1  484 ? -79.108 -12.437 16.006  1.00 163.81 ? 867  CYS A N     1 
ATOM   3583  C  CA    . CYS A 1  484 ? -80.265 -12.642 15.135  1.00 164.69 ? 867  CYS A CA    1 
ATOM   3584  C  C     . CYS A 1  484 ? -80.364 -11.555 14.074  1.00 166.75 ? 867  CYS A C     1 
ATOM   3585  O  O     . CYS A 1  484 ? -80.905 -11.794 12.987  1.00 167.97 ? 867  CYS A O     1 
ATOM   3586  C  CB    . CYS A 1  484 ? -81.557 -12.667 15.955  1.00 163.01 ? 867  CYS A CB    1 
ATOM   3587  S  SG    . CYS A 1  484 ? -81.949 -14.222 16.769  1.00 162.96 ? 867  CYS A SG    1 
ATOM   3588  N  N     . GLU A 1  485 ? -79.883 -10.346 14.380  1.00 173.94 ? 868  GLU A N     1 
ATOM   3589  C  CA    . GLU A 1  485 ? -79.775 -9.337  13.325  1.00 169.53 ? 868  GLU A CA    1 
ATOM   3590  C  C     . GLU A 1  485 ? -78.894 -9.781  12.152  1.00 170.36 ? 868  GLU A C     1 
ATOM   3591  O  O     . GLU A 1  485 ? -78.890 -9.096  11.124  1.00 173.85 ? 868  GLU A O     1 
ATOM   3592  C  CB    . GLU A 1  485 ? -79.223 -8.022  13.872  1.00 168.88 ? 868  GLU A CB    1 
ATOM   3593  C  CG    . GLU A 1  485 ? -80.135 -7.300  14.841  1.00 168.97 ? 868  GLU A CG    1 
ATOM   3594  C  CD    . GLU A 1  485 ? -79.455 -6.101  15.461  1.00 169.82 ? 868  GLU A CD    1 
ATOM   3595  O  OE1   . GLU A 1  485 ? -78.249 -5.909  15.199  1.00 166.88 ? 868  GLU A OE1   1 
ATOM   3596  O  OE2   . GLU A 1  485 ? -80.124 -5.355  16.207  1.00 171.41 ? 868  GLU A OE2   1 
ATOM   3597  N  N     . LEU A 1  486 ? -78.160 -10.893 12.274  1.00 169.44 ? 869  LEU A N     1 
ATOM   3598  C  CA    . LEU A 1  486 ? -77.269 -11.382 11.229  1.00 170.70 ? 869  LEU A CA    1 
ATOM   3599  C  C     . LEU A 1  486 ? -77.697 -12.734 10.657  1.00 168.17 ? 869  LEU A C     1 
ATOM   3600  O  O     . LEU A 1  486 ? -76.943 -13.323 9.877   1.00 171.09 ? 869  LEU A O     1 
ATOM   3601  C  CB    . LEU A 1  486 ? -75.836 -11.512 11.761  1.00 175.04 ? 869  LEU A CB    1 
ATOM   3602  C  CG    . LEU A 1  486 ? -75.054 -10.238 12.102  1.00 170.60 ? 869  LEU A CG    1 
ATOM   3603  C  CD1   . LEU A 1  486 ? -73.691 -10.555 12.702  1.00 172.82 ? 869  LEU A CD1   1 
ATOM   3604  C  CD2   . LEU A 1  486 ? -74.899 -9.377  10.870  1.00 166.82 ? 869  LEU A CD2   1 
ATOM   3605  N  N     . ILE A 1  487 ? -78.857 -13.247 11.043  1.00 172.30 ? 870  ILE A N     1 
ATOM   3606  C  CA    . ILE A 1  487 ? -79.337 -14.561 10.623  1.00 177.07 ? 870  ILE A CA    1 
ATOM   3607  C  C     . ILE A 1  487 ? -80.513 -14.363 9.665   1.00 178.31 ? 870  ILE A C     1 
ATOM   3608  O  O     . ILE A 1  487 ? -81.444 -13.627 9.993   1.00 178.18 ? 870  ILE A O     1 
ATOM   3609  C  CB    . ILE A 1  487 ? -79.760 -15.429 11.835  1.00 163.07 ? 870  ILE A CB    1 
ATOM   3610  C  CG1   . ILE A 1  487 ? -78.561 -15.973 12.758  1.00 149.07 ? 870  ILE A CG1   1 
ATOM   3611  C  CG2   . ILE A 1  487 ? -80.833 -16.593 11.399  1.00 163.42 ? 870  ILE A CG2   1 
ATOM   3612  C  CD1   . ILE A 1  487 ? -79.008 -16.276 14.357  1.00 153.82 ? 870  ILE A CD1   1 
ATOM   3613  N  N     . PRO A 1  488 ? -80.514 -14.975 8.530   1.00 177.36 ? 871  PRO A N     1 
ATOM   3614  C  CA    . PRO A 1  488 ? -81.681 -14.879 7.643   1.00 176.97 ? 871  PRO A CA    1 
ATOM   3615  C  C     . PRO A 1  488 ? -83.020 -15.381 8.196   1.00 176.55 ? 871  PRO A C     1 
ATOM   3616  O  O     . PRO A 1  488 ? -83.999 -14.622 8.365   1.00 176.96 ? 871  PRO A O     1 
ATOM   3617  C  CB    . PRO A 1  488 ? -81.270 -15.721 6.437   1.00 162.23 ? 871  PRO A CB    1 
ATOM   3618  C  CG    . PRO A 1  488 ? -80.240 -16.861 7.100   1.00 153.19 ? 871  PRO A CG    1 
ATOM   3619  C  CD    . PRO A 1  488 ? -79.490 -15.952 8.163   1.00 155.95 ? 871  PRO A CD    1 
ATOM   3620  N  N     . SER A 1  489 ? -83.083 -16.648 8.521   1.00 171.64 ? 872  SER A N     1 
ATOM   3621  C  CA    . SER A 1  489 ? -84.363 -17.262 8.797   1.00 174.43 ? 872  SER A CA    1 
ATOM   3622  C  C     . SER A 1  489 ? -84.725 -17.050 10.263  1.00 176.13 ? 872  SER A C     1 
ATOM   3623  O  O     . SER A 1  489 ? -83.871 -17.058 11.159  1.00 177.67 ? 872  SER A O     1 
ATOM   3624  C  CB    . SER A 1  489 ? -84.294 -18.730 8.407   1.00 167.93 ? 872  SER A CB    1 
ATOM   3625  O  OG    . SER A 1  489 ? -85.232 -19.599 9.125   1.00 123.85 ? 872  SER A OG    1 
ATOM   3626  N  N     . GLU A 1  490 ? -86.000 -16.845 10.510  1.00 177.92 ? 873  GLU A N     1 
ATOM   3627  C  CA    . GLU A 1  490 ? -86.380 -16.535 11.869  1.00 178.76 ? 873  GLU A CA    1 
ATOM   3628  C  C     . GLU A 1  490 ? -86.848 -17.766 12.622  1.00 176.44 ? 873  GLU A C     1 
ATOM   3629  O  O     . GLU A 1  490 ? -86.986 -17.695 13.840  1.00 177.50 ? 873  GLU A O     1 
ATOM   3630  C  CB    . GLU A 1  490 ? -87.427 -15.411 11.867  1.00 153.66 ? 873  GLU A CB    1 
ATOM   3631  N  N     . GLU A 1  491 ? -87.063 -18.903 11.945  1.00 173.69 ? 874  GLU A N     1 
ATOM   3632  C  CA    . GLU A 1  491 ? -87.199 -20.149 12.701  1.00 179.30 ? 874  GLU A CA    1 
ATOM   3633  C  C     . GLU A 1  491 ? -85.931 -20.416 13.504  1.00 178.63 ? 874  GLU A C     1 
ATOM   3634  O  O     . GLU A 1  491 ? -85.985 -20.898 14.648  1.00 180.10 ? 874  GLU A O     1 
ATOM   3635  C  CB    . GLU A 1  491 ? -87.500 -21.330 11.775  1.00 184.81 ? 874  GLU A CB    1 
ATOM   3636  C  CG    . GLU A 1  491 ? -88.857 -21.275 11.090  1.00 186.31 ? 874  GLU A CG    1 
ATOM   3637  C  CD    . GLU A 1  491 ? -89.071 -22.410 10.099  1.00 192.83 ? 874  GLU A CD    1 
ATOM   3638  O  OE1   . GLU A 1  491 ? -88.100 -23.134 9.784   1.00 195.65 ? 874  GLU A OE1   1 
ATOM   3639  O  OE2   . GLU A 1  491 ? -90.217 -22.574 9.633   1.00 194.98 ? 874  GLU A OE2   1 
ATOM   3640  N  N     . ARG A 1  492 ? -84.776 -20.084 12.921  1.00 168.76 ? 875  ARG A N     1 
ATOM   3641  C  CA    . ARG A 1  492 ? -83.511 -20.191 13.637  1.00 168.99 ? 875  ARG A CA    1 
ATOM   3642  C  C     . ARG A 1  492 ? -83.385 -19.114 14.716  1.00 166.90 ? 875  ARG A C     1 
ATOM   3643  O  O     . ARG A 1  492 ? -82.740 -19.348 15.749  1.00 164.22 ? 875  ARG A O     1 
ATOM   3644  C  CB    . ARG A 1  492 ? -82.356 -20.149 12.628  1.00 164.07 ? 875  ARG A CB    1 
ATOM   3645  C  CG    . ARG A 1  492 ? -82.600 -21.076 11.411  1.00 167.15 ? 875  ARG A CG    1 
ATOM   3646  C  CD    . ARG A 1  492 ? -81.330 -21.753 10.875  1.00 168.50 ? 875  ARG A CD    1 
ATOM   3647  N  NE    . ARG A 1  492 ? -80.619 -22.476 11.924  1.00 168.45 ? 875  ARG A NE    1 
ATOM   3648  C  CZ    . ARG A 1  492 ? -81.016 -23.633 12.443  1.00 161.03 ? 875  ARG A CZ    1 
ATOM   3649  N  NH1   . ARG A 1  492 ? -82.123 -24.216 12.010  1.00 157.25 ? 875  ARG A NH1   1 
ATOM   3650  N  NH2   . ARG A 1  492 ? -80.306 -24.204 13.403  1.00 145.26 ? 875  ARG A NH2   1 
ATOM   3651  N  N     . HIS A 1  493 ? -84.020 -17.950 14.521  1.00 167.05 ? 876  HIS A N     1 
ATOM   3652  C  CA    . HIS A 1  493 ? -84.139 -16.986 15.616  1.00 169.49 ? 876  HIS A CA    1 
ATOM   3653  C  C     . HIS A 1  493 ? -84.843 -17.618 16.808  1.00 163.55 ? 876  HIS A C     1 
ATOM   3654  O  O     . HIS A 1  493 ? -84.361 -17.539 17.943  1.00 158.88 ? 876  HIS A O     1 
ATOM   3655  C  CB    . HIS A 1  493 ? -84.881 -15.716 15.157  1.00 183.58 ? 876  HIS A CB    1 
ATOM   3656  C  CG    . HIS A 1  493 ? -84.163 -14.942 14.072  1.00 151.53 ? 876  HIS A CG    1 
ATOM   3657  N  ND1   . HIS A 1  493 ? -84.425 -13.595 13.812  1.00 144.48 ? 876  HIS A ND1   1 
ATOM   3658  C  CD2   . HIS A 1  493 ? -83.186 -15.332 13.191  1.00 182.43 ? 876  HIS A CD2   1 
ATOM   3659  C  CE1   . HIS A 1  493 ? -83.638 -13.207 12.804  1.00 155.86 ? 876  HIS A CE1   1 
ATOM   3660  N  NE2   . HIS A 1  493 ? -82.880 -14.236 12.415  1.00 167.10 ? 876  HIS A NE2   1 
ATOM   3661  N  N     . GLU A 1  494 ? -85.986 -18.262 16.555  1.00 167.67 ? 877  GLU A N     1 
ATOM   3662  C  CA    . GLU A 1  494 ? -86.724 -18.943 17.617  1.00 165.49 ? 877  GLU A CA    1 
ATOM   3663  C  C     . GLU A 1  494 ? -85.864 -20.002 18.301  1.00 167.30 ? 877  GLU A C     1 
ATOM   3664  O  O     . GLU A 1  494 ? -85.836 -20.093 19.538  1.00 161.08 ? 877  GLU A O     1 
ATOM   3665  C  CB    . GLU A 1  494 ? -87.990 -19.566 17.027  1.00 173.48 ? 877  GLU A CB    1 
ATOM   3666  C  CG    . GLU A 1  494 ? -89.004 -20.079 18.032  1.00 182.95 ? 877  GLU A CG    1 
ATOM   3667  C  CD    . GLU A 1  494 ? -90.098 -20.897 17.368  1.00 187.78 ? 877  GLU A CD    1 
ATOM   3668  O  OE1   . GLU A 1  494 ? -89.800 -21.585 16.366  1.00 184.71 ? 877  GLU A OE1   1 
ATOM   3669  O  OE2   . GLU A 1  494 ? -91.253 -20.849 17.841  1.00 194.36 ? 877  GLU A OE2   1 
ATOM   3670  N  N     . ALA A 1  495 ? -85.165 -20.820 17.508  1.00 169.81 ? 878  ALA A N     1 
ATOM   3671  C  CA    . ALA A 1  495 ? -84.308 -21.860 18.076  1.00 162.10 ? 878  ALA A CA    1 
ATOM   3672  C  C     . ALA A 1  495 ? -83.246 -21.265 18.999  1.00 155.38 ? 878  ALA A C     1 
ATOM   3673  O  O     . ALA A 1  495 ? -83.036 -21.754 20.118  1.00 148.07 ? 878  ALA A O     1 
ATOM   3674  C  CB    . ALA A 1  495 ? -83.661 -22.674 16.956  1.00 157.95 ? 878  ALA A CB    1 
ATOM   3675  N  N     . LEU A 1  496 ? -82.566 -20.203 18.546  1.00 158.01 ? 879  LEU A N     1 
ATOM   3676  C  CA    . LEU A 1  496 ? -81.510 -19.598 19.358  1.00 152.64 ? 879  LEU A CA    1 
ATOM   3677  C  C     . LEU A 1  496 ? -82.075 -18.965 20.622  1.00 152.37 ? 879  LEU A C     1 
ATOM   3678  O  O     . LEU A 1  496 ? -81.475 -19.068 21.702  1.00 154.41 ? 879  LEU A O     1 
ATOM   3679  C  CB    . LEU A 1  496 ? -80.740 -18.557 18.546  1.00 149.19 ? 879  LEU A CB    1 
ATOM   3680  C  CG    . LEU A 1  496 ? -79.531 -19.051 17.746  1.00 152.20 ? 879  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A 1  496 ? -78.685 -17.897 17.297  1.00 153.08 ? 879  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A 1  496 ? -78.686 -19.989 18.573  1.00 154.33 ? 879  LEU A CD2   1 
ATOM   3683  N  N     . ARG A 1  497 ? -83.226 -18.300 20.509  1.00 156.17 ? 880  ARG A N     1 
ATOM   3684  C  CA    . ARG A 1  497 ? -83.832 -17.686 21.683  1.00 153.31 ? 880  ARG A CA    1 
ATOM   3685  C  C     . ARG A 1  497 ? -84.218 -18.738 22.710  1.00 145.75 ? 880  ARG A C     1 
ATOM   3686  O  O     . ARG A 1  497 ? -84.026 -18.534 23.913  1.00 141.44 ? 880  ARG A O     1 
ATOM   3687  C  CB    . ARG A 1  497 ? -85.041 -16.846 21.276  1.00 162.46 ? 880  ARG A CB    1 
ATOM   3688  C  CG    . ARG A 1  497 ? -84.676 -15.686 20.358  1.00 165.97 ? 880  ARG A CG    1 
ATOM   3689  C  CD    . ARG A 1  497 ? -85.025 -14.333 20.958  1.00 162.15 ? 880  ARG A CD    1 
ATOM   3690  N  NE    . ARG A 1  497 ? -84.350 -13.253 20.245  1.00 164.70 ? 880  ARG A NE    1 
ATOM   3691  C  CZ    . ARG A 1  497 ? -84.711 -12.807 19.046  1.00 161.97 ? 880  ARG A CZ    1 
ATOM   3692  N  NH1   . ARG A 1  497 ? -85.745 -13.350 18.417  1.00 149.72 ? 880  ARG A NH1   1 
ATOM   3693  N  NH2   . ARG A 1  497 ? -84.037 -11.817 18.470  1.00 164.15 ? 880  ARG A NH2   1 
ATOM   3694  N  N     . GLU A 1  498 ? -84.712 -19.895 22.254  1.00 153.20 ? 881  GLU A N     1 
ATOM   3695  C  CA    . GLU A 1  498 ? -85.094 -20.942 23.200  1.00 158.48 ? 881  GLU A CA    1 
ATOM   3696  C  C     . GLU A 1  498 ? -83.872 -21.623 23.812  1.00 150.06 ? 881  GLU A C     1 
ATOM   3697  O  O     . GLU A 1  498 ? -83.881 -21.971 25.002  1.00 148.73 ? 881  GLU A O     1 
ATOM   3698  C  CB    . GLU A 1  498 ? -85.995 -21.979 22.529  1.00 159.43 ? 881  GLU A CB    1 
ATOM   3699  C  CG    . GLU A 1  498 ? -86.693 -22.884 23.543  1.00 155.82 ? 881  GLU A CG    1 
ATOM   3700  C  CD    . GLU A 1  498 ? -87.282 -24.136 22.926  1.00 167.10 ? 881  GLU A CD    1 
ATOM   3701  O  OE1   . GLU A 1  498 ? -88.150 -24.761 23.575  1.00 173.49 ? 881  GLU A OE1   1 
ATOM   3702  O  OE2   . GLU A 1  498 ? -86.876 -24.499 21.800  1.00 167.12 ? 881  GLU A OE2   1 
ATOM   3703  N  N     . LEU A 1  499 ? -82.814 -21.826 23.022  1.00 142.49 ? 882  LEU A N     1 
ATOM   3704  C  CA    . LEU A 1  499 ? -81.591 -22.399 23.578  1.00 134.20 ? 882  LEU A CA    1 
ATOM   3705  C  C     . LEU A 1  499 ? -81.008 -21.490 24.659  1.00 134.16 ? 882  LEU A C     1 
ATOM   3706  O  O     . LEU A 1  499 ? -80.616 -21.957 25.739  1.00 131.94 ? 882  LEU A O     1 
ATOM   3707  C  CB    . LEU A 1  499 ? -80.575 -22.654 22.461  1.00 130.46 ? 882  LEU A CB    1 
ATOM   3708  C  CG    . LEU A 1  499 ? -79.384 -23.568 22.774  1.00 122.96 ? 882  LEU A CG    1 
ATOM   3709  C  CD1   . LEU A 1  499 ? -79.805 -25.023 22.924  1.00 122.18 ? 882  LEU A CD1   1 
ATOM   3710  C  CD2   . LEU A 1  499 ? -78.303 -23.435 21.715  1.00 124.88 ? 882  LEU A CD2   1 
ATOM   3711  N  N     . MET A 1  500 ? -80.981 -20.178 24.405  1.00 139.67 ? 883  MET A N     1 
ATOM   3712  C  CA    . MET A 1  500 ? -80.476 -19.241 25.404  1.00 139.61 ? 883  MET A CA    1 
ATOM   3713  C  C     . MET A 1  500 ? -81.420 -19.110 26.597  1.00 136.00 ? 883  MET A C     1 
ATOM   3714  O  O     . MET A 1  500 ? -80.969 -18.873 27.725  1.00 134.61 ? 883  MET A O     1 
ATOM   3715  C  CB    . MET A 1  500 ? -80.238 -17.881 24.756  1.00 145.33 ? 883  MET A CB    1 
ATOM   3716  C  CG    . MET A 1  500 ? -79.662 -16.856 25.703  1.00 147.84 ? 883  MET A CG    1 
ATOM   3717  S  SD    . MET A 1  500 ? -78.015 -17.298 26.279  1.00 155.62 ? 883  MET A SD    1 
ATOM   3718  C  CE    . MET A 1  500 ? -76.997 -16.801 24.884  1.00 141.75 ? 883  MET A CE    1 
ATOM   3719  N  N     . ASP A 1  501 ? -82.727 -19.268 26.375  1.00 138.46 ? 884  ASP A N     1 
ATOM   3720  C  CA    . ASP A 1  501 ? -83.677 -19.301 27.483  1.00 143.53 ? 884  ASP A CA    1 
ATOM   3721  C  C     . ASP A 1  501 ? -83.406 -20.484 28.406  1.00 136.08 ? 884  ASP A C     1 
ATOM   3722  O  O     . ASP A 1  501 ? -83.454 -20.352 29.636  1.00 131.83 ? 884  ASP A O     1 
ATOM   3723  C  CB    . ASP A 1  501 ? -85.103 -19.371 26.931  1.00 153.72 ? 884  ASP A CB    1 
ATOM   3724  C  CG    . ASP A 1  501 ? -86.158 -19.107 27.989  1.00 160.12 ? 884  ASP A CG    1 
ATOM   3725  O  OD1   . ASP A 1  501 ? -86.230 -17.951 28.460  1.00 166.27 ? 884  ASP A OD1   1 
ATOM   3726  O  OD2   . ASP A 1  501 ? -86.917 -20.042 28.338  1.00 157.52 ? 884  ASP A OD2   1 
ATOM   3727  N  N     . LEU A 1  502 ? -83.129 -21.653 27.826  1.00 137.39 ? 885  LEU A N     1 
ATOM   3728  C  CA    . LEU A 1  502 ? -82.800 -22.820 28.637  1.00 134.98 ? 885  LEU A CA    1 
ATOM   3729  C  C     . LEU A 1  502 ? -81.486 -22.609 29.383  1.00 127.15 ? 885  LEU A C     1 
ATOM   3730  O  O     . LEU A 1  502 ? -81.365 -22.979 30.561  1.00 124.75 ? 885  LEU A O     1 
ATOM   3731  C  CB    . LEU A 1  502 ? -82.741 -24.077 27.759  1.00 137.56 ? 885  LEU A CB    1 
ATOM   3732  C  CG    . LEU A 1  502 ? -84.043 -24.517 27.071  1.00 128.53 ? 885  LEU A CG    1 
ATOM   3733  C  CD1   . LEU A 1  502 ? -83.820 -25.640 26.067  1.00 120.75 ? 885  LEU A CD1   1 
ATOM   3734  C  CD2   . LEU A 1  502 ? -85.054 -24.941 28.109  1.00 126.32 ? 885  LEU A CD2   1 
ATOM   3735  N  N     . TYR A 1  503 ? -80.491 -22.008 28.717  1.00 128.09 ? 886  TYR A N     1 
ATOM   3736  C  CA    . TYR A 1  503 ? -79.260 -21.649 29.423  1.00 127.53 ? 886  TYR A CA    1 
ATOM   3737  C  C     . TYR A 1  503 ? -79.564 -20.786 30.646  1.00 129.12 ? 886  TYR A C     1 
ATOM   3738  O  O     . TYR A 1  503 ? -78.997 -20.986 31.730  1.00 122.94 ? 886  TYR A O     1 
ATOM   3739  C  CB    . TYR A 1  503 ? -78.275 -20.914 28.501  1.00 121.52 ? 886  TYR A CB    1 
ATOM   3740  C  CG    . TYR A 1  503 ? -77.111 -20.292 29.268  1.00 121.91 ? 886  TYR A CG    1 
ATOM   3741  C  CD1   . TYR A 1  503 ? -77.231 -19.044 29.872  1.00 125.51 ? 886  TYR A CD1   1 
ATOM   3742  C  CD2   . TYR A 1  503 ? -75.906 -20.961 29.408  1.00 123.89 ? 886  TYR A CD2   1 
ATOM   3743  C  CE1   . TYR A 1  503 ? -76.196 -18.489 30.595  1.00 131.02 ? 886  TYR A CE1   1 
ATOM   3744  C  CE2   . TYR A 1  503 ? -74.855 -20.402 30.124  1.00 125.99 ? 886  TYR A CE2   1 
ATOM   3745  C  CZ    . TYR A 1  503 ? -75.007 -19.166 30.713  1.00 128.64 ? 886  TYR A CZ    1 
ATOM   3746  O  OH    . TYR A 1  503 ? -73.972 -18.598 31.426  1.00 120.53 ? 886  TYR A OH    1 
ATOM   3747  N  N     . LEU A 1  504 ? -80.418 -19.779 30.472  1.00 135.91 ? 887  LEU A N     1 
ATOM   3748  C  CA    . LEU A 1  504 ? -80.661 -18.850 31.563  1.00 128.23 ? 887  LEU A CA    1 
ATOM   3749  C  C     . LEU A 1  504 ? -81.495 -19.492 32.658  1.00 126.98 ? 887  LEU A C     1 
ATOM   3750  O  O     . LEU A 1  504 ? -81.401 -19.094 33.824  1.00 127.04 ? 887  LEU A O     1 
ATOM   3751  C  CB    . LEU A 1  504 ? -81.325 -17.590 31.020  1.00 127.60 ? 887  LEU A CB    1 
ATOM   3752  C  CG    . LEU A 1  504 ? -80.361 -16.733 30.193  1.00 130.69 ? 887  LEU A CG    1 
ATOM   3753  C  CD1   . LEU A 1  504 ? -81.058 -15.482 29.703  1.00 144.11 ? 887  LEU A CD1   1 
ATOM   3754  C  CD2   . LEU A 1  504 ? -79.101 -16.377 30.992  1.00 126.43 ? 887  LEU A CD2   1 
ATOM   3755  N  N     . LYS A 1  505 ? -82.313 -20.482 32.303  1.00 128.28 ? 888  LYS A N     1 
ATOM   3756  C  CA    . LYS A 1  505 ? -83.046 -21.240 33.311  1.00 131.38 ? 888  LYS A CA    1 
ATOM   3757  C  C     . LYS A 1  505 ? -82.125 -22.172 34.095  1.00 130.19 ? 888  LYS A C     1 
ATOM   3758  O  O     . LYS A 1  505 ? -82.429 -22.523 35.243  1.00 125.83 ? 888  LYS A O     1 
ATOM   3759  C  CB    . LYS A 1  505 ? -84.169 -22.037 32.649  1.00 130.13 ? 888  LYS A CB    1 
ATOM   3760  C  CG    . LYS A 1  505 ? -85.431 -21.256 32.339  1.00 130.17 ? 888  LYS A CG    1 
ATOM   3761  C  CD    . LYS A 1  505 ? -86.337 -22.080 31.446  1.00 131.23 ? 888  LYS A CD    1 
ATOM   3762  C  CE    . LYS A 1  505 ? -87.799 -21.770 31.678  1.00 140.76 ? 888  LYS A CE    1 
ATOM   3763  N  NZ    . LYS A 1  505 ? -88.128 -20.383 31.275  1.00 147.45 ? 888  LYS A NZ    1 
ATOM   3764  N  N     . MET A 1  506 ? -81.012 -22.596 33.493  1.00 123.40 ? 889  MET A N     1 
ATOM   3765  C  CA    . MET A 1  506 ? -80.092 -23.481 34.202  1.00 121.93 ? 889  MET A CA    1 
ATOM   3766  C  C     . MET A 1  506 ? -79.074 -22.725 35.058  1.00 122.91 ? 889  MET A C     1 
ATOM   3767  O  O     . MET A 1  506 ? -78.758 -23.170 36.166  1.00 120.58 ? 889  MET A O     1 
ATOM   3768  C  CB    . MET A 1  506 ? -79.365 -24.394 33.210  1.00 121.39 ? 889  MET A CB    1 
ATOM   3769  C  CG    . MET A 1  506 ? -80.279 -25.300 32.406  1.00 117.12 ? 889  MET A CG    1 
ATOM   3770  S  SD    . MET A 1  506 ? -79.353 -26.516 31.459  1.00 114.47 ? 889  MET A SD    1 
ATOM   3771  C  CE    . MET A 1  506 ? -78.477 -25.469 30.301  1.00 106.44 ? 889  MET A CE    1 
ATOM   3772  N  N     . LYS A 1  507 ? -78.580 -21.580 34.579  1.00 121.39 ? 890  LYS A N     1 
ATOM   3773  C  CA    . LYS A 1  507 ? -77.460 -20.877 35.218  1.00 122.34 ? 890  LYS A CA    1 
ATOM   3774  C  C     . LYS A 1  507 ? -77.609 -20.633 36.724  1.00 127.27 ? 890  LYS A C     1 
ATOM   3775  O  O     . LYS A 1  507 ? -76.624 -20.843 37.457  1.00 134.18 ? 890  LYS A O     1 
ATOM   3776  C  CB    . LYS A 1  507 ? -77.230 -19.560 34.461  1.00 127.09 ? 890  LYS A CB    1 
ATOM   3777  C  CG    . LYS A 1  507 ? -75.983 -18.795 34.886  1.00 137.05 ? 890  LYS A CG    1 
ATOM   3778  C  CD    . LYS A 1  507 ? -75.788 -17.512 34.080  1.00 144.76 ? 890  LYS A CD    1 
ATOM   3779  C  CE    . LYS A 1  507 ? -74.603 -16.723 34.612  1.00 150.94 ? 890  LYS A CE    1 
ATOM   3780  N  NZ    . LYS A 1  507 ? -74.441 -15.448 33.883  1.00 152.23 ? 890  LYS A NZ    1 
ATOM   3781  N  N     . PRO A 1  508 ? -78.765 -20.183 37.249  1.00 127.76 ? 891  PRO A N     1 
ATOM   3782  C  CA    . PRO A 1  508 ? -78.849 -19.910 38.697  1.00 129.18 ? 891  PRO A CA    1 
ATOM   3783  C  C     . PRO A 1  508 ? -78.441 -21.078 39.579  1.00 126.07 ? 891  PRO A C     1 
ATOM   3784  O  O     . PRO A 1  508 ? -77.864 -20.849 40.649  1.00 130.13 ? 891  PRO A O     1 
ATOM   3785  C  CB    . PRO A 1  508 ? -80.326 -19.551 38.900  1.00 127.49 ? 891  PRO A CB    1 
ATOM   3786  C  CG    . PRO A 1  508 ? -80.782 -19.062 37.572  1.00 126.51 ? 891  PRO A CG    1 
ATOM   3787  C  CD    . PRO A 1  508 ? -80.026 -19.849 36.560  1.00 127.04 ? 891  PRO A CD    1 
ATOM   3788  N  N     . VAL A 1  509 ? -78.710 -22.318 39.164  1.00 125.55 ? 892  VAL A N     1 
ATOM   3789  C  CA    . VAL A 1  509 ? -78.379 -23.468 40.006  1.00 128.07 ? 892  VAL A CA    1 
ATOM   3790  C  C     . VAL A 1  509 ? -76.870 -23.552 40.222  1.00 124.51 ? 892  VAL A C     1 
ATOM   3791  O  O     . VAL A 1  509 ? -76.394 -23.696 41.356  1.00 126.90 ? 892  VAL A O     1 
ATOM   3792  C  CB    . VAL A 1  509 ? -78.947 -24.766 39.398  1.00 128.70 ? 892  VAL A CB    1 
ATOM   3793  C  CG1   . VAL A 1  509 ? -78.563 -26.002 40.242  1.00 118.37 ? 892  VAL A CG1   1 
ATOM   3794  C  CG2   . VAL A 1  509 ? -80.454 -24.656 39.251  1.00 122.77 ? 892  VAL A CG2   1 
ATOM   3795  N  N     . TRP A 1  510 ? -76.090 -23.436 39.149  1.00 117.42 ? 893  TRP A N     1 
ATOM   3796  C  CA    . TRP A 1  510 ? -74.658 -23.574 39.347  1.00 121.11 ? 893  TRP A CA    1 
ATOM   3797  C  C     . TRP A 1  510 ? -73.995 -22.282 39.794  1.00 127.17 ? 893  TRP A C     1 
ATOM   3798  O  O     . TRP A 1  510 ? -72.835 -22.325 40.217  1.00 131.25 ? 893  TRP A O     1 
ATOM   3799  C  CB    . TRP A 1  510 ? -73.971 -24.122 38.086  1.00 123.90 ? 893  TRP A CB    1 
ATOM   3800  C  CG    . TRP A 1  510 ? -73.947 -23.250 36.873  1.00 118.53 ? 893  TRP A CG    1 
ATOM   3801  C  CD1   . TRP A 1  510 ? -73.284 -22.067 36.718  1.00 117.45 ? 893  TRP A CD1   1 
ATOM   3802  C  CD2   . TRP A 1  510 ? -74.570 -23.527 35.614  1.00 119.81 ? 893  TRP A CD2   1 
ATOM   3803  N  NE1   . TRP A 1  510 ? -73.481 -21.579 35.453  1.00 118.58 ? 893  TRP A NE1   1 
ATOM   3804  C  CE2   . TRP A 1  510 ? -74.265 -22.457 34.754  1.00 117.83 ? 893  TRP A CE2   1 
ATOM   3805  C  CE3   . TRP A 1  510 ? -75.370 -24.569 35.136  1.00 119.87 ? 893  TRP A CE3   1 
ATOM   3806  C  CZ2   . TRP A 1  510 ? -74.730 -22.398 33.443  1.00 117.19 ? 893  TRP A CZ2   1 
ATOM   3807  C  CZ3   . TRP A 1  510 ? -75.830 -24.505 33.833  1.00 120.70 ? 893  TRP A CZ3   1 
ATOM   3808  C  CH2   . TRP A 1  510 ? -75.510 -23.429 33.004  1.00 117.00 ? 893  TRP A CH2   1 
ATOM   3809  N  N     . ARG A 1  511 ? -74.690 -21.143 39.750  1.00 135.20 ? 894  ARG A N     1 
ATOM   3810  C  CA    . ARG A 1  511 ? -73.998 -19.957 40.245  1.00 135.34 ? 894  ARG A CA    1 
ATOM   3811  C  C     . ARG A 1  511 ? -74.324 -19.612 41.701  1.00 129.10 ? 894  ARG A C     1 
ATOM   3812  O  O     . ARG A 1  511 ? -73.441 -19.135 42.423  1.00 133.18 ? 894  ARG A O     1 
ATOM   3813  C  CB    . ARG A 1  511 ? -74.287 -18.754 39.356  1.00 131.98 ? 894  ARG A CB    1 
ATOM   3814  C  CG    . ARG A 1  511 ? -73.325 -17.645 39.664  1.00 139.98 ? 894  ARG A CG    1 
ATOM   3815  C  CD    . ARG A 1  511 ? -73.606 -16.394 38.894  1.00 161.25 ? 894  ARG A CD    1 
ATOM   3816  N  NE    . ARG A 1  511 ? -72.841 -15.305 39.480  1.00 166.89 ? 894  ARG A NE    1 
ATOM   3817  C  CZ    . ARG A 1  511 ? -72.731 -14.096 38.952  1.00 168.04 ? 894  ARG A CZ    1 
ATOM   3818  N  NH1   . ARG A 1  511 ? -73.334 -13.812 37.806  1.00 171.06 ? 894  ARG A NH1   1 
ATOM   3819  N  NH2   . ARG A 1  511 ? -72.005 -13.177 39.570  1.00 171.93 ? 894  ARG A NH2   1 
ATOM   3820  N  N     . SER A 1  512 ? -75.552 -19.856 42.158  1.00 125.33 ? 895  SER A N     1 
ATOM   3821  C  CA    . SER A 1  512 ? -75.972 -19.421 43.487  1.00 129.92 ? 895  SER A CA    1 
ATOM   3822  C  C     . SER A 1  512 ? -75.142 -20.077 44.594  1.00 133.44 ? 895  SER A C     1 
ATOM   3823  O  O     . SER A 1  512 ? -74.464 -21.089 44.391  1.00 133.09 ? 895  SER A O     1 
ATOM   3824  C  CB    . SER A 1  512 ? -77.445 -19.740 43.713  1.00 132.97 ? 895  SER A CB    1 
ATOM   3825  O  OG    . SER A 1  512 ? -77.581 -20.851 44.578  1.00 127.12 ? 895  SER A OG    1 
ATOM   3826  N  N     . SER A 1  513 ? -75.213 -19.482 45.793  1.00 138.34 ? 896  SER A N     1 
ATOM   3827  C  CA    . SER A 1  513 ? -74.451 -19.975 46.941  1.00 138.63 ? 896  SER A CA    1 
ATOM   3828  C  C     . SER A 1  513 ? -75.190 -21.077 47.687  1.00 138.85 ? 896  SER A C     1 
ATOM   3829  O  O     . SER A 1  513 ? -74.553 -21.975 48.250  1.00 139.09 ? 896  SER A O     1 
ATOM   3830  C  CB    . SER A 1  513 ? -74.136 -18.838 47.917  1.00 139.53 ? 896  SER A CB    1 
ATOM   3831  O  OG    . SER A 1  513 ? -73.666 -17.683 47.247  1.00 142.87 ? 896  SER A OG    1 
ATOM   3832  N  N     . CYS A 1  514 ? -76.519 -21.006 47.733  1.00 136.76 ? 897  CYS A N     1 
ATOM   3833  C  CA    . CYS A 1  514 ? -77.346 -22.097 48.243  1.00 141.47 ? 897  CYS A CA    1 
ATOM   3834  C  C     . CYS A 1  514 ? -78.556 -22.197 47.324  1.00 145.67 ? 897  CYS A C     1 
ATOM   3835  O  O     . CYS A 1  514 ? -79.566 -21.506 47.521  1.00 146.77 ? 897  CYS A O     1 
ATOM   3836  C  CB    . CYS A 1  514 ? -77.756 -21.870 49.699  1.00 146.89 ? 897  CYS A CB    1 
ATOM   3837  S  SG    . CYS A 1  514 ? -78.434 -23.330 50.570  1.00 151.96 ? 897  CYS A SG    1 
ATOM   3838  N  N     . PRO A 1  515 ? -78.477 -23.038 46.285  1.00 143.23 ? 898  PRO A N     1 
ATOM   3839  C  CA    . PRO A 1  515 ? -79.607 -23.165 45.348  1.00 136.76 ? 898  PRO A CA    1 
ATOM   3840  C  C     . PRO A 1  515 ? -80.842 -23.804 45.956  1.00 137.44 ? 898  PRO A C     1 
ATOM   3841  O  O     . PRO A 1  515 ? -81.951 -23.563 45.462  1.00 141.82 ? 898  PRO A O     1 
ATOM   3842  C  CB    . PRO A 1  515 ? -79.025 -24.034 44.226  1.00 130.84 ? 898  PRO A CB    1 
ATOM   3843  C  CG    . PRO A 1  515 ? -77.965 -24.832 44.913  1.00 132.87 ? 898  PRO A CG    1 
ATOM   3844  C  CD    . PRO A 1  515 ? -77.341 -23.884 45.890  1.00 136.73 ? 898  PRO A CD    1 
ATOM   3845  N  N     . ALA A 1  516 ? -80.692 -24.622 47.000  1.00 132.50 ? 899  ALA A N     1 
ATOM   3846  C  CA    . ALA A 1  516 ? -81.867 -25.180 47.659  1.00 131.23 ? 899  ALA A CA    1 
ATOM   3847  C  C     . ALA A 1  516 ? -82.778 -24.085 48.203  1.00 133.92 ? 899  ALA A C     1 
ATOM   3848  O  O     . ALA A 1  516 ? -84.005 -24.217 48.146  1.00 129.76 ? 899  ALA A O     1 
ATOM   3849  C  CB    . ALA A 1  516 ? -81.435 -26.127 48.776  1.00 137.82 ? 899  ALA A CB    1 
ATOM   3850  N  N     . LYS A 1  517 ? -82.200 -22.989 48.702  1.00 141.19 ? 900  LYS A N     1 
ATOM   3851  C  CA    . LYS A 1  517 ? -82.943 -21.875 49.284  1.00 141.47 ? 900  LYS A CA    1 
ATOM   3852  C  C     . LYS A 1  517 ? -83.193 -20.728 48.311  1.00 139.16 ? 900  LYS A C     1 
ATOM   3853  O  O     . LYS A 1  517 ? -84.276 -20.139 48.326  1.00 145.51 ? 900  LYS A O     1 
ATOM   3854  C  CB    . LYS A 1  517 ? -82.198 -21.330 50.510  1.00 151.43 ? 900  LYS A CB    1 
ATOM   3855  C  CG    . LYS A 1  517 ? -81.976 -22.352 51.626  1.00 155.07 ? 900  LYS A CG    1 
ATOM   3856  C  CD    . LYS A 1  517 ? -81.405 -21.702 52.887  1.00 160.02 ? 900  LYS A CD    1 
ATOM   3857  C  CE    . LYS A 1  517 ? -81.084 -22.745 53.954  1.00 152.55 ? 900  LYS A CE    1 
ATOM   3858  N  NZ    . LYS A 1  517 ? -79.927 -23.607 53.570  1.00 158.52 ? 900  LYS A NZ    1 
ATOM   3859  N  N     . GLU A 1  518 ? -82.220 -20.390 47.464  1.00 136.06 ? 901  GLU A N     1 
ATOM   3860  C  CA    . GLU A 1  518 ? -82.327 -19.172 46.665  1.00 144.70 ? 901  GLU A CA    1 
ATOM   3861  C  C     . GLU A 1  518 ? -83.220 -19.350 45.440  1.00 146.74 ? 901  GLU A C     1 
ATOM   3862  O  O     . GLU A 1  518 ? -84.014 -18.456 45.118  1.00 150.49 ? 901  GLU A O     1 
ATOM   3863  C  CB    . GLU A 1  518 ? -80.935 -18.698 46.246  1.00 145.79 ? 901  GLU A CB    1 
ATOM   3864  C  CG    . GLU A 1  518 ? -80.196 -17.947 47.338  1.00 149.38 ? 901  GLU A CG    1 
ATOM   3865  C  CD    . GLU A 1  518 ? -78.825 -17.477 46.893  1.00 151.46 ? 901  GLU A CD    1 
ATOM   3866  O  OE1   . GLU A 1  518 ? -78.028 -18.322 46.440  1.00 151.45 ? 901  GLU A OE1   1 
ATOM   3867  O  OE2   . GLU A 1  518 ? -78.543 -16.264 46.986  1.00 161.20 ? 901  GLU A OE2   1 
ATOM   3868  N  N     . CYS A 1  519 ? -83.103 -20.478 44.739  1.00 141.61 ? 902  CYS A N     1 
ATOM   3869  C  CA    . CYS A 1  519 ? -83.842 -20.718 43.497  1.00 140.98 ? 902  CYS A CA    1 
ATOM   3870  C  C     . CYS A 1  519 ? -84.337 -22.157 43.474  1.00 139.91 ? 902  CYS A C     1 
ATOM   3871  O  O     . CYS A 1  519 ? -83.899 -22.970 42.654  1.00 143.40 ? 902  CYS A O     1 
ATOM   3872  C  CB    . CYS A 1  519 ? -82.967 -20.411 42.277  1.00 135.42 ? 902  CYS A CB    1 
ATOM   3873  S  SG    . CYS A 1  519 ? -81.396 -21.314 42.193  1.00 129.78 ? 902  CYS A SG    1 
ATOM   3874  N  N     . PRO A 1  520 ? -85.273 -22.505 44.361  1.00 143.62 ? 903  PRO A N     1 
ATOM   3875  C  CA    . PRO A 1  520 ? -85.697 -23.913 44.444  1.00 137.18 ? 903  PRO A CA    1 
ATOM   3876  C  C     . PRO A 1  520 ? -86.352 -24.423 43.170  1.00 141.37 ? 903  PRO A C     1 
ATOM   3877  O  O     . PRO A 1  520 ? -86.192 -25.605 42.837  1.00 140.10 ? 903  PRO A O     1 
ATOM   3878  C  CB    . PRO A 1  520 ? -86.667 -23.912 45.632  1.00 135.97 ? 903  PRO A CB    1 
ATOM   3879  C  CG    . PRO A 1  520 ? -87.193 -22.516 45.675  1.00 138.12 ? 903  PRO A CG    1 
ATOM   3880  C  CD    . PRO A 1  520 ? -86.039 -21.645 45.280  1.00 142.50 ? 903  PRO A CD    1 
ATOM   3881  N  N     . GLU A 1  521 ? -87.064 -23.568 42.428  1.00 145.05 ? 904  GLU A N     1 
ATOM   3882  C  CA    . GLU A 1  521 ? -87.664 -24.025 41.177  1.00 146.08 ? 904  GLU A CA    1 
ATOM   3883  C  C     . GLU A 1  521 ? -86.600 -24.281 40.115  1.00 143.61 ? 904  GLU A C     1 
ATOM   3884  O  O     . GLU A 1  521 ? -86.699 -25.251 39.354  1.00 145.11 ? 904  GLU A O     1 
ATOM   3885  C  CB    . GLU A 1  521 ? -88.695 -23.016 40.671  1.00 154.14 ? 904  GLU A CB    1 
ATOM   3886  C  CG    . GLU A 1  521 ? -89.632 -23.613 39.627  1.00 161.23 ? 904  GLU A CG    1 
ATOM   3887  C  CD    . GLU A 1  521 ? -90.233 -22.579 38.697  1.00 163.42 ? 904  GLU A CD    1 
ATOM   3888  O  OE1   . GLU A 1  521 ? -90.149 -21.370 39.001  1.00 162.97 ? 904  GLU A OE1   1 
ATOM   3889  O  OE2   . GLU A 1  521 ? -90.787 -22.985 37.652  1.00 168.40 ? 904  GLU A OE2   1 
ATOM   3890  N  N     . SER A 1  522 ? -85.580 -23.418 40.042  1.00 140.14 ? 905  SER A N     1 
ATOM   3891  C  CA    . SER A 1  522 ? -84.472 -23.657 39.118  1.00 142.36 ? 905  SER A CA    1 
ATOM   3892  C  C     . SER A 1  522 ? -83.804 -25.002 39.399  1.00 140.80 ? 905  SER A C     1 
ATOM   3893  O  O     . SER A 1  522 ? -83.525 -25.779 38.476  1.00 139.97 ? 905  SER A O     1 
ATOM   3894  C  CB    . SER A 1  522 ? -83.449 -22.517 39.208  1.00 136.15 ? 905  SER A CB    1 
ATOM   3895  O  OG    . SER A 1  522 ? -83.964 -21.292 38.713  1.00 134.55 ? 905  SER A OG    1 
ATOM   3896  N  N     . LEU A 1  523 ? -83.543 -25.296 40.678  1.00 134.71 ? 906  LEU A N     1 
ATOM   3897  C  CA    . LEU A 1  523 ? -82.916 -26.565 41.034  1.00 125.46 ? 906  LEU A CA    1 
ATOM   3898  C  C     . LEU A 1  523 ? -83.828 -27.733 40.711  1.00 128.52 ? 906  LEU A C     1 
ATOM   3899  O  O     . LEU A 1  523 ? -83.369 -28.772 40.224  1.00 135.13 ? 906  LEU A O     1 
ATOM   3900  C  CB    . LEU A 1  523 ? -82.547 -26.583 42.515  1.00 122.92 ? 906  LEU A CB    1 
ATOM   3901  C  CG    . LEU A 1  523 ? -81.890 -27.863 43.047  1.00 112.35 ? 906  LEU A CG    1 
ATOM   3902  C  CD1   . LEU A 1  523 ? -80.646 -28.224 42.249  1.00 113.84 ? 906  LEU A CD1   1 
ATOM   3903  C  CD2   . LEU A 1  523 ? -81.548 -27.711 44.516  1.00 117.36 ? 906  LEU A CD2   1 
ATOM   3904  N  N     . CYS A 1  524 ? -85.125 -27.583 40.978  1.00 135.65 ? 907  CYS A N     1 
ATOM   3905  C  CA    . CYS A 1  524 ? -86.049 -28.680 40.719  1.00 142.74 ? 907  CYS A CA    1 
ATOM   3906  C  C     . CYS A 1  524 ? -86.190 -28.958 39.225  1.00 139.13 ? 907  CYS A C     1 
ATOM   3907  O  O     . CYS A 1  524 ? -86.325 -30.118 38.827  1.00 140.21 ? 907  CYS A O     1 
ATOM   3908  C  CB    . CYS A 1  524 ? -87.412 -28.393 41.362  1.00 145.92 ? 907  CYS A CB    1 
ATOM   3909  S  SG    . CYS A 1  524 ? -87.540 -28.879 43.121  1.00 153.93 ? 907  CYS A SG    1 
ATOM   3910  N  N     . GLN A 1  525 ? -86.133 -27.929 38.381  1.00 137.20 ? 908  GLN A N     1 
ATOM   3911  C  CA    . GLN A 1  525 ? -86.309 -28.121 36.948  1.00 136.04 ? 908  GLN A CA    1 
ATOM   3912  C  C     . GLN A 1  525 ? -84.998 -28.209 36.183  1.00 133.16 ? 908  GLN A C     1 
ATOM   3913  O  O     . GLN A 1  525 ? -85.031 -28.245 34.949  1.00 131.89 ? 908  GLN A O     1 
ATOM   3914  C  CB    . GLN A 1  525 ? -87.159 -26.990 36.357  1.00 141.71 ? 908  GLN A CB    1 
ATOM   3915  C  CG    . GLN A 1  525 ? -88.514 -26.843 37.006  1.00 150.03 ? 908  GLN A CG    1 
ATOM   3916  C  CD    . GLN A 1  525 ? -89.265 -28.160 37.063  1.00 158.51 ? 908  GLN A CD    1 
ATOM   3917  O  OE1   . GLN A 1  525 ? -89.483 -28.810 36.038  1.00 160.13 ? 908  GLN A OE1   1 
ATOM   3918  N  NE2   . GLN A 1  525 ? -89.643 -28.574 38.267  1.00 159.64 ? 908  GLN A NE2   1 
ATOM   3919  N  N     . TYR A 1  526 ? -83.852 -28.198 36.870  1.00 128.80 ? 909  TYR A N     1 
ATOM   3920  C  CA    . TYR A 1  526 ? -82.576 -28.263 36.162  1.00 121.82 ? 909  TYR A CA    1 
ATOM   3921  C  C     . TYR A 1  526 ? -82.498 -29.482 35.254  1.00 120.58 ? 909  TYR A C     1 
ATOM   3922  O  O     . TYR A 1  526 ? -82.066 -29.376 34.101  1.00 117.34 ? 909  TYR A O     1 
ATOM   3923  C  CB    . TYR A 1  526 ? -81.405 -28.262 37.148  1.00 120.07 ? 909  TYR A CB    1 
ATOM   3924  C  CG    . TYR A 1  526 ? -80.041 -28.136 36.477  1.00 118.32 ? 909  TYR A CG    1 
ATOM   3925  C  CD1   . TYR A 1  526 ? -79.371 -29.252 35.998  1.00 120.58 ? 909  TYR A CD1   1 
ATOM   3926  C  CD2   . TYR A 1  526 ? -79.427 -26.898 36.322  1.00 120.42 ? 909  TYR A CD2   1 
ATOM   3927  C  CE1   . TYR A 1  526 ? -78.136 -29.142 35.383  1.00 117.62 ? 909  TYR A CE1   1 
ATOM   3928  C  CE2   . TYR A 1  526 ? -78.190 -26.778 35.711  1.00 110.97 ? 909  TYR A CE2   1 
ATOM   3929  C  CZ    . TYR A 1  526 ? -77.552 -27.901 35.243  1.00 113.85 ? 909  TYR A CZ    1 
ATOM   3930  O  OH    . TYR A 1  526 ? -76.323 -27.788 34.635  1.00 118.42 ? 909  TYR A OH    1 
ATOM   3931  N  N     . SER A 1  527 ? -82.891 -30.653 35.760  1.00 120.62 ? 910  SER A N     1 
ATOM   3932  C  CA    . SER A 1  527 ? -82.722 -31.872 34.976  1.00 121.64 ? 910  SER A CA    1 
ATOM   3933  C  C     . SER A 1  527 ? -83.632 -31.860 33.749  1.00 129.64 ? 910  SER A C     1 
ATOM   3934  O  O     . SER A 1  527 ? -83.206 -32.211 32.637  1.00 133.44 ? 910  SER A O     1 
ATOM   3935  C  CB    . SER A 1  527 ? -82.976 -33.099 35.853  1.00 115.53 ? 910  SER A CB    1 
ATOM   3936  O  OG    . SER A 1  527 ? -82.616 -34.295 35.182  1.00 129.25 ? 910  SER A OG    1 
ATOM   3937  N  N     . PHE A 1  528 ? -84.877 -31.411 33.922  1.00 128.26 ? 911  PHE A N     1 
ATOM   3938  C  CA    . PHE A 1  528 ? -85.806 -31.302 32.799  1.00 126.53 ? 911  PHE A CA    1 
ATOM   3939  C  C     . PHE A 1  528 ? -85.297 -30.306 31.758  1.00 126.41 ? 911  PHE A C     1 
ATOM   3940  O  O     . PHE A 1  528 ? -85.412 -30.525 30.542  1.00 125.63 ? 911  PHE A O     1 
ATOM   3941  C  CB    . PHE A 1  528 ? -87.181 -30.891 33.332  1.00 126.50 ? 911  PHE A CB    1 
ATOM   3942  C  CG    . PHE A 1  528 ? -88.189 -30.603 32.265  1.00 126.89 ? 911  PHE A CG    1 
ATOM   3943  C  CD1   . PHE A 1  528 ? -89.043 -31.593 31.824  1.00 130.84 ? 911  PHE A CD1   1 
ATOM   3944  C  CD2   . PHE A 1  528 ? -88.290 -29.337 31.713  1.00 128.02 ? 911  PHE A CD2   1 
ATOM   3945  C  CE1   . PHE A 1  528 ? -89.969 -31.333 30.846  1.00 137.10 ? 911  PHE A CE1   1 
ATOM   3946  C  CE2   . PHE A 1  528 ? -89.213 -29.068 30.728  1.00 131.35 ? 911  PHE A CE2   1 
ATOM   3947  C  CZ    . PHE A 1  528 ? -90.055 -30.065 30.294  1.00 138.34 ? 911  PHE A CZ    1 
ATOM   3948  N  N     . ASN A 1  529 ? -84.702 -29.210 32.233  1.00 122.47 ? 912  ASN A N     1 
ATOM   3949  C  CA    . ASN A 1  529 ? -84.243 -28.155 31.343  1.00 118.99 ? 912  ASN A CA    1 
ATOM   3950  C  C     . ASN A 1  529 ? -83.000 -28.570 30.579  1.00 117.84 ? 912  ASN A C     1 
ATOM   3951  O  O     . ASN A 1  529 ? -82.860 -28.240 29.400  1.00 117.98 ? 912  ASN A O     1 
ATOM   3952  C  CB    . ASN A 1  529 ? -83.993 -26.893 32.150  1.00 119.87 ? 912  ASN A CB    1 
ATOM   3953  C  CG    . ASN A 1  529 ? -85.265 -26.329 32.703  1.00 121.77 ? 912  ASN A CG    1 
ATOM   3954  O  OD1   . ASN A 1  529 ? -86.295 -26.367 32.039  1.00 123.94 ? 912  ASN A OD1   1 
ATOM   3955  N  ND2   . ASN A 1  529 ? -85.220 -25.832 33.932  1.00 128.17 ? 912  ASN A ND2   1 
ATOM   3956  N  N     . SER A 1  530 ? -82.094 -29.305 31.227  1.00 111.98 ? 913  SER A N     1 
ATOM   3957  C  CA    . SER A 1  530 ? -80.930 -29.821 30.514  1.00 110.27 ? 913  SER A CA    1 
ATOM   3958  C  C     . SER A 1  530 ? -81.328 -30.899 29.510  1.00 115.14 ? 913  SER A C     1 
ATOM   3959  O  O     . SER A 1  530 ? -80.734 -30.984 28.425  1.00 108.83 ? 913  SER A O     1 
ATOM   3960  C  CB    . SER A 1  530 ? -79.879 -30.352 31.498  1.00 109.65 ? 913  SER A CB    1 
ATOM   3961  O  OG    . SER A 1  530 ? -80.321 -31.504 32.195  1.00 117.32 ? 913  SER A OG    1 
ATOM   3962  N  N     . GLN A 1  531 ? -82.341 -31.711 29.831  1.00 116.94 ? 914  GLN A N     1 
ATOM   3963  C  CA    . GLN A 1  531 ? -82.864 -32.640 28.835  1.00 114.04 ? 914  GLN A CA    1 
ATOM   3964  C  C     . GLN A 1  531 ? -83.383 -31.893 27.614  1.00 119.37 ? 914  GLN A C     1 
ATOM   3965  O  O     . GLN A 1  531 ? -83.028 -32.222 26.477  1.00 126.76 ? 914  GLN A O     1 
ATOM   3966  C  CB    . GLN A 1  531 ? -83.962 -33.512 29.440  1.00 115.09 ? 914  GLN A CB    1 
ATOM   3967  C  CG    . GLN A 1  531 ? -83.454 -34.444 30.521  1.00 118.06 ? 914  GLN A CG    1 
ATOM   3968  C  CD    . GLN A 1  531 ? -84.556 -35.282 31.143  1.00 128.92 ? 914  GLN A CD    1 
ATOM   3969  O  OE1   . GLN A 1  531 ? -85.549 -35.606 30.486  1.00 136.42 ? 914  GLN A OE1   1 
ATOM   3970  N  NE2   . GLN A 1  531 ? -84.386 -35.638 32.421  1.00 115.79 ? 914  GLN A NE2   1 
ATOM   3971  N  N     . ARG A 1  532 ? -84.235 -30.888 27.824  1.00 119.73 ? 915  ARG A N     1 
ATOM   3972  C  CA    . ARG A 1  532 ? -84.740 -30.137 26.679  1.00 122.21 ? 915  ARG A CA    1 
ATOM   3973  C  C     . ARG A 1  532 ? -83.608 -29.439 25.934  1.00 120.14 ? 915  ARG A C     1 
ATOM   3974  O  O     . ARG A 1  532 ? -83.633 -29.340 24.704  1.00 123.96 ? 915  ARG A O     1 
ATOM   3975  C  CB    . ARG A 1  532 ? -85.792 -29.124 27.123  1.00 129.14 ? 915  ARG A CB    1 
ATOM   3976  C  CG    . ARG A 1  532 ? -86.328 -28.265 25.980  1.00 137.58 ? 915  ARG A CG    1 
ATOM   3977  C  CD    . ARG A 1  532 ? -87.219 -29.058 25.030  1.00 147.20 ? 915  ARG A CD    1 
ATOM   3978  N  NE    . ARG A 1  532 ? -87.675 -28.233 23.914  1.00 147.33 ? 915  ARG A NE    1 
ATOM   3979  C  CZ    . ARG A 1  532 ? -87.351 -28.448 22.643  1.00 152.09 ? 915  ARG A CZ    1 
ATOM   3980  N  NH1   . ARG A 1  532 ? -86.583 -29.481 22.313  1.00 148.06 ? 915  ARG A NH1   1 
ATOM   3981  N  NH2   . ARG A 1  532 ? -87.805 -27.637 21.697  1.00 155.85 ? 915  ARG A NH2   1 
ATOM   3982  N  N     . PHE A 1  533 ? -82.610 -28.945 26.665  1.00 123.38 ? 916  PHE A N     1 
ATOM   3983  C  CA    . PHE A 1  533 ? -81.454 -28.297 26.054  1.00 124.21 ? 916  PHE A CA    1 
ATOM   3984  C  C     . PHE A 1  533 ? -80.766 -29.239 25.075  1.00 118.96 ? 916  PHE A C     1 
ATOM   3985  O  O     . PHE A 1  533 ? -80.581 -28.912 23.895  1.00 123.67 ? 916  PHE A O     1 
ATOM   3986  C  CB    . PHE A 1  533 ? -80.511 -27.848 27.179  1.00 122.19 ? 916  PHE A CB    1 
ATOM   3987  C  CG    . PHE A 1  533 ? -79.343 -27.015 26.737  1.00 114.73 ? 916  PHE A CG    1 
ATOM   3988  C  CD1   . PHE A 1  533 ? -78.099 -27.593 26.552  1.00 115.81 ? 916  PHE A CD1   1 
ATOM   3989  C  CD2   . PHE A 1  533 ? -79.474 -25.647 26.574  1.00 114.07 ? 916  PHE A CD2   1 
ATOM   3990  C  CE1   . PHE A 1  533 ? -77.012 -26.833 26.175  1.00 113.72 ? 916  PHE A CE1   1 
ATOM   3991  C  CE2   . PHE A 1  533 ? -78.394 -24.879 26.196  1.00 123.67 ? 916  PHE A CE2   1 
ATOM   3992  C  CZ    . PHE A 1  533 ? -77.158 -25.474 25.995  1.00 118.02 ? 916  PHE A CZ    1 
ATOM   3993  N  N     . ALA A 1  534 ? -80.414 -30.434 25.549  1.00 111.85 ? 917  ALA A N     1 
ATOM   3994  C  CA    . ALA A 1  534 ? -79.747 -31.409 24.696  1.00 114.40 ? 917  ALA A CA    1 
ATOM   3995  C  C     . ALA A 1  534 ? -80.647 -31.875 23.557  1.00 126.52 ? 917  ALA A C     1 
ATOM   3996  O  O     . ALA A 1  534 ? -80.155 -32.163 22.460  1.00 129.26 ? 917  ALA A O     1 
ATOM   3997  C  CB    . ALA A 1  534 ? -79.288 -32.595 25.536  1.00 118.48 ? 917  ALA A CB    1 
ATOM   3998  N  N     . GLU A 1  535 ? -81.963 -31.939 23.782  1.00 129.93 ? 918  GLU A N     1 
ATOM   3999  C  CA    . GLU A 1  535 ? -82.865 -32.351 22.711  1.00 129.66 ? 918  GLU A CA    1 
ATOM   4000  C  C     . GLU A 1  535 ? -82.940 -31.287 21.621  1.00 131.25 ? 918  GLU A C     1 
ATOM   4001  O  O     . GLU A 1  535 ? -82.986 -31.608 20.425  1.00 136.31 ? 918  GLU A O     1 
ATOM   4002  C  CB    . GLU A 1  535 ? -84.247 -32.644 23.285  1.00 130.46 ? 918  GLU A CB    1 
ATOM   4003  C  CG    . GLU A 1  535 ? -85.246 -33.101 22.258  1.00 140.58 ? 918  GLU A CG    1 
ATOM   4004  C  CD    . GLU A 1  535 ? -86.642 -33.231 22.823  1.00 157.68 ? 918  GLU A CD    1 
ATOM   4005  O  OE1   . GLU A 1  535 ? -86.844 -32.868 24.003  1.00 154.45 ? 918  GLU A OE1   1 
ATOM   4006  O  OE2   . GLU A 1  535 ? -87.535 -33.698 22.084  1.00 172.64 ? 918  GLU A OE2   1 
ATOM   4007  N  N     . LEU A 1  536 ? -82.938 -30.014 22.021  1.00 127.12 ? 919  LEU A N     1 
ATOM   4008  C  CA    . LEU A 1  536 ? -82.882 -28.918 21.059  1.00 129.86 ? 919  LEU A CA    1 
ATOM   4009  C  C     . LEU A 1  536 ? -81.571 -28.933 20.279  1.00 131.32 ? 919  LEU A C     1 
ATOM   4010  O  O     . LEU A 1  536 ? -81.554 -28.668 19.071  1.00 136.19 ? 919  LEU A O     1 
ATOM   4011  C  CB    . LEU A 1  536 ? -83.064 -27.583 21.782  1.00 129.41 ? 919  LEU A CB    1 
ATOM   4012  C  CG    . LEU A 1  536 ? -83.289 -26.344 20.920  1.00 133.35 ? 919  LEU A CG    1 
ATOM   4013  C  CD1   . LEU A 1  536 ? -84.517 -26.527 20.049  1.00 141.05 ? 919  LEU A CD1   1 
ATOM   4014  C  CD2   . LEU A 1  536 ? -83.442 -25.135 21.813  1.00 136.76 ? 919  LEU A CD2   1 
ATOM   4015  N  N     . LEU A 1  537 ? -80.457 -29.234 20.952  1.00 126.53 ? 920  LEU A N     1 
ATOM   4016  C  CA    . LEU A 1  537 ? -79.192 -29.370 20.232  1.00 125.97 ? 920  LEU A CA    1 
ATOM   4017  C  C     . LEU A 1  537 ? -79.207 -30.555 19.270  1.00 128.88 ? 920  LEU A C     1 
ATOM   4018  O  O     . LEU A 1  537 ? -78.580 -30.495 18.206  1.00 133.93 ? 920  LEU A O     1 
ATOM   4019  C  CB    . LEU A 1  537 ? -78.032 -29.515 21.211  1.00 126.86 ? 920  LEU A CB    1 
ATOM   4020  C  CG    . LEU A 1  537 ? -77.594 -28.266 21.962  1.00 120.24 ? 920  LEU A CG    1 
ATOM   4021  C  CD1   . LEU A 1  537 ? -76.376 -28.620 22.762  1.00 115.97 ? 920  LEU A CD1   1 
ATOM   4022  C  CD2   . LEU A 1  537 ? -77.280 -27.145 21.001  1.00 123.15 ? 920  LEU A CD2   1 
ATOM   4023  N  N     . SER A 1  538 ? -79.909 -31.636 19.623  1.00 128.59 ? 921  SER A N     1 
ATOM   4024  C  CA    . SER A 1  538 ? -79.898 -32.845 18.804  1.00 134.03 ? 921  SER A CA    1 
ATOM   4025  C  C     . SER A 1  538 ? -80.843 -32.759 17.611  1.00 134.07 ? 921  SER A C     1 
ATOM   4026  O  O     . SER A 1  538 ? -80.609 -33.425 16.595  1.00 139.74 ? 921  SER A O     1 
ATOM   4027  C  CB    . SER A 1  538 ? -80.265 -34.064 19.654  1.00 139.30 ? 921  SER A CB    1 
ATOM   4028  O  OG    . SER A 1  538 ? -79.304 -34.298 20.672  1.00 140.60 ? 921  SER A OG    1 
ATOM   4029  N  N     . THR A 1  539 ? -81.910 -31.965 17.712  1.00 131.40 ? 922  THR A N     1 
ATOM   4030  C  CA    . THR A 1  539 ? -82.879 -31.840 16.626  1.00 136.47 ? 922  THR A CA    1 
ATOM   4031  C  C     . THR A 1  539 ? -82.586 -30.649 15.712  1.00 140.00 ? 922  THR A C     1 
ATOM   4032  O  O     . THR A 1  539 ? -82.355 -30.830 14.512  1.00 142.80 ? 922  THR A O     1 
ATOM   4033  C  CB    . THR A 1  539 ? -84.307 -31.753 17.194  1.00 135.92 ? 922  THR A CB    1 
ATOM   4034  O  OG1   . THR A 1  539 ? -84.436 -30.618 18.061  1.00 134.21 ? 922  THR A OG1   1 
ATOM   4035  C  CG2   . THR A 1  539 ? -84.636 -33.008 17.976  1.00 143.38 ? 922  THR A CG2   1 
ATOM   4036  N  N     . LYS A 1  540 ? -82.585 -29.431 16.255  1.00 134.50 ? 923  LYS A N     1 
ATOM   4037  C  CA    . LYS A 1  540 ? -82.464 -28.220 15.455  1.00 129.24 ? 923  LYS A CA    1 
ATOM   4038  C  C     . LYS A 1  540 ? -81.037 -27.683 15.399  1.00 133.07 ? 923  LYS A C     1 
ATOM   4039  O  O     . LYS A 1  540 ? -80.830 -26.541 14.976  1.00 145.18 ? 923  LYS A O     1 
ATOM   4040  C  CB    . LYS A 1  540 ? -83.409 -27.143 15.988  1.00 131.94 ? 923  LYS A CB    1 
ATOM   4041  C  CG    . LYS A 1  540 ? -84.880 -27.474 15.816  1.00 136.94 ? 923  LYS A CG    1 
ATOM   4042  C  CD    . LYS A 1  540 ? -85.750 -26.405 16.440  1.00 147.38 ? 923  LYS A CD    1 
ATOM   4043  C  CE    . LYS A 1  540 ? -87.208 -26.798 16.417  1.00 141.43 ? 923  LYS A CE    1 
ATOM   4044  N  NZ    . LYS A 1  540 ? -88.008 -25.792 17.156  1.00 149.17 ? 923  LYS A NZ    1 
ATOM   4045  N  N     . PHE A 1  541 ? -80.048 -28.477 15.811  1.00 128.63 ? 924  PHE A N     1 
ATOM   4046  C  CA    . PHE A 1  541 ? -78.653 -28.053 15.740  1.00 128.07 ? 924  PHE A CA    1 
ATOM   4047  C  C     . PHE A 1  541 ? -77.752 -29.247 15.436  1.00 133.91 ? 924  PHE A C     1 
ATOM   4048  O  O     . PHE A 1  541 ? -76.645 -29.355 15.973  1.00 129.58 ? 924  PHE A O     1 
ATOM   4049  C  CB    . PHE A 1  541 ? -78.203 -27.372 17.039  1.00 128.70 ? 924  PHE A CB    1 
ATOM   4050  C  CG    . PHE A 1  541 ? -78.776 -25.987 17.253  1.00 133.15 ? 924  PHE A CG    1 
ATOM   4051  C  CD1   . PHE A 1  541 ? -78.158 -24.871 16.715  1.00 134.04 ? 924  PHE A CD1   1 
ATOM   4052  C  CD2   . PHE A 1  541 ? -79.912 -25.801 18.026  1.00 137.20 ? 924  PHE A CD2   1 
ATOM   4053  C  CE1   . PHE A 1  541 ? -78.675 -23.611 16.922  1.00 133.81 ? 924  PHE A CE1   1 
ATOM   4054  C  CE2   . PHE A 1  541 ? -80.433 -24.531 18.236  1.00 127.67 ? 924  PHE A CE2   1 
ATOM   4055  C  CZ    . PHE A 1  541 ? -79.813 -23.444 17.683  1.00 129.55 ? 924  PHE A CZ    1 
ATOM   4056  N  N     . LYS A 1  542 ? -78.215 -30.153 14.563  1.00 140.08 ? 925  LYS A N     1 
ATOM   4057  C  CA    . LYS A 1  542 ? -77.484 -31.393 14.300  1.00 132.75 ? 925  LYS A CA    1 
ATOM   4058  C  C     . LYS A 1  542 ? -76.054 -31.139 13.853  1.00 129.43 ? 925  LYS A C     1 
ATOM   4059  O  O     . LYS A 1  542 ? -75.167 -31.955 14.125  1.00 132.12 ? 925  LYS A O     1 
ATOM   4060  C  CB    . LYS A 1  542 ? -78.195 -32.228 13.234  1.00 135.44 ? 925  LYS A CB    1 
ATOM   4061  C  CG    . LYS A 1  542 ? -79.553 -32.775 13.616  1.00 141.17 ? 925  LYS A CG    1 
ATOM   4062  C  CD    . LYS A 1  542 ? -80.014 -33.780 12.570  1.00 152.89 ? 925  LYS A CD    1 
ATOM   4063  C  CE    . LYS A 1  542 ? -81.524 -33.863 12.489  1.00 154.30 ? 925  LYS A CE    1 
ATOM   4064  N  NZ    . LYS A 1  542 ? -81.945 -34.746 11.367  1.00 161.86 ? 925  LYS A NZ    1 
ATOM   4065  N  N     . TYR A 1  543 ? -75.806 -30.021 13.172  1.00 128.86 ? 926  TYR A N     1 
ATOM   4066  C  CA    . TYR A 1  543 ? -74.484 -29.811 12.589  1.00 138.70 ? 926  TYR A CA    1 
ATOM   4067  C  C     . TYR A 1  543 ? -73.377 -29.777 13.639  1.00 140.93 ? 926  TYR A C     1 
ATOM   4068  O  O     . TYR A 1  543 ? -72.279 -30.272 13.383  1.00 144.90 ? 926  TYR A O     1 
ATOM   4069  C  CB    . TYR A 1  543 ? -74.469 -28.539 11.733  1.00 148.93 ? 926  TYR A CB    1 
ATOM   4070  C  CG    . TYR A 1  543 ? -74.917 -27.271 12.435  1.00 147.78 ? 926  TYR A CG    1 
ATOM   4071  C  CD1   . TYR A 1  543 ? -76.268 -26.972 12.579  1.00 141.73 ? 926  TYR A CD1   1 
ATOM   4072  C  CD2   . TYR A 1  543 ? -73.987 -26.357 12.918  1.00 139.88 ? 926  TYR A CD2   1 
ATOM   4073  C  CE1   . TYR A 1  543 ? -76.678 -25.820 13.202  1.00 142.53 ? 926  TYR A CE1   1 
ATOM   4074  C  CE2   . TYR A 1  543 ? -74.390 -25.200 13.544  1.00 143.93 ? 926  TYR A CE2   1 
ATOM   4075  C  CZ    . TYR A 1  543 ? -75.737 -24.934 13.683  1.00 144.23 ? 926  TYR A CZ    1 
ATOM   4076  O  OH    . TYR A 1  543 ? -76.152 -23.776 14.309  1.00 147.60 ? 926  TYR A OH    1 
ATOM   4077  N  N     . ARG A 1  544 ? -73.633 -29.240 14.827  1.00 142.71 ? 927  ARG A N     1 
ATOM   4078  C  CA    . ARG A 1  544 ? -72.570 -29.102 15.827  1.00 143.33 ? 927  ARG A CA    1 
ATOM   4079  C  C     . ARG A 1  544 ? -72.383 -30.391 16.632  1.00 137.45 ? 927  ARG A C     1 
ATOM   4080  O  O     . ARG A 1  544 ? -72.446 -30.408 17.856  1.00 148.87 ? 927  ARG A O     1 
ATOM   4081  C  CB    . ARG A 1  544 ? -72.845 -27.914 16.745  1.00 141.35 ? 927  ARG A CB    1 
ATOM   4082  C  CG    . ARG A 1  544 ? -71.696 -27.548 17.671  1.00 145.07 ? 927  ARG A CG    1 
ATOM   4083  C  CD    . ARG A 1  544 ? -70.521 -27.016 16.893  1.00 158.52 ? 927  ARG A CD    1 
ATOM   4084  N  NE    . ARG A 1  544 ? -69.276 -27.256 17.614  1.00 164.28 ? 927  ARG A NE    1 
ATOM   4085  C  CZ    . ARG A 1  544 ? -68.090 -27.394 17.030  1.00 164.66 ? 927  ARG A CZ    1 
ATOM   4086  N  NH1   . ARG A 1  544 ? -67.990 -27.319 15.709  1.00 167.83 ? 927  ARG A NH1   1 
ATOM   4087  N  NH2   . ARG A 1  544 ? -67.007 -27.616 17.765  1.00 157.46 ? 927  ARG A NH2   1 
ATOM   4088  N  N     . TYR A 1  545 ? -72.164 -31.491 15.916  1.00 125.60 ? 928  TYR A N     1 
ATOM   4089  C  CA    . TYR A 1  545 ? -71.821 -32.765 16.533  1.00 128.10 ? 928  TYR A CA    1 
ATOM   4090  C  C     . TYR A 1  545 ? -70.573 -33.280 15.844  1.00 134.13 ? 928  TYR A C     1 
ATOM   4091  O  O     . TYR A 1  545 ? -70.594 -33.545 14.637  1.00 135.24 ? 928  TYR A O     1 
ATOM   4092  C  CB    . TYR A 1  545 ? -72.951 -33.800 16.429  1.00 128.85 ? 928  TYR A CB    1 
ATOM   4093  C  CG    . TYR A 1  545 ? -72.437 -35.225 16.561  1.00 127.28 ? 928  TYR A CG    1 
ATOM   4094  C  CD1   . TYR A 1  545 ? -71.891 -35.683 17.756  1.00 128.80 ? 928  TYR A CD1   1 
ATOM   4095  C  CD2   . TYR A 1  545 ? -72.470 -36.099 15.486  1.00 124.58 ? 928  TYR A CD2   1 
ATOM   4096  C  CE1   . TYR A 1  545 ? -71.402 -36.981 17.880  1.00 119.95 ? 928  TYR A CE1   1 
ATOM   4097  C  CE2   . TYR A 1  545 ? -71.984 -37.393 15.598  1.00 122.02 ? 928  TYR A CE2   1 
ATOM   4098  C  CZ    . TYR A 1  545 ? -71.450 -37.830 16.798  1.00 121.81 ? 928  TYR A CZ    1 
ATOM   4099  O  OH    . TYR A 1  545 ? -70.964 -39.119 16.916  1.00 123.74 ? 928  TYR A OH    1 
ATOM   4100  N  N     . GLU A 1  546 ? -69.483 -33.399 16.594  1.00 135.39 ? 929  GLU A N     1 
ATOM   4101  C  CA    . GLU A 1  546 ? -68.247 -33.921 16.032  1.00 139.19 ? 929  GLU A CA    1 
ATOM   4102  C  C     . GLU A 1  546 ? -67.713 -35.108 16.819  1.00 137.78 ? 929  GLU A C     1 
ATOM   4103  O  O     . GLU A 1  546 ? -66.607 -35.582 16.529  1.00 144.10 ? 929  GLU A O     1 
ATOM   4104  C  CB    . GLU A 1  546 ? -67.187 -32.819 15.966  1.00 140.07 ? 929  GLU A CB    1 
ATOM   4105  C  CG    . GLU A 1  546 ? -67.711 -31.466 15.524  1.00 138.16 ? 929  GLU A CG    1 
ATOM   4106  C  CD    . GLU A 1  546 ? -66.645 -30.404 15.617  1.00 135.61 ? 929  GLU A CD    1 
ATOM   4107  O  OE1   . GLU A 1  546 ? -65.819 -30.493 16.551  1.00 137.52 ? 929  GLU A OE1   1 
ATOM   4108  O  OE2   . GLU A 1  546 ? -66.618 -29.501 14.755  1.00 130.05 ? 929  GLU A OE2   1 
ATOM   4109  N  N     . GLY A 1  547 ? -68.463 -35.611 17.796  1.00 127.21 ? 930  GLY A N     1 
ATOM   4110  C  CA    . GLY A 1  547 ? -67.911 -36.625 18.667  1.00 123.45 ? 930  GLY A CA    1 
ATOM   4111  C  C     . GLY A 1  547 ? -66.921 -36.063 19.656  1.00 120.59 ? 930  GLY A C     1 
ATOM   4112  O  O     . GLY A 1  547 ? -66.123 -36.809 20.225  1.00 118.27 ? 930  GLY A O     1 
ATOM   4113  N  N     . LYS A 1  548 ? -66.936 -34.755 19.861  1.00 121.08 ? 931  LYS A N     1 
ATOM   4114  C  CA    . LYS A 1  548 ? -66.038 -34.112 20.794  1.00 123.99 ? 931  LYS A CA    1 
ATOM   4115  C  C     . LYS A 1  548 ? -66.871 -33.334 21.802  1.00 121.06 ? 931  LYS A C     1 
ATOM   4116  O  O     . LYS A 1  548 ? -67.922 -32.791 21.458  1.00 115.00 ? 931  LYS A O     1 
ATOM   4117  C  CB    . LYS A 1  548 ? -65.062 -33.164 20.074  1.00 127.08 ? 931  LYS A CB    1 
ATOM   4118  C  CG    . LYS A 1  548 ? -64.828 -33.470 18.586  1.00 132.78 ? 931  LYS A CG    1 
ATOM   4119  C  CD    . LYS A 1  548 ? -63.432 -34.035 18.289  1.00 135.63 ? 931  LYS A CD    1 
ATOM   4120  C  CE    . LYS A 1  548 ? -62.674 -33.178 17.271  1.00 138.46 ? 931  LYS A CE    1 
ATOM   4121  N  NZ    . LYS A 1  548 ? -61.508 -32.459 17.874  1.00 133.55 ? 931  LYS A NZ    1 
ATOM   4122  N  N     . ILE A 1  549 ? -66.401 -33.304 23.034  1.00 117.01 ? 932  ILE A N     1 
ATOM   4123  C  CA    . ILE A 1  549 ? -67.004 -32.486 24.090  1.00 105.72 ? 932  ILE A CA    1 
ATOM   4124  C  C     . ILE A 1  549 ? -66.018 -32.364 25.237  1.00 105.68 ? 932  ILE A C     1 
ATOM   4125  O  O     . ILE A 1  549 ? -65.144 -33.219 25.415  1.00 103.87 ? 932  ILE A O     1 
ATOM   4126  C  CB    . ILE A 1  549 ? -68.344 -33.106 24.564  1.00 99.67  ? 932  ILE A CB    1 
ATOM   4127  C  CG1   . ILE A 1  549 ? -69.054 -32.187 25.536  1.00 104.84 ? 932  ILE A CG1   1 
ATOM   4128  C  CG2   . ILE A 1  549 ? -68.079 -34.315 25.367  1.00 94.26  ? 932  ILE A CG2   1 
ATOM   4129  C  CD1   . ILE A 1  549 ? -70.398 -32.759 25.881  1.00 100.75 ? 932  ILE A CD1   1 
ATOM   4130  N  N     . THR A 1  550 ? -66.163 -31.308 26.020  1.00 103.31 ? 933  THR A N     1 
ATOM   4131  C  CA    . THR A 1  550 ? -65.275 -31.006 27.128  1.00 102.09 ? 933  THR A CA    1 
ATOM   4132  C  C     . THR A 1  550 ? -65.828 -31.547 28.446  1.00 112.50 ? 933  THR A C     1 
ATOM   4133  O  O     . THR A 1  550 ? -67.036 -31.748 28.599  1.00 113.45 ? 933  THR A O     1 
ATOM   4134  C  CB    . THR A 1  550 ? -65.081 -29.495 27.236  1.00 109.76 ? 933  THR A CB    1 
ATOM   4135  O  OG1   . THR A 1  550 ? -66.356 -28.856 27.334  1.00 116.52 ? 933  THR A OG1   1 
ATOM   4136  C  CG2   . THR A 1  550 ? -64.339 -28.967 26.045  1.00 118.48 ? 933  THR A CG2   1 
ATOM   4137  N  N     . ASN A 1  551 ? -64.923 -31.789 29.401  1.00 108.96 ? 934  ASN A N     1 
ATOM   4138  C  CA    . ASN A 1  551 ? -65.336 -32.201 30.744  1.00 109.21 ? 934  ASN A CA    1 
ATOM   4139  C  C     . ASN A 1  551 ? -66.265 -31.188 31.380  1.00 109.23 ? 934  ASN A C     1 
ATOM   4140  O  O     . ASN A 1  551 ? -67.147 -31.554 32.159  1.00 115.76 ? 934  ASN A O     1 
ATOM   4141  C  CB    . ASN A 1  551 ? -64.132 -32.385 31.654  1.00 114.04 ? 934  ASN A CB    1 
ATOM   4142  C  CG    . ASN A 1  551 ? -62.837 -32.270 30.918  1.00 126.52 ? 934  ASN A CG    1 
ATOM   4143  O  OD1   . ASN A 1  551 ? -62.687 -32.828 29.827  1.00 132.32 ? 934  ASN A OD1   1 
ATOM   4144  N  ND2   . ASN A 1  551 ? -61.887 -31.537 31.491  1.00 133.54 ? 934  ASN A ND2   1 
ATOM   4145  N  N     . TYR A 1  552 ? -66.010 -29.901 31.139  1.00 106.07 ? 935  TYR A N     1 
ATOM   4146  C  CA    . TYR A 1  552 ? -66.832 -28.840 31.709  1.00 107.46 ? 935  TYR A CA    1 
ATOM   4147  C  C     . TYR A 1  552 ? -68.259 -28.918 31.201  1.00 101.57 ? 935  TYR A C     1 
ATOM   4148  O  O     . TYR A 1  552 ? -69.221 -28.772 31.969  1.00 104.99 ? 935  TYR A O     1 
ATOM   4149  C  CB    . TYR A 1  552 ? -66.221 -27.489 31.355  1.00 122.09 ? 935  TYR A CB    1 
ATOM   4150  C  CG    . TYR A 1  552 ? -64.768 -27.380 31.727  1.00 127.73 ? 935  TYR A CG    1 
ATOM   4151  C  CD1   . TYR A 1  552 ? -64.299 -27.976 32.892  1.00 129.73 ? 935  TYR A CD1   1 
ATOM   4152  C  CD2   . TYR A 1  552 ? -63.867 -26.677 30.935  1.00 126.63 ? 935  TYR A CD2   1 
ATOM   4153  C  CE1   . TYR A 1  552 ? -62.985 -27.886 33.265  1.00 133.18 ? 935  TYR A CE1   1 
ATOM   4154  C  CE2   . TYR A 1  552 ? -62.536 -26.585 31.298  1.00 138.98 ? 935  TYR A CE2   1 
ATOM   4155  C  CZ    . TYR A 1  552 ? -62.102 -27.195 32.470  1.00 142.46 ? 935  TYR A CZ    1 
ATOM   4156  O  OH    . TYR A 1  552 ? -60.784 -27.114 32.862  1.00 148.97 ? 935  TYR A OH    1 
ATOM   4157  N  N     . PHE A 1  553 ? -68.416 -29.138 29.901  1.00 101.39 ? 936  PHE A N     1 
ATOM   4158  C  CA    . PHE A 1  553 ? -69.753 -29.209 29.342  1.00 100.01 ? 936  PHE A CA    1 
ATOM   4159  C  C     . PHE A 1  553 ? -70.438 -30.488 29.780  1.00 104.62 ? 936  PHE A C     1 
ATOM   4160  O  O     . PHE A 1  553 ? -71.627 -30.482 30.136  1.00 102.14 ? 936  PHE A O     1 
ATOM   4161  C  CB    . PHE A 1  553 ? -69.675 -29.162 27.829  1.00 96.73  ? 936  PHE A CB    1 
ATOM   4162  C  CG    . PHE A 1  553 ? -70.816 -28.475 27.237  1.00 110.90 ? 936  PHE A CG    1 
ATOM   4163  C  CD1   . PHE A 1  553 ? -71.312 -27.381 27.892  1.00 117.07 ? 936  PHE A CD1   1 
ATOM   4164  C  CD2   . PHE A 1  553 ? -71.375 -28.854 26.035  1.00 113.89 ? 936  PHE A CD2   1 
ATOM   4165  C  CE1   . PHE A 1  553 ? -72.350 -26.674 27.396  1.00 127.52 ? 936  PHE A CE1   1 
ATOM   4166  C  CE2   . PHE A 1  553 ? -72.440 -28.129 25.522  1.00 122.29 ? 936  PHE A CE2   1 
ATOM   4167  C  CZ    . PHE A 1  553 ? -72.922 -27.040 26.212  1.00 128.96 ? 936  PHE A CZ    1 
ATOM   4168  N  N     . HIS A 1  554 ? -69.679 -31.601 29.744  1.00 101.68 ? 937  HIS A N     1 
ATOM   4169  C  CA    . HIS A 1  554 ? -70.169 -32.911 30.185  1.00 94.57  ? 937  HIS A CA    1 
ATOM   4170  C  C     . HIS A 1  554 ? -70.649 -32.813 31.634  1.00 97.60  ? 937  HIS A C     1 
ATOM   4171  O  O     . HIS A 1  554 ? -71.775 -33.213 31.940  1.00 106.79 ? 937  HIS A O     1 
ATOM   4172  C  CB    . HIS A 1  554 ? -69.100 -34.021 29.949  1.00 87.53  ? 937  HIS A CB    1 
ATOM   4173  C  CG    . HIS A 1  554 ? -69.379 -35.311 30.659  1.00 89.28  ? 937  HIS A CG    1 
ATOM   4174  N  ND1   . HIS A 1  554 ? -70.461 -36.111 30.353  1.00 91.18  ? 937  HIS A ND1   1 
ATOM   4175  C  CD2   . HIS A 1  554 ? -68.709 -35.963 31.638  1.00 93.17  ? 937  HIS A CD2   1 
ATOM   4176  C  CE1   . HIS A 1  554 ? -70.495 -37.164 31.154  1.00 98.06  ? 937  HIS A CE1   1 
ATOM   4177  N  NE2   . HIS A 1  554 ? -69.435 -37.102 31.947  1.00 82.58  ? 937  HIS A NE2   1 
ATOM   4178  N  N     . LYS A 1  555 ? -69.847 -32.203 32.528  1.00 87.81  ? 938  LYS A N     1 
ATOM   4179  C  CA    . LYS A 1  555 ? -70.240 -32.110 33.936  1.00 84.82  ? 938  LYS A CA    1 
ATOM   4180  C  C     . LYS A 1  555 ? -71.434 -31.195 34.119  1.00 97.54  ? 938  LYS A C     1 
ATOM   4181  O  O     . LYS A 1  555 ? -72.308 -31.480 34.948  1.00 98.86  ? 938  LYS A O     1 
ATOM   4182  C  CB    . LYS A 1  555 ? -69.071 -31.638 34.798  1.00 85.27  ? 938  LYS A CB    1 
ATOM   4183  C  CG    . LYS A 1  555 ? -68.000 -32.670 34.925  1.00 85.17  ? 938  LYS A CG    1 
ATOM   4184  C  CD    . LYS A 1  555 ? -66.815 -32.211 35.716  1.00 103.86 ? 938  LYS A CD    1 
ATOM   4185  C  CE    . LYS A 1  555 ? -65.761 -33.313 35.669  1.00 106.77 ? 938  LYS A CE    1 
ATOM   4186  N  NZ    . LYS A 1  555 ? -64.516 -32.925 36.379  1.00 121.18 ? 938  LYS A NZ    1 
ATOM   4187  N  N     . THR A 1  556 ? -71.494 -30.110 33.336  1.00 97.67  ? 939  THR A N     1 
ATOM   4188  C  CA    . THR A 1  556 ? -72.602 -29.160 33.432  1.00 104.77 ? 939  THR A CA    1 
ATOM   4189  C  C     . THR A 1  556 ? -73.937 -29.788 33.041  1.00 107.84 ? 939  THR A C     1 
ATOM   4190  O  O     . THR A 1  556 ? -74.969 -29.516 33.670  1.00 98.48  ? 939  THR A O     1 
ATOM   4191  C  CB    . THR A 1  556 ? -72.339 -27.945 32.545  1.00 96.99  ? 939  THR A CB    1 
ATOM   4192  O  OG1   . THR A 1  556 ? -71.061 -27.382 32.852  1.00 96.59  ? 939  THR A OG1   1 
ATOM   4193  C  CG2   . THR A 1  556 ? -73.421 -26.911 32.742  1.00 105.70 ? 939  THR A CG2   1 
ATOM   4194  N  N     . LEU A 1  557 ? -73.951 -30.576 31.959  1.00 108.96 ? 940  LEU A N     1 
ATOM   4195  C  CA    . LEU A 1  557 ? -75.196 -31.158 31.471  1.00 103.26 ? 940  LEU A CA    1 
ATOM   4196  C  C     . LEU A 1  557 ? -75.573 -32.435 32.196  1.00 107.00 ? 940  LEU A C     1 
ATOM   4197  O  O     . LEU A 1  557 ? -76.764 -32.750 32.292  1.00 120.96 ? 940  LEU A O     1 
ATOM   4198  C  CB    . LEU A 1  557 ? -75.073 -31.460 29.975  1.00 98.30  ? 940  LEU A CB    1 
ATOM   4199  C  CG    . LEU A 1  557 ? -74.841 -30.195 29.163  1.00 95.28  ? 940  LEU A CG    1 
ATOM   4200  C  CD1   . LEU A 1  557 ? -74.715 -30.442 27.661  1.00 97.62  ? 940  LEU A CD1   1 
ATOM   4201  C  CD2   . LEU A 1  557 ? -76.000 -29.277 29.463  1.00 105.09 ? 940  LEU A CD2   1 
ATOM   4202  N  N     . ALA A 1  558 ? -74.598 -33.140 32.756  1.00 99.24  ? 941  ALA A N     1 
ATOM   4203  C  CA    . ALA A 1  558 ? -74.837 -34.469 33.290  1.00 98.90  ? 941  ALA A CA    1 
ATOM   4204  C  C     . ALA A 1  558 ? -74.803 -34.550 34.801  1.00 96.52  ? 941  ALA A C     1 
ATOM   4205  O  O     . ALA A 1  558 ? -75.517 -35.377 35.373  1.00 100.03 ? 941  ALA A O     1 
ATOM   4206  C  CB    . ALA A 1  558 ? -73.801 -35.457 32.734  1.00 95.11  ? 941  ALA A CB    1 
ATOM   4207  N  N     . HIS A 1  559 ? -73.966 -33.759 35.474  1.00 93.21  ? 942  HIS A N     1 
ATOM   4208  C  CA    . HIS A 1  559 ? -73.690 -34.007 36.886  1.00 93.02  ? 942  HIS A CA    1 
ATOM   4209  C  C     . HIS A 1  559 ? -74.052 -32.846 37.800  1.00 95.16  ? 942  HIS A C     1 
ATOM   4210  O  O     . HIS A 1  559 ? -73.795 -32.935 39.001  1.00 100.09 ? 942  HIS A O     1 
ATOM   4211  C  CB    . HIS A 1  559 ? -72.212 -34.379 37.125  1.00 104.45 ? 942  HIS A CB    1 
ATOM   4212  C  CG    . HIS A 1  559 ? -71.805 -35.679 36.524  1.00 95.74  ? 942  HIS A CG    1 
ATOM   4213  N  ND1   . HIS A 1  559 ? -72.642 -36.772 36.512  1.00 95.55  ? 942  HIS A ND1   1 
ATOM   4214  C  CD2   . HIS A 1  559 ? -70.654 -36.062 35.904  1.00 109.56 ? 942  HIS A CD2   1 
ATOM   4215  C  CE1   . HIS A 1  559 ? -72.031 -37.773 35.895  1.00 104.82 ? 942  HIS A CE1   1 
ATOM   4216  N  NE2   . HIS A 1  559 ? -70.820 -37.373 35.517  1.00 98.03  ? 942  HIS A NE2   1 
ATOM   4217  N  N     . VAL A 1  560 ? -74.669 -31.783 37.303  1.00 97.81  ? 943  VAL A N     1 
ATOM   4218  C  CA    . VAL A 1  560 ? -74.888 -30.636 38.181  1.00 100.43 ? 943  VAL A CA    1 
ATOM   4219  C  C     . VAL A 1  560 ? -75.885 -31.009 39.276  1.00 100.33 ? 943  VAL A C     1 
ATOM   4220  O  O     . VAL A 1  560 ? -75.613 -30.739 40.457  1.00 107.71 ? 943  VAL A O     1 
ATOM   4221  C  CB    . VAL A 1  560 ? -75.320 -29.392 37.387  1.00 104.72 ? 943  VAL A CB    1 
ATOM   4222  C  CG1   . VAL A 1  560 ? -76.020 -28.442 38.282  1.00 94.29  ? 943  VAL A CG1   1 
ATOM   4223  C  CG2   . VAL A 1  560 ? -74.090 -28.731 36.744  1.00 106.19 ? 943  VAL A CG2   1 
ATOM   4224  N  N     . PRO A 1  561 ? -77.034 -31.622 38.964  1.00 94.74  ? 944  PRO A N     1 
ATOM   4225  C  CA    . PRO A 1  561 ? -77.968 -31.947 40.053  1.00 94.94  ? 944  PRO A CA    1 
ATOM   4226  C  C     . PRO A 1  561 ? -77.429 -32.947 41.073  1.00 92.76  ? 944  PRO A C     1 
ATOM   4227  O  O     . PRO A 1  561 ? -77.721 -32.819 42.273  1.00 92.69  ? 944  PRO A O     1 
ATOM   4228  C  CB    . PRO A 1  561 ? -79.195 -32.488 39.314  1.00 103.25 ? 944  PRO A CB    1 
ATOM   4229  C  CG    . PRO A 1  561 ? -79.105 -31.945 37.942  1.00 101.22 ? 944  PRO A CG    1 
ATOM   4230  C  CD    . PRO A 1  561 ? -77.644 -31.889 37.648  1.00 93.44  ? 944  PRO A CD    1 
ATOM   4231  N  N     . GLU A 1  562 ? -76.688 -33.966 40.626  1.00 95.53  ? 945  GLU A N     1 
ATOM   4232  C  CA    . GLU A 1  562 ? -76.086 -34.905 41.566  1.00 97.84  ? 945  GLU A CA    1 
ATOM   4233  C  C     . GLU A 1  562 ? -75.042 -34.218 42.438  1.00 98.99  ? 945  GLU A C     1 
ATOM   4234  O  O     . GLU A 1  562 ? -74.966 -34.486 43.640  1.00 104.87 ? 945  GLU A O     1 
ATOM   4235  C  CB    . GLU A 1  562 ? -75.483 -36.075 40.807  1.00 103.49 ? 945  GLU A CB    1 
ATOM   4236  C  CG    . GLU A 1  562 ? -76.329 -36.552 39.662  1.00 104.75 ? 945  GLU A CG    1 
ATOM   4237  C  CD    . GLU A 1  562 ? -75.727 -37.765 39.004  1.00 111.33 ? 945  GLU A CD    1 
ATOM   4238  O  OE1   . GLU A 1  562 ? -75.208 -38.643 39.737  1.00 110.21 ? 945  GLU A OE1   1 
ATOM   4239  O  OE2   . GLU A 1  562 ? -75.706 -37.803 37.752  1.00 110.19 ? 945  GLU A OE2   1 
ATOM   4240  N  N     . ILE A 1  563 ? -74.248 -33.304 41.864  1.00 101.93 ? 946  ILE A N     1 
ATOM   4241  C  CA    . ILE A 1  563 ? -73.241 -32.612 42.669  1.00 101.68 ? 946  ILE A CA    1 
ATOM   4242  C  C     . ILE A 1  563 ? -73.905 -31.666 43.670  1.00 108.33 ? 946  ILE A C     1 
ATOM   4243  O  O     . ILE A 1  563 ? -73.420 -31.500 44.795  1.00 111.78 ? 946  ILE A O     1 
ATOM   4244  C  CB    . ILE A 1  563 ? -72.231 -31.856 41.787  1.00 92.60  ? 946  ILE A CB    1 
ATOM   4245  C  CG1   . ILE A 1  563 ? -71.325 -32.815 41.024  1.00 98.72  ? 946  ILE A CG1   1 
ATOM   4246  C  CG2   . ILE A 1  563 ? -71.351 -30.971 42.647  1.00 97.42  ? 946  ILE A CG2   1 
ATOM   4247  C  CD1   . ILE A 1  563 ? -70.529 -32.102 39.959  1.00 100.89 ? 946  ILE A CD1   1 
ATOM   4248  N  N     . ILE A 1  564 ? -74.997 -31.001 43.275  1.00 106.52 ? 947  ILE A N     1 
ATOM   4249  C  CA    . ILE A 1  564 ? -75.741 -30.165 44.223  1.00 102.98 ? 947  ILE A CA    1 
ATOM   4250  C  C     . ILE A 1  564 ? -76.264 -31.016 45.374  1.00 100.95 ? 947  ILE A C     1 
ATOM   4251  O  O     . ILE A 1  564 ? -76.039 -30.717 46.554  1.00 103.98 ? 947  ILE A O     1 
ATOM   4252  C  CB    . ILE A 1  564 ? -76.899 -29.436 43.517  1.00 104.21 ? 947  ILE A CB    1 
ATOM   4253  C  CG1   . ILE A 1  564 ? -76.376 -28.420 42.498  1.00 102.70 ? 947  ILE A CG1   1 
ATOM   4254  C  CG2   . ILE A 1  564 ? -77.825 -28.766 44.516  1.00 114.31 ? 947  ILE A CG2   1 
ATOM   4255  C  CD1   . ILE A 1  564 ? -75.916 -27.101 43.090  1.00 114.07 ? 947  ILE A CD1   1 
ATOM   4256  N  N     . GLU A 1  565 ? -76.960 -32.111 45.043  1.00 99.15  ? 948  GLU A N     1 
ATOM   4257  C  CA    . GLU A 1  565 ? -77.475 -32.991 46.087  1.00 106.58 ? 948  GLU A CA    1 
ATOM   4258  C  C     . GLU A 1  565 ? -76.358 -33.560 46.958  1.00 108.27 ? 948  GLU A C     1 
ATOM   4259  O  O     . GLU A 1  565 ? -76.608 -33.914 48.115  1.00 114.59 ? 948  GLU A O     1 
ATOM   4260  C  CB    . GLU A 1  565 ? -78.349 -34.081 45.436  1.00 119.48 ? 948  GLU A CB    1 
ATOM   4261  C  CG    . GLU A 1  565 ? -77.808 -35.493 45.427  1.00 120.88 ? 948  GLU A CG    1 
ATOM   4262  C  CD    . GLU A 1  565 ? -78.813 -36.460 44.817  1.00 131.85 ? 948  GLU A CD    1 
ATOM   4263  O  OE1   . GLU A 1  565 ? -78.499 -37.125 43.799  1.00 140.03 ? 948  GLU A OE1   1 
ATOM   4264  O  OE2   . GLU A 1  565 ? -79.943 -36.513 45.343  1.00 139.57 ? 948  GLU A OE2   1 
ATOM   4265  N  N     . ARG A 1  566 ? -75.145 -33.696 46.416  1.00 109.32 ? 949  ARG A N     1 
ATOM   4266  C  CA    . ARG A 1  566 ? -74.038 -34.184 47.228  1.00 104.52 ? 949  ARG A CA    1 
ATOM   4267  C  C     . ARG A 1  566 ? -73.457 -33.098 48.128  1.00 97.80  ? 949  ARG A C     1 
ATOM   4268  O  O     . ARG A 1  566 ? -73.068 -33.394 49.257  1.00 104.52 ? 949  ARG A O     1 
ATOM   4269  C  CB    . ARG A 1  566 ? -72.925 -34.765 46.338  1.00 105.14 ? 949  ARG A CB    1 
ATOM   4270  C  CG    . ARG A 1  566 ? -71.712 -35.306 47.127  1.00 104.46 ? 949  ARG A CG    1 
ATOM   4271  C  CD    . ARG A 1  566 ? -70.560 -35.690 46.201  1.00 102.36 ? 949  ARG A CD    1 
ATOM   4272  N  NE    . ARG A 1  566 ? -70.008 -34.525 45.515  1.00 101.90 ? 949  ARG A NE    1 
ATOM   4273  C  CZ    . ARG A 1  566 ? -69.188 -34.587 44.470  1.00 104.21 ? 949  ARG A CZ    1 
ATOM   4274  N  NH1   . ARG A 1  566 ? -68.822 -35.768 43.980  1.00 102.43 ? 949  ARG A NH1   1 
ATOM   4275  N  NH2   . ARG A 1  566 ? -68.735 -33.464 43.917  1.00 104.30 ? 949  ARG A NH2   1 
ATOM   4276  N  N     . ASP A 1  567 ? -73.376 -31.853 47.659  1.00 98.02  ? 950  ASP A N     1 
ATOM   4277  C  CA    . ASP A 1  567 ? -72.677 -30.791 48.385  1.00 109.02 ? 950  ASP A CA    1 
ATOM   4278  C  C     . ASP A 1  567 ? -73.561 -29.607 48.767  1.00 113.85 ? 950  ASP A C     1 
ATOM   4279  O  O     . ASP A 1  567 ? -73.120 -28.755 49.547  1.00 114.61 ? 950  ASP A O     1 
ATOM   4280  C  CB    . ASP A 1  567 ? -71.498 -30.239 47.553  1.00 122.70 ? 950  ASP A CB    1 
ATOM   4281  C  CG    . ASP A 1  567 ? -70.536 -31.313 47.078  1.00 116.51 ? 950  ASP A CG    1 
ATOM   4282  O  OD1   . ASP A 1  567 ? -70.461 -32.398 47.697  1.00 112.62 ? 950  ASP A OD1   1 
ATOM   4283  O  OD2   . ASP A 1  567 ? -69.818 -31.038 46.089  1.00 105.89 ? 950  ASP A OD2   1 
ATOM   4284  N  N     . GLY A 1  568 ? -74.771 -29.510 48.221  1.00 111.65 ? 951  GLY A N     1 
ATOM   4285  C  CA    . GLY A 1  568 ? -75.621 -28.376 48.473  1.00 110.30 ? 951  GLY A CA    1 
ATOM   4286  C  C     . GLY A 1  568 ? -75.387 -27.178 47.574  1.00 111.65 ? 951  GLY A C     1 
ATOM   4287  O  O     . GLY A 1  568 ? -76.302 -26.357 47.414  1.00 119.57 ? 951  GLY A O     1 
ATOM   4288  N  N     . SER A 1  569 ? -74.200 -27.056 46.974  1.00 115.65 ? 952  SER A N     1 
ATOM   4289  C  CA    . SER A 1  569 ? -73.835 -25.884 46.176  1.00 118.14 ? 952  SER A CA    1 
ATOM   4290  C  C     . SER A 1  569 ? -72.701 -26.218 45.208  1.00 112.06 ? 952  SER A C     1 
ATOM   4291  O  O     . SER A 1  569 ? -72.070 -27.274 45.303  1.00 114.55 ? 952  SER A O     1 
ATOM   4292  C  CB    . SER A 1  569 ? -73.447 -24.706 47.081  1.00 129.38 ? 952  SER A CB    1 
ATOM   4293  O  OG    . SER A 1  569 ? -72.144 -24.882 47.628  1.00 132.67 ? 952  SER A OG    1 
ATOM   4294  N  N     . ILE A 1  570 ? -72.446 -25.277 44.279  1.00 114.28 ? 953  ILE A N     1 
ATOM   4295  C  CA    . ILE A 1  570 ? -71.358 -25.336 43.297  1.00 126.29 ? 953  ILE A CA    1 
ATOM   4296  C  C     . ILE A 1  570 ? -70.350 -24.200 43.532  1.00 135.49 ? 953  ILE A C     1 
ATOM   4297  O  O     . ILE A 1  570 ? -69.179 -24.457 43.841  1.00 134.15 ? 953  ILE A O     1 
ATOM   4298  C  CB    . ILE A 1  570 ? -71.911 -25.301 41.850  1.00 119.82 ? 953  ILE A CB    1 
ATOM   4299  C  CG1   . ILE A 1  570 ? -72.754 -26.549 41.530  1.00 115.20 ? 953  ILE A CG1   1 
ATOM   4300  C  CG2   . ILE A 1  570 ? -70.795 -25.128 40.816  1.00 119.78 ? 953  ILE A CG2   1 
ATOM   4301  C  CD1   . ILE A 1  570 ? -71.965 -27.792 41.061  1.00 112.41 ? 953  ILE A CD1   1 
ATOM   4302  N  N     . GLY A 1  571 ? -70.794 -22.936 43.419  1.00 135.46 ? 954  GLY A N     1 
ATOM   4303  C  CA    . GLY A 1  571 ? -69.883 -21.786 43.376  1.00 137.19 ? 954  GLY A CA    1 
ATOM   4304  C  C     . GLY A 1  571 ? -68.898 -21.681 44.528  1.00 144.99 ? 954  GLY A C     1 
ATOM   4305  O  O     . GLY A 1  571 ? -67.860 -21.015 44.385  1.00 148.16 ? 954  GLY A O     1 
ATOM   4306  N  N     . ALA A 1  572 ? -69.191 -22.336 45.652  1.00 145.33 ? 955  ALA A N     1 
ATOM   4307  C  CA    . ALA A 1  572 ? -68.396 -22.298 46.877  1.00 146.07 ? 955  ALA A CA    1 
ATOM   4308  C  C     . ALA A 1  572 ? -67.279 -23.331 46.918  1.00 143.79 ? 955  ALA A C     1 
ATOM   4309  O  O     . ALA A 1  572 ? -66.361 -23.202 47.735  1.00 141.36 ? 955  ALA A O     1 
ATOM   4310  C  CB    . ALA A 1  572 ? -69.312 -22.513 48.085  1.00 144.57 ? 955  ALA A CB    1 
ATOM   4311  N  N     . TRP A 1  573 ? -67.344 -24.363 46.085  1.00 151.26 ? 956  TRP A N     1 
ATOM   4312  C  CA    . TRP A 1  573 ? -66.250 -25.326 45.956  1.00 153.07 ? 956  TRP A CA    1 
ATOM   4313  C  C     . TRP A 1  573 ? -65.456 -25.081 44.676  1.00 153.71 ? 956  TRP A C     1 
ATOM   4314  O  O     . TRP A 1  573 ? -65.033 -26.016 43.985  1.00 141.36 ? 956  TRP A O     1 
ATOM   4315  C  CB    . TRP A 1  573 ? -66.790 -26.754 46.025  1.00 140.51 ? 956  TRP A CB    1 
ATOM   4316  C  CG    . TRP A 1  573 ? -67.797 -26.944 47.139  1.00 140.28 ? 956  TRP A CG    1 
ATOM   4317  C  CD1   . TRP A 1  573 ? -69.117 -26.586 47.121  1.00 140.04 ? 956  TRP A CD1   1 
ATOM   4318  C  CD2   . TRP A 1  573 ? -67.562 -27.527 48.430  1.00 137.25 ? 956  TRP A CD2   1 
ATOM   4319  N  NE1   . TRP A 1  573 ? -69.717 -26.910 48.318  1.00 134.82 ? 956  TRP A NE1   1 
ATOM   4320  C  CE2   . TRP A 1  573 ? -68.785 -27.490 49.139  1.00 136.74 ? 956  TRP A CE2   1 
ATOM   4321  C  CE3   . TRP A 1  573 ? -66.438 -28.076 49.055  1.00 133.29 ? 956  TRP A CE3   1 
ATOM   4322  C  CZ2   . TRP A 1  573 ? -68.912 -27.984 50.443  1.00 129.96 ? 956  TRP A CZ2   1 
ATOM   4323  C  CZ3   . TRP A 1  573 ? -66.567 -28.574 50.354  1.00 126.35 ? 956  TRP A CZ3   1 
ATOM   4324  C  CH2   . TRP A 1  573 ? -67.795 -28.521 51.031  1.00 123.74 ? 956  TRP A CH2   1 
ATOM   4325  N  N     . ALA A 1  574 ? -65.235 -23.805 44.360  1.00 159.06 ? 957  ALA A N     1 
ATOM   4326  C  CA    . ALA A 1  574 ? -64.553 -23.364 43.156  1.00 155.65 ? 957  ALA A CA    1 
ATOM   4327  C  C     . ALA A 1  574 ? -63.039 -23.527 43.279  1.00 161.17 ? 957  ALA A C     1 
ATOM   4328  O  O     . ALA A 1  574 ? -62.481 -23.699 44.369  1.00 164.66 ? 957  ALA A O     1 
ATOM   4329  C  CB    . ALA A 1  574 ? -64.899 -21.901 42.850  1.00 150.01 ? 957  ALA A CB    1 
ATOM   4330  N  N     . SER A 1  575 ? -62.376 -23.462 42.123  1.00 161.83 ? 958  SER A N     1 
ATOM   4331  C  CA    . SER A 1  575 ? -60.926 -23.540 42.010  1.00 162.53 ? 958  SER A CA    1 
ATOM   4332  C  C     . SER A 1  575 ? -60.249 -22.160 41.940  1.00 162.53 ? 958  SER A C     1 
ATOM   4333  O  O     . SER A 1  575 ? -59.080 -22.080 41.547  1.00 162.38 ? 958  SER A O     1 
ATOM   4334  C  CB    . SER A 1  575 ? -60.559 -24.387 40.783  1.00 156.86 ? 958  SER A CB    1 
ATOM   4335  O  OG    . SER A 1  575 ? -61.247 -23.933 39.626  1.00 148.53 ? 958  SER A OG    1 
ATOM   4336  N  N     . GLU A 1  576 ? -60.930 -21.085 42.375  1.00 161.80 ? 959  GLU A N     1 
ATOM   4337  C  CA    . GLU A 1  576 ? -60.559 -19.701 42.040  1.00 170.62 ? 959  GLU A CA    1 
ATOM   4338  C  C     . GLU A 1  576 ? -59.483 -19.044 42.919  1.00 174.78 ? 959  GLU A C     1 
ATOM   4339  O  O     . GLU A 1  576 ? -58.711 -18.226 42.412  1.00 166.99 ? 959  GLU A O     1 
ATOM   4340  C  CB    . GLU A 1  576 ? -61.803 -18.804 42.071  1.00 161.59 ? 959  GLU A CB    1 
ATOM   4341  N  N     . GLY A 1  577 ? -59.389 -19.327 44.218  1.00 172.45 ? 960  GLY A N     1 
ATOM   4342  C  CA    . GLY A 1  577 ? -58.605 -18.437 45.070  1.00 162.27 ? 960  GLY A CA    1 
ATOM   4343  C  C     . GLY A 1  577 ? -57.108 -18.690 45.121  1.00 161.59 ? 960  GLY A C     1 
ATOM   4344  O  O     . GLY A 1  577 ? -56.319 -17.739 45.125  1.00 157.27 ? 960  GLY A O     1 
ATOM   4345  N  N     . ASN A 1  578 ? -56.696 -19.960 45.174  1.00 161.62 ? 961  ASN A N     1 
ATOM   4346  C  CA    . ASN A 1  578 ? -55.316 -20.356 45.445  1.00 151.24 ? 961  ASN A CA    1 
ATOM   4347  C  C     . ASN A 1  578 ? -54.315 -19.800 44.426  1.00 151.59 ? 961  ASN A C     1 
ATOM   4348  O  O     . ASN A 1  578 ? -53.104 -19.917 44.646  1.00 153.06 ? 961  ASN A O     1 
ATOM   4349  C  CB    . ASN A 1  578 ? -55.216 -21.892 45.560  1.00 146.09 ? 961  ASN A CB    1 
ATOM   4350  C  CG    . ASN A 1  578 ? -56.022 -22.456 46.781  1.00 152.60 ? 961  ASN A CG    1 
ATOM   4351  O  OD1   . ASN A 1  578 ? -56.638 -23.542 46.712  1.00 155.99 ? 961  ASN A OD1   1 
ATOM   4352  N  ND2   . ASN A 1  578 ? -56.058 -21.687 47.871  1.00 129.56 ? 961  ASN A ND2   1 
ATOM   4353  N  N     . GLN A 1  579 ? -54.768 -19.148 43.352  1.00 154.51 ? 962  GLN A N     1 
ATOM   4354  C  CA    . GLN A 1  579 ? -53.828 -18.378 42.548  1.00 150.08 ? 962  GLN A CA    1 
ATOM   4355  C  C     . GLN A 1  579 ? -53.114 -17.286 43.357  1.00 143.91 ? 962  GLN A C     1 
ATOM   4356  O  O     . GLN A 1  579 ? -52.028 -16.865 42.961  1.00 133.04 ? 962  GLN A O     1 
ATOM   4357  C  CB    . GLN A 1  579 ? -54.533 -17.762 41.338  1.00 150.18 ? 962  GLN A CB    1 
ATOM   4358  C  CG    . GLN A 1  579 ? -55.790 -18.495 40.904  1.00 159.13 ? 962  GLN A CG    1 
ATOM   4359  C  CD    . GLN A 1  579 ? -55.868 -18.683 39.404  1.00 155.84 ? 962  GLN A CD    1 
ATOM   4360  O  OE1   . GLN A 1  579 ? -55.394 -17.848 38.629  1.00 142.60 ? 962  GLN A OE1   1 
ATOM   4361  N  NE2   . GLN A 1  579 ? -56.457 -19.794 38.985  1.00 153.22 ? 962  GLN A NE2   1 
ATOM   4362  N  N     . SER A 1  580 ? -53.651 -16.846 44.501  1.00 150.14 ? 963  SER A N     1 
ATOM   4363  C  CA    . SER A 1  580 ? -52.885 -15.906 45.325  1.00 145.28 ? 963  SER A CA    1 
ATOM   4364  C  C     . SER A 1  580 ? -51.783 -16.605 46.116  1.00 134.58 ? 963  SER A C     1 
ATOM   4365  O  O     . SER A 1  580 ? -50.738 -15.996 46.410  1.00 122.18 ? 963  SER A O     1 
ATOM   4366  C  CB    . SER A 1  580 ? -53.814 -15.148 46.279  1.00 135.31 ? 963  SER A CB    1 
ATOM   4367  O  OG    . SER A 1  580 ? -54.227 -15.973 47.356  1.00 129.19 ? 963  SER A OG    1 
ATOM   4368  N  N     . GLY A 1  581 ? -51.981 -17.880 46.458  1.00 133.87 ? 964  GLY A N     1 
ATOM   4369  C  CA    . GLY A 1  581 ? -51.069 -18.594 47.330  1.00 121.56 ? 964  GLY A CA    1 
ATOM   4370  C  C     . GLY A 1  581 ? -49.595 -18.459 47.020  1.00 105.36 ? 964  GLY A C     1 
ATOM   4371  O  O     . GLY A 1  581 ? -48.807 -18.092 47.901  1.00 99.12  ? 964  GLY A O     1 
ATOM   4372  N  N     . ASN A 1  582 ? -49.226 -18.759 45.768  1.00 109.39 ? 965  ASN A N     1 
ATOM   4373  C  CA    . ASN A 1  582 ? -47.841 -18.626 45.324  1.00 112.77 ? 965  ASN A CA    1 
ATOM   4374  C  C     . ASN A 1  582 ? -47.261 -17.288 45.754  1.00 114.42 ? 965  ASN A C     1 
ATOM   4375  O  O     . ASN A 1  582 ? -46.239 -17.236 46.458  1.00 104.46 ? 965  ASN A O     1 
ATOM   4376  C  CB    . ASN A 1  582 ? -47.752 -18.773 43.800  1.00 114.59 ? 965  ASN A CB    1 
ATOM   4377  C  CG    . ASN A 1  582 ? -46.338 -18.512 43.261  1.00 116.70 ? 965  ASN A CG    1 
ATOM   4378  O  OD1   . ASN A 1  582 ? -45.350 -18.976 43.823  1.00 120.89 ? 965  ASN A OD1   1 
ATOM   4379  N  ND2   . ASN A 1  582 ? -46.247 -17.760 42.176  1.00 119.93 ? 965  ASN A ND2   1 
ATOM   4380  N  N     . LYS A 1  583 ? -47.926 -16.193 45.361  1.00 123.21 ? 966  LYS A N     1 
ATOM   4381  C  CA    . LYS A 1  583 ? -47.495 -14.861 45.770  1.00 104.19 ? 966  LYS A CA    1 
ATOM   4382  C  C     . LYS A 1  583 ? -47.237 -14.823 47.269  1.00 97.36  ? 966  LYS A C     1 
ATOM   4383  O  O     . LYS A 1  583 ? -46.104 -14.583 47.711  1.00 88.62  ? 966  LYS A O     1 
ATOM   4384  C  CB    . LYS A 1  583 ? -48.550 -13.836 45.361  1.00 101.94 ? 966  LYS A CB    1 
ATOM   4385  C  CG    . LYS A 1  583 ? -48.759 -13.746 43.852  1.00 120.38 ? 966  LYS A CG    1 
ATOM   4386  C  CD    . LYS A 1  583 ? -49.748 -12.639 43.475  1.00 130.05 ? 966  LYS A CD    1 
ATOM   4387  C  CE    . LYS A 1  583 ? -49.914 -12.497 41.957  1.00 126.84 ? 966  LYS A CE    1 
ATOM   4388  N  NZ    . LYS A 1  583 ? -48.747 -11.858 41.270  1.00 133.08 ? 966  LYS A NZ    1 
ATOM   4389  N  N     . LEU A 1  584 ? -48.277 -15.137 48.057  1.00 97.49  ? 967  LEU A N     1 
ATOM   4390  C  CA    . LEU A 1  584 ? -48.148 -15.246 49.510  1.00 87.84  ? 967  LEU A CA    1 
ATOM   4391  C  C     . LEU A 1  584 ? -46.895 -16.023 49.893  1.00 88.05  ? 967  LEU A C     1 
ATOM   4392  O  O     . LEU A 1  584 ? -46.017 -15.505 50.599  1.00 83.27  ? 967  LEU A O     1 
ATOM   4393  C  CB    . LEU A 1  584 ? -49.394 -15.914 50.096  1.00 88.63  ? 967  LEU A CB    1 
ATOM   4394  C  CG    . LEU A 1  584 ? -50.325 -15.060 50.963  1.00 97.88  ? 967  LEU A CG    1 
ATOM   4395  C  CD1   . LEU A 1  584 ? -51.625 -15.806 51.234  1.00 111.84 ? 967  LEU A CD1   1 
ATOM   4396  C  CD2   . LEU A 1  584 ? -49.681 -14.646 52.275  1.00 80.65  ? 967  LEU A CD2   1 
ATOM   4397  N  N     . PHE A 1  585 ? -46.766 -17.251 49.372  1.00 101.68 ? 968  PHE A N     1 
ATOM   4398  C  CA    . PHE A 1  585 ? -45.589 -18.067 49.660  1.00 95.20  ? 968  PHE A CA    1 
ATOM   4399  C  C     . PHE A 1  585 ? -44.307 -17.288 49.393  1.00 81.51  ? 968  PHE A C     1 
ATOM   4400  O  O     . PHE A 1  585 ? -43.494 -17.086 50.305  1.00 78.10  ? 968  PHE A O     1 
ATOM   4401  C  CB    . PHE A 1  585 ? -45.629 -19.367 48.845  1.00 100.13 ? 968  PHE A CB    1 
ATOM   4402  C  CG    . PHE A 1  585 ? -44.599 -20.394 49.273  1.00 89.20  ? 968  PHE A CG    1 
ATOM   4403  C  CD1   . PHE A 1  585 ? -44.889 -21.323 50.264  1.00 84.68  ? 968  PHE A CD1   1 
ATOM   4404  C  CD2   . PHE A 1  585 ? -43.346 -20.421 48.691  1.00 79.21  ? 968  PHE A CD2   1 
ATOM   4405  C  CE1   . PHE A 1  585 ? -43.938 -22.257 50.661  1.00 89.44  ? 968  PHE A CE1   1 
ATOM   4406  C  CE2   . PHE A 1  585 ? -42.398 -21.343 49.080  1.00 88.08  ? 968  PHE A CE2   1 
ATOM   4407  C  CZ    . PHE A 1  585 ? -42.689 -22.265 50.064  1.00 85.57  ? 968  PHE A CZ    1 
ATOM   4408  N  N     . ARG A 1  586 ? -44.137 -16.786 48.167  1.00 88.15  ? 969  ARG A N     1 
ATOM   4409  C  CA    . ARG A 1  586 ? -42.887 -16.101 47.862  1.00 92.21  ? 969  ARG A CA    1 
ATOM   4410  C  C     . ARG A 1  586 ? -42.639 -14.974 48.847  1.00 94.22  ? 969  ARG A C     1 
ATOM   4411  O  O     . ARG A 1  586 ? -41.529 -14.843 49.380  1.00 92.95  ? 969  ARG A O     1 
ATOM   4412  C  CB    . ARG A 1  586 ? -42.889 -15.554 46.440  1.00 93.34  ? 969  ARG A CB    1 
ATOM   4413  C  CG    . ARG A 1  586 ? -43.113 -16.588 45.419  1.00 94.19  ? 969  ARG A CG    1 
ATOM   4414  C  CD    . ARG A 1  586 ? -43.499 -15.947 44.119  1.00 109.16 ? 969  ARG A CD    1 
ATOM   4415  N  NE    . ARG A 1  586 ? -42.369 -15.851 43.208  1.00 118.68 ? 969  ARG A NE    1 
ATOM   4416  C  CZ    . ARG A 1  586 ? -42.481 -15.449 41.949  1.00 130.18 ? 969  ARG A CZ    1 
ATOM   4417  N  NH1   . ARG A 1  586 ? -43.677 -15.102 41.479  1.00 125.37 ? 969  ARG A NH1   1 
ATOM   4418  N  NH2   . ARG A 1  586 ? -41.411 -15.398 41.160  1.00 130.72 ? 969  ARG A NH2   1 
ATOM   4419  N  N     . ARG A 1  587 ? -43.667 -14.168 49.129  1.00 89.87  ? 970  ARG A N     1 
ATOM   4420  C  CA    . ARG A 1  587 ? -43.457 -13.061 50.046  1.00 78.52  ? 970  ARG A CA    1 
ATOM   4421  C  C     . ARG A 1  587 ? -42.828 -13.570 51.329  1.00 84.21  ? 970  ARG A C     1 
ATOM   4422  O  O     . ARG A 1  587 ? -41.741 -13.128 51.715  1.00 79.80  ? 970  ARG A O     1 
ATOM   4423  C  CB    . ARG A 1  587 ? -44.776 -12.357 50.328  1.00 82.99  ? 970  ARG A CB    1 
ATOM   4424  C  CG    . ARG A 1  587 ? -44.651 -10.951 50.859  1.00 89.98  ? 970  ARG A CG    1 
ATOM   4425  C  CD    . ARG A 1  587 ? -45.936 -10.228 50.544  1.00 88.61  ? 970  ARG A CD    1 
ATOM   4426  N  NE    . ARG A 1  587 ? -45.908 -8.823  50.910  1.00 101.79 ? 970  ARG A NE    1 
ATOM   4427  C  CZ    . ARG A 1  587 ? -46.854 -7.971  50.537  1.00 112.28 ? 970  ARG A CZ    1 
ATOM   4428  N  NH1   . ARG A 1  587 ? -47.861 -8.416  49.789  1.00 120.92 ? 970  ARG A NH1   1 
ATOM   4429  N  NH2   . ARG A 1  587 ? -46.802 -6.691  50.900  1.00 116.27 ? 970  ARG A NH2   1 
ATOM   4430  N  N     . PHE A 1  588 ? -43.460 -14.572 51.953  1.00 82.85  ? 971  PHE A N     1 
ATOM   4431  C  CA    . PHE A 1  588 ? -42.971 -15.049 53.237  1.00 75.41  ? 971  PHE A CA    1 
ATOM   4432  C  C     . PHE A 1  588 ? -41.544 -15.557 53.126  1.00 76.25  ? 971  PHE A C     1 
ATOM   4433  O  O     . PHE A 1  588 ? -40.744 -15.383 54.052  1.00 78.52  ? 971  PHE A O     1 
ATOM   4434  C  CB    . PHE A 1  588 ? -43.900 -16.126 53.771  1.00 71.87  ? 971  PHE A CB    1 
ATOM   4435  C  CG    . PHE A 1  588 ? -45.169 -15.592 54.329  1.00 71.25  ? 971  PHE A CG    1 
ATOM   4436  C  CD1   . PHE A 1  588 ? -45.169 -14.476 55.150  1.00 77.16  ? 971  PHE A CD1   1 
ATOM   4437  C  CD2   . PHE A 1  588 ? -46.367 -16.207 54.031  1.00 81.18  ? 971  PHE A CD2   1 
ATOM   4438  C  CE1   . PHE A 1  588 ? -46.347 -13.986 55.673  1.00 77.72  ? 971  PHE A CE1   1 
ATOM   4439  C  CE2   . PHE A 1  588 ? -47.548 -15.734 54.549  1.00 78.79  ? 971  PHE A CE2   1 
ATOM   4440  C  CZ    . PHE A 1  588 ? -47.545 -14.618 55.369  1.00 74.81  ? 971  PHE A CZ    1 
ATOM   4441  N  N     . ARG A 1  589 ? -41.198 -16.146 51.985  1.00 75.54  ? 972  ARG A N     1 
ATOM   4442  C  CA    . ARG A 1  589 ? -39.857 -16.681 51.806  1.00 77.92  ? 972  ARG A CA    1 
ATOM   4443  C  C     . ARG A 1  589 ? -38.814 -15.573 51.717  1.00 89.39  ? 972  ARG A C     1 
ATOM   4444  O  O     . ARG A 1  589 ? -37.652 -15.784 52.092  1.00 92.29  ? 972  ARG A O     1 
ATOM   4445  C  CB    . ARG A 1  589 ? -39.830 -17.539 50.548  1.00 85.46  ? 972  ARG A CB    1 
ATOM   4446  C  CG    . ARG A 1  589 ? -38.820 -18.655 50.554  1.00 86.05  ? 972  ARG A CG    1 
ATOM   4447  C  CD    . ARG A 1  589 ? -38.791 -19.307 49.181  1.00 78.76  ? 972  ARG A CD    1 
ATOM   4448  N  NE    . ARG A 1  589 ? -37.786 -20.351 49.100  1.00 77.95  ? 972  ARG A NE    1 
ATOM   4449  C  CZ    . ARG A 1  589 ? -37.437 -20.950 47.973  1.00 94.42  ? 972  ARG A CZ    1 
ATOM   4450  N  NH1   . ARG A 1  589 ? -36.505 -21.898 47.984  1.00 106.27 ? 972  ARG A NH1   1 
ATOM   4451  N  NH2   . ARG A 1  589 ? -38.016 -20.597 46.831  1.00 113.95 ? 972  ARG A NH2   1 
ATOM   4452  N  N     . LYS A 1  590 ? -39.198 -14.399 51.212  1.00 90.85  ? 973  LYS A N     1 
ATOM   4453  C  CA    . LYS A 1  590 ? -38.231 -13.323 51.027  1.00 94.69  ? 973  LYS A CA    1 
ATOM   4454  C  C     . LYS A 1  590 ? -38.039 -12.517 52.302  1.00 87.97  ? 973  LYS A C     1 
ATOM   4455  O  O     . LYS A 1  590 ? -36.907 -12.218 52.688  1.00 90.71  ? 973  LYS A O     1 
ATOM   4456  C  CB    . LYS A 1  590 ? -38.670 -12.393 49.896  1.00 105.88 ? 973  LYS A CB    1 
ATOM   4457  C  CG    . LYS A 1  590 ? -38.755 -13.041 48.528  1.00 117.61 ? 973  LYS A CG    1 
ATOM   4458  C  CD    . LYS A 1  590 ? -39.063 -11.993 47.462  1.00 127.65 ? 973  LYS A CD    1 
ATOM   4459  C  CE    . LYS A 1  590 ? -37.935 -10.979 47.342  1.00 131.26 ? 973  LYS A CE    1 
ATOM   4460  N  NZ    . LYS A 1  590 ? -36.684 -11.631 46.854  1.00 132.57 ? 973  LYS A NZ    1 
ATOM   4461  N  N     . MET A 1  591 ? -39.132 -12.153 52.969  1.00 91.98  ? 974  MET A N     1 
ATOM   4462  C  CA    . MET A 1  591 ? -39.090 -11.106 53.978  1.00 95.34  ? 974  MET A CA    1 
ATOM   4463  C  C     . MET A 1  591 ? -39.260 -11.602 55.407  1.00 90.07  ? 974  MET A C     1 
ATOM   4464  O  O     . MET A 1  591 ? -39.105 -10.807 56.342  1.00 91.06  ? 974  MET A O     1 
ATOM   4465  C  CB    . MET A 1  591 ? -40.174 -10.055 53.687  1.00 95.21  ? 974  MET A CB    1 
ATOM   4466  C  CG    . MET A 1  591 ? -40.309 -9.700  52.212  1.00 101.01 ? 974  MET A CG    1 
ATOM   4467  S  SD    . MET A 1  591 ? -41.176 -8.143  51.883  1.00 131.93 ? 974  MET A SD    1 
ATOM   4468  C  CE    . MET A 1  591 ? -42.822 -8.500  52.473  1.00 97.61  ? 974  MET A CE    1 
ATOM   4469  N  N     . ASN A 1  592 ? -39.570 -12.877 55.609  1.00 89.13  ? 975  ASN A N     1 
ATOM   4470  C  CA    . ASN A 1  592 ? -39.880 -13.345 56.949  1.00 78.53  ? 975  ASN A CA    1 
ATOM   4471  C  C     . ASN A 1  592 ? -39.277 -14.709 57.215  1.00 77.77  ? 975  ASN A C     1 
ATOM   4472  O  O     . ASN A 1  592 ? -39.755 -15.432 58.089  1.00 81.97  ? 975  ASN A O     1 
ATOM   4473  C  CB    . ASN A 1  592 ? -41.392 -13.397 57.177  1.00 82.75  ? 975  ASN A CB    1 
ATOM   4474  C  CG    . ASN A 1  592 ? -42.013 -12.018 57.307  1.00 90.14  ? 975  ASN A CG    1 
ATOM   4475  O  OD1   . ASN A 1  592 ? -42.098 -11.476 58.411  1.00 95.99  ? 975  ASN A OD1   1 
ATOM   4476  N  ND2   . ASN A 1  592 ? -42.472 -11.450 56.183  1.00 82.98  ? 975  ASN A ND2   1 
ATOM   4477  N  N     . ALA A 1  593 ? -38.220 -15.077 56.491  1.00 71.55  ? 976  ALA A N     1 
ATOM   4478  C  CA    . ALA A 1  593 ? -37.691 -16.431 56.553  1.00 69.37  ? 976  ALA A CA    1 
ATOM   4479  C  C     . ALA A 1  593 ? -36.172 -16.451 56.655  1.00 69.80  ? 976  ALA A C     1 
ATOM   4480  O  O     . ALA A 1  593 ? -35.489 -15.843 55.826  1.00 69.83  ? 976  ALA A O     1 
ATOM   4481  C  CB    . ALA A 1  593 ? -38.119 -17.212 55.321  1.00 83.40  ? 976  ALA A CB    1 
ATOM   4482  N  N     . ARG A 1  594 ? -35.645 -17.171 57.655  1.00 65.50  ? 977  ARG A N     1 
ATOM   4483  C  CA    . ARG A 1  594 ? -34.205 -17.403 57.721  1.00 70.19  ? 977  ARG A CA    1 
ATOM   4484  C  C     . ARG A 1  594 ? -33.728 -18.017 56.418  1.00 78.43  ? 977  ARG A C     1 
ATOM   4485  O  O     . ARG A 1  594 ? -34.425 -18.820 55.802  1.00 82.84  ? 977  ARG A O     1 
ATOM   4486  C  CB    . ARG A 1  594 ? -33.848 -18.319 58.885  1.00 64.07  ? 977  ARG A CB    1 
ATOM   4487  C  CG    . ARG A 1  594 ? -34.516 -17.921 60.158  1.00 60.61  ? 977  ARG A CG    1 
ATOM   4488  C  CD    . ARG A 1  594 ? -33.774 -18.391 61.393  1.00 69.94  ? 977  ARG A CD    1 
ATOM   4489  N  NE    . ARG A 1  594 ? -34.060 -19.788 61.682  1.00 78.38  ? 977  ARG A NE    1 
ATOM   4490  C  CZ    . ARG A 1  594 ? -35.231 -20.238 62.131  1.00 81.78  ? 977  ARG A CZ    1 
ATOM   4491  N  NH1   . ARG A 1  594 ? -35.406 -21.528 62.365  1.00 76.98  ? 977  ARG A NH1   1 
ATOM   4492  N  NH2   . ARG A 1  594 ? -36.237 -19.403 62.348  1.00 88.42  ? 977  ARG A NH2   1 
ATOM   4493  N  N     . GLN A 1  595 ? -32.549 -17.621 55.972  1.00 84.26  ? 978  GLN A N     1 
ATOM   4494  C  CA    . GLN A 1  595 ? -32.120 -17.994 54.624  1.00 95.99  ? 978  GLN A CA    1 
ATOM   4495  C  C     . GLN A 1  595 ? -31.304 -19.285 54.681  1.00 96.72  ? 978  GLN A C     1 
ATOM   4496  O  O     . GLN A 1  595 ? -30.122 -19.321 54.368  1.00 111.09 ? 978  GLN A O     1 
ATOM   4497  C  CB    . GLN A 1  595 ? -31.347 -16.846 53.967  1.00 91.26  ? 978  GLN A CB    1 
ATOM   4498  C  CG    . GLN A 1  595 ? -31.515 -16.733 52.428  1.00 74.35  ? 978  GLN A CG    1 
ATOM   4499  C  CD    . GLN A 1  595 ? -32.967 -16.526 51.974  1.00 82.15  ? 978  GLN A CD    1 
ATOM   4500  O  OE1   . GLN A 1  595 ? -33.512 -15.423 52.068  1.00 82.61  ? 978  GLN A OE1   1 
ATOM   4501  N  NE2   . GLN A 1  595 ? -33.596 -17.597 51.484  1.00 88.80  ? 978  GLN A NE2   1 
ATOM   4502  N  N     . SER A 1  596 ? -31.972 -20.354 55.111  1.00 85.96  ? 979  SER A N     1 
ATOM   4503  C  CA    . SER A 1  596 ? -31.370 -21.680 55.219  1.00 93.57  ? 979  SER A CA    1 
ATOM   4504  C  C     . SER A 1  596 ? -32.447 -22.711 54.916  1.00 101.19 ? 979  SER A C     1 
ATOM   4505  O  O     . SER A 1  596 ? -33.535 -22.649 55.496  1.00 103.76 ? 979  SER A O     1 
ATOM   4506  C  CB    . SER A 1  596 ? -30.778 -21.921 56.615  1.00 93.60  ? 979  SER A CB    1 
ATOM   4507  O  OG    . SER A 1  596 ? -31.025 -23.252 57.042  1.00 87.20  ? 979  SER A OG    1 
ATOM   4508  N  N     . LYS A 1  597 ? -32.138 -23.666 54.029  1.00 108.03 ? 980  LYS A N     1 
ATOM   4509  C  CA    . LYS A 1  597 ? -33.182 -24.498 53.426  1.00 106.14 ? 980  LYS A CA    1 
ATOM   4510  C  C     . LYS A 1  597 ? -34.046 -25.189 54.474  1.00 98.69  ? 980  LYS A C     1 
ATOM   4511  O  O     . LYS A 1  597 ? -35.254 -25.363 54.273  1.00 95.47  ? 980  LYS A O     1 
ATOM   4512  C  CB    . LYS A 1  597 ? -32.558 -25.536 52.489  1.00 103.50 ? 980  LYS A CB    1 
ATOM   4513  C  CG    . LYS A 1  597 ? -31.844 -24.930 51.309  1.00 116.18 ? 980  LYS A CG    1 
ATOM   4514  C  CD    . LYS A 1  597 ? -32.817 -24.568 50.205  1.00 118.51 ? 980  LYS A CD    1 
ATOM   4515  C  CE    . LYS A 1  597 ? -33.218 -25.820 49.453  1.00 117.94 ? 980  LYS A CE    1 
ATOM   4516  N  NZ    . LYS A 1  597 ? -34.068 -25.535 48.272  1.00 108.29 ? 980  LYS A NZ    1 
ATOM   4517  N  N     . CYS A 1  598 ? -33.456 -25.615 55.588  1.00 100.97 ? 981  CYS A N     1 
ATOM   4518  C  CA    . CYS A 1  598 ? -34.275 -26.344 56.548  1.00 103.42 ? 981  CYS A CA    1 
ATOM   4519  C  C     . CYS A 1  598 ? -35.179 -25.392 57.312  1.00 106.73 ? 981  CYS A C     1 
ATOM   4520  O  O     . CYS A 1  598 ? -36.334 -25.721 57.610  1.00 100.87 ? 981  CYS A O     1 
ATOM   4521  C  CB    . CYS A 1  598 ? -33.399 -27.150 57.514  1.00 112.82 ? 981  CYS A CB    1 
ATOM   4522  S  SG    . CYS A 1  598 ? -32.117 -26.181 58.360  1.00 138.12 ? 981  CYS A SG    1 
ATOM   4523  N  N     . TYR A 1  599 ? -34.674 -24.204 57.633  1.00 94.65  ? 982  TYR A N     1 
ATOM   4524  C  CA    . TYR A 1  599 ? -35.433 -23.290 58.463  1.00 78.70  ? 982  TYR A CA    1 
ATOM   4525  C  C     . TYR A 1  599 ? -36.404 -22.456 57.674  1.00 75.94  ? 982  TYR A C     1 
ATOM   4526  O  O     . TYR A 1  599 ? -37.450 -22.089 58.214  1.00 84.24  ? 982  TYR A O     1 
ATOM   4527  C  CB    . TYR A 1  599 ? -34.499 -22.354 59.199  1.00 75.95  ? 982  TYR A CB    1 
ATOM   4528  C  CG    . TYR A 1  599 ? -33.647 -23.012 60.226  1.00 76.80  ? 982  TYR A CG    1 
ATOM   4529  C  CD1   . TYR A 1  599 ? -34.164 -23.956 61.090  1.00 84.52  ? 982  TYR A CD1   1 
ATOM   4530  C  CD2   . TYR A 1  599 ? -32.314 -22.671 60.344  1.00 91.35  ? 982  TYR A CD2   1 
ATOM   4531  C  CE1   . TYR A 1  599 ? -33.368 -24.537 62.058  1.00 86.92  ? 982  TYR A CE1   1 
ATOM   4532  C  CE2   . TYR A 1  599 ? -31.516 -23.239 61.291  1.00 95.13  ? 982  TYR A CE2   1 
ATOM   4533  C  CZ    . TYR A 1  599 ? -32.038 -24.169 62.146  1.00 87.39  ? 982  TYR A CZ    1 
ATOM   4534  O  OH    . TYR A 1  599 ? -31.207 -24.718 63.089  1.00 90.27  ? 982  TYR A OH    1 
ATOM   4535  N  N     . GLU A 1  600 ? -36.055 -22.104 56.435  1.00 77.61  ? 983  GLU A N     1 
ATOM   4536  C  CA    . GLU A 1  600 ? -36.908 -21.198 55.680  1.00 80.18  ? 983  GLU A CA    1 
ATOM   4537  C  C     . GLU A 1  600 ? -38.282 -21.802 55.517  1.00 84.26  ? 983  GLU A C     1 
ATOM   4538  O  O     . GLU A 1  600 ? -39.297 -21.097 55.608  1.00 85.28  ? 983  GLU A O     1 
ATOM   4539  C  CB    . GLU A 1  600 ? -36.296 -20.864 54.314  1.00 84.12  ? 983  GLU A CB    1 
ATOM   4540  C  CG    . GLU A 1  600 ? -36.555 -21.869 53.195  1.00 93.50  ? 983  GLU A CG    1 
ATOM   4541  C  CD    . GLU A 1  600 ? -35.846 -21.479 51.908  1.00 110.44 ? 983  GLU A CD    1 
ATOM   4542  O  OE1   . GLU A 1  600 ? -35.231 -22.374 51.273  1.00 115.35 ? 983  GLU A OE1   1 
ATOM   4543  O  OE2   . GLU A 1  600 ? -35.901 -20.274 51.546  1.00 100.41 ? 983  GLU A OE2   1 
ATOM   4544  N  N     . MET A 1  601 ? -38.328 -23.123 55.346  1.00 90.29  ? 984  MET A N     1 
ATOM   4545  C  CA    . MET A 1  601 ? -39.596 -23.796 55.145  1.00 79.40  ? 984  MET A CA    1 
ATOM   4546  C  C     . MET A 1  601 ? -40.461 -23.691 56.384  1.00 73.28  ? 984  MET A C     1 
ATOM   4547  O  O     . MET A 1  601 ? -41.626 -23.296 56.297  1.00 76.25  ? 984  MET A O     1 
ATOM   4548  C  CB    . MET A 1  601 ? -39.369 -25.244 54.734  1.00 77.24  ? 984  MET A CB    1 
ATOM   4549  C  CG    . MET A 1  601 ? -39.484 -25.395 53.226  1.00 85.36  ? 984  MET A CG    1 
ATOM   4550  S  SD    . MET A 1  601 ? -40.813 -24.352 52.580  1.00 82.81  ? 984  MET A SD    1 
ATOM   4551  C  CE    . MET A 1  601 ? -41.767 -25.545 51.662  1.00 88.02  ? 984  MET A CE    1 
ATOM   4552  N  N     . GLU A 1  602 ? -39.904 -23.977 57.559  1.00 71.35  ? 985  GLU A N     1 
ATOM   4553  C  CA    . GLU A 1  602 ? -40.762 -23.880 58.731  1.00 71.61  ? 985  GLU A CA    1 
ATOM   4554  C  C     . GLU A 1  602 ? -41.093 -22.444 59.091  1.00 73.89  ? 985  GLU A C     1 
ATOM   4555  O  O     . GLU A 1  602 ? -42.148 -22.199 59.684  1.00 72.93  ? 985  GLU A O     1 
ATOM   4556  C  CB    . GLU A 1  602 ? -40.151 -24.602 59.924  1.00 79.07  ? 985  GLU A CB    1 
ATOM   4557  C  CG    . GLU A 1  602 ? -38.783 -24.178 60.351  1.00 89.05  ? 985  GLU A CG    1 
ATOM   4558  C  CD    . GLU A 1  602 ? -38.408 -24.819 61.684  1.00 107.81 ? 985  GLU A CD    1 
ATOM   4559  O  OE1   . GLU A 1  602 ? -38.819 -24.268 62.743  1.00 108.94 ? 985  GLU A OE1   1 
ATOM   4560  O  OE2   . GLU A 1  602 ? -37.734 -25.883 61.665  1.00 105.57 ? 985  GLU A OE2   1 
ATOM   4561  N  N     . ASP A 1  603 ? -40.257 -21.487 58.703  1.00 73.92  ? 986  ASP A N     1 
ATOM   4562  C  CA    . ASP A 1  603 ? -40.622 -20.098 58.938  1.00 70.34  ? 986  ASP A CA    1 
ATOM   4563  C  C     . ASP A 1  603 ? -41.754 -19.682 58.033  1.00 69.04  ? 986  ASP A C     1 
ATOM   4564  O  O     . ASP A 1  603 ? -42.665 -18.963 58.463  1.00 75.89  ? 986  ASP A O     1 
ATOM   4565  C  CB    . ASP A 1  603 ? -39.434 -19.184 58.727  1.00 75.96  ? 986  ASP A CB    1 
ATOM   4566  C  CG    . ASP A 1  603 ? -38.405 -19.336 59.807  1.00 87.01  ? 986  ASP A CG    1 
ATOM   4567  O  OD1   . ASP A 1  603 ? -37.253 -18.908 59.564  1.00 86.85  ? 986  ASP A OD1   1 
ATOM   4568  O  OD2   . ASP A 1  603 ? -38.738 -19.897 60.887  1.00 84.10  ? 986  ASP A OD2   1 
ATOM   4569  N  N     . VAL A 1  604 ? -41.723 -20.136 56.783  1.00 64.88  ? 987  VAL A N     1 
ATOM   4570  C  CA    . VAL A 1  604 ? -42.860 -19.897 55.905  1.00 68.19  ? 987  VAL A CA    1 
ATOM   4571  C  C     . VAL A 1  604 ? -44.111 -20.572 56.444  1.00 74.68  ? 987  VAL A C     1 
ATOM   4572  O  O     . VAL A 1  604 ? -45.224 -20.049 56.319  1.00 77.72  ? 987  VAL A O     1 
ATOM   4573  C  CB    . VAL A 1  604 ? -42.568 -20.380 54.484  1.00 64.52  ? 987  VAL A CB    1 
ATOM   4574  C  CG1   . VAL A 1  604 ? -43.812 -20.202 53.646  1.00 67.92  ? 987  VAL A CG1   1 
ATOM   4575  C  CG2   . VAL A 1  604 ? -41.445 -19.617 53.916  1.00 71.19  ? 987  VAL A CG2   1 
ATOM   4576  N  N     . LEU A 1  605 ? -43.963 -21.750 57.032  1.00 73.75  ? 988  LEU A N     1 
ATOM   4577  C  CA    . LEU A 1  605 ? -45.145 -22.448 57.511  1.00 70.31  ? 988  LEU A CA    1 
ATOM   4578  C  C     . LEU A 1  605 ? -45.749 -21.708 58.686  1.00 67.07  ? 988  LEU A C     1 
ATOM   4579  O  O     . LEU A 1  605 ? -46.952 -21.443 58.713  1.00 75.72  ? 988  LEU A O     1 
ATOM   4580  C  CB    . LEU A 1  605 ? -44.804 -23.883 57.891  1.00 68.02  ? 988  LEU A CB    1 
ATOM   4581  C  CG    . LEU A 1  605 ? -45.975 -24.707 58.374  1.00 68.51  ? 988  LEU A CG    1 
ATOM   4582  C  CD1   . LEU A 1  605 ? -46.902 -24.997 57.230  1.00 64.85  ? 988  LEU A CD1   1 
ATOM   4583  C  CD2   . LEU A 1  605 ? -45.398 -25.941 58.934  1.00 61.36  ? 988  LEU A CD2   1 
ATOM   4584  N  N     . LYS A 1  606 ? -44.922 -21.353 59.663  1.00 68.19  ? 989  LYS A N     1 
ATOM   4585  C  CA    . LYS A 1  606 ? -45.450 -20.712 60.857  1.00 67.56  ? 989  LYS A CA    1 
ATOM   4586  C  C     . LYS A 1  606 ? -46.053 -19.346 60.518  1.00 75.07  ? 989  LYS A C     1 
ATOM   4587  O  O     . LYS A 1  606 ? -47.145 -19.005 61.001  1.00 72.71  ? 989  LYS A O     1 
ATOM   4588  C  CB    . LYS A 1  606 ? -44.345 -20.628 61.913  1.00 65.37  ? 989  LYS A CB    1 
ATOM   4589  C  CG    . LYS A 1  606 ? -44.493 -19.504 62.916  1.00 81.43  ? 989  LYS A CG    1 
ATOM   4590  C  CD    . LYS A 1  606 ? -43.228 -19.359 63.763  1.00 91.75  ? 989  LYS A CD    1 
ATOM   4591  C  CE    . LYS A 1  606 ? -43.073 -17.947 64.334  1.00 87.03  ? 989  LYS A CE    1 
ATOM   4592  N  NZ    . LYS A 1  606 ? -42.821 -16.842 63.352  1.00 83.42  ? 989  LYS A NZ    1 
ATOM   4593  N  N     . HIS A 1  607 ? -45.395 -18.577 59.634  1.00 73.10  ? 990  HIS A N     1 
ATOM   4594  C  CA    . HIS A 1  607 ? -45.978 -17.308 59.210  1.00 75.85  ? 990  HIS A CA    1 
ATOM   4595  C  C     . HIS A 1  607 ? -47.280 -17.505 58.450  1.00 73.27  ? 990  HIS A C     1 
ATOM   4596  O  O     . HIS A 1  607 ? -48.204 -16.702 58.595  1.00 76.46  ? 990  HIS A O     1 
ATOM   4597  C  CB    . HIS A 1  607 ? -44.989 -16.520 58.354  1.00 72.86  ? 990  HIS A CB    1 
ATOM   4598  C  CG    . HIS A 1  607 ? -43.916 -15.852 59.153  1.00 78.83  ? 990  HIS A CG    1 
ATOM   4599  N  ND1   . HIS A 1  607 ? -44.135 -14.713 59.902  1.00 87.93  ? 990  HIS A ND1   1 
ATOM   4600  C  CD2   . HIS A 1  607 ? -42.618 -16.177 59.340  1.00 82.23  ? 990  HIS A CD2   1 
ATOM   4601  C  CE1   . HIS A 1  607 ? -43.017 -14.366 60.514  1.00 88.09  ? 990  HIS A CE1   1 
ATOM   4602  N  NE2   . HIS A 1  607 ? -42.082 -15.238 60.189  1.00 89.48  ? 990  HIS A NE2   1 
ATOM   4603  N  N     . HIS A 1  608 ? -47.387 -18.552 57.643  1.00 75.46  ? 991  HIS A N     1 
ATOM   4604  C  CA    . HIS A 1  608 ? -48.627 -18.758 56.916  1.00 73.81  ? 991  HIS A CA    1 
ATOM   4605  C  C     . HIS A 1  608 ? -49.744 -19.167 57.876  1.00 67.06  ? 991  HIS A C     1 
ATOM   4606  O  O     . HIS A 1  608 ? -50.883 -18.679 57.776  1.00 75.24  ? 991  HIS A O     1 
ATOM   4607  C  CB    . HIS A 1  608 ? -48.357 -19.784 55.819  1.00 73.39  ? 991  HIS A CB    1 
ATOM   4608  C  CG    . HIS A 1  608 ? -49.238 -19.649 54.628  1.00 71.42  ? 991  HIS A CG    1 
ATOM   4609  N  ND1   . HIS A 1  608 ? -48.801 -19.917 53.350  1.00 76.43  ? 991  HIS A ND1   1 
ATOM   4610  C  CD2   . HIS A 1  608 ? -50.544 -19.311 54.523  1.00 71.91  ? 991  HIS A CD2   1 
ATOM   4611  C  CE1   . HIS A 1  608 ? -49.804 -19.741 52.507  1.00 97.05  ? 991  HIS A CE1   1 
ATOM   4612  N  NE2   . HIS A 1  608 ? -50.873 -19.375 53.194  1.00 88.36  ? 991  HIS A NE2   1 
ATOM   4613  N  N     . TRP A 1  609 ? -49.409 -19.997 58.866  1.00 66.84  ? 992  TRP A N     1 
ATOM   4614  C  CA    . TRP A 1  609 ? -50.373 -20.355 59.895  1.00 64.36  ? 992  TRP A CA    1 
ATOM   4615  C  C     . TRP A 1  609 ? -50.908 -19.097 60.547  1.00 70.80  ? 992  TRP A C     1 
ATOM   4616  O  O     . TRP A 1  609 ? -52.123 -18.864 60.586  1.00 77.06  ? 992  TRP A O     1 
ATOM   4617  C  CB    . TRP A 1  609 ? -49.739 -21.247 60.967  1.00 70.64  ? 992  TRP A CB    1 
ATOM   4618  C  CG    . TRP A 1  609 ? -50.790 -21.758 61.909  1.00 69.32  ? 992  TRP A CG    1 
ATOM   4619  C  CD1   . TRP A 1  609 ? -51.055 -21.303 63.164  1.00 67.69  ? 992  TRP A CD1   1 
ATOM   4620  C  CD2   . TRP A 1  609 ? -51.762 -22.782 61.639  1.00 75.63  ? 992  TRP A CD2   1 
ATOM   4621  N  NE1   . TRP A 1  609 ? -52.117 -21.988 63.698  1.00 80.48  ? 992  TRP A NE1   1 
ATOM   4622  C  CE2   . TRP A 1  609 ? -52.565 -22.905 62.781  1.00 78.02  ? 992  TRP A CE2   1 
ATOM   4623  C  CE3   . TRP A 1  609 ? -52.018 -23.618 60.545  1.00 75.04  ? 992  TRP A CE3   1 
ATOM   4624  C  CZ2   . TRP A 1  609 ? -53.605 -23.833 62.864  1.00 83.88  ? 992  TRP A CZ2   1 
ATOM   4625  C  CZ3   . TRP A 1  609 ? -53.048 -24.520 60.627  1.00 68.64  ? 992  TRP A CZ3   1 
ATOM   4626  C  CH2   . TRP A 1  609 ? -53.826 -24.628 61.777  1.00 73.33  ? 992  TRP A CH2   1 
ATOM   4627  N  N     . LEU A 1  610 ? -49.998 -18.254 61.056  1.00 73.08  ? 993  LEU A N     1 
ATOM   4628  C  CA    . LEU A 1  610 ? -50.420 -17.043 61.741  1.00 69.96  ? 993  LEU A CA    1 
ATOM   4629  C  C     . LEU A 1  610 ? -51.245 -16.156 60.829  1.00 66.56  ? 993  LEU A C     1 
ATOM   4630  O  O     . LEU A 1  610 ? -52.235 -15.564 61.261  1.00 66.86  ? 993  LEU A O     1 
ATOM   4631  C  CB    . LEU A 1  610 ? -49.194 -16.313 62.251  1.00 66.80  ? 993  LEU A CB    1 
ATOM   4632  C  CG    . LEU A 1  610 ? -48.462 -17.064 63.356  1.00 69.38  ? 993  LEU A CG    1 
ATOM   4633  C  CD1   . LEU A 1  610 ? -47.099 -16.514 63.700  1.00 74.71  ? 993  LEU A CD1   1 
ATOM   4634  C  CD2   . LEU A 1  610 ? -49.321 -17.001 64.556  1.00 67.35  ? 993  LEU A CD2   1 
ATOM   4635  N  N     . TYR A 1  611 ? -50.844 -16.033 59.570  1.00 66.70  ? 994  TYR A N     1 
ATOM   4636  C  CA    . TYR A 1  611 ? -51.605 -15.216 58.639  1.00 68.94  ? 994  TYR A CA    1 
ATOM   4637  C  C     . TYR A 1  611 ? -53.041 -15.702 58.502  1.00 68.48  ? 994  TYR A C     1 
ATOM   4638  O  O     . TYR A 1  611 ? -53.929 -14.897 58.207  1.00 79.26  ? 994  TYR A O     1 
ATOM   4639  C  CB    . TYR A 1  611 ? -50.889 -15.202 57.293  1.00 84.35  ? 994  TYR A CB    1 
ATOM   4640  C  CG    . TYR A 1  611 ? -51.494 -14.341 56.207  1.00 84.41  ? 994  TYR A CG    1 
ATOM   4641  C  CD1   . TYR A 1  611 ? -51.189 -12.992 56.103  1.00 78.80  ? 994  TYR A CD1   1 
ATOM   4642  C  CD2   . TYR A 1  611 ? -52.328 -14.898 55.254  1.00 92.68  ? 994  TYR A CD2   1 
ATOM   4643  C  CE1   . TYR A 1  611 ? -51.722 -12.229 55.101  1.00 80.97  ? 994  TYR A CE1   1 
ATOM   4644  C  CE2   . TYR A 1  611 ? -52.860 -14.148 54.254  1.00 87.72  ? 994  TYR A CE2   1 
ATOM   4645  C  CZ    . TYR A 1  611 ? -52.559 -12.819 54.176  1.00 88.73  ? 994  TYR A CZ    1 
ATOM   4646  O  OH    . TYR A 1  611 ? -53.116 -12.088 53.157  1.00 115.10 ? 994  TYR A OH    1 
ATOM   4647  N  N     . THR A 1  612 ? -53.303 -16.995 58.738  1.00 75.79  ? 995  THR A N     1 
ATOM   4648  C  CA    . THR A 1  612 ? -54.669 -17.514 58.591  1.00 78.53  ? 995  THR A CA    1 
ATOM   4649  C  C     . THR A 1  612 ? -55.527 -17.434 59.861  1.00 76.72  ? 995  THR A C     1 
ATOM   4650  O  O     . THR A 1  612 ? -56.747 -17.608 59.768  1.00 84.45  ? 995  THR A O     1 
ATOM   4651  C  CB    . THR A 1  612 ? -54.667 -18.979 58.110  1.00 72.90  ? 995  THR A CB    1 
ATOM   4652  O  OG1   . THR A 1  612 ? -54.031 -19.822 59.079  1.00 77.10  ? 995  THR A OG1   1 
ATOM   4653  C  CG2   . THR A 1  612 ? -53.986 -19.129 56.757  1.00 69.55  ? 995  THR A CG2   1 
ATOM   4654  N  N     . SER A 1  613 ? -54.941 -17.165 61.031  1.00 77.69  ? 996  SER A N     1 
ATOM   4655  C  CA    . SER A 1  613 ? -55.678 -17.215 62.298  1.00 82.00  ? 996  SER A CA    1 
ATOM   4656  C  C     . SER A 1  613 ? -56.770 -16.135 62.369  1.00 81.46  ? 996  SER A C     1 
ATOM   4657  O  O     . SER A 1  613 ? -56.541 -14.963 62.051  1.00 85.62  ? 996  SER A O     1 
ATOM   4658  C  CB    . SER A 1  613 ? -54.702 -17.073 63.480  1.00 82.13  ? 996  SER A CB    1 
ATOM   4659  O  OG    . SER A 1  613 ? -54.613 -15.772 64.049  1.00 96.57  ? 996  SER A OG    1 
ATOM   4660  N  N     . LYS A 1  614 ? -57.970 -16.535 62.806  1.00 82.73  ? 997  LYS A N     1 
ATOM   4661  C  CA    . LYS A 1  614 ? -59.121 -15.635 62.778  1.00 81.37  ? 997  LYS A CA    1 
ATOM   4662  C  C     . LYS A 1  614 ? -59.062 -14.642 63.924  1.00 75.89  ? 997  LYS A C     1 
ATOM   4663  O  O     . LYS A 1  614 ? -59.602 -13.533 63.820  1.00 88.19  ? 997  LYS A O     1 
ATOM   4664  C  CB    . LYS A 1  614 ? -60.415 -16.457 62.831  1.00 87.27  ? 997  LYS A CB    1 
ATOM   4665  C  CG    . LYS A 1  614 ? -60.963 -16.834 61.449  1.00 84.05  ? 997  LYS A CG    1 
ATOM   4666  C  CD    . LYS A 1  614 ? -61.756 -18.133 61.433  1.00 83.25  ? 997  LYS A CD    1 
ATOM   4667  C  CE    . LYS A 1  614 ? -62.351 -18.373 60.056  1.00 83.55  ? 997  LYS A CE    1 
ATOM   4668  N  NZ    . LYS A 1  614 ? -63.332 -17.300 59.772  1.00 89.35  ? 997  LYS A NZ    1 
ATOM   4669  N  N     . TYR A 1  615 ? -58.431 -15.042 65.027  1.00 73.74  ? 998  TYR A N     1 
ATOM   4670  C  CA    . TYR A 1  615 ? -58.115 -14.117 66.107  1.00 69.82  ? 998  TYR A CA    1 
ATOM   4671  C  C     . TYR A 1  615 ? -57.463 -12.827 65.582  1.00 80.77  ? 998  TYR A C     1 
ATOM   4672  O  O     . TYR A 1  615 ? -58.033 -11.721 65.694  1.00 90.25  ? 998  TYR A O     1 
ATOM   4673  C  CB    . TYR A 1  615 ? -57.209 -14.850 67.084  1.00 72.57  ? 998  TYR A CB    1 
ATOM   4674  C  CG    . TYR A 1  615 ? -57.066 -14.212 68.436  1.00 77.77  ? 998  TYR A CG    1 
ATOM   4675  C  CD1   . TYR A 1  615 ? -58.148 -13.624 69.067  1.00 92.35  ? 998  TYR A CD1   1 
ATOM   4676  C  CD2   . TYR A 1  615 ? -55.853 -14.254 69.108  1.00 81.35  ? 998  TYR A CD2   1 
ATOM   4677  C  CE1   . TYR A 1  615 ? -58.016 -13.067 70.313  1.00 103.94 ? 998  TYR A CE1   1 
ATOM   4678  C  CE2   . TYR A 1  615 ? -55.705 -13.708 70.350  1.00 82.44  ? 998  TYR A CE2   1 
ATOM   4679  C  CZ    . TYR A 1  615 ? -56.794 -13.114 70.952  1.00 99.83  ? 998  TYR A CZ    1 
ATOM   4680  O  OH    . TYR A 1  615 ? -56.720 -12.545 72.202  1.00 111.04 ? 998  TYR A OH    1 
ATOM   4681  N  N     . LEU A 1  616 ? -56.287 -12.949 64.955  1.00 73.09  ? 999  LEU A N     1 
ATOM   4682  C  CA    . LEU A 1  616 ? -55.577 -11.754 64.509  1.00 67.58  ? 999  LEU A CA    1 
ATOM   4683  C  C     . LEU A 1  616 ? -56.369 -11.011 63.430  1.00 71.63  ? 999  LEU A C     1 
ATOM   4684  O  O     . LEU A 1  616 ? -56.392 -9.780  63.423  1.00 75.01  ? 999  LEU A O     1 
ATOM   4685  C  CB    . LEU A 1  616 ? -54.158 -12.116 64.045  1.00 68.42  ? 999  LEU A CB    1 
ATOM   4686  C  CG    . LEU A 1  616 ? -53.050 -12.481 65.072  1.00 65.98  ? 999  LEU A CG    1 
ATOM   4687  C  CD1   . LEU A 1  616 ? -53.622 -13.142 66.296  1.00 85.76  ? 999  LEU A CD1   1 
ATOM   4688  C  CD2   . LEU A 1  616 ? -51.912 -13.349 64.491  1.00 66.76  ? 999  LEU A CD2   1 
ATOM   4689  N  N     . GLN A 1  617 ? -57.056 -11.726 62.535  1.00 73.39  ? 1000 GLN A N     1 
ATOM   4690  C  CA    . GLN A 1  617 ? -57.889 -11.049 61.536  1.00 71.26  ? 1000 GLN A CA    1 
ATOM   4691  C  C     . GLN A 1  617 ? -58.987 -10.227 62.179  1.00 73.74  ? 1000 GLN A C     1 
ATOM   4692  O  O     . GLN A 1  617 ? -59.358 -9.165  61.660  1.00 78.38  ? 1000 GLN A O     1 
ATOM   4693  C  CB    . GLN A 1  617 ? -58.519 -12.060 60.585  1.00 86.68  ? 1000 GLN A CB    1 
ATOM   4694  C  CG    . GLN A 1  617 ? -57.517 -12.885 59.771  1.00 91.80  ? 1000 GLN A CG    1 
ATOM   4695  C  CD    . GLN A 1  617 ? -58.172 -14.075 59.080  1.00 88.25  ? 1000 GLN A CD    1 
ATOM   4696  O  OE1   . GLN A 1  617 ? -59.391 -14.270 59.161  1.00 99.26  ? 1000 GLN A OE1   1 
ATOM   4697  N  NE2   . GLN A 1  617 ? -57.364 -14.879 58.404  1.00 89.21  ? 1000 GLN A NE2   1 
ATOM   4698  N  N     . LYS A 1  618 ? -59.529 -10.709 63.295  1.00 78.52  ? 1001 LYS A N     1 
ATOM   4699  C  CA    . LYS A 1  618 ? -60.444 -9.885  64.068  1.00 86.09  ? 1001 LYS A CA    1 
ATOM   4700  C  C     . LYS A 1  618 ? -59.762 -8.594  64.496  1.00 85.91  ? 1001 LYS A C     1 
ATOM   4701  O  O     . LYS A 1  618 ? -60.320 -7.507  64.312  1.00 91.89  ? 1001 LYS A O     1 
ATOM   4702  C  CB    . LYS A 1  618 ? -60.992 -10.661 65.270  1.00 89.92  ? 1001 LYS A CB    1 
ATOM   4703  C  CG    . LYS A 1  618 ? -62.241 -10.024 65.900  1.00 103.37 ? 1001 LYS A CG    1 
ATOM   4704  C  CD    . LYS A 1  618 ? -63.530 -10.471 65.204  1.00 119.07 ? 1001 LYS A CD    1 
ATOM   4705  C  CE    . LYS A 1  618 ? -64.763 -9.823  65.824  1.00 124.10 ? 1001 LYS A CE    1 
ATOM   4706  N  NZ    . LYS A 1  618 ? -65.906 -9.869  64.870  1.00 128.54 ? 1001 LYS A NZ    1 
ATOM   4707  N  N     . PHE A 1  619 ? -58.529 -8.675  65.014  1.00 84.61  ? 1002 PHE A N     1 
ATOM   4708  C  CA    . PHE A 1  619 ? -57.863 -7.402  65.352  1.00 73.97  ? 1002 PHE A CA    1 
ATOM   4709  C  C     . PHE A 1  619 ? -57.696 -6.511  64.127  1.00 77.66  ? 1002 PHE A C     1 
ATOM   4710  O  O     . PHE A 1  619 ? -57.811 -5.290  64.227  1.00 76.16  ? 1002 PHE A O     1 
ATOM   4711  C  CB    . PHE A 1  619 ? -56.502 -7.589  66.004  1.00 74.18  ? 1002 PHE A CB    1 
ATOM   4712  C  CG    . PHE A 1  619 ? -56.562 -8.141  67.366  1.00 73.85  ? 1002 PHE A CG    1 
ATOM   4713  C  CD1   . PHE A 1  619 ? -57.369 -7.580  68.319  1.00 70.48  ? 1002 PHE A CD1   1 
ATOM   4714  C  CD2   . PHE A 1  619 ? -55.838 -9.261  67.672  1.00 82.54  ? 1002 PHE A CD2   1 
ATOM   4715  C  CE1   . PHE A 1  619 ? -57.421 -8.128  69.569  1.00 83.04  ? 1002 PHE A CE1   1 
ATOM   4716  C  CE2   . PHE A 1  619 ? -55.890 -9.817  68.901  1.00 83.35  ? 1002 PHE A CE2   1 
ATOM   4717  C  CZ    . PHE A 1  619 ? -56.677 -9.260  69.859  1.00 78.76  ? 1002 PHE A CZ    1 
ATOM   4718  N  N     . MET A 1  620 ? -57.433 -7.096  62.969  1.00 79.44  ? 1003 MET A N     1 
ATOM   4719  C  CA    . MET A 1  620 ? -57.157 -6.286  61.791  1.00 79.06  ? 1003 MET A CA    1 
ATOM   4720  C  C     . MET A 1  620 ? -58.423 -5.789  61.110  1.00 90.75  ? 1003 MET A C     1 
ATOM   4721  O  O     . MET A 1  620 ? -58.321 -5.056  60.121  1.00 96.10  ? 1003 MET A O     1 
ATOM   4722  C  CB    . MET A 1  620 ? -56.305 -7.054  60.777  1.00 80.43  ? 1003 MET A CB    1 
ATOM   4723  C  CG    . MET A 1  620 ? -54.925 -7.519  61.269  1.00 80.96  ? 1003 MET A CG    1 
ATOM   4724  S  SD    . MET A 1  620 ? -53.809 -6.183  61.687  1.00 83.71  ? 1003 MET A SD    1 
ATOM   4725  C  CE    . MET A 1  620 ? -53.980 -5.161  60.233  1.00 92.57  ? 1003 MET A CE    1 
ATOM   4726  N  N     . ASN A 1  621 ? -59.609 -6.179  61.588  1.00 98.15  ? 1004 ASN A N     1 
ATOM   4727  C  CA    . ASN A 1  621 ? -60.856 -5.561  61.143  1.00 97.91  ? 1004 ASN A CA    1 
ATOM   4728  C  C     . ASN A 1  621 ? -61.551 -4.807  62.280  1.00 101.83 ? 1004 ASN A C     1 
ATOM   4729  O  O     . ASN A 1  621 ? -62.771 -4.641  62.264  1.00 109.20 ? 1004 ASN A O     1 
ATOM   4730  C  CB    . ASN A 1  621 ? -61.790 -6.609  60.535  1.00 101.22 ? 1004 ASN A CB    1 
ATOM   4731  C  CG    . ASN A 1  621 ? -61.135 -7.391  59.416  1.00 104.84 ? 1004 ASN A CG    1 
ATOM   4732  O  OD1   . ASN A 1  621 ? -60.655 -6.803  58.440  1.00 110.26 ? 1004 ASN A OD1   1 
ATOM   4733  N  ND2   . ASN A 1  621 ? -61.083 -8.719  59.561  1.00 108.75 ? 1004 ASN A ND2   1 
ATOM   4734  N  N     . ALA A 1  622 ? -60.778 -4.317  63.259  1.00 107.65 ? 1005 ALA A N     1 
ATOM   4735  C  CA    . ALA A 1  622 ? -61.353 -3.748  64.481  1.00 111.35 ? 1005 ALA A CA    1 
ATOM   4736  C  C     . ALA A 1  622 ? -62.299 -2.589  64.204  1.00 122.73 ? 1005 ALA A C     1 
ATOM   4737  O  O     . ALA A 1  622 ? -63.305 -2.437  64.909  1.00 135.73 ? 1005 ALA A O     1 
ATOM   4738  C  CB    . ALA A 1  622 ? -60.243 -3.270  65.419  1.00 98.40  ? 1005 ALA A CB    1 
ATOM   4739  N  N     . HIS A 1  623 ? -61.984 -1.757  63.202  1.00 115.13 ? 1006 HIS A N     1 
ATOM   4740  C  CA    . HIS A 1  623 ? -62.769 -0.554  62.936  1.00 118.85 ? 1006 HIS A CA    1 
ATOM   4741  C  C     . HIS A 1  623 ? -64.226 -0.875  62.628  1.00 126.74 ? 1006 HIS A C     1 
ATOM   4742  O  O     . HIS A 1  623 ? -65.110 -0.044  62.874  1.00 134.96 ? 1006 HIS A O     1 
ATOM   4743  C  CB    . HIS A 1  623 ? -62.140 0.248   61.790  1.00 116.96 ? 1006 HIS A CB    1 
ATOM   4744  C  CG    . HIS A 1  623 ? -61.542 -0.588  60.692  1.00 123.69 ? 1006 HIS A CG    1 
ATOM   4745  N  ND1   . HIS A 1  623 ? -60.381 -1.316  60.853  1.00 123.08 ? 1006 HIS A ND1   1 
ATOM   4746  C  CD2   . HIS A 1  623 ? -61.911 -0.754  59.396  1.00 126.97 ? 1006 HIS A CD2   1 
ATOM   4747  C  CE1   . HIS A 1  623 ? -60.086 -1.926  59.717  1.00 125.41 ? 1006 HIS A CE1   1 
ATOM   4748  N  NE2   . HIS A 1  623 ? -60.992 -1.593  58.813  1.00 121.77 ? 1006 HIS A NE2   1 
ATOM   4749  N  N     . ASN A 1  624 ? -64.495 -2.066  62.100  1.00 130.00 ? 1007 ASN A N     1 
ATOM   4750  C  CA    . ASN A 1  624 ? -65.858 -2.523  61.855  1.00 136.41 ? 1007 ASN A CA    1 
ATOM   4751  C  C     . ASN A 1  624 ? -66.311 -3.528  62.921  1.00 134.63 ? 1007 ASN A C     1 
ATOM   4752  O  O     . ASN A 1  624 ? -66.499 -3.182  64.091  1.00 136.54 ? 1007 ASN A O     1 
ATOM   4753  C  CB    . ASN A 1  624 ? -65.964 -3.162  60.469  1.00 133.35 ? 1007 ASN A CB    1 
ATOM   4754  C  CG    . ASN A 1  624 ? -65.146 -2.433  59.429  1.00 129.80 ? 1007 ASN A CG    1 
ATOM   4755  O  OD1   . ASN A 1  624 ? -64.963 -1.217  59.509  1.00 126.49 ? 1007 ASN A OD1   1 
ATOM   4756  N  ND2   . ASN A 1  624 ? -64.643 -3.173  58.448  1.00 130.99 ? 1007 ASN A ND2   1 
ATOM   4757  N  N     . MET B 2  1   ? -11.059 -52.346 30.952  1.00 108.89 ? 1    MET B N     1 
ATOM   4758  C  CA    . MET B 2  1   ? -12.360 -51.752 31.226  1.00 113.19 ? 1    MET B CA    1 
ATOM   4759  C  C     . MET B 2  1   ? -12.466 -50.355 30.607  1.00 121.97 ? 1    MET B C     1 
ATOM   4760  O  O     . MET B 2  1   ? -11.813 -49.417 31.069  1.00 123.63 ? 1    MET B O     1 
ATOM   4761  C  CB    . MET B 2  1   ? -12.612 -51.698 32.739  1.00 102.25 ? 1    MET B CB    1 
ATOM   4762  N  N     . SER B 2  2   ? -13.286 -50.213 29.563  1.00 125.66 ? 2    SER B N     1 
ATOM   4763  C  CA    . SER B 2  2   ? -13.402 -48.952 28.837  1.00 128.10 ? 2    SER B CA    1 
ATOM   4764  C  C     . SER B 2  2   ? -14.714 -48.259 29.181  1.00 123.40 ? 2    SER B C     1 
ATOM   4765  O  O     . SER B 2  2   ? -15.794 -48.823 28.975  1.00 123.83 ? 2    SER B O     1 
ATOM   4766  C  CB    . SER B 2  2   ? -13.341 -49.183 27.327  1.00 132.59 ? 2    SER B CB    1 
ATOM   4767  O  OG    . SER B 2  2   ? -14.576 -49.709 26.866  1.00 135.48 ? 2    SER B OG    1 
ATOM   4768  N  N     . LEU B 2  3   ? -14.615 -47.009 29.623  1.00 118.08 ? 3    LEU B N     1 
ATOM   4769  C  CA    . LEU B 2  3   ? -15.773 -46.201 29.979  1.00 116.83 ? 3    LEU B CA    1 
ATOM   4770  C  C     . LEU B 2  3   ? -16.230 -45.415 28.756  1.00 118.89 ? 3    LEU B C     1 
ATOM   4771  O  O     . LEU B 2  3   ? -15.406 -44.915 27.986  1.00 124.03 ? 3    LEU B O     1 
ATOM   4772  C  CB    . LEU B 2  3   ? -15.425 -45.257 31.137  1.00 119.76 ? 3    LEU B CB    1 
ATOM   4773  C  CG    . LEU B 2  3   ? -16.481 -44.367 31.808  1.00 117.64 ? 3    LEU B CG    1 
ATOM   4774  C  CD1   . LEU B 2  3   ? -17.562 -45.212 32.405  1.00 121.25 ? 3    LEU B CD1   1 
ATOM   4775  C  CD2   . LEU B 2  3   ? -15.881 -43.463 32.889  1.00 115.66 ? 3    LEU B CD2   1 
ATOM   4776  N  N     . GLN B 2  4   ? -17.546 -45.325 28.562  1.00 120.72 ? 4    GLN B N     1 
ATOM   4777  C  CA    . GLN B 2  4   ? -18.077 -44.650 27.380  1.00 126.23 ? 4    GLN B CA    1 
ATOM   4778  C  C     . GLN B 2  4   ? -19.332 -43.865 27.741  1.00 117.51 ? 4    GLN B C     1 
ATOM   4779  O  O     . GLN B 2  4   ? -20.207 -44.390 28.429  1.00 116.42 ? 4    GLN B O     1 
ATOM   4780  C  CB    . GLN B 2  4   ? -18.383 -45.670 26.274  1.00 123.51 ? 4    GLN B CB    1 
ATOM   4781  C  CG    . GLN B 2  4   ? -18.770 -45.043 24.957  1.00 122.53 ? 4    GLN B CG    1 
ATOM   4782  C  CD    . GLN B 2  4   ? -17.633 -44.235 24.367  1.00 137.09 ? 4    GLN B CD    1 
ATOM   4783  O  OE1   . GLN B 2  4   ? -17.840 -43.150 23.820  1.00 143.83 ? 4    GLN B OE1   1 
ATOM   4784  N  NE2   . GLN B 2  4   ? -16.414 -44.748 24.504  1.00 142.56 ? 4    GLN B NE2   1 
ATOM   4785  N  N     . MET B 2  5   ? -19.420 -42.609 27.308  1.00 116.21 ? 5    MET B N     1 
ATOM   4786  C  CA    . MET B 2  5   ? -20.639 -41.843 27.548  1.00 117.29 ? 5    MET B CA    1 
ATOM   4787  C  C     . MET B 2  5   ? -21.784 -42.364 26.686  1.00 118.58 ? 5    MET B C     1 
ATOM   4788  O  O     . MET B 2  5   ? -21.569 -42.936 25.612  1.00 124.46 ? 5    MET B O     1 
ATOM   4789  C  CB    . MET B 2  5   ? -20.424 -40.358 27.263  1.00 121.98 ? 5    MET B CB    1 
ATOM   4790  C  CG    . MET B 2  5   ? -19.511 -39.673 28.253  1.00 131.68 ? 5    MET B CG    1 
ATOM   4791  S  SD    . MET B 2  5   ? -19.659 -37.870 28.317  1.00 157.14 ? 5    MET B SD    1 
ATOM   4792  C  CE    . MET B 2  5   ? -21.344 -37.657 28.876  1.00 128.56 ? 5    MET B CE    1 
ATOM   4793  N  N     . VAL B 2  6   ? -23.016 -42.165 27.163  1.00 112.29 ? 6    VAL B N     1 
ATOM   4794  C  CA    . VAL B 2  6   ? -24.210 -42.609 26.448  1.00 107.12 ? 6    VAL B CA    1 
ATOM   4795  C  C     . VAL B 2  6   ? -25.222 -41.476 26.382  1.00 112.06 ? 6    VAL B C     1 
ATOM   4796  O  O     . VAL B 2  6   ? -25.502 -40.830 27.399  1.00 111.32 ? 6    VAL B O     1 
ATOM   4797  C  CB    . VAL B 2  6   ? -24.854 -43.831 27.114  1.00 107.66 ? 6    VAL B CB    1 
ATOM   4798  C  CG1   . VAL B 2  6   ? -25.933 -44.390 26.206  1.00 114.40 ? 6    VAL B CG1   1 
ATOM   4799  C  CG2   . VAL B 2  6   ? -23.808 -44.873 27.405  1.00 110.95 ? 6    VAL B CG2   1 
ATOM   4800  N  N     . THR B 2  7   ? -25.808 -41.272 25.203  1.00 113.22 ? 7    THR B N     1 
ATOM   4801  C  CA    . THR B 2  7   ? -26.913 -40.341 25.029  1.00 113.69 ? 7    THR B CA    1 
ATOM   4802  C  C     . THR B 2  7   ? -28.233 -41.094 25.106  1.00 119.75 ? 7    THR B C     1 
ATOM   4803  O  O     . THR B 2  7   ? -28.306 -42.298 24.840  1.00 121.53 ? 7    THR B O     1 
ATOM   4804  C  CB    . THR B 2  7   ? -26.845 -39.602 23.689  1.00 114.06 ? 7    THR B CB    1 
ATOM   4805  O  OG1   . THR B 2  7   ? -26.921 -40.546 22.611  1.00 117.44 ? 7    THR B OG1   1 
ATOM   4806  C  CG2   . THR B 2  7   ? -25.558 -38.804 23.578  1.00 115.03 ? 7    THR B CG2   1 
ATOM   4807  N  N     . VAL B 2  8   ? -29.291 -40.365 25.452  1.00 117.31 ? 8    VAL B N     1 
ATOM   4808  C  CA    . VAL B 2  8   ? -30.583 -40.987 25.698  1.00 114.60 ? 8    VAL B CA    1 
ATOM   4809  C  C     . VAL B 2  8   ? -31.656 -40.287 24.875  1.00 114.57 ? 8    VAL B C     1 
ATOM   4810  O  O     . VAL B 2  8   ? -31.550 -39.099 24.556  1.00 118.63 ? 8    VAL B O     1 
ATOM   4811  C  CB    . VAL B 2  8   ? -30.958 -40.966 27.198  1.00 117.12 ? 8    VAL B CB    1 
ATOM   4812  C  CG1   . VAL B 2  8   ? -32.029 -41.998 27.484  1.00 118.46 ? 8    VAL B CG1   1 
ATOM   4813  C  CG2   . VAL B 2  8   ? -29.744 -41.220 28.073  1.00 115.62 ? 8    VAL B CG2   1 
ATOM   4814  N  N     . GLY B 2  9   ? -32.696 -41.049 24.529  1.00 116.43 ? 9    GLY B N     1 
ATOM   4815  C  CA    . GLY B 2  9   ? -33.794 -40.566 23.719  1.00 115.50 ? 9    GLY B CA    1 
ATOM   4816  C  C     . GLY B 2  9   ? -34.781 -39.746 24.520  1.00 110.59 ? 9    GLY B C     1 
ATOM   4817  O  O     . GLY B 2  9   ? -34.504 -39.304 25.636  1.00 108.46 ? 9    GLY B O     1 
ATOM   4818  N  N     . HIS B 2  10  ? -35.983 -39.601 23.963  1.00 114.88 ? 10   HIS B N     1 
ATOM   4819  C  CA    . HIS B 2  10  ? -36.935 -38.644 24.524  1.00 120.99 ? 10   HIS B CA    1 
ATOM   4820  C  C     . HIS B 2  10  ? -37.394 -39.038 25.922  1.00 116.01 ? 10   HIS B C     1 
ATOM   4821  O  O     . HIS B 2  10  ? -37.628 -38.174 26.775  1.00 115.84 ? 10   HIS B O     1 
ATOM   4822  C  CB    . HIS B 2  10  ? -38.119 -38.473 23.573  1.00 131.44 ? 10   HIS B CB    1 
ATOM   4823  C  CG    . HIS B 2  10  ? -38.940 -39.706 23.399  1.00 133.17 ? 10   HIS B CG    1 
ATOM   4824  N  ND1   . HIS B 2  10  ? -38.457 -40.836 22.775  1.00 151.62 ? 10   HIS B ND1   1 
ATOM   4825  C  CD2   . HIS B 2  10  ? -40.224 -39.977 23.731  1.00 132.30 ? 10   HIS B CD2   1 
ATOM   4826  C  CE1   . HIS B 2  10  ? -39.400 -41.762 22.752  1.00 149.62 ? 10   HIS B CE1   1 
ATOM   4827  N  NE2   . HIS B 2  10  ? -40.483 -41.264 23.324  1.00 148.83 ? 10   HIS B NE2   1 
ATOM   4828  N  N     . ASN B 2  11  ? -37.510 -40.330 26.189  1.00 118.59 ? 11   ASN B N     1 
ATOM   4829  C  CA    . ASN B 2  11  ? -38.013 -40.799 27.478  1.00 113.36 ? 11   ASN B CA    1 
ATOM   4830  C  C     . ASN B 2  11  ? -36.884 -41.099 28.462  1.00 105.02 ? 11   ASN B C     1 
ATOM   4831  O  O     . ASN B 2  11  ? -36.906 -42.110 29.169  1.00 90.78  ? 11   ASN B O     1 
ATOM   4832  C  CB    . ASN B 2  11  ? -38.908 -42.012 27.260  1.00 98.64  ? 11   ASN B CB    1 
ATOM   4833  C  CG    . ASN B 2  11  ? -38.441 -42.856 26.098  1.00 115.38 ? 11   ASN B CG    1 
ATOM   4834  O  OD1   . ASN B 2  11  ? -37.293 -42.739 25.651  1.00 125.18 ? 11   ASN B OD1   1 
ATOM   4835  N  ND2   . ASN B 2  11  ? -39.334 -43.684 25.568  1.00 118.06 ? 11   ASN B ND2   1 
ATOM   4836  N  N     . ILE B 2  12  ? -35.889 -40.211 28.544  1.00 102.37 ? 12   ILE B N     1 
ATOM   4837  C  CA    . ILE B 2  12  ? -34.811 -40.406 29.506  1.00 93.51  ? 12   ILE B CA    1 
ATOM   4838  C  C     . ILE B 2  12  ? -35.332 -40.292 30.928  1.00 97.89  ? 12   ILE B C     1 
ATOM   4839  O  O     . ILE B 2  12  ? -34.735 -40.841 31.863  1.00 99.99  ? 12   ILE B O     1 
ATOM   4840  C  CB    . ILE B 2  12  ? -33.685 -39.392 29.268  1.00 104.71 ? 12   ILE B CB    1 
ATOM   4841  C  CG1   . ILE B 2  12  ? -32.529 -39.654 30.233  1.00 103.74 ? 12   ILE B CG1   1 
ATOM   4842  C  CG2   . ILE B 2  12  ? -34.208 -37.997 29.489  1.00 107.98 ? 12   ILE B CG2   1 
ATOM   4843  C  CD1   . ILE B 2  12  ? -31.408 -38.653 30.145  1.00 111.06 ? 12   ILE B CD1   1 
ATOM   4844  N  N     . ALA B 2  13  ? -36.436 -39.571 31.126  1.00 96.90  ? 13   ALA B N     1 
ATOM   4845  C  CA    . ALA B 2  13  ? -36.944 -39.366 32.476  1.00 93.04  ? 13   ALA B CA    1 
ATOM   4846  C  C     . ALA B 2  13  ? -37.312 -40.683 33.160  1.00 91.80  ? 13   ALA B C     1 
ATOM   4847  O  O     . ALA B 2  13  ? -37.273 -40.766 34.392  1.00 95.59  ? 13   ALA B O     1 
ATOM   4848  C  CB    . ALA B 2  13  ? -38.140 -38.421 32.438  1.00 91.50  ? 13   ALA B CB    1 
ATOM   4849  N  N     . LEU B 2  14  ? -37.653 -41.721 32.390  1.00 82.49  ? 14   LEU B N     1 
ATOM   4850  C  CA    . LEU B 2  14  ? -38.033 -43.002 32.981  1.00 78.34  ? 14   LEU B CA    1 
ATOM   4851  C  C     . LEU B 2  14  ? -36.933 -43.583 33.863  1.00 79.76  ? 14   LEU B C     1 
ATOM   4852  O  O     . LEU B 2  14  ? -37.218 -44.309 34.819  1.00 86.76  ? 14   LEU B O     1 
ATOM   4853  C  CB    . LEU B 2  14  ? -38.383 -43.993 31.887  1.00 86.64  ? 14   LEU B CB    1 
ATOM   4854  C  CG    . LEU B 2  14  ? -39.505 -43.543 30.974  1.00 91.68  ? 14   LEU B CG    1 
ATOM   4855  C  CD1   . LEU B 2  14  ? -39.642 -44.568 29.874  1.00 104.89 ? 14   LEU B CD1   1 
ATOM   4856  C  CD2   . LEU B 2  14  ? -40.782 -43.403 31.755  1.00 78.61  ? 14   LEU B CD2   1 
ATOM   4857  N  N     . ILE B 2  15  ? -35.669 -43.340 33.519  1.00 85.87  ? 15   ILE B N     1 
ATOM   4858  C  CA    . ILE B 2  15  ? -34.562 -43.944 34.254  1.00 80.72  ? 15   ILE B CA    1 
ATOM   4859  C  C     . ILE B 2  15  ? -34.407 -43.260 35.603  1.00 74.65  ? 15   ILE B C     1 
ATOM   4860  O  O     . ILE B 2  15  ? -34.300 -42.032 35.688  1.00 85.69  ? 15   ILE B O     1 
ATOM   4861  C  CB    . ILE B 2  15  ? -33.265 -43.872 33.435  1.00 81.45  ? 15   ILE B CB    1 
ATOM   4862  C  CG1   . ILE B 2  15  ? -33.494 -44.441 32.036  1.00 77.97  ? 15   ILE B CG1   1 
ATOM   4863  C  CG2   . ILE B 2  15  ? -32.129 -44.593 34.140  1.00 83.93  ? 15   ILE B CG2   1 
ATOM   4864  C  CD1   . ILE B 2  15  ? -32.287 -44.341 31.151  1.00 85.19  ? 15   ILE B CD1   1 
ATOM   4865  N  N     . GLN B 2  16  ? -34.383 -44.053 36.659  1.00 67.79  ? 16   GLN B N     1 
ATOM   4866  C  CA    . GLN B 2  16  ? -34.267 -43.560 38.017  1.00 70.96  ? 16   GLN B CA    1 
ATOM   4867  C  C     . GLN B 2  16  ? -33.409 -44.521 38.814  1.00 70.91  ? 16   GLN B C     1 
ATOM   4868  O  O     . GLN B 2  16  ? -33.174 -45.653 38.389  1.00 72.14  ? 16   GLN B O     1 
ATOM   4869  C  CB    . GLN B 2  16  ? -35.637 -43.419 38.688  1.00 77.21  ? 16   GLN B CB    1 
ATOM   4870  C  CG    . GLN B 2  16  ? -36.270 -44.744 39.044  1.00 81.51  ? 16   GLN B CG    1 
ATOM   4871  C  CD    . GLN B 2  16  ? -37.702 -44.604 39.524  1.00 79.01  ? 16   GLN B CD    1 
ATOM   4872  O  OE1   . GLN B 2  16  ? -38.069 -43.610 40.151  1.00 82.45  ? 16   GLN B OE1   1 
ATOM   4873  N  NE2   . GLN B 2  16  ? -38.528 -45.588 39.197  1.00 82.15  ? 16   GLN B NE2   1 
ATOM   4874  N  N     . PRO B 2  17  ? -32.903 -44.085 39.955  1.00 74.89  ? 17   PRO B N     1 
ATOM   4875  C  CA    . PRO B 2  17  ? -32.224 -45.008 40.864  1.00 78.20  ? 17   PRO B CA    1 
ATOM   4876  C  C     . PRO B 2  17  ? -33.145 -46.141 41.291  1.00 87.38  ? 17   PRO B C     1 
ATOM   4877  O  O     . PRO B 2  17  ? -34.341 -45.939 41.513  1.00 89.97  ? 17   PRO B O     1 
ATOM   4878  C  CB    . PRO B 2  17  ? -31.857 -44.116 42.052  1.00 82.28  ? 17   PRO B CB    1 
ATOM   4879  C  CG    . PRO B 2  17  ? -31.765 -42.747 41.465  1.00 88.83  ? 17   PRO B CG    1 
ATOM   4880  C  CD    . PRO B 2  17  ? -32.816 -42.694 40.410  1.00 81.47  ? 17   PRO B CD    1 
ATOM   4881  N  N     . GLY B 2  18  ? -32.577 -47.349 41.400  1.00 84.16  ? 18   GLY B N     1 
ATOM   4882  C  CA    . GLY B 2  18  ? -33.347 -48.530 41.748  1.00 84.10  ? 18   GLY B CA    1 
ATOM   4883  C  C     . GLY B 2  18  ? -33.896 -49.333 40.583  1.00 86.65  ? 18   GLY B C     1 
ATOM   4884  O  O     . GLY B 2  18  ? -34.545 -50.363 40.815  1.00 88.87  ? 18   GLY B O     1 
ATOM   4885  N  N     . PHE B 2  19  ? -33.672 -48.901 39.346  1.00 84.40  ? 19   PHE B N     1 
ATOM   4886  C  CA    . PHE B 2  19  ? -34.183 -49.638 38.203  1.00 76.60  ? 19   PHE B CA    1 
ATOM   4887  C  C     . PHE B 2  19  ? -33.454 -50.964 38.064  1.00 79.04  ? 19   PHE B C     1 
ATOM   4888  O  O     . PHE B 2  19  ? -32.431 -51.219 38.711  1.00 77.96  ? 19   PHE B O     1 
ATOM   4889  C  CB    . PHE B 2  19  ? -34.004 -48.835 36.928  1.00 75.34  ? 19   PHE B CB    1 
ATOM   4890  C  CG    . PHE B 2  19  ? -32.614 -48.871 36.413  1.00 77.73  ? 19   PHE B CG    1 
ATOM   4891  C  CD1   . PHE B 2  19  ? -31.603 -48.212 37.089  1.00 90.70  ? 19   PHE B CD1   1 
ATOM   4892  C  CD2   . PHE B 2  19  ? -32.304 -49.551 35.261  1.00 74.53  ? 19   PHE B CD2   1 
ATOM   4893  C  CE1   . PHE B 2  19  ? -30.311 -48.235 36.626  1.00 82.93  ? 19   PHE B CE1   1 
ATOM   4894  C  CE2   . PHE B 2  19  ? -31.011 -49.575 34.788  1.00 89.15  ? 19   PHE B CE2   1 
ATOM   4895  C  CZ    . PHE B 2  19  ? -30.015 -48.915 35.472  1.00 89.13  ? 19   PHE B CZ    1 
ATOM   4896  N  N     . SER B 2  20  ? -33.992 -51.813 37.190  1.00 85.53  ? 20   SER B N     1 
ATOM   4897  C  CA    . SER B 2  20  ? -33.416 -53.125 36.925  1.00 92.14  ? 20   SER B CA    1 
ATOM   4898  C  C     . SER B 2  20  ? -33.302 -53.366 35.423  1.00 85.05  ? 20   SER B C     1 
ATOM   4899  O  O     . SER B 2  20  ? -34.113 -52.881 34.626  1.00 83.68  ? 20   SER B O     1 
ATOM   4900  C  CB    . SER B 2  20  ? -34.252 -54.272 37.569  1.00 85.49  ? 20   SER B CB    1 
ATOM   4901  O  OG    . SER B 2  20  ? -34.593 -53.999 38.917  1.00 89.42  ? 20   SER B OG    1 
ATOM   4902  N  N     . LEU B 2  21  ? -32.297 -54.151 35.053  1.00 81.30  ? 21   LEU B N     1 
ATOM   4903  C  CA    . LEU B 2  21  ? -32.108 -54.603 33.689  1.00 82.20  ? 21   LEU B CA    1 
ATOM   4904  C  C     . LEU B 2  21  ? -32.092 -56.113 33.674  1.00 90.37  ? 21   LEU B C     1 
ATOM   4905  O  O     . LEU B 2  21  ? -31.427 -56.744 34.501  1.00 92.03  ? 21   LEU B O     1 
ATOM   4906  C  CB    . LEU B 2  21  ? -30.808 -54.114 33.117  1.00 81.05  ? 21   LEU B CB    1 
ATOM   4907  C  CG    . LEU B 2  21  ? -30.757 -52.618 33.001  1.00 83.64  ? 21   LEU B CG    1 
ATOM   4908  C  CD1   . LEU B 2  21  ? -29.415 -52.222 32.480  1.00 91.82  ? 21   LEU B CD1   1 
ATOM   4909  C  CD2   . LEU B 2  21  ? -31.840 -52.218 32.054  1.00 85.77  ? 21   LEU B CD2   1 
ATOM   4910  N  N     . MET B 2  22  ? -32.792 -56.681 32.713  1.00 91.77  ? 22   MET B N     1 
ATOM   4911  C  CA    . MET B 2  22  ? -32.827 -58.125 32.563  1.00 100.12 ? 22   MET B CA    1 
ATOM   4912  C  C     . MET B 2  22  ? -32.417 -58.490 31.151  1.00 102.51 ? 22   MET B C     1 
ATOM   4913  O  O     . MET B 2  22  ? -32.832 -57.835 30.192  1.00 97.93  ? 22   MET B O     1 
ATOM   4914  C  CB    . MET B 2  22  ? -34.207 -58.673 32.874  1.00 98.68  ? 22   MET B CB    1 
ATOM   4915  C  CG    . MET B 2  22  ? -35.310 -57.769 32.382  1.00 99.81  ? 22   MET B CG    1 
ATOM   4916  S  SD    . MET B 2  22  ? -36.883 -58.361 32.979  1.00 101.73 ? 22   MET B SD    1 
ATOM   4917  C  CE    . MET B 2  22  ? -36.417 -58.729 34.675  1.00 100.71 ? 22   MET B CE    1 
ATOM   4918  N  N     . ASN B 2  23  ? -31.636 -59.561 31.026  1.00 102.90 ? 23   ASN B N     1 
ATOM   4919  C  CA    . ASN B 2  23  ? -31.064 -59.952 29.749  1.00 100.67 ? 23   ASN B CA    1 
ATOM   4920  C  C     . ASN B 2  23  ? -31.673 -61.267 29.291  1.00 99.46  ? 23   ASN B C     1 
ATOM   4921  O  O     . ASN B 2  23  ? -31.557 -62.278 29.988  1.00 104.96 ? 23   ASN B O     1 
ATOM   4922  C  CB    . ASN B 2  23  ? -29.552 -60.075 29.841  1.00 100.51 ? 23   ASN B CB    1 
ATOM   4923  C  CG    . ASN B 2  23  ? -28.907 -59.975 28.491  1.00 110.71 ? 23   ASN B CG    1 
ATOM   4924  O  OD1   . ASN B 2  23  ? -29.465 -60.437 27.498  1.00 112.79 ? 23   ASN B OD1   1 
ATOM   4925  N  ND2   . ASN B 2  23  ? -27.734 -59.357 28.431  1.00 120.45 ? 23   ASN B ND2   1 
ATOM   4926  N  N     . PHE B 2  24  ? -32.302 -61.249 28.115  1.00 102.39 ? 24   PHE B N     1 
ATOM   4927  C  CA    . PHE B 2  24  ? -32.894 -62.429 27.491  1.00 102.45 ? 24   PHE B CA    1 
ATOM   4928  C  C     . PHE B 2  24  ? -32.258 -62.635 26.127  1.00 108.28 ? 24   PHE B C     1 
ATOM   4929  O  O     . PHE B 2  24  ? -32.531 -61.875 25.188  1.00 112.04 ? 24   PHE B O     1 
ATOM   4930  C  CB    . PHE B 2  24  ? -34.404 -62.291 27.346  1.00 95.99  ? 24   PHE B CB    1 
ATOM   4931  C  CG    . PHE B 2  24  ? -35.143 -62.525 28.612  1.00 98.86  ? 24   PHE B CG    1 
ATOM   4932  C  CD1   . PHE B 2  24  ? -35.722 -61.475 29.291  1.00 99.13  ? 24   PHE B CD1   1 
ATOM   4933  C  CD2   . PHE B 2  24  ? -35.246 -63.801 29.134  1.00 104.62 ? 24   PHE B CD2   1 
ATOM   4934  C  CE1   . PHE B 2  24  ? -36.397 -61.690 30.463  1.00 97.95  ? 24   PHE B CE1   1 
ATOM   4935  C  CE2   . PHE B 2  24  ? -35.918 -64.027 30.299  1.00 104.97 ? 24   PHE B CE2   1 
ATOM   4936  C  CZ    . PHE B 2  24  ? -36.498 -62.966 30.970  1.00 106.40 ? 24   PHE B CZ    1 
ATOM   4937  N  N     . ASP B 2  25  ? -31.403 -63.656 26.026  1.00 108.28 ? 25   ASP B N     1 
ATOM   4938  C  CA    . ASP B 2  25  ? -30.813 -64.060 24.752  1.00 118.14 ? 25   ASP B CA    1 
ATOM   4939  C  C     . ASP B 2  25  ? -30.069 -62.879 24.130  1.00 117.05 ? 25   ASP B C     1 
ATOM   4940  O  O     . ASP B 2  25  ? -30.247 -62.544 22.957  1.00 122.57 ? 25   ASP B O     1 
ATOM   4941  C  CB    . ASP B 2  25  ? -31.871 -64.625 23.797  1.00 129.73 ? 25   ASP B CB    1 
ATOM   4942  C  CG    . ASP B 2  25  ? -31.302 -65.660 22.822  1.00 138.52 ? 25   ASP B CG    1 
ATOM   4943  O  OD1   . ASP B 2  25  ? -30.070 -65.678 22.601  1.00 146.92 ? 25   ASP B OD1   1 
ATOM   4944  O  OD2   . ASP B 2  25  ? -32.095 -66.458 22.274  1.00 138.01 ? 25   ASP B OD2   1 
ATOM   4945  N  N     . GLY B 2  26  ? -29.278 -62.199 24.956  1.00 112.21 ? 26   GLY B N     1 
ATOM   4946  C  CA    . GLY B 2  26  ? -28.504 -61.063 24.504  1.00 107.72 ? 26   GLY B CA    1 
ATOM   4947  C  C     . GLY B 2  26  ? -29.248 -59.744 24.477  1.00 106.21 ? 26   GLY B C     1 
ATOM   4948  O  O     . GLY B 2  26  ? -28.618 -58.692 24.599  1.00 111.05 ? 26   GLY B O     1 
ATOM   4949  N  N     . GLN B 2  27  ? -30.574 -59.764 24.355  1.00 106.47 ? 27   GLN B N     1 
ATOM   4950  C  CA    . GLN B 2  27  ? -31.334 -58.519 24.346  1.00 107.79 ? 27   GLN B CA    1 
ATOM   4951  C  C     . GLN B 2  27  ? -31.557 -58.008 25.771  1.00 105.18 ? 27   GLN B C     1 
ATOM   4952  O  O     . GLN B 2  27  ? -31.937 -58.774 26.662  1.00 106.75 ? 27   GLN B O     1 
ATOM   4953  C  CB    . GLN B 2  27  ? -32.659 -58.722 23.619  1.00 107.47 ? 27   GLN B CB    1 
ATOM   4954  C  CG    . GLN B 2  27  ? -32.564 -58.493 22.130  1.00 113.85 ? 27   GLN B CG    1 
ATOM   4955  C  CD    . GLN B 2  27  ? -33.923 -58.283 21.511  1.00 126.45 ? 27   GLN B CD    1 
ATOM   4956  O  OE1   . GLN B 2  27  ? -34.094 -57.450 20.620  1.00 132.05 ? 27   GLN B OE1   1 
ATOM   4957  N  NE2   . GLN B 2  27  ? -34.901 -59.058 21.963  1.00 131.83 ? 27   GLN B NE2   1 
ATOM   4958  N  N     . VAL B 2  28  ? -31.293 -56.712 25.997  1.00 100.92 ? 28   VAL B N     1 
ATOM   4959  C  CA    . VAL B 2  28  ? -31.418 -56.105 27.322  1.00 100.87 ? 28   VAL B CA    1 
ATOM   4960  C  C     . VAL B 2  28  ? -32.765 -55.392 27.443  1.00 100.00 ? 28   VAL B C     1 
ATOM   4961  O  O     . VAL B 2  28  ? -33.259 -54.766 26.489  1.00 95.96  ? 28   VAL B O     1 
ATOM   4962  C  CB    . VAL B 2  28  ? -30.230 -55.157 27.603  1.00 98.35  ? 28   VAL B CB    1 
ATOM   4963  C  CG1   . VAL B 2  28  ? -30.291 -54.594 29.022  1.00 99.47  ? 28   VAL B CG1   1 
ATOM   4964  C  CG2   . VAL B 2  28  ? -28.920 -55.897 27.414  1.00 92.37  ? 28   VAL B CG2   1 
ATOM   4965  N  N     . PHE B 2  29  ? -33.358 -55.479 28.630  1.00 93.59  ? 29   PHE B N     1 
ATOM   4966  C  CA    . PHE B 2  29  ? -34.631 -54.849 28.919  1.00 90.32  ? 29   PHE B CA    1 
ATOM   4967  C  C     . PHE B 2  29  ? -34.523 -54.075 30.219  1.00 93.79  ? 29   PHE B C     1 
ATOM   4968  O  O     . PHE B 2  29  ? -33.656 -54.357 31.056  1.00 89.25  ? 29   PHE B O     1 
ATOM   4969  C  CB    . PHE B 2  29  ? -35.757 -55.878 29.006  1.00 98.70  ? 29   PHE B CB    1 
ATOM   4970  C  CG    . PHE B 2  29  ? -36.049 -56.554 27.701  1.00 96.70  ? 29   PHE B CG    1 
ATOM   4971  C  CD1   . PHE B 2  29  ? -35.390 -57.715 27.354  1.00 88.80  ? 29   PHE B CD1   1 
ATOM   4972  C  CD2   . PHE B 2  29  ? -36.959 -56.007 26.804  1.00 103.24 ? 29   PHE B CD2   1 
ATOM   4973  C  CE1   . PHE B 2  29  ? -35.645 -58.329 26.143  1.00 101.95 ? 29   PHE B CE1   1 
ATOM   4974  C  CE2   . PHE B 2  29  ? -37.224 -56.620 25.586  1.00 100.65 ? 29   PHE B CE2   1 
ATOM   4975  C  CZ    . PHE B 2  29  ? -36.570 -57.777 25.250  1.00 100.44 ? 29   PHE B CZ    1 
ATOM   4976  N  N     . PHE B 2  30  ? -35.400 -53.078 30.346  1.00 82.28  ? 30   PHE B N     1 
ATOM   4977  C  CA    . PHE B 2  30  ? -35.408 -52.114 31.438  1.00 77.06  ? 30   PHE B CA    1 
ATOM   4978  C  C     . PHE B 2  30  ? -36.750 -52.161 32.146  1.00 75.12  ? 30   PHE B C     1 
ATOM   4979  O  O     . PHE B 2  30  ? -37.801 -52.121 31.500  1.00 78.71  ? 30   PHE B O     1 
ATOM   4980  C  CB    . PHE B 2  30  ? -35.129 -50.710 30.907  1.00 76.56  ? 30   PHE B CB    1 
ATOM   4981  C  CG    . PHE B 2  30  ? -35.469 -49.598 31.865  1.00 81.52  ? 30   PHE B CG    1 
ATOM   4982  C  CD1   . PHE B 2  30  ? -34.545 -49.164 32.809  1.00 83.05  ? 30   PHE B CD1   1 
ATOM   4983  C  CD2   . PHE B 2  30  ? -36.677 -48.913 31.767  1.00 84.96  ? 30   PHE B CD2   1 
ATOM   4984  C  CE1   . PHE B 2  30  ? -34.836 -48.112 33.672  1.00 80.36  ? 30   PHE B CE1   1 
ATOM   4985  C  CE2   . PHE B 2  30  ? -36.968 -47.852 32.629  1.00 84.55  ? 30   PHE B CE2   1 
ATOM   4986  C  CZ    . PHE B 2  30  ? -36.044 -47.457 33.579  1.00 81.50  ? 30   PHE B CZ    1 
ATOM   4987  N  N     . PHE B 2  31  ? -36.708 -52.192 33.470  1.00 75.09  ? 31   PHE B N     1 
ATOM   4988  C  CA    . PHE B 2  31  ? -37.903 -52.309 34.283  1.00 74.23  ? 31   PHE B CA    1 
ATOM   4989  C  C     . PHE B 2  31  ? -37.734 -51.447 35.509  1.00 77.36  ? 31   PHE B C     1 
ATOM   4990  O  O     . PHE B 2  31  ? -36.630 -51.316 36.046  1.00 80.41  ? 31   PHE B O     1 
ATOM   4991  C  CB    . PHE B 2  31  ? -38.171 -53.739 34.732  1.00 71.72  ? 31   PHE B CB    1 
ATOM   4992  C  CG    . PHE B 2  31  ? -39.040 -53.832 35.959  1.00 82.87  ? 31   PHE B CG    1 
ATOM   4993  C  CD1   . PHE B 2  31  ? -40.421 -53.634 35.877  1.00 85.88  ? 31   PHE B CD1   1 
ATOM   4994  C  CD2   . PHE B 2  31  ? -38.480 -54.121 37.212  1.00 86.39  ? 31   PHE B CD2   1 
ATOM   4995  C  CE1   . PHE B 2  31  ? -41.234 -53.720 37.029  1.00 83.39  ? 31   PHE B CE1   1 
ATOM   4996  C  CE2   . PHE B 2  31  ? -39.294 -54.206 38.377  1.00 86.84  ? 31   PHE B CE2   1 
ATOM   4997  C  CZ    . PHE B 2  31  ? -40.665 -54.006 38.278  1.00 84.50  ? 31   PHE B CZ    1 
ATOM   4998  N  N     . GLY B 2  32  ? -38.847 -50.885 35.964  1.00 74.39  ? 32   GLY B N     1 
ATOM   4999  C  CA    . GLY B 2  32  ? -38.797 -50.032 37.127  1.00 76.55  ? 32   GLY B CA    1 
ATOM   5000  C  C     . GLY B 2  32  ? -38.778 -48.572 36.745  1.00 74.89  ? 32   GLY B C     1 
ATOM   5001  O  O     . GLY B 2  32  ? -37.951 -47.794 37.235  1.00 72.80  ? 32   GLY B O     1 
ATOM   5002  N  N     . GLN B 2  33  ? -39.675 -48.199 35.844  1.00 81.36  ? 33   GLN B N     1 
ATOM   5003  C  CA    . GLN B 2  33  ? -39.734 -46.814 35.430  1.00 73.36  ? 33   GLN B CA    1 
ATOM   5004  C  C     . GLN B 2  33  ? -40.197 -45.910 36.567  1.00 70.35  ? 33   GLN B C     1 
ATOM   5005  O  O     . GLN B 2  33  ? -40.951 -46.314 37.447  1.00 73.24  ? 33   GLN B O     1 
ATOM   5006  C  CB    . GLN B 2  33  ? -40.667 -46.665 34.232  1.00 76.07  ? 33   GLN B CB    1 
ATOM   5007  C  CG    . GLN B 2  33  ? -42.105 -46.999 34.511  1.00 76.23  ? 33   GLN B CG    1 
ATOM   5008  C  CD    . GLN B 2  33  ? -43.029 -46.273 33.557  1.00 77.30  ? 33   GLN B CD    1 
ATOM   5009  O  OE1   . GLN B 2  33  ? -43.121 -46.573 32.360  1.00 69.90  ? 33   GLN B OE1   1 
ATOM   5010  N  NE2   . GLN B 2  33  ? -43.707 -45.274 34.090  1.00 78.86  ? 33   GLN B NE2   1 
ATOM   5011  N  N     . LYS B 2  34  ? -39.756 -44.659 36.516  1.00 76.29  ? 34   LYS B N     1 
ATOM   5012  C  CA    . LYS B 2  34  ? -40.269 -43.647 37.421  1.00 77.38  ? 34   LYS B CA    1 
ATOM   5013  C  C     . LYS B 2  34  ? -41.696 -43.307 37.038  1.00 80.96  ? 34   LYS B C     1 
ATOM   5014  O  O     . LYS B 2  34  ? -42.025 -43.174 35.855  1.00 78.68  ? 34   LYS B O     1 
ATOM   5015  C  CB    . LYS B 2  34  ? -39.423 -42.382 37.370  1.00 84.23  ? 34   LYS B CB    1 
ATOM   5016  C  CG    . LYS B 2  34  ? -39.811 -41.357 38.430  1.00 87.16  ? 34   LYS B CG    1 
ATOM   5017  C  CD    . LYS B 2  34  ? -39.004 -40.083 38.339  1.00 90.72  ? 34   LYS B CD    1 
ATOM   5018  C  CE    . LYS B 2  34  ? -38.590 -39.715 39.753  1.00 101.20 ? 34   LYS B CE    1 
ATOM   5019  N  NZ    . LYS B 2  34  ? -39.715 -39.733 40.724  1.00 99.49  ? 34   LYS B NZ    1 
ATOM   5020  N  N     . GLY B 2  35  ? -42.537 -43.130 38.057  1.00 95.63  ? 35   GLY B N     1 
ATOM   5021  C  CA    . GLY B 2  35  ? -43.958 -42.884 37.874  1.00 89.45  ? 35   GLY B CA    1 
ATOM   5022  C  C     . GLY B 2  35  ? -44.736 -44.100 37.409  1.00 83.32  ? 35   GLY B C     1 
ATOM   5023  O  O     . GLY B 2  35  ? -44.144 -45.115 37.030  1.00 88.79  ? 35   GLY B O     1 
ATOM   5024  N  N     . TRP B 2  36  ? -46.059 -44.025 37.449  1.00 81.27  ? 36   TRP B N     1 
ATOM   5025  C  CA    . TRP B 2  36  ? -46.845 -45.132 36.952  1.00 71.67  ? 36   TRP B CA    1 
ATOM   5026  C  C     . TRP B 2  36  ? -46.799 -45.164 35.430  1.00 77.00  ? 36   TRP B C     1 
ATOM   5027  O  O     . TRP B 2  36  ? -46.680 -44.122 34.785  1.00 82.57  ? 36   TRP B O     1 
ATOM   5028  C  CB    . TRP B 2  36  ? -48.276 -45.024 37.434  1.00 76.17  ? 36   TRP B CB    1 
ATOM   5029  C  CG    . TRP B 2  36  ? -48.379 -45.238 38.908  1.00 88.45  ? 36   TRP B CG    1 
ATOM   5030  C  CD1   . TRP B 2  36  ? -48.420 -44.274 39.879  1.00 87.37  ? 36   TRP B CD1   1 
ATOM   5031  C  CD2   . TRP B 2  36  ? -48.447 -46.490 39.583  1.00 74.54  ? 36   TRP B CD2   1 
ATOM   5032  N  NE1   . TRP B 2  36  ? -48.516 -44.856 41.120  1.00 74.69  ? 36   TRP B NE1   1 
ATOM   5033  C  CE2   . TRP B 2  36  ? -48.539 -46.217 40.963  1.00 74.63  ? 36   TRP B CE2   1 
ATOM   5034  C  CE3   . TRP B 2  36  ? -48.439 -47.813 39.157  1.00 75.66  ? 36   TRP B CE3   1 
ATOM   5035  C  CZ2   . TRP B 2  36  ? -48.614 -47.217 41.910  1.00 80.98  ? 36   TRP B CZ2   1 
ATOM   5036  C  CZ3   . TRP B 2  36  ? -48.512 -48.807 40.104  1.00 83.45  ? 36   TRP B CZ3   1 
ATOM   5037  C  CH2   . TRP B 2  36  ? -48.599 -48.506 41.465  1.00 78.71  ? 36   TRP B CH2   1 
ATOM   5038  N  N     . PRO B 2  37  ? -46.891 -46.352 34.837  1.00 75.97  ? 37   PRO B N     1 
ATOM   5039  C  CA    . PRO B 2  37  ? -46.805 -46.466 33.378  1.00 81.06  ? 37   PRO B CA    1 
ATOM   5040  C  C     . PRO B 2  37  ? -47.882 -45.641 32.705  1.00 84.02  ? 37   PRO B C     1 
ATOM   5041  O  O     . PRO B 2  37  ? -49.012 -45.546 33.191  1.00 81.44  ? 37   PRO B O     1 
ATOM   5042  C  CB    . PRO B 2  37  ? -47.010 -47.957 33.129  1.00 88.30  ? 37   PRO B CB    1 
ATOM   5043  C  CG    . PRO B 2  37  ? -46.508 -48.603 34.383  1.00 89.04  ? 37   PRO B CG    1 
ATOM   5044  C  CD    . PRO B 2  37  ? -46.877 -47.667 35.498  1.00 81.03  ? 37   PRO B CD    1 
ATOM   5045  N  N     . LYS B 2  38  ? -47.508 -45.034 31.583  1.00 87.80  ? 38   LYS B N     1 
ATOM   5046  C  CA    . LYS B 2  38  ? -48.376 -44.151 30.823  1.00 94.30  ? 38   LYS B CA    1 
ATOM   5047  C  C     . LYS B 2  38  ? -48.914 -44.867 29.589  1.00 92.57  ? 38   LYS B C     1 
ATOM   5048  O  O     . LYS B 2  38  ? -48.602 -46.034 29.331  1.00 100.47 ? 38   LYS B O     1 
ATOM   5049  C  CB    . LYS B 2  38  ? -47.617 -42.883 30.438  1.00 93.30  ? 38   LYS B CB    1 
ATOM   5050  N  N     . ARG B 2  39  ? -49.790 -44.180 28.852  1.00 99.42  ? 39   ARG B N     1 
ATOM   5051  C  CA    . ARG B 2  39  ? -50.366 -44.785 27.655  1.00 100.47 ? 39   ARG B CA    1 
ATOM   5052  C  C     . ARG B 2  39  ? -49.291 -45.183 26.646  1.00 97.77  ? 39   ARG B C     1 
ATOM   5053  O  O     . ARG B 2  39  ? -49.449 -46.187 25.943  1.00 99.91  ? 39   ARG B O     1 
ATOM   5054  C  CB    . ARG B 2  39  ? -51.384 -43.837 27.014  1.00 108.81 ? 39   ARG B CB    1 
ATOM   5055  C  CG    . ARG B 2  39  ? -52.662 -43.641 27.838  1.00 111.32 ? 39   ARG B CG    1 
ATOM   5056  C  CD    . ARG B 2  39  ? -53.543 -44.906 27.868  1.00 125.47 ? 39   ARG B CD    1 
ATOM   5057  N  NE    . ARG B 2  39  ? -53.943 -45.358 26.530  1.00 135.72 ? 39   ARG B NE    1 
ATOM   5058  C  CZ    . ARG B 2  39  ? -53.970 -46.634 26.124  1.00 139.59 ? 39   ARG B CZ    1 
ATOM   5059  N  NH1   . ARG B 2  39  ? -54.340 -46.915 24.875  1.00 149.09 ? 39   ARG B NH1   1 
ATOM   5060  N  NH2   . ARG B 2  39  ? -53.626 -47.631 26.948  1.00 111.32 ? 39   ARG B NH2   1 
ATOM   5061  N  N     . SER B 2  40  ? -48.171 -44.454 26.602  1.00 102.28 ? 40   SER B N     1 
ATOM   5062  C  CA    . SER B 2  40  ? -47.102 -44.786 25.659  1.00 98.89  ? 40   SER B CA    1 
ATOM   5063  C  C     . SER B 2  40  ? -46.540 -46.192 25.874  1.00 103.55 ? 40   SER B C     1 
ATOM   5064  O  O     . SER B 2  40  ? -46.179 -46.871 24.906  1.00 111.62 ? 40   SER B O     1 
ATOM   5065  C  CB    . SER B 2  40  ? -45.977 -43.773 25.774  1.00 99.90  ? 40   SER B CB    1 
ATOM   5066  O  OG    . SER B 2  40  ? -45.437 -43.812 27.079  1.00 101.29 ? 40   SER B OG    1 
ATOM   5067  N  N     . CYS B 2  41  ? -46.467 -46.654 27.120  1.00 104.97 ? 41   CYS B N     1 
ATOM   5068  C  CA    . CYS B 2  41  ? -46.008 -48.012 27.411  1.00 90.44  ? 41   CYS B CA    1 
ATOM   5069  C  C     . CYS B 2  41  ? -46.700 -48.493 28.675  1.00 85.71  ? 41   CYS B C     1 
ATOM   5070  O  O     . CYS B 2  41  ? -46.246 -48.239 29.800  1.00 85.16  ? 41   CYS B O     1 
ATOM   5071  C  CB    . CYS B 2  41  ? -44.491 -48.092 27.553  1.00 91.60  ? 41   CYS B CB    1 
ATOM   5072  S  SG    . CYS B 2  41  ? -43.902 -49.714 28.090  1.00 90.78  ? 41   CYS B SG    1 
ATOM   5073  N  N     . PRO B 2  42  ? -47.825 -49.182 28.521  1.00 78.36  ? 42   PRO B N     1 
ATOM   5074  C  CA    . PRO B 2  42  ? -48.614 -49.612 29.686  1.00 72.57  ? 42   PRO B CA    1 
ATOM   5075  C  C     . PRO B 2  42  ? -47.939 -50.641 30.585  1.00 74.02  ? 42   PRO B C     1 
ATOM   5076  O  O     . PRO B 2  42  ? -48.378 -50.803 31.730  1.00 77.01  ? 42   PRO B O     1 
ATOM   5077  C  CB    . PRO B 2  42  ? -49.880 -50.185 29.045  1.00 78.22  ? 42   PRO B CB    1 
ATOM   5078  C  CG    . PRO B 2  42  ? -49.969 -49.459 27.715  1.00 87.58  ? 42   PRO B CG    1 
ATOM   5079  C  CD    . PRO B 2  42  ? -48.562 -49.318 27.259  1.00 82.75  ? 42   PRO B CD    1 
ATOM   5080  N  N     . THR B 2  43  ? -46.951 -51.392 30.103  1.00 78.06  ? 43   THR B N     1 
ATOM   5081  C  CA    . THR B 2  43  ? -46.330 -52.398 30.958  1.00 78.47  ? 43   THR B CA    1 
ATOM   5082  C  C     . THR B 2  43  ? -45.325 -51.803 31.932  1.00 77.34  ? 43   THR B C     1 
ATOM   5083  O  O     . THR B 2  43  ? -45.236 -52.256 33.078  1.00 86.19  ? 43   THR B O     1 
ATOM   5084  C  CB    . THR B 2  43  ? -45.624 -53.451 30.109  1.00 80.94  ? 43   THR B CB    1 
ATOM   5085  O  OG1   . THR B 2  43  ? -44.432 -52.886 29.554  1.00 88.32  ? 43   THR B OG1   1 
ATOM   5086  C  CG2   . THR B 2  43  ? -46.533 -53.936 28.987  1.00 87.45  ? 43   THR B CG2   1 
ATOM   5087  N  N     . GLY B 2  44  ? -44.609 -50.762 31.529  1.00 74.61  ? 44   GLY B N     1 
ATOM   5088  C  CA    . GLY B 2  44  ? -43.461 -50.318 32.293  1.00 81.89  ? 44   GLY B CA    1 
ATOM   5089  C  C     . GLY B 2  44  ? -42.199 -51.106 32.046  1.00 85.08  ? 44   GLY B C     1 
ATOM   5090  O  O     . GLY B 2  44  ? -41.265 -51.021 32.851  1.00 86.29  ? 44   GLY B O     1 
ATOM   5091  N  N     . VAL B 2  45  ? -42.169 -51.899 30.981  1.00 88.40  ? 45   VAL B N     1 
ATOM   5092  C  CA    . VAL B 2  45  ? -41.026 -52.710 30.579  1.00 85.22  ? 45   VAL B CA    1 
ATOM   5093  C  C     . VAL B 2  45  ? -40.592 -52.258 29.191  1.00 88.41  ? 45   VAL B C     1 
ATOM   5094  O  O     . VAL B 2  45  ? -41.435 -52.053 28.311  1.00 93.01  ? 45   VAL B O     1 
ATOM   5095  C  CB    . VAL B 2  45  ? -41.389 -54.203 30.576  1.00 87.89  ? 45   VAL B CB    1 
ATOM   5096  C  CG1   . VAL B 2  45  ? -40.225 -55.033 30.105  1.00 93.01  ? 45   VAL B CG1   1 
ATOM   5097  C  CG2   . VAL B 2  45  ? -41.858 -54.620 31.948  1.00 85.23  ? 45   VAL B CG2   1 
ATOM   5098  N  N     . PHE B 2  46  ? -39.290 -52.103 28.985  1.00 87.63  ? 46   PHE B N     1 
ATOM   5099  C  CA    . PHE B 2  46  ? -38.818 -51.512 27.744  1.00 86.93  ? 46   PHE B CA    1 
ATOM   5100  C  C     . PHE B 2  46  ? -37.676 -52.335 27.160  1.00 88.97  ? 46   PHE B C     1 
ATOM   5101  O  O     . PHE B 2  46  ? -36.876 -52.916 27.899  1.00 86.88  ? 46   PHE B O     1 
ATOM   5102  C  CB    . PHE B 2  46  ? -38.352 -50.062 27.966  1.00 93.87  ? 46   PHE B CB    1 
ATOM   5103  C  CG    . PHE B 2  46  ? -39.461 -49.087 28.351  1.00 96.48  ? 46   PHE B CG    1 
ATOM   5104  C  CD1   . PHE B 2  46  ? -39.874 -48.958 29.674  1.00 89.40  ? 46   PHE B CD1   1 
ATOM   5105  C  CD2   . PHE B 2  46  ? -40.018 -48.232 27.403  1.00 100.95 ? 46   PHE B CD2   1 
ATOM   5106  C  CE1   . PHE B 2  46  ? -40.865 -48.042 30.031  1.00 95.04  ? 46   PHE B CE1   1 
ATOM   5107  C  CE2   . PHE B 2  46  ? -41.006 -47.307 27.756  1.00 97.81  ? 46   PHE B CE2   1 
ATOM   5108  C  CZ    . PHE B 2  46  ? -41.432 -47.219 29.067  1.00 96.35  ? 46   PHE B CZ    1 
ATOM   5109  N  N     . HIS B 2  47  ? -37.657 -52.437 25.832  1.00 101.43 ? 47   HIS B N     1 
ATOM   5110  C  CA    A HIS B 2  47  ? -36.444 -52.788 25.124  0.50 104.05 ? 47   HIS B CA    1 
ATOM   5111  C  CA    B HIS B 2  47  ? -36.438 -52.768 25.095  0.50 104.64 ? 47   HIS B CA    1 
ATOM   5112  C  C     . HIS B 2  47  ? -35.409 -51.686 25.339  1.00 110.74 ? 47   HIS B C     1 
ATOM   5113  O  O     . HIS B 2  47  ? -35.667 -50.504 25.068  1.00 103.61 ? 47   HIS B O     1 
ATOM   5114  C  CB    A HIS B 2  47  ? -36.737 -52.986 23.633  0.50 103.86 ? 47   HIS B CB    1 
ATOM   5115  C  CB    B HIS B 2  47  ? -36.706 -52.848 23.587  0.50 103.98 ? 47   HIS B CB    1 
ATOM   5116  C  CG    A HIS B 2  47  ? -35.577 -53.538 22.868  0.50 109.15 ? 47   HIS B CG    1 
ATOM   5117  C  CG    B HIS B 2  47  ? -37.693 -53.897 23.196  0.50 109.15 ? 47   HIS B CG    1 
ATOM   5118  N  ND1   A HIS B 2  47  ? -34.461 -54.056 23.491  0.50 113.20 ? 47   HIS B ND1   1 
ATOM   5119  N  ND1   B HIS B 2  47  ? -37.313 -55.152 22.779  0.50 113.20 ? 47   HIS B ND1   1 
ATOM   5120  C  CD2   A HIS B 2  47  ? -35.354 -53.650 21.537  0.50 117.45 ? 47   HIS B CD2   1 
ATOM   5121  C  CD2   B HIS B 2  47  ? -39.047 -53.867 23.127  0.50 117.45 ? 47   HIS B CD2   1 
ATOM   5122  C  CE1   A HIS B 2  47  ? -33.602 -54.463 22.574  0.50 109.97 ? 47   HIS B CE1   1 
ATOM   5123  C  CE1   B HIS B 2  47  ? -38.393 -55.856 22.490  0.50 110.58 ? 47   HIS B CE1   1 
ATOM   5124  N  NE2   A HIS B 2  47  ? -34.119 -54.229 21.381  0.50 115.48 ? 47   HIS B NE2   1 
ATOM   5125  N  NE2   B HIS B 2  47  ? -39.457 -55.101 22.691  0.50 115.48 ? 47   HIS B NE2   1 
ATOM   5126  N  N     . PHE B 2  48  ? -34.241 -52.083 25.841  1.00 103.86 ? 48   PHE B N     1 
ATOM   5127  C  CA    . PHE B 2  48  ? -33.187 -51.173 26.280  1.00 99.94  ? 48   PHE B CA    1 
ATOM   5128  C  C     . PHE B 2  48  ? -31.980 -51.392 25.365  1.00 106.78 ? 48   PHE B C     1 
ATOM   5129  O  O     . PHE B 2  48  ? -31.143 -52.260 25.637  1.00 110.94 ? 48   PHE B O     1 
ATOM   5130  C  CB    . PHE B 2  48  ? -32.890 -51.491 27.762  1.00 91.93  ? 48   PHE B CB    1 
ATOM   5131  C  CG    . PHE B 2  48  ? -31.810 -50.664 28.397  1.00 91.49  ? 48   PHE B CG    1 
ATOM   5132  C  CD1   . PHE B 2  48  ? -30.483 -51.023 28.262  1.00 93.32  ? 48   PHE B CD1   1 
ATOM   5133  C  CD2   . PHE B 2  48  ? -32.122 -49.597 29.225  1.00 90.60  ? 48   PHE B CD2   1 
ATOM   5134  C  CE1   . PHE B 2  48  ? -29.477 -50.289 28.871  1.00 93.80  ? 48   PHE B CE1   1 
ATOM   5135  C  CE2   . PHE B 2  48  ? -31.111 -48.855 29.846  1.00 96.13  ? 48   PHE B CE2   1 
ATOM   5136  C  CZ    . PHE B 2  48  ? -29.790 -49.207 29.667  1.00 95.77  ? 48   PHE B CZ    1 
ATOM   5137  N  N     . ASP B 2  49  ? -31.893 -50.637 24.262  1.00 109.48 ? 49   ASP B N     1 
ATOM   5138  C  CA    . ASP B 2  49  ? -30.882 -50.915 23.235  1.00 116.05 ? 49   ASP B CA    1 
ATOM   5139  C  C     . ASP B 2  49  ? -29.952 -49.722 23.034  1.00 117.64 ? 49   ASP B C     1 
ATOM   5140  O  O     . ASP B 2  49  ? -30.410 -48.599 22.798  1.00 116.11 ? 49   ASP B O     1 
ATOM   5141  C  CB    . ASP B 2  49  ? -31.532 -51.351 21.915  1.00 116.72 ? 49   ASP B CB    1 
ATOM   5142  C  CG    . ASP B 2  49  ? -32.761 -50.526 21.557  1.00 130.20 ? 49   ASP B CG    1 
ATOM   5143  O  OD1   . ASP B 2  49  ? -32.639 -49.630 20.685  1.00 138.95 ? 49   ASP B OD1   1 
ATOM   5144  O  OD2   . ASP B 2  49  ? -33.845 -50.774 22.143  1.00 124.44 ? 49   ASP B OD2   1 
ATOM   5145  N  N     . ILE B 2  50  ? -28.650 -49.964 23.162  1.00 121.06 ? 50   ILE B N     1 
ATOM   5146  C  CA    . ILE B 2  50  ? -27.615 -48.951 22.970  1.00 109.87 ? 50   ILE B CA    1 
ATOM   5147  C  C     . ILE B 2  50  ? -26.929 -49.219 21.630  1.00 118.44 ? 50   ILE B C     1 
ATOM   5148  O  O     . ILE B 2  50  ? -26.183 -50.196 21.487  1.00 118.46 ? 50   ILE B O     1 
ATOM   5149  C  CB    . ILE B 2  50  ? -26.602 -48.973 24.122  1.00 101.12 ? 50   ILE B CB    1 
ATOM   5150  C  CG1   . ILE B 2  50  ? -27.314 -48.865 25.463  1.00 95.07  ? 50   ILE B CG1   1 
ATOM   5151  C  CG2   . ILE B 2  50  ? -25.571 -47.880 23.968  1.00 108.55 ? 50   ILE B CG2   1 
ATOM   5152  C  CD1   . ILE B 2  50  ? -26.356 -48.838 26.616  1.00 90.65  ? 50   ILE B CD1   1 
ATOM   5153  N  N     . LYS B 2  51  ? -27.176 -48.357 20.640  1.00 130.77 ? 51   LYS B N     1 
ATOM   5154  C  CA    . LYS B 2  51  ? -26.511 -48.426 19.337  1.00 127.32 ? 51   LYS B CA    1 
ATOM   5155  C  C     . LYS B 2  51  ? -25.633 -47.194 19.172  1.00 125.53 ? 51   LYS B C     1 
ATOM   5156  O  O     . LYS B 2  51  ? -26.128 -46.062 19.245  1.00 125.88 ? 51   LYS B O     1 
ATOM   5157  C  CB    . LYS B 2  51  ? -27.510 -48.507 18.178  1.00 125.02 ? 51   LYS B CB    1 
ATOM   5158  C  CG    . LYS B 2  51  ? -28.494 -49.670 18.248  1.00 137.74 ? 51   LYS B CG    1 
ATOM   5159  C  CD    . LYS B 2  51  ? -27.786 -51.019 18.233  1.00 135.04 ? 51   LYS B CD    1 
ATOM   5160  C  CE    . LYS B 2  51  ? -28.745 -52.162 18.555  1.00 134.78 ? 51   LYS B CE    1 
ATOM   5161  N  NZ    . LYS B 2  51  ? -28.123 -53.490 18.299  1.00 149.99 ? 51   LYS B NZ    1 
ATOM   5162  N  N     . GLN B 2  52  ? -24.335 -47.415 18.966  1.00 127.90 ? 52   GLN B N     1 
ATOM   5163  C  CA    . GLN B 2  52  ? -23.385 -46.327 18.732  1.00 134.58 ? 52   GLN B CA    1 
ATOM   5164  C  C     . GLN B 2  52  ? -23.489 -45.261 19.826  1.00 118.81 ? 52   GLN B C     1 
ATOM   5165  O  O     . GLN B 2  52  ? -23.638 -44.065 19.564  1.00 109.86 ? 52   GLN B O     1 
ATOM   5166  C  CB    . GLN B 2  52  ? -23.582 -45.725 17.337  1.00 140.79 ? 52   GLN B CB    1 
ATOM   5167  C  CG    . GLN B 2  52  ? -23.317 -46.708 16.180  1.00 141.85 ? 52   GLN B CG    1 
ATOM   5168  C  CD    . GLN B 2  52  ? -22.018 -46.420 15.427  1.00 139.30 ? 52   GLN B CD    1 
ATOM   5169  O  OE1   . GLN B 2  52  ? -21.235 -45.550 15.814  1.00 137.90 ? 52   GLN B OE1   1 
ATOM   5170  N  NE2   . GLN B 2  52  ? -21.791 -47.156 14.343  1.00 128.61 ? 52   GLN B NE2   1 
ATOM   5171  N  N     . ASN B 2  53  ? -23.434 -45.731 21.072  1.00 123.30 ? 53   ASN B N     1 
ATOM   5172  C  CA    . ASN B 2  53  ? -23.484 -44.928 22.295  1.00 124.15 ? 53   ASN B CA    1 
ATOM   5173  C  C     . ASN B 2  53  ? -24.789 -44.140 22.463  1.00 118.24 ? 53   ASN B C     1 
ATOM   5174  O  O     . ASN B 2  53  ? -24.860 -43.225 23.292  1.00 111.01 ? 53   ASN B O     1 
ATOM   5175  C  CB    . ASN B 2  53  ? -22.278 -43.981 22.374  1.00 120.66 ? 53   ASN B CB    1 
ATOM   5176  C  CG    . ASN B 2  53  ? -20.945 -44.722 22.340  1.00 127.43 ? 53   ASN B CG    1 
ATOM   5177  O  OD1   . ASN B 2  53  ? -20.869 -45.918 22.638  1.00 129.92 ? 53   ASN B OD1   1 
ATOM   5178  N  ND2   . ASN B 2  53  ? -19.885 -44.007 21.978  1.00 136.07 ? 53   ASN B ND2   1 
ATOM   5179  N  N     . HIS B 2  54  ? -25.852 -44.493 21.743  1.00 118.88 ? 54   HIS B N     1 
ATOM   5180  C  CA    . HIS B 2  54  ? -27.150 -43.855 21.928  1.00 110.88 ? 54   HIS B CA    1 
ATOM   5181  C  C     . HIS B 2  54  ? -28.147 -44.882 22.441  1.00 116.57 ? 54   HIS B C     1 
ATOM   5182  O  O     . HIS B 2  54  ? -28.333 -45.935 21.819  1.00 118.35 ? 54   HIS B O     1 
ATOM   5183  C  CB    . HIS B 2  54  ? -27.653 -43.235 20.632  1.00 119.72 ? 54   HIS B CB    1 
ATOM   5184  C  CG    . HIS B 2  54  ? -28.962 -42.528 20.776  1.00 121.04 ? 54   HIS B CG    1 
ATOM   5185  N  ND1   . HIS B 2  54  ? -29.105 -41.364 21.500  1.00 114.12 ? 54   HIS B ND1   1 
ATOM   5186  C  CD2   . HIS B 2  54  ? -30.191 -42.823 20.290  1.00 129.73 ? 54   HIS B CD2   1 
ATOM   5187  C  CE1   . HIS B 2  54  ? -30.366 -40.972 21.451  1.00 117.83 ? 54   HIS B CE1   1 
ATOM   5188  N  NE2   . HIS B 2  54  ? -31.045 -41.839 20.722  1.00 125.29 ? 54   HIS B NE2   1 
ATOM   5189  N  N     . LEU B 2  55  ? -28.803 -44.555 23.557  1.00 123.37 ? 55   LEU B N     1 
ATOM   5190  C  CA    . LEU B 2  55  ? -29.713 -45.460 24.253  1.00 119.27 ? 55   LEU B CA    1 
ATOM   5191  C  C     . LEU B 2  55  ? -31.146 -45.146 23.857  1.00 107.72 ? 55   LEU B C     1 
ATOM   5192  O  O     . LEU B 2  55  ? -31.616 -44.024 24.058  1.00 106.68 ? 55   LEU B O     1 
ATOM   5193  C  CB    . LEU B 2  55  ? -29.556 -45.333 25.768  1.00 105.87 ? 55   LEU B CB    1 
ATOM   5194  C  CG    . LEU B 2  55  ? -30.688 -45.987 26.553  1.00 105.17 ? 55   LEU B CG    1 
ATOM   5195  C  CD1   . LEU B 2  55  ? -30.728 -47.483 26.256  1.00 104.31 ? 55   LEU B CD1   1 
ATOM   5196  C  CD2   . LEU B 2  55  ? -30.538 -45.730 28.039  1.00 105.24 ? 55   LEU B CD2   1 
ATOM   5197  N  N     . LYS B 2  56  ? -31.851 -46.144 23.339  1.00 109.15 ? 56   LYS B N     1 
ATOM   5198  C  CA    . LYS B 2  56  ? -33.268 -46.010 23.047  1.00 110.70 ? 56   LYS B CA    1 
ATOM   5199  C  C     . LYS B 2  56  ? -34.064 -46.968 23.921  1.00 110.84 ? 56   LYS B C     1 
ATOM   5200  O  O     . LYS B 2  56  ? -33.714 -48.156 24.052  1.00 112.47 ? 56   LYS B O     1 
ATOM   5201  C  CB    . LYS B 2  56  ? -33.562 -46.260 21.564  1.00 120.08 ? 56   LYS B CB    1 
ATOM   5202  C  CG    . LYS B 2  56  ? -33.470 -45.003 20.721  1.00 131.52 ? 56   LYS B CG    1 
ATOM   5203  C  CD    . LYS B 2  56  ? -33.708 -45.280 19.248  1.00 147.56 ? 56   LYS B CD    1 
ATOM   5204  C  CE    . LYS B 2  56  ? -32.414 -45.206 18.464  1.00 156.40 ? 56   LYS B CE    1 
ATOM   5205  N  NZ    . LYS B 2  56  ? -32.656 -45.214 16.998  1.00 163.50 ? 56   LYS B NZ    1 
ATOM   5206  N  N     . LEU B 2  57  ? -35.143 -46.438 24.503  1.00 101.63 ? 57   LEU B N     1 
ATOM   5207  C  CA    . LEU B 2  57  ? -36.085 -47.195 25.316  1.00 100.34 ? 57   LEU B CA    1 
ATOM   5208  C  C     . LEU B 2  57  ? -37.369 -47.354 24.519  1.00 96.08  ? 57   LEU B C     1 
ATOM   5209  O  O     . LEU B 2  57  ? -38.086 -46.377 24.281  1.00 97.66  ? 57   LEU B O     1 
ATOM   5210  C  CB    . LEU B 2  57  ? -36.347 -46.495 26.646  1.00 89.50  ? 57   LEU B CB    1 
ATOM   5211  C  CG    . LEU B 2  57  ? -35.143 -46.284 27.552  1.00 82.58  ? 57   LEU B CG    1 
ATOM   5212  C  CD1   . LEU B 2  57  ? -35.581 -45.534 28.779  1.00 79.16  ? 57   LEU B CD1   1 
ATOM   5213  C  CD2   . LEU B 2  57  ? -34.544 -47.613 27.936  1.00 91.37  ? 57   LEU B CD2   1 
ATOM   5214  N  N     . LYS B 2  58  ? -37.658 -48.579 24.106  1.00 96.91  ? 58   LYS B N     1 
ATOM   5215  C  CA    . LYS B 2  58  ? -38.795 -48.828 23.247  1.00 95.59  ? 58   LYS B CA    1 
ATOM   5216  C  C     . LYS B 2  58  ? -39.791 -49.739 23.949  1.00 92.64  ? 58   LYS B C     1 
ATOM   5217  O  O     . LYS B 2  58  ? -39.402 -50.786 24.472  1.00 96.72  ? 58   LYS B O     1 
ATOM   5218  C  CB    . LYS B 2  58  ? -38.342 -49.453 21.917  1.00 105.05 ? 58   LYS B CB    1 
ATOM   5219  C  CG    . LYS B 2  58  ? -37.525 -48.495 21.067  1.00 113.02 ? 58   LYS B CG    1 
ATOM   5220  C  CD    . LYS B 2  58  ? -37.159 -49.080 19.715  1.00 126.75 ? 58   LYS B CD    1 
ATOM   5221  C  CE    . LYS B 2  58  ? -36.429 -48.048 18.859  1.00 139.96 ? 58   LYS B CE    1 
ATOM   5222  N  NZ    . LYS B 2  58  ? -36.068 -48.577 17.505  1.00 134.71 ? 58   LYS B NZ    1 
ATOM   5223  N  N     . PRO B 2  59  ? -41.068 -49.389 23.979  1.00 88.93  ? 59   PRO B N     1 
ATOM   5224  C  CA    . PRO B 2  59  ? -42.021 -50.162 24.777  1.00 89.41  ? 59   PRO B CA    1 
ATOM   5225  C  C     . PRO B 2  59  ? -42.095 -51.620 24.345  1.00 91.62  ? 59   PRO B C     1 
ATOM   5226  O  O     . PRO B 2  59  ? -42.071 -51.945 23.156  1.00 84.26  ? 59   PRO B O     1 
ATOM   5227  C  CB    . PRO B 2  59  ? -43.352 -49.433 24.550  1.00 87.83  ? 59   PRO B CB    1 
ATOM   5228  C  CG    . PRO B 2  59  ? -43.151 -48.622 23.337  1.00 96.84  ? 59   PRO B CG    1 
ATOM   5229  C  CD    . PRO B 2  59  ? -41.703 -48.239 23.324  1.00 94.03  ? 59   PRO B CD    1 
ATOM   5230  N  N     . ALA B 2  60  ? -42.185 -52.491 25.348  1.00 87.56  ? 60   ALA B N     1 
ATOM   5231  C  CA    . ALA B 2  60  ? -42.401 -53.918 25.211  1.00 81.97  ? 60   ALA B CA    1 
ATOM   5232  C  C     . ALA B 2  60  ? -43.802 -54.257 25.711  1.00 82.75  ? 60   ALA B C     1 
ATOM   5233  O  O     . ALA B 2  60  ? -44.332 -53.580 26.597  1.00 93.03  ? 60   ALA B O     1 
ATOM   5234  C  CB    . ALA B 2  60  ? -41.355 -54.685 26.015  1.00 87.33  ? 60   ALA B CB    1 
ATOM   5235  N  N     . ILE B 2  61  ? -44.409 -55.295 25.120  1.00 85.45  ? 61   ILE B N     1 
ATOM   5236  C  CA    . ILE B 2  61  ? -45.797 -55.672 25.394  1.00 89.16  ? 61   ILE B CA    1 
ATOM   5237  C  C     . ILE B 2  61  ? -45.841 -56.978 26.180  1.00 87.18  ? 61   ILE B C     1 
ATOM   5238  O  O     . ILE B 2  61  ? -44.894 -57.767 26.167  1.00 93.01  ? 61   ILE B O     1 
ATOM   5239  C  CB    . ILE B 2  61  ? -46.621 -55.775 24.090  1.00 85.97  ? 61   ILE B CB    1 
ATOM   5240  C  CG1   . ILE B 2  61  ? -46.582 -54.425 23.374  1.00 107.30 ? 61   ILE B CG1   1 
ATOM   5241  C  CG2   . ILE B 2  61  ? -48.072 -56.196 24.347  1.00 85.98  ? 61   ILE B CG2   1 
ATOM   5242  C  CD1   . ILE B 2  61  ? -47.060 -53.233 24.244  1.00 109.45 ? 61   ILE B CD1   1 
ATOM   5243  N  N     . PHE B 2  62  ? -46.963 -57.203 26.876  1.00 86.90  ? 62   PHE B N     1 
ATOM   5244  C  CA    . PHE B 2  62  ? -47.206 -58.404 27.667  1.00 86.98  ? 62   PHE B CA    1 
ATOM   5245  C  C     . PHE B 2  62  ? -48.194 -59.356 26.980  1.00 84.27  ? 62   PHE B C     1 
ATOM   5246  O  O     . PHE B 2  62  ? -49.040 -58.940 26.183  1.00 92.09  ? 62   PHE B O     1 
ATOM   5247  C  CB    . PHE B 2  62  ? -47.757 -58.021 29.041  1.00 90.59  ? 62   PHE B CB    1 
ATOM   5248  C  CG    . PHE B 2  62  ? -46.711 -57.565 30.026  1.00 88.96  ? 62   PHE B CG    1 
ATOM   5249  C  CD1   . PHE B 2  62  ? -45.367 -57.710 29.754  1.00 89.98  ? 62   PHE B CD1   1 
ATOM   5250  C  CD2   . PHE B 2  62  ? -47.082 -57.054 31.255  1.00 83.25  ? 62   PHE B CD2   1 
ATOM   5251  C  CE1   . PHE B 2  62  ? -44.417 -57.310 30.673  1.00 89.57  ? 62   PHE B CE1   1 
ATOM   5252  C  CE2   . PHE B 2  62  ? -46.132 -56.666 32.177  1.00 82.85  ? 62   PHE B CE2   1 
ATOM   5253  C  CZ    . PHE B 2  62  ? -44.801 -56.795 31.883  1.00 80.90  ? 62   PHE B CZ    1 
ATOM   5254  N  N     . SER B 2  63  ? -48.122 -60.640 27.351  1.00 80.18  ? 63   SER B N     1 
ATOM   5255  C  CA    . SER B 2  63  ? -49.039 -61.627 26.782  1.00 88.47  ? 63   SER B CA    1 
ATOM   5256  C  C     . SER B 2  63  ? -50.433 -61.443 27.381  1.00 88.32  ? 63   SER B C     1 
ATOM   5257  O  O     . SER B 2  63  ? -50.657 -60.614 28.266  1.00 90.86  ? 63   SER B O     1 
ATOM   5258  C  CB    . SER B 2  63  ? -48.548 -63.074 26.993  1.00 88.08  ? 63   SER B CB    1 
ATOM   5259  O  OG    . SER B 2  63  ? -48.440 -63.483 28.352  1.00 81.16  ? 63   SER B OG    1 
ATOM   5260  N  N     . LYS B 2  64  ? -51.402 -62.179 26.834  1.00 88.43  ? 64   LYS B N     1 
ATOM   5261  C  CA    . LYS B 2  64  ? -52.765 -62.013 27.325  1.00 87.59  ? 64   LYS B CA    1 
ATOM   5262  C  C     . LYS B 2  64  ? -52.925 -62.538 28.745  1.00 92.34  ? 64   LYS B C     1 
ATOM   5263  O  O     . LYS B 2  64  ? -53.765 -62.040 29.502  1.00 92.77  ? 64   LYS B O     1 
ATOM   5264  C  CB    . LYS B 2  64  ? -53.771 -62.662 26.381  1.00 90.42  ? 64   LYS B CB    1 
ATOM   5265  C  CG    . LYS B 2  64  ? -53.786 -61.986 25.023  1.00 101.55 ? 64   LYS B CG    1 
ATOM   5266  C  CD    . LYS B 2  64  ? -54.878 -62.519 24.113  1.00 114.56 ? 64   LYS B CD    1 
ATOM   5267  C  CE    . LYS B 2  64  ? -56.247 -62.143 24.686  1.00 110.99 ? 64   LYS B CE    1 
ATOM   5268  N  NZ    . LYS B 2  64  ? -57.376 -62.467 23.766  1.00 124.64 ? 64   LYS B NZ    1 
ATOM   5269  N  N     . ASP B 2  65  ? -52.109 -63.508 29.136  1.00 88.77  ? 65   ASP B N     1 
ATOM   5270  C  CA    . ASP B 2  65  ? -52.193 -64.121 30.449  1.00 90.66  ? 65   ASP B CA    1 
ATOM   5271  C  C     . ASP B 2  65  ? -51.220 -63.512 31.454  1.00 95.70  ? 65   ASP B C     1 
ATOM   5272  O  O     . ASP B 2  65  ? -50.826 -64.190 32.407  1.00 100.30 ? 65   ASP B O     1 
ATOM   5273  C  CB    . ASP B 2  65  ? -51.931 -65.614 30.316  1.00 95.13  ? 65   ASP B CB    1 
ATOM   5274  C  CG    . ASP B 2  65  ? -50.539 -65.905 29.796  1.00 108.57 ? 65   ASP B CG    1 
ATOM   5275  O  OD1   . ASP B 2  65  ? -49.849 -66.740 30.414  1.00 118.65 ? 65   ASP B OD1   1 
ATOM   5276  O  OD2   . ASP B 2  65  ? -50.127 -65.285 28.786  1.00 108.76 ? 65   ASP B OD2   1 
ATOM   5277  N  N     . SER B 2  66  ? -50.785 -62.276 31.245  1.00 91.70  ? 66   SER B N     1 
ATOM   5278  C  CA    . SER B 2  66  ? -49.791 -61.692 32.132  1.00 83.64  ? 66   SER B CA    1 
ATOM   5279  C  C     . SER B 2  66  ? -50.421 -60.844 33.225  1.00 86.77  ? 66   SER B C     1 
ATOM   5280  O  O     . SER B 2  66  ? -51.556 -60.361 33.108  1.00 78.56  ? 66   SER B O     1 
ATOM   5281  C  CB    . SER B 2  66  ? -48.772 -60.854 31.367  1.00 89.30  ? 66   SER B CB    1 
ATOM   5282  O  OG    . SER B 2  66  ? -47.848 -61.705 30.723  1.00 97.18  ? 66   SER B OG    1 
ATOM   5283  N  N     . CYS B 2  67  ? -49.682 -60.733 34.326  1.00 86.49  ? 67   CYS B N     1 
ATOM   5284  C  CA    . CYS B 2  67  ? -49.868 -59.655 35.278  1.00 79.06  ? 67   CYS B CA    1 
ATOM   5285  C  C     . CYS B 2  67  ? -49.242 -58.383 34.732  1.00 89.54  ? 67   CYS B C     1 
ATOM   5286  O  O     . CYS B 2  67  ? -48.310 -58.410 33.929  1.00 103.74 ? 67   CYS B O     1 
ATOM   5287  C  CB    . CYS B 2  67  ? -49.247 -59.999 36.631  1.00 73.40  ? 67   CYS B CB    1 
ATOM   5288  S  SG    . CYS B 2  67  ? -50.035 -61.374 37.459  1.00 118.90 ? 67   CYS B SG    1 
ATOM   5289  N  N     . TYR B 2  68  ? -49.766 -57.261 35.175  1.00 91.91  ? 68   TYR B N     1 
ATOM   5290  C  CA    . TYR B 2  68  ? -49.179 -55.969 34.879  1.00 79.33  ? 68   TYR B CA    1 
ATOM   5291  C  C     . TYR B 2  68  ? -48.578 -55.467 36.181  1.00 84.25  ? 68   TYR B C     1 
ATOM   5292  O  O     . TYR B 2  68  ? -49.201 -54.699 36.919  1.00 83.55  ? 68   TYR B O     1 
ATOM   5293  C  CB    . TYR B 2  68  ? -50.214 -55.065 34.326  1.00 85.60  ? 68   TYR B CB    1 
ATOM   5294  C  CG    . TYR B 2  68  ? -50.506 -55.380 32.898  1.00 78.94  ? 68   TYR B CG    1 
ATOM   5295  C  CD1   . TYR B 2  68  ? -51.144 -56.547 32.533  1.00 79.99  ? 68   TYR B CD1   1 
ATOM   5296  C  CD2   . TYR B 2  68  ? -50.108 -54.517 31.911  1.00 83.22  ? 68   TYR B CD2   1 
ATOM   5297  C  CE1   . TYR B 2  68  ? -51.396 -56.820 31.220  1.00 82.81  ? 68   TYR B CE1   1 
ATOM   5298  C  CE2   . TYR B 2  68  ? -50.354 -54.775 30.609  1.00 81.11  ? 68   TYR B CE2   1 
ATOM   5299  C  CZ    . TYR B 2  68  ? -50.996 -55.922 30.258  1.00 85.14  ? 68   TYR B CZ    1 
ATOM   5300  O  OH    . TYR B 2  68  ? -51.227 -56.161 28.922  1.00 87.39  ? 68   TYR B OH    1 
ATOM   5301  N  N     . LEU B 2  69  ? -47.367 -55.929 36.465  1.00 76.68  ? 69   LEU B N     1 
ATOM   5302  C  CA    . LEU B 2  69  ? -46.756 -55.613 37.741  1.00 81.48  ? 69   LEU B CA    1 
ATOM   5303  C  C     . LEU B 2  69  ? -46.491 -54.112 37.841  1.00 80.98  ? 69   LEU B C     1 
ATOM   5304  O  O     . LEU B 2  69  ? -46.289 -53.440 36.825  1.00 85.06  ? 69   LEU B O     1 
ATOM   5305  C  CB    . LEU B 2  69  ? -45.466 -56.404 37.933  1.00 69.86  ? 69   LEU B CB    1 
ATOM   5306  C  CG    . LEU B 2  69  ? -44.180 -56.002 37.224  1.00 71.74  ? 69   LEU B CG    1 
ATOM   5307  C  CD1   . LEU B 2  69  ? -43.039 -56.861 37.720  1.00 83.87  ? 69   LEU B CD1   1 
ATOM   5308  C  CD2   . LEU B 2  69  ? -44.362 -56.213 35.735  1.00 75.08  ? 69   LEU B CD2   1 
ATOM   5309  N  N     . PRO B 2  70  ? -46.560 -53.555 39.046  1.00 70.37  ? 70   PRO B N     1 
ATOM   5310  C  CA    . PRO B 2  70  ? -46.282 -52.152 39.220  1.00 68.43  ? 70   PRO B CA    1 
ATOM   5311  C  C     . PRO B 2  70  ? -44.786 -51.911 39.184  1.00 75.65  ? 70   PRO B C     1 
ATOM   5312  O  O     . PRO B 2  70  ? -44.001 -52.760 39.639  1.00 85.48  ? 70   PRO B O     1 
ATOM   5313  C  CB    . PRO B 2  70  ? -46.859 -51.862 40.605  1.00 70.64  ? 70   PRO B CB    1 
ATOM   5314  C  CG    . PRO B 2  70  ? -46.517 -53.102 41.343  1.00 70.24  ? 70   PRO B CG    1 
ATOM   5315  C  CD    . PRO B 2  70  ? -46.749 -54.222 40.347  1.00 78.32  ? 70   PRO B CD    1 
ATOM   5316  N  N     . PRO B 2  71  ? -44.361 -50.734 38.749  1.00 70.36  ? 71   PRO B N     1 
ATOM   5317  C  CA    . PRO B 2  71  ? -42.930 -50.428 38.706  1.00 66.34  ? 71   PRO B CA    1 
ATOM   5318  C  C     . PRO B 2  71  ? -42.296 -50.517 40.077  1.00 63.35  ? 71   PRO B C     1 
ATOM   5319  O  O     . PRO B 2  71  ? -42.766 -49.897 41.026  1.00 73.60  ? 71   PRO B O     1 
ATOM   5320  C  CB    . PRO B 2  71  ? -42.904 -48.987 38.194  1.00 81.45  ? 71   PRO B CB    1 
ATOM   5321  C  CG    . PRO B 2  71  ? -44.205 -48.796 37.528  1.00 75.46  ? 71   PRO B CG    1 
ATOM   5322  C  CD    . PRO B 2  71  ? -45.191 -49.641 38.238  1.00 67.14  ? 71   PRO B CD    1 
ATOM   5323  N  N     . LEU B 2  72  ? -41.145 -51.163 40.152  1.00 62.46  ? 72   LEU B N     1 
ATOM   5324  C  CA    . LEU B 2  72  ? -40.577 -51.461 41.455  1.00 73.37  ? 72   LEU B CA    1 
ATOM   5325  C  C     . LEU B 2  72  ? -39.162 -50.934 41.558  1.00 80.77  ? 72   LEU B C     1 
ATOM   5326  O  O     . LEU B 2  72  ? -38.340 -51.154 40.657  1.00 78.56  ? 72   LEU B O     1 
ATOM   5327  C  CB    . LEU B 2  72  ? -40.603 -52.958 41.709  1.00 72.17  ? 72   LEU B CB    1 
ATOM   5328  C  CG    . LEU B 2  72  ? -42.001 -53.486 41.955  1.00 71.04  ? 72   LEU B CG    1 
ATOM   5329  C  CD1   . LEU B 2  72  ? -41.960 -54.976 41.770  1.00 78.07  ? 72   LEU B CD1   1 
ATOM   5330  C  CD2   . LEU B 2  72  ? -42.426 -53.132 43.352  1.00 68.60  ? 72   LEU B CD2   1 
ATOM   5331  N  N     . ARG B 2  73  ? -38.882 -50.261 42.669  1.00 74.44  ? 73   ARG B N     1 
ATOM   5332  C  CA    . ARG B 2  73  ? -37.562 -49.717 42.930  1.00 79.87  ? 73   ARG B CA    1 
ATOM   5333  C  C     . ARG B 2  73  ? -36.836 -50.578 43.950  1.00 77.11  ? 73   ARG B C     1 
ATOM   5334  O  O     . ARG B 2  73  ? -37.396 -50.930 44.992  1.00 76.36  ? 73   ARG B O     1 
ATOM   5335  C  CB    . ARG B 2  73  ? -37.647 -48.276 43.431  1.00 80.02  ? 73   ARG B CB    1 
ATOM   5336  C  CG    . ARG B 2  73  ? -38.048 -47.271 42.377  1.00 77.29  ? 73   ARG B CG    1 
ATOM   5337  C  CD    . ARG B 2  73  ? -38.296 -45.952 43.032  1.00 74.77  ? 73   ARG B CD    1 
ATOM   5338  N  NE    . ARG B 2  73  ? -39.475 -46.012 43.870  1.00 72.55  ? 73   ARG B NE    1 
ATOM   5339  C  CZ    . ARG B 2  73  ? -39.693 -45.179 44.873  1.00 79.19  ? 73   ARG B CZ    1 
ATOM   5340  N  NH1   . ARG B 2  73  ? -38.791 -44.255 45.162  1.00 80.59  ? 73   ARG B NH1   1 
ATOM   5341  N  NH2   . ARG B 2  73  ? -40.800 -45.279 45.595  1.00 84.72  ? 73   ARG B NH2   1 
ATOM   5342  N  N     . TYR B 2  74  ? -35.582 -50.890 43.650  1.00 73.99  ? 74   TYR B N     1 
ATOM   5343  C  CA    . TYR B 2  74  ? -34.739 -51.705 44.515  1.00 77.27  ? 74   TYR B CA    1 
ATOM   5344  C  C     . TYR B 2  74  ? -35.336 -53.062 44.876  1.00 77.35  ? 74   TYR B C     1 
ATOM   5345  O  O     . TYR B 2  74  ? -35.182 -53.519 46.023  1.00 72.85  ? 74   TYR B O     1 
ATOM   5346  C  CB    . TYR B 2  74  ? -34.444 -50.923 45.787  1.00 80.78  ? 74   TYR B CB    1 
ATOM   5347  C  CG    . TYR B 2  74  ? -33.827 -49.580 45.524  1.00 77.18  ? 74   TYR B CG    1 
ATOM   5348  C  CD1   . TYR B 2  74  ? -32.499 -49.486 45.154  1.00 81.27  ? 74   TYR B CD1   1 
ATOM   5349  C  CD2   . TYR B 2  74  ? -34.552 -48.411 45.673  1.00 77.60  ? 74   TYR B CD2   1 
ATOM   5350  C  CE1   . TYR B 2  74  ? -31.909 -48.274 44.917  1.00 92.73  ? 74   TYR B CE1   1 
ATOM   5351  C  CE2   . TYR B 2  74  ? -33.966 -47.188 45.442  1.00 88.41  ? 74   TYR B CE2   1 
ATOM   5352  C  CZ    . TYR B 2  74  ? -32.639 -47.123 45.062  1.00 88.77  ? 74   TYR B CZ    1 
ATOM   5353  O  OH    . TYR B 2  74  ? -32.034 -45.903 44.829  1.00 86.11  ? 74   TYR B OH    1 
ATOM   5354  N  N     . PRO B 2  75  ? -35.955 -53.755 43.918  1.00 82.53  ? 75   PRO B N     1 
ATOM   5355  C  CA    . PRO B 2  75  ? -36.485 -55.094 44.180  1.00 77.71  ? 75   PRO B CA    1 
ATOM   5356  C  C     . PRO B 2  75  ? -35.351 -56.103 44.204  1.00 75.60  ? 75   PRO B C     1 
ATOM   5357  O  O     . PRO B 2  75  ? -34.217 -55.798 43.858  1.00 71.93  ? 75   PRO B O     1 
ATOM   5358  C  CB    . PRO B 2  75  ? -37.418 -55.323 42.988  1.00 67.10  ? 75   PRO B CB    1 
ATOM   5359  C  CG    . PRO B 2  75  ? -36.739 -54.600 41.897  1.00 75.06  ? 75   PRO B CG    1 
ATOM   5360  C  CD    . PRO B 2  75  ? -36.114 -53.393 42.495  1.00 75.49  ? 75   PRO B CD    1 
ATOM   5361  N  N     . ALA B 2  76  ? -35.651 -57.292 44.708  1.00 79.71  ? 76   ALA B N     1 
ATOM   5362  C  CA    . ALA B 2  76  ? -34.700 -58.396 44.668  1.00 87.65  ? 76   ALA B CA    1 
ATOM   5363  C  C     . ALA B 2  76  ? -34.894 -59.124 43.346  1.00 84.39  ? 76   ALA B C     1 
ATOM   5364  O  O     . ALA B 2  76  ? -36.009 -59.531 43.022  1.00 89.21  ? 76   ALA B O     1 
ATOM   5365  C  CB    . ALA B 2  76  ? -34.888 -59.343 45.854  1.00 73.26  ? 76   ALA B CB    1 
ATOM   5366  N  N     . THR B 2  77  ? -33.847 -59.240 42.552  1.00 76.21  ? 77   THR B N     1 
ATOM   5367  C  CA    . THR B 2  77  ? -33.998 -59.941 41.293  1.00 78.80  ? 77   THR B CA    1 
ATOM   5368  C  C     . THR B 2  77  ? -32.931 -61.014 41.203  1.00 91.79  ? 77   THR B C     1 
ATOM   5369  O  O     . THR B 2  77  ? -31.893 -60.934 41.867  1.00 88.35  ? 77   THR B O     1 
ATOM   5370  C  CB    . THR B 2  77  ? -33.902 -59.015 40.061  1.00 85.08  ? 77   THR B CB    1 
ATOM   5371  O  OG1   . THR B 2  77  ? -32.550 -58.612 39.849  1.00 88.61  ? 77   THR B OG1   1 
ATOM   5372  C  CG2   . THR B 2  77  ? -34.768 -57.788 40.237  1.00 85.95  ? 77   THR B CG2   1 
ATOM   5373  N  N     . CYS B 2  78  ? -33.247 -62.049 40.421  1.00 105.05 ? 78   CYS B N     1 
ATOM   5374  C  CA    . CYS B 2  78  ? -32.308 -63.120 40.087  1.00 103.10 ? 78   CYS B CA    1 
ATOM   5375  C  C     . CYS B 2  78  ? -32.769 -63.861 38.832  1.00 96.87  ? 78   CYS B C     1 
ATOM   5376  O  O     . CYS B 2  78  ? -33.953 -63.864 38.483  1.00 91.76  ? 78   CYS B O     1 
ATOM   5377  C  CB    . CYS B 2  78  ? -32.170 -64.104 41.236  1.00 98.66  ? 78   CYS B CB    1 
ATOM   5378  S  SG    . CYS B 2  78  ? -33.565 -65.175 41.223  1.00 111.15 ? 78   CYS B SG    1 
ATOM   5379  N  N     . SER B 2  79  ? -31.834 -64.585 38.222  1.00 97.43  ? 79   SER B N     1 
ATOM   5380  C  CA    . SER B 2  79  ? -32.075 -65.277 36.962  1.00 90.66  ? 79   SER B CA    1 
ATOM   5381  C  C     . SER B 2  79  ? -32.267 -66.768 37.194  1.00 99.07  ? 79   SER B C     1 
ATOM   5382  O  O     . SER B 2  79  ? -31.525 -67.378 37.964  1.00 100.60 ? 79   SER B O     1 
ATOM   5383  C  CB    . SER B 2  79  ? -30.927 -65.042 35.986  1.00 96.90  ? 79   SER B CB    1 
ATOM   5384  O  OG    . SER B 2  79  ? -31.319 -65.476 34.702  1.00 103.73 ? 79   SER B OG    1 
ATOM   5385  N  N     . TYR B 2  80  ? -33.250 -67.348 36.510  1.00 96.41  ? 80   TYR B N     1 
ATOM   5386  C  CA    . TYR B 2  80  ? -33.675 -68.726 36.710  1.00 102.85 ? 80   TYR B CA    1 
ATOM   5387  C  C     . TYR B 2  80  ? -33.570 -69.494 35.401  1.00 116.14 ? 80   TYR B C     1 
ATOM   5388  O  O     . TYR B 2  80  ? -34.081 -69.041 34.372  1.00 114.87 ? 80   TYR B O     1 
ATOM   5389  C  CB    . TYR B 2  80  ? -35.115 -68.750 37.218  1.00 99.17  ? 80   TYR B CB    1 
ATOM   5390  C  CG    . TYR B 2  80  ? -35.608 -70.058 37.774  1.00 101.16 ? 80   TYR B CG    1 
ATOM   5391  C  CD1   . TYR B 2  80  ? -36.937 -70.196 38.149  1.00 108.32 ? 80   TYR B CD1   1 
ATOM   5392  C  CD2   . TYR B 2  80  ? -34.761 -71.140 37.947  1.00 112.37 ? 80   TYR B CD2   1 
ATOM   5393  C  CE1   . TYR B 2  80  ? -37.426 -71.380 38.665  1.00 116.11 ? 80   TYR B CE1   1 
ATOM   5394  C  CE2   . TYR B 2  80  ? -35.236 -72.334 38.462  1.00 123.19 ? 80   TYR B CE2   1 
ATOM   5395  C  CZ    . TYR B 2  80  ? -36.574 -72.451 38.824  1.00 128.12 ? 80   TYR B CZ    1 
ATOM   5396  O  OH    . TYR B 2  80  ? -37.063 -73.639 39.342  1.00 134.46 ? 80   TYR B OH    1 
ATOM   5397  N  N     . LYS B 2  81  ? -32.935 -70.659 35.446  1.00 118.09 ? 81   LYS B N     1 
ATOM   5398  C  CA    . LYS B 2  81  ? -32.791 -71.489 34.256  1.00 113.35 ? 81   LYS B CA    1 
ATOM   5399  C  C     . LYS B 2  81  ? -33.959 -72.462 34.123  1.00 115.84 ? 81   LYS B C     1 
ATOM   5400  O  O     . LYS B 2  81  ? -34.371 -73.088 35.102  1.00 117.23 ? 81   LYS B O     1 
ATOM   5401  C  CB    . LYS B 2  81  ? -31.476 -72.265 34.302  1.00 103.95 ? 81   LYS B CB    1 
ATOM   5402  N  N     . HIS B 2  89  ? -35.587 -69.962 30.281  1.00 120.22 ? 89   HIS B N     1 
ATOM   5403  C  CA    . HIS B 2  89  ? -34.933 -68.914 31.068  1.00 117.60 ? 89   HIS B CA    1 
ATOM   5404  C  C     . HIS B 2  89  ? -35.904 -67.790 31.502  1.00 104.99 ? 89   HIS B C     1 
ATOM   5405  O  O     . HIS B 2  89  ? -36.594 -67.191 30.668  1.00 95.85  ? 89   HIS B O     1 
ATOM   5406  C  CB    . HIS B 2  89  ? -33.774 -68.321 30.260  1.00 119.28 ? 89   HIS B CB    1 
ATOM   5407  C  CG    . HIS B 2  89  ? -33.087 -67.177 30.938  1.00 111.78 ? 89   HIS B CG    1 
ATOM   5408  N  ND1   . HIS B 2  89  ? -32.466 -66.158 30.246  1.00 109.24 ? 89   HIS B ND1   1 
ATOM   5409  C  CD2   . HIS B 2  89  ? -32.899 -66.908 32.252  1.00 105.39 ? 89   HIS B CD2   1 
ATOM   5410  C  CE1   . HIS B 2  89  ? -31.936 -65.307 31.105  1.00 107.53 ? 89   HIS B CE1   1 
ATOM   5411  N  NE2   . HIS B 2  89  ? -32.186 -65.737 32.329  1.00 107.10 ? 89   HIS B NE2   1 
ATOM   5412  N  N     . GLN B 2  90  ? -35.930 -67.479 32.801  1.00 102.08 ? 90   GLN B N     1 
ATOM   5413  C  CA    . GLN B 2  90  ? -36.887 -66.516 33.338  1.00 102.40 ? 90   GLN B CA    1 
ATOM   5414  C  C     . GLN B 2  90  ? -36.245 -65.660 34.436  1.00 98.87  ? 90   GLN B C     1 
ATOM   5415  O  O     . GLN B 2  90  ? -35.124 -65.911 34.884  1.00 104.33 ? 90   GLN B O     1 
ATOM   5416  C  CB    . GLN B 2  90  ? -38.148 -67.246 33.824  1.00 93.23  ? 90   GLN B CB    1 
ATOM   5417  C  CG    . GLN B 2  90  ? -37.892 -68.558 34.560  1.00 97.46  ? 90   GLN B CG    1 
ATOM   5418  C  CD    . GLN B 2  90  ? -39.193 -69.275 34.918  1.00 103.59 ? 90   GLN B CD    1 
ATOM   5419  O  OE1   . GLN B 2  90  ? -40.110 -69.355 34.096  1.00 100.28 ? 90   GLN B OE1   1 
ATOM   5420  N  NE2   . GLN B 2  90  ? -39.274 -69.807 36.141  1.00 103.02 ? 90   GLN B NE2   1 
ATOM   5421  N  N     . TYR B 2  91  ? -36.947 -64.601 34.830  1.00 88.22  ? 91   TYR B N     1 
ATOM   5422  C  CA    . TYR B 2  91  ? -36.447 -63.639 35.798  1.00 87.08  ? 91   TYR B CA    1 
ATOM   5423  C  C     . TYR B 2  91  ? -37.397 -63.530 36.981  1.00 90.30  ? 91   TYR B C     1 
ATOM   5424  O  O     . TYR B 2  91  ? -38.602 -63.342 36.801  1.00 83.97  ? 91   TYR B O     1 
ATOM   5425  C  CB    . TYR B 2  91  ? -36.277 -62.276 35.145  1.00 94.21  ? 91   TYR B CB    1 
ATOM   5426  C  CG    . TYR B 2  91  ? -34.843 -61.988 34.791  1.00 109.23 ? 91   TYR B CG    1 
ATOM   5427  C  CD1   . TYR B 2  91  ? -34.303 -62.468 33.600  1.00 109.01 ? 91   TYR B CD1   1 
ATOM   5428  C  CD2   . TYR B 2  91  ? -34.026 -61.235 35.631  1.00 109.57 ? 91   TYR B CD2   1 
ATOM   5429  C  CE1   . TYR B 2  91  ? -32.986 -62.231 33.254  1.00 109.19 ? 91   TYR B CE1   1 
ATOM   5430  C  CE2   . TYR B 2  91  ? -32.699 -60.988 35.294  1.00 119.68 ? 91   TYR B CE2   1 
ATOM   5431  C  CZ    . TYR B 2  91  ? -32.184 -61.494 34.095  1.00 118.96 ? 91   TYR B CZ    1 
ATOM   5432  O  OH    . TYR B 2  91  ? -30.873 -61.268 33.719  1.00 111.08 ? 91   TYR B OH    1 
ATOM   5433  N  N     . ILE B 2  92  ? -36.840 -63.573 38.189  1.00 83.75  ? 92   ILE B N     1 
ATOM   5434  C  CA    . ILE B 2  92  ? -37.601 -63.483 39.424  1.00 80.82  ? 92   ILE B CA    1 
ATOM   5435  C  C     . ILE B 2  92  ? -37.387 -62.105 40.029  1.00 87.77  ? 92   ILE B C     1 
ATOM   5436  O  O     . ILE B 2  92  ? -36.246 -61.679 40.245  1.00 89.09  ? 92   ILE B O     1 
ATOM   5437  C  CB    . ILE B 2  92  ? -37.183 -64.589 40.407  1.00 82.23  ? 92   ILE B CB    1 
ATOM   5438  C  CG1   . ILE B 2  92  ? -37.449 -65.952 39.804  1.00 85.76  ? 92   ILE B CG1   1 
ATOM   5439  C  CG2   . ILE B 2  92  ? -37.896 -64.487 41.720  1.00 99.51  ? 92   ILE B CG2   1 
ATOM   5440  C  CD1   . ILE B 2  92  ? -36.260 -66.784 39.838  1.00 110.88 ? 92   ILE B CD1   1 
ATOM   5441  N  N     . ILE B 2  93  ? -38.489 -61.426 40.313  1.00 78.45  ? 93   ILE B N     1 
ATOM   5442  C  CA    . ILE B 2  93  ? -38.521 -60.128 40.966  1.00 74.53  ? 93   ILE B CA    1 
ATOM   5443  C  C     . ILE B 2  93  ? -39.322 -60.342 42.241  1.00 74.84  ? 93   ILE B C     1 
ATOM   5444  O  O     . ILE B 2  93  ? -40.417 -60.906 42.194  1.00 75.31  ? 93   ILE B O     1 
ATOM   5445  C  CB    . ILE B 2  93  ? -39.173 -59.063 40.063  1.00 76.43  ? 93   ILE B CB    1 
ATOM   5446  C  CG1   . ILE B 2  93  ? -38.594 -59.110 38.650  1.00 68.32  ? 93   ILE B CG1   1 
ATOM   5447  C  CG2   . ILE B 2  93  ? -39.047 -57.654 40.640  1.00 89.46  ? 93   ILE B CG2   1 
ATOM   5448  C  CD1   . ILE B 2  93  ? -39.363 -58.246 37.681  1.00 67.16  ? 93   ILE B CD1   1 
ATOM   5449  N  N     . HIS B 2  94  ? -38.750 -59.996 43.384  1.00 74.76  ? 94   HIS B N     1 
ATOM   5450  C  CA    . HIS B 2  94  ? -39.474 -60.070 44.642  1.00 80.01  ? 94   HIS B CA    1 
ATOM   5451  C  C     . HIS B 2  94  ? -39.287 -58.796 45.434  1.00 76.34  ? 94   HIS B C     1 
ATOM   5452  O  O     . HIS B 2  94  ? -38.154 -58.382 45.683  1.00 80.26  ? 94   HIS B O     1 
ATOM   5453  C  CB    . HIS B 2  94  ? -39.018 -61.251 45.483  1.00 82.68  ? 94   HIS B CB    1 
ATOM   5454  C  CG    . HIS B 2  94  ? -39.559 -61.230 46.875  1.00 84.03  ? 94   HIS B CG    1 
ATOM   5455  N  ND1   . HIS B 2  94  ? -38.924 -60.571 47.901  1.00 79.64  ? 94   HIS B ND1   1 
ATOM   5456  C  CD2   . HIS B 2  94  ? -40.710 -61.714 47.396  1.00 86.92  ? 94   HIS B CD2   1 
ATOM   5457  C  CE1   . HIS B 2  94  ? -39.635 -60.690 49.007  1.00 88.94  ? 94   HIS B CE1   1 
ATOM   5458  N  NE2   . HIS B 2  94  ? -40.726 -61.379 48.727  1.00 87.11  ? 94   HIS B NE2   1 
ATOM   5459  N  N     . GLY B 2  95  ? -40.391 -58.226 45.895  1.00 72.54  ? 95   GLY B N     1 
ATOM   5460  C  CA    . GLY B 2  95  ? -40.318 -57.049 46.735  1.00 78.53  ? 95   GLY B CA    1 
ATOM   5461  C  C     . GLY B 2  95  ? -40.143 -55.762 45.942  1.00 81.71  ? 95   GLY B C     1 
ATOM   5462  O  O     . GLY B 2  95  ? -40.510 -55.670 44.769  1.00 81.58  ? 95   GLY B O     1 
ATOM   5463  N  N     . GLY B 2  96  ? -39.578 -54.755 46.608  1.00 79.87  ? 96   GLY B N     1 
ATOM   5464  C  CA    . GLY B 2  96  ? -39.361 -53.443 46.031  1.00 79.41  ? 96   GLY B CA    1 
ATOM   5465  C  C     . GLY B 2  96  ? -40.417 -52.436 46.473  1.00 84.17  ? 96   GLY B C     1 
ATOM   5466  O  O     . GLY B 2  96  ? -41.424 -52.770 47.105  1.00 81.45  ? 96   GLY B O     1 
ATOM   5467  N  N     . LYS B 2  97  ? -40.160 -51.162 46.148  1.00 84.37  ? 97   LYS B N     1 
ATOM   5468  C  CA    . LYS B 2  97  ? -41.093 -50.075 46.429  1.00 72.38  ? 97   LYS B CA    1 
ATOM   5469  C  C     . LYS B 2  97  ? -41.868 -49.696 45.175  1.00 77.15  ? 97   LYS B C     1 
ATOM   5470  O  O     . LYS B 2  97  ? -41.277 -49.491 44.105  1.00 76.25  ? 97   LYS B O     1 
ATOM   5471  C  CB    . LYS B 2  97  ? -40.374 -48.826 46.934  1.00 76.30  ? 97   LYS B CB    1 
ATOM   5472  C  CG    . LYS B 2  97  ? -39.562 -48.949 48.188  1.00 80.12  ? 97   LYS B CG    1 
ATOM   5473  C  CD    . LYS B 2  97  ? -39.469 -47.564 48.820  1.00 86.72  ? 97   LYS B CD    1 
ATOM   5474  C  CE    . LYS B 2  97  ? -38.493 -47.501 49.981  1.00 98.56  ? 97   LYS B CE    1 
ATOM   5475  N  NZ    . LYS B 2  97  ? -38.836 -46.393 50.927  1.00 104.82 ? 97   LYS B NZ    1 
ATOM   5476  N  N     . THR B 2  98  ? -43.183 -49.475 45.346  1.00 72.23  ? 98   THR B N     1 
ATOM   5477  C  CA    . THR B 2  98  ? -44.046 -49.073 44.249  1.00 71.18  ? 98   THR B CA    1 
ATOM   5478  C  C     . THR B 2  98  ? -44.096 -47.552 44.157  1.00 74.40  ? 98   THR B C     1 
ATOM   5479  O  O     . THR B 2  98  ? -43.619 -46.843 45.047  1.00 79.11  ? 98   THR B O     1 
ATOM   5480  C  CB    . THR B 2  98  ? -45.445 -49.656 44.441  1.00 65.30  ? 98   THR B CB    1 
ATOM   5481  O  OG1   . THR B 2  98  ? -46.072 -49.054 45.573  1.00 71.28  ? 98   THR B OG1   1 
ATOM   5482  C  CG2   . THR B 2  98  ? -45.334 -51.138 44.675  1.00 73.21  ? 98   THR B CG2   1 
ATOM   5483  N  N     . PRO B 2  99  ? -44.590 -47.009 43.060  1.00 74.52  ? 99   PRO B N     1 
ATOM   5484  C  CA    . PRO B 2  99  ? -44.661 -45.544 42.943  1.00 79.36  ? 99   PRO B CA    1 
ATOM   5485  C  C     . PRO B 2  99  ? -45.396 -44.841 44.074  1.00 74.22  ? 99   PRO B C     1 
ATOM   5486  O  O     . PRO B 2  99  ? -45.180 -43.649 44.287  1.00 90.81  ? 99   PRO B O     1 
ATOM   5487  C  CB    . PRO B 2  99  ? -45.394 -45.336 41.615  1.00 79.14  ? 99   PRO B CB    1 
ATOM   5488  C  CG    . PRO B 2  99  ? -45.144 -46.571 40.845  1.00 88.66  ? 99   PRO B CG    1 
ATOM   5489  C  CD    . PRO B 2  99  ? -45.034 -47.689 41.830  1.00 75.38  ? 99   PRO B CD    1 
ATOM   5490  N  N     . ASN B 2  100 ? -46.263 -45.545 44.793  1.00 77.06  ? 100  ASN B N     1 
ATOM   5491  C  CA    . ASN B 2  100 ? -46.976 -45.004 45.945  1.00 75.73  ? 100  ASN B CA    1 
ATOM   5492  C  C     . ASN B 2  100 ? -46.214 -45.212 47.248  1.00 70.42  ? 100  ASN B C     1 
ATOM   5493  O  O     . ASN B 2  100 ? -46.771 -44.976 48.323  1.00 72.82  ? 100  ASN B O     1 
ATOM   5494  C  CB    . ASN B 2  100 ? -48.369 -45.647 46.054  1.00 81.11  ? 100  ASN B CB    1 
ATOM   5495  C  CG    . ASN B 2  100 ? -49.365 -45.119 45.015  1.00 71.53  ? 100  ASN B CG    1 
ATOM   5496  O  OD1   . ASN B 2  100 ? -49.001 -44.415 44.075  1.00 71.84  ? 100  ASN B OD1   1 
ATOM   5497  N  ND2   . ASN B 2  100 ? -50.628 -45.497 45.173  1.00 73.60  ? 100  ASN B ND2   1 
ATOM   5498  N  N     . ASN B 2  101 ? -44.969 -45.667 47.170  1.00 69.15  ? 101  ASN B N     1 
ATOM   5499  C  CA    . ASN B 2  101 ? -44.100 -45.919 48.308  1.00 76.17  ? 101  ASN B CA    1 
ATOM   5500  C  C     . ASN B 2  101 ? -44.532 -47.118 49.148  1.00 86.14  ? 101  ASN B C     1 
ATOM   5501  O  O     . ASN B 2  101 ? -43.993 -47.319 50.248  1.00 90.77  ? 101  ASN B O     1 
ATOM   5502  C  CB    . ASN B 2  101 ? -43.961 -44.686 49.203  1.00 74.48  ? 101  ASN B CB    1 
ATOM   5503  C  CG    . ASN B 2  101 ? -42.549 -44.162 49.225  1.00 89.71  ? 101  ASN B CG    1 
ATOM   5504  O  OD1   . ASN B 2  101 ? -42.039 -43.687 48.207  1.00 94.89  ? 101  ASN B OD1   1 
ATOM   5505  N  ND2   . ASN B 2  101 ? -41.892 -44.262 50.380  1.00 94.55  ? 101  ASN B ND2   1 
ATOM   5506  N  N     . GLU B 2  102 ? -45.475 -47.930 48.678  1.00 78.63  ? 102  GLU B N     1 
ATOM   5507  C  CA    . GLU B 2  102 ? -45.760 -49.184 49.363  1.00 79.60  ? 102  GLU B CA    1 
ATOM   5508  C  C     . GLU B 2  102 ? -44.722 -50.242 49.031  1.00 75.43  ? 102  GLU B C     1 
ATOM   5509  O  O     . GLU B 2  102 ? -44.155 -50.273 47.935  1.00 78.03  ? 102  GLU B O     1 
ATOM   5510  C  CB    . GLU B 2  102 ? -47.156 -49.698 49.014  1.00 82.57  ? 102  GLU B CB    1 
ATOM   5511  C  CG    . GLU B 2  102 ? -48.254 -48.774 49.513  1.00 100.33 ? 102  GLU B CG    1 
ATOM   5512  C  CD    . GLU B 2  102 ? -49.638 -49.175 49.062  1.00 102.91 ? 102  GLU B CD    1 
ATOM   5513  O  OE1   . GLU B 2  102 ? -50.381 -49.802 49.858  1.00 105.51 ? 102  GLU B OE1   1 
ATOM   5514  O  OE2   . GLU B 2  102 ? -49.979 -48.841 47.907  1.00 98.39  ? 102  GLU B OE2   1 
ATOM   5515  N  N     . LEU B 2  103 ? -44.482 -51.119 49.991  1.00 72.71  ? 103  LEU B N     1 
ATOM   5516  C  CA    . LEU B 2  103 ? -43.614 -52.264 49.785  1.00 74.48  ? 103  LEU B CA    1 
ATOM   5517  C  C     . LEU B 2  103 ? -44.472 -53.461 49.404  1.00 85.80  ? 103  LEU B C     1 
ATOM   5518  O  O     . LEU B 2  103 ? -45.524 -53.693 50.012  1.00 93.75  ? 103  LEU B O     1 
ATOM   5519  C  CB    . LEU B 2  103 ? -42.799 -52.541 51.042  1.00 73.41  ? 103  LEU B CB    1 
ATOM   5520  C  CG    . LEU B 2  103 ? -41.928 -51.371 51.469  1.00 68.12  ? 103  LEU B CG    1 
ATOM   5521  C  CD1   . LEU B 2  103 ? -41.347 -51.676 52.820  1.00 73.24  ? 103  LEU B CD1   1 
ATOM   5522  C  CD2   . LEU B 2  103 ? -40.815 -51.214 50.460  1.00 79.32  ? 103  LEU B CD2   1 
ATOM   5523  N  N     . SER B 2  104 ? -44.047 -54.181 48.369  1.00 80.90  ? 104  SER B N     1 
ATOM   5524  C  CA    . SER B 2  104 ? -44.759 -55.348 47.868  1.00 82.29  ? 104  SER B CA    1 
ATOM   5525  C  C     . SER B 2  104 ? -44.168 -56.604 48.498  1.00 81.63  ? 104  SER B C     1 
ATOM   5526  O  O     . SER B 2  104 ? -42.968 -56.670 48.781  1.00 76.90  ? 104  SER B O     1 
ATOM   5527  C  CB    . SER B 2  104 ? -44.713 -55.403 46.331  1.00 84.00  ? 104  SER B CB    1 
ATOM   5528  O  OG    . SER B 2  104 ? -43.858 -56.413 45.808  1.00 76.29  ? 104  SER B OG    1 
ATOM   5529  N  N     . ASP B 2  105 ? -45.042 -57.537 48.850  1.00 86.04  ? 105  ASP B N     1 
ATOM   5530  C  CA    . ASP B 2  105 ? -44.617 -58.864 49.266  1.00 89.81  ? 105  ASP B CA    1 
ATOM   5531  C  C     . ASP B 2  105 ? -44.677 -59.878 48.135  1.00 89.22  ? 105  ASP B C     1 
ATOM   5532  O  O     . ASP B 2  105 ? -44.164 -60.994 48.292  1.00 93.65  ? 105  ASP B O     1 
ATOM   5533  C  CB    . ASP B 2  105 ? -45.449 -59.337 50.476  1.00 110.73 ? 105  ASP B CB    1 
ATOM   5534  C  CG    . ASP B 2  105 ? -46.964 -59.398 50.198  1.00 117.10 ? 105  ASP B CG    1 
ATOM   5535  O  OD1   . ASP B 2  105 ? -47.422 -58.922 49.128  1.00 111.11 ? 105  ASP B OD1   1 
ATOM   5536  O  OD2   . ASP B 2  105 ? -47.699 -59.905 51.084  1.00 115.86 ? 105  ASP B OD2   1 
ATOM   5537  N  N     . LYS B 2  106 ? -45.192 -59.477 46.974  1.00 91.82  ? 106  LYS B N     1 
ATOM   5538  C  CA    . LYS B 2  106 ? -45.451 -60.399 45.882  1.00 95.00  ? 106  LYS B CA    1 
ATOM   5539  C  C     . LYS B 2  106 ? -44.149 -60.864 45.226  1.00 85.56  ? 106  LYS B C     1 
ATOM   5540  O  O     . LYS B 2  106 ? -43.054 -60.388 45.524  1.00 84.45  ? 106  LYS B O     1 
ATOM   5541  C  CB    . LYS B 2  106 ? -46.361 -59.747 44.839  1.00 82.24  ? 106  LYS B CB    1 
ATOM   5542  C  CG    . LYS B 2  106 ? -47.638 -59.157 45.400  1.00 86.95  ? 106  LYS B CG    1 
ATOM   5543  C  CD    . LYS B 2  106 ? -48.818 -60.098 45.283  1.00 90.62  ? 106  LYS B CD    1 
ATOM   5544  C  CE    . LYS B 2  106 ? -50.067 -59.506 45.951  1.00 102.60 ? 106  LYS B CE    1 
ATOM   5545  N  NZ    . LYS B 2  106 ? -49.938 -59.320 47.432  1.00 108.35 ? 106  LYS B NZ    1 
ATOM   5546  N  N     . ILE B 2  107 ? -44.291 -61.845 44.340  1.00 85.46  ? 107  ILE B N     1 
ATOM   5547  C  CA    . ILE B 2  107 ? -43.204 -62.345 43.513  1.00 81.31  ? 107  ILE B CA    1 
ATOM   5548  C  C     . ILE B 2  107 ? -43.692 -62.363 42.073  1.00 84.13  ? 107  ILE B C     1 
ATOM   5549  O  O     . ILE B 2  107 ? -44.783 -62.866 41.787  1.00 101.09 ? 107  ILE B O     1 
ATOM   5550  C  CB    . ILE B 2  107 ? -42.742 -63.748 43.939  1.00 82.91  ? 107  ILE B CB    1 
ATOM   5551  C  CG1   . ILE B 2  107 ? -42.083 -63.696 45.305  1.00 88.91  ? 107  ILE B CG1   1 
ATOM   5552  C  CG2   . ILE B 2  107 ? -41.752 -64.296 42.945  1.00 93.70  ? 107  ILE B CG2   1 
ATOM   5553  C  CD1   . ILE B 2  107 ? -41.260 -64.939 45.609  1.00 92.04  ? 107  ILE B CD1   1 
ATOM   5554  N  N     . TYR B 2  108 ? -42.916 -61.778 41.179  1.00 76.09  ? 108  TYR B N     1 
ATOM   5555  C  CA    . TYR B 2  108 ? -43.248 -61.784 39.772  1.00 73.90  ? 108  TYR B CA    1 
ATOM   5556  C  C     . TYR B 2  108 ? -42.178 -62.565 39.024  1.00 82.77  ? 108  TYR B C     1 
ATOM   5557  O  O     . TYR B 2  108 ? -41.009 -62.603 39.424  1.00 81.77  ? 108  TYR B O     1 
ATOM   5558  C  CB    . TYR B 2  108 ? -43.379 -60.365 39.225  1.00 73.02  ? 108  TYR B CB    1 
ATOM   5559  C  CG    . TYR B 2  108 ? -44.472 -59.557 39.898  1.00 72.30  ? 108  TYR B CG    1 
ATOM   5560  C  CD1   . TYR B 2  108 ? -44.195 -58.760 41.003  1.00 74.68  ? 108  TYR B CD1   1 
ATOM   5561  C  CD2   . TYR B 2  108 ? -45.779 -59.585 39.428  1.00 80.25  ? 108  TYR B CD2   1 
ATOM   5562  C  CE1   . TYR B 2  108 ? -45.192 -58.013 41.625  1.00 73.47  ? 108  TYR B CE1   1 
ATOM   5563  C  CE2   . TYR B 2  108 ? -46.788 -58.841 40.043  1.00 78.14  ? 108  TYR B CE2   1 
ATOM   5564  C  CZ    . TYR B 2  108 ? -46.486 -58.060 41.136  1.00 74.22  ? 108  TYR B CZ    1 
ATOM   5565  O  OH    . TYR B 2  108 ? -47.494 -57.335 41.731  1.00 80.01  ? 108  TYR B OH    1 
ATOM   5566  N  N     . ILE B 2  109 ? -42.602 -63.215 37.947  1.00 91.51  ? 109  ILE B N     1 
ATOM   5567  C  CA    . ILE B 2  109 ? -41.731 -64.016 37.103  1.00 76.31  ? 109  ILE B CA    1 
ATOM   5568  C  C     . ILE B 2  109 ? -41.889 -63.541 35.672  1.00 78.89  ? 109  ILE B C     1 
ATOM   5569  O  O     . ILE B 2  109 ? -43.004 -63.525 35.131  1.00 79.64  ? 109  ILE B O     1 
ATOM   5570  C  CB    . ILE B 2  109 ? -42.069 -65.497 37.238  1.00 73.17  ? 109  ILE B CB    1 
ATOM   5571  C  CG1   . ILE B 2  109 ? -41.677 -65.953 38.633  1.00 74.82  ? 109  ILE B CG1   1 
ATOM   5572  C  CG2   . ILE B 2  109 ? -41.414 -66.292 36.146  1.00 81.13  ? 109  ILE B CG2   1 
ATOM   5573  C  CD1   . ILE B 2  109 ? -42.077 -67.331 38.901  1.00 89.16  ? 109  ILE B CD1   1 
ATOM   5574  N  N     . MET B 2  110 ? -40.776 -63.176 35.062  1.00 72.20  ? 110  MET B N     1 
ATOM   5575  C  CA    . MET B 2  110 ? -40.742 -62.638 33.718  1.00 87.28  ? 110  MET B CA    1 
ATOM   5576  C  C     . MET B 2  110 ? -40.178 -63.713 32.811  1.00 89.98  ? 110  MET B C     1 
ATOM   5577  O  O     . MET B 2  110 ? -39.152 -64.315 33.124  1.00 86.82  ? 110  MET B O     1 
ATOM   5578  C  CB    . MET B 2  110 ? -39.882 -61.369 33.651  1.00 90.86  ? 110  MET B CB    1 
ATOM   5579  C  CG    . MET B 2  110 ? -40.454 -60.159 34.393  1.00 94.38  ? 110  MET B CG    1 
ATOM   5580  S  SD    . MET B 2  110 ? -41.968 -59.491 33.712  1.00 96.43  ? 110  MET B SD    1 
ATOM   5581  C  CE    . MET B 2  110 ? -41.373 -59.079 32.084  1.00 97.60  ? 110  MET B CE    1 
ATOM   5582  N  N     . SER B 2  111 ? -40.864 -63.970 31.709  1.00 95.03  ? 111  SER B N     1 
ATOM   5583  C  CA    . SER B 2  111 ? -40.386 -64.939 30.741  1.00 93.52  ? 111  SER B CA    1 
ATOM   5584  C  C     . SER B 2  111 ? -40.748 -64.426 29.360  1.00 100.56 ? 111  SER B C     1 
ATOM   5585  O  O     . SER B 2  111 ? -41.593 -63.539 29.215  1.00 99.11  ? 111  SER B O     1 
ATOM   5586  C  CB    . SER B 2  111 ? -40.994 -66.315 30.996  1.00 90.97  ? 111  SER B CB    1 
ATOM   5587  O  OG    . SER B 2  111 ? -42.410 -66.205 31.046  1.00 93.92  ? 111  SER B OG    1 
ATOM   5588  N  N     . VAL B 2  112 ? -40.081 -64.967 28.344  1.00 99.33  ? 112  VAL B N     1 
ATOM   5589  C  CA    . VAL B 2  112 ? -40.374 -64.618 26.957  1.00 99.63  ? 112  VAL B CA    1 
ATOM   5590  C  C     . VAL B 2  112 ? -41.502 -65.508 26.456  1.00 94.70  ? 112  VAL B C     1 
ATOM   5591  O  O     . VAL B 2  112 ? -41.326 -66.715 26.304  1.00 102.43 ? 112  VAL B O     1 
ATOM   5592  C  CB    . VAL B 2  112 ? -39.140 -64.741 26.060  1.00 93.21  ? 112  VAL B CB    1 
ATOM   5593  C  CG1   . VAL B 2  112 ? -39.537 -64.439 24.621  1.00 100.80 ? 112  VAL B CG1   1 
ATOM   5594  C  CG2   . VAL B 2  112 ? -38.057 -63.780 26.524  1.00 100.13 ? 112  VAL B CG2   1 
ATOM   5595  N  N     . ALA B 2  113 ? -42.657 -64.909 26.181  1.00 95.97  ? 113  ALA B N     1 
ATOM   5596  C  CA    . ALA B 2  113 ? -43.826 -65.644 25.720  1.00 104.32 ? 113  ALA B CA    1 
ATOM   5597  C  C     . ALA B 2  113 ? -43.809 -65.882 24.215  1.00 109.93 ? 113  ALA B C     1 
ATOM   5598  O  O     . ALA B 2  113 ? -44.264 -66.936 23.754  1.00 100.33 ? 113  ALA B O     1 
ATOM   5599  C  CB    . ALA B 2  113 ? -45.095 -64.884 26.094  1.00 109.51 ? 113  ALA B CB    1 
ATOM   5600  N  N     . CYS B 2  114 ? -43.345 -64.890 23.451  1.00 109.89 ? 114  CYS B N     1 
ATOM   5601  C  CA    . CYS B 2  114 ? -43.287 -64.958 21.996  1.00 105.06 ? 114  CYS B CA    1 
ATOM   5602  C  C     . CYS B 2  114 ? -42.239 -63.978 21.495  1.00 113.65 ? 114  CYS B C     1 
ATOM   5603  O  O     . CYS B 2  114 ? -42.195 -62.834 21.954  1.00 118.24 ? 114  CYS B O     1 
ATOM   5604  C  CB    . CYS B 2  114 ? -44.651 -64.629 21.385  1.00 103.49 ? 114  CYS B CB    1 
ATOM   5605  S  SG    . CYS B 2  114 ? -44.651 -64.362 19.590  1.00 134.10 ? 114  CYS B SG    1 
ATOM   5606  N  N     . LYS B 2  115 ? -41.404 -64.424 20.563  1.00 126.39 ? 115  LYS B N     1 
ATOM   5607  C  CA    . LYS B 2  115 ? -40.410 -63.575 19.917  1.00 127.54 ? 115  LYS B CA    1 
ATOM   5608  C  C     . LYS B 2  115 ? -40.676 -63.711 18.421  1.00 139.47 ? 115  LYS B C     1 
ATOM   5609  O  O     . LYS B 2  115 ? -40.131 -64.594 17.756  1.00 144.15 ? 115  LYS B O     1 
ATOM   5610  C  CB    . LYS B 2  115 ? -39.010 -63.990 20.306  1.00 118.84 ? 115  LYS B CB    1 
ATOM   5611  C  CG    . LYS B 2  115 ? -37.915 -63.146 19.717  1.00 130.60 ? 115  LYS B CG    1 
ATOM   5612  C  CD    . LYS B 2  115 ? -36.579 -63.698 20.165  1.00 126.50 ? 115  LYS B CD    1 
ATOM   5613  C  CE    . LYS B 2  115 ? -36.357 -65.087 19.590  1.00 130.59 ? 115  LYS B CE    1 
ATOM   5614  N  NZ    . LYS B 2  115 ? -36.077 -65.025 18.113  1.00 138.01 ? 115  LYS B NZ    1 
ATOM   5615  N  N     . ASN B 2  116 ? -41.470 -62.786 17.888  1.00 147.12 ? 116  ASN B N     1 
ATOM   5616  C  CA    . ASN B 2  116 ? -41.895 -62.791 16.492  1.00 157.30 ? 116  ASN B CA    1 
ATOM   5617  C  C     . ASN B 2  116 ? -41.220 -61.640 15.769  1.00 160.72 ? 116  ASN B C     1 
ATOM   5618  O  O     . ASN B 2  116 ? -41.517 -60.474 16.048  1.00 167.25 ? 116  ASN B O     1 
ATOM   5619  C  CB    . ASN B 2  116 ? -43.420 -62.669 16.376  1.00 162.49 ? 116  ASN B CB    1 
ATOM   5620  C  CG    . ASN B 2  116 ? -43.899 -62.543 14.926  1.00 170.48 ? 116  ASN B CG    1 
ATOM   5621  O  OD1   . ASN B 2  116 ? -43.150 -62.813 13.984  1.00 174.65 ? 116  ASN B OD1   1 
ATOM   5622  N  ND2   . ASN B 2  116 ? -45.159 -62.142 14.747  1.00 166.78 ? 116  ASN B ND2   1 
ATOM   5623  N  N     . ASN B 2  117 ? -40.381 -61.975 14.790  1.00 158.45 ? 117  ASN B N     1 
ATOM   5624  C  CA    . ASN B 2  117 ? -39.688 -60.980 13.978  1.00 167.35 ? 117  ASN B CA    1 
ATOM   5625  C  C     . ASN B 2  117 ? -38.916 -59.994 14.858  1.00 169.24 ? 117  ASN B C     1 
ATOM   5626  O  O     . ASN B 2  117 ? -38.978 -58.772 14.677  1.00 166.42 ? 117  ASN B O     1 
ATOM   5627  C  CB    . ASN B 2  117 ? -40.686 -60.259 13.066  1.00 164.97 ? 117  ASN B CB    1 
ATOM   5628  N  N     . LYS B 2  118 ? -38.182 -60.554 15.831  1.00 162.01 ? 118  LYS B N     1 
ATOM   5629  C  CA    . LYS B 2  118 ? -37.341 -59.797 16.770  1.00 161.19 ? 118  LYS B CA    1 
ATOM   5630  C  C     . LYS B 2  118 ? -38.139 -58.786 17.589  1.00 160.57 ? 118  LYS B C     1 
ATOM   5631  O  O     . LYS B 2  118 ? -37.633 -57.716 17.935  1.00 161.38 ? 118  LYS B O     1 
ATOM   5632  C  CB    . LYS B 2  118 ? -36.202 -59.084 16.040  1.00 164.37 ? 118  LYS B CB    1 
ATOM   5633  C  CG    . LYS B 2  118 ? -35.269 -60.006 15.314  1.00 165.81 ? 118  LYS B CG    1 
ATOM   5634  C  CD    . LYS B 2  118 ? -34.586 -60.912 16.295  1.00 171.73 ? 118  LYS B CD    1 
ATOM   5635  C  CE    . LYS B 2  118 ? -33.556 -61.766 15.601  1.00 176.08 ? 118  LYS B CE    1 
ATOM   5636  N  NZ    . LYS B 2  118 ? -32.881 -62.662 16.574  1.00 174.56 ? 118  LYS B NZ    1 
ATOM   5637  N  N     . LYS B 2  119 ? -39.375 -59.124 17.944  1.00 154.61 ? 119  LYS B N     1 
ATOM   5638  C  CA    . LYS B 2  119 ? -40.257 -58.245 18.713  1.00 145.05 ? 119  LYS B CA    1 
ATOM   5639  C  C     . LYS B 2  119 ? -40.850 -59.061 19.862  1.00 141.70 ? 119  LYS B C     1 
ATOM   5640  O  O     . LYS B 2  119 ? -41.823 -59.800 19.671  1.00 137.69 ? 119  LYS B O     1 
ATOM   5641  C  CB    . LYS B 2  119 ? -41.340 -57.635 17.822  1.00 141.37 ? 119  LYS B CB    1 
ATOM   5642  N  N     . VAL B 2  120 ? -40.238 -58.958 21.044  1.00 135.39 ? 120  VAL B N     1 
ATOM   5643  C  CA    . VAL B 2  120 ? -40.532 -59.873 22.142  1.00 118.22 ? 120  VAL B CA    1 
ATOM   5644  C  C     . VAL B 2  120 ? -41.852 -59.504 22.816  1.00 106.30 ? 120  VAL B C     1 
ATOM   5645  O  O     . VAL B 2  120 ? -42.127 -58.334 23.116  1.00 109.20 ? 120  VAL B O     1 
ATOM   5646  C  CB    . VAL B 2  120 ? -39.371 -59.854 23.154  1.00 106.21 ? 120  VAL B CB    1 
ATOM   5647  C  CG1   . VAL B 2  120 ? -39.652 -60.750 24.336  1.00 103.86 ? 120  VAL B CG1   1 
ATOM   5648  C  CG2   . VAL B 2  120 ? -38.092 -60.295 22.481  1.00 111.55 ? 120  VAL B CG2   1 
ATOM   5649  N  N     . THR B 2  121 ? -42.654 -60.526 23.096  1.00 99.41  ? 121  THR B N     1 
ATOM   5650  C  CA    . THR B 2  121 ? -43.805 -60.431 23.979  1.00 99.12  ? 121  THR B CA    1 
ATOM   5651  C  C     . THR B 2  121 ? -43.407 -61.101 25.283  1.00 95.01  ? 121  THR B C     1 
ATOM   5652  O  O     . THR B 2  121 ? -42.775 -62.160 25.268  1.00 98.31  ? 121  THR B O     1 
ATOM   5653  C  CB    . THR B 2  121 ? -45.056 -61.094 23.376  1.00 101.43 ? 121  THR B CB    1 
ATOM   5654  O  OG1   . THR B 2  121 ? -45.364 -60.499 22.105  1.00 104.01 ? 121  THR B OG1   1 
ATOM   5655  C  CG2   . THR B 2  121 ? -46.266 -60.938 24.299  1.00 92.00  ? 121  THR B CG2   1 
ATOM   5656  N  N     . PHE B 2  122 ? -43.718 -60.460 26.398  1.00 91.15  ? 122  PHE B N     1 
ATOM   5657  C  CA    . PHE B 2  122 ? -43.371 -60.994 27.701  1.00 88.07  ? 122  PHE B CA    1 
ATOM   5658  C  C     . PHE B 2  122 ? -44.581 -61.610 28.379  1.00 88.76  ? 122  PHE B C     1 
ATOM   5659  O  O     . PHE B 2  122 ? -45.723 -61.206 28.147  1.00 82.70  ? 122  PHE B O     1 
ATOM   5660  C  CB    . PHE B 2  122 ? -42.799 -59.916 28.607  1.00 84.78  ? 122  PHE B CB    1 
ATOM   5661  C  CG    . PHE B 2  122 ? -41.412 -59.562 28.291  1.00 86.70  ? 122  PHE B CG    1 
ATOM   5662  C  CD1   . PHE B 2  122 ? -40.370 -60.255 28.868  1.00 87.61  ? 122  PHE B CD1   1 
ATOM   5663  C  CD2   . PHE B 2  122 ? -41.142 -58.563 27.388  1.00 88.61  ? 122  PHE B CD2   1 
ATOM   5664  C  CE1   . PHE B 2  122 ? -39.081 -59.942 28.572  1.00 93.94  ? 122  PHE B CE1   1 
ATOM   5665  C  CE2   . PHE B 2  122 ? -39.847 -58.235 27.082  1.00 97.66  ? 122  PHE B CE2   1 
ATOM   5666  C  CZ    . PHE B 2  122 ? -38.812 -58.923 27.672  1.00 99.97  ? 122  PHE B CZ    1 
ATOM   5667  N  N     . ARG B 2  123 ? -44.301 -62.601 29.220  1.00 91.77  ? 123  ARG B N     1 
ATOM   5668  C  CA    . ARG B 2  123 ? -45.234 -63.154 30.190  1.00 83.09  ? 123  ARG B CA    1 
ATOM   5669  C  C     . ARG B 2  123 ? -44.781 -62.785 31.597  1.00 84.29  ? 123  ARG B C     1 
ATOM   5670  O  O     . ARG B 2  123 ? -43.727 -63.248 32.050  1.00 84.16  ? 123  ARG B O     1 
ATOM   5671  C  CB    . ARG B 2  123 ? -45.302 -64.673 30.049  1.00 89.58  ? 123  ARG B CB    1 
ATOM   5672  C  CG    . ARG B 2  123 ? -46.367 -65.309 30.921  1.00 99.58  ? 123  ARG B CG    1 
ATOM   5673  C  CD    . ARG B 2  123 ? -46.520 -66.812 30.714  1.00 100.64 ? 123  ARG B CD    1 
ATOM   5674  N  NE    . ARG B 2  123 ? -45.986 -67.270 29.439  1.00 99.06  ? 123  ARG B NE    1 
ATOM   5675  C  CZ    . ARG B 2  123 ? -46.722 -67.397 28.339  1.00 107.56 ? 123  ARG B CZ    1 
ATOM   5676  N  NH1   . ARG B 2  123 ? -48.010 -67.081 28.366  1.00 107.32 ? 123  ARG B NH1   1 
ATOM   5677  N  NH2   . ARG B 2  123 ? -46.177 -67.836 27.213  1.00 114.69 ? 123  ARG B NH2   1 
ATOM   5678  N  N     . CYS B 2  124 ? -45.619 -62.044 32.315  1.00 84.15  ? 124  CYS B N     1 
ATOM   5679  C  CA    . CYS B 2  124 ? -45.381 -61.700 33.713  1.00 84.02  ? 124  CYS B CA    1 
ATOM   5680  C  C     . CYS B 2  124 ? -46.424 -62.408 34.554  1.00 82.43  ? 124  CYS B C     1 
ATOM   5681  O  O     . CYS B 2  124 ? -47.612 -62.070 34.497  1.00 79.99  ? 124  CYS B O     1 
ATOM   5682  C  CB    . CYS B 2  124 ? -45.444 -60.196 33.958  1.00 96.91  ? 124  CYS B CB    1 
ATOM   5683  S  SG    . CYS B 2  124 ? -45.327 -59.765 35.728  1.00 115.25 ? 124  CYS B SG    1 
ATOM   5684  N  N     . THR B 2  125 ? -45.979 -63.377 35.337  1.00 85.58  ? 125  THR B N     1 
ATOM   5685  C  CA    . THR B 2  125 ? -46.877 -64.167 36.167  1.00 89.20  ? 125  THR B CA    1 
ATOM   5686  C  C     . THR B 2  125 ? -46.580 -63.937 37.638  1.00 88.12  ? 125  THR B C     1 
ATOM   5687  O  O     . THR B 2  125 ? -45.422 -63.984 38.062  1.00 87.66  ? 125  THR B O     1 
ATOM   5688  C  CB    . THR B 2  125 ? -46.738 -65.653 35.847  1.00 91.14  ? 125  THR B CB    1 
ATOM   5689  O  OG1   . THR B 2  125 ? -45.379 -66.043 36.074  1.00 91.19  ? 125  THR B OG1   1 
ATOM   5690  C  CG2   . THR B 2  125 ? -47.142 -65.954 34.404  1.00 88.37  ? 125  THR B CG2   1 
ATOM   5691  N  N     . GLU B 2  126 ? -47.635 -63.731 38.418  1.00 94.89  ? 126  GLU B N     1 
ATOM   5692  C  CA    . GLU B 2  126 ? -47.488 -63.534 39.848  1.00 94.84  ? 126  GLU B CA    1 
ATOM   5693  C  C     . GLU B 2  126 ? -47.543 -64.884 40.535  1.00 98.39  ? 126  GLU B C     1 
ATOM   5694  O  O     . GLU B 2  126 ? -48.458 -65.674 40.288  1.00 108.65 ? 126  GLU B O     1 
ATOM   5695  C  CB    . GLU B 2  126 ? -48.593 -62.623 40.375  1.00 99.72  ? 126  GLU B CB    1 
ATOM   5696  C  CG    . GLU B 2  126 ? -48.841 -62.708 41.866  1.00 111.58 ? 126  GLU B CG    1 
ATOM   5697  C  CD    . GLU B 2  126 ? -50.196 -62.126 42.266  1.00 117.78 ? 126  GLU B CD    1 
ATOM   5698  O  OE1   . GLU B 2  126 ? -50.905 -61.574 41.384  1.00 108.11 ? 126  GLU B OE1   1 
ATOM   5699  O  OE2   . GLU B 2  126 ? -50.548 -62.227 43.466  1.00 119.32 ? 126  GLU B OE2   1 
ATOM   5700  N  N     . LYS B 2  127 ? -46.583 -65.132 41.419  1.00 100.43 ? 127  LYS B N     1 
ATOM   5701  C  CA    . LYS B 2  127 ? -46.493 -66.390 42.149  1.00 108.26 ? 127  LYS B CA    1 
ATOM   5702  C  C     . LYS B 2  127 ? -46.952 -66.172 43.577  1.00 113.33 ? 127  LYS B C     1 
ATOM   5703  O  O     . LYS B 2  127 ? -46.398 -65.325 44.289  1.00 107.07 ? 127  LYS B O     1 
ATOM   5704  C  CB    . LYS B 2  127 ? -45.072 -66.946 42.132  1.00 109.75 ? 127  LYS B CB    1 
ATOM   5705  C  CG    . LYS B 2  127 ? -44.916 -68.193 41.296  1.00 113.58 ? 127  LYS B CG    1 
ATOM   5706  C  CD    . LYS B 2  127 ? -45.587 -69.390 41.945  1.00 115.55 ? 127  LYS B CD    1 
ATOM   5707  C  CE    . LYS B 2  127 ? -45.509 -70.610 41.037  1.00 136.17 ? 127  LYS B CE    1 
ATOM   5708  N  NZ    . LYS B 2  127 ? -45.781 -71.895 41.753  1.00 143.64 ? 127  LYS B NZ    1 
ATOM   5709  N  N     . ASP B 2  128 ? -47.974 -66.919 43.977  1.00 119.98 ? 128  ASP B N     1 
ATOM   5710  C  CA    . ASP B 2  128 ? -48.434 -66.883 45.353  1.00 120.68 ? 128  ASP B CA    1 
ATOM   5711  C  C     . ASP B 2  128 ? -47.442 -67.628 46.243  1.00 108.73 ? 128  ASP B C     1 
ATOM   5712  O  O     . ASP B 2  128 ? -46.778 -68.577 45.819  1.00 114.09 ? 128  ASP B O     1 
ATOM   5713  C  CB    . ASP B 2  128 ? -49.835 -67.488 45.436  1.00 121.74 ? 128  ASP B CB    1 
ATOM   5714  C  CG    . ASP B 2  128 ? -50.822 -66.777 44.514  1.00 129.47 ? 128  ASP B CG    1 
ATOM   5715  O  OD1   . ASP B 2  128 ? -50.857 -65.526 44.544  1.00 129.82 ? 128  ASP B OD1   1 
ATOM   5716  O  OD2   . ASP B 2  128 ? -51.526 -67.458 43.735  1.00 139.22 ? 128  ASP B OD2   1 
ATOM   5717  N  N     . LEU B 2  129 ? -47.313 -67.159 47.475  1.00 109.52 ? 129  LEU B N     1 
ATOM   5718  C  CA    . LEU B 2  129 ? -46.317 -67.667 48.404  1.00 103.70 ? 129  LEU B CA    1 
ATOM   5719  C  C     . LEU B 2  129 ? -47.014 -67.928 49.733  1.00 102.02 ? 129  LEU B C     1 
ATOM   5720  O  O     . LEU B 2  129 ? -47.761 -67.074 50.224  1.00 107.89 ? 129  LEU B O     1 
ATOM   5721  C  CB    . LEU B 2  129 ? -45.152 -66.673 48.552  1.00 98.61  ? 129  LEU B CB    1 
ATOM   5722  C  CG    . LEU B 2  129 ? -43.747 -67.207 48.828  1.00 99.10  ? 129  LEU B CG    1 
ATOM   5723  C  CD1   . LEU B 2  129 ? -43.327 -68.200 47.767  1.00 99.63  ? 129  LEU B CD1   1 
ATOM   5724  C  CD2   . LEU B 2  129 ? -42.766 -66.048 48.908  1.00 92.96  ? 129  LEU B CD2   1 
ATOM   5725  N  N     . VAL B 2  130 ? -46.813 -69.126 50.281  1.00 104.02 ? 130  VAL B N     1 
ATOM   5726  C  CA    . VAL B 2  130 ? -47.398 -69.536 51.549  1.00 90.23  ? 130  VAL B CA    1 
ATOM   5727  C  C     . VAL B 2  130 ? -46.312 -70.176 52.399  1.00 85.44  ? 130  VAL B C     1 
ATOM   5728  O  O     . VAL B 2  130 ? -45.251 -70.563 51.912  1.00 84.20  ? 130  VAL B O     1 
ATOM   5729  C  CB    . VAL B 2  130 ? -48.591 -70.494 51.357  1.00 90.22  ? 130  VAL B CB    1 
ATOM   5730  C  CG1   . VAL B 2  130 ? -49.764 -69.740 50.738  1.00 98.58  ? 130  VAL B CG1   1 
ATOM   5731  C  CG2   . VAL B 2  130 ? -48.196 -71.663 50.465  1.00 94.92  ? 130  VAL B CG2   1 
ATOM   5732  N  N     . GLY B 2  131 ? -46.576 -70.251 53.690  1.00 81.99  ? 131  GLY B N     1 
ATOM   5733  C  CA    . GLY B 2  131 ? -45.575 -70.768 54.593  1.00 87.17  ? 131  GLY B CA    1 
ATOM   5734  C  C     . GLY B 2  131 ? -44.956 -69.656 55.404  1.00 88.78  ? 131  GLY B C     1 
ATOM   5735  O  O     . GLY B 2  131 ? -45.680 -68.873 56.021  1.00 100.14 ? 131  GLY B O     1 
ATOM   5736  N  N     . ASP B 2  132 ? -43.635 -69.529 55.370  1.00 86.52  ? 132  ASP B N     1 
ATOM   5737  C  CA    . ASP B 2  132 ? -42.959 -68.431 56.055  1.00 88.23  ? 132  ASP B CA    1 
ATOM   5738  C  C     . ASP B 2  132 ? -42.698 -67.311 55.048  1.00 93.79  ? 132  ASP B C     1 
ATOM   5739  O  O     . ASP B 2  132 ? -41.562 -67.063 54.645  1.00 103.17 ? 132  ASP B O     1 
ATOM   5740  C  CB    . ASP B 2  132 ? -41.651 -68.929 56.677  1.00 93.56  ? 132  ASP B CB    1 
ATOM   5741  C  CG    . ASP B 2  132 ? -41.860 -70.043 57.713  1.00 107.38 ? 132  ASP B CG    1 
ATOM   5742  O  OD1   . ASP B 2  132 ? -42.848 -70.004 58.485  1.00 111.70 ? 132  ASP B OD1   1 
ATOM   5743  O  OD2   . ASP B 2  132 ? -41.021 -70.978 57.736  1.00 106.17 ? 132  ASP B OD2   1 
ATOM   5744  N  N     . VAL B 2  133 ? -43.766 -66.616 54.645  1.00 89.21  ? 133  VAL B N     1 
ATOM   5745  C  CA    . VAL B 2  133 ? -43.573 -65.567 53.630  1.00 85.90  ? 133  VAL B CA    1 
ATOM   5746  C  C     . VAL B 2  133 ? -42.725 -64.453 54.223  1.00 86.51  ? 133  VAL B C     1 
ATOM   5747  O  O     . VAL B 2  133 ? -42.953 -64.048 55.373  1.00 94.92  ? 133  VAL B O     1 
ATOM   5748  C  CB    . VAL B 2  133 ? -44.913 -65.026 53.117  1.00 84.79  ? 133  VAL B CB    1 
ATOM   5749  C  CG1   . VAL B 2  133 ? -45.764 -66.130 52.572  1.00 88.47  ? 133  VAL B CG1   1 
ATOM   5750  C  CG2   . VAL B 2  133 ? -45.670 -64.293 54.206  1.00 97.64  ? 133  VAL B CG2   1 
ATOM   5751  N  N     . PRO B 2  134 ? -41.718 -63.970 53.514  1.00 88.11  ? 134  PRO B N     1 
ATOM   5752  C  CA    . PRO B 2  134 ? -40.913 -62.873 54.044  1.00 90.40  ? 134  PRO B CA    1 
ATOM   5753  C  C     . PRO B 2  134 ? -41.677 -61.562 53.940  1.00 101.43 ? 134  PRO B C     1 
ATOM   5754  O  O     . PRO B 2  134 ? -42.331 -61.281 52.929  1.00 100.07 ? 134  PRO B O     1 
ATOM   5755  C  CB    . PRO B 2  134 ? -39.662 -62.900 53.157  1.00 86.49  ? 134  PRO B CB    1 
ATOM   5756  C  CG    . PRO B 2  134 ? -40.103 -63.548 51.900  1.00 91.36  ? 134  PRO B CG    1 
ATOM   5757  C  CD    . PRO B 2  134 ? -41.187 -64.508 52.255  1.00 85.76  ? 134  PRO B CD    1 
ATOM   5758  N  N     . GLU B 2  135 ? -41.588 -60.761 55.009  1.00 97.61  ? 135  GLU B N     1 
ATOM   5759  C  CA    . GLU B 2  135 ? -42.272 -59.479 55.046  1.00 92.95  ? 135  GLU B CA    1 
ATOM   5760  C  C     . GLU B 2  135 ? -41.850 -58.635 53.843  1.00 94.71  ? 135  GLU B C     1 
ATOM   5761  O  O     . GLU B 2  135 ? -40.752 -58.818 53.314  1.00 94.80  ? 135  GLU B O     1 
ATOM   5762  C  CB    . GLU B 2  135 ? -41.964 -58.733 56.347  1.00 101.89 ? 135  GLU B CB    1 
ATOM   5763  C  CG    . GLU B 2  135 ? -40.478 -58.407 56.575  1.00 105.61 ? 135  GLU B CG    1 
ATOM   5764  C  CD    . GLU B 2  135 ? -40.221 -57.556 57.839  1.00 119.12 ? 135  GLU B CD    1 
ATOM   5765  O  OE1   . GLU B 2  135 ? -39.096 -57.622 58.390  1.00 121.85 ? 135  GLU B OE1   1 
ATOM   5766  O  OE2   . GLU B 2  135 ? -41.133 -56.798 58.264  1.00 113.66 ? 135  GLU B OE2   1 
ATOM   5767  N  N     . PRO B 2  136 ? -42.715 -57.732 53.372  1.00 84.06  ? 136  PRO B N     1 
ATOM   5768  C  CA    . PRO B 2  136 ? -42.361 -56.910 52.213  1.00 77.89  ? 136  PRO B CA    1 
ATOM   5769  C  C     . PRO B 2  136 ? -41.044 -56.192 52.453  1.00 75.97  ? 136  PRO B C     1 
ATOM   5770  O  O     . PRO B 2  136 ? -40.722 -55.809 53.575  1.00 75.74  ? 136  PRO B O     1 
ATOM   5771  C  CB    . PRO B 2  136 ? -43.539 -55.942 52.098  1.00 74.42  ? 136  PRO B CB    1 
ATOM   5772  C  CG    . PRO B 2  136 ? -44.680 -56.662 52.716  1.00 73.04  ? 136  PRO B CG    1 
ATOM   5773  C  CD    . PRO B 2  136 ? -44.095 -57.474 53.830  1.00 82.65  ? 136  PRO B CD    1 
ATOM   5774  N  N     . ARG B 2  137 ? -40.237 -56.088 51.406  1.00 82.22  ? 137  ARG B N     1 
ATOM   5775  C  CA    . ARG B 2  137 ? -38.865 -55.629 51.567  1.00 84.67  ? 137  ARG B CA    1 
ATOM   5776  C  C     . ARG B 2  137 ? -38.405 -54.870 50.340  1.00 85.09  ? 137  ARG B C     1 
ATOM   5777  O  O     . ARG B 2  137 ? -38.978 -54.989 49.254  1.00 87.35  ? 137  ARG B O     1 
ATOM   5778  C  CB    . ARG B 2  137 ? -37.876 -56.790 51.745  1.00 93.26  ? 137  ARG B CB    1 
ATOM   5779  C  CG    . ARG B 2  137 ? -38.017 -57.574 52.993  1.00 92.19  ? 137  ARG B CG    1 
ATOM   5780  C  CD    . ARG B 2  137 ? -37.549 -58.974 52.771  1.00 81.31  ? 137  ARG B CD    1 
ATOM   5781  N  NE    . ARG B 2  137 ? -37.912 -59.760 53.936  1.00 96.75  ? 137  ARG B NE    1 
ATOM   5782  C  CZ    . ARG B 2  137 ? -37.022 -60.325 54.737  1.00 99.49  ? 137  ARG B CZ    1 
ATOM   5783  N  NH1   . ARG B 2  137 ? -35.730 -60.191 54.456  1.00 92.40  ? 137  ARG B NH1   1 
ATOM   5784  N  NH2   . ARG B 2  137 ? -37.418 -61.026 55.800  1.00 92.98  ? 137  ARG B NH2   1 
ATOM   5785  N  N     . TYR B 2  138 ? -37.332 -54.111 50.521  1.00 75.47  ? 138  TYR B N     1 
ATOM   5786  C  CA    . TYR B 2  138 ? -36.549 -53.675 49.386  1.00 75.58  ? 138  TYR B CA    1 
ATOM   5787  C  C     . TYR B 2  138 ? -35.089 -53.840 49.764  1.00 73.20  ? 138  TYR B C     1 
ATOM   5788  O  O     . TYR B 2  138 ? -34.756 -54.111 50.922  1.00 63.95  ? 138  TYR B O     1 
ATOM   5789  C  CB    . TYR B 2  138 ? -36.888 -52.241 48.951  1.00 83.10  ? 138  TYR B CB    1 
ATOM   5790  C  CG    . TYR B 2  138 ? -36.502 -51.139 49.917  1.00 92.39  ? 138  TYR B CG    1 
ATOM   5791  C  CD1   . TYR B 2  138 ? -37.335 -50.765 50.961  1.00 78.29  ? 138  TYR B CD1   1 
ATOM   5792  C  CD2   . TYR B 2  138 ? -35.292 -50.467 49.775  1.00 94.04  ? 138  TYR B CD2   1 
ATOM   5793  C  CE1   . TYR B 2  138 ? -36.961 -49.746 51.836  1.00 76.44  ? 138  TYR B CE1   1 
ATOM   5794  C  CE2   . TYR B 2  138 ? -34.919 -49.467 50.639  1.00 78.55  ? 138  TYR B CE2   1 
ATOM   5795  C  CZ    . TYR B 2  138 ? -35.753 -49.103 51.658  1.00 80.40  ? 138  TYR B CZ    1 
ATOM   5796  O  OH    . TYR B 2  138 ? -35.357 -48.091 52.497  1.00 99.54  ? 138  TYR B OH    1 
ATOM   5797  N  N     . GLY B 2  139 ? -34.226 -53.754 48.758  1.00 76.64  ? 139  GLY B N     1 
ATOM   5798  C  CA    . GLY B 2  139 ? -32.796 -53.791 49.001  1.00 74.88  ? 139  GLY B CA    1 
ATOM   5799  C  C     . GLY B 2  139 ? -32.294 -55.100 49.561  1.00 77.47  ? 139  GLY B C     1 
ATOM   5800  O  O     . GLY B 2  139 ? -31.396 -55.098 50.408  1.00 85.06  ? 139  GLY B O     1 
ATOM   5801  N  N     . HIS B 2  140 ? -32.862 -56.218 49.114  1.00 86.96  ? 140  HIS B N     1 
ATOM   5802  C  CA    . HIS B 2  140 ? -32.558 -57.562 49.596  1.00 83.42  ? 140  HIS B CA    1 
ATOM   5803  C  C     . HIS B 2  140 ? -32.152 -58.433 48.421  1.00 89.75  ? 140  HIS B C     1 
ATOM   5804  O  O     . HIS B 2  140 ? -32.413 -58.108 47.264  1.00 106.35 ? 140  HIS B O     1 
ATOM   5805  C  CB    . HIS B 2  140 ? -33.760 -58.195 50.309  1.00 83.48  ? 140  HIS B CB    1 
ATOM   5806  C  CG    . HIS B 2  140 ? -35.001 -58.283 49.469  1.00 87.55  ? 140  HIS B CG    1 
ATOM   5807  N  ND1   . HIS B 2  140 ? -35.577 -57.181 48.875  1.00 95.67  ? 140  HIS B ND1   1 
ATOM   5808  C  CD2   . HIS B 2  140 ? -35.807 -59.327 49.170  1.00 88.77  ? 140  HIS B CD2   1 
ATOM   5809  C  CE1   . HIS B 2  140 ? -36.667 -57.544 48.225  1.00 88.33  ? 140  HIS B CE1   1 
ATOM   5810  N  NE2   . HIS B 2  140 ? -36.828 -58.842 48.387  1.00 84.50  ? 140  HIS B NE2   1 
ATOM   5811  N  N     . SER B 2  141 ? -31.562 -59.580 48.716  1.00 96.71  ? 141  SER B N     1 
ATOM   5812  C  CA    . SER B 2  141 ? -31.059 -60.437 47.656  1.00 100.02 ? 141  SER B CA    1 
ATOM   5813  C  C     . SER B 2  141 ? -31.895 -61.700 47.522  1.00 94.85  ? 141  SER B C     1 
ATOM   5814  O  O     . SER B 2  141 ? -32.453 -62.214 48.493  1.00 88.54  ? 141  SER B O     1 
ATOM   5815  C  CB    . SER B 2  141 ? -29.592 -60.807 47.890  1.00 97.29  ? 141  SER B CB    1 
ATOM   5816  O  OG    . SER B 2  141 ? -29.373 -61.165 49.240  1.00 97.74  ? 141  SER B OG    1 
ATOM   5817  N  N     . ILE B 2  142 ? -31.965 -62.192 46.294  1.00 95.37  ? 142  ILE B N     1 
ATOM   5818  C  CA    . ILE B 2  142 ? -32.546 -63.493 46.005  1.00 93.88  ? 142  ILE B CA    1 
ATOM   5819  C  C     . ILE B 2  142 ? -31.724 -64.112 44.887  1.00 96.77  ? 142  ILE B C     1 
ATOM   5820  O  O     . ILE B 2  142 ? -31.298 -63.421 43.955  1.00 102.12 ? 142  ILE B O     1 
ATOM   5821  C  CB    . ILE B 2  142 ? -34.045 -63.394 45.631  1.00 87.84  ? 142  ILE B CB    1 
ATOM   5822  C  CG1   . ILE B 2  142 ? -34.743 -64.733 45.805  1.00 87.79  ? 142  ILE B CG1   1 
ATOM   5823  C  CG2   . ILE B 2  142 ? -34.244 -62.976 44.192  1.00 87.13  ? 142  ILE B CG2   1 
ATOM   5824  C  CD1   . ILE B 2  142 ? -36.157 -64.709 45.274  1.00 89.47  ? 142  ILE B CD1   1 
ATOM   5825  N  N     . ASP B 2  143 ? -31.423 -65.397 45.039  1.00 98.49  ? 143  ASP B N     1 
ATOM   5826  C  CA    . ASP B 2  143 ? -30.671 -66.153 44.052  1.00 100.56 ? 143  ASP B CA    1 
ATOM   5827  C  C     . ASP B 2  143 ? -31.221 -67.568 44.024  1.00 100.19 ? 143  ASP B C     1 
ATOM   5828  O  O     . ASP B 2  143 ? -32.006 -67.955 44.886  1.00 101.99 ? 143  ASP B O     1 
ATOM   5829  C  CB    . ASP B 2  143 ? -29.175 -66.151 44.374  1.00 101.94 ? 143  ASP B CB    1 
ATOM   5830  C  CG    . ASP B 2  143 ? -28.593 -64.750 44.429  1.00 115.41 ? 143  ASP B CG    1 
ATOM   5831  O  OD1   . ASP B 2  143 ? -28.663 -64.133 45.518  1.00 122.21 ? 143  ASP B OD1   1 
ATOM   5832  O  OD2   . ASP B 2  143 ? -28.083 -64.257 43.389  1.00 113.63 ? 143  ASP B OD2   1 
ATOM   5833  N  N     . VAL B 2  144 ? -30.806 -68.352 43.029  1.00 102.10 ? 144  VAL B N     1 
ATOM   5834  C  CA    . VAL B 2  144 ? -31.227 -69.746 42.897  1.00 86.11  ? 144  VAL B CA    1 
ATOM   5835  C  C     . VAL B 2  144 ? -30.020 -70.631 43.142  1.00 87.52  ? 144  VAL B C     1 
ATOM   5836  O  O     . VAL B 2  144 ? -28.935 -70.365 42.614  1.00 99.31  ? 144  VAL B O     1 
ATOM   5837  C  CB    . VAL B 2  144 ? -31.840 -70.051 41.521  1.00 81.75  ? 144  VAL B CB    1 
ATOM   5838  C  CG1   . VAL B 2  144 ? -32.139 -71.525 41.409  1.00 91.06  ? 144  VAL B CG1   1 
ATOM   5839  C  CG2   . VAL B 2  144 ? -33.101 -69.253 41.314  1.00 91.96  ? 144  VAL B CG2   1 
ATOM   5840  N  N     . VAL B 2  145 ? -30.196 -71.650 43.977  1.00 91.79  ? 145  VAL B N     1 
ATOM   5841  C  CA    . VAL B 2  145 ? -29.178 -72.663 44.220  1.00 100.82 ? 145  VAL B CA    1 
ATOM   5842  C  C     . VAL B 2  145 ? -29.665 -73.991 43.667  1.00 106.37 ? 145  VAL B C     1 
ATOM   5843  O  O     . VAL B 2  145 ? -30.873 -74.259 43.594  1.00 110.68 ? 145  VAL B O     1 
ATOM   5844  C  CB    . VAL B 2  145 ? -28.827 -72.819 45.714  1.00 93.62  ? 145  VAL B CB    1 
ATOM   5845  C  CG1   . VAL B 2  145 ? -28.164 -71.564 46.237  1.00 97.17  ? 145  VAL B CG1   1 
ATOM   5846  C  CG2   . VAL B 2  145 ? -30.074 -73.167 46.507  1.00 91.64  ? 145  VAL B CG2   1 
ATOM   5847  N  N     . TYR B 2  146 ? -28.706 -74.836 43.294  1.00 105.61 ? 146  TYR B N     1 
ATOM   5848  C  CA    . TYR B 2  146 ? -28.978 -76.169 42.781  1.00 106.65 ? 146  TYR B CA    1 
ATOM   5849  C  C     . TYR B 2  146 ? -28.237 -77.163 43.658  1.00 114.22 ? 146  TYR B C     1 
ATOM   5850  O  O     . TYR B 2  146 ? -27.012 -77.085 43.800  1.00 120.64 ? 146  TYR B O     1 
ATOM   5851  C  CB    . TYR B 2  146 ? -28.548 -76.307 41.326  1.00 106.62 ? 146  TYR B CB    1 
ATOM   5852  C  CG    . TYR B 2  146 ? -29.233 -75.337 40.413  1.00 103.09 ? 146  TYR B CG    1 
ATOM   5853  C  CD1   . TYR B 2  146 ? -28.743 -74.053 40.221  1.00 98.34  ? 146  TYR B CD1   1 
ATOM   5854  C  CD2   . TYR B 2  146 ? -30.405 -75.696 39.773  1.00 110.84 ? 146  TYR B CD2   1 
ATOM   5855  C  CE1   . TYR B 2  146 ? -29.396 -73.165 39.373  1.00 105.14 ? 146  TYR B CE1   1 
ATOM   5856  C  CE2   . TYR B 2  146 ? -31.061 -74.827 38.936  1.00 103.00 ? 146  TYR B CE2   1 
ATOM   5857  C  CZ    . TYR B 2  146 ? -30.562 -73.567 38.735  1.00 99.69  ? 146  TYR B CZ    1 
ATOM   5858  O  OH    . TYR B 2  146 ? -31.264 -72.734 37.887  1.00 101.17 ? 146  TYR B OH    1 
ATOM   5859  N  N     . SER B 2  147 ? -28.982 -78.084 44.253  1.00 113.70 ? 147  SER B N     1 
ATOM   5860  C  CA    . SER B 2  147 ? -28.411 -79.092 45.130  1.00 117.07 ? 147  SER B CA    1 
ATOM   5861  C  C     . SER B 2  147 ? -29.151 -80.397 44.903  1.00 117.25 ? 147  SER B C     1 
ATOM   5862  O  O     . SER B 2  147 ? -30.385 -80.423 44.945  1.00 114.57 ? 147  SER B O     1 
ATOM   5863  C  CB    . SER B 2  147 ? -28.507 -78.647 46.593  1.00 120.01 ? 147  SER B CB    1 
ATOM   5864  O  OG    . SER B 2  147 ? -28.105 -79.666 47.485  1.00 125.30 ? 147  SER B OG    1 
ATOM   5865  N  N     . ARG B 2  148 ? -28.393 -81.463 44.641  1.00 118.18 ? 148  ARG B N     1 
ATOM   5866  C  CA    . ARG B 2  148 ? -28.949 -82.805 44.474  1.00 126.23 ? 148  ARG B CA    1 
ATOM   5867  C  C     . ARG B 2  148 ? -30.077 -82.805 43.443  1.00 122.24 ? 148  ARG B C     1 
ATOM   5868  O  O     . ARG B 2  148 ? -31.210 -83.220 43.709  1.00 115.60 ? 148  ARG B O     1 
ATOM   5869  C  CB    . ARG B 2  148 ? -29.383 -83.409 45.820  1.00 130.19 ? 148  ARG B CB    1 
ATOM   5870  C  CG    . ARG B 2  148 ? -28.177 -83.748 46.721  1.00 128.01 ? 148  ARG B CG    1 
ATOM   5871  C  CD    . ARG B 2  148 ? -28.526 -84.485 48.021  1.00 122.43 ? 148  ARG B CD    1 
ATOM   5872  N  NE    . ARG B 2  148 ? -27.398 -84.472 48.956  1.00 127.57 ? 148  ARG B NE    1 
ATOM   5873  C  CZ    . ARG B 2  148 ? -26.384 -85.337 48.910  1.00 135.77 ? 148  ARG B CZ    1 
ATOM   5874  N  NH1   . ARG B 2  148 ? -25.394 -85.258 49.793  1.00 133.76 ? 148  ARG B NH1   1 
ATOM   5875  N  NH2   . ARG B 2  148 ? -26.354 -86.282 47.971  1.00 131.20 ? 148  ARG B NH2   1 
ATOM   5876  N  N     . GLY B 2  149 ? -29.766 -82.248 42.270  1.00 115.27 ? 149  GLY B N     1 
ATOM   5877  C  CA    . GLY B 2  149 ? -30.708 -82.214 41.171  1.00 115.34 ? 149  GLY B CA    1 
ATOM   5878  C  C     . GLY B 2  149 ? -31.940 -81.393 41.442  1.00 119.83 ? 149  GLY B C     1 
ATOM   5879  O  O     . GLY B 2  149 ? -32.963 -81.595 40.789  1.00 116.59 ? 149  GLY B O     1 
ATOM   5880  N  N     . LYS B 2  150 ? -31.886 -80.502 42.427  1.00 127.35 ? 150  LYS B N     1 
ATOM   5881  C  CA    . LYS B 2  150 ? -33.038 -79.723 42.840  1.00 115.87 ? 150  LYS B CA    1 
ATOM   5882  C  C     . LYS B 2  150 ? -32.711 -78.235 42.826  1.00 117.30 ? 150  LYS B C     1 
ATOM   5883  O  O     . LYS B 2  150 ? -31.576 -77.832 43.090  1.00 113.89 ? 150  LYS B O     1 
ATOM   5884  C  CB    . LYS B 2  150 ? -33.443 -80.160 44.231  1.00 117.35 ? 150  LYS B CB    1 
ATOM   5885  C  CG    . LYS B 2  150 ? -33.905 -81.606 44.290  1.00 119.26 ? 150  LYS B CG    1 
ATOM   5886  C  CD    . LYS B 2  150 ? -34.335 -81.963 45.704  1.00 129.13 ? 150  LYS B CD    1 
ATOM   5887  C  CE    . LYS B 2  150 ? -34.827 -83.386 45.815  1.00 128.70 ? 150  LYS B CE    1 
ATOM   5888  N  NZ    . LYS B 2  150 ? -35.262 -83.617 47.196  1.00 130.97 ? 150  LYS B NZ    1 
ATOM   5889  N  N     . SER B 2  151 ? -33.722 -77.416 42.540  1.00 118.35 ? 151  SER B N     1 
ATOM   5890  C  CA    . SER B 2  151 ? -33.580 -75.966 42.494  1.00 111.72 ? 151  SER B CA    1 
ATOM   5891  C  C     . SER B 2  151 ? -34.366 -75.331 43.637  1.00 107.34 ? 151  SER B C     1 
ATOM   5892  O  O     . SER B 2  151 ? -35.515 -75.706 43.894  1.00 104.98 ? 151  SER B O     1 
ATOM   5893  C  CB    . SER B 2  151 ? -34.069 -75.415 41.152  1.00 107.99 ? 151  SER B CB    1 
ATOM   5894  O  OG    . SER B 2  151 ? -35.473 -75.568 41.043  1.00 108.85 ? 151  SER B OG    1 
ATOM   5895  N  N     . MET B 2  152 ? -33.741 -74.369 44.323  1.00 102.53 ? 152  MET B N     1 
ATOM   5896  C  CA    . MET B 2  152 ? -34.369 -73.681 45.444  1.00 101.13 ? 152  MET B CA    1 
ATOM   5897  C  C     . MET B 2  152 ? -33.942 -72.221 45.452  1.00 100.07 ? 152  MET B C     1 
ATOM   5898  O  O     . MET B 2  152 ? -32.791 -71.902 45.148  1.00 101.30 ? 152  MET B O     1 
ATOM   5899  C  CB    . MET B 2  152 ? -33.983 -74.320 46.783  1.00 110.45 ? 152  MET B CB    1 
ATOM   5900  C  CG    . MET B 2  152 ? -34.824 -73.861 47.958  1.00 101.82 ? 152  MET B CG    1 
ATOM   5901  S  SD    . MET B 2  152 ? -36.485 -74.535 47.825  1.00 96.87  ? 152  MET B SD    1 
ATOM   5902  C  CE    . MET B 2  152 ? -36.181 -76.293 47.663  1.00 118.82 ? 152  MET B CE    1 
ATOM   5903  N  N     . GLY B 2  153 ? -34.849 -71.334 45.861  1.00 98.98  ? 153  GLY B N     1 
ATOM   5904  C  CA    . GLY B 2  153 ? -34.529 -69.927 45.959  1.00 93.50  ? 153  GLY B CA    1 
ATOM   5905  C  C     . GLY B 2  153 ? -34.079 -69.566 47.367  1.00 98.35  ? 153  GLY B C     1 
ATOM   5906  O  O     . GLY B 2  153 ? -34.650 -70.021 48.348  1.00 101.69 ? 153  GLY B O     1 
ATOM   5907  N  N     . VAL B 2  154 ? -33.048 -68.728 47.444  1.00 97.56  ? 154  VAL B N     1 
ATOM   5908  C  CA    . VAL B 2  154 ? -32.508 -68.211 48.692  1.00 85.95  ? 154  VAL B CA    1 
ATOM   5909  C  C     . VAL B 2  154 ? -32.681 -66.699 48.690  1.00 92.41  ? 154  VAL B C     1 
ATOM   5910  O  O     . VAL B 2  154 ? -32.184 -66.019 47.784  1.00 107.01 ? 154  VAL B O     1 
ATOM   5911  C  CB    . VAL B 2  154 ? -31.023 -68.574 48.837  1.00 87.10  ? 154  VAL B CB    1 
ATOM   5912  C  CG1   . VAL B 2  154 ? -30.430 -67.851 50.017  1.00 96.79  ? 154  VAL B CG1   1 
ATOM   5913  C  CG2   . VAL B 2  154 ? -30.860 -70.063 48.954  1.00 93.00  ? 154  VAL B CG2   1 
ATOM   5914  N  N     . LEU B 2  155 ? -33.313 -66.167 49.736  1.00 94.65  ? 155  LEU B N     1 
ATOM   5915  C  CA    . LEU B 2  155 ? -33.601 -64.738 49.851  1.00 86.38  ? 155  LEU B CA    1 
ATOM   5916  C  C     . LEU B 2  155 ? -33.122 -64.242 51.207  1.00 79.14  ? 155  LEU B C     1 
ATOM   5917  O  O     . LEU B 2  155 ? -33.376 -64.880 52.233  1.00 85.11  ? 155  LEU B O     1 
ATOM   5918  C  CB    . LEU B 2  155 ? -35.104 -64.464 49.661  1.00 83.99  ? 155  LEU B CB    1 
ATOM   5919  C  CG    . LEU B 2  155 ? -35.754 -63.099 49.905  1.00 73.30  ? 155  LEU B CG    1 
ATOM   5920  C  CD1   . LEU B 2  155 ? -37.061 -62.997 49.140  1.00 73.82  ? 155  LEU B CD1   1 
ATOM   5921  C  CD2   . LEU B 2  155 ? -36.031 -62.877 51.373  1.00 75.24  ? 155  LEU B CD2   1 
ATOM   5922  N  N     . PHE B 2  156 ? -32.442 -63.102 51.214  1.00 82.20  ? 156  PHE B N     1 
ATOM   5923  C  CA    . PHE B 2  156 ? -31.878 -62.612 52.459  1.00 84.74  ? 156  PHE B CA    1 
ATOM   5924  C  C     . PHE B 2  156 ? -31.779 -61.092 52.485  1.00 95.03  ? 156  PHE B C     1 
ATOM   5925  O  O     . PHE B 2  156 ? -31.405 -60.446 51.494  1.00 91.81  ? 156  PHE B O     1 
ATOM   5926  C  CB    . PHE B 2  156 ? -30.506 -63.241 52.685  1.00 81.39  ? 156  PHE B CB    1 
ATOM   5927  C  CG    . PHE B 2  156 ? -29.736 -62.620 53.785  1.00 89.10  ? 156  PHE B CG    1 
ATOM   5928  C  CD1   . PHE B 2  156 ? -30.090 -62.860 55.100  1.00 91.09  ? 156  PHE B CD1   1 
ATOM   5929  C  CD2   . PHE B 2  156 ? -28.631 -61.843 53.515  1.00 82.33  ? 156  PHE B CD2   1 
ATOM   5930  C  CE1   . PHE B 2  156 ? -29.377 -62.308 56.137  1.00 96.57  ? 156  PHE B CE1   1 
ATOM   5931  C  CE2   . PHE B 2  156 ? -27.908 -61.284 54.540  1.00 87.10  ? 156  PHE B CE2   1 
ATOM   5932  C  CZ    . PHE B 2  156 ? -28.274 -61.516 55.856  1.00 96.48  ? 156  PHE B CZ    1 
ATOM   5933  N  N     . GLY B 2  157 ? -32.063 -60.543 53.658  1.00 96.88  ? 157  GLY B N     1 
ATOM   5934  C  CA    . GLY B 2  157 ? -31.761 -59.160 53.929  1.00 95.98  ? 157  GLY B CA    1 
ATOM   5935  C  C     . GLY B 2  157 ? -32.864 -58.192 53.567  1.00 95.04  ? 157  GLY B C     1 
ATOM   5936  O  O     . GLY B 2  157 ? -34.040 -58.540 53.367  1.00 90.82  ? 157  GLY B O     1 
ATOM   5937  N  N     . GLY B 2  158 ? -32.475 -56.925 53.596  1.00 92.85  ? 158  GLY B N     1 
ATOM   5938  C  CA    . GLY B 2  158 ? -33.307 -55.850 53.118  1.00 88.80  ? 158  GLY B CA    1 
ATOM   5939  C  C     . GLY B 2  158 ? -33.828 -55.001 54.261  1.00 87.28  ? 158  GLY B C     1 
ATOM   5940  O  O     . GLY B 2  158 ? -33.404 -55.101 55.419  1.00 88.90  ? 158  GLY B O     1 
ATOM   5941  N  N     . ARG B 2  159 ? -34.787 -54.154 53.907  1.00 81.58  ? 159  ARG B N     1 
ATOM   5942  C  CA    . ARG B 2  159 ? -35.395 -53.239 54.853  1.00 82.54  ? 159  ARG B CA    1 
ATOM   5943  C  C     . ARG B 2  159 ? -36.890 -53.189 54.627  1.00 78.87  ? 159  ARG B C     1 
ATOM   5944  O  O     . ARG B 2  159 ? -37.391 -53.510 53.547  1.00 80.99  ? 159  ARG B O     1 
ATOM   5945  C  CB    . ARG B 2  159 ? -34.843 -51.825 54.709  1.00 86.89  ? 159  ARG B CB    1 
ATOM   5946  C  CG    . ARG B 2  159 ? -33.436 -51.635 55.180  1.00 90.41  ? 159  ARG B CG    1 
ATOM   5947  C  CD    . ARG B 2  159 ? -32.770 -50.420 54.536  1.00 88.38  ? 159  ARG B CD    1 
ATOM   5948  N  NE    . ARG B 2  159 ? -31.333 -50.518 54.756  1.00 100.56 ? 159  ARG B NE    1 
ATOM   5949  C  CZ    . ARG B 2  159 ? -30.463 -49.519 54.653  1.00 113.81 ? 159  ARG B CZ    1 
ATOM   5950  N  NH1   . ARG B 2  159 ? -30.862 -48.289 54.332  1.00 113.84 ? 159  ARG B NH1   1 
ATOM   5951  N  NH2   . ARG B 2  159 ? -29.180 -49.761 54.890  1.00 117.16 ? 159  ARG B NH2   1 
ATOM   5952  N  N     . SER B 2  160 ? -37.585 -52.731 55.660  1.00 78.94  ? 160  SER B N     1 
ATOM   5953  C  CA    . SER B 2  160 ? -39.033 -52.603 55.597  1.00 78.37  ? 160  SER B CA    1 
ATOM   5954  C  C     . SER B 2  160 ? -39.468 -51.507 56.558  1.00 81.12  ? 160  SER B C     1 
ATOM   5955  O  O     . SER B 2  160 ? -38.680 -51.033 57.381  1.00 87.51  ? 160  SER B O     1 
ATOM   5956  C  CB    . SER B 2  160 ? -39.693 -53.944 55.917  1.00 85.86  ? 160  SER B CB    1 
ATOM   5957  O  OG    . SER B 2  160 ? -39.441 -54.331 57.260  1.00 87.17  ? 160  SER B OG    1 
ATOM   5958  N  N     . TYR B 2  161 ? -40.744 -51.129 56.474  1.00 71.71  ? 161  TYR B N     1 
ATOM   5959  C  CA    . TYR B 2  161 ? -41.229 -50.140 57.422  1.00 85.31  ? 161  TYR B CA    1 
ATOM   5960  C  C     . TYR B 2  161 ? -41.409 -50.798 58.786  1.00 91.84  ? 161  TYR B C     1 
ATOM   5961  O  O     . TYR B 2  161 ? -41.227 -52.007 58.952  1.00 96.33  ? 161  TYR B O     1 
ATOM   5962  C  CB    . TYR B 2  161 ? -42.531 -49.485 56.941  1.00 94.54  ? 161  TYR B CB    1 
ATOM   5963  C  CG    . TYR B 2  161 ? -42.373 -48.747 55.634  1.00 87.32  ? 161  TYR B CG    1 
ATOM   5964  C  CD1   . TYR B 2  161 ? -41.309 -47.889 55.442  1.00 81.98  ? 161  TYR B CD1   1 
ATOM   5965  C  CD2   . TYR B 2  161 ? -43.293 -48.891 54.601  1.00 83.21  ? 161  TYR B CD2   1 
ATOM   5966  C  CE1   . TYR B 2  161 ? -41.135 -47.219 54.246  1.00 82.31  ? 161  TYR B CE1   1 
ATOM   5967  C  CE2   . TYR B 2  161 ? -43.134 -48.212 53.395  1.00 81.15  ? 161  TYR B CE2   1 
ATOM   5968  C  CZ    . TYR B 2  161 ? -42.044 -47.377 53.227  1.00 80.49  ? 161  TYR B CZ    1 
ATOM   5969  O  OH    . TYR B 2  161 ? -41.833 -46.677 52.061  1.00 87.08  ? 161  TYR B OH    1 
ATOM   5970  N  N     . MET B 2  162 ? -41.730 -49.987 59.784  1.00 90.55  ? 162  MET B N     1 
ATOM   5971  C  CA    . MET B 2  162 ? -41.986 -50.542 61.103  1.00 98.16  ? 162  MET B CA    1 
ATOM   5972  C  C     . MET B 2  162 ? -43.239 -51.424 61.079  1.00 97.86  ? 162  MET B C     1 
ATOM   5973  O  O     . MET B 2  162 ? -44.100 -51.279 60.201  1.00 94.16  ? 162  MET B O     1 
ATOM   5974  C  CB    . MET B 2  162 ? -42.130 -49.422 62.130  1.00 102.71 ? 162  MET B CB    1 
ATOM   5975  C  CG    . MET B 2  162 ? -40.981 -48.423 62.128  1.00 106.35 ? 162  MET B CG    1 
ATOM   5976  S  SD    . MET B 2  162 ? -39.381 -49.060 62.705  1.00 111.95 ? 162  MET B SD    1 
ATOM   5977  C  CE    . MET B 2  162 ? -38.448 -47.528 62.863  1.00 102.16 ? 162  MET B CE    1 
ATOM   5978  N  N     . PRO B 2  163 ? -43.340 -52.379 62.001  1.00 97.81  ? 163  PRO B N     1 
ATOM   5979  C  CA    . PRO B 2  163 ? -44.536 -53.222 62.055  1.00 94.29  ? 163  PRO B CA    1 
ATOM   5980  C  C     . PRO B 2  163 ? -45.747 -52.395 62.433  1.00 105.85 ? 163  PRO B C     1 
ATOM   5981  O  O     . PRO B 2  163 ? -45.635 -51.391 63.140  1.00 111.37 ? 163  PRO B O     1 
ATOM   5982  C  CB    . PRO B 2  163 ? -44.205 -54.243 63.146  1.00 109.28 ? 163  PRO B CB    1 
ATOM   5983  C  CG    . PRO B 2  163 ? -42.721 -54.058 63.430  1.00 113.76 ? 163  PRO B CG    1 
ATOM   5984  C  CD    . PRO B 2  163 ? -42.438 -52.641 63.130  1.00 92.30  ? 163  PRO B CD    1 
ATOM   5985  N  N     . SER B 2  164 ? -46.924 -52.858 61.994  1.00 110.91 ? 164  SER B N     1 
ATOM   5986  C  CA    . SER B 2  164 ? -48.157 -52.083 62.145  1.00 111.62 ? 164  SER B CA    1 
ATOM   5987  C  C     . SER B 2  164 ? -48.419 -51.649 63.584  1.00 105.00 ? 164  SER B C     1 
ATOM   5988  O  O     . SER B 2  164 ? -49.120 -50.653 63.803  1.00 101.12 ? 164  SER B O     1 
ATOM   5989  C  CB    . SER B 2  164 ? -49.350 -52.901 61.644  1.00 108.88 ? 164  SER B CB    1 
ATOM   5990  O  OG    . SER B 2  164 ? -49.127 -53.395 60.333  1.00 119.18 ? 164  SER B OG    1 
ATOM   5991  N  N     . THR B 2  165 ? -47.844 -52.358 64.561  1.00 112.56 ? 165  THR B N     1 
ATOM   5992  C  CA    . THR B 2  165 ? -48.036 -52.042 65.973  1.00 117.01 ? 165  THR B CA    1 
ATOM   5993  C  C     . THR B 2  165 ? -47.232 -50.816 66.389  1.00 110.26 ? 165  THR B C     1 
ATOM   5994  O  O     . THR B 2  165 ? -47.755 -49.934 67.075  1.00 107.28 ? 165  THR B O     1 
ATOM   5995  C  CB    . THR B 2  165 ? -47.616 -53.244 66.839  1.00 115.81 ? 165  THR B CB    1 
ATOM   5996  O  OG1   . THR B 2  165 ? -48.311 -54.423 66.414  1.00 118.61 ? 165  THR B OG1   1 
ATOM   5997  C  CG2   . THR B 2  165 ? -47.901 -52.992 68.325  1.00 122.52 ? 165  THR B CG2   1 
ATOM   5998  N  N     . GLN B 2  166 ? -45.979 -50.723 65.950  1.00 109.12 ? 166  GLN B N     1 
ATOM   5999  C  CA    . GLN B 2  166 ? -45.079 -49.665 66.391  1.00 110.52 ? 166  GLN B CA    1 
ATOM   6000  C  C     . GLN B 2  166 ? -45.013 -48.466 65.447  1.00 110.06 ? 166  GLN B C     1 
ATOM   6001  O  O     . GLN B 2  166 ? -44.461 -47.428 65.830  1.00 104.91 ? 166  GLN B O     1 
ATOM   6002  C  CB    . GLN B 2  166 ? -43.674 -50.237 66.581  1.00 108.85 ? 166  GLN B CB    1 
ATOM   6003  C  CG    . GLN B 2  166 ? -43.612 -51.290 67.653  1.00 115.79 ? 166  GLN B CG    1 
ATOM   6004  C  CD    . GLN B 2  166 ? -42.398 -52.153 67.506  1.00 125.50 ? 166  GLN B CD    1 
ATOM   6005  O  OE1   . GLN B 2  166 ? -41.317 -51.663 67.186  1.00 124.99 ? 166  GLN B OE1   1 
ATOM   6006  N  NE2   . GLN B 2  166 ? -42.567 -53.455 67.712  1.00 130.43 ? 166  GLN B NE2   1 
ATOM   6007  N  N     . ARG B 2  167 ? -45.532 -48.584 64.227  1.00 107.62 ? 167  ARG B N     1 
ATOM   6008  C  CA    . ARG B 2  167 ? -45.413 -47.508 63.250  1.00 96.26  ? 167  ARG B CA    1 
ATOM   6009  C  C     . ARG B 2  167 ? -46.279 -46.316 63.637  1.00 96.00  ? 167  ARG B C     1 
ATOM   6010  O  O     . ARG B 2  167 ? -47.473 -46.468 63.919  1.00 98.21  ? 167  ARG B O     1 
ATOM   6011  C  CB    . ARG B 2  167 ? -45.820 -48.018 61.874  1.00 94.51  ? 167  ARG B CB    1 
ATOM   6012  C  CG    . ARG B 2  167 ? -45.542 -47.088 60.734  1.00 84.93  ? 167  ARG B CG    1 
ATOM   6013  C  CD    . ARG B 2  167 ? -46.058 -47.715 59.477  1.00 81.79  ? 167  ARG B CD    1 
ATOM   6014  N  NE    . ARG B 2  167 ? -45.572 -47.076 58.267  1.00 81.13  ? 167  ARG B NE    1 
ATOM   6015  C  CZ    . ARG B 2  167 ? -45.896 -47.499 57.053  1.00 86.46  ? 167  ARG B CZ    1 
ATOM   6016  N  NH1   . ARG B 2  167 ? -46.706 -48.537 56.933  1.00 100.27 ? 167  ARG B NH1   1 
ATOM   6017  N  NH2   . ARG B 2  167 ? -45.423 -46.903 55.967  1.00 87.78  ? 167  ARG B NH2   1 
ATOM   6018  N  N     . THR B 2  168 ? -45.694 -45.118 63.593  1.00 95.78  ? 168  THR B N     1 
ATOM   6019  C  CA    . THR B 2  168 ? -46.408 -43.886 63.903  1.00 97.58  ? 168  THR B CA    1 
ATOM   6020  C  C     . THR B 2  168 ? -46.202 -42.843 62.800  1.00 92.47  ? 168  THR B C     1 
ATOM   6021  O  O     . THR B 2  168 ? -45.148 -42.786 62.158  1.00 87.68  ? 168  THR B O     1 
ATOM   6022  C  CB    . THR B 2  168 ? -45.967 -43.337 65.263  1.00 97.97  ? 168  THR B CB    1 
ATOM   6023  O  OG1   . THR B 2  168 ? -46.637 -42.097 65.522  1.00 103.73 ? 168  THR B OG1   1 
ATOM   6024  C  CG2   . THR B 2  168 ? -44.459 -43.138 65.300  1.00 92.85  ? 168  THR B CG2   1 
ATOM   6025  N  N     . THR B 2  169 ? -47.230 -42.005 62.599  1.00 86.51  ? 169  THR B N     1 
ATOM   6026  C  CA    . THR B 2  169 ? -47.276 -41.093 61.452  1.00 88.97  ? 169  THR B CA    1 
ATOM   6027  C  C     . THR B 2  169 ? -46.143 -40.066 61.460  1.00 88.85  ? 169  THR B C     1 
ATOM   6028  O  O     . THR B 2  169 ? -45.824 -39.488 60.413  1.00 82.98  ? 169  THR B O     1 
ATOM   6029  C  CB    . THR B 2  169 ? -48.625 -40.379 61.398  1.00 83.81  ? 169  THR B CB    1 
ATOM   6030  O  OG1   . THR B 2  169 ? -48.819 -39.629 62.599  1.00 94.61  ? 169  THR B OG1   1 
ATOM   6031  C  CG2   . THR B 2  169 ? -49.758 -41.386 61.246  1.00 81.81  ? 169  THR B CG2   1 
ATOM   6032  N  N     . GLU B 2  170 ? -45.603 -39.737 62.634  1.00 94.15  ? 170  GLU B N     1 
ATOM   6033  C  CA    . GLU B 2  170 ? -44.457 -38.833 62.674  1.00 91.64  ? 170  GLU B CA    1 
ATOM   6034  C  C     . GLU B 2  170 ? -43.205 -39.456 62.067  1.00 87.38  ? 170  GLU B C     1 
ATOM   6035  O  O     . GLU B 2  170 ? -42.341 -38.740 61.554  1.00 92.23  ? 170  GLU B O     1 
ATOM   6036  C  CB    . GLU B 2  170 ? -44.200 -38.391 64.106  1.00 84.70  ? 170  GLU B CB    1 
ATOM   6037  C  CG    . GLU B 2  170 ? -45.442 -37.809 64.732  1.00 98.61  ? 170  GLU B CG    1 
ATOM   6038  C  CD    . GLU B 2  170 ? -45.138 -37.014 65.980  1.00 122.18 ? 170  GLU B CD    1 
ATOM   6039  O  OE1   . GLU B 2  170 ? -44.012 -36.459 66.039  1.00 124.59 ? 170  GLU B OE1   1 
ATOM   6040  O  OE2   . GLU B 2  170 ? -46.020 -36.911 66.875  1.00 115.63 ? 170  GLU B OE2   1 
ATOM   6041  N  N     . LYS B 2  171 ? -43.069 -40.771 62.156  1.00 86.73  ? 171  LYS B N     1 
ATOM   6042  C  CA    . LYS B 2  171 ? -41.971 -41.506 61.547  1.00 80.17  ? 171  LYS B CA    1 
ATOM   6043  C  C     . LYS B 2  171 ? -42.501 -42.563 60.584  1.00 84.46  ? 171  LYS B C     1 
ATOM   6044  O  O     . LYS B 2  171 ? -41.968 -43.672 60.491  1.00 87.79  ? 171  LYS B O     1 
ATOM   6045  C  CB    . LYS B 2  171 ? -41.085 -42.122 62.623  1.00 90.64  ? 171  LYS B CB    1 
ATOM   6046  C  CG    . LYS B 2  171 ? -40.387 -41.083 63.476  1.00 80.71  ? 171  LYS B CG    1 
ATOM   6047  C  CD    . LYS B 2  171 ? -39.511 -40.208 62.632  1.00 86.94  ? 171  LYS B CD    1 
ATOM   6048  C  CE    . LYS B 2  171 ? -38.819 -39.151 63.469  1.00 102.38 ? 171  LYS B CE    1 
ATOM   6049  N  NZ    . LYS B 2  171 ? -37.993 -38.244 62.622  1.00 108.70 ? 171  LYS B NZ    1 
ATOM   6050  N  N     . TRP B 2  172 ? -43.585 -42.215 59.890  1.00 74.72  ? 172  TRP B N     1 
ATOM   6051  C  CA    . TRP B 2  172 ? -44.279 -43.132 59.000  1.00 71.10  ? 172  TRP B CA    1 
ATOM   6052  C  C     . TRP B 2  172 ? -43.355 -43.745 57.963  1.00 72.87  ? 172  TRP B C     1 
ATOM   6053  O  O     . TRP B 2  172 ? -43.582 -44.871 57.525  1.00 83.16  ? 172  TRP B O     1 
ATOM   6054  C  CB    . TRP B 2  172 ? -45.384 -42.379 58.304  1.00 73.62  ? 172  TRP B CB    1 
ATOM   6055  C  CG    . TRP B 2  172 ? -46.334 -43.206 57.592  1.00 81.16  ? 172  TRP B CG    1 
ATOM   6056  C  CD1   . TRP B 2  172 ? -46.462 -43.328 56.247  1.00 90.05  ? 172  TRP B CD1   1 
ATOM   6057  C  CD2   . TRP B 2  172 ? -47.378 -43.987 58.172  1.00 82.69  ? 172  TRP B CD2   1 
ATOM   6058  N  NE1   . TRP B 2  172 ? -47.505 -44.175 55.947  1.00 94.49  ? 172  TRP B NE1   1 
ATOM   6059  C  CE2   . TRP B 2  172 ? -48.084 -44.590 57.118  1.00 86.87  ? 172  TRP B CE2   1 
ATOM   6060  C  CE3   . TRP B 2  172 ? -47.774 -44.249 59.486  1.00 83.84  ? 172  TRP B CE3   1 
ATOM   6061  C  CZ2   . TRP B 2  172 ? -49.154 -45.437 57.335  1.00 95.09  ? 172  TRP B CZ2   1 
ATOM   6062  C  CZ3   . TRP B 2  172 ? -48.833 -45.087 59.701  1.00 84.62  ? 172  TRP B CZ3   1 
ATOM   6063  C  CH2   . TRP B 2  172 ? -49.515 -45.672 58.633  1.00 99.62  ? 172  TRP B CH2   1 
ATOM   6064  N  N     . ASN B 2  173 ? -42.321 -43.031 57.546  1.00 68.92  ? 173  ASN B N     1 
ATOM   6065  C  CA    . ASN B 2  173 ? -41.436 -43.544 56.514  1.00 75.02  ? 173  ASN B CA    1 
ATOM   6066  C  C     . ASN B 2  173 ? -40.139 -44.145 57.042  1.00 73.17  ? 173  ASN B C     1 
ATOM   6067  O  O     . ASN B 2  173 ? -39.298 -44.551 56.235  1.00 80.64  ? 173  ASN B O     1 
ATOM   6068  C  CB    . ASN B 2  173 ? -41.119 -42.449 55.499  1.00 82.29  ? 173  ASN B CB    1 
ATOM   6069  C  CG    . ASN B 2  173 ? -42.355 -41.960 54.771  1.00 86.40  ? 173  ASN B CG    1 
ATOM   6070  O  OD1   . ASN B 2  173 ? -43.223 -42.747 54.384  1.00 89.65  ? 173  ASN B OD1   1 
ATOM   6071  N  ND2   . ASN B 2  173 ? -42.430 -40.650 54.561  1.00 90.61  ? 173  ASN B ND2   1 
ATOM   6072  N  N     . SER B 2  174 ? -39.926 -44.167 58.355  1.00 73.12  ? 174  SER B N     1 
ATOM   6073  C  CA    . SER B 2  174 ? -38.723 -44.774 58.916  1.00 75.82  ? 174  SER B CA    1 
ATOM   6074  C  C     . SER B 2  174 ? -38.618 -46.251 58.557  1.00 81.29  ? 174  SER B C     1 
ATOM   6075  O  O     . SER B 2  174 ? -39.623 -46.961 58.470  1.00 87.77  ? 174  SER B O     1 
ATOM   6076  C  CB    . SER B 2  174 ? -38.709 -44.597 60.423  1.00 81.19  ? 174  SER B CB    1 
ATOM   6077  O  OG    . SER B 2  174 ? -38.438 -43.245 60.730  1.00 92.19  ? 174  SER B OG    1 
ATOM   6078  N  N     . VAL B 2  175 ? -37.394 -46.723 58.344  1.00 77.73  ? 175  VAL B N     1 
ATOM   6079  C  CA    . VAL B 2  175 ? -37.193 -48.099 57.911  1.00 76.83  ? 175  VAL B CA    1 
ATOM   6080  C  C     . VAL B 2  175 ? -36.233 -48.804 58.852  1.00 80.12  ? 175  VAL B C     1 
ATOM   6081  O  O     . VAL B 2  175 ? -35.397 -48.175 59.504  1.00 82.12  ? 175  VAL B O     1 
ATOM   6082  C  CB    . VAL B 2  175 ? -36.655 -48.193 56.473  1.00 77.38  ? 175  VAL B CB    1 
ATOM   6083  C  CG1   . VAL B 2  175 ? -37.697 -47.698 55.484  1.00 84.54  ? 175  VAL B CG1   1 
ATOM   6084  C  CG2   . VAL B 2  175 ? -35.350 -47.444 56.351  1.00 77.34  ? 175  VAL B CG2   1 
ATOM   6085  N  N     . ALA B 2  176 ? -36.342 -50.130 58.897  1.00 83.11  ? 176  ALA B N     1 
ATOM   6086  C  CA    . ALA B 2  176 ? -35.416 -50.935 59.673  1.00 84.94  ? 176  ALA B CA    1 
ATOM   6087  C  C     . ALA B 2  176 ? -34.991 -52.146 58.862  1.00 90.39  ? 176  ALA B C     1 
ATOM   6088  O  O     . ALA B 2  176 ? -35.735 -52.641 58.003  1.00 86.51  ? 176  ALA B O     1 
ATOM   6089  C  CB    . ALA B 2  176 ? -36.027 -51.392 60.997  1.00 82.68  ? 176  ALA B CB    1 
ATOM   6090  N  N     . ASP B 2  177 ? -33.786 -52.624 59.171  1.00 91.83  ? 177  ASP B N     1 
ATOM   6091  C  CA    . ASP B 2  177 ? -33.292 -53.839 58.557  1.00 88.59  ? 177  ASP B CA    1 
ATOM   6092  C  C     . ASP B 2  177 ? -34.205 -54.988 58.949  1.00 100.66 ? 177  ASP B C     1 
ATOM   6093  O  O     . ASP B 2  177 ? -34.749 -55.025 60.059  1.00 97.37  ? 177  ASP B O     1 
ATOM   6094  C  CB    . ASP B 2  177 ? -31.852 -54.133 58.997  1.00 96.44  ? 177  ASP B CB    1 
ATOM   6095  C  CG    . ASP B 2  177 ? -30.804 -53.298 58.257  1.00 101.64 ? 177  ASP B CG    1 
ATOM   6096  O  OD1   . ASP B 2  177 ? -31.015 -52.936 57.076  1.00 97.97  ? 177  ASP B OD1   1 
ATOM   6097  O  OD2   . ASP B 2  177 ? -29.735 -53.051 58.857  1.00 113.41 ? 177  ASP B OD2   1 
ATOM   6098  N  N     . CYS B 2  178 ? -34.433 -55.891 58.006  1.00 99.96  ? 178  CYS B N     1 
ATOM   6099  C  CA    . CYS B 2  178 ? -35.159 -57.105 58.323  1.00 94.45  ? 178  CYS B CA    1 
ATOM   6100  C  C     . CYS B 2  178 ? -34.294 -58.032 59.166  1.00 93.75  ? 178  CYS B C     1 
ATOM   6101  O  O     . CYS B 2  178 ? -33.062 -57.939 59.166  1.00 98.69  ? 178  CYS B O     1 
ATOM   6102  C  CB    . CYS B 2  178 ? -35.618 -57.806 57.049  1.00 101.06 ? 178  CYS B CB    1 
ATOM   6103  S  SG    . CYS B 2  178 ? -36.843 -56.893 56.096  1.00 96.25  ? 178  CYS B SG    1 
ATOM   6104  N  N     . LEU B 2  179 ? -34.958 -58.897 59.926  1.00 87.88  ? 179  LEU B N     1 
ATOM   6105  C  CA    . LEU B 2  179 ? -34.242 -59.920 60.667  1.00 86.89  ? 179  LEU B CA    1 
ATOM   6106  C  C     . LEU B 2  179 ? -33.456 -60.810 59.707  1.00 94.58  ? 179  LEU B C     1 
ATOM   6107  O  O     . LEU B 2  179 ? -34.008 -61.285 58.706  1.00 92.87  ? 179  LEU B O     1 
ATOM   6108  C  CB    . LEU B 2  179 ? -35.214 -60.760 61.485  1.00 82.76  ? 179  LEU B CB    1 
ATOM   6109  C  CG    . LEU B 2  179 ? -35.815 -60.100 62.709  1.00 81.63  ? 179  LEU B CG    1 
ATOM   6110  C  CD1   . LEU B 2  179 ? -36.852 -61.020 63.295  1.00 85.20  ? 179  LEU B CD1   1 
ATOM   6111  C  CD2   . LEU B 2  179 ? -34.710 -59.842 63.699  1.00 78.15  ? 179  LEU B CD2   1 
ATOM   6112  N  N     . PRO B 2  180 ? -32.194 -61.112 60.008  1.00 95.17  ? 180  PRO B N     1 
ATOM   6113  C  CA    . PRO B 2  180 ? -31.358 -61.841 59.028  1.00 95.19  ? 180  PRO B CA    1 
ATOM   6114  C  C     . PRO B 2  180 ? -31.691 -63.329 58.989  1.00 105.10 ? 180  PRO B C     1 
ATOM   6115  O  O     . PRO B 2  180 ? -30.909 -64.205 59.384  1.00 110.17 ? 180  PRO B O     1 
ATOM   6116  C  CB    . PRO B 2  180 ? -29.937 -61.565 59.534  1.00 94.05  ? 180  PRO B CB    1 
ATOM   6117  C  CG    . PRO B 2  180 ? -30.078 -61.254 60.993  1.00 98.61  ? 180  PRO B CG    1 
ATOM   6118  C  CD    . PRO B 2  180 ? -31.500 -60.870 61.284  1.00 94.53  ? 180  PRO B CD    1 
ATOM   6119  N  N     . HIS B 2  181 ? -32.887 -63.648 58.503  1.00 97.40  ? 181  HIS B N     1 
ATOM   6120  C  CA    . HIS B 2  181 ? -33.308 -65.033 58.339  1.00 93.69  ? 181  HIS B CA    1 
ATOM   6121  C  C     . HIS B 2  181 ? -33.202 -65.396 56.871  1.00 91.76  ? 181  HIS B C     1 
ATOM   6122  O  O     . HIS B 2  181 ? -33.713 -64.673 56.014  1.00 97.15  ? 181  HIS B O     1 
ATOM   6123  C  CB    . HIS B 2  181 ? -34.741 -65.241 58.820  1.00 85.88  ? 181  HIS B CB    1 
ATOM   6124  C  CG    . HIS B 2  181 ? -34.940 -64.944 60.267  1.00 92.32  ? 181  HIS B CG    1 
ATOM   6125  N  ND1   . HIS B 2  181 ? -36.193 -64.855 60.837  1.00 100.11 ? 181  HIS B ND1   1 
ATOM   6126  C  CD2   . HIS B 2  181 ? -34.051 -64.737 61.267  1.00 90.41  ? 181  HIS B CD2   1 
ATOM   6127  C  CE1   . HIS B 2  181 ? -36.066 -64.589 62.125  1.00 99.87  ? 181  HIS B CE1   1 
ATOM   6128  N  NE2   . HIS B 2  181 ? -34.777 -64.512 62.412  1.00 98.30  ? 181  HIS B NE2   1 
ATOM   6129  N  N     . VAL B 2  182 ? -32.606 -66.540 56.585  1.00 85.23  ? 182  VAL B N     1 
ATOM   6130  C  CA    . VAL B 2  182 ? -32.512 -66.973 55.203  1.00 72.55  ? 182  VAL B CA    1 
ATOM   6131  C  C     . VAL B 2  182 ? -33.833 -67.608 54.817  1.00 78.71  ? 182  VAL B C     1 
ATOM   6132  O  O     . VAL B 2  182 ? -34.398 -68.402 55.572  1.00 90.15  ? 182  VAL B O     1 
ATOM   6133  C  CB    . VAL B 2  182 ? -31.350 -67.958 55.030  1.00 74.60  ? 182  VAL B CB    1 
ATOM   6134  C  CG1   . VAL B 2  182 ? -31.168 -68.300 53.564  1.00 75.30  ? 182  VAL B CG1   1 
ATOM   6135  C  CG2   . VAL B 2  182 ? -30.086 -67.400 55.658  1.00 76.04  ? 182  VAL B CG2   1 
ATOM   6136  N  N     . PHE B 2  183 ? -34.336 -67.288 53.640  1.00 76.30  ? 183  PHE B N     1 
ATOM   6137  C  CA    . PHE B 2  183 ? -35.613 -67.835 53.208  1.00 81.18  ? 183  PHE B CA    1 
ATOM   6138  C  C     . PHE B 2  183 ? -35.372 -68.770 52.037  1.00 87.99  ? 183  PHE B C     1 
ATOM   6139  O  O     . PHE B 2  183 ? -34.861 -68.342 50.994  1.00 91.74  ? 183  PHE B O     1 
ATOM   6140  C  CB    . PHE B 2  183 ? -36.577 -66.720 52.822  1.00 80.57  ? 183  PHE B CB    1 
ATOM   6141  C  CG    . PHE B 2  183 ? -37.179 -66.023 53.989  1.00 81.52  ? 183  PHE B CG    1 
ATOM   6142  C  CD1   . PHE B 2  183 ? -36.405 -65.238 54.812  1.00 81.86  ? 183  PHE B CD1   1 
ATOM   6143  C  CD2   . PHE B 2  183 ? -38.530 -66.115 54.234  1.00 83.08  ? 183  PHE B CD2   1 
ATOM   6144  C  CE1   . PHE B 2  183 ? -36.957 -64.587 55.882  1.00 84.05  ? 183  PHE B CE1   1 
ATOM   6145  C  CE2   . PHE B 2  183 ? -39.090 -65.469 55.297  1.00 85.44  ? 183  PHE B CE2   1 
ATOM   6146  C  CZ    . PHE B 2  183 ? -38.306 -64.696 56.122  1.00 89.71  ? 183  PHE B CZ    1 
ATOM   6147  N  N     . LEU B 2  184 ? -35.706 -70.047 52.224  1.00 91.94  ? 184  LEU B N     1 
ATOM   6148  C  CA    . LEU B 2  184 ? -35.762 -70.987 51.116  1.00 85.11  ? 184  LEU B CA    1 
ATOM   6149  C  C     . LEU B 2  184 ? -37.151 -70.906 50.505  1.00 88.71  ? 184  LEU B C     1 
ATOM   6150  O  O     . LEU B 2  184 ? -38.155 -70.911 51.223  1.00 89.20  ? 184  LEU B O     1 
ATOM   6151  C  CB    . LEU B 2  184 ? -35.425 -72.415 51.562  1.00 80.90  ? 184  LEU B CB    1 
ATOM   6152  C  CG    . LEU B 2  184 ? -33.996 -72.639 52.085  1.00 88.15  ? 184  LEU B CG    1 
ATOM   6153  C  CD1   . LEU B 2  184 ? -33.657 -74.090 52.287  1.00 91.06  ? 184  LEU B CD1   1 
ATOM   6154  C  CD2   . LEU B 2  184 ? -32.999 -72.044 51.141  1.00 96.11  ? 184  LEU B CD2   1 
ATOM   6155  N  N     . ILE B 2  185 ? -37.201 -70.795 49.184  1.00 86.37  ? 185  ILE B N     1 
ATOM   6156  C  CA    . ILE B 2  185 ? -38.433 -70.530 48.464  1.00 90.55  ? 185  ILE B CA    1 
ATOM   6157  C  C     . ILE B 2  185 ? -38.525 -71.525 47.324  1.00 96.13  ? 185  ILE B C     1 
ATOM   6158  O  O     . ILE B 2  185 ? -37.690 -71.509 46.411  1.00 99.42  ? 185  ILE B O     1 
ATOM   6159  C  CB    . ILE B 2  185 ? -38.484 -69.096 47.923  1.00 92.89  ? 185  ILE B CB    1 
ATOM   6160  C  CG1   . ILE B 2  185 ? -38.357 -68.090 49.075  1.00 103.64 ? 185  ILE B CG1   1 
ATOM   6161  C  CG2   . ILE B 2  185 ? -39.785 -68.900 47.182  1.00 95.07  ? 185  ILE B CG2   1 
ATOM   6162  C  CD1   . ILE B 2  185 ? -38.287 -66.623 48.642  1.00 105.25 ? 185  ILE B CD1   1 
ATOM   6163  N  N     . ASP B 2  186 ? -39.521 -72.399 47.386  1.00 103.72 ? 186  ASP B N     1 
ATOM   6164  C  CA    . ASP B 2  186 ? -39.789 -73.336 46.309  1.00 108.94 ? 186  ASP B CA    1 
ATOM   6165  C  C     . ASP B 2  186 ? -40.841 -72.732 45.397  1.00 117.93 ? 186  ASP B C     1 
ATOM   6166  O  O     . ASP B 2  186 ? -42.001 -72.559 45.802  1.00 125.34 ? 186  ASP B O     1 
ATOM   6167  C  CB    . ASP B 2  186 ? -40.242 -74.688 46.842  1.00 117.64 ? 186  ASP B CB    1 
ATOM   6168  C  CG    . ASP B 2  186 ? -40.288 -75.744 45.755  1.00 143.56 ? 186  ASP B CG    1 
ATOM   6169  O  OD1   . ASP B 2  186 ? -39.769 -75.479 44.642  1.00 145.69 ? 186  ASP B OD1   1 
ATOM   6170  O  OD2   . ASP B 2  186 ? -40.848 -76.832 46.006  1.00 148.57 ? 186  ASP B OD2   1 
ATOM   6171  N  N     . PHE B 2  187 ? -40.410 -72.399 44.171  1.00 119.01 ? 187  PHE B N     1 
ATOM   6172  C  CA    . PHE B 2  187 ? -41.273 -71.805 43.159  1.00 114.85 ? 187  PHE B CA    1 
ATOM   6173  C  C     . PHE B 2  187 ? -42.207 -72.843 42.575  1.00 125.80 ? 187  PHE B C     1 
ATOM   6174  O  O     . PHE B 2  187 ? -43.283 -72.505 42.079  1.00 123.47 ? 187  PHE B O     1 
ATOM   6175  C  CB    . PHE B 2  187 ? -40.419 -71.208 42.050  1.00 107.18 ? 187  PHE B CB    1 
ATOM   6176  C  CG    . PHE B 2  187 ? -39.405 -70.222 42.538  1.00 102.62 ? 187  PHE B CG    1 
ATOM   6177  C  CD1   . PHE B 2  187 ? -39.747 -69.234 43.430  1.00 107.87 ? 187  PHE B CD1   1 
ATOM   6178  C  CD2   . PHE B 2  187 ? -38.090 -70.310 42.121  1.00 113.75 ? 187  PHE B CD2   1 
ATOM   6179  C  CE1   . PHE B 2  187 ? -38.790 -68.330 43.879  1.00 110.91 ? 187  PHE B CE1   1 
ATOM   6180  C  CE2   . PHE B 2  187 ? -37.137 -69.416 42.569  1.00 109.54 ? 187  PHE B CE2   1 
ATOM   6181  C  CZ    . PHE B 2  187 ? -37.483 -68.429 43.444  1.00 101.75 ? 187  PHE B CZ    1 
ATOM   6182  N  N     . GLU B 2  188 ? -41.792 -74.107 42.612  1.00 129.88 ? 188  GLU B N     1 
ATOM   6183  C  CA    . GLU B 2  188 ? -42.622 -75.181 42.089  1.00 144.99 ? 188  GLU B CA    1 
ATOM   6184  C  C     . GLU B 2  188 ? -43.901 -75.308 42.902  1.00 145.65 ? 188  GLU B C     1 
ATOM   6185  O  O     . GLU B 2  188 ? -44.991 -75.476 42.342  1.00 148.44 ? 188  GLU B O     1 
ATOM   6186  C  CB    . GLU B 2  188 ? -41.833 -76.489 42.101  1.00 151.41 ? 188  GLU B CB    1 
ATOM   6187  C  CG    . GLU B 2  188 ? -42.603 -77.692 41.635  1.00 158.25 ? 188  GLU B CG    1 
ATOM   6188  C  CD    . GLU B 2  188 ? -41.793 -78.954 41.772  1.00 165.78 ? 188  GLU B CD    1 
ATOM   6189  O  OE1   . GLU B 2  188 ? -40.612 -78.857 42.172  1.00 168.75 ? 188  GLU B OE1   1 
ATOM   6190  O  OE2   . GLU B 2  188 ? -42.339 -80.041 41.496  1.00 172.54 ? 188  GLU B OE2   1 
ATOM   6191  N  N     . PHE B 2  189 ? -43.795 -75.182 44.224  1.00 139.50 ? 189  PHE B N     1 
ATOM   6192  C  CA    . PHE B 2  189 ? -44.947 -75.336 45.093  1.00 138.37 ? 189  PHE B CA    1 
ATOM   6193  C  C     . PHE B 2  189 ? -45.458 -74.009 45.619  1.00 136.73 ? 189  PHE B C     1 
ATOM   6194  O  O     . PHE B 2  189 ? -46.588 -73.948 46.114  1.00 139.43 ? 189  PHE B O     1 
ATOM   6195  C  CB    . PHE B 2  189 ? -44.599 -76.197 46.315  1.00 138.97 ? 189  PHE B CB    1 
ATOM   6196  C  CG    . PHE B 2  189 ? -44.347 -77.637 46.006  1.00 158.36 ? 189  PHE B CG    1 
ATOM   6197  C  CD1   . PHE B 2  189 ? -44.701 -78.184 44.782  1.00 159.70 ? 189  PHE B CD1   1 
ATOM   6198  C  CD2   . PHE B 2  189 ? -43.772 -78.459 46.968  1.00 166.38 ? 189  PHE B CD2   1 
ATOM   6199  C  CE1   . PHE B 2  189 ? -44.462 -79.523 44.515  1.00 166.21 ? 189  PHE B CE1   1 
ATOM   6200  C  CE2   . PHE B 2  189 ? -43.536 -79.798 46.711  1.00 167.72 ? 189  PHE B CE2   1 
ATOM   6201  C  CZ    . PHE B 2  189 ? -43.883 -80.330 45.482  1.00 172.02 ? 189  PHE B CZ    1 
ATOM   6202  N  N     . GLY B 2  190 ? -44.652 -72.960 45.539  1.00 128.86 ? 190  GLY B N     1 
ATOM   6203  C  CA    . GLY B 2  190 ? -45.061 -71.667 46.025  1.00 116.01 ? 190  GLY B CA    1 
ATOM   6204  C  C     . GLY B 2  190 ? -44.969 -71.581 47.527  1.00 107.21 ? 190  GLY B C     1 
ATOM   6205  O  O     . GLY B 2  190 ? -45.853 -71.001 48.159  1.00 110.32 ? 190  GLY B O     1 
ATOM   6206  N  N     . CYS B 2  191 ? -43.954 -72.194 48.129  1.00 104.13 ? 191  CYS B N     1 
ATOM   6207  C  CA    . CYS B 2  191 ? -43.847 -72.189 49.581  1.00 100.05 ? 191  CYS B CA    1 
ATOM   6208  C  C     . CYS B 2  191 ? -42.516 -71.609 50.032  1.00 97.80  ? 191  CYS B C     1 
ATOM   6209  O  O     . CYS B 2  191 ? -41.545 -71.550 49.274  1.00 105.02 ? 191  CYS B O     1 
ATOM   6210  C  CB    . CYS B 2  191 ? -43.997 -73.577 50.173  1.00 106.26 ? 191  CYS B CB    1 
ATOM   6211  S  SG    . CYS B 2  191 ? -42.731 -74.683 49.604  1.00 144.46 ? 191  CYS B SG    1 
ATOM   6212  N  N     . ALA B 2  192 ? -42.491 -71.160 51.284  1.00 96.32  ? 192  ALA B N     1 
ATOM   6213  C  CA    . ALA B 2  192 ? -41.321 -70.501 51.842  1.00 94.03  ? 192  ALA B CA    1 
ATOM   6214  C  C     . ALA B 2  192 ? -41.076 -70.960 53.273  1.00 90.75  ? 192  ALA B C     1 
ATOM   6215  O  O     . ALA B 2  192 ? -42.010 -71.090 54.066  1.00 86.95  ? 192  ALA B O     1 
ATOM   6216  C  CB    . ALA B 2  192 ? -41.467 -68.984 51.797  1.00 95.36  ? 192  ALA B CB    1 
ATOM   6217  N  N     . THR B 2  193 ? -39.811 -71.198 53.591  1.00 90.60  ? 193  THR B N     1 
ATOM   6218  C  CA    . THR B 2  193 ? -39.385 -71.622 54.915  1.00 89.78  ? 193  THR B CA    1 
ATOM   6219  C  C     . THR B 2  193 ? -38.285 -70.710 55.429  1.00 94.14  ? 193  THR B C     1 
ATOM   6220  O  O     . THR B 2  193 ? -37.363 -70.363 54.680  1.00 103.69 ? 193  THR B O     1 
ATOM   6221  C  CB    . THR B 2  193 ? -38.872 -73.046 54.872  1.00 99.57  ? 193  THR B CB    1 
ATOM   6222  O  OG1   . THR B 2  193 ? -39.781 -73.837 54.102  1.00 117.65 ? 193  THR B OG1   1 
ATOM   6223  C  CG2   . THR B 2  193 ? -38.739 -73.601 56.276  1.00 97.63  ? 193  THR B CG2   1 
ATOM   6224  N  N     . SER B 2  194 ? -38.378 -70.319 56.695  1.00 90.59  ? 194  SER B N     1 
ATOM   6225  C  CA    . SER B 2  194 ? -37.407 -69.403 57.276  1.00 95.22  ? 194  SER B CA    1 
ATOM   6226  C  C     . SER B 2  194 ? -36.415 -70.165 58.145  1.00 88.90  ? 194  SER B C     1 
ATOM   6227  O  O     . SER B 2  194 ? -36.802 -71.038 58.926  1.00 102.39 ? 194  SER B O     1 
ATOM   6228  C  CB    . SER B 2  194 ? -38.101 -68.299 58.084  1.00 97.80  ? 194  SER B CB    1 
ATOM   6229  O  OG    . SER B 2  194 ? -38.965 -68.822 59.074  1.00 104.31 ? 194  SER B OG    1 
ATOM   6230  N  N     . TYR B 2  195 ? -35.132 -69.833 57.990  1.00 81.80  ? 195  TYR B N     1 
ATOM   6231  C  CA    . TYR B 2  195 ? -34.033 -70.480 58.701  1.00 89.56  ? 195  TYR B CA    1 
ATOM   6232  C  C     . TYR B 2  195 ? -33.218 -69.433 59.438  1.00 95.66  ? 195  TYR B C     1 
ATOM   6233  O  O     . TYR B 2  195 ? -32.560 -68.602 58.799  1.00 107.60 ? 195  TYR B O     1 
ATOM   6234  C  CB    . TYR B 2  195 ? -33.135 -71.239 57.719  1.00 90.70  ? 195  TYR B CB    1 
ATOM   6235  C  CG    . TYR B 2  195 ? -33.859 -72.367 57.051  1.00 95.26  ? 195  TYR B CG    1 
ATOM   6236  C  CD1   . TYR B 2  195 ? -33.731 -73.656 57.520  1.00 106.69 ? 195  TYR B CD1   1 
ATOM   6237  C  CD2   . TYR B 2  195 ? -34.691 -72.143 55.967  1.00 97.78  ? 195  TYR B CD2   1 
ATOM   6238  C  CE1   . TYR B 2  195 ? -34.402 -74.694 56.928  1.00 110.74 ? 195  TYR B CE1   1 
ATOM   6239  C  CE2   . TYR B 2  195 ? -35.370 -73.177 55.368  1.00 96.24  ? 195  TYR B CE2   1 
ATOM   6240  C  CZ    . TYR B 2  195 ? -35.223 -74.451 55.853  1.00 100.92 ? 195  TYR B CZ    1 
ATOM   6241  O  OH    . TYR B 2  195 ? -35.895 -75.493 55.264  1.00 108.80 ? 195  TYR B OH    1 
ATOM   6242  N  N     . ILE B 2  196 ? -33.220 -69.505 60.770  1.00 91.74  ? 196  ILE B N     1 
ATOM   6243  C  CA    . ILE B 2  196 ? -32.386 -68.638 61.599  1.00 100.38 ? 196  ILE B CA    1 
ATOM   6244  C  C     . ILE B 2  196 ? -31.019 -69.280 61.765  1.00 99.24  ? 196  ILE B C     1 
ATOM   6245  O  O     . ILE B 2  196 ? -30.914 -70.439 62.173  1.00 103.86 ? 196  ILE B O     1 
ATOM   6246  C  CB    . ILE B 2  196 ? -33.030 -68.380 62.972  1.00 96.47  ? 196  ILE B CB    1 
ATOM   6247  C  CG1   . ILE B 2  196 ? -34.368 -67.671 62.820  1.00 98.88  ? 196  ILE B CG1   1 
ATOM   6248  C  CG2   . ILE B 2  196 ? -32.085 -67.577 63.860  1.00 101.54 ? 196  ILE B CG2   1 
ATOM   6249  C  CD1   . ILE B 2  196 ? -35.554 -68.613 62.809  1.00 116.52 ? 196  ILE B CD1   1 
ATOM   6250  N  N     . LEU B 2  197 ? -29.971 -68.522 61.470  1.00 102.86 ? 197  LEU B N     1 
ATOM   6251  C  CA    . LEU B 2  197 ? -28.600 -68.973 61.578  1.00 98.87  ? 197  LEU B CA    1 
ATOM   6252  C  C     . LEU B 2  197 ? -27.847 -68.163 62.621  1.00 112.81 ? 197  LEU B C     1 
ATOM   6253  O  O     . LEU B 2  197 ? -27.996 -66.939 62.676  1.00 131.29 ? 197  LEU B O     1 
ATOM   6254  C  CB    . LEU B 2  197 ? -27.882 -68.837 60.237  1.00 101.14 ? 197  LEU B CB    1 
ATOM   6255  C  CG    . LEU B 2  197 ? -28.507 -69.614 59.091  1.00 101.38 ? 197  LEU B CG    1 
ATOM   6256  C  CD1   . LEU B 2  197 ? -27.742 -69.382 57.791  1.00 105.04 ? 197  LEU B CD1   1 
ATOM   6257  C  CD2   . LEU B 2  197 ? -28.532 -71.087 59.462  1.00 119.13 ? 197  LEU B CD2   1 
ATOM   6258  N  N     . PRO B 2  198 ? -27.027 -68.806 63.451  1.00 110.18 ? 198  PRO B N     1 
ATOM   6259  C  CA    . PRO B 2  198 ? -26.270 -68.049 64.460  1.00 117.10 ? 198  PRO B CA    1 
ATOM   6260  C  C     . PRO B 2  198 ? -25.213 -67.140 63.859  1.00 118.61 ? 198  PRO B C     1 
ATOM   6261  O  O     . PRO B 2  198 ? -24.845 -66.139 64.485  1.00 123.62 ? 198  PRO B O     1 
ATOM   6262  C  CB    . PRO B 2  198 ? -25.646 -69.146 65.327  1.00 116.70 ? 198  PRO B CB    1 
ATOM   6263  C  CG    . PRO B 2  198 ? -25.598 -70.340 64.431  1.00 125.61 ? 198  PRO B CG    1 
ATOM   6264  C  CD    . PRO B 2  198 ? -26.821 -70.254 63.571  1.00 115.12 ? 198  PRO B CD    1 
ATOM   6265  N  N     . GLU B 2  199 ? -24.695 -67.467 62.675  1.00 118.29 ? 199  GLU B N     1 
ATOM   6266  C  CA    . GLU B 2  199 ? -23.631 -66.666 62.084  1.00 120.25 ? 199  GLU B CA    1 
ATOM   6267  C  C     . GLU B 2  199 ? -24.141 -65.334 61.543  1.00 122.99 ? 199  GLU B C     1 
ATOM   6268  O  O     . GLU B 2  199 ? -23.357 -64.390 61.390  1.00 129.67 ? 199  GLU B O     1 
ATOM   6269  C  CB    . GLU B 2  199 ? -22.964 -67.475 60.973  1.00 117.43 ? 199  GLU B CB    1 
ATOM   6270  C  CG    . GLU B 2  199 ? -22.459 -68.845 61.441  1.00 127.68 ? 199  GLU B CG    1 
ATOM   6271  C  CD    . GLU B 2  199 ? -23.513 -69.948 61.302  1.00 136.18 ? 199  GLU B CD    1 
ATOM   6272  O  OE1   . GLU B 2  199 ? -23.141 -71.111 61.036  1.00 136.46 ? 199  GLU B OE1   1 
ATOM   6273  O  OE2   . GLU B 2  199 ? -24.719 -69.652 61.447  1.00 133.50 ? 199  GLU B OE2   1 
ATOM   6274  N  N     . LEU B 2  200 ? -25.431 -65.226 61.265  1.00 116.42 ? 200  LEU B N     1 
ATOM   6275  C  CA    . LEU B 2  200 ? -26.011 -63.987 60.764  1.00 109.97 ? 200  LEU B CA    1 
ATOM   6276  C  C     . LEU B 2  200 ? -26.762 -63.354 61.925  1.00 115.04 ? 200  LEU B C     1 
ATOM   6277  O  O     . LEU B 2  200 ? -27.929 -63.647 62.175  1.00 108.30 ? 200  LEU B O     1 
ATOM   6278  C  CB    . LEU B 2  200 ? -26.902 -64.258 59.562  1.00 115.34 ? 200  LEU B CB    1 
ATOM   6279  C  CG    . LEU B 2  200 ? -26.131 -64.864 58.388  1.00 114.60 ? 200  LEU B CG    1 
ATOM   6280  C  CD1   . LEU B 2  200 ? -27.082 -65.277 57.277  1.00 112.32 ? 200  LEU B CD1   1 
ATOM   6281  C  CD2   . LEU B 2  200 ? -25.076 -63.886 57.871  1.00 112.93 ? 200  LEU B CD2   1 
ATOM   6282  N  N     . GLN B 2  201 ? -26.060 -62.490 62.653  1.00 128.35 ? 201  GLN B N     1 
ATOM   6283  C  CA    . GLN B 2  201 ? -26.602 -61.840 63.837  1.00 131.65 ? 201  GLN B CA    1 
ATOM   6284  C  C     . GLN B 2  201 ? -27.247 -60.494 63.520  1.00 126.14 ? 201  GLN B C     1 
ATOM   6285  O  O     . GLN B 2  201 ? -28.215 -60.102 64.182  1.00 125.78 ? 201  GLN B O     1 
ATOM   6286  C  CB    . GLN B 2  201 ? -25.506 -61.692 64.894  1.00 133.38 ? 201  GLN B CB    1 
ATOM   6287  C  CG    . GLN B 2  201 ? -25.276 -62.989 65.671  1.00 131.00 ? 201  GLN B CG    1 
ATOM   6288  C  CD    . GLN B 2  201 ? -26.501 -63.431 66.462  1.00 141.07 ? 201  GLN B CD    1 
ATOM   6289  O  OE1   . GLN B 2  201 ? -27.022 -62.682 67.287  1.00 153.24 ? 201  GLN B OE1   1 
ATOM   6290  N  NE2   . GLN B 2  201 ? -26.979 -64.643 66.195  1.00 136.11 ? 201  GLN B NE2   1 
ATOM   6291  N  N     . ASP B 2  202 ? -26.709 -59.754 62.557  1.00 124.05 ? 202  ASP B N     1 
ATOM   6292  C  CA    . ASP B 2  202 ? -27.184 -58.414 62.258  1.00 119.49 ? 202  ASP B CA    1 
ATOM   6293  C  C     . ASP B 2  202 ? -27.942 -58.401 60.938  1.00 114.56 ? 202  ASP B C     1 
ATOM   6294  O  O     . ASP B 2  202 ? -27.756 -59.274 60.087  1.00 116.88 ? 202  ASP B O     1 
ATOM   6295  C  CB    . ASP B 2  202 ? -26.010 -57.438 62.178  1.00 123.18 ? 202  ASP B CB    1 
ATOM   6296  C  CG    . ASP B 2  202 ? -25.277 -57.309 63.491  1.00 136.21 ? 202  ASP B CG    1 
ATOM   6297  O  OD1   . ASP B 2  202 ? -25.765 -57.857 64.504  1.00 145.93 ? 202  ASP B OD1   1 
ATOM   6298  O  OD2   . ASP B 2  202 ? -24.200 -56.676 63.503  1.00 140.35 ? 202  ASP B OD2   1 
ATOM   6299  N  N     . GLY B 2  203 ? -28.783 -57.373 60.761  1.00 105.43 ? 203  GLY B N     1 
ATOM   6300  C  CA    . GLY B 2  203 ? -29.466 -57.185 59.498  1.00 95.10  ? 203  GLY B CA    1 
ATOM   6301  C  C     . GLY B 2  203 ? -28.567 -56.551 58.448  1.00 98.42  ? 203  GLY B C     1 
ATOM   6302  O  O     . GLY B 2  203 ? -27.600 -55.850 58.751  1.00 101.11 ? 203  GLY B O     1 
ATOM   6303  N  N     . LEU B 2  204 ? -28.919 -56.767 57.183  1.00 92.84  ? 204  LEU B N     1 
ATOM   6304  C  CA    . LEU B 2  204 ? -28.041 -56.363 56.093  1.00 96.57  ? 204  LEU B CA    1 
ATOM   6305  C  C     . LEU B 2  204 ? -28.872 -55.968 54.879  1.00 100.53 ? 204  LEU B C     1 
ATOM   6306  O  O     . LEU B 2  204 ? -29.821 -56.666 54.509  1.00 95.77  ? 204  LEU B O     1 
ATOM   6307  C  CB    . LEU B 2  204 ? -27.076 -57.497 55.722  1.00 87.09  ? 204  LEU B CB    1 
ATOM   6308  C  CG    . LEU B 2  204 ? -25.781 -57.038 55.069  1.00 90.75  ? 204  LEU B CG    1 
ATOM   6309  C  CD1   . LEU B 2  204 ? -24.937 -56.427 56.155  1.00 107.18 ? 204  LEU B CD1   1 
ATOM   6310  C  CD2   . LEU B 2  204 ? -25.042 -58.161 54.426  1.00 95.13  ? 204  LEU B CD2   1 
ATOM   6311  N  N     . SER B 2  205 ? -28.486 -54.863 54.243  1.00 94.00  ? 205  SER B N     1 
ATOM   6312  C  CA    . SER B 2  205 ? -29.199 -54.359 53.085  1.00 86.51  ? 205  SER B CA    1 
ATOM   6313  C  C     . SER B 2  205 ? -28.211 -53.844 52.054  1.00 88.85  ? 205  SER B C     1 
ATOM   6314  O  O     . SER B 2  205 ? -27.089 -53.446 52.377  1.00 91.78  ? 205  SER B O     1 
ATOM   6315  C  CB    . SER B 2  205 ? -30.166 -53.262 53.494  1.00 89.72  ? 205  SER B CB    1 
ATOM   6316  O  OG    . SER B 2  205 ? -30.949 -53.726 54.568  1.00 94.80  ? 205  SER B OG    1 
ATOM   6317  N  N     . PHE B 2  206 ? -28.656 -53.850 50.799  1.00 88.66  ? 206  PHE B N     1 
ATOM   6318  C  CA    . PHE B 2  206 ? -27.879 -53.334 49.676  1.00 93.57  ? 206  PHE B CA    1 
ATOM   6319  C  C     . PHE B 2  206 ? -26.549 -54.075 49.512  1.00 90.13  ? 206  PHE B C     1 
ATOM   6320  O  O     . PHE B 2  206 ? -25.562 -53.511 49.052  1.00 95.89  ? 206  PHE B O     1 
ATOM   6321  C  CB    . PHE B 2  206 ? -27.691 -51.819 49.813  1.00 85.63  ? 206  PHE B CB    1 
ATOM   6322  C  CG    . PHE B 2  206 ? -28.994 -51.073 49.848  1.00 84.02  ? 206  PHE B CG    1 
ATOM   6323  C  CD1   . PHE B 2  206 ? -29.737 -50.882 48.692  1.00 81.26  ? 206  PHE B CD1   1 
ATOM   6324  C  CD2   . PHE B 2  206 ? -29.518 -50.644 51.057  1.00 92.84  ? 206  PHE B CD2   1 
ATOM   6325  C  CE1   . PHE B 2  206 ? -30.956 -50.230 48.732  1.00 87.12  ? 206  PHE B CE1   1 
ATOM   6326  C  CE2   . PHE B 2  206 ? -30.744 -49.988 51.113  1.00 95.09  ? 206  PHE B CE2   1 
ATOM   6327  C  CZ    . PHE B 2  206 ? -31.466 -49.783 49.949  1.00 97.30  ? 206  PHE B CZ    1 
ATOM   6328  N  N     . HIS B 2  207 ? -26.512 -55.348 49.879  1.00 95.56  ? 207  HIS B N     1 
ATOM   6329  C  CA    . HIS B 2  207 ? -25.339 -56.192 49.710  1.00 95.24  ? 207  HIS B CA    1 
ATOM   6330  C  C     . HIS B 2  207 ? -25.334 -56.838 48.325  1.00 102.53 ? 207  HIS B C     1 
ATOM   6331  O  O     . HIS B 2  207 ? -26.296 -56.739 47.560  1.00 109.73 ? 207  HIS B O     1 
ATOM   6332  C  CB    . HIS B 2  207 ? -25.326 -57.272 50.778  1.00 95.13  ? 207  HIS B CB    1 
ATOM   6333  C  CG    . HIS B 2  207 ? -26.618 -58.011 50.847  1.00 89.79  ? 207  HIS B CG    1 
ATOM   6334  N  ND1   . HIS B 2  207 ? -27.618 -57.665 51.727  1.00 93.90  ? 207  HIS B ND1   1 
ATOM   6335  C  CD2   . HIS B 2  207 ? -27.111 -59.019 50.092  1.00 88.92  ? 207  HIS B CD2   1 
ATOM   6336  C  CE1   . HIS B 2  207 ? -28.664 -58.446 51.532  1.00 94.93  ? 207  HIS B CE1   1 
ATOM   6337  N  NE2   . HIS B 2  207 ? -28.382 -59.278 50.546  1.00 92.45  ? 207  HIS B NE2   1 
ATOM   6338  N  N     . VAL B 2  208 ? -24.233 -57.523 48.015  1.00 94.52  ? 208  VAL B N     1 
ATOM   6339  C  CA    . VAL B 2  208 ? -24.061 -58.253 46.764  1.00 92.52  ? 208  VAL B CA    1 
ATOM   6340  C  C     . VAL B 2  208 ? -24.166 -59.736 47.053  1.00 97.14  ? 208  VAL B C     1 
ATOM   6341  O  O     . VAL B 2  208 ? -23.699 -60.203 48.094  1.00 107.17 ? 208  VAL B O     1 
ATOM   6342  C  CB    . VAL B 2  208 ? -22.703 -57.933 46.111  1.00 95.22  ? 208  VAL B CB    1 
ATOM   6343  C  CG1   . VAL B 2  208 ? -22.611 -58.528 44.722  1.00 93.06  ? 208  VAL B CG1   1 
ATOM   6344  C  CG2   . VAL B 2  208 ? -22.512 -56.442 46.046  1.00 106.54 ? 208  VAL B CG2   1 
ATOM   6345  N  N     . SER B 2  209 ? -24.778 -60.477 46.138  1.00 105.78 ? 209  SER B N     1 
ATOM   6346  C  CA    . SER B 2  209 ? -24.963 -61.913 46.312  1.00 104.57 ? 209  SER B CA    1 
ATOM   6347  C  C     . SER B 2  209 ? -24.539 -62.649 45.048  1.00 105.95 ? 209  SER B C     1 
ATOM   6348  O  O     . SER B 2  209 ? -24.988 -62.316 43.947  1.00 112.32 ? 209  SER B O     1 
ATOM   6349  C  CB    . SER B 2  209 ? -26.413 -62.225 46.682  1.00 97.04  ? 209  SER B CB    1 
ATOM   6350  O  OG    . SER B 2  209 ? -27.262 -61.959 45.584  1.00 114.35 ? 209  SER B OG    1 
ATOM   6351  N  N     . ILE B 2  210 ? -23.697 -63.664 45.213  1.00 107.18 ? 210  ILE B N     1 
ATOM   6352  C  CA    . ILE B 2  210 ? -23.182 -64.452 44.097  1.00 105.01 ? 210  ILE B CA    1 
ATOM   6353  C  C     . ILE B 2  210 ? -23.551 -65.909 44.332  1.00 115.62 ? 210  ILE B C     1 
ATOM   6354  O  O     . ILE B 2  210 ? -23.207 -66.480 45.373  1.00 113.46 ? 210  ILE B O     1 
ATOM   6355  C  CB    . ILE B 2  210 ? -21.657 -64.319 43.953  1.00 103.51 ? 210  ILE B CB    1 
ATOM   6356  C  CG1   . ILE B 2  210 ? -21.247 -62.895 43.620  1.00 108.66 ? 210  ILE B CG1   1 
ATOM   6357  C  CG2   . ILE B 2  210 ? -21.150 -65.266 42.900  1.00 120.43 ? 210  ILE B CG2   1 
ATOM   6358  C  CD1   . ILE B 2  210 ? -20.890 -62.077 44.817  1.00 119.11 ? 210  ILE B CD1   1 
ATOM   6359  N  N     . ALA B 2  211 ? -24.197 -66.527 43.350  1.00 116.36 ? 211  ALA B N     1 
ATOM   6360  C  CA    . ALA B 2  211 ? -24.742 -67.870 43.507  1.00 107.29 ? 211  ALA B CA    1 
ATOM   6361  C  C     . ALA B 2  211 ? -23.972 -68.824 42.615  1.00 108.86 ? 211  ALA B C     1 
ATOM   6362  O  O     . ALA B 2  211 ? -23.903 -68.624 41.401  1.00 114.20 ? 211  ALA B O     1 
ATOM   6363  C  CB    . ALA B 2  211 ? -26.228 -67.913 43.150  1.00 102.30 ? 211  ALA B CB    1 
ATOM   6364  N  N     . ARG B 2  212 ? -23.401 -69.863 43.213  1.00 114.09 ? 212  ARG B N     1 
ATOM   6365  C  CA    . ARG B 2  212 ? -22.759 -70.910 42.434  1.00 115.24 ? 212  ARG B CA    1 
ATOM   6366  C  C     . ARG B 2  212 ? -23.132 -72.264 43.009  1.00 115.74 ? 212  ARG B C     1 
ATOM   6367  O  O     . ARG B 2  212 ? -22.882 -72.539 44.189  1.00 114.76 ? 212  ARG B O     1 
ATOM   6368  C  CB    . ARG B 2  212 ? -21.240 -70.726 42.371  1.00 118.78 ? 212  ARG B CB    1 
ATOM   6369  C  CG    . ARG B 2  212 ? -20.599 -71.848 41.602  1.00 127.40 ? 212  ARG B CG    1 
ATOM   6370  C  CD    . ARG B 2  212 ? -19.360 -71.405 40.856  1.00 132.94 ? 212  ARG B CD    1 
ATOM   6371  N  NE    . ARG B 2  212 ? -18.826 -72.526 40.095  1.00 148.15 ? 212  ARG B NE    1 
ATOM   6372  C  CZ    . ARG B 2  212 ? -17.812 -73.263 40.522  1.00 153.41 ? 212  ARG B CZ    1 
ATOM   6373  N  NH1   . ARG B 2  212 ? -17.253 -72.967 41.681  1.00 156.78 ? 212  ARG B NH1   1 
ATOM   6374  N  NH2   . ARG B 2  212 ? -17.364 -74.287 39.810  1.00 151.11 ? 212  ARG B NH2   1 
ATOM   6375  N  N     . ASN B 2  213 ? -23.725 -73.102 42.158  1.00 111.97 ? 213  ASN B N     1 
ATOM   6376  C  CA    . ASN B 2  213 ? -24.136 -74.438 42.558  1.00 113.86 ? 213  ASN B CA    1 
ATOM   6377  C  C     . ASN B 2  213 ? -25.066 -74.374 43.766  1.00 111.72 ? 213  ASN B C     1 
ATOM   6378  O  O     . ASN B 2  213 ? -26.168 -73.830 43.672  1.00 111.94 ? 213  ASN B O     1 
ATOM   6379  C  CB    . ASN B 2  213 ? -22.906 -75.306 42.835  1.00 116.12 ? 213  ASN B CB    1 
ATOM   6380  C  CG    . ASN B 2  213 ? -22.043 -75.493 41.602  1.00 117.62 ? 213  ASN B CG    1 
ATOM   6381  O  OD1   . ASN B 2  213 ? -22.553 -75.573 40.481  1.00 110.04 ? 213  ASN B OD1   1 
ATOM   6382  N  ND2   . ASN B 2  213 ? -20.729 -75.562 41.801  1.00 123.87 ? 213  ASN B ND2   1 
ATOM   6383  N  N     . ASP B 2  214 ? -24.656 -74.984 44.879  1.00 112.08 ? 214  ASP B N     1 
ATOM   6384  C  CA    . ASP B 2  214 ? -25.447 -75.053 46.102  1.00 110.71 ? 214  ASP B CA    1 
ATOM   6385  C  C     . ASP B 2  214 ? -25.096 -73.949 47.090  1.00 120.34 ? 214  ASP B C     1 
ATOM   6386  O  O     . ASP B 2  214 ? -25.403 -74.076 48.283  1.00 127.03 ? 214  ASP B O     1 
ATOM   6387  C  CB    . ASP B 2  214 ? -25.265 -76.422 46.763  1.00 115.20 ? 214  ASP B CB    1 
ATOM   6388  C  CG    . ASP B 2  214 ? -23.894 -76.582 47.400  1.00 129.54 ? 214  ASP B CG    1 
ATOM   6389  O  OD1   . ASP B 2  214 ? -22.904 -76.066 46.827  1.00 131.50 ? 214  ASP B OD1   1 
ATOM   6390  O  OD2   . ASP B 2  214 ? -23.798 -77.253 48.451  1.00 131.74 ? 214  ASP B OD2   1 
ATOM   6391  N  N     . THR B 2  215 ? -24.434 -72.889 46.640  1.00 116.28 ? 215  THR B N     1 
ATOM   6392  C  CA    . THR B 2  215 ? -23.933 -71.874 47.551  1.00 114.52 ? 215  THR B CA    1 
ATOM   6393  C  C     . THR B 2  215 ? -24.301 -70.468 47.081  1.00 119.52 ? 215  THR B C     1 
ATOM   6394  O  O     . THR B 2  215 ? -24.401 -70.201 45.880  1.00 122.19 ? 215  THR B O     1 
ATOM   6395  C  CB    . THR B 2  215 ? -22.417 -72.023 47.706  1.00 120.94 ? 215  THR B CB    1 
ATOM   6396  O  OG1   . THR B 2  215 ? -22.114 -73.354 48.136  1.00 127.96 ? 215  THR B OG1   1 
ATOM   6397  C  CG2   . THR B 2  215 ? -21.882 -71.050 48.710  1.00 123.31 ? 215  THR B CG2   1 
ATOM   6398  N  N     . VAL B 2  216 ? -24.515 -69.568 48.047  1.00 120.67 ? 216  VAL B N     1 
ATOM   6399  C  CA    . VAL B 2  216 ? -24.637 -68.134 47.803  1.00 105.70 ? 216  VAL B CA    1 
ATOM   6400  C  C     . VAL B 2  216 ? -23.683 -67.409 48.741  1.00 109.81 ? 216  VAL B C     1 
ATOM   6401  O  O     . VAL B 2  216 ? -23.688 -67.650 49.953  1.00 113.00 ? 216  VAL B O     1 
ATOM   6402  C  CB    . VAL B 2  216 ? -26.077 -67.609 47.995  1.00 101.54 ? 216  VAL B CB    1 
ATOM   6403  C  CG1   . VAL B 2  216 ? -26.979 -68.064 46.866  1.00 105.73 ? 216  VAL B CG1   1 
ATOM   6404  C  CG2   . VAL B 2  216 ? -26.652 -68.054 49.332  1.00 110.20 ? 216  VAL B CG2   1 
ATOM   6405  N  N     . TYR B 2  217 ? -22.835 -66.560 48.175  1.00 109.15 ? 217  TYR B N     1 
ATOM   6406  C  CA    . TYR B 2  217 ? -21.958 -65.688 48.941  1.00 116.44 ? 217  TYR B CA    1 
ATOM   6407  C  C     . TYR B 2  217 ? -22.574 -64.301 49.078  1.00 118.65 ? 217  TYR B C     1 
ATOM   6408  O  O     . TYR B 2  217 ? -23.050 -63.714 48.097  1.00 117.59 ? 217  TYR B O     1 
ATOM   6409  C  CB    . TYR B 2  217 ? -20.579 -65.560 48.293  1.00 121.07 ? 217  TYR B CB    1 
ATOM   6410  C  CG    . TYR B 2  217 ? -19.796 -66.847 48.190  1.00 125.63 ? 217  TYR B CG    1 
ATOM   6411  C  CD1   . TYR B 2  217 ? -18.963 -67.269 49.223  1.00 125.78 ? 217  TYR B CD1   1 
ATOM   6412  C  CD2   . TYR B 2  217 ? -19.877 -67.632 47.055  1.00 128.20 ? 217  TYR B CD2   1 
ATOM   6413  C  CE1   . TYR B 2  217 ? -18.243 -68.440 49.123  1.00 131.39 ? 217  TYR B CE1   1 
ATOM   6414  C  CE2   . TYR B 2  217 ? -19.164 -68.803 46.946  1.00 133.40 ? 217  TYR B CE2   1 
ATOM   6415  C  CZ    . TYR B 2  217 ? -18.352 -69.204 47.980  1.00 137.00 ? 217  TYR B CZ    1 
ATOM   6416  O  OH    . TYR B 2  217 ? -17.651 -70.380 47.855  1.00 145.01 ? 217  TYR B OH    1 
ATOM   6417  N  N     . ILE B 2  218 ? -22.497 -63.766 50.295  1.00 116.58 ? 218  ILE B N     1 
ATOM   6418  C  CA    . ILE B 2  218 ? -23.017 -62.454 50.651  1.00 107.68 ? 218  ILE B CA    1 
ATOM   6419  C  C     . ILE B 2  218 ? -21.838 -61.540 50.937  1.00 114.23 ? 218  ILE B C     1 
ATOM   6420  O  O     . ILE B 2  218 ? -20.977 -61.861 51.772  1.00 117.70 ? 218  ILE B O     1 
ATOM   6421  C  CB    . ILE B 2  218 ? -23.960 -62.536 51.861  1.00 99.66  ? 218  ILE B CB    1 
ATOM   6422  C  CG1   . ILE B 2  218 ? -25.229 -63.284 51.474  1.00 100.77 ? 218  ILE B CG1   1 
ATOM   6423  C  CG2   . ILE B 2  218 ? -24.306 -61.155 52.344  1.00 102.17 ? 218  ILE B CG2   1 
ATOM   6424  C  CD1   . ILE B 2  218 ? -25.863 -62.754 50.212  1.00 96.59  ? 218  ILE B CD1   1 
ATOM   6425  N  N     . LEU B 2  219 ? -21.810 -60.400 50.244  1.00 118.59 ? 219  LEU B N     1 
ATOM   6426  C  CA    . LEU B 2  219 ? -20.703 -59.460 50.261  1.00 117.62 ? 219  LEU B CA    1 
ATOM   6427  C  C     . LEU B 2  219 ? -21.183 -58.067 50.621  1.00 109.19 ? 219  LEU B C     1 
ATOM   6428  O  O     . LEU B 2  219 ? -22.200 -57.591 50.104  1.00 104.28 ? 219  LEU B O     1 
ATOM   6429  C  CB    . LEU B 2  219 ? -20.023 -59.410 48.908  1.00 115.44 ? 219  LEU B CB    1 
ATOM   6430  C  CG    . LEU B 2  219 ? -19.074 -60.577 48.728  1.00 117.33 ? 219  LEU B CG    1 
ATOM   6431  C  CD1   . LEU B 2  219 ? -18.781 -60.764 47.269  1.00 127.06 ? 219  LEU B CD1   1 
ATOM   6432  C  CD2   . LEU B 2  219 ? -17.813 -60.275 49.498  1.00 128.77 ? 219  LEU B CD2   1 
ATOM   6433  N  N     . GLY B 2  220 ? -20.421 -57.416 51.492  1.00 108.39 ? 220  GLY B N     1 
ATOM   6434  C  CA    . GLY B 2  220 ? -20.656 -56.027 51.820  1.00 115.01 ? 220  GLY B CA    1 
ATOM   6435  C  C     . GLY B 2  220 ? -22.045 -55.802 52.366  1.00 106.40 ? 220  GLY B C     1 
ATOM   6436  O  O     . GLY B 2  220 ? -22.578 -56.598 53.145  1.00 104.38 ? 220  GLY B O     1 
ATOM   6437  N  N     . GLY B 2  221 ? -22.661 -54.731 51.907  1.00 100.54 ? 221  GLY B N     1 
ATOM   6438  C  CA    . GLY B 2  221 ? -23.943 -54.325 52.424  1.00 102.36 ? 221  GLY B CA    1 
ATOM   6439  C  C     . GLY B 2  221 ? -23.792 -53.328 53.547  1.00 102.66 ? 221  GLY B C     1 
ATOM   6440  O  O     . GLY B 2  221 ? -22.698 -53.026 54.033  1.00 111.77 ? 221  GLY B O     1 
ATOM   6441  N  N     . HIS B 2  222 ? -24.942 -52.847 53.998  1.00 96.93  ? 222  HIS B N     1 
ATOM   6442  C  CA    . HIS B 2  222 ? -25.017 -51.807 55.004  1.00 101.80 ? 222  HIS B CA    1 
ATOM   6443  C  C     . HIS B 2  222 ? -26.011 -52.235 56.066  1.00 105.79 ? 222  HIS B C     1 
ATOM   6444  O  O     . HIS B 2  222 ? -27.106 -52.712 55.748  1.00 106.07 ? 222  HIS B O     1 
ATOM   6445  C  CB    . HIS B 2  222 ? -25.431 -50.482 54.358  1.00 106.30 ? 222  HIS B CB    1 
ATOM   6446  C  CG    . HIS B 2  222 ? -25.568 -49.349 55.324  1.00 115.52 ? 222  HIS B CG    1 
ATOM   6447  N  ND1   . HIS B 2  222 ? -26.754 -48.675 55.523  1.00 116.39 ? 222  HIS B ND1   1 
ATOM   6448  C  CD2   . HIS B 2  222 ? -24.669 -48.781 56.160  1.00 121.66 ? 222  HIS B CD2   1 
ATOM   6449  C  CE1   . HIS B 2  222 ? -26.578 -47.735 56.433  1.00 121.48 ? 222  HIS B CE1   1 
ATOM   6450  N  NE2   . HIS B 2  222 ? -25.321 -47.778 56.836  1.00 127.79 ? 222  HIS B NE2   1 
ATOM   6451  N  N     . SER B 2  223 ? -25.625 -52.078 57.322  1.00 109.42 ? 223  SER B N     1 
ATOM   6452  C  CA    . SER B 2  223 ? -26.472 -52.414 58.454  1.00 110.89 ? 223  SER B CA    1 
ATOM   6453  C  C     . SER B 2  223 ? -26.928 -51.106 59.088  1.00 109.78 ? 223  SER B C     1 
ATOM   6454  O  O     . SER B 2  223 ? -26.097 -50.255 59.412  1.00 109.68 ? 223  SER B O     1 
ATOM   6455  C  CB    . SER B 2  223 ? -25.724 -53.308 59.445  1.00 111.34 ? 223  SER B CB    1 
ATOM   6456  O  OG    . SER B 2  223 ? -26.568 -53.771 60.485  1.00 110.17 ? 223  SER B OG    1 
ATOM   6457  N  N     . LEU B 2  224 ? -28.248 -50.911 59.167  1.00 118.10 ? 224  LEU B N     1 
ATOM   6458  C  CA    . LEU B 2  224 ? -28.805 -49.650 59.656  1.00 114.44 ? 224  LEU B CA    1 
ATOM   6459  C  C     . LEU B 2  224 ? -28.546 -49.465 61.146  1.00 118.83 ? 224  LEU B C     1 
ATOM   6460  O  O     . LEU B 2  224 ? -28.140 -48.380 61.580  1.00 129.89 ? 224  LEU B O     1 
ATOM   6461  C  CB    . LEU B 2  224 ? -30.310 -49.581 59.384  1.00 103.05 ? 224  LEU B CB    1 
ATOM   6462  C  CG    . LEU B 2  224 ? -30.823 -48.996 58.071  1.00 103.52 ? 224  LEU B CG    1 
ATOM   6463  C  CD1   . LEU B 2  224 ? -32.340 -49.007 58.069  1.00 93.37  ? 224  LEU B CD1   1 
ATOM   6464  C  CD2   . LEU B 2  224 ? -30.301 -47.585 57.850  1.00 116.31 ? 224  LEU B CD2   1 
ATOM   6465  N  N     . ALA B 2  225 ? -28.788 -50.507 61.948  1.00 110.02 ? 225  ALA B N     1 
ATOM   6466  C  CA    . ALA B 2  225 ? -28.711 -50.347 63.397  1.00 109.94 ? 225  ALA B CA    1 
ATOM   6467  C  C     . ALA B 2  225 ? -27.323 -49.889 63.820  1.00 121.80 ? 225  ALA B C     1 
ATOM   6468  O  O     . ALA B 2  225 ? -27.180 -48.925 64.579  1.00 137.89 ? 225  ALA B O     1 
ATOM   6469  C  CB    . ALA B 2  225 ? -29.086 -51.648 64.098  1.00 111.96 ? 225  ALA B CB    1 
ATOM   6470  N  N     . SER B 2  226 ? -26.282 -50.557 63.319  1.00 121.56 ? 226  SER B N     1 
ATOM   6471  C  CA    . SER B 2  226 ? -24.916 -50.123 63.583  1.00 122.45 ? 226  SER B CA    1 
ATOM   6472  C  C     . SER B 2  226 ? -24.484 -48.956 62.699  1.00 125.47 ? 226  SER B C     1 
ATOM   6473  O  O     . SER B 2  226 ? -23.527 -48.256 63.046  1.00 128.84 ? 226  SER B O     1 
ATOM   6474  C  CB    . SER B 2  226 ? -23.946 -51.293 63.396  1.00 123.38 ? 226  SER B CB    1 
ATOM   6475  O  OG    . SER B 2  226 ? -24.002 -51.813 62.077  1.00 132.74 ? 226  SER B OG    1 
ATOM   6476  N  N     . ASN B 2  227 ? -25.167 -48.732 61.577  1.00 121.48 ? 227  ASN B N     1 
ATOM   6477  C  CA    . ASN B 2  227 ? -24.754 -47.758 60.566  1.00 125.26 ? 227  ASN B CA    1 
ATOM   6478  C  C     . ASN B 2  227 ? -23.322 -48.026 60.109  1.00 128.06 ? 227  ASN B C     1 
ATOM   6479  O  O     . ASN B 2  227 ? -22.494 -47.118 59.991  1.00 128.37 ? 227  ASN B O     1 
ATOM   6480  C  CB    . ASN B 2  227 ? -24.918 -46.325 61.063  1.00 122.05 ? 227  ASN B CB    1 
ATOM   6481  C  CG    . ASN B 2  227 ? -25.006 -45.331 59.924  1.00 125.73 ? 227  ASN B CG    1 
ATOM   6482  O  OD1   . ASN B 2  227 ? -24.705 -45.649 58.772  1.00 121.92 ? 227  ASN B OD1   1 
ATOM   6483  N  ND2   . ASN B 2  227 ? -25.443 -44.125 60.236  1.00 143.86 ? 227  ASN B ND2   1 
ATOM   6484  N  N     . ILE B 2  228 ? -23.046 -49.304 59.849  1.00 117.63 ? 228  ILE B N     1 
ATOM   6485  C  CA    . ILE B 2  228 ? -21.747 -49.784 59.403  1.00 122.04 ? 228  ILE B CA    1 
ATOM   6486  C  C     . ILE B 2  228 ? -21.910 -50.523 58.083  1.00 124.74 ? 228  ILE B C     1 
ATOM   6487  O  O     . ILE B 2  228 ? -22.929 -51.188 57.855  1.00 128.81 ? 228  ILE B O     1 
ATOM   6488  C  CB    . ILE B 2  228 ? -21.101 -50.702 60.459  1.00 126.67 ? 228  ILE B CB    1 
ATOM   6489  C  CG1   . ILE B 2  228 ? -21.023 -49.998 61.813  1.00 135.34 ? 228  ILE B CG1   1 
ATOM   6490  C  CG2   . ILE B 2  228 ? -19.721 -51.160 60.013  1.00 125.37 ? 228  ILE B CG2   1 
ATOM   6491  C  CD1   . ILE B 2  228 ? -20.346 -50.838 62.875  1.00 140.71 ? 228  ILE B CD1   1 
ATOM   6492  N  N     . ARG B 2  229 ? -20.905 -50.390 57.210  1.00 127.43 ? 229  ARG B N     1 
ATOM   6493  C  CA    . ARG B 2  229 ? -20.769 -51.176 55.990  1.00 122.65 ? 229  ARG B CA    1 
ATOM   6494  C  C     . ARG B 2  229 ? -19.721 -52.253 56.229  1.00 119.55 ? 229  ARG B C     1 
ATOM   6495  O  O     . ARG B 2  229 ? -18.538 -52.043 55.934  1.00 119.47 ? 229  ARG B O     1 
ATOM   6496  C  CB    . ARG B 2  229 ? -20.389 -50.274 54.818  1.00 116.21 ? 229  ARG B CB    1 
ATOM   6497  C  CG    . ARG B 2  229 ? -21.492 -49.293 54.452  1.00 110.49 ? 229  ARG B CG    1 
ATOM   6498  C  CD    . ARG B 2  229 ? -21.111 -48.350 53.317  1.00 111.72 ? 229  ARG B CD    1 
ATOM   6499  N  NE    . ARG B 2  229 ? -22.273 -47.570 52.916  1.00 114.00 ? 229  ARG B NE    1 
ATOM   6500  C  CZ    . ARG B 2  229 ? -22.813 -46.614 53.662  1.00 116.25 ? 229  ARG B CZ    1 
ATOM   6501  N  NH1   . ARG B 2  229 ? -23.885 -45.955 53.240  1.00 120.34 ? 229  ARG B NH1   1 
ATOM   6502  N  NH2   . ARG B 2  229 ? -22.288 -46.321 54.843  1.00 124.21 ? 229  ARG B NH2   1 
ATOM   6503  N  N     . PRO B 2  230 ? -20.119 -53.416 56.750  1.00 120.88 ? 230  PRO B N     1 
ATOM   6504  C  CA    . PRO B 2  230 ? -19.135 -54.365 57.284  1.00 125.19 ? 230  PRO B CA    1 
ATOM   6505  C  C     . PRO B 2  230 ? -18.301 -55.016 56.195  1.00 133.72 ? 230  PRO B C     1 
ATOM   6506  O  O     . PRO B 2  230 ? -18.765 -55.261 55.077  1.00 134.50 ? 230  PRO B O     1 
ATOM   6507  C  CB    . PRO B 2  230 ? -19.998 -55.401 58.009  1.00 125.70 ? 230  PRO B CB    1 
ATOM   6508  C  CG    . PRO B 2  230 ? -21.276 -55.375 57.282  1.00 127.13 ? 230  PRO B CG    1 
ATOM   6509  C  CD    . PRO B 2  230 ? -21.491 -53.944 56.848  1.00 118.11 ? 230  PRO B CD    1 
ATOM   6510  N  N     . ALA B 2  231 ? -17.044 -55.282 56.538  1.00 129.73 ? 231  ALA B N     1 
ATOM   6511  C  CA    . ALA B 2  231 ? -16.108 -55.931 55.626  1.00 130.58 ? 231  ALA B CA    1 
ATOM   6512  C  C     . ALA B 2  231 ? -16.104 -57.443 55.830  1.00 136.85 ? 231  ALA B C     1 
ATOM   6513  O  O     . ALA B 2  231 ? -15.055 -58.078 55.940  1.00 141.64 ? 231  ALA B O     1 
ATOM   6514  C  CB    . ALA B 2  231 ? -14.715 -55.340 55.803  1.00 133.85 ? 231  ALA B CB    1 
ATOM   6515  N  N     . ASN B 2  232 ? -17.298 -58.029 55.872  1.00 138.71 ? 232  ASN B N     1 
ATOM   6516  C  CA    . ASN B 2  232 ? -17.462 -59.464 56.041  1.00 137.06 ? 232  ASN B CA    1 
ATOM   6517  C  C     . ASN B 2  232 ? -17.909 -60.129 54.750  1.00 133.39 ? 232  ASN B C     1 
ATOM   6518  O  O     . ASN B 2  232 ? -18.569 -59.521 53.900  1.00 126.27 ? 232  ASN B O     1 
ATOM   6519  C  CB    . ASN B 2  232 ? -18.483 -59.806 57.128  1.00 133.61 ? 232  ASN B CB    1 
ATOM   6520  C  CG    . ASN B 2  232 ? -17.916 -59.687 58.520  1.00 146.09 ? 232  ASN B CG    1 
ATOM   6521  O  OD1   . ASN B 2  232 ? -16.829 -60.198 58.801  1.00 145.09 ? 232  ASN B OD1   1 
ATOM   6522  N  ND2   . ASN B 2  232 ? -18.670 -59.058 59.419  1.00 149.52 ? 232  ASN B ND2   1 
ATOM   6523  N  N     . LEU B 2  233 ? -17.523 -61.391 54.623  1.00 134.40 ? 233  LEU B N     1 
ATOM   6524  C  CA    . LEU B 2  233 ? -17.953 -62.254 53.539  1.00 130.63 ? 233  LEU B CA    1 
ATOM   6525  C  C     . LEU B 2  233 ? -18.579 -63.489 54.162  1.00 124.79 ? 233  LEU B C     1 
ATOM   6526  O  O     . LEU B 2  233 ? -17.960 -64.152 55.006  1.00 124.27 ? 233  LEU B O     1 
ATOM   6527  C  CB    . LEU B 2  233 ? -16.779 -62.631 52.642  1.00 124.15 ? 233  LEU B CB    1 
ATOM   6528  C  CG    . LEU B 2  233 ? -17.035 -63.734 51.629  1.00 123.48 ? 233  LEU B CG    1 
ATOM   6529  C  CD1   . LEU B 2  233 ? -18.287 -63.439 50.825  1.00 125.04 ? 233  LEU B CD1   1 
ATOM   6530  C  CD2   . LEU B 2  233 ? -15.829 -63.859 50.719  1.00 130.55 ? 233  LEU B CD2   1 
ATOM   6531  N  N     . TYR B 2  234 ? -19.794 -63.805 53.734  1.00 119.82 ? 234  TYR B N     1 
ATOM   6532  C  CA    . TYR B 2  234 ? -20.543 -64.920 54.289  1.00 118.90 ? 234  TYR B CA    1 
ATOM   6533  C  C     . TYR B 2  234 ? -20.806 -65.935 53.187  1.00 120.58 ? 234  TYR B C     1 
ATOM   6534  O  O     . TYR B 2  234 ? -21.216 -65.559 52.088  1.00 115.25 ? 234  TYR B O     1 
ATOM   6535  C  CB    . TYR B 2  234 ? -21.863 -64.443 54.912  1.00 123.66 ? 234  TYR B CB    1 
ATOM   6536  C  CG    . TYR B 2  234 ? -21.720 -63.369 55.977  1.00 122.40 ? 234  TYR B CG    1 
ATOM   6537  C  CD1   . TYR B 2  234 ? -21.638 -63.708 57.321  1.00 129.25 ? 234  TYR B CD1   1 
ATOM   6538  C  CD2   . TYR B 2  234 ? -21.672 -62.025 55.641  1.00 123.53 ? 234  TYR B CD2   1 
ATOM   6539  C  CE1   . TYR B 2  234 ? -21.508 -62.740 58.303  1.00 122.46 ? 234  TYR B CE1   1 
ATOM   6540  C  CE2   . TYR B 2  234 ? -21.541 -61.046 56.619  1.00 130.32 ? 234  TYR B CE2   1 
ATOM   6541  C  CZ    . TYR B 2  234 ? -21.457 -61.414 57.949  1.00 129.14 ? 234  TYR B CZ    1 
ATOM   6542  O  OH    . TYR B 2  234 ? -21.322 -60.459 58.933  1.00 132.42 ? 234  TYR B OH    1 
ATOM   6543  N  N     . ARG B 2  235 ? -20.518 -67.207 53.455  1.00 127.96 ? 235  ARG B N     1 
ATOM   6544  C  CA    . ARG B 2  235 ? -20.925 -68.296 52.576  1.00 127.78 ? 235  ARG B CA    1 
ATOM   6545  C  C     . ARG B 2  235 ? -22.117 -69.027 53.171  1.00 123.51 ? 235  ARG B C     1 
ATOM   6546  O  O     . ARG B 2  235 ? -22.077 -69.454 54.329  1.00 118.60 ? 235  ARG B O     1 
ATOM   6547  C  CB    . ARG B 2  235 ? -19.784 -69.282 52.346  1.00 129.48 ? 235  ARG B CB    1 
ATOM   6548  C  CG    . ARG B 2  235 ? -20.153 -70.468 51.476  1.00 129.18 ? 235  ARG B CG    1 
ATOM   6549  C  CD    . ARG B 2  235 ? -18.949 -71.370 51.263  1.00 132.30 ? 235  ARG B CD    1 
ATOM   6550  N  NE    . ARG B 2  235 ? -18.435 -71.894 52.524  1.00 138.79 ? 235  ARG B NE    1 
ATOM   6551  C  CZ    . ARG B 2  235 ? -17.172 -72.264 52.722  1.00 143.27 ? 235  ARG B CZ    1 
ATOM   6552  N  NH1   . ARG B 2  235 ? -16.797 -72.727 53.909  1.00 141.13 ? 235  ARG B NH1   1 
ATOM   6553  N  NH2   . ARG B 2  235 ? -16.277 -72.143 51.744  1.00 142.91 ? 235  ARG B NH2   1 
ATOM   6554  N  N     . ILE B 2  236 ? -23.149 -69.225 52.362  1.00 122.18 ? 236  ILE B N     1 
ATOM   6555  C  CA    . ILE B 2  236 ? -24.358 -69.905 52.791  1.00 120.75 ? 236  ILE B CA    1 
ATOM   6556  C  C     . ILE B 2  236 ? -24.518 -71.076 51.839  1.00 133.84 ? 236  ILE B C     1 
ATOM   6557  O  O     . ILE B 2  236 ? -24.739 -70.883 50.637  1.00 134.22 ? 236  ILE B O     1 
ATOM   6558  C  CB    . ILE B 2  236 ? -25.582 -68.979 52.764  1.00 112.63 ? 236  ILE B CB    1 
ATOM   6559  C  CG1   . ILE B 2  236 ? -25.505 -67.983 53.913  1.00 114.28 ? 236  ILE B CG1   1 
ATOM   6560  C  CG2   . ILE B 2  236 ? -26.884 -69.764 52.824  1.00 108.01 ? 236  ILE B CG2   1 
ATOM   6561  C  CD1   . ILE B 2  236 ? -26.737 -67.145 54.041  1.00 107.52 ? 236  ILE B CD1   1 
ATOM   6562  N  N     . ARG B 2  237 ? -24.361 -72.288 52.366  1.00 136.58 ? 237  ARG B N     1 
ATOM   6563  C  CA    . ARG B 2  237 ? -24.495 -73.518 51.607  1.00 117.86 ? 237  ARG B CA    1 
ATOM   6564  C  C     . ARG B 2  237 ? -25.827 -74.162 51.937  1.00 115.27 ? 237  ARG B C     1 
ATOM   6565  O  O     . ARG B 2  237 ? -26.258 -74.161 53.094  1.00 115.02 ? 237  ARG B O     1 
ATOM   6566  C  CB    . ARG B 2  237 ? -23.341 -74.464 51.925  1.00 121.95 ? 237  ARG B CB    1 
ATOM   6567  C  CG    . ARG B 2  237 ? -23.340 -75.751 51.136  1.00 134.39 ? 237  ARG B CG    1 
ATOM   6568  C  CD    . ARG B 2  237 ? -22.024 -76.529 51.255  1.00 146.77 ? 237  ARG B CD    1 
ATOM   6569  N  NE    . ARG B 2  237 ? -20.929 -75.947 50.473  1.00 151.78 ? 237  ARG B NE    1 
ATOM   6570  C  CZ    . ARG B 2  237 ? -19.824 -75.394 50.970  1.00 151.09 ? 237  ARG B CZ    1 
ATOM   6571  N  NH1   . ARG B 2  237 ? -19.623 -75.331 52.281  1.00 150.15 ? 237  ARG B NH1   1 
ATOM   6572  N  NH2   . ARG B 2  237 ? -18.909 -74.916 50.135  1.00 149.26 ? 237  ARG B NH2   1 
ATOM   6573  N  N     . VAL B 2  238 ? -26.467 -74.723 50.918  1.00 108.34 ? 238  VAL B N     1 
ATOM   6574  C  CA    . VAL B 2  238 ? -27.772 -75.352 51.055  1.00 106.10 ? 238  VAL B CA    1 
ATOM   6575  C  C     . VAL B 2  238 ? -27.713 -76.741 50.440  1.00 125.24 ? 238  VAL B C     1 
ATOM   6576  O  O     . VAL B 2  238 ? -27.354 -76.890 49.264  1.00 127.25 ? 238  VAL B O     1 
ATOM   6577  C  CB    . VAL B 2  238 ? -28.876 -74.525 50.384  1.00 97.19  ? 238  VAL B CB    1 
ATOM   6578  C  CG1   . VAL B 2  238 ? -30.009 -75.420 49.934  1.00 95.69  ? 238  VAL B CG1   1 
ATOM   6579  C  CG2   . VAL B 2  238 ? -29.378 -73.483 51.337  1.00 106.64 ? 238  VAL B CG2   1 
ATOM   6580  N  N     . ASP B 2  239 ? -28.037 -77.758 51.230  1.00 122.27 ? 239  ASP B N     1 
ATOM   6581  C  CA    . ASP B 2  239 ? -28.183 -79.104 50.705  1.00 116.99 ? 239  ASP B CA    1 
ATOM   6582  C  C     . ASP B 2  239 ? -29.653 -79.477 50.745  1.00 113.19 ? 239  ASP B C     1 
ATOM   6583  O  O     . ASP B 2  239 ? -30.350 -79.158 51.709  1.00 115.29 ? 239  ASP B O     1 
ATOM   6584  C  CB    . ASP B 2  239 ? -27.358 -80.113 51.498  1.00 128.88 ? 239  ASP B CB    1 
ATOM   6585  C  CG    . ASP B 2  239 ? -27.356 -81.503 50.857  1.00 145.01 ? 239  ASP B CG    1 
ATOM   6586  O  OD1   . ASP B 2  239 ? -27.913 -81.657 49.739  1.00 142.04 ? 239  ASP B OD1   1 
ATOM   6587  O  OD2   . ASP B 2  239 ? -26.799 -82.444 51.469  1.00 147.06 ? 239  ASP B OD2   1 
ATOM   6588  N  N     . LEU B 2  240 ? -30.136 -80.132 49.690  1.00 110.18 ? 240  LEU B N     1 
ATOM   6589  C  CA    . LEU B 2  240 ? -31.548 -80.489 49.572  1.00 113.36 ? 240  LEU B CA    1 
ATOM   6590  C  C     . LEU B 2  240 ? -31.699 -82.011 49.486  1.00 117.63 ? 240  LEU B C     1 
ATOM   6591  O  O     . LEU B 2  240 ? -32.008 -82.543 48.413  1.00 125.10 ? 240  LEU B O     1 
ATOM   6592  C  CB    . LEU B 2  240 ? -32.135 -79.801 48.338  1.00 119.67 ? 240  LEU B CB    1 
ATOM   6593  C  CG    . LEU B 2  240 ? -32.119 -78.268 48.224  1.00 113.10 ? 240  LEU B CG    1 
ATOM   6594  C  CD1   . LEU B 2  240 ? -32.735 -77.869 46.917  1.00 110.27 ? 240  LEU B CD1   1 
ATOM   6595  C  CD2   . LEU B 2  240 ? -32.883 -77.603 49.328  1.00 115.83 ? 240  LEU B CD2   1 
ATOM   6596  N  N     . PRO B 2  241 ? -31.484 -82.755 50.607  1.00 120.54 ? 241  PRO B N     1 
ATOM   6597  C  CA    . PRO B 2  241 ? -31.735 -84.203 50.619  1.00 118.44 ? 241  PRO B CA    1 
ATOM   6598  C  C     . PRO B 2  241 ? -33.225 -84.477 50.729  1.00 119.59 ? 241  PRO B C     1 
ATOM   6599  O  O     . PRO B 2  241 ? -33.848 -84.187 51.754  1.00 123.55 ? 241  PRO B O     1 
ATOM   6600  C  CB    . PRO B 2  241 ? -30.980 -84.671 51.872  1.00 112.35 ? 241  PRO B CB    1 
ATOM   6601  C  CG    . PRO B 2  241 ? -30.031 -83.606 52.184  1.00 104.53 ? 241  PRO B CG    1 
ATOM   6602  C  CD    . PRO B 2  241 ? -30.776 -82.358 51.831  1.00 120.98 ? 241  PRO B CD    1 
ATOM   6603  N  N     . LEU B 2  242 ? -33.799 -85.055 49.675  1.00 121.58 ? 242  LEU B N     1 
ATOM   6604  C  CA    . LEU B 2  242 ? -35.226 -85.349 49.622  1.00 121.06 ? 242  LEU B CA    1 
ATOM   6605  C  C     . LEU B 2  242 ? -36.026 -84.131 50.065  1.00 131.06 ? 242  LEU B C     1 
ATOM   6606  O  O     . LEU B 2  242 ? -35.686 -82.997 49.709  1.00 128.69 ? 242  LEU B O     1 
ATOM   6607  C  CB    . LEU B 2  242 ? -35.548 -86.598 50.450  1.00 115.43 ? 242  LEU B CB    1 
ATOM   6608  C  CG    . LEU B 2  242 ? -35.059 -87.788 49.612  1.00 110.48 ? 242  LEU B CG    1 
ATOM   6609  C  CD1   . LEU B 2  242 ? -34.434 -88.876 50.473  1.00 91.76  ? 242  LEU B CD1   1 
ATOM   6610  C  CD2   . LEU B 2  242 ? -36.176 -88.338 48.698  1.00 110.96 ? 242  LEU B CD2   1 
ATOM   6611  N  N     . GLY B 2  243 ? -37.082 -84.345 50.831  1.00 133.47 ? 243  GLY B N     1 
ATOM   6612  C  CA    . GLY B 2  243 ? -37.851 -83.208 51.279  1.00 129.51 ? 243  GLY B CA    1 
ATOM   6613  C  C     . GLY B 2  243 ? -37.358 -82.516 52.535  1.00 122.53 ? 243  GLY B C     1 
ATOM   6614  O  O     . GLY B 2  243 ? -38.129 -81.743 53.097  1.00 123.19 ? 243  GLY B O     1 
ATOM   6615  N  N     . THR B 2  244 ? -36.121 -82.752 53.004  1.00 130.96 ? 244  THR B N     1 
ATOM   6616  C  CA    . THR B 2  244 ? -35.621 -82.116 54.230  1.00 121.73 ? 244  THR B CA    1 
ATOM   6617  C  C     . THR B 2  244 ? -34.387 -81.271 53.942  1.00 114.53 ? 244  THR B C     1 
ATOM   6618  O  O     . THR B 2  244 ? -33.249 -81.742 54.091  1.00 114.22 ? 244  THR B O     1 
ATOM   6619  C  CB    . THR B 2  244 ? -35.319 -83.168 55.298  1.00 119.92 ? 244  THR B CB    1 
ATOM   6620  O  OG1   . THR B 2  244 ? -36.534 -83.852 55.629  1.00 128.08 ? 244  THR B OG1   1 
ATOM   6621  C  CG2   . THR B 2  244 ? -34.743 -82.541 56.577  1.00 113.46 ? 244  THR B CG2   1 
ATOM   6622  N  N     . PRO B 2  245 ? -34.562 -80.014 53.548  1.00 112.46 ? 245  PRO B N     1 
ATOM   6623  C  CA    . PRO B 2  245 ? -33.407 -79.155 53.274  1.00 103.04 ? 245  PRO B CA    1 
ATOM   6624  C  C     . PRO B 2  245 ? -32.627 -78.791 54.532  1.00 104.45 ? 245  PRO B C     1 
ATOM   6625  O  O     . PRO B 2  245 ? -33.140 -78.807 55.651  1.00 103.45 ? 245  PRO B O     1 
ATOM   6626  C  CB    . PRO B 2  245 ? -34.043 -77.913 52.641  1.00 107.70 ? 245  PRO B CB    1 
ATOM   6627  C  CG    . PRO B 2  245 ? -35.478 -77.933 53.085  1.00 105.12 ? 245  PRO B CG    1 
ATOM   6628  C  CD    . PRO B 2  245 ? -35.843 -79.366 53.230  1.00 111.15 ? 245  PRO B CD    1 
ATOM   6629  N  N     . ALA B 2  246 ? -31.359 -78.434 54.324  1.00 108.76 ? 246  ALA B N     1 
ATOM   6630  C  CA    . ALA B 2  246 ? -30.492 -77.989 55.407  1.00 113.45 ? 246  ALA B CA    1 
ATOM   6631  C  C     . ALA B 2  246 ? -29.633 -76.821 54.934  1.00 117.71 ? 246  ALA B C     1 
ATOM   6632  O  O     . ALA B 2  246 ? -29.101 -76.845 53.816  1.00 109.36 ? 246  ALA B O     1 
ATOM   6633  C  CB    . ALA B 2  246 ? -29.606 -79.125 55.916  1.00 118.57 ? 246  ALA B CB    1 
ATOM   6634  N  N     . VAL B 2  247 ? -29.473 -75.818 55.804  1.00 118.43 ? 247  VAL B N     1 
ATOM   6635  C  CA    . VAL B 2  247 ? -28.767 -74.582 55.479  1.00 111.76 ? 247  VAL B CA    1 
ATOM   6636  C  C     . VAL B 2  247 ? -27.632 -74.392 56.482  1.00 111.86 ? 247  VAL B C     1 
ATOM   6637  O  O     . VAL B 2  247 ? -27.838 -74.553 57.689  1.00 116.74 ? 247  VAL B O     1 
ATOM   6638  C  CB    . VAL B 2  247 ? -29.719 -73.374 55.507  1.00 101.07 ? 247  VAL B CB    1 
ATOM   6639  C  CG1   . VAL B 2  247 ? -29.085 -72.206 54.785  1.00 112.30 ? 247  VAL B CG1   1 
ATOM   6640  C  CG2   . VAL B 2  247 ? -31.091 -73.727 54.943  1.00 98.80  ? 247  VAL B CG2   1 
ATOM   6641  N  N     . ASN B 2  248 ? -26.438 -74.060 55.989  1.00 117.24 ? 248  ASN B N     1 
ATOM   6642  C  CA    . ASN B 2  248 ? -25.294 -73.829 56.864  1.00 129.50 ? 248  ASN B CA    1 
ATOM   6643  C  C     . ASN B 2  248 ? -24.515 -72.597 56.419  1.00 132.92 ? 248  ASN B C     1 
ATOM   6644  O  O     . ASN B 2  248 ? -24.243 -72.427 55.230  1.00 133.68 ? 248  ASN B O     1 
ATOM   6645  C  CB    . ASN B 2  248 ? -24.355 -75.049 56.897  1.00 142.43 ? 248  ASN B CB    1 
ATOM   6646  C  CG    . ASN B 2  248 ? -23.155 -74.850 57.830  1.00 154.00 ? 248  ASN B CG    1 
ATOM   6647  O  OD1   . ASN B 2  248 ? -23.303 -74.360 58.956  1.00 152.83 ? 248  ASN B OD1   1 
ATOM   6648  N  ND2   . ASN B 2  248 ? -21.963 -75.215 57.358  1.00 158.28 ? 248  ASN B ND2   1 
ATOM   6649  N  N     . CYS B 2  249 ? -24.134 -71.751 57.372  1.00 126.85 ? 249  CYS B N     1 
ATOM   6650  C  CA    . CYS B 2  249 ? -23.380 -70.546 57.064  1.00 126.94 ? 249  CYS B CA    1 
ATOM   6651  C  C     . CYS B 2  249 ? -21.972 -70.611 57.648  1.00 131.06 ? 249  CYS B C     1 
ATOM   6652  O  O     . CYS B 2  249 ? -21.740 -71.214 58.699  1.00 132.16 ? 249  CYS B O     1 
ATOM   6653  C  CB    . CYS B 2  249 ? -24.095 -69.300 57.589  1.00 134.34 ? 249  CYS B CB    1 
ATOM   6654  S  SG    . CYS B 2  249 ? -23.339 -67.729 57.074  1.00 143.40 ? 249  CYS B SG    1 
ATOM   6655  N  N     . THR B 2  250 ? -21.031 -69.993 56.935  1.00 132.83 ? 250  THR B N     1 
ATOM   6656  C  CA    . THR B 2  250 ? -19.634 -69.907 57.344  1.00 132.95 ? 250  THR B CA    1 
ATOM   6657  C  C     . THR B 2  250 ? -19.100 -68.508 57.066  1.00 132.33 ? 250  THR B C     1 
ATOM   6658  O  O     . THR B 2  250 ? -19.251 -67.997 55.954  1.00 135.55 ? 250  THR B O     1 
ATOM   6659  C  CB    . THR B 2  250 ? -18.784 -70.937 56.590  1.00 134.03 ? 250  THR B CB    1 
ATOM   6660  O  OG1   . THR B 2  250 ? -19.029 -70.806 55.183  1.00 136.27 ? 250  THR B OG1   1 
ATOM   6661  C  CG2   . THR B 2  250 ? -19.109 -72.355 57.036  1.00 133.89 ? 250  THR B CG2   1 
ATOM   6662  N  N     . VAL B 2  251 ? -18.466 -67.896 58.060  1.00 128.79 ? 251  VAL B N     1 
ATOM   6663  C  CA    . VAL B 2  251 ? -17.799 -66.617 57.851  1.00 130.21 ? 251  VAL B CA    1 
ATOM   6664  C  C     . VAL B 2  251 ? -16.430 -66.856 57.223  1.00 128.49 ? 251  VAL B C     1 
ATOM   6665  O  O     . VAL B 2  251 ? -15.687 -67.744 57.652  1.00 132.43 ? 251  VAL B O     1 
ATOM   6666  C  CB    . VAL B 2  251 ? -17.692 -65.857 59.183  1.00 118.97 ? 251  VAL B CB    1 
ATOM   6667  C  CG1   . VAL B 2  251 ? -16.788 -64.639 59.035  1.00 131.49 ? 251  VAL B CG1   1 
ATOM   6668  C  CG2   . VAL B 2  251 ? -19.072 -65.466 59.670  1.00 128.51 ? 251  VAL B CG2   1 
ATOM   6669  N  N     . LEU B 2  252 ? -16.073 -66.064 56.213  1.00 120.25 ? 252  LEU B N     1 
ATOM   6670  C  CA    . LEU B 2  252 ? -14.777 -66.206 55.564  1.00 123.49 ? 252  LEU B CA    1 
ATOM   6671  C  C     . LEU B 2  252 ? -14.121 -64.837 55.614  1.00 143.01 ? 252  LEU B C     1 
ATOM   6672  O  O     . LEU B 2  252 ? -14.722 -63.849 55.142  1.00 152.31 ? 252  LEU B O     1 
ATOM   6673  C  CB    . LEU B 2  252 ? -14.884 -66.689 54.118  1.00 124.53 ? 252  LEU B CB    1 
ATOM   6674  C  CG    . LEU B 2  252 ? -15.457 -68.067 53.812  1.00 129.16 ? 252  LEU B CG    1 
ATOM   6675  C  CD1   . LEU B 2  252 ? -16.956 -67.995 53.793  1.00 128.10 ? 252  LEU B CD1   1 
ATOM   6676  C  CD2   . LEU B 2  252 ? -14.930 -68.569 52.477  1.00 131.78 ? 252  LEU B CD2   1 
ATOM   6677  N  N     . PRO B 2  253 ? -12.919 -64.719 56.165  1.00 148.70 ? 253  PRO B N     1 
ATOM   6678  C  CA    . PRO B 2  253 ? -12.239 -63.420 56.179  1.00 145.89 ? 253  PRO B CA    1 
ATOM   6679  C  C     . PRO B 2  253 ? -11.890 -62.974 54.767  1.00 131.80 ? 253  PRO B C     1 
ATOM   6680  O  O     . PRO B 2  253 ? -11.875 -63.755 53.814  1.00 126.56 ? 253  PRO B O     1 
ATOM   6681  C  CB    . PRO B 2  253 ? -10.986 -63.684 57.019  1.00 147.39 ? 253  PRO B CB    1 
ATOM   6682  C  CG    . PRO B 2  253 ? -11.368 -64.841 57.900  1.00 145.13 ? 253  PRO B CG    1 
ATOM   6683  C  CD    . PRO B 2  253 ? -12.282 -65.696 57.064  1.00 142.32 ? 253  PRO B CD    1 
ATOM   6684  N  N     . GLY B 2  254 ? -11.571 -61.689 54.655  1.00 135.81 ? 254  GLY B N     1 
ATOM   6685  C  CA    . GLY B 2  254 ? -11.266 -61.094 53.369  1.00 145.19 ? 254  GLY B CA    1 
ATOM   6686  C  C     . GLY B 2  254 ? -12.461 -60.560 52.616  1.00 135.34 ? 254  GLY B C     1 
ATOM   6687  O  O     . GLY B 2  254 ? -12.447 -60.523 51.379  1.00 126.58 ? 254  GLY B O     1 
ATOM   6688  N  N     . GLY B 2  255 ? -13.491 -60.121 53.331  1.00 136.91 ? 255  GLY B N     1 
ATOM   6689  C  CA    . GLY B 2  255 ? -14.688 -59.606 52.702  1.00 140.18 ? 255  GLY B CA    1 
ATOM   6690  C  C     . GLY B 2  255 ? -14.555 -58.118 52.427  1.00 135.66 ? 255  GLY B C     1 
ATOM   6691  O  O     . GLY B 2  255 ? -14.016 -57.368 53.237  1.00 135.81 ? 255  GLY B O     1 
ATOM   6692  N  N     . ILE B 2  256 ? -15.046 -57.704 51.260  1.00 134.88 ? 256  ILE B N     1 
ATOM   6693  C  CA    . ILE B 2  256 ? -15.047 -56.287 50.925  1.00 131.75 ? 256  ILE B CA    1 
ATOM   6694  C  C     . ILE B 2  256 ? -16.104 -55.570 51.760  1.00 129.80 ? 256  ILE B C     1 
ATOM   6695  O  O     . ILE B 2  256 ? -17.066 -56.185 52.245  1.00 130.59 ? 256  ILE B O     1 
ATOM   6696  C  CB    . ILE B 2  256 ? -15.300 -56.089 49.419  1.00 125.39 ? 256  ILE B CB    1 
ATOM   6697  C  CG1   . ILE B 2  256 ? -16.634 -56.727 49.019  1.00 135.11 ? 256  ILE B CG1   1 
ATOM   6698  C  CG2   . ILE B 2  256 ? -14.162 -56.679 48.618  1.00 121.08 ? 256  ILE B CG2   1 
ATOM   6699  C  CD1   . ILE B 2  256 ? -16.932 -56.651 47.545  1.00 128.15 ? 256  ILE B CD1   1 
ATOM   6700  N  N     . SER B 2  257 ? -15.894 -54.262 51.979  1.00 122.15 ? 257  SER B N     1 
ATOM   6701  C  CA    . SER B 2  257 ? -16.851 -53.394 52.675  1.00 118.52 ? 257  SER B CA    1 
ATOM   6702  C  C     . SER B 2  257 ? -17.428 -52.429 51.640  1.00 115.12 ? 257  SER B C     1 
ATOM   6703  O  O     . SER B 2  257 ? -16.782 -51.448 51.254  1.00 111.42 ? 257  SER B O     1 
ATOM   6704  C  CB    . SER B 2  257 ? -16.206 -52.641 53.836  1.00 118.44 ? 257  SER B CB    1 
ATOM   6705  O  OG    . SER B 2  257 ? -17.053 -51.595 54.290  1.00 115.86 ? 257  SER B OG    1 
ATOM   6706  N  N     . VAL B 2  258 ? -18.641 -52.720 51.186  1.00 115.65 ? 258  VAL B N     1 
ATOM   6707  C  CA    . VAL B 2  258 ? -19.286 -51.917 50.161  1.00 106.61 ? 258  VAL B CA    1 
ATOM   6708  C  C     . VAL B 2  258 ? -20.784 -52.151 50.231  1.00 102.18 ? 258  VAL B C     1 
ATOM   6709  O  O     . VAL B 2  258 ? -21.243 -53.275 50.435  1.00 105.76 ? 258  VAL B O     1 
ATOM   6710  C  CB    . VAL B 2  258 ? -18.721 -52.246 48.761  1.00 108.65 ? 258  VAL B CB    1 
ATOM   6711  C  CG1   . VAL B 2  258 ? -18.919 -53.706 48.459  1.00 110.67 ? 258  VAL B CG1   1 
ATOM   6712  C  CG2   . VAL B 2  258 ? -19.414 -51.405 47.725  1.00 107.83 ? 258  VAL B CG2   1 
ATOM   6713  N  N     . SER B 2  259 ? -21.539 -51.068 50.121  1.00 104.29 ? 259  SER B N     1 
ATOM   6714  C  CA    . SER B 2  259 ? -22.978 -51.129 49.924  1.00 100.54 ? 259  SER B CA    1 
ATOM   6715  C  C     . SER B 2  259 ? -23.310 -50.641 48.522  1.00 96.60  ? 259  SER B C     1 
ATOM   6716  O  O     . SER B 2  259 ? -22.562 -49.862 47.929  1.00 101.66 ? 259  SER B O     1 
ATOM   6717  C  CB    . SER B 2  259 ? -23.730 -50.285 50.954  1.00 95.36  ? 259  SER B CB    1 
ATOM   6718  O  OG    . SER B 2  259 ? -23.370 -48.927 50.848  1.00 98.00  ? 259  SER B OG    1 
ATOM   6719  N  N     . SER B 2  260 ? -24.414 -51.146 47.980  1.00 97.15  ? 260  SER B N     1 
ATOM   6720  C  CA    . SER B 2  260 ? -24.972 -50.693 46.708  1.00 88.04  ? 260  SER B CA    1 
ATOM   6721  C  C     . SER B 2  260 ? -24.023 -50.886 45.539  1.00 84.44  ? 260  SER B C     1 
ATOM   6722  O  O     . SER B 2  260 ? -24.136 -50.178 44.538  1.00 85.27  ? 260  SER B O     1 
ATOM   6723  C  CB    . SER B 2  260 ? -25.369 -49.219 46.792  1.00 90.18  ? 260  SER B CB    1 
ATOM   6724  O  OG    . SER B 2  260 ? -26.466 -49.007 47.669  1.00 97.46  ? 260  SER B OG    1 
ATOM   6725  N  N     . ALA B 2  261 ? -23.080 -51.823 45.651  1.00 94.47  ? 261  ALA B N     1 
ATOM   6726  C  CA    . ALA B 2  261 ? -22.174 -52.136 44.556  1.00 94.46  ? 261  ALA B CA    1 
ATOM   6727  C  C     . ALA B 2  261 ? -22.919 -52.837 43.426  1.00 84.30  ? 261  ALA B C     1 
ATOM   6728  O  O     . ALA B 2  261 ? -24.026 -53.341 43.596  1.00 98.36  ? 261  ALA B O     1 
ATOM   6729  C  CB    . ALA B 2  261 ? -21.024 -53.014 45.049  1.00 87.88  ? 261  ALA B CB    1 
ATOM   6730  N  N     . ILE B 2  262 ? -22.306 -52.858 42.257  1.00 80.02  ? 262  ILE B N     1 
ATOM   6731  C  CA    . ILE B 2  262 ? -22.878 -53.550 41.115  1.00 93.46  ? 262  ILE B CA    1 
ATOM   6732  C  C     . ILE B 2  262 ? -21.990 -54.733 40.763  1.00 104.51 ? 262  ILE B C     1 
ATOM   6733  O  O     . ILE B 2  262 ? -20.763 -54.691 40.901  1.00 115.20 ? 262  ILE B O     1 
ATOM   6734  C  CB    . ILE B 2  262 ? -23.081 -52.590 39.929  1.00 86.47  ? 262  ILE B CB    1 
ATOM   6735  C  CG1   . ILE B 2  262 ? -23.708 -51.312 40.453  1.00 90.93  ? 262  ILE B CG1   1 
ATOM   6736  C  CG2   . ILE B 2  262 ? -23.970 -53.183 38.849  1.00 90.86  ? 262  ILE B CG2   1 
ATOM   6737  C  CD1   . ILE B 2  262 ? -23.888 -50.291 39.400  1.00 96.38  ? 262  ILE B CD1   1 
ATOM   6738  N  N     . LEU B 2  263 ? -22.628 -55.811 40.323  1.00 99.52  ? 263  LEU B N     1 
ATOM   6739  C  CA    . LEU B 2  263 ? -21.958 -57.067 40.054  1.00 100.53 ? 263  LEU B CA    1 
ATOM   6740  C  C     . LEU B 2  263 ? -22.232 -57.438 38.606  1.00 98.79  ? 263  LEU B C     1 
ATOM   6741  O  O     . LEU B 2  263 ? -23.347 -57.242 38.112  1.00 99.42  ? 263  LEU B O     1 
ATOM   6742  C  CB    . LEU B 2  263 ? -22.460 -58.161 41.004  1.00 109.16 ? 263  LEU B CB    1 
ATOM   6743  C  CG    . LEU B 2  263 ? -21.919 -59.571 40.794  1.00 112.16 ? 263  LEU B CG    1 
ATOM   6744  C  CD1   . LEU B 2  263 ? -20.443 -59.595 41.111  1.00 115.23 ? 263  LEU B CD1   1 
ATOM   6745  C  CD2   . LEU B 2  263 ? -22.679 -60.567 41.636  1.00 105.05 ? 263  LEU B CD2   1 
ATOM   6746  N  N     . THR B 2  264 ? -21.196 -57.891 37.903  1.00 101.69 ? 264  THR B N     1 
ATOM   6747  C  CA    . THR B 2  264 ? -21.364 -58.372 36.541  1.00 108.95 ? 264  THR B CA    1 
ATOM   6748  C  C     . THR B 2  264 ? -20.535 -59.636 36.354  1.00 117.08 ? 264  THR B C     1 
ATOM   6749  O  O     . THR B 2  264 ? -19.554 -59.868 37.065  1.00 116.27 ? 264  THR B O     1 
ATOM   6750  C  CB    . THR B 2  264 ? -20.952 -57.341 35.483  1.00 100.61 ? 264  THR B CB    1 
ATOM   6751  O  OG1   . THR B 2  264 ? -21.204 -57.876 34.180  1.00 117.61 ? 264  THR B OG1   1 
ATOM   6752  C  CG2   . THR B 2  264 ? -19.466 -57.045 35.597  1.00 104.25 ? 264  THR B CG2   1 
ATOM   6753  N  N     . GLN B 2  265 ? -20.939 -60.464 35.396  1.00 115.21 ? 265  GLN B N     1 
ATOM   6754  C  CA    . GLN B 2  265 ? -20.236 -61.705 35.116  1.00 120.66 ? 265  GLN B CA    1 
ATOM   6755  C  C     . GLN B 2  265 ? -19.406 -61.524 33.854  1.00 133.32 ? 265  GLN B C     1 
ATOM   6756  O  O     . GLN B 2  265 ? -19.951 -61.238 32.781  1.00 138.87 ? 265  GLN B O     1 
ATOM   6757  C  CB    . GLN B 2  265 ? -21.200 -62.880 34.964  1.00 127.39 ? 265  GLN B CB    1 
ATOM   6758  C  CG    . GLN B 2  265 ? -20.484 -64.215 34.767  1.00 129.50 ? 265  GLN B CG    1 
ATOM   6759  C  CD    . GLN B 2  265 ? -21.416 -65.418 34.841  1.00 128.38 ? 265  GLN B CD    1 
ATOM   6760  O  OE1   . GLN B 2  265 ? -22.491 -65.358 35.441  1.00 118.83 ? 265  GLN B OE1   1 
ATOM   6761  N  NE2   . GLN B 2  265 ? -21.014 -66.512 34.209  1.00 142.37 ? 265  GLN B NE2   1 
ATOM   6762  N  N     . THR B 2  266 ? -18.090 -61.693 33.985  1.00 137.59 ? 266  THR B N     1 
ATOM   6763  C  CA    . THR B 2  266 ? -17.177 -61.596 32.851  1.00 140.11 ? 266  THR B CA    1 
ATOM   6764  C  C     . THR B 2  266 ? -16.862 -62.950 32.249  1.00 137.40 ? 266  THR B C     1 
ATOM   6765  O  O     . THR B 2  266 ? -16.733 -63.067 31.028  1.00 135.05 ? 266  THR B O     1 
ATOM   6766  C  CB    . THR B 2  266 ? -15.871 -60.910 33.260  1.00 136.81 ? 266  THR B CB    1 
ATOM   6767  O  OG1   . THR B 2  266 ? -15.326 -61.558 34.418  1.00 134.89 ? 266  THR B OG1   1 
ATOM   6768  C  CG2   . THR B 2  266 ? -16.123 -59.448 33.564  1.00 131.93 ? 266  THR B CG2   1 
ATOM   6769  N  N     . ASN B 2  267 ? -16.739 -63.977 33.075  1.00 143.34 ? 267  ASN B N     1 
ATOM   6770  C  CA    . ASN B 2  267 ? -16.634 -65.316 32.532  1.00 147.16 ? 267  ASN B CA    1 
ATOM   6771  C  C     . ASN B 2  267 ? -17.166 -66.256 33.593  1.00 150.50 ? 267  ASN B C     1 
ATOM   6772  O  O     . ASN B 2  267 ? -17.383 -65.858 34.740  1.00 147.69 ? 267  ASN B O     1 
ATOM   6773  C  CB    . ASN B 2  267 ? -15.204 -65.661 32.112  1.00 147.01 ? 267  ASN B CB    1 
ATOM   6774  C  CG    . ASN B 2  267 ? -15.157 -66.772 31.077  1.00 159.64 ? 267  ASN B CG    1 
ATOM   6775  O  OD1   . ASN B 2  267 ? -16.142 -67.486 30.860  1.00 156.25 ? 267  ASN B OD1   1 
ATOM   6776  N  ND2   . ASN B 2  267 ? -14.006 -66.925 30.431  1.00 168.72 ? 267  ASN B ND2   1 
ATOM   6777  N  N     . ASN B 2  268 ? -17.414 -67.499 33.197  1.00 150.85 ? 268  ASN B N     1 
ATOM   6778  C  CA    . ASN B 2  268 ? -17.862 -68.473 34.176  1.00 145.01 ? 268  ASN B CA    1 
ATOM   6779  C  C     . ASN B 2  268 ? -16.837 -68.547 35.290  1.00 139.32 ? 268  ASN B C     1 
ATOM   6780  O  O     . ASN B 2  268 ? -15.631 -68.591 35.042  1.00 142.76 ? 268  ASN B O     1 
ATOM   6781  C  CB    . ASN B 2  268 ? -18.078 -69.825 33.524  1.00 149.69 ? 268  ASN B CB    1 
ATOM   6782  C  CG    . ASN B 2  268 ? -19.178 -69.778 32.507  1.00 157.68 ? 268  ASN B CG    1 
ATOM   6783  O  OD1   . ASN B 2  268 ? -18.962 -70.079 31.334  1.00 163.03 ? 268  ASN B OD1   1 
ATOM   6784  N  ND2   . ASN B 2  268 ? -20.370 -69.368 32.938  1.00 154.55 ? 268  ASN B ND2   1 
ATOM   6785  N  N     . ASP B 2  269 ? -17.325 -68.506 36.518  1.00 133.60 ? 269  ASP B N     1 
ATOM   6786  C  CA    . ASP B 2  269 ? -16.533 -68.557 37.734  1.00 135.45 ? 269  ASP B CA    1 
ATOM   6787  C  C     . ASP B 2  269 ? -15.649 -67.329 37.929  1.00 129.24 ? 269  ASP B C     1 
ATOM   6788  O  O     . ASP B 2  269 ? -14.753 -67.365 38.783  1.00 130.04 ? 269  ASP B O     1 
ATOM   6789  C  CB    . ASP B 2  269 ? -15.646 -69.805 37.778  1.00 145.75 ? 269  ASP B CB    1 
ATOM   6790  C  CG    . ASP B 2  269 ? -16.442 -71.092 37.792  1.00 149.45 ? 269  ASP B CG    1 
ATOM   6791  O  OD1   . ASP B 2  269 ? -17.643 -71.045 38.146  1.00 152.03 ? 269  ASP B OD1   1 
ATOM   6792  O  OD2   . ASP B 2  269 ? -15.863 -72.145 37.447  1.00 146.32 ? 269  ASP B OD2   1 
ATOM   6793  N  N     . GLU B 2  270 ? -15.849 -66.247 37.162  1.00 136.26 ? 270  GLU B N     1 
ATOM   6794  C  CA    . GLU B 2  270 ? -15.199 -64.963 37.449  1.00 144.07 ? 270  GLU B CA    1 
ATOM   6795  C  C     . GLU B 2  270 ? -16.151 -63.788 37.209  1.00 137.45 ? 270  GLU B C     1 
ATOM   6796  O  O     . GLU B 2  270 ? -16.663 -63.594 36.095  1.00 132.74 ? 270  GLU B O     1 
ATOM   6797  C  CB    . GLU B 2  270 ? -13.896 -64.787 36.652  1.00 145.43 ? 270  GLU B CB    1 
ATOM   6798  C  CG    . GLU B 2  270 ? -14.026 -64.637 35.152  1.00 151.66 ? 270  GLU B CG    1 
ATOM   6799  C  CD    . GLU B 2  270 ? -12.860 -63.862 34.564  1.00 157.03 ? 270  GLU B CD    1 
ATOM   6800  O  OE1   . GLU B 2  270 ? -12.259 -63.052 35.304  1.00 154.71 ? 270  GLU B OE1   1 
ATOM   6801  O  OE2   . GLU B 2  270 ? -12.534 -64.067 33.375  1.00 160.63 ? 270  GLU B OE2   1 
ATOM   6802  N  N     . PHE B 2  271 ? -16.314 -62.972 38.255  1.00 129.32 ? 271  PHE B N     1 
ATOM   6803  C  CA    . PHE B 2  271 ? -17.226 -61.838 38.309  1.00 127.77 ? 271  PHE B CA    1 
ATOM   6804  C  C     . PHE B 2  271 ? -16.446 -60.591 38.705  1.00 128.30 ? 271  PHE B C     1 
ATOM   6805  O  O     . PHE B 2  271 ? -15.404 -60.670 39.355  1.00 126.47 ? 271  PHE B O     1 
ATOM   6806  C  CB    . PHE B 2  271 ? -18.351 -62.043 39.339  1.00 125.75 ? 271  PHE B CB    1 
ATOM   6807  C  CG    . PHE B 2  271 ? -19.166 -63.278 39.125  1.00 129.56 ? 271  PHE B CG    1 
ATOM   6808  C  CD1   . PHE B 2  271 ? -18.912 -64.409 39.876  1.00 129.85 ? 271  PHE B CD1   1 
ATOM   6809  C  CD2   . PHE B 2  271 ? -20.186 -63.318 38.192  1.00 130.04 ? 271  PHE B CD2   1 
ATOM   6810  C  CE1   . PHE B 2  271 ? -19.651 -65.553 39.696  1.00 126.29 ? 271  PHE B CE1   1 
ATOM   6811  C  CE2   . PHE B 2  271 ? -20.933 -64.468 38.016  1.00 121.73 ? 271  PHE B CE2   1 
ATOM   6812  C  CZ    . PHE B 2  271 ? -20.659 -65.583 38.763  1.00 123.25 ? 271  PHE B CZ    1 
ATOM   6813  N  N     . VAL B 2  272 ? -16.968 -59.430 38.325  1.00 128.48 ? 272  VAL B N     1 
ATOM   6814  C  CA    . VAL B 2  272 ? -16.363 -58.149 38.662  1.00 114.13 ? 272  VAL B CA    1 
ATOM   6815  C  C     . VAL B 2  272 ? -17.336 -57.362 39.527  1.00 110.91 ? 272  VAL B C     1 
ATOM   6816  O  O     . VAL B 2  272 ? -18.546 -57.360 39.275  1.00 114.76 ? 272  VAL B O     1 
ATOM   6817  C  CB    . VAL B 2  272 ? -15.983 -57.351 37.397  1.00 108.69 ? 272  VAL B CB    1 
ATOM   6818  C  CG1   . VAL B 2  272 ? -15.432 -56.005 37.782  1.00 108.55 ? 272  VAL B CG1   1 
ATOM   6819  C  CG2   . VAL B 2  272 ? -14.952 -58.115 36.595  1.00 112.46 ? 272  VAL B CG2   1 
ATOM   6820  N  N     . ILE B 2  273 ? -16.807 -56.732 40.570  1.00 106.98 ? 273  ILE B N     1 
ATOM   6821  C  CA    . ILE B 2  273 ? -17.571 -55.854 41.443  1.00 105.15 ? 273  ILE B CA    1 
ATOM   6822  C  C     . ILE B 2  273 ? -17.044 -54.443 41.220  1.00 111.34 ? 273  ILE B C     1 
ATOM   6823  O  O     . ILE B 2  273 ? -15.864 -54.167 41.471  1.00 120.00 ? 273  ILE B O     1 
ATOM   6824  C  CB    . ILE B 2  273 ? -17.438 -56.275 42.915  1.00 101.67 ? 273  ILE B CB    1 
ATOM   6825  C  CG1   . ILE B 2  273 ? -18.239 -57.543 43.177  1.00 111.23 ? 273  ILE B CG1   1 
ATOM   6826  C  CG2   . ILE B 2  273 ? -17.905 -55.181 43.843  1.00 102.45 ? 273  ILE B CG2   1 
ATOM   6827  C  CD1   . ILE B 2  273 ? -18.149 -58.010 44.600  1.00 113.94 ? 273  ILE B CD1   1 
ATOM   6828  N  N     . VAL B 2  274 ? -17.910 -53.568 40.700  1.00 107.13 ? 274  VAL B N     1 
ATOM   6829  C  CA    . VAL B 2  274 ? -17.628 -52.156 40.453  1.00 104.16 ? 274  VAL B CA    1 
ATOM   6830  C  C     . VAL B 2  274 ? -18.616 -51.271 41.197  1.00 95.35  ? 274  VAL B C     1 
ATOM   6831  O  O     . VAL B 2  274 ? -19.754 -51.667 41.467  1.00 101.96 ? 274  VAL B O     1 
ATOM   6832  C  CB    . VAL B 2  274 ? -17.667 -51.812 38.946  1.00 107.46 ? 274  VAL B CB    1 
ATOM   6833  C  CG1   . VAL B 2  274 ? -16.808 -52.780 38.146  1.00 111.12 ? 274  VAL B CG1   1 
ATOM   6834  C  CG2   . VAL B 2  274 ? -19.108 -51.826 38.442  1.00 93.78  ? 274  VAL B CG2   1 
ATOM   6835  N  N     . GLY B 2  275 ? -18.184 -50.053 41.498  1.00 93.23  ? 275  GLY B N     1 
ATOM   6836  C  CA    . GLY B 2  275 ? -19.054 -49.087 42.143  1.00 100.06 ? 275  GLY B CA    1 
ATOM   6837  C  C     . GLY B 2  275 ? -19.437 -49.367 43.588  1.00 95.70  ? 275  GLY B C     1 
ATOM   6838  O  O     . GLY B 2  275 ? -18.994 -50.316 44.229  1.00 99.95  ? 275  GLY B O     1 
ATOM   6839  N  N     . GLY B 2  276 ? -20.244 -48.447 44.111  1.00 87.61  ? 276  GLY B N     1 
ATOM   6840  C  CA    . GLY B 2  276 ? -20.847 -48.485 45.429  1.00 92.53  ? 276  GLY B CA    1 
ATOM   6841  C  C     . GLY B 2  276 ? -20.264 -47.436 46.361  1.00 92.23  ? 276  GLY B C     1 
ATOM   6842  O  O     . GLY B 2  276 ? -19.550 -46.520 45.952  1.00 106.13 ? 276  GLY B O     1 
ATOM   6843  N  N     . TYR B 2  277 ? -20.564 -47.597 47.645  1.00 91.70  ? 277  TYR B N     1 
ATOM   6844  C  CA    . TYR B 2  277 ? -20.131 -46.660 48.672  1.00 97.88  ? 277  TYR B CA    1 
ATOM   6845  C  C     . TYR B 2  277 ? -19.326 -47.344 49.763  1.00 104.01 ? 277  TYR B C     1 
ATOM   6846  O  O     . TYR B 2  277 ? -19.765 -48.357 50.311  1.00 112.63 ? 277  TYR B O     1 
ATOM   6847  C  CB    . TYR B 2  277 ? -21.330 -45.956 49.282  1.00 99.57  ? 277  TYR B CB    1 
ATOM   6848  C  CG    . TYR B 2  277 ? -22.240 -45.348 48.247  1.00 100.96 ? 277  TYR B CG    1 
ATOM   6849  C  CD1   . TYR B 2  277 ? -21.864 -44.217 47.534  1.00 107.89 ? 277  TYR B CD1   1 
ATOM   6850  C  CD2   . TYR B 2  277 ? -23.478 -45.899 47.988  1.00 107.42 ? 277  TYR B CD2   1 
ATOM   6851  C  CE1   . TYR B 2  277 ? -22.699 -43.664 46.589  1.00 100.69 ? 277  TYR B CE1   1 
ATOM   6852  C  CE2   . TYR B 2  277 ? -24.324 -45.347 47.062  1.00 104.61 ? 277  TYR B CE2   1 
ATOM   6853  C  CZ    . TYR B 2  277 ? -23.933 -44.238 46.363  1.00 98.60  ? 277  TYR B CZ    1 
ATOM   6854  O  OH    . TYR B 2  277 ? -24.801 -43.718 45.435  1.00 101.04 ? 277  TYR B OH    1 
ATOM   6855  N  N     . GLN B 2  278 ? -18.167 -46.777 50.097  1.00 110.56 ? 278  GLN B N     1 
ATOM   6856  C  CA    . GLN B 2  278 ? -17.397 -47.265 51.236  1.00 113.14 ? 278  GLN B CA    1 
ATOM   6857  C  C     . GLN B 2  278 ? -17.771 -46.553 52.524  1.00 112.42 ? 278  GLN B C     1 
ATOM   6858  O  O     . GLN B 2  278 ? -17.744 -47.165 53.595  1.00 107.63 ? 278  GLN B O     1 
ATOM   6859  C  CB    . GLN B 2  278 ? -15.899 -47.064 51.009  1.00 127.01 ? 278  GLN B CB    1 
ATOM   6860  C  CG    . GLN B 2  278 ? -15.310 -47.793 49.827  1.00 130.72 ? 278  GLN B CG    1 
ATOM   6861  C  CD    . GLN B 2  278 ? -13.882 -47.360 49.545  1.00 135.05 ? 278  GLN B CD    1 
ATOM   6862  O  OE1   . GLN B 2  278 ? -13.258 -46.663 50.349  1.00 129.70 ? 278  GLN B OE1   1 
ATOM   6863  N  NE2   . GLN B 2  278 ? -13.359 -47.767 48.393  1.00 137.65 ? 278  GLN B NE2   1 
ATOM   6864  N  N     . LEU B 2  279 ? -18.116 -45.272 52.433  1.00 128.04 ? 279  LEU B N     1 
ATOM   6865  C  CA    . LEU B 2  279 ? -18.639 -44.487 53.543  1.00 132.88 ? 279  LEU B CA    1 
ATOM   6866  C  C     . LEU B 2  279 ? -19.766 -43.613 53.023  1.00 132.07 ? 279  LEU B C     1 
ATOM   6867  O  O     . LEU B 2  279 ? -19.936 -43.450 51.812  1.00 129.55 ? 279  LEU B O     1 
ATOM   6868  C  CB    . LEU B 2  279 ? -17.564 -43.615 54.191  1.00 130.15 ? 279  LEU B CB    1 
ATOM   6869  C  CG    . LEU B 2  279 ? -16.586 -44.293 55.137  1.00 130.98 ? 279  LEU B CG    1 
ATOM   6870  C  CD1   . LEU B 2  279 ? -15.543 -43.295 55.574  1.00 137.74 ? 279  LEU B CD1   1 
ATOM   6871  C  CD2   . LEU B 2  279 ? -17.349 -44.822 56.343  1.00 129.49 ? 279  LEU B CD2   1 
ATOM   6872  N  N     . GLU B 2  280 ? -20.519 -43.012 53.948  1.00 121.48 ? 280  GLU B N     1 
ATOM   6873  C  CA    . GLU B 2  280 ? -21.669 -42.220 53.528  1.00 123.55 ? 280  GLU B CA    1 
ATOM   6874  C  C     . GLU B 2  280 ? -21.265 -41.129 52.549  1.00 138.99 ? 280  GLU B C     1 
ATOM   6875  O  O     . GLU B 2  280 ? -21.943 -40.911 51.540  1.00 145.67 ? 280  GLU B O     1 
ATOM   6876  C  CB    . GLU B 2  280 ? -22.372 -41.611 54.732  1.00 126.38 ? 280  GLU B CB    1 
ATOM   6877  C  CG    . GLU B 2  280 ? -23.441 -40.590 54.340  1.00 138.53 ? 280  GLU B CG    1 
ATOM   6878  C  CD    . GLU B 2  280 ? -24.620 -41.205 53.586  1.00 133.60 ? 280  GLU B CD    1 
ATOM   6879  O  OE1   . GLU B 2  280 ? -25.388 -40.444 52.954  1.00 127.33 ? 280  GLU B OE1   1 
ATOM   6880  O  OE2   . GLU B 2  280 ? -24.787 -42.446 53.631  1.00 131.61 ? 280  GLU B OE2   1 
ATOM   6881  N  N     . ASN B 2  281 ? -20.148 -40.457 52.809  1.00 142.43 ? 281  ASN B N     1 
ATOM   6882  C  CA    . ASN B 2  281 ? -19.659 -39.404 51.931  1.00 143.29 ? 281  ASN B CA    1 
ATOM   6883  C  C     . ASN B 2  281 ? -18.623 -39.874 50.925  1.00 144.16 ? 281  ASN B C     1 
ATOM   6884  O  O     . ASN B 2  281 ? -18.262 -39.095 50.035  1.00 147.66 ? 281  ASN B O     1 
ATOM   6885  C  CB    . ASN B 2  281 ? -19.098 -38.236 52.744  1.00 145.09 ? 281  ASN B CB    1 
ATOM   6886  C  CG    . ASN B 2  281 ? -20.153 -37.581 53.609  1.00 154.08 ? 281  ASN B CG    1 
ATOM   6887  O  OD1   . ASN B 2  281 ? -21.329 -37.549 53.240  1.00 156.45 ? 281  ASN B OD1   1 
ATOM   6888  N  ND2   . ASN B 2  281 ? -19.736 -36.993 54.727  1.00 156.72 ? 281  ASN B ND2   1 
ATOM   6889  N  N     . GLN B 2  282 ? -18.144 -41.112 51.030  1.00 138.85 ? 282  GLN B N     1 
ATOM   6890  C  CA    . GLN B 2  282 ? -17.091 -41.601 50.153  1.00 137.49 ? 282  GLN B CA    1 
ATOM   6891  C  C     . GLN B 2  282 ? -17.641 -42.663 49.216  1.00 120.09 ? 282  GLN B C     1 
ATOM   6892  O  O     . GLN B 2  282 ? -18.575 -43.388 49.555  1.00 113.08 ? 282  GLN B O     1 
ATOM   6893  C  CB    . GLN B 2  282 ? -15.927 -42.183 50.958  1.00 139.64 ? 282  GLN B CB    1 
ATOM   6894  C  CG    . GLN B 2  282 ? -14.672 -42.422 50.134  1.00 139.98 ? 282  GLN B CG    1 
ATOM   6895  C  CD    . GLN B 2  282 ? -13.571 -43.083 50.935  1.00 149.08 ? 282  GLN B CD    1 
ATOM   6896  O  OE1   . GLN B 2  282 ? -13.784 -43.518 52.071  1.00 150.67 ? 282  GLN B OE1   1 
ATOM   6897  N  NE2   . GLN B 2  282 ? -12.382 -43.162 50.345  1.00 157.00 ? 282  GLN B NE2   1 
ATOM   6898  N  N     . LYS B 2  283 ? -17.044 -42.756 48.037  1.00 116.97 ? 283  LYS B N     1 
ATOM   6899  C  CA    . LYS B 2  283 ? -17.456 -43.723 47.040  1.00 109.09 ? 283  LYS B CA    1 
ATOM   6900  C  C     . LYS B 2  283 ? -16.351 -44.741 46.831  1.00 113.24 ? 283  LYS B C     1 
ATOM   6901  O  O     . LYS B 2  283 ? -15.166 -44.429 46.948  1.00 120.40 ? 283  LYS B O     1 
ATOM   6902  C  CB    . LYS B 2  283 ? -17.776 -43.055 45.707  1.00 105.97 ? 283  LYS B CB    1 
ATOM   6903  C  CG    . LYS B 2  283 ? -18.993 -42.169 45.723  1.00 103.41 ? 283  LYS B CG    1 
ATOM   6904  C  CD    . LYS B 2  283 ? -19.479 -41.908 44.302  1.00 107.19 ? 283  LYS B CD    1 
ATOM   6905  C  CE    . LYS B 2  283 ? -18.324 -41.610 43.334  1.00 99.74  ? 283  LYS B CE    1 
ATOM   6906  N  NZ    . LYS B 2  283 ? -17.568 -40.377 43.674  1.00 109.93 ? 283  LYS B NZ    1 
ATOM   6907  N  N     . ARG B 2  284 ? -16.751 -45.961 46.511  1.00 112.16 ? 284  ARG B N     1 
ATOM   6908  C  CA    . ARG B 2  284 ? -15.779 -47.012 46.257  1.00 117.69 ? 284  ARG B CA    1 
ATOM   6909  C  C     . ARG B 2  284 ? -15.325 -46.880 44.812  1.00 123.92 ? 284  ARG B C     1 
ATOM   6910  O  O     . ARG B 2  284 ? -15.997 -47.350 43.892  1.00 119.38 ? 284  ARG B O     1 
ATOM   6911  C  CB    . ARG B 2  284 ? -16.375 -48.387 46.524  1.00 114.03 ? 284  ARG B CB    1 
ATOM   6912  C  CG    . ARG B 2  284 ? -15.363 -49.497 46.314  1.00 122.03 ? 284  ARG B CG    1 
ATOM   6913  C  CD    . ARG B 2  284 ? -15.985 -50.879 46.350  1.00 121.54 ? 284  ARG B CD    1 
ATOM   6914  N  NE    . ARG B 2  284 ? -14.962 -51.912 46.209  1.00 124.78 ? 284  ARG B NE    1 
ATOM   6915  C  CZ    . ARG B 2  284 ? -14.213 -52.362 47.209  1.00 127.85 ? 284  ARG B CZ    1 
ATOM   6916  N  NH1   . ARG B 2  284 ? -14.377 -51.872 48.433  1.00 121.51 ? 284  ARG B NH1   1 
ATOM   6917  N  NH2   . ARG B 2  284 ? -13.298 -53.300 46.986  1.00 129.11 ? 284  ARG B NH2   1 
ATOM   6918  N  N     . MET B 2  285 ? -14.177 -46.231 44.608  1.00 128.29 ? 285  MET B N     1 
ATOM   6919  C  CA    . MET B 2  285 ? -13.670 -46.021 43.258  1.00 133.59 ? 285  MET B CA    1 
ATOM   6920  C  C     . MET B 2  285 ? -12.905 -47.229 42.737  1.00 129.79 ? 285  MET B C     1 
ATOM   6921  O  O     . MET B 2  285 ? -12.771 -47.387 41.517  1.00 129.08 ? 285  MET B O     1 
ATOM   6922  C  CB    . MET B 2  285 ? -12.789 -44.771 43.217  1.00 122.03 ? 285  MET B CB    1 
ATOM   6923  C  CG    . MET B 2  285 ? -13.482 -43.552 43.784  1.00 119.86 ? 285  MET B CG    1 
ATOM   6924  S  SD    . MET B 2  285 ? -15.095 -43.298 43.018  1.00 117.47 ? 285  MET B SD    1 
ATOM   6925  C  CE    . MET B 2  285 ? -14.607 -43.161 41.306  1.00 109.00 ? 285  MET B CE    1 
ATOM   6926  N  N     . VAL B 2  286 ? -12.430 -48.089 43.632  1.00 123.21 ? 286  VAL B N     1 
ATOM   6927  C  CA    . VAL B 2  286 ? -11.688 -49.281 43.248  1.00 128.50 ? 286  VAL B CA    1 
ATOM   6928  C  C     . VAL B 2  286 ? -12.641 -50.350 42.728  1.00 126.49 ? 286  VAL B C     1 
ATOM   6929  O  O     . VAL B 2  286 ? -13.864 -50.244 42.882  1.00 126.91 ? 286  VAL B O     1 
ATOM   6930  C  CB    . VAL B 2  286 ? -10.868 -49.801 44.438  1.00 134.23 ? 286  VAL B CB    1 
ATOM   6931  C  CG1   . VAL B 2  286 ? -9.909  -48.716 44.917  1.00 135.02 ? 286  VAL B CG1   1 
ATOM   6932  C  CG2   . VAL B 2  286 ? -11.792 -50.242 45.560  1.00 132.54 ? 286  VAL B CG2   1 
ATOM   6933  N  N     . CYS B 2  287 ? -12.085 -51.385 42.101  1.00 116.95 ? 287  CYS B N     1 
ATOM   6934  C  CA    . CYS B 2  287 ? -12.864 -52.498 41.584  1.00 116.15 ? 287  CYS B CA    1 
ATOM   6935  C  C     . CYS B 2  287 ? -12.260 -53.810 42.041  1.00 133.49 ? 287  CYS B C     1 
ATOM   6936  O  O     . CYS B 2  287 ? -11.043 -53.932 42.228  1.00 142.89 ? 287  CYS B O     1 
ATOM   6937  C  CB    . CYS B 2  287 ? -12.921 -52.517 40.069  1.00 112.28 ? 287  CYS B CB    1 
ATOM   6938  S  SG    . CYS B 2  287 ? -13.726 -51.127 39.366  1.00 127.37 ? 287  CYS B SG    1 
ATOM   6939  N  N     . SER B 2  288 ? -13.119 -54.809 42.158  1.00 130.71 ? 288  SER B N     1 
ATOM   6940  C  CA    . SER B 2  288 ? -12.717 -56.113 42.636  1.00 123.26 ? 288  SER B CA    1 
ATOM   6941  C  C     . SER B 2  288 ? -13.039 -57.170 41.592  1.00 128.70 ? 288  SER B C     1 
ATOM   6942  O  O     . SER B 2  288 ? -13.998 -57.049 40.826  1.00 129.42 ? 288  SER B O     1 
ATOM   6943  C  CB    . SER B 2  288 ? -13.425 -56.436 43.946  1.00 117.95 ? 288  SER B CB    1 
ATOM   6944  O  OG    . SER B 2  288 ? -13.197 -55.397 44.878  1.00 120.21 ? 288  SER B OG    1 
ATOM   6945  N  N     . LEU B 2  289 ? -12.228 -58.216 41.587  1.00 135.18 ? 289  LEU B N     1 
ATOM   6946  C  CA    . LEU B 2  289 ? -12.417 -59.382 40.749  1.00 131.73 ? 289  LEU B CA    1 
ATOM   6947  C  C     . LEU B 2  289 ? -12.594 -60.570 41.682  1.00 130.21 ? 289  LEU B C     1 
ATOM   6948  O  O     . LEU B 2  289 ? -11.749 -60.804 42.550  1.00 133.95 ? 289  LEU B O     1 
ATOM   6949  C  CB    . LEU B 2  289 ? -11.208 -59.567 39.824  1.00 129.40 ? 289  LEU B CB    1 
ATOM   6950  C  CG    . LEU B 2  289 ? -11.209 -60.739 38.847  1.00 133.23 ? 289  LEU B CG    1 
ATOM   6951  C  CD1   . LEU B 2  289 ? -12.489 -60.759 38.020  1.00 136.31 ? 289  LEU B CD1   1 
ATOM   6952  C  CD2   . LEU B 2  289 ? -9.967  -60.714 37.952  1.00 123.11 ? 289  LEU B CD2   1 
ATOM   6953  N  N     . VAL B 2  290 ? -13.687 -61.313 41.519  1.00 130.60 ? 290  VAL B N     1 
ATOM   6954  C  CA    . VAL B 2  290 ? -13.953 -62.502 42.319  1.00 135.17 ? 290  VAL B CA    1 
ATOM   6955  C  C     . VAL B 2  290 ? -13.877 -63.706 41.395  1.00 137.70 ? 290  VAL B C     1 
ATOM   6956  O  O     . VAL B 2  290 ? -14.554 -63.757 40.360  1.00 130.33 ? 290  VAL B O     1 
ATOM   6957  C  CB    . VAL B 2  290 ? -15.308 -62.451 43.053  1.00 127.02 ? 290  VAL B CB    1 
ATOM   6958  C  CG1   . VAL B 2  290 ? -15.279 -61.457 44.199  1.00 123.59 ? 290  VAL B CG1   1 
ATOM   6959  C  CG2   . VAL B 2  290 ? -16.449 -62.156 42.112  1.00 124.00 ? 290  VAL B CG2   1 
ATOM   6960  N  N     . SER B 2  291 ? -13.025 -64.655 41.768  1.00 140.00 ? 291  SER B N     1 
ATOM   6961  C  CA    . SER B 2  291 ? -12.824 -65.906 41.051  1.00 139.90 ? 291  SER B CA    1 
ATOM   6962  C  C     . SER B 2  291 ? -13.354 -67.027 41.938  1.00 135.10 ? 291  SER B C     1 
ATOM   6963  O  O     . SER B 2  291 ? -13.079 -67.060 43.143  1.00 129.42 ? 291  SER B O     1 
ATOM   6964  C  CB    . SER B 2  291 ? -11.348 -66.106 40.690  1.00 147.51 ? 291  SER B CB    1 
ATOM   6965  O  OG    . SER B 2  291 ? -10.922 -65.077 39.793  1.00 142.23 ? 291  SER B OG    1 
ATOM   6966  N  N     . LEU B 2  292 ? -14.097 -67.952 41.351  1.00 135.75 ? 292  LEU B N     1 
ATOM   6967  C  CA    . LEU B 2  292 ? -14.807 -68.937 42.147  1.00 144.08 ? 292  LEU B CA    1 
ATOM   6968  C  C     . LEU B 2  292 ? -14.267 -70.347 41.940  1.00 151.80 ? 292  LEU B C     1 
ATOM   6969  O  O     . LEU B 2  292 ? -14.024 -70.783 40.810  1.00 153.11 ? 292  LEU B O     1 
ATOM   6970  C  CB    . LEU B 2  292 ? -16.294 -68.896 41.807  1.00 142.45 ? 292  LEU B CB    1 
ATOM   6971  C  CG    . LEU B 2  292 ? -17.070 -67.628 42.170  1.00 133.01 ? 292  LEU B CG    1 
ATOM   6972  C  CD1   . LEU B 2  292 ? -18.555 -67.866 41.989  1.00 134.60 ? 292  LEU B CD1   1 
ATOM   6973  C  CD2   . LEU B 2  292 ? -16.768 -67.241 43.600  1.00 134.23 ? 292  LEU B CD2   1 
ATOM   6974  N  N     . GLY B 2  293 ? -14.070 -71.047 43.055  1.00 156.27 ? 293  GLY B N     1 
ATOM   6975  C  CA    . GLY B 2  293 ? -13.720 -72.450 43.037  1.00 163.03 ? 293  GLY B CA    1 
ATOM   6976  C  C     . GLY B 2  293 ? -14.848 -73.233 43.659  1.00 165.58 ? 293  GLY B C     1 
ATOM   6977  O  O     . GLY B 2  293 ? -15.684 -72.647 44.359  1.00 160.95 ? 293  GLY B O     1 
ATOM   6978  N  N     . ASP B 2  294 ? -14.898 -74.544 43.410  1.00 166.03 ? 294  ASP B N     1 
ATOM   6979  C  CA    . ASP B 2  294 ? -16.012 -75.353 43.887  1.00 167.20 ? 294  ASP B CA    1 
ATOM   6980  C  C     . ASP B 2  294 ? -16.189 -75.238 45.395  1.00 162.71 ? 294  ASP B C     1 
ATOM   6981  O  O     . ASP B 2  294 ? -17.308 -75.393 45.899  1.00 161.28 ? 294  ASP B O     1 
ATOM   6982  C  CB    . ASP B 2  294 ? -15.810 -76.813 43.483  1.00 171.74 ? 294  ASP B CB    1 
ATOM   6983  C  CG    . ASP B 2  294 ? -15.951 -77.038 41.986  1.00 169.37 ? 294  ASP B CG    1 
ATOM   6984  O  OD1   . ASP B 2  294 ? -15.065 -76.585 41.230  1.00 169.25 ? 294  ASP B OD1   1 
ATOM   6985  O  OD2   . ASP B 2  294 ? -16.942 -77.672 41.565  1.00 165.06 ? 294  ASP B OD2   1 
ATOM   6986  N  N     . ASN B 2  295 ? -15.106 -74.980 46.129  1.00 160.24 ? 295  ASN B N     1 
ATOM   6987  C  CA    . ASN B 2  295 ? -15.181 -74.749 47.565  1.00 166.86 ? 295  ASN B CA    1 
ATOM   6988  C  C     . ASN B 2  295 ? -14.408 -73.509 47.998  1.00 167.89 ? 295  ASN B C     1 
ATOM   6989  O  O     . ASN B 2  295 ? -14.284 -73.266 49.206  1.00 167.60 ? 295  ASN B O     1 
ATOM   6990  C  CB    . ASN B 2  295 ? -14.676 -75.968 48.348  1.00 171.47 ? 295  ASN B CB    1 
ATOM   6991  C  CG    . ASN B 2  295 ? -15.637 -77.137 48.297  1.00 177.04 ? 295  ASN B CG    1 
ATOM   6992  O  OD1   . ASN B 2  295 ? -16.856 -76.953 48.236  1.00 172.37 ? 295  ASN B OD1   1 
ATOM   6993  N  ND2   . ASN B 2  295 ? -15.093 -78.353 48.331  1.00 180.59 ? 295  ASN B ND2   1 
ATOM   6994  N  N     . THR B 2  296 ? -13.889 -72.717 47.059  1.00 166.68 ? 296  THR B N     1 
ATOM   6995  C  CA    . THR B 2  296 ? -13.145 -71.514 47.399  1.00 166.02 ? 296  THR B CA    1 
ATOM   6996  C  C     . THR B 2  296 ? -13.632 -70.318 46.586  1.00 161.63 ? 296  THR B C     1 
ATOM   6997  O  O     . THR B 2  296 ? -14.132 -70.460 45.467  1.00 154.62 ? 296  THR B O     1 
ATOM   6998  C  CB    . THR B 2  296 ? -11.636 -71.730 47.150  1.00 167.06 ? 296  THR B CB    1 
ATOM   6999  O  OG1   . THR B 2  296 ? -10.910 -70.518 47.400  1.00 169.47 ? 296  THR B OG1   1 
ATOM   7000  C  CG2   . THR B 2  296 ? -11.389 -72.178 45.712  1.00 160.30 ? 296  THR B CG2   1 
ATOM   7001  N  N     . ILE B 2  297 ? -13.475 -69.132 47.175  1.00 154.94 ? 297  ILE B N     1 
ATOM   7002  C  CA    . ILE B 2  297 ? -13.782 -67.846 46.555  1.00 149.55 ? 297  ILE B CA    1 
ATOM   7003  C  C     . ILE B 2  297 ? -12.557 -66.965 46.764  1.00 148.45 ? 297  ILE B C     1 
ATOM   7004  O  O     . ILE B 2  297 ? -11.971 -66.971 47.853  1.00 151.98 ? 297  ILE B O     1 
ATOM   7005  C  CB    . ILE B 2  297 ? -15.048 -67.181 47.147  1.00 144.03 ? 297  ILE B CB    1 
ATOM   7006  N  N     . GLU B 2  298 ? -12.150 -66.230 45.734  1.00 147.55 ? 298  GLU B N     1 
ATOM   7007  C  CA    . GLU B 2  298 ? -11.004 -65.339 45.852  1.00 152.28 ? 298  GLU B CA    1 
ATOM   7008  C  C     . GLU B 2  298 ? -11.418 -63.946 45.419  1.00 143.77 ? 298  GLU B C     1 
ATOM   7009  O  O     . GLU B 2  298 ? -12.077 -63.771 44.387  1.00 139.13 ? 298  GLU B O     1 
ATOM   7010  C  CB    . GLU B 2  298 ? -9.797  -65.792 45.002  1.00 145.87 ? 298  GLU B CB    1 
ATOM   7011  N  N     . ILE B 2  299 ? -10.982 -62.961 46.188  1.00 131.22 ? 299  ILE B N     1 
ATOM   7012  C  CA    . ILE B 2  299 ? -11.287 -61.567 45.941  1.00 135.84 ? 299  ILE B CA    1 
ATOM   7013  C  C     . ILE B 2  299 ? -9.959  -60.855 45.740  1.00 140.35 ? 299  ILE B C     1 
ATOM   7014  O  O     . ILE B 2  299 ? -9.128  -60.790 46.656  1.00 140.51 ? 299  ILE B O     1 
ATOM   7015  C  CB    . ILE B 2  299 ? -12.084 -60.962 47.100  1.00 139.44 ? 299  ILE B CB    1 
ATOM   7016  C  CG1   . ILE B 2  299 ? -13.482 -61.599 47.171  1.00 140.61 ? 299  ILE B CG1   1 
ATOM   7017  C  CG2   . ILE B 2  299 ? -12.140 -59.474 46.951  1.00 135.63 ? 299  ILE B CG2   1 
ATOM   7018  C  CD1   . ILE B 2  299 ? -14.328 -61.067 48.306  1.00 135.95 ? 299  ILE B CD1   1 
ATOM   7019  N  N     . SER B 2  300 ? -9.774  -60.292 44.557  1.00 140.13 ? 300  SER B N     1 
ATOM   7020  C  CA    . SER B 2  300 ? -8.532  -59.641 44.190  1.00 135.87 ? 300  SER B CA    1 
ATOM   7021  C  C     . SER B 2  300 ? -8.806  -58.218 43.735  1.00 141.90 ? 300  SER B C     1 
ATOM   7022  O  O     . SER B 2  300 ? -9.775  -57.962 43.017  1.00 144.91 ? 300  SER B O     1 
ATOM   7023  C  CB    . SER B 2  300 ? -7.835  -60.402 43.072  1.00 136.06 ? 300  SER B CB    1 
ATOM   7024  O  OG    . SER B 2  300 ? -8.652  -60.407 41.917  1.00 138.75 ? 300  SER B OG    1 
ATOM   7025  N  N     . GLU B 2  301 ? -7.956  -57.291 44.164  1.00 138.48 ? 301  GLU B N     1 
ATOM   7026  C  CA    . GLU B 2  301 ? -8.035  -55.937 43.638  1.00 129.25 ? 301  GLU B CA    1 
ATOM   7027  C  C     . GLU B 2  301 ? -7.745  -55.960 42.143  1.00 127.58 ? 301  GLU B C     1 
ATOM   7028  O  O     . GLU B 2  301 ? -6.919  -56.743 41.670  1.00 131.08 ? 301  GLU B O     1 
ATOM   7029  C  CB    . GLU B 2  301 ? -7.030  -55.040 44.366  1.00 129.58 ? 301  GLU B CB    1 
ATOM   7030  C  CG    . GLU B 2  301 ? -6.826  -53.666 43.737  1.00 133.64 ? 301  GLU B CG    1 
ATOM   7031  C  CD    . GLU B 2  301 ? -7.803  -52.622 44.244  1.00 139.34 ? 301  GLU B CD    1 
ATOM   7032  O  OE1   . GLU B 2  301 ? -8.556  -52.914 45.203  1.00 140.58 ? 301  GLU B OE1   1 
ATOM   7033  O  OE2   . GLU B 2  301 ? -7.809  -51.503 43.681  1.00 134.20 ? 301  GLU B OE2   1 
ATOM   7034  N  N     . MET B 2  302 ? -8.452  -55.130 41.383  1.00 124.94 ? 302  MET B N     1 
ATOM   7035  C  CA    . MET B 2  302 ? -8.128  -54.981 39.975  1.00 126.54 ? 302  MET B CA    1 
ATOM   7036  C  C     . MET B 2  302 ? -7.835  -53.517 39.665  1.00 136.33 ? 302  MET B C     1 
ATOM   7037  O  O     . MET B 2  302 ? -8.016  -52.626 40.500  1.00 130.36 ? 302  MET B O     1 
ATOM   7038  C  CB    . MET B 2  302 ? -9.235  -55.555 39.083  1.00 124.89 ? 302  MET B CB    1 
ATOM   7039  C  CG    . MET B 2  302 ? -10.604 -54.954 39.227  1.00 123.20 ? 302  MET B CG    1 
ATOM   7040  S  SD    . MET B 2  302 ? -11.661 -55.569 37.909  1.00 132.09 ? 302  MET B SD    1 
ATOM   7041  C  CE    . MET B 2  302 ? -10.943 -54.754 36.467  1.00 119.19 ? 302  MET B CE    1 
ATOM   7042  N  N     . GLU B 2  303 ? -7.344  -53.278 38.449  1.00 142.98 ? 303  GLU B N     1 
ATOM   7043  C  CA    . GLU B 2  303 ? -6.990  -51.924 38.041  1.00 141.80 ? 303  GLU B CA    1 
ATOM   7044  C  C     . GLU B 2  303 ? -8.224  -51.036 37.969  1.00 139.62 ? 303  GLU B C     1 
ATOM   7045  O  O     . GLU B 2  303 ? -9.208  -51.371 37.303  1.00 137.99 ? 303  GLU B O     1 
ATOM   7046  C  CB    . GLU B 2  303 ? -6.283  -51.956 36.688  1.00 147.20 ? 303  GLU B CB    1 
ATOM   7047  C  CG    . GLU B 2  303 ? -5.947  -50.595 36.119  1.00 149.49 ? 303  GLU B CG    1 
ATOM   7048  C  CD    . GLU B 2  303 ? -5.184  -50.706 34.818  1.00 157.68 ? 303  GLU B CD    1 
ATOM   7049  O  OE1   . GLU B 2  303 ? -4.907  -51.850 34.398  1.00 159.79 ? 303  GLU B OE1   1 
ATOM   7050  O  OE2   . GLU B 2  303 ? -4.862  -49.657 34.216  1.00 162.37 ? 303  GLU B OE2   1 
ATOM   7051  N  N     . THR B 2  304 ? -8.165  -49.894 38.654  1.00 142.36 ? 304  THR B N     1 
ATOM   7052  C  CA    . THR B 2  304 ? -9.305  -48.987 38.660  1.00 139.72 ? 304  THR B CA    1 
ATOM   7053  C  C     . THR B 2  304 ? -9.480  -48.361 37.276  1.00 134.86 ? 304  THR B C     1 
ATOM   7054  O  O     . THR B 2  304 ? -8.494  -47.998 36.624  1.00 131.67 ? 304  THR B O     1 
ATOM   7055  C  CB    . THR B 2  304 ? -9.134  -47.888 39.715  1.00 133.73 ? 304  THR B CB    1 
ATOM   7056  O  OG1   . THR B 2  304 ? -8.280  -46.858 39.200  1.00 137.00 ? 304  THR B OG1   1 
ATOM   7057  C  CG2   . THR B 2  304 ? -8.542  -48.454 41.006  1.00 127.79 ? 304  THR B CG2   1 
ATOM   7058  N  N     . PRO B 2  305 ? -10.715 -48.201 36.810  1.00 129.80 ? 305  PRO B N     1 
ATOM   7059  C  CA    . PRO B 2  305 ? -10.938 -47.651 35.471  1.00 125.03 ? 305  PRO B CA    1 
ATOM   7060  C  C     . PRO B 2  305 ? -10.591 -46.174 35.435  1.00 129.13 ? 305  PRO B C     1 
ATOM   7061  O  O     . PRO B 2  305 ? -10.340 -45.535 36.459  1.00 130.50 ? 305  PRO B O     1 
ATOM   7062  C  CB    . PRO B 2  305 ? -12.436 -47.874 35.229  1.00 128.41 ? 305  PRO B CB    1 
ATOM   7063  C  CG    . PRO B 2  305 ? -12.935 -48.669 36.413  1.00 131.05 ? 305  PRO B CG    1 
ATOM   7064  C  CD    . PRO B 2  305 ? -11.978 -48.421 37.527  1.00 131.85 ? 305  PRO B CD    1 
ATOM   7065  N  N     . ASP B 2  306 ? -10.584 -45.628 34.217  1.00 133.54 ? 306  ASP B N     1 
ATOM   7066  C  CA    . ASP B 2  306 ? -10.230 -44.223 33.997  1.00 140.67 ? 306  ASP B CA    1 
ATOM   7067  C  C     . ASP B 2  306 ? -11.474 -43.351 34.185  1.00 135.18 ? 306  ASP B C     1 
ATOM   7068  O  O     . ASP B 2  306 ? -12.075 -42.846 33.232  1.00 130.57 ? 306  ASP B O     1 
ATOM   7069  C  CB    . ASP B 2  306 ? -9.606  -44.038 32.619  1.00 142.09 ? 306  ASP B CB    1 
ATOM   7070  C  CG    . ASP B 2  306 ? -8.654  -42.857 32.565  1.00 149.01 ? 306  ASP B CG    1 
ATOM   7071  O  OD1   . ASP B 2  306 ? -7.572  -43.003 31.960  1.00 160.02 ? 306  ASP B OD1   1 
ATOM   7072  O  OD2   . ASP B 2  306 ? -8.958  -41.806 33.174  1.00 136.83 ? 306  ASP B OD2   1 
ATOM   7073  N  N     . TRP B 2  307 ? -11.851 -43.159 35.450  1.00 127.45 ? 307  TRP B N     1 
ATOM   7074  C  CA    . TRP B 2  307 ? -13.021 -42.349 35.767  1.00 124.22 ? 307  TRP B CA    1 
ATOM   7075  C  C     . TRP B 2  307 ? -12.832 -40.913 35.287  1.00 119.23 ? 307  TRP B C     1 
ATOM   7076  O  O     . TRP B 2  307 ? -11.732 -40.361 35.350  1.00 125.96 ? 307  TRP B O     1 
ATOM   7077  C  CB    . TRP B 2  307 ? -13.277 -42.358 37.281  1.00 126.18 ? 307  TRP B CB    1 
ATOM   7078  C  CG    . TRP B 2  307 ? -13.535 -43.721 37.908  1.00 131.53 ? 307  TRP B CG    1 
ATOM   7079  C  CD1   . TRP B 2  307 ? -12.803 -44.327 38.896  1.00 126.30 ? 307  TRP B CD1   1 
ATOM   7080  C  CD2   . TRP B 2  307 ? -14.606 -44.627 37.597  1.00 128.24 ? 307  TRP B CD2   1 
ATOM   7081  N  NE1   . TRP B 2  307 ? -13.355 -45.545 39.219  1.00 123.28 ? 307  TRP B NE1   1 
ATOM   7082  C  CE2   . TRP B 2  307 ? -14.456 -45.756 38.432  1.00 123.73 ? 307  TRP B CE2   1 
ATOM   7083  C  CE3   . TRP B 2  307 ? -15.671 -44.594 36.690  1.00 124.10 ? 307  TRP B CE3   1 
ATOM   7084  C  CZ2   . TRP B 2  307 ? -15.330 -46.836 38.386  1.00 123.14 ? 307  TRP B CZ2   1 
ATOM   7085  C  CZ3   . TRP B 2  307 ? -16.535 -45.666 36.648  1.00 121.14 ? 307  TRP B CZ3   1 
ATOM   7086  C  CH2   . TRP B 2  307 ? -16.360 -46.774 37.489  1.00 125.08 ? 307  TRP B CH2   1 
ATOM   7087  N  N     . THR B 2  308 ? -13.912 -40.299 34.811  1.00 118.65 ? 308  THR B N     1 
ATOM   7088  C  CA    . THR B 2  308 ? -13.840 -38.885 34.486  1.00 124.10 ? 308  THR B CA    1 
ATOM   7089  C  C     . THR B 2  308 ? -14.006 -38.072 35.767  1.00 126.08 ? 308  THR B C     1 
ATOM   7090  O  O     . THR B 2  308 ? -14.344 -38.603 36.826  1.00 131.33 ? 308  THR B O     1 
ATOM   7091  C  CB    . THR B 2  308 ? -14.906 -38.495 33.453  1.00 121.51 ? 308  THR B CB    1 
ATOM   7092  O  OG1   . THR B 2  308 ? -16.168 -38.273 34.099  1.00 113.62 ? 308  THR B OG1   1 
ATOM   7093  C  CG2   . THR B 2  308 ? -15.066 -39.592 32.410  1.00 112.72 ? 308  THR B CG2   1 
ATOM   7094  N  N     . SER B 2  309 ? -13.752 -36.764 35.672  1.00 131.76 ? 309  SER B N     1 
ATOM   7095  C  CA    . SER B 2  309 ? -13.843 -35.922 36.862  1.00 131.39 ? 309  SER B CA    1 
ATOM   7096  C  C     . SER B 2  309 ? -15.264 -35.869 37.394  1.00 132.96 ? 309  SER B C     1 
ATOM   7097  O  O     . SER B 2  309 ? -15.471 -35.783 38.612  1.00 136.07 ? 309  SER B O     1 
ATOM   7098  C  CB    . SER B 2  309 ? -13.355 -34.509 36.562  1.00 135.89 ? 309  SER B CB    1 
ATOM   7099  O  OG    . SER B 2  309 ? -13.350 -33.730 37.744  1.00 143.06 ? 309  SER B OG    1 
ATOM   7100  N  N     . ASP B 2  310 ? -16.247 -35.931 36.494  1.00 132.07 ? 310  ASP B N     1 
ATOM   7101  C  CA    . ASP B 2  310 ? -17.649 -35.909 36.893  1.00 134.39 ? 310  ASP B CA    1 
ATOM   7102  C  C     . ASP B 2  310 ? -17.979 -37.072 37.819  1.00 126.03 ? 310  ASP B C     1 
ATOM   7103  O  O     . ASP B 2  310 ? -18.639 -36.893 38.850  1.00 122.16 ? 310  ASP B O     1 
ATOM   7104  C  CB    . ASP B 2  310 ? -18.525 -35.945 35.644  1.00 140.29 ? 310  ASP B CB    1 
ATOM   7105  C  CG    . ASP B 2  310 ? -18.075 -34.942 34.592  1.00 148.30 ? 310  ASP B CG    1 
ATOM   7106  O  OD1   . ASP B 2  310 ? -17.681 -35.388 33.490  1.00 146.77 ? 310  ASP B OD1   1 
ATOM   7107  O  OD2   . ASP B 2  310 ? -18.071 -33.719 34.880  1.00 143.17 ? 310  ASP B OD2   1 
ATOM   7108  N  N     . ILE B 2  311 ? -17.542 -38.280 37.452  1.00 123.67 ? 311  ILE B N     1 
ATOM   7109  C  CA    . ILE B 2  311 ? -17.738 -39.453 38.303  1.00 122.47 ? 311  ILE B CA    1 
ATOM   7110  C  C     . ILE B 2  311 ? -16.960 -39.313 39.608  1.00 119.36 ? 311  ILE B C     1 
ATOM   7111  O  O     . ILE B 2  311 ? -17.451 -39.677 40.686  1.00 114.27 ? 311  ILE B O     1 
ATOM   7112  C  CB    . ILE B 2  311 ? -17.346 -40.739 37.545  1.00 109.58 ? 311  ILE B CB    1 
ATOM   7113  C  CG1   . ILE B 2  311 ? -18.399 -41.109 36.503  1.00 103.28 ? 311  ILE B CG1   1 
ATOM   7114  C  CG2   . ILE B 2  311 ? -17.113 -41.894 38.499  1.00 109.10 ? 311  ILE B CG2   1 
ATOM   7115  C  CD1   . ILE B 2  311 ? -18.244 -40.411 35.202  1.00 121.63 ? 311  ILE B CD1   1 
ATOM   7116  N  N     . LYS B 2  312 ? -15.727 -38.804 39.532  1.00 118.42 ? 312  LYS B N     1 
ATOM   7117  C  CA    . LYS B 2  312 ? -14.895 -38.726 40.726  1.00 116.69 ? 312  LYS B CA    1 
ATOM   7118  C  C     . LYS B 2  312 ? -15.509 -37.796 41.756  1.00 119.76 ? 312  LYS B C     1 
ATOM   7119  O  O     . LYS B 2  312 ? -15.394 -38.036 42.963  1.00 122.90 ? 312  LYS B O     1 
ATOM   7120  C  CB    . LYS B 2  312 ? -13.483 -38.265 40.370  1.00 126.44 ? 312  LYS B CB    1 
ATOM   7121  C  CG    . LYS B 2  312 ? -12.644 -39.281 39.615  1.00 119.60 ? 312  LYS B CG    1 
ATOM   7122  C  CD    . LYS B 2  312 ? -11.257 -38.726 39.393  1.00 115.23 ? 312  LYS B CD    1 
ATOM   7123  C  CE    . LYS B 2  312 ? -10.497 -39.574 38.405  1.00 125.99 ? 312  LYS B CE    1 
ATOM   7124  N  NZ    . LYS B 2  312 ? -9.201  -38.953 38.005  1.00 140.73 ? 312  LYS B NZ    1 
ATOM   7125  N  N     . HIS B 2  313 ? -16.149 -36.721 41.300  1.00 125.48 ? 313  HIS B N     1 
ATOM   7126  C  CA    . HIS B 2  313 ? -16.685 -35.704 42.195  1.00 132.86 ? 313  HIS B CA    1 
ATOM   7127  C  C     . HIS B 2  313 ? -18.180 -35.846 42.459  1.00 125.56 ? 313  HIS B C     1 
ATOM   7128  O  O     . HIS B 2  313 ? -18.726 -35.068 43.246  1.00 128.13 ? 313  HIS B O     1 
ATOM   7129  C  CB    . HIS B 2  313 ? -16.372 -34.309 41.640  1.00 134.02 ? 313  HIS B CB    1 
ATOM   7130  C  CG    . HIS B 2  313 ? -14.918 -33.965 41.716  1.00 146.11 ? 313  HIS B CG    1 
ATOM   7131  N  ND1   . HIS B 2  313 ? -14.028 -34.285 40.711  1.00 144.25 ? 313  HIS B ND1   1 
ATOM   7132  C  CD2   . HIS B 2  313 ? -14.188 -33.371 42.691  1.00 157.06 ? 313  HIS B CD2   1 
ATOM   7133  C  CE1   . HIS B 2  313 ? -12.816 -33.888 41.058  1.00 153.71 ? 313  HIS B CE1   1 
ATOM   7134  N  NE2   . HIS B 2  313 ? -12.886 -33.329 42.254  1.00 167.17 ? 313  HIS B NE2   1 
ATOM   7135  N  N     . SER B 2  314 ? -18.848 -36.831 41.859  1.00 122.65 ? 314  SER B N     1 
ATOM   7136  C  CA    . SER B 2  314 ? -20.264 -37.038 42.139  1.00 117.60 ? 314  SER B CA    1 
ATOM   7137  C  C     . SER B 2  314 ? -20.446 -37.635 43.527  1.00 111.25 ? 314  SER B C     1 
ATOM   7138  O  O     . SER B 2  314 ? -19.680 -38.502 43.951  1.00 115.00 ? 314  SER B O     1 
ATOM   7139  C  CB    . SER B 2  314 ? -20.888 -37.965 41.093  1.00 115.12 ? 314  SER B CB    1 
ATOM   7140  O  OG    . SER B 2  314 ? -22.285 -38.094 41.300  1.00 107.80 ? 314  SER B OG    1 
ATOM   7141  N  N     . LYS B 2  315 ? -21.470 -37.189 44.246  1.00 106.97 ? 315  LYS B N     1 
ATOM   7142  C  CA    . LYS B 2  315 ? -21.663 -37.831 45.541  1.00 112.76 ? 315  LYS B CA    1 
ATOM   7143  C  C     . LYS B 2  315 ? -22.391 -39.157 45.400  1.00 110.68 ? 315  LYS B C     1 
ATOM   7144  O  O     . LYS B 2  315 ? -22.100 -40.108 46.131  1.00 113.86 ? 315  LYS B O     1 
ATOM   7145  C  CB    . LYS B 2  315 ? -22.403 -36.917 46.512  1.00 121.69 ? 315  LYS B CB    1 
ATOM   7146  C  CG    . LYS B 2  315 ? -22.934 -37.661 47.731  1.00 125.09 ? 315  LYS B CG    1 
ATOM   7147  C  CD    . LYS B 2  315 ? -22.805 -36.769 48.945  1.00 145.96 ? 315  LYS B CD    1 
ATOM   7148  C  CE    . LYS B 2  315 ? -23.587 -37.266 50.139  1.00 147.21 ? 315  LYS B CE    1 
ATOM   7149  N  NZ    . LYS B 2  315 ? -23.195 -36.522 51.370  1.00 139.03 ? 315  LYS B NZ    1 
ATOM   7150  N  N     . ILE B 2  316 ? -23.336 -39.237 44.481  1.00 112.03 ? 316  ILE B N     1 
ATOM   7151  C  CA    . ILE B 2  316 ? -24.130 -40.437 44.302  1.00 103.00 ? 316  ILE B CA    1 
ATOM   7152  C  C     . ILE B 2  316 ? -23.920 -40.939 42.883  1.00 98.28  ? 316  ILE B C     1 
ATOM   7153  O  O     . ILE B 2  316 ? -23.700 -40.155 41.954  1.00 105.38 ? 316  ILE B O     1 
ATOM   7154  C  CB    . ILE B 2  316 ? -25.623 -40.179 44.594  1.00 98.72  ? 316  ILE B CB    1 
ATOM   7155  C  CG1   . ILE B 2  316 ? -26.277 -39.472 43.414  1.00 96.51  ? 316  ILE B CG1   1 
ATOM   7156  C  CG2   . ILE B 2  316 ? -25.774 -39.332 45.851  1.00 96.70  ? 316  ILE B CG2   1 
ATOM   7157  C  CD1   . ILE B 2  316 ? -27.767 -39.565 43.413  1.00 104.68 ? 316  ILE B CD1   1 
ATOM   7158  N  N     . TRP B 2  317 ? -23.931 -42.262 42.734  1.00 95.30  ? 317  TRP B N     1 
ATOM   7159  C  CA    . TRP B 2  317 ? -24.015 -42.928 41.439  1.00 91.85  ? 317  TRP B CA    1 
ATOM   7160  C  C     . TRP B 2  317 ? -24.847 -44.190 41.584  1.00 92.10  ? 317  TRP B C     1 
ATOM   7161  O  O     . TRP B 2  317 ? -24.946 -44.766 42.671  1.00 88.00  ? 317  TRP B O     1 
ATOM   7162  C  CB    . TRP B 2  317 ? -22.633 -43.239 40.826  1.00 89.73  ? 317  TRP B CB    1 
ATOM   7163  C  CG    . TRP B 2  317 ? -21.669 -43.941 41.717  1.00 85.28  ? 317  TRP B CG    1 
ATOM   7164  C  CD1   . TRP B 2  317 ? -21.831 -44.226 43.041  1.00 94.14  ? 317  TRP B CD1   1 
ATOM   7165  C  CD2   . TRP B 2  317 ? -20.371 -44.428 41.359  1.00 86.21  ? 317  TRP B CD2   1 
ATOM   7166  N  NE1   . TRP B 2  317 ? -20.714 -44.855 43.530  1.00 100.22 ? 317  TRP B NE1   1 
ATOM   7167  C  CE2   . TRP B 2  317 ? -19.803 -44.991 42.517  1.00 92.31  ? 317  TRP B CE2   1 
ATOM   7168  C  CE3   . TRP B 2  317 ? -19.636 -44.445 40.173  1.00 87.01  ? 317  TRP B CE3   1 
ATOM   7169  C  CZ2   . TRP B 2  317 ? -18.536 -45.564 42.526  1.00 100.82 ? 317  TRP B CZ2   1 
ATOM   7170  C  CZ3   . TRP B 2  317 ? -18.377 -45.014 40.183  1.00 101.76 ? 317  TRP B CZ3   1 
ATOM   7171  C  CH2   . TRP B 2  317 ? -17.841 -45.567 41.353  1.00 108.24 ? 317  TRP B CH2   1 
ATOM   7172  N  N     . PHE B 2  318 ? -25.487 -44.587 40.486  1.00 93.16  ? 318  PHE B N     1 
ATOM   7173  C  CA    . PHE B 2  318 ? -26.364 -45.751 40.508  1.00 93.32  ? 318  PHE B CA    1 
ATOM   7174  C  C     . PHE B 2  318 ? -26.274 -46.501 39.184  1.00 91.41  ? 318  PHE B C     1 
ATOM   7175  O  O     . PHE B 2  318 ? -25.986 -45.905 38.149  1.00 96.41  ? 318  PHE B O     1 
ATOM   7176  C  CB    . PHE B 2  318 ? -27.802 -45.307 40.803  1.00 98.71  ? 318  PHE B CB    1 
ATOM   7177  C  CG    . PHE B 2  318 ? -28.404 -44.433 39.744  1.00 81.27  ? 318  PHE B CG    1 
ATOM   7178  C  CD1   . PHE B 2  318 ? -28.131 -43.088 39.705  1.00 85.53  ? 318  PHE B CD1   1 
ATOM   7179  C  CD2   . PHE B 2  318 ? -29.264 -44.968 38.805  1.00 86.94  ? 318  PHE B CD2   1 
ATOM   7180  C  CE1   . PHE B 2  318 ? -28.690 -42.285 38.733  1.00 91.66  ? 318  PHE B CE1   1 
ATOM   7181  C  CE2   . PHE B 2  318 ? -29.832 -44.172 37.833  1.00 91.02  ? 318  PHE B CE2   1 
ATOM   7182  C  CZ    . PHE B 2  318 ? -29.540 -42.821 37.794  1.00 89.00  ? 318  PHE B CZ    1 
ATOM   7183  N  N     . GLY B 2  319 ? -26.544 -47.802 39.201  1.00 87.74  ? 319  GLY B N     1 
ATOM   7184  C  CA    . GLY B 2  319 ? -26.424 -48.509 37.936  1.00 95.34  ? 319  GLY B CA    1 
ATOM   7185  C  C     . GLY B 2  319 ? -26.904 -49.942 38.009  1.00 93.02  ? 319  GLY B C     1 
ATOM   7186  O  O     . GLY B 2  319 ? -27.302 -50.440 39.064  1.00 103.30 ? 319  GLY B O     1 
ATOM   7187  N  N     . SER B 2  320 ? -26.822 -50.617 36.865  1.00 90.95  ? 320  SER B N     1 
ATOM   7188  C  CA    . SER B 2  320 ? -27.267 -52.002 36.784  1.00 90.85  ? 320  SER B CA    1 
ATOM   7189  C  C     . SER B 2  320 ? -26.345 -52.779 35.856  1.00 99.08  ? 320  SER B C     1 
ATOM   7190  O  O     . SER B 2  320 ? -25.576 -52.208 35.076  1.00 110.94 ? 320  SER B O     1 
ATOM   7191  C  CB    . SER B 2  320 ? -28.724 -52.115 36.301  1.00 92.52  ? 320  SER B CB    1 
ATOM   7192  O  OG    . SER B 2  320 ? -29.156 -53.469 36.229  1.00 97.73  ? 320  SER B OG    1 
ATOM   7193  N  N     . ASN B 2  321 ? -26.412 -54.103 35.972  1.00 102.77 ? 321  ASN B N     1 
ATOM   7194  C  CA    . ASN B 2  321 ? -25.647 -54.997 35.112  1.00 100.37 ? 321  ASN B CA    1 
ATOM   7195  C  C     . ASN B 2  321 ? -26.425 -55.263 33.835  1.00 93.46  ? 321  ASN B C     1 
ATOM   7196  O  O     . ASN B 2  321 ? -27.564 -55.725 33.885  1.00 101.55 ? 321  ASN B O     1 
ATOM   7197  C  CB    . ASN B 2  321 ? -25.358 -56.316 35.826  1.00 94.08  ? 321  ASN B CB    1 
ATOM   7198  C  CG    . ASN B 2  321 ? -24.687 -57.325 34.929  1.00 93.22  ? 321  ASN B CG    1 
ATOM   7199  O  OD1   . ASN B 2  321 ? -24.111 -56.976 33.908  1.00 94.27  ? 321  ASN B OD1   1 
ATOM   7200  N  ND2   . ASN B 2  321 ? -24.779 -58.588 35.294  1.00 99.28  ? 321  ASN B ND2   1 
ATOM   7201  N  N     . MET B 2  322 ? -25.796 -55.013 32.696  1.00 94.35  ? 322  MET B N     1 
ATOM   7202  C  CA    . MET B 2  322 ? -26.460 -55.270 31.427  1.00 93.41  ? 322  MET B CA    1 
ATOM   7203  C  C     . MET B 2  322 ? -26.390 -56.735 31.029  1.00 102.82 ? 322  MET B C     1 
ATOM   7204  O  O     . MET B 2  322 ? -27.212 -57.182 30.222  1.00 106.54 ? 322  MET B O     1 
ATOM   7205  C  CB    . MET B 2  322 ? -25.848 -54.394 30.352  1.00 95.52  ? 322  MET B CB    1 
ATOM   7206  C  CG    . MET B 2  322 ? -26.002 -52.928 30.659  1.00 100.96 ? 322  MET B CG    1 
ATOM   7207  S  SD    . MET B 2  322 ? -25.331 -51.927 29.345  1.00 107.93 ? 322  MET B SD    1 
ATOM   7208  C  CE    . MET B 2  322 ? -26.406 -52.469 28.009  1.00 106.92 ? 322  MET B CE    1 
ATOM   7209  N  N     . GLY B 2  323 ? -25.414 -57.473 31.550  1.00 110.14 ? 323  GLY B N     1 
ATOM   7210  C  CA    . GLY B 2  323 ? -25.303 -58.902 31.325  1.00 118.69 ? 323  GLY B CA    1 
ATOM   7211  C  C     . GLY B 2  323 ? -24.045 -59.351 30.612  1.00 122.19 ? 323  GLY B C     1 
ATOM   7212  O  O     . GLY B 2  323 ? -23.389 -60.306 31.040  1.00 125.63 ? 323  GLY B O     1 
ATOM   7213  N  N     . ASN B 2  324 ? -23.695 -58.651 29.536  1.00 119.30 ? 324  ASN B N     1 
ATOM   7214  C  CA    . ASN B 2  324 ? -22.557 -58.988 28.678  1.00 125.31 ? 324  ASN B CA    1 
ATOM   7215  C  C     . ASN B 2  324 ? -21.260 -58.395 29.210  1.00 116.47 ? 324  ASN B C     1 
ATOM   7216  O  O     . ASN B 2  324 ? -20.474 -57.793 28.483  1.00 115.85 ? 324  ASN B O     1 
ATOM   7217  C  CB    . ASN B 2  324 ? -22.826 -58.525 27.248  1.00 129.85 ? 324  ASN B CB    1 
ATOM   7218  C  CG    . ASN B 2  324 ? -24.012 -59.234 26.621  1.00 140.18 ? 324  ASN B CG    1 
ATOM   7219  O  OD1   . ASN B 2  324 ? -24.216 -60.430 26.842  1.00 143.35 ? 324  ASN B OD1   1 
ATOM   7220  N  ND2   . ASN B 2  324 ? -24.775 -58.517 25.807  1.00 138.71 ? 324  ASN B ND2   1 
ATOM   7221  N  N     . GLY B 2  325 ? -21.025 -58.595 30.502  1.00 112.90 ? 325  GLY B N     1 
ATOM   7222  C  CA    . GLY B 2  325 ? -19.889 -57.994 31.172  1.00 113.21 ? 325  GLY B CA    1 
ATOM   7223  C  C     . GLY B 2  325 ? -19.828 -56.485 31.111  1.00 105.03 ? 325  GLY B C     1 
ATOM   7224  O  O     . GLY B 2  325 ? -18.750 -55.916 31.275  1.00 100.72 ? 325  GLY B O     1 
ATOM   7225  N  N     . THR B 2  326 ? -20.963 -55.814 30.916  1.00 113.86 ? 326  THR B N     1 
ATOM   7226  C  CA    . THR B 2  326 ? -21.011 -54.365 30.766  1.00 113.36 ? 326  THR B CA    1 
ATOM   7227  C  C     . THR B 2  326 ? -22.021 -53.774 31.748  1.00 111.20 ? 326  THR B C     1 
ATOM   7228  O  O     . THR B 2  326 ? -23.132 -54.291 31.903  1.00 112.08 ? 326  THR B O     1 
ATOM   7229  C  CB    . THR B 2  326 ? -21.354 -53.972 29.313  1.00 111.53 ? 326  THR B CB    1 
ATOM   7230  O  OG1   . THR B 2  326 ? -22.624 -54.517 28.940  1.00 119.83 ? 326  THR B OG1   1 
ATOM   7231  C  CG2   . THR B 2  326 ? -20.305 -54.505 28.355  1.00 116.50 ? 326  THR B CG2   1 
ATOM   7232  N  N     . ILE B 2  327 ? -21.624 -52.710 32.414  1.00 105.98 ? 327  ILE B N     1 
ATOM   7233  C  CA    . ILE B 2  327 ? -22.445 -52.037 33.408  1.00 98.42  ? 327  ILE B CA    1 
ATOM   7234  C  C     . ILE B 2  327 ? -22.991 -50.763 32.787  1.00 105.21 ? 327  ILE B C     1 
ATOM   7235  O  O     . ILE B 2  327 ? -22.358 -50.147 31.916  1.00 113.06 ? 327  ILE B O     1 
ATOM   7236  C  CB    . ILE B 2  327 ? -21.640 -51.752 34.696  1.00 97.18  ? 327  ILE B CB    1 
ATOM   7237  C  CG1   . ILE B 2  327 ? -21.063 -53.051 35.246  1.00 96.82  ? 327  ILE B CG1   1 
ATOM   7238  C  CG2   . ILE B 2  327 ? -22.499 -51.086 35.752  1.00 97.18  ? 327  ILE B CG2   1 
ATOM   7239  C  CD1   . ILE B 2  327 ? -22.119 -54.028 35.675  1.00 108.51 ? 327  ILE B CD1   1 
ATOM   7240  N  N     . PHE B 2  328 ? -24.200 -50.399 33.195  1.00 99.87  ? 328  PHE B N     1 
ATOM   7241  C  CA    . PHE B 2  328 ? -24.816 -49.134 32.833  1.00 94.57  ? 328  PHE B CA    1 
ATOM   7242  C  C     . PHE B 2  328 ? -24.848 -48.286 34.097  1.00 92.04  ? 328  PHE B C     1 
ATOM   7243  O  O     . PHE B 2  328 ? -25.464 -48.683 35.088  1.00 87.18  ? 328  PHE B O     1 
ATOM   7244  C  CB    . PHE B 2  328 ? -26.208 -49.373 32.246  1.00 92.98  ? 328  PHE B CB    1 
ATOM   7245  C  CG    . PHE B 2  328 ? -26.918 -48.129 31.845  1.00 96.53  ? 328  PHE B CG    1 
ATOM   7246  C  CD1   . PHE B 2  328 ? -26.629 -47.521 30.637  1.00 102.71 ? 328  PHE B CD1   1 
ATOM   7247  C  CD2   . PHE B 2  328 ? -27.899 -47.586 32.647  1.00 97.39  ? 328  PHE B CD2   1 
ATOM   7248  C  CE1   . PHE B 2  328 ? -27.278 -46.369 30.251  1.00 102.31 ? 328  PHE B CE1   1 
ATOM   7249  C  CE2   . PHE B 2  328 ? -28.560 -46.443 32.268  1.00 99.30  ? 328  PHE B CE2   1 
ATOM   7250  C  CZ    . PHE B 2  328 ? -28.249 -45.829 31.067  1.00 106.65 ? 328  PHE B CZ    1 
ATOM   7251  N  N     . LEU B 2  329 ? -24.129 -47.160 34.080  1.00 93.94  ? 329  LEU B N     1 
ATOM   7252  C  CA    . LEU B 2  329 ? -23.928 -46.283 35.226  1.00 91.72  ? 329  LEU B CA    1 
ATOM   7253  C  C     . LEU B 2  329 ? -24.583 -44.929 34.999  1.00 92.52  ? 329  LEU B C     1 
ATOM   7254  O  O     . LEU B 2  329 ? -24.759 -44.486 33.862  1.00 93.85  ? 329  LEU B O     1 
ATOM   7255  C  CB    . LEU B 2  329 ? -22.446 -46.031 35.477  1.00 89.87  ? 329  LEU B CB    1 
ATOM   7256  C  CG    . LEU B 2  329 ? -21.652 -47.214 35.995  1.00 106.34 ? 329  LEU B CG    1 
ATOM   7257  C  CD1   . LEU B 2  329 ? -20.231 -46.749 36.247  1.00 109.12 ? 329  LEU B CD1   1 
ATOM   7258  C  CD2   . LEU B 2  329 ? -22.311 -47.782 37.239  1.00 113.55 ? 329  LEU B CD2   1 
ATOM   7259  N  N     . GLY B 2  330 ? -24.898 -44.248 36.101  1.00 100.11 ? 330  GLY B N     1 
ATOM   7260  C  CA    . GLY B 2  330 ? -25.506 -42.932 36.030  1.00 95.52  ? 330  GLY B CA    1 
ATOM   7261  C  C     . GLY B 2  330 ? -25.192 -42.024 37.207  1.00 95.61  ? 330  GLY B C     1 
ATOM   7262  O  O     . GLY B 2  330 ? -25.136 -42.483 38.358  1.00 104.90 ? 330  GLY B O     1 
ATOM   7263  N  N     . ILE B 2  331 ? -24.993 -40.736 36.924  1.00 97.85  ? 331  ILE B N     1 
ATOM   7264  C  CA    . ILE B 2  331 ? -24.732 -39.733 37.968  1.00 101.47 ? 331  ILE B CA    1 
ATOM   7265  C  C     . ILE B 2  331 ? -25.548 -38.485 37.678  1.00 98.54  ? 331  ILE B C     1 
ATOM   7266  O  O     . ILE B 2  331 ? -25.842 -38.156 36.522  1.00 100.36 ? 331  ILE B O     1 
ATOM   7267  C  CB    . ILE B 2  331 ? -23.230 -39.348 38.072  1.00 107.03 ? 331  ILE B CB    1 
ATOM   7268  C  CG1   . ILE B 2  331 ? -22.754 -38.548 36.851  1.00 117.09 ? 331  ILE B CG1   1 
ATOM   7269  C  CG2   . ILE B 2  331 ? -22.344 -40.560 38.312  1.00 97.99  ? 331  ILE B CG2   1 
ATOM   7270  C  CD1   . ILE B 2  331 ? -21.320 -38.011 36.993  1.00 116.87 ? 331  ILE B CD1   1 
ATOM   7271  N  N     . PRO B 2  332 ? -25.959 -37.779 38.725  1.00 99.56  ? 332  PRO B N     1 
ATOM   7272  C  CA    . PRO B 2  332 ? -26.692 -36.525 38.521  1.00 111.34 ? 332  PRO B CA    1 
ATOM   7273  C  C     . PRO B 2  332 ? -25.777 -35.326 38.294  1.00 127.63 ? 332  PRO B C     1 
ATOM   7274  O  O     . PRO B 2  332 ? -24.642 -35.272 38.777  1.00 125.61 ? 332  PRO B O     1 
ATOM   7275  C  CB    . PRO B 2  332 ? -27.485 -36.380 39.830  1.00 118.04 ? 332  PRO B CB    1 
ATOM   7276  C  CG    . PRO B 2  332 ? -26.650 -37.066 40.837  1.00 113.75 ? 332  PRO B CG    1 
ATOM   7277  C  CD    . PRO B 2  332 ? -25.989 -38.217 40.130  1.00 97.13  ? 332  PRO B CD    1 
ATOM   7278  N  N     . GLY B 2  333 ? -26.286 -34.362 37.524  1.00 128.07 ? 333  GLY B N     1 
ATOM   7279  C  CA    . GLY B 2  333 ? -25.582 -33.109 37.311  1.00 124.93 ? 333  GLY B CA    1 
ATOM   7280  C  C     . GLY B 2  333 ? -26.522 -31.920 37.360  1.00 137.93 ? 333  GLY B C     1 
ATOM   7281  O  O     . GLY B 2  333 ? -27.704 -32.019 37.039  1.00 145.16 ? 333  GLY B O     1 
ATOM   7282  N  N     . ASP B 2  334 ? -25.969 -30.771 37.754  1.00 147.41 ? 334  ASP B N     1 
ATOM   7283  C  CA    . ASP B 2  334 ? -26.752 -29.542 37.904  1.00 152.89 ? 334  ASP B CA    1 
ATOM   7284  C  C     . ASP B 2  334 ? -26.526 -28.535 36.783  1.00 157.60 ? 334  ASP B C     1 
ATOM   7285  O  O     . ASP B 2  334 ? -26.733 -28.833 35.602  1.00 151.61 ? 334  ASP B O     1 
ATOM   7286  C  CB    . ASP B 2  334 ? -26.458 -28.891 39.265  1.00 156.50 ? 334  ASP B CB    1 
ATOM   7287  C  CG    . ASP B 2  334 ? -27.471 -27.813 39.645  1.00 152.82 ? 334  ASP B CG    1 
ATOM   7288  O  OD1   . ASP B 2  334 ? -28.671 -28.131 39.796  1.00 149.86 ? 334  ASP B OD1   1 
ATOM   7289  O  OD2   . ASP B 2  334 ? -27.055 -26.640 39.776  1.00 148.73 ? 334  ASP B OD2   1 
ATOM   7290  N  N     . ASN B 2  335 ? -26.092 -27.327 37.178  1.00 163.85 ? 335  ASN B N     1 
ATOM   7291  C  CA    . ASN B 2  335 ? -25.828 -26.160 36.334  1.00 163.64 ? 335  ASN B CA    1 
ATOM   7292  C  C     . ASN B 2  335 ? -27.009 -25.755 35.456  1.00 158.02 ? 335  ASN B C     1 
ATOM   7293  O  O     . ASN B 2  335 ? -28.062 -25.397 35.983  1.00 150.65 ? 335  ASN B O     1 
ATOM   7294  C  CB    . ASN B 2  335 ? -24.576 -26.395 35.492  1.00 162.22 ? 335  ASN B CB    1 
ATOM   7295  C  CG    . ASN B 2  335 ? -23.304 -26.293 36.316  1.00 158.17 ? 335  ASN B CG    1 
ATOM   7296  O  OD1   . ASN B 2  335 ? -23.218 -25.495 37.257  1.00 150.75 ? 335  ASN B OD1   1 
ATOM   7297  N  ND2   . ASN B 2  335 ? -22.315 -27.101 35.974  1.00 158.36 ? 335  ASN B ND2   1 
ATOM   7298  N  N     . LYS B 2  336 ? -26.834 -25.776 34.141  1.00 154.38 ? 336  LYS B N     1 
ATOM   7299  C  CA    . LYS B 2  336 ? -27.888 -25.308 33.240  1.00 146.64 ? 336  LYS B CA    1 
ATOM   7300  C  C     . LYS B 2  336 ? -29.145 -26.161 33.353  1.00 143.04 ? 336  LYS B C     1 
ATOM   7301  O  O     . LYS B 2  336 ? -30.258 -25.640 33.350  1.00 138.82 ? 336  LYS B O     1 
ATOM   7302  C  CB    . LYS B 2  336 ? -27.391 -25.301 31.796  1.00 143.21 ? 336  LYS B CB    1 
ATOM   7303  N  N     . SER B 2  340 ? -26.617 -29.648 33.329  1.00 142.44 ? 340  SER B N     1 
ATOM   7304  C  CA    . SER B 2  340 ? -27.885 -29.289 32.697  1.00 147.44 ? 340  SER B CA    1 
ATOM   7305  C  C     . SER B 2  340 ? -28.897 -30.431 32.785  1.00 145.85 ? 340  SER B C     1 
ATOM   7306  O  O     . SER B 2  340 ? -29.990 -30.260 33.327  1.00 137.40 ? 340  SER B O     1 
ATOM   7307  C  CB    . SER B 2  340 ? -27.664 -28.891 31.235  1.00 145.23 ? 340  SER B CB    1 
ATOM   7308  N  N     . GLU B 2  341 ? -28.521 -31.593 32.249  1.00 157.09 ? 341  GLU B N     1 
ATOM   7309  C  CA    . GLU B 2  341 ? -29.397 -32.758 32.261  1.00 143.65 ? 341  GLU B CA    1 
ATOM   7310  C  C     . GLU B 2  341 ? -29.585 -33.289 33.675  1.00 136.17 ? 341  GLU B C     1 
ATOM   7311  O  O     . GLU B 2  341 ? -28.737 -33.102 34.553  1.00 141.31 ? 341  GLU B O     1 
ATOM   7312  C  CB    . GLU B 2  341 ? -28.839 -33.880 31.376  1.00 138.13 ? 341  GLU B CB    1 
ATOM   7313  C  CG    . GLU B 2  341 ? -29.353 -33.896 29.933  1.00 144.29 ? 341  GLU B CG    1 
ATOM   7314  C  CD    . GLU B 2  341 ? -30.811 -34.364 29.783  1.00 146.88 ? 341  GLU B CD    1 
ATOM   7315  O  OE1   . GLU B 2  341 ? -31.543 -34.494 30.798  1.00 141.26 ? 341  GLU B OE1   1 
ATOM   7316  O  OE2   . GLU B 2  341 ? -31.221 -34.598 28.623  1.00 140.39 ? 341  GLU B OE2   1 
ATOM   7317  N  N     . ALA B 2  342 ? -30.721 -33.960 33.888  1.00 129.66 ? 342  ALA B N     1 
ATOM   7318  C  CA    . ALA B 2  342 ? -31.003 -34.549 35.192  1.00 123.22 ? 342  ALA B CA    1 
ATOM   7319  C  C     . ALA B 2  342 ? -30.014 -35.657 35.521  1.00 108.73 ? 342  ALA B C     1 
ATOM   7320  O  O     . ALA B 2  342 ? -29.546 -35.766 36.661  1.00 101.19 ? 342  ALA B O     1 
ATOM   7321  C  CB    . ALA B 2  342 ? -32.431 -35.083 35.221  1.00 119.22 ? 342  ALA B CB    1 
ATOM   7322  N  N     . PHE B 2  343 ? -29.682 -36.486 34.532  1.00 111.62 ? 343  PHE B N     1 
ATOM   7323  C  CA    . PHE B 2  343 ? -28.750 -37.583 34.730  1.00 105.22 ? 343  PHE B CA    1 
ATOM   7324  C  C     . PHE B 2  343 ? -27.833 -37.716 33.521  1.00 110.68 ? 343  PHE B C     1 
ATOM   7325  O  O     . PHE B 2  343 ? -28.218 -37.406 32.389  1.00 116.06 ? 343  PHE B O     1 
ATOM   7326  C  CB    . PHE B 2  343 ? -29.488 -38.894 34.975  1.00 100.78 ? 343  PHE B CB    1 
ATOM   7327  C  CG    . PHE B 2  343 ? -30.091 -38.985 36.336  1.00 98.05  ? 343  PHE B CG    1 
ATOM   7328  C  CD1   . PHE B 2  343 ? -29.285 -39.068 37.451  1.00 99.57  ? 343  PHE B CD1   1 
ATOM   7329  C  CD2   . PHE B 2  343 ? -31.462 -39.003 36.503  1.00 92.76  ? 343  PHE B CD2   1 
ATOM   7330  C  CE1   . PHE B 2  343 ? -29.835 -39.149 38.710  1.00 98.53  ? 343  PHE B CE1   1 
ATOM   7331  C  CE2   . PHE B 2  343 ? -32.014 -39.094 37.757  1.00 92.32  ? 343  PHE B CE2   1 
ATOM   7332  C  CZ    . PHE B 2  343 ? -31.200 -39.167 38.863  1.00 98.24  ? 343  PHE B CZ    1 
ATOM   7333  N  N     . TYR B 2  344 ? -26.621 -38.212 33.779  1.00 105.41 ? 344  TYR B N     1 
ATOM   7334  C  CA    . TYR B 2  344 ? -25.600 -38.485 32.775  1.00 104.38 ? 344  TYR B CA    1 
ATOM   7335  C  C     . TYR B 2  344 ? -25.205 -39.947 32.897  1.00 103.66 ? 344  TYR B C     1 
ATOM   7336  O  O     . TYR B 2  344 ? -24.831 -40.390 33.990  1.00 106.18 ? 344  TYR B O     1 
ATOM   7337  C  CB    . TYR B 2  344 ? -24.347 -37.627 32.996  1.00 116.02 ? 344  TYR B CB    1 
ATOM   7338  C  CG    . TYR B 2  344 ? -24.495 -36.135 32.759  1.00 124.14 ? 344  TYR B CG    1 
ATOM   7339  C  CD1   . TYR B 2  344 ? -24.824 -35.640 31.502  1.00 123.01 ? 344  TYR B CD1   1 
ATOM   7340  C  CD2   . TYR B 2  344 ? -24.262 -35.220 33.786  1.00 125.75 ? 344  TYR B CD2   1 
ATOM   7341  C  CE1   . TYR B 2  344 ? -24.947 -34.280 31.278  1.00 128.61 ? 344  TYR B CE1   1 
ATOM   7342  C  CE2   . TYR B 2  344 ? -24.381 -33.854 33.570  1.00 133.34 ? 344  TYR B CE2   1 
ATOM   7343  C  CZ    . TYR B 2  344 ? -24.724 -33.391 32.314  1.00 138.50 ? 344  TYR B CZ    1 
ATOM   7344  O  OH    . TYR B 2  344 ? -24.844 -32.034 32.092  1.00 143.51 ? 344  TYR B OH    1 
ATOM   7345  N  N     . PHE B 2  345 ? -25.233 -40.682 31.781  1.00 106.19 ? 345  PHE B N     1 
ATOM   7346  C  CA    . PHE B 2  345 ? -25.072 -42.133 31.811  1.00 106.49 ? 345  PHE B CA    1 
ATOM   7347  C  C     . PHE B 2  345 ? -23.829 -42.576 31.044  1.00 100.79 ? 345  PHE B C     1 
ATOM   7348  O  O     . PHE B 2  345 ? -23.433 -41.959 30.047  1.00 99.43  ? 345  PHE B O     1 
ATOM   7349  C  CB    . PHE B 2  345 ? -26.325 -42.875 31.269  1.00 104.88 ? 345  PHE B CB    1 
ATOM   7350  C  CG    . PHE B 2  345 ? -27.593 -42.606 32.059  1.00 96.60  ? 345  PHE B CG    1 
ATOM   7351  C  CD1   . PHE B 2  345 ? -27.762 -43.138 33.326  1.00 95.20  ? 345  PHE B CD1   1 
ATOM   7352  C  CD2   . PHE B 2  345 ? -28.624 -41.859 31.513  1.00 90.43  ? 345  PHE B CD2   1 
ATOM   7353  C  CE1   . PHE B 2  345 ? -28.911 -42.894 34.048  1.00 87.13  ? 345  PHE B CE1   1 
ATOM   7354  C  CE2   . PHE B 2  345 ? -29.776 -41.620 32.229  1.00 96.10  ? 345  PHE B CE2   1 
ATOM   7355  C  CZ    . PHE B 2  345 ? -29.917 -42.139 33.497  1.00 91.36  ? 345  PHE B CZ    1 
ATOM   7356  N  N     . TYR B 2  346 ? -23.210 -43.643 31.558  1.00 105.42 ? 346  TYR B N     1 
ATOM   7357  C  CA    . TYR B 2  346 ? -22.011 -44.260 31.002  1.00 114.50 ? 346  TYR B CA    1 
ATOM   7358  C  C     . TYR B 2  346 ? -22.188 -45.776 30.903  1.00 103.19 ? 346  TYR B C     1 
ATOM   7359  O  O     . TYR B 2  346 ? -23.022 -46.373 31.582  1.00 101.98 ? 346  TYR B O     1 
ATOM   7360  C  CB    . TYR B 2  346 ? -20.774 -43.934 31.864  1.00 115.23 ? 346  TYR B CB    1 
ATOM   7361  C  CG    . TYR B 2  346 ? -20.443 -42.458 31.969  1.00 113.70 ? 346  TYR B CG    1 
ATOM   7362  C  CD1   . TYR B 2  346 ? -21.182 -41.606 32.779  1.00 110.52 ? 346  TYR B CD1   1 
ATOM   7363  C  CD2   . TYR B 2  346 ? -19.362 -41.925 31.283  1.00 119.13 ? 346  TYR B CD2   1 
ATOM   7364  C  CE1   . TYR B 2  346 ? -20.869 -40.248 32.876  1.00 123.61 ? 346  TYR B CE1   1 
ATOM   7365  C  CE2   . TYR B 2  346 ? -19.034 -40.573 31.383  1.00 127.25 ? 346  TYR B CE2   1 
ATOM   7366  C  CZ    . TYR B 2  346 ? -19.790 -39.734 32.174  1.00 130.31 ? 346  TYR B CZ    1 
ATOM   7367  O  OH    . TYR B 2  346 ? -19.457 -38.391 32.266  1.00 124.99 ? 346  TYR B OH    1 
ATOM   7368  N  N     . THR B 2  347 ? -21.374 -46.402 30.059  1.00 98.56  ? 347  THR B N     1 
ATOM   7369  C  CA    . THR B 2  347 ? -21.314 -47.855 29.952  1.00 99.34  ? 347  THR B CA    1 
ATOM   7370  C  C     . THR B 2  347 ? -19.875 -48.277 30.172  1.00 104.14 ? 347  THR B C     1 
ATOM   7371  O  O     . THR B 2  347 ? -18.968 -47.785 29.490  1.00 118.14 ? 347  THR B O     1 
ATOM   7372  C  CB    . THR B 2  347 ? -21.825 -48.374 28.602  1.00 104.43 ? 347  THR B CB    1 
ATOM   7373  O  OG1   . THR B 2  347 ? -21.150 -47.720 27.519  1.00 104.69 ? 347  THR B OG1   1 
ATOM   7374  C  CG2   . THR B 2  347 ? -23.318 -48.153 28.481  1.00 102.90 ? 347  THR B CG2   1 
ATOM   7375  N  N     . LEU B 2  348 ? -19.667 -49.141 31.158  1.00 97.71  ? 348  LEU B N     1 
ATOM   7376  C  CA    . LEU B 2  348 ? -18.344 -49.629 31.515  1.00 99.27  ? 348  LEU B CA    1 
ATOM   7377  C  C     . LEU B 2  348 ? -18.234 -51.080 31.075  1.00 103.06 ? 348  LEU B C     1 
ATOM   7378  O  O     . LEU B 2  348 ? -18.979 -51.928 31.568  1.00 111.31 ? 348  LEU B O     1 
ATOM   7379  C  CB    . LEU B 2  348 ? -18.118 -49.480 33.019  1.00 94.70  ? 348  LEU B CB    1 
ATOM   7380  C  CG    . LEU B 2  348 ? -16.856 -50.082 33.614  1.00 108.82 ? 348  LEU B CG    1 
ATOM   7381  C  CD1   . LEU B 2  348 ? -15.655 -49.375 33.022  1.00 121.48 ? 348  LEU B CD1   1 
ATOM   7382  C  CD2   . LEU B 2  348 ? -16.858 -49.956 35.133  1.00 114.19 ? 348  LEU B CD2   1 
ATOM   7383  N  N     . ARG B 2  349 ? -17.320 -51.364 30.147  1.00 110.00 ? 349  ARG B N     1 
ATOM   7384  C  CA    . ARG B 2  349 ? -17.167 -52.697 29.575  1.00 114.38 ? 349  ARG B CA    1 
ATOM   7385  C  C     . ARG B 2  349 ? -15.996 -53.435 30.217  1.00 116.06 ? 349  ARG B C     1 
ATOM   7386  O  O     . ARG B 2  349 ? -15.075 -52.825 30.757  1.00 117.72 ? 349  ARG B O     1 
ATOM   7387  C  CB    . ARG B 2  349 ? -16.972 -52.640 28.059  1.00 117.43 ? 349  ARG B CB    1 
ATOM   7388  C  CG    . ARG B 2  349 ? -18.041 -51.864 27.310  1.00 128.64 ? 349  ARG B CG    1 
ATOM   7389  C  CD    . ARG B 2  349 ? -17.767 -51.900 25.823  1.00 149.17 ? 349  ARG B CD    1 
ATOM   7390  N  NE    . ARG B 2  349 ? -18.706 -51.082 25.064  1.00 162.30 ? 349  ARG B NE    1 
ATOM   7391  C  CZ    . ARG B 2  349 ? -18.664 -50.943 23.744  1.00 173.71 ? 349  ARG B CZ    1 
ATOM   7392  N  NH1   . ARG B 2  349 ? -17.731 -51.571 23.036  1.00 169.65 ? 349  ARG B NH1   1 
ATOM   7393  N  NH2   . ARG B 2  349 ? -19.553 -50.176 23.128  1.00 180.56 ? 349  ARG B NH2   1 
ATOM   7394  N  N     . CYS B 2  350 ? -16.043 -54.768 30.150  1.00 117.28 ? 350  CYS B N     1 
ATOM   7395  C  CA    . CYS B 2  350 ? -14.998 -55.606 30.748  1.00 112.91 ? 350  CYS B CA    1 
ATOM   7396  C  C     . CYS B 2  350 ? -14.583 -56.762 29.823  1.00 108.36 ? 350  CYS B C     1 
ATOM   7397  O  O     . CYS B 2  350 ? -15.094 -57.881 29.904  1.00 104.61 ? 350  CYS B O     1 
ATOM   7398  C  CB    . CYS B 2  350 ? -15.463 -56.158 32.110  1.00 115.49 ? 350  CYS B CB    1 
ATOM   7399  S  SG    . CYS B 2  350 ? -16.207 -54.953 33.293  1.00 122.83 ? 350  CYS B SG    1 
ATOM   7400  N  N     . LEU C 1  13  ? -70.840 18.217  86.091  1.00 173.34 ? 396  LEU C N     1 
ATOM   7401  C  CA    . LEU C 1  13  ? -70.828 18.741  84.732  1.00 173.67 ? 396  LEU C CA    1 
ATOM   7402  C  C     . LEU C 1  13  ? -70.173 17.751  83.773  1.00 179.49 ? 396  LEU C C     1 
ATOM   7403  O  O     . LEU C 1  13  ? -70.567 17.643  82.613  1.00 180.32 ? 396  LEU C O     1 
ATOM   7404  C  CB    . LEU C 1  13  ? -70.095 20.083  84.670  1.00 165.37 ? 396  LEU C CB    1 
ATOM   7405  N  N     . LEU C 1  14  ? -69.165 17.037  84.279  1.00 184.59 ? 397  LEU C N     1 
ATOM   7406  C  CA    . LEU C 1  14  ? -68.395 16.107  83.458  1.00 176.25 ? 397  LEU C CA    1 
ATOM   7407  C  C     . LEU C 1  14  ? -69.150 14.815  83.189  1.00 180.37 ? 397  LEU C C     1 
ATOM   7408  O  O     . LEU C 1  14  ? -69.029 14.247  82.095  1.00 174.73 ? 397  LEU C O     1 
ATOM   7409  C  CB    . LEU C 1  14  ? -67.056 15.794  84.127  1.00 163.92 ? 397  LEU C CB    1 
ATOM   7410  N  N     . SER C 1  15  ? -69.913 14.326  84.167  1.00 185.98 ? 398  SER C N     1 
ATOM   7411  C  CA    . SER C 1  15  ? -70.774 13.173  83.947  1.00 183.25 ? 398  SER C CA    1 
ATOM   7412  C  C     . SER C 1  15  ? -71.860 13.447  82.914  1.00 187.05 ? 398  SER C C     1 
ATOM   7413  O  O     . SER C 1  15  ? -72.549 12.508  82.505  1.00 179.22 ? 398  SER C O     1 
ATOM   7414  C  CB    . SER C 1  15  ? -71.406 12.730  85.269  1.00 175.18 ? 398  SER C CB    1 
ATOM   7415  N  N     . LEU C 1  16  ? -72.022 14.698  82.484  1.00 194.30 ? 399  LEU C N     1 
ATOM   7416  C  CA    . LEU C 1  16  ? -73.023 15.047  81.488  1.00 197.88 ? 399  LEU C CA    1 
ATOM   7417  C  C     . LEU C 1  16  ? -72.484 14.823  80.077  1.00 195.73 ? 399  LEU C C     1 
ATOM   7418  O  O     . LEU C 1  16  ? -71.273 14.765  79.844  1.00 187.90 ? 399  LEU C O     1 
ATOM   7419  C  CB    . LEU C 1  16  ? -73.471 16.502  81.654  1.00 193.08 ? 399  LEU C CB    1 
ATOM   7420  N  N     . THR C 1  17  ? -73.413 14.693  79.131  1.00 201.97 ? 400  THR C N     1 
ATOM   7421  C  CA    . THR C 1  17  ? -73.080 14.486  77.731  1.00 190.85 ? 400  THR C CA    1 
ATOM   7422  C  C     . THR C 1  17  ? -72.862 15.833  77.039  1.00 185.63 ? 400  THR C C     1 
ATOM   7423  O  O     . THR C 1  17  ? -72.840 16.891  77.676  1.00 186.05 ? 400  THR C O     1 
ATOM   7424  C  CB    . THR C 1  17  ? -74.168 13.662  77.045  1.00 191.74 ? 400  THR C CB    1 
ATOM   7425  N  N     . ARG C 1  18  ? -72.702 15.802  75.713  1.00 179.37 ? 401  ARG C N     1 
ATOM   7426  C  CA    . ARG C 1  18  ? -72.226 16.977  74.988  1.00 170.45 ? 401  ARG C CA    1 
ATOM   7427  C  C     . ARG C 1  18  ? -73.278 18.077  74.956  1.00 179.91 ? 401  ARG C C     1 
ATOM   7428  O  O     . ARG C 1  18  ? -72.986 19.234  75.282  1.00 189.28 ? 401  ARG C O     1 
ATOM   7429  C  CB    . ARG C 1  18  ? -71.809 16.586  73.571  1.00 157.34 ? 401  ARG C CB    1 
ATOM   7430  N  N     . ARG C 1  19  ? -74.507 17.737  74.554  1.00 179.45 ? 402  ARG C N     1 
ATOM   7431  C  CA    . ARG C 1  19  ? -75.580 18.729  74.497  1.00 187.52 ? 402  ARG C CA    1 
ATOM   7432  C  C     . ARG C 1  19  ? -75.828 19.351  75.866  1.00 186.72 ? 402  ARG C C     1 
ATOM   7433  O  O     . ARG C 1  19  ? -76.080 20.560  75.982  1.00 191.64 ? 402  ARG C O     1 
ATOM   7434  C  CB    . ARG C 1  19  ? -76.857 18.081  73.959  1.00 190.28 ? 402  ARG C CB    1 
ATOM   7435  N  N     . ALA C 1  20  ? -75.730 18.538  76.918  1.00 190.73 ? 403  ALA C N     1 
ATOM   7436  C  CA    . ALA C 1  20  ? -75.931 19.029  78.276  1.00 188.75 ? 403  ALA C CA    1 
ATOM   7437  C  C     . ALA C 1  20  ? -74.881 20.064  78.653  1.00 182.20 ? 403  ALA C C     1 
ATOM   7438  O  O     . ALA C 1  20  ? -75.213 21.156  79.133  1.00 188.70 ? 403  ALA C O     1 
ATOM   7439  C  CB    . ALA C 1  20  ? -75.894 17.861  79.255  1.00 198.18 ? 403  ALA C CB    1 
ATOM   7440  N  N     . GLN C 1  21  ? -73.602 19.721  78.471  1.00 174.23 ? 404  GLN C N     1 
ATOM   7441  C  CA    . GLN C 1  21  ? -72.523 20.649  78.793  1.00 179.40 ? 404  GLN C CA    1 
ATOM   7442  C  C     . GLN C 1  21  ? -72.605 21.921  77.956  1.00 183.30 ? 404  GLN C C     1 
ATOM   7443  O  O     . GLN C 1  21  ? -72.324 23.015  78.459  1.00 185.30 ? 404  GLN C O     1 
ATOM   7444  C  CB    . GLN C 1  21  ? -71.165 19.968  78.590  1.00 180.06 ? 404  GLN C CB    1 
ATOM   7445  N  N     . LYS C 1  22  ? -72.940 21.796  76.670  1.00 179.13 ? 405  LYS C N     1 
ATOM   7446  C  CA    . LYS C 1  22  ? -73.139 22.978  75.830  1.00 172.07 ? 405  LYS C CA    1 
ATOM   7447  C  C     . LYS C 1  22  ? -74.243 23.893  76.375  1.00 171.74 ? 405  LYS C C     1 
ATOM   7448  O  O     . LYS C 1  22  ? -74.077 25.117  76.409  1.00 171.71 ? 405  LYS C O     1 
ATOM   7449  C  CB    . LYS C 1  22  ? -73.403 22.557  74.381  1.00 161.70 ? 405  LYS C CB    1 
ATOM   7450  N  N     . HIS C 1  23  ? -75.390 23.329  76.782  1.00 178.07 ? 406  HIS C N     1 
ATOM   7451  C  CA    . HIS C 1  23  ? -76.452 24.165  77.359  1.00 180.60 ? 406  HIS C CA    1 
ATOM   7452  C  C     . HIS C 1  23  ? -76.020 24.817  78.669  1.00 179.45 ? 406  HIS C C     1 
ATOM   7453  O  O     . HIS C 1  23  ? -76.059 26.045  78.817  1.00 181.77 ? 406  HIS C O     1 
ATOM   7454  C  CB    . HIS C 1  23  ? -77.725 23.346  77.612  1.00 166.29 ? 406  HIS C CB    1 
ATOM   7455  N  N     . ARG C 1  24  ? -75.630 24.000  79.646  1.00 178.66 ? 407  ARG C N     1 
ATOM   7456  C  CA    . ARG C 1  24  ? -75.349 24.517  80.978  1.00 170.55 ? 407  ARG C CA    1 
ATOM   7457  C  C     . ARG C 1  24  ? -74.155 25.463  81.010  1.00 164.89 ? 407  ARG C C     1 
ATOM   7458  O  O     . ARG C 1  24  ? -73.928 26.110  82.037  1.00 167.69 ? 407  ARG C O     1 
ATOM   7459  C  CB    . ARG C 1  24  ? -75.178 23.365  81.959  1.00 143.05 ? 407  ARG C CB    1 
ATOM   7460  N  N     . LEU C 1  25  ? -73.367 25.527  79.940  1.00 156.01 ? 408  LEU C N     1 
ATOM   7461  C  CA    . LEU C 1  25  ? -72.263 26.470  79.840  1.00 160.63 ? 408  LEU C CA    1 
ATOM   7462  C  C     . LEU C 1  25  ? -72.520 27.544  78.792  1.00 169.57 ? 408  LEU C C     1 
ATOM   7463  O  O     . LEU C 1  25  ? -71.650 28.396  78.569  1.00 166.14 ? 408  LEU C O     1 
ATOM   7464  C  CB    . LEU C 1  25  ? -70.958 25.746  79.506  1.00 158.96 ? 408  LEU C CB    1 
ATOM   7465  N  N     . ARG C 1  26  ? -73.691 27.514  78.145  1.00 171.10 ? 409  ARG C N     1 
ATOM   7466  C  CA    . ARG C 1  26  ? -74.018 28.466  77.087  1.00 165.01 ? 409  ARG C CA    1 
ATOM   7467  C  C     . ARG C 1  26  ? -73.795 29.907  77.530  1.00 166.32 ? 409  ARG C C     1 
ATOM   7468  O  O     . ARG C 1  26  ? -73.302 30.733  76.753  1.00 164.81 ? 409  ARG C O     1 
ATOM   7469  C  CB    . ARG C 1  26  ? -75.468 28.267  76.645  1.00 158.64 ? 409  ARG C CB    1 
ATOM   7470  N  N     . GLU C 1  27  ? -74.167 30.230  78.773  1.00 171.25 ? 410  GLU C N     1 
ATOM   7471  C  CA    . GLU C 1  27  ? -74.025 31.599  79.264  1.00 169.44 ? 410  GLU C CA    1 
ATOM   7472  C  C     . GLU C 1  27  ? -72.556 31.997  79.344  1.00 168.03 ? 410  GLU C C     1 
ATOM   7473  O  O     . GLU C 1  27  ? -72.145 33.035  78.801  1.00 163.47 ? 410  GLU C O     1 
ATOM   7474  C  CB    . GLU C 1  27  ? -74.699 31.735  80.635  1.00 162.24 ? 410  GLU C CB    1 
ATOM   7475  C  CG    . GLU C 1  27  ? -76.200 31.460  80.644  1.00 158.57 ? 410  GLU C CG    1 
ATOM   7476  C  CD    . GLU C 1  27  ? -76.991 32.484  79.852  1.00 162.66 ? 410  GLU C CD    1 
ATOM   7477  O  OE1   . GLU C 1  27  ? -76.548 33.647  79.776  1.00 161.56 ? 410  GLU C OE1   1 
ATOM   7478  O  OE2   . GLU C 1  27  ? -78.055 32.129  79.303  1.00 163.51 ? 410  GLU C OE2   1 
ATOM   7479  N  N     . LEU C 1  28  ? -71.746 31.172  80.016  1.00 168.86 ? 411  LEU C N     1 
ATOM   7480  C  CA    . LEU C 1  28  ? -70.318 31.448  80.076  1.00 165.12 ? 411  LEU C CA    1 
ATOM   7481  C  C     . LEU C 1  28  ? -69.703 31.397  78.689  1.00 161.84 ? 411  LEU C C     1 
ATOM   7482  O  O     . LEU C 1  28  ? -68.747 32.121  78.409  1.00 159.12 ? 411  LEU C O     1 
ATOM   7483  C  CB    . LEU C 1  28  ? -69.626 30.471  81.032  1.00 154.49 ? 411  LEU C CB    1 
ATOM   7484  C  CG    . LEU C 1  28  ? -68.104 30.592  81.151  1.00 151.72 ? 411  LEU C CG    1 
ATOM   7485  C  CD1   . LEU C 1  28  ? -67.682 31.949  81.669  1.00 155.68 ? 411  LEU C CD1   1 
ATOM   7486  C  CD2   . LEU C 1  28  ? -67.583 29.526  82.070  1.00 152.41 ? 411  LEU C CD2   1 
ATOM   7487  N  N     . LYS C 1  29  ? -70.261 30.574  77.799  1.00 160.69 ? 412  LYS C N     1 
ATOM   7488  C  CA    . LYS C 1  29  ? -69.765 30.537  76.430  1.00 161.37 ? 412  LYS C CA    1 
ATOM   7489  C  C     . LYS C 1  29  ? -69.994 31.873  75.739  1.00 159.85 ? 412  LYS C C     1 
ATOM   7490  O  O     . LYS C 1  29  ? -69.103 32.386  75.054  1.00 156.02 ? 412  LYS C O     1 
ATOM   7491  C  CB    . LYS C 1  29  ? -70.433 29.401  75.652  1.00 156.95 ? 412  LYS C CB    1 
ATOM   7492  N  N     . ILE C 1  30  ? -71.180 32.455  75.911  1.00 156.56 ? 413  ILE C N     1 
ATOM   7493  C  CA    . ILE C 1  30  ? -71.462 33.741  75.290  1.00 156.21 ? 413  ILE C CA    1 
ATOM   7494  C  C     . ILE C 1  30  ? -70.565 34.819  75.878  1.00 164.65 ? 413  ILE C C     1 
ATOM   7495  O  O     . ILE C 1  30  ? -69.996 35.637  75.145  1.00 164.14 ? 413  ILE C O     1 
ATOM   7496  C  CB    . ILE C 1  30  ? -72.952 34.093  75.441  1.00 145.91 ? 413  ILE C CB    1 
ATOM   7497  N  N     . GLN C 1  31  ? -70.381 34.806  77.201  1.00 165.09 ? 414  GLN C N     1 
ATOM   7498  C  CA    . GLN C 1  31  ? -69.523 35.808  77.831  1.00 164.83 ? 414  GLN C CA    1 
ATOM   7499  C  C     . GLN C 1  31  ? -68.073 35.665  77.375  1.00 169.52 ? 414  GLN C C     1 
ATOM   7500  O  O     . GLN C 1  31  ? -67.399 36.666  77.090  1.00 171.08 ? 414  GLN C O     1 
ATOM   7501  C  CB    . GLN C 1  31  ? -69.620 35.702  79.353  1.00 157.90 ? 414  GLN C CB    1 
ATOM   7502  N  N     . VAL C 1  32  ? -67.586 34.426  77.274  1.00 166.02 ? 415  VAL C N     1 
ATOM   7503  C  CA    . VAL C 1  32  ? -66.206 34.184  76.872  1.00 166.23 ? 415  VAL C CA    1 
ATOM   7504  C  C     . VAL C 1  32  ? -66.000 34.541  75.406  1.00 171.22 ? 415  VAL C C     1 
ATOM   7505  O  O     . VAL C 1  32  ? -64.971 35.114  75.038  1.00 173.99 ? 415  VAL C O     1 
ATOM   7506  C  CB    . VAL C 1  32  ? -65.821 32.723  77.159  1.00 151.02 ? 415  VAL C CB    1 
ATOM   7507  N  N     . LYS C 1  33  ? -66.964 34.202  74.544  1.00 165.74 ? 416  LYS C N     1 
ATOM   7508  C  CA    . LYS C 1  33  ? -66.856 34.567  73.135  1.00 163.48 ? 416  LYS C CA    1 
ATOM   7509  C  C     . LYS C 1  33  ? -66.867 36.076  72.964  1.00 174.06 ? 416  LYS C C     1 
ATOM   7510  O  O     . LYS C 1  33  ? -66.118 36.622  72.145  1.00 171.35 ? 416  LYS C O     1 
ATOM   7511  C  CB    . LYS C 1  33  ? -67.992 33.931  72.334  1.00 155.38 ? 416  LYS C CB    1 
ATOM   7512  N  N     . GLU C 1  34  ? -67.713 36.768  73.732  1.00 176.25 ? 417  GLU C N     1 
ATOM   7513  C  CA    . GLU C 1  34  ? -67.735 38.225  73.690  1.00 176.00 ? 417  GLU C CA    1 
ATOM   7514  C  C     . GLU C 1  34  ? -66.390 38.804  74.102  1.00 174.73 ? 417  GLU C C     1 
ATOM   7515  O  O     . GLU C 1  34  ? -65.817 39.633  73.388  1.00 177.79 ? 417  GLU C O     1 
ATOM   7516  C  CB    . GLU C 1  34  ? -68.851 38.756  74.588  1.00 170.28 ? 417  GLU C CB    1 
ATOM   7517  N  N     . PHE C 1  35  ? -65.869 38.374  75.255  1.00 172.67 ? 418  PHE C N     1 
ATOM   7518  C  CA    . PHE C 1  35  ? -64.575 38.870  75.718  1.00 174.01 ? 418  PHE C CA    1 
ATOM   7519  C  C     . PHE C 1  35  ? -63.471 38.551  74.720  1.00 174.21 ? 418  PHE C C     1 
ATOM   7520  O  O     . PHE C 1  35  ? -62.595 39.384  74.459  1.00 175.06 ? 418  PHE C O     1 
ATOM   7521  C  CB    . PHE C 1  35  ? -64.241 38.271  77.086  1.00 170.12 ? 418  PHE C CB    1 
ATOM   7522  N  N     . ALA C 1  36  ? -63.514 37.358  74.130  1.00 177.66 ? 419  ALA C N     1 
ATOM   7523  C  CA    . ALA C 1  36  ? -62.473 36.937  73.203  1.00 183.65 ? 419  ALA C CA    1 
ATOM   7524  C  C     . ALA C 1  36  ? -62.506 37.756  71.919  1.00 181.67 ? 419  ALA C C     1 
ATOM   7525  O  O     . ALA C 1  36  ? -61.467 38.248  71.463  1.00 178.60 ? 419  ALA C O     1 
ATOM   7526  C  CB    . ALA C 1  36  ? -62.624 35.445  72.908  1.00 177.63 ? 419  ALA C CB    1 
ATOM   7527  N  N     . ASP C 1  37  ? -63.689 37.916  71.321  1.00 177.99 ? 420  ASP C N     1 
ATOM   7528  C  CA    . ASP C 1  37  ? -63.798 38.732  70.119  1.00 180.04 ? 420  ASP C CA    1 
ATOM   7529  C  C     . ASP C 1  37  ? -63.451 40.187  70.404  1.00 182.09 ? 420  ASP C C     1 
ATOM   7530  O  O     . ASP C 1  37  ? -62.879 40.867  69.544  1.00 179.63 ? 420  ASP C O     1 
ATOM   7531  C  CB    . ASP C 1  37  ? -65.205 38.615  69.533  1.00 176.71 ? 420  ASP C CB    1 
ATOM   7532  N  N     . LYS C 1  38  ? -63.765 40.674  71.610  1.00 185.66 ? 421  LYS C N     1 
ATOM   7533  C  CA    . LYS C 1  38  ? -63.546 42.073  71.962  1.00 185.28 ? 421  LYS C CA    1 
ATOM   7534  C  C     . LYS C 1  38  ? -62.106 42.384  72.351  1.00 184.16 ? 421  LYS C C     1 
ATOM   7535  O  O     . LYS C 1  38  ? -61.714 43.554  72.307  1.00 186.51 ? 421  LYS C O     1 
ATOM   7536  C  CB    . LYS C 1  38  ? -64.484 42.485  73.104  1.00 182.78 ? 421  LYS C CB    1 
ATOM   7537  N  N     . GLU C 1  39  ? -61.309 41.385  72.734  1.00 185.45 ? 422  GLU C N     1 
ATOM   7538  C  CA    . GLU C 1  39  ? -59.959 41.644  73.226  1.00 184.69 ? 422  GLU C CA    1 
ATOM   7539  C  C     . GLU C 1  39  ? -58.859 41.038  72.373  1.00 185.43 ? 422  GLU C C     1 
ATOM   7540  O  O     . GLU C 1  39  ? -57.758 41.592  72.325  1.00 182.73 ? 422  GLU C O     1 
ATOM   7541  C  CB    . GLU C 1  39  ? -59.804 41.102  74.656  1.00 154.13 ? 422  GLU C CB    1 
ATOM   7542  N  N     . GLU C 1  40  ? -59.116 39.908  71.718  1.00 186.41 ? 423  GLU C N     1 
ATOM   7543  C  CA    . GLU C 1  40  ? -58.099 39.174  70.978  1.00 189.30 ? 423  GLU C CA    1 
ATOM   7544  C  C     . GLU C 1  40  ? -58.496 38.969  69.518  1.00 190.10 ? 423  GLU C C     1 
ATOM   7545  O  O     . GLU C 1  40  ? -57.924 38.111  68.833  1.00 179.86 ? 423  GLU C O     1 
ATOM   7546  C  CB    . GLU C 1  40  ? -57.824 37.830  71.652  1.00 187.50 ? 423  GLU C CB    1 
ATOM   7547  N  N     . GLY C 1  41  ? -59.477 39.728  69.035  1.00 191.91 ? 424  GLY C N     1 
ATOM   7548  C  CA    . GLY C 1  41  ? -59.860 39.644  67.642  1.00 187.78 ? 424  GLY C CA    1 
ATOM   7549  C  C     . GLY C 1  41  ? -60.566 38.364  67.265  1.00 188.52 ? 424  GLY C C     1 
ATOM   7550  O  O     . GLY C 1  41  ? -60.526 37.967  66.097  1.00 193.91 ? 424  GLY C O     1 
ATOM   7551  N  N     . GLY C 1  42  ? -61.212 37.703  68.223  1.00 183.34 ? 425  GLY C N     1 
ATOM   7552  C  CA    . GLY C 1  42  ? -61.958 36.492  67.956  1.00 180.50 ? 425  GLY C CA    1 
ATOM   7553  C  C     . GLY C 1  42  ? -61.152 35.216  68.042  1.00 179.83 ? 425  GLY C C     1 
ATOM   7554  O  O     . GLY C 1  42  ? -61.627 34.171  67.581  1.00 177.03 ? 425  GLY C O     1 
ATOM   7555  N  N     . ASP C 1  43  ? -59.946 35.263  68.610  1.00 189.61 ? 426  ASP C N     1 
ATOM   7556  C  CA    . ASP C 1  43  ? -59.100 34.074  68.704  1.00 184.34 ? 426  ASP C CA    1 
ATOM   7557  C  C     . ASP C 1  43  ? -59.486 33.352  69.995  1.00 178.92 ? 426  ASP C C     1 
ATOM   7558  O  O     . ASP C 1  43  ? -58.816 33.431  71.029  1.00 177.49 ? 426  ASP C O     1 
ATOM   7559  C  CB    . ASP C 1  43  ? -57.619 34.459  68.645  1.00 176.67 ? 426  ASP C CB    1 
ATOM   7560  N  N     . VAL C 1  44  ? -60.617 32.642  69.915  1.00 176.70 ? 427  VAL C N     1 
ATOM   7561  C  CA    . VAL C 1  44  ? -61.150 31.897  71.057  1.00 176.50 ? 427  VAL C CA    1 
ATOM   7562  C  C     . VAL C 1  44  ? -60.226 30.751  71.451  1.00 178.45 ? 427  VAL C C     1 
ATOM   7563  O  O     . VAL C 1  44  ? -60.083 30.435  72.642  1.00 175.76 ? 427  VAL C O     1 
ATOM   7564  C  CB    . VAL C 1  44  ? -62.582 31.405  70.757  1.00 147.78 ? 427  VAL C CB    1 
ATOM   7565  N  N     . LYS C 1  45  ? -59.635 30.076  70.459  1.00 185.35 ? 428  LYS C N     1 
ATOM   7566  C  CA    . LYS C 1  45  ? -58.738 28.949  70.721  1.00 180.06 ? 428  LYS C CA    1 
ATOM   7567  C  C     . LYS C 1  45  ? -57.580 29.344  71.636  1.00 182.67 ? 428  LYS C C     1 
ATOM   7568  O  O     . LYS C 1  45  ? -57.294 28.655  72.624  1.00 177.13 ? 428  LYS C O     1 
ATOM   7569  C  CB    . LYS C 1  45  ? -58.196 28.394  69.404  1.00 177.81 ? 428  LYS C CB    1 
ATOM   7570  N  N     . ALA C 1  46  ? -56.881 30.437  71.308  1.00 189.97 ? 429  ALA C N     1 
ATOM   7571  C  CA    . ALA C 1  46  ? -55.739 30.839  72.123  1.00 183.97 ? 429  ALA C CA    1 
ATOM   7572  C  C     . ALA C 1  46  ? -56.184 31.172  73.538  1.00 177.06 ? 429  ALA C C     1 
ATOM   7573  O  O     . ALA C 1  46  ? -55.506 30.825  74.514  1.00 173.58 ? 429  ALA C O     1 
ATOM   7574  C  CB    . ALA C 1  46  ? -55.030 32.041  71.497  1.00 177.69 ? 429  ALA C CB    1 
ATOM   7575  N  N     . VAL C 1  47  ? -57.353 31.806  73.670  1.00 177.65 ? 430  VAL C N     1 
ATOM   7576  C  CA    . VAL C 1  47  ? -57.825 32.209  74.990  1.00 180.05 ? 430  VAL C CA    1 
ATOM   7577  C  C     . VAL C 1  47  ? -58.186 30.994  75.838  1.00 173.26 ? 430  VAL C C     1 
ATOM   7578  O  O     . VAL C 1  47  ? -57.795 30.916  77.007  1.00 170.77 ? 430  VAL C O     1 
ATOM   7579  C  CB    . VAL C 1  47  ? -58.994 33.210  74.873  1.00 160.80 ? 430  VAL C CB    1 
ATOM   7580  N  N     . CYS C 1  48  ? -58.903 30.017  75.286  1.00 161.22 ? 431  CYS C N     1 
ATOM   7581  C  CA    . CYS C 1  48  ? -59.212 28.865  76.134  1.00 160.36 ? 431  CYS C CA    1 
ATOM   7582  C  C     . CYS C 1  48  ? -57.969 27.998  76.406  1.00 163.00 ? 431  CYS C C     1 
ATOM   7583  O  O     . CYS C 1  48  ? -57.819 27.475  77.518  1.00 156.27 ? 431  CYS C O     1 
ATOM   7584  C  CB    . CYS C 1  48  ? -60.386 28.043  75.573  1.00 150.85 ? 431  CYS C CB    1 
ATOM   7585  N  N     . LEU C 1  49  ? -57.064 27.811  75.431  1.00 176.39 ? 432  LEU C N     1 
ATOM   7586  C  CA    . LEU C 1  49  ? -55.841 27.056  75.740  1.00 174.35 ? 432  LEU C CA    1 
ATOM   7587  C  C     . LEU C 1  49  ? -55.026 27.742  76.845  1.00 170.39 ? 432  LEU C C     1 
ATOM   7588  O  O     . LEU C 1  49  ? -54.578 27.083  77.793  1.00 170.16 ? 432  LEU C O     1 
ATOM   7589  C  CB    . LEU C 1  49  ? -54.982 26.802  74.485  1.00 164.30 ? 432  LEU C CB    1 
ATOM   7590  N  N     . THR C 1  50  ? -54.808 29.062  76.747  1.00 164.01 ? 433  THR C N     1 
ATOM   7591  C  CA    . THR C 1  50  ? -54.031 29.727  77.793  1.00 161.95 ? 433  THR C CA    1 
ATOM   7592  C  C     . THR C 1  50  ? -54.774 29.701  79.130  1.00 166.26 ? 433  THR C C     1 
ATOM   7593  O  O     . THR C 1  50  ? -54.148 29.537  80.181  1.00 163.66 ? 433  THR C O     1 
ATOM   7594  C  CB    . THR C 1  50  ? -53.677 31.162  77.385  1.00 153.08 ? 433  THR C CB    1 
ATOM   7595  N  N     . LEU C 1  51  ? -56.105 29.855  79.116  1.00 161.61 ? 434  LEU C N     1 
ATOM   7596  C  CA    . LEU C 1  51  ? -56.879 29.765  80.355  1.00 160.19 ? 434  LEU C CA    1 
ATOM   7597  C  C     . LEU C 1  51  ? -56.695 28.423  81.034  1.00 157.61 ? 434  LEU C C     1 
ATOM   7598  O  O     . LEU C 1  51  ? -56.454 28.347  82.243  1.00 158.63 ? 434  LEU C O     1 
ATOM   7599  C  CB    . LEU C 1  51  ? -58.364 29.952  80.073  1.00 157.06 ? 434  LEU C CB    1 
ATOM   7600  C  CG    . LEU C 1  51  ? -59.029 31.306  80.211  1.00 154.77 ? 434  LEU C CG    1 
ATOM   7601  C  CD1   . LEU C 1  51  ? -60.469 31.072  79.875  1.00 152.73 ? 434  LEU C CD1   1 
ATOM   7602  C  CD2   . LEU C 1  51  ? -58.882 31.864  81.610  1.00 156.96 ? 434  LEU C CD2   1 
ATOM   7603  N  N     . PHE C 1  52  ? -56.857 27.345  80.277  1.00 158.07 ? 435  PHE C N     1 
ATOM   7604  C  CA    . PHE C 1  52  ? -56.779 26.038  80.899  1.00 155.40 ? 435  PHE C CA    1 
ATOM   7605  C  C     . PHE C 1  52  ? -55.359 25.735  81.352  1.00 157.74 ? 435  PHE C C     1 
ATOM   7606  O  O     . PHE C 1  52  ? -55.162 25.196  82.445  1.00 156.93 ? 435  PHE C O     1 
ATOM   7607  C  CB    . PHE C 1  52  ? -57.297 24.973  79.945  1.00 157.13 ? 435  PHE C CB    1 
ATOM   7608  C  CG    . PHE C 1  52  ? -57.352 23.614  80.551  1.00 159.18 ? 435  PHE C CG    1 
ATOM   7609  C  CD1   . PHE C 1  52  ? -57.737 23.446  81.867  1.00 158.77 ? 435  PHE C CD1   1 
ATOM   7610  C  CD2   . PHE C 1  52  ? -57.033 22.500  79.806  1.00 165.18 ? 435  PHE C CD2   1 
ATOM   7611  C  CE1   . PHE C 1  52  ? -57.789 22.184  82.429  1.00 158.93 ? 435  PHE C CE1   1 
ATOM   7612  C  CE2   . PHE C 1  52  ? -57.089 21.243  80.361  1.00 159.12 ? 435  PHE C CE2   1 
ATOM   7613  C  CZ    . PHE C 1  52  ? -57.466 21.083  81.672  1.00 152.41 ? 435  PHE C CZ    1 
ATOM   7614  N  N     . LEU C 1  53  ? -54.352 26.091  80.547  1.00 162.01 ? 436  LEU C N     1 
ATOM   7615  C  CA    . LEU C 1  53  ? -52.972 25.882  80.981  1.00 164.94 ? 436  LEU C CA    1 
ATOM   7616  C  C     . LEU C 1  53  ? -52.673 26.648  82.264  1.00 161.75 ? 436  LEU C C     1 
ATOM   7617  O  O     . LEU C 1  53  ? -52.061 26.101  83.188  1.00 163.29 ? 436  LEU C O     1 
ATOM   7618  C  CB    . LEU C 1  53  ? -51.982 26.272  79.877  1.00 169.69 ? 436  LEU C CB    1 
ATOM   7619  C  CG    . LEU C 1  53  ? -51.748 25.305  78.708  1.00 167.12 ? 436  LEU C CG    1 
ATOM   7620  C  CD1   . LEU C 1  53  ? -50.668 25.829  77.764  1.00 164.47 ? 436  LEU C CD1   1 
ATOM   7621  C  CD2   . LEU C 1  53  ? -51.371 23.925  79.221  1.00 162.20 ? 436  LEU C CD2   1 
ATOM   7622  N  N     . LEU C 1  54  ? -53.106 27.910  82.348  1.00 161.99 ? 437  LEU C N     1 
ATOM   7623  C  CA    . LEU C 1  54  ? -52.834 28.705  83.542  1.00 160.33 ? 437  LEU C CA    1 
ATOM   7624  C  C     . LEU C 1  54  ? -53.599 28.175  84.748  1.00 158.34 ? 437  LEU C C     1 
ATOM   7625  O  O     . LEU C 1  54  ? -53.095 28.225  85.875  1.00 159.35 ? 437  LEU C O     1 
ATOM   7626  C  CB    . LEU C 1  54  ? -53.186 30.170  83.290  1.00 163.54 ? 437  LEU C CB    1 
ATOM   7627  C  CG    . LEU C 1  54  ? -52.332 30.920  82.271  1.00 161.27 ? 437  LEU C CG    1 
ATOM   7628  C  CD1   . LEU C 1  54  ? -52.854 32.336  82.072  1.00 156.57 ? 437  LEU C CD1   1 
ATOM   7629  C  CD2   . LEU C 1  54  ? -50.895 30.933  82.737  1.00 156.57 ? 437  LEU C CD2   1 
ATOM   7630  N  N     . ALA C 1  55  ? -54.824 27.687  84.542  1.00 158.23 ? 438  ALA C N     1 
ATOM   7631  C  CA    . ALA C 1  55  ? -55.561 27.067  85.638  1.00 154.66 ? 438  ALA C CA    1 
ATOM   7632  C  C     . ALA C 1  55  ? -54.846 25.821  86.141  1.00 159.79 ? 438  ALA C C     1 
ATOM   7633  O  O     . ALA C 1  55  ? -54.668 25.637  87.350  1.00 160.44 ? 438  ALA C O     1 
ATOM   7634  C  CB    . ALA C 1  55  ? -56.980 26.722  85.189  1.00 153.47 ? 438  ALA C CB    1 
ATOM   7635  N  N     . LEU C 1  56  ? -54.419 24.959  85.215  1.00 160.65 ? 439  LEU C N     1 
ATOM   7636  C  CA    . LEU C 1  56  ? -53.662 23.763  85.572  1.00 158.32 ? 439  LEU C CA    1 
ATOM   7637  C  C     . LEU C 1  56  ? -52.405 24.119  86.348  1.00 160.89 ? 439  LEU C C     1 
ATOM   7638  O  O     . LEU C 1  56  ? -52.067 23.464  87.340  1.00 162.05 ? 439  LEU C O     1 
ATOM   7639  C  CB    . LEU C 1  56  ? -53.300 22.972  84.320  1.00 161.37 ? 439  LEU C CB    1 
ATOM   7640  C  CG    . LEU C 1  56  ? -54.345 21.982  83.820  1.00 162.40 ? 439  LEU C CG    1 
ATOM   7641  C  CD1   . LEU C 1  56  ? -53.943 21.462  82.450  1.00 170.82 ? 439  LEU C CD1   1 
ATOM   7642  C  CD2   . LEU C 1  56  ? -54.492 20.838  84.805  1.00 169.59 ? 439  LEU C CD2   1 
ATOM   7643  N  N     . ARG C 1  57  ? -51.670 25.127  85.886  1.00 158.35 ? 440  ARG C N     1 
ATOM   7644  C  CA    . ARG C 1  57  ? -50.494 25.523  86.642  1.00 160.07 ? 440  ARG C CA    1 
ATOM   7645  C  C     . ARG C 1  57  ? -50.883 26.051  88.011  1.00 162.71 ? 440  ARG C C     1 
ATOM   7646  O  O     . ARG C 1  57  ? -50.246 25.699  89.008  1.00 164.00 ? 440  ARG C O     1 
ATOM   7647  C  CB    . ARG C 1  57  ? -49.703 26.570  85.867  1.00 155.47 ? 440  ARG C CB    1 
ATOM   7648  N  N     . ALA C 1  58  ? -52.023 26.744  88.098  1.00 155.58 ? 441  ALA C N     1 
ATOM   7649  C  CA    . ALA C 1  58  ? -52.441 27.339  89.361  1.00 152.80 ? 441  ALA C CA    1 
ATOM   7650  C  C     . ALA C 1  58  ? -52.675 26.278  90.423  1.00 156.86 ? 441  ALA C C     1 
ATOM   7651  O  O     . ALA C 1  58  ? -52.346 26.486  91.595  1.00 163.84 ? 441  ALA C O     1 
ATOM   7652  C  CB    . ALA C 1  58  ? -53.706 28.168  89.151  1.00 154.37 ? 441  ALA C CB    1 
ATOM   7653  N  N     . ARG C 1  59  ? -53.222 25.126  90.028  1.00 162.47 ? 442  ARG C N     1 
ATOM   7654  C  CA    . ARG C 1  59  ? -53.493 24.008  90.931  1.00 162.22 ? 442  ARG C CA    1 
ATOM   7655  C  C     . ARG C 1  59  ? -52.279 23.119  91.187  1.00 161.04 ? 442  ARG C C     1 
ATOM   7656  O  O     . ARG C 1  59  ? -52.454 22.005  91.695  1.00 157.44 ? 442  ARG C O     1 
ATOM   7657  C  CB    . ARG C 1  59  ? -54.613 23.130  90.373  1.00 161.21 ? 442  ARG C CB    1 
ATOM   7658  C  CG    . ARG C 1  59  ? -55.992 23.715  90.455  1.00 166.18 ? 442  ARG C CG    1 
ATOM   7659  C  CD    . ARG C 1  59  ? -57.014 22.614  90.226  1.00 171.32 ? 442  ARG C CD    1 
ATOM   7660  N  NE    . ARG C 1  59  ? -58.373 23.084  90.470  1.00 181.46 ? 442  ARG C NE    1 
ATOM   7661  C  CZ    . ARG C 1  59  ? -59.434 22.292  90.581  1.00 173.57 ? 442  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG C 1  59  ? -59.298 20.978  90.473  1.00 172.07 ? 442  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG C 1  59  ? -60.631 22.819  90.806  1.00 164.50 ? 442  ARG C NH2   1 
ATOM   7664  N  N     . ASN C 1  60  ? -51.075 23.576  90.834  1.00 167.12 ? 443  ASN C N     1 
ATOM   7665  C  CA    . ASN C 1  60  ? -49.822 22.829  90.968  1.00 166.11 ? 443  ASN C CA    1 
ATOM   7666  C  C     . ASN C 1  60  ? -49.816 21.542  90.142  1.00 162.74 ? 443  ASN C C     1 
ATOM   7667  O  O     . ASN C 1  60  ? -49.001 20.645  90.389  1.00 165.05 ? 443  ASN C O     1 
ATOM   7668  C  CB    . ASN C 1  60  ? -49.510 22.517  92.438  1.00 162.84 ? 443  ASN C CB    1 
ATOM   7669  C  CG    . ASN C 1  60  ? -49.233 23.771  93.261  1.00 153.94 ? 443  ASN C CG    1 
ATOM   7670  O  OD1   . ASN C 1  60  ? -48.695 24.751  92.754  1.00 161.64 ? 443  ASN C OD1   1 
ATOM   7671  N  ND2   . ASN C 1  60  ? -49.597 23.741  94.536  1.00 153.84 ? 443  ASN C ND2   1 
ATOM   7672  N  N     . GLU C 1  61  ? -50.668 21.451  89.122  1.00 153.28 ? 444  GLU C N     1 
ATOM   7673  C  CA    . GLU C 1  61  ? -50.767 20.241  88.312  1.00 156.53 ? 444  GLU C CA    1 
ATOM   7674  C  C     . GLU C 1  61  ? -49.872 20.384  87.084  1.00 159.79 ? 444  GLU C C     1 
ATOM   7675  O  O     . GLU C 1  61  ? -50.287 20.331  85.926  1.00 164.21 ? 444  GLU C O     1 
ATOM   7676  C  CB    . GLU C 1  61  ? -52.220 19.972  87.948  1.00 156.61 ? 444  GLU C CB    1 
ATOM   7677  C  CG    . GLU C 1  61  ? -52.971 19.366  89.119  1.00 163.07 ? 444  GLU C CG    1 
ATOM   7678  C  CD    . GLU C 1  61  ? -54.396 18.989  88.801  1.00 167.60 ? 444  GLU C CD    1 
ATOM   7679  O  OE1   . GLU C 1  61  ? -55.045 19.735  88.042  1.00 175.22 ? 444  GLU C OE1   1 
ATOM   7680  O  OE2   . GLU C 1  61  ? -54.866 17.948  89.313  1.00 161.65 ? 444  GLU C OE2   1 
ATOM   7681  N  N     . HIS C 1  62  ? -48.591 20.560  87.402  1.00 158.81 ? 445  HIS C N     1 
ATOM   7682  C  CA    . HIS C 1  62  ? -47.581 20.839  86.391  1.00 159.56 ? 445  HIS C CA    1 
ATOM   7683  C  C     . HIS C 1  62  ? -47.401 19.677  85.408  1.00 165.64 ? 445  HIS C C     1 
ATOM   7684  O  O     . HIS C 1  62  ? -47.051 19.910  84.244  1.00 166.31 ? 445  HIS C O     1 
ATOM   7685  C  CB    . HIS C 1  62  ? -46.279 21.228  87.092  1.00 148.03 ? 445  HIS C CB    1 
ATOM   7686  N  N     . ARG C 1  63  ? -47.593 18.427  85.853  1.00 166.14 ? 446  ARG C N     1 
ATOM   7687  C  CA    . ARG C 1  63  ? -47.464 17.284  84.946  1.00 170.96 ? 446  ARG C CA    1 
ATOM   7688  C  C     . ARG C 1  63  ? -48.499 17.356  83.830  1.00 169.13 ? 446  ARG C C     1 
ATOM   7689  O  O     . ARG C 1  63  ? -48.162 17.258  82.643  1.00 170.51 ? 446  ARG C O     1 
ATOM   7690  C  CB    . ARG C 1  63  ? -47.601 15.967  85.714  1.00 149.50 ? 446  ARG C CB    1 
ATOM   7691  N  N     . GLN C 1  64  ? -49.772 17.520  84.204  1.00 169.48 ? 447  GLN C N     1 
ATOM   7692  C  CA    . GLN C 1  64  ? -50.861 17.554  83.235  1.00 165.56 ? 447  GLN C CA    1 
ATOM   7693  C  C     . GLN C 1  64  ? -50.737 18.748  82.299  1.00 166.07 ? 447  GLN C C     1 
ATOM   7694  O  O     . GLN C 1  64  ? -50.979 18.625  81.090  1.00 163.72 ? 447  GLN C O     1 
ATOM   7695  C  CB    . GLN C 1  64  ? -52.195 17.605  83.992  1.00 147.27 ? 447  GLN C CB    1 
ATOM   7696  N  N     . ALA C 1  65  ? -50.286 19.884  82.835  1.00 171.20 ? 448  ALA C N     1 
ATOM   7697  C  CA    . ALA C 1  65  ? -50.093 21.089  82.036  1.00 169.41 ? 448  ALA C CA    1 
ATOM   7698  C  C     . ALA C 1  65  ? -48.964 20.936  81.033  1.00 169.30 ? 448  ALA C C     1 
ATOM   7699  O  O     . ALA C 1  65  ? -49.091 21.349  79.874  1.00 170.00 ? 448  ALA C O     1 
ATOM   7700  C  CB    . ALA C 1  65  ? -49.779 22.271  82.948  1.00 171.40 ? 448  ALA C CB    1 
ATOM   7701  N  N     . ASP C 1  66  ? -47.829 20.404  81.477  1.00 167.10 ? 449  ASP C N     1 
ATOM   7702  C  CA    . ASP C 1  66  ? -46.723 20.195  80.556  1.00 169.78 ? 449  ASP C CA    1 
ATOM   7703  C  C     . ASP C 1  66  ? -47.078 19.134  79.515  1.00 168.92 ? 449  ASP C C     1 
ATOM   7704  O  O     . ASP C 1  66  ? -46.637 19.217  78.364  1.00 166.59 ? 449  ASP C O     1 
ATOM   7705  C  CB    . ASP C 1  66  ? -45.447 19.884  81.338  1.00 158.30 ? 449  ASP C CB    1 
ATOM   7706  N  N     . GLU C 1  67  ? -47.886 18.133  79.892  1.00 167.32 ? 450  GLU C N     1 
ATOM   7707  C  CA    . GLU C 1  67  ? -48.335 17.158  78.897  1.00 160.68 ? 450  GLU C CA    1 
ATOM   7708  C  C     . GLU C 1  67  ? -49.238 17.798  77.844  1.00 159.53 ? 450  GLU C C     1 
ATOM   7709  O  O     . GLU C 1  67  ? -49.133 17.470  76.661  1.00 159.94 ? 450  GLU C O     1 
ATOM   7710  C  CB    . GLU C 1  67  ? -49.072 15.992  79.572  1.00 142.94 ? 450  GLU C CB    1 
ATOM   7711  N  N     . LEU C 1  68  ? -50.149 18.687  78.248  1.00 164.65 ? 451  LEU C N     1 
ATOM   7712  C  CA    . LEU C 1  68  ? -50.960 19.401  77.257  1.00 162.31 ? 451  LEU C CA    1 
ATOM   7713  C  C     . LEU C 1  68  ? -50.116 20.347  76.404  1.00 164.19 ? 451  LEU C C     1 
ATOM   7714  O  O     . LEU C 1  68  ? -50.376 20.506  75.205  1.00 164.81 ? 451  LEU C O     1 
ATOM   7715  C  CB    . LEU C 1  68  ? -52.119 20.137  77.918  1.00 153.53 ? 451  LEU C CB    1 
ATOM   7716  N  N     . GLU C 1  69  ? -49.146 21.040  77.006  1.00 172.07 ? 452  GLU C N     1 
ATOM   7717  C  CA    . GLU C 1  69  ? -48.235 21.837  76.183  1.00 172.66 ? 452  GLU C CA    1 
ATOM   7718  C  C     . GLU C 1  69  ? -47.500 20.946  75.171  1.00 174.83 ? 452  GLU C C     1 
ATOM   7719  O  O     . GLU C 1  69  ? -47.233 21.372  74.042  1.00 177.44 ? 452  GLU C O     1 
ATOM   7720  C  CB    . GLU C 1  69  ? -47.262 22.646  77.057  1.00 166.11 ? 452  GLU C CB    1 
ATOM   7721  N  N     . ALA C 1  70  ? -47.130 19.719  75.574  1.00 174.36 ? 453  ALA C N     1 
ATOM   7722  C  CA    . ALA C 1  70  ? -46.487 18.771  74.659  1.00 169.89 ? 453  ALA C CA    1 
ATOM   7723  C  C     . ALA C 1  70  ? -47.448 18.244  73.594  1.00 165.84 ? 453  ALA C C     1 
ATOM   7724  O  O     . ALA C 1  70  ? -47.014 17.924  72.482  1.00 171.15 ? 453  ALA C O     1 
ATOM   7725  C  CB    . ALA C 1  70  ? -45.880 17.608  75.440  1.00 169.99 ? 453  ALA C CB    1 
ATOM   7726  N  N     . ILE C 1  71  ? -48.742 18.128  73.917  1.00 161.42 ? 454  ILE C N     1 
ATOM   7727  C  CA    . ILE C 1  71  ? -49.735 17.707  72.925  1.00 159.96 ? 454  ILE C CA    1 
ATOM   7728  C  C     . ILE C 1  71  ? -49.953 18.820  71.911  1.00 162.42 ? 454  ILE C C     1 
ATOM   7729  O  O     . ILE C 1  71  ? -50.159 18.556  70.718  1.00 163.54 ? 454  ILE C O     1 
ATOM   7730  C  CB    . ILE C 1  71  ? -51.064 17.321  73.613  1.00 156.35 ? 454  ILE C CB    1 
ATOM   7731  C  CG1   . ILE C 1  71  ? -51.131 15.814  73.876  1.00 151.43 ? 454  ILE C CG1   1 
ATOM   7732  C  CG2   . ILE C 1  71  ? -52.256 17.717  72.748  1.00 153.78 ? 454  ILE C CG2   1 
ATOM   7733  C  CD1   . ILE C 1  71  ? -49.994 15.209  74.693  1.00 150.55 ? 454  ILE C CD1   1 
ATOM   7734  N  N     . MET C 1  72  ? -49.846 20.079  72.352  1.00 168.76 ? 455  MET C N     1 
ATOM   7735  C  CA    . MET C 1  72  ? -49.921 21.224  71.447  1.00 175.03 ? 455  MET C CA    1 
ATOM   7736  C  C     . MET C 1  72  ? -48.643 21.448  70.648  1.00 174.23 ? 455  MET C C     1 
ATOM   7737  O  O     . MET C 1  72  ? -48.704 22.047  69.566  1.00 173.16 ? 455  MET C O     1 
ATOM   7738  C  CB    . MET C 1  72  ? -50.272 22.495  72.223  1.00 170.90 ? 455  MET C CB    1 
ATOM   7739  C  CG    . MET C 1  72  ? -51.660 22.440  72.817  1.00 168.45 ? 455  MET C CG    1 
ATOM   7740  S  SD    . MET C 1  72  ? -52.886 22.245  71.510  1.00 179.10 ? 455  MET C SD    1 
ATOM   7741  C  CE    . MET C 1  72  ? -52.559 23.662  70.452  1.00 160.52 ? 455  MET C CE    1 
ATOM   7742  N  N     . GLN C 1  73  ? -47.502 21.014  71.180  1.00 177.15 ? 456  GLN C N     1 
ATOM   7743  C  CA    . GLN C 1  73  ? -46.248 20.894  70.452  1.00 175.31 ? 456  GLN C CA    1 
ATOM   7744  C  C     . GLN C 1  73  ? -46.098 19.539  69.761  1.00 180.66 ? 456  GLN C C     1 
ATOM   7745  O  O     . GLN C 1  73  ? -45.180 19.373  68.951  1.00 184.04 ? 456  GLN C O     1 
ATOM   7746  C  CB    . GLN C 1  73  ? -45.063 21.120  71.403  1.00 177.54 ? 456  GLN C CB    1 
ATOM   7747  C  CG    . GLN C 1  73  ? -45.012 22.508  72.038  1.00 179.94 ? 456  GLN C CG    1 
ATOM   7748  C  CD    . GLN C 1  73  ? -44.786 23.613  71.020  1.00 183.19 ? 456  GLN C CD    1 
ATOM   7749  O  OE1   . GLN C 1  73  ? -44.062 23.427  70.043  1.00 183.95 ? 456  GLN C OE1   1 
ATOM   7750  N  NE2   . GLN C 1  73  ? -45.408 24.766  71.242  1.00 179.51 ? 456  GLN C NE2   1 
ATOM   7751  N  N     . GLY C 1  74  ? -46.958 18.568  70.065  1.00 180.88 ? 457  GLY C N     1 
ATOM   7752  C  CA    . GLY C 1  74  ? -46.974 17.323  69.316  1.00 166.93 ? 457  GLY C CA    1 
ATOM   7753  C  C     . GLY C 1  74  ? -45.907 16.324  69.692  1.00 159.65 ? 457  GLY C C     1 
ATOM   7754  O  O     . GLY C 1  74  ? -45.474 15.544  68.840  1.00 149.28 ? 457  GLY C O     1 
ATOM   7755  N  N     . ARG C 1  75  ? -45.487 16.301  70.959  1.00 165.48 ? 458  ARG C N     1 
ATOM   7756  C  CA    . ARG C 1  75  ? -44.371 15.470  71.395  1.00 170.82 ? 458  ARG C CA    1 
ATOM   7757  C  C     . ARG C 1  75  ? -44.785 14.250  72.217  1.00 166.07 ? 458  ARG C C     1 
ATOM   7758  O  O     . ARG C 1  75  ? -43.965 13.343  72.403  1.00 154.26 ? 458  ARG C O     1 
ATOM   7759  C  CB    . ARG C 1  75  ? -43.375 16.315  72.204  1.00 162.66 ? 458  ARG C CB    1 
ATOM   7760  N  N     . GLY C 1  76  ? -46.020 14.192  72.708  1.00 157.63 ? 459  GLY C N     1 
ATOM   7761  C  CA    . GLY C 1  76  ? -46.402 13.071  73.546  1.00 150.94 ? 459  GLY C CA    1 
ATOM   7762  C  C     . GLY C 1  76  ? -47.694 12.396  73.144  1.00 147.11 ? 459  GLY C C     1 
ATOM   7763  O  O     . GLY C 1  76  ? -48.712 13.064  72.935  1.00 147.74 ? 459  GLY C O     1 
ATOM   7764  N  N     . SER C 1  77  ? -47.651 11.066  73.002  1.00 144.05 ? 460  SER C N     1 
ATOM   7765  C  CA    . SER C 1  77  ? -48.832 10.240  72.753  1.00 144.06 ? 460  SER C CA    1 
ATOM   7766  C  C     . SER C 1  77  ? -49.480 10.531  71.397  1.00 136.93 ? 460  SER C C     1 
ATOM   7767  O  O     . SER C 1  77  ? -50.527 9.965   71.057  1.00 129.82 ? 460  SER C O     1 
ATOM   7768  C  CB    . SER C 1  77  ? -49.842 10.411  73.893  1.00 148.23 ? 460  SER C CB    1 
ATOM   7769  N  N     . GLY C 1  78  ? -48.869 11.428  70.626  1.00 136.14 ? 461  GLY C N     1 
ATOM   7770  C  CA    . GLY C 1  78  ? -49.259 11.691  69.255  1.00 117.30 ? 461  GLY C CA    1 
ATOM   7771  C  C     . GLY C 1  78  ? -47.989 11.863  68.455  1.00 115.28 ? 461  GLY C C     1 
ATOM   7772  O  O     . GLY C 1  78  ? -47.196 12.764  68.736  1.00 131.89 ? 461  GLY C O     1 
ATOM   7773  N  N     . LEU C 1  79  ? -47.782 11.030  67.446  1.00 103.35 ? 462  LEU C N     1 
ATOM   7774  C  CA    . LEU C 1  79  ? -46.556 11.120  66.674  1.00 94.74  ? 462  LEU C CA    1 
ATOM   7775  C  C     . LEU C 1  79  ? -46.651 12.291  65.703  1.00 86.27  ? 462  LEU C C     1 
ATOM   7776  O  O     . LEU C 1  79  ? -47.694 12.503  65.086  1.00 93.76  ? 462  LEU C O     1 
ATOM   7777  C  CB    . LEU C 1  79  ? -46.299 9.797   65.950  1.00 86.90  ? 462  LEU C CB    1 
ATOM   7778  C  CG    . LEU C 1  79  ? -46.072 8.601   66.883  1.00 83.69  ? 462  LEU C CG    1 
ATOM   7779  C  CD1   . LEU C 1  79  ? -46.125 7.292   66.107  1.00 89.92  ? 462  LEU C CD1   1 
ATOM   7780  C  CD2   . LEU C 1  79  ? -44.770 8.713   67.650  1.00 76.36  ? 462  LEU C CD2   1 
ATOM   7781  N  N     . GLN C 1  80  ? -45.610 13.110  65.641  1.00 92.18  ? 463  GLN C N     1 
ATOM   7782  C  CA    . GLN C 1  80  ? -45.603 14.167  64.641  1.00 92.36  ? 463  GLN C CA    1 
ATOM   7783  C  C     . GLN C 1  80  ? -45.598 13.534  63.255  1.00 87.29  ? 463  GLN C C     1 
ATOM   7784  O  O     . GLN C 1  80  ? -44.851 12.578  63.027  1.00 99.42  ? 463  GLN C O     1 
ATOM   7785  C  CB    . GLN C 1  80  ? -44.362 15.041  64.777  1.00 107.64 ? 463  GLN C CB    1 
ATOM   7786  C  CG    . GLN C 1  80  ? -44.094 15.559  66.151  1.00 125.04 ? 463  GLN C CG    1 
ATOM   7787  C  CD    . GLN C 1  80  ? -42.613 15.728  66.373  1.00 124.03 ? 463  GLN C CD    1 
ATOM   7788  O  OE1   . GLN C 1  80  ? -41.962 16.519  65.682  1.00 112.60 ? 463  GLN C OE1   1 
ATOM   7789  N  NE2   . GLN C 1  80  ? -42.058 14.955  67.308  1.00 116.61 ? 463  GLN C NE2   1 
ATOM   7790  N  N     . PRO C 1  81  ? -46.362 14.060  62.293  1.00 80.94  ? 464  PRO C N     1 
ATOM   7791  C  CA    . PRO C 1  81  ? -46.367 13.436  60.960  1.00 87.04  ? 464  PRO C CA    1 
ATOM   7792  C  C     . PRO C 1  81  ? -44.971 13.195  60.403  1.00 80.57  ? 464  PRO C C     1 
ATOM   7793  O  O     . PRO C 1  81  ? -44.773 12.261  59.618  1.00 76.07  ? 464  PRO C O     1 
ATOM   7794  C  CB    . PRO C 1  81  ? -47.170 14.431  60.107  1.00 77.12  ? 464  PRO C CB    1 
ATOM   7795  C  CG    . PRO C 1  81  ? -47.166 15.684  60.857  1.00 83.50  ? 464  PRO C CG    1 
ATOM   7796  C  CD    . PRO C 1  81  ? -47.183 15.273  62.309  1.00 88.30  ? 464  PRO C CD    1 
ATOM   7797  N  N     . ALA C 1  82  ? -43.995 14.014  60.792  1.00 83.62  ? 465  ALA C N     1 
ATOM   7798  C  CA    . ALA C 1  82  ? -42.619 13.798  60.361  1.00 77.44  ? 465  ALA C CA    1 
ATOM   7799  C  C     . ALA C 1  82  ? -42.056 12.511  60.931  1.00 71.25  ? 465  ALA C C     1 
ATOM   7800  O  O     . ALA C 1  82  ? -41.244 11.850  60.287  1.00 80.70  ? 465  ALA C O     1 
ATOM   7801  C  CB    . ALA C 1  82  ? -41.749 14.980  60.771  1.00 92.78  ? 465  ALA C CB    1 
ATOM   7802  N  N     . VAL C 1  83  ? -42.434 12.164  62.158  1.00 74.24  ? 466  VAL C N     1 
ATOM   7803  C  CA    . VAL C 1  83  ? -41.948 10.929  62.764  1.00 77.85  ? 466  VAL C CA    1 
ATOM   7804  C  C     . VAL C 1  83  ? -42.618 9.713   62.133  1.00 75.00  ? 466  VAL C C     1 
ATOM   7805  O  O     . VAL C 1  83  ? -41.996 8.655   61.978  1.00 72.88  ? 466  VAL C O     1 
ATOM   7806  C  CB    . VAL C 1  83  ? -42.147 10.975  64.284  1.00 80.32  ? 466  VAL C CB    1 
ATOM   7807  C  CG1   . VAL C 1  83  ? -41.695 9.703   64.874  1.00 76.11  ? 466  VAL C CG1   1 
ATOM   7808  C  CG2   . VAL C 1  83  ? -41.362 12.107  64.872  1.00 85.11  ? 466  VAL C CG2   1 
ATOM   7809  N  N     . CYS C 1  84  ? -43.909 9.825   61.807  1.00 71.70  ? 467  CYS C N     1 
ATOM   7810  C  CA    . CYS C 1  84  ? -44.581 8.782   61.032  1.00 74.96  ? 467  CYS C CA    1 
ATOM   7811  C  C     . CYS C 1  84  ? -43.927 8.591   59.673  1.00 72.24  ? 467  CYS C C     1 
ATOM   7812  O  O     . CYS C 1  84  ? -43.810 7.467   59.185  1.00 69.04  ? 467  CYS C O     1 
ATOM   7813  C  CB    . CYS C 1  84  ? -46.058 9.109   60.839  1.00 77.34  ? 467  CYS C CB    1 
ATOM   7814  S  SG    . CYS C 1  84  ? -46.995 9.318   62.339  1.00 103.55 ? 467  CYS C SG    1 
ATOM   7815  N  N     . LEU C 1  85  ? -43.582 9.684   59.008  1.00 75.86  ? 468  LEU C N     1 
ATOM   7816  C  CA    . LEU C 1  85  ? -42.854 9.574   57.756  1.00 71.25  ? 468  LEU C CA    1 
ATOM   7817  C  C     . LEU C 1  85  ? -41.521 8.881   57.978  1.00 65.90  ? 468  LEU C C     1 
ATOM   7818  O  O     . LEU C 1  85  ? -41.093 8.071   57.158  1.00 78.30  ? 468  LEU C O     1 
ATOM   7819  C  CB    . LEU C 1  85  ? -42.641 10.952  57.136  1.00 70.83  ? 468  LEU C CB    1 
ATOM   7820  C  CG    . LEU C 1  85  ? -42.017 10.854  55.752  1.00 70.09  ? 468  LEU C CG    1 
ATOM   7821  C  CD1   . LEU C 1  85  ? -42.922 10.038  54.830  1.00 78.88  ? 468  LEU C CD1   1 
ATOM   7822  C  CD2   . LEU C 1  85  ? -41.766 12.222  55.194  1.00 76.55  ? 468  LEU C CD2   1 
ATOM   7823  N  N     . ALA C 1  86  ? -40.822 9.234   59.055  1.00 63.75  ? 469  ALA C N     1 
ATOM   7824  C  CA    . ALA C 1  86  ? -39.533 8.613   59.331  1.00 66.51  ? 469  ALA C CA    1 
ATOM   7825  C  C     . ALA C 1  86  ? -39.674 7.111   59.503  1.00 71.35  ? 469  ALA C C     1 
ATOM   7826  O  O     . ALA C 1  86  ? -38.909 6.335   58.915  1.00 78.37  ? 469  ALA C O     1 
ATOM   7827  C  CB    . ALA C 1  86  ? -38.904 9.232   60.574  1.00 77.32  ? 469  ALA C CB    1 
ATOM   7828  N  N     . ILE C 1  87  ? -40.687 6.690   60.262  1.00 70.33  ? 470  ILE C N     1 
ATOM   7829  C  CA    . ILE C 1  87  ? -40.937 5.268   60.494  1.00 65.66  ? 470  ILE C CA    1 
ATOM   7830  C  C     . ILE C 1  87  ? -41.343 4.569   59.201  1.00 65.11  ? 470  ILE C C     1 
ATOM   7831  O  O     . ILE C 1  87  ? -40.794 3.522   58.842  1.00 66.78  ? 470  ILE C O     1 
ATOM   7832  C  CB    . ILE C 1  87  ? -42.013 5.091   61.575  1.00 69.62  ? 470  ILE C CB    1 
ATOM   7833  C  CG1   . ILE C 1  87  ? -41.507 5.593   62.941  1.00 77.39  ? 470  ILE C CG1   1 
ATOM   7834  C  CG2   . ILE C 1  87  ? -42.470 3.646   61.612  1.00 70.99  ? 470  ILE C CG2   1 
ATOM   7835  C  CD1   . ILE C 1  87  ? -42.594 5.645   64.050  1.00 68.05  ? 470  ILE C CD1   1 
ATOM   7836  N  N     . ARG C 1  88  ? -42.360 5.096   58.518  1.00 66.75  ? 471  ARG C N     1 
ATOM   7837  C  CA    . ARG C 1  88  ? -42.830 4.478   57.286  1.00 60.08  ? 471  ARG C CA    1 
ATOM   7838  C  C     . ARG C 1  88  ? -41.722 4.356   56.259  1.00 60.53  ? 471  ARG C C     1 
ATOM   7839  O  O     . ARG C 1  88  ? -41.461 3.270   55.750  1.00 71.41  ? 471  ARG C O     1 
ATOM   7840  C  CB    . ARG C 1  88  ? -43.998 5.245   56.699  1.00 69.19  ? 471  ARG C CB    1 
ATOM   7841  C  CG    . ARG C 1  88  ? -44.736 4.405   55.693  1.00 72.65  ? 471  ARG C CG    1 
ATOM   7842  C  CD    . ARG C 1  88  ? -44.626 4.938   54.325  1.00 62.71  ? 471  ARG C CD    1 
ATOM   7843  N  NE    . ARG C 1  88  ? -45.404 6.152   54.172  1.00 79.07  ? 471  ARG C NE    1 
ATOM   7844  C  CZ    . ARG C 1  88  ? -45.461 6.819   53.026  1.00 108.12 ? 471  ARG C CZ    1 
ATOM   7845  N  NH1   . ARG C 1  88  ? -44.791 6.345   51.977  1.00 106.48 ? 471  ARG C NH1   1 
ATOM   7846  N  NH2   . ARG C 1  88  ? -46.163 7.949   52.919  1.00 109.83 ? 471  ARG C NH2   1 
ATOM   7847  N  N     . VAL C 1  89  ? -41.070 5.461   55.919  1.00 70.15  ? 472  VAL C N     1 
ATOM   7848  C  CA    . VAL C 1  89  ? -39.976 5.386   54.958  1.00 73.51  ? 472  VAL C CA    1 
ATOM   7849  C  C     . VAL C 1  89  ? -38.938 4.386   55.430  1.00 77.04  ? 472  VAL C C     1 
ATOM   7850  O  O     . VAL C 1  89  ? -38.446 3.565   54.650  1.00 83.26  ? 472  VAL C O     1 
ATOM   7851  C  CB    . VAL C 1  89  ? -39.327 6.764   54.736  1.00 80.65  ? 472  VAL C CB    1 
ATOM   7852  C  CG1   . VAL C 1  89  ? -38.032 6.594   53.942  1.00 67.38  ? 472  VAL C CG1   1 
ATOM   7853  C  CG2   . VAL C 1  89  ? -40.276 7.706   54.008  1.00 79.38  ? 472  VAL C CG2   1 
ATOM   7854  N  N     . ASN C 1  90  ? -38.552 4.469   56.698  1.00 71.34  ? 473  ASN C N     1 
ATOM   7855  C  CA    . ASN C 1  90  ? -37.388 3.743   57.147  1.00 75.83  ? 473  ASN C CA    1 
ATOM   7856  C  C     . ASN C 1  90  ? -37.674 2.269   57.408  1.00 73.25  ? 473  ASN C C     1 
ATOM   7857  O  O     . ASN C 1  90  ? -36.728 1.522   57.674  1.00 81.13  ? 473  ASN C O     1 
ATOM   7858  C  CB    . ASN C 1  90  ? -36.848 4.447   58.397  1.00 79.04  ? 473  ASN C CB    1 
ATOM   7859  C  CG    . ASN C 1  90  ? -35.326 4.445   58.471  1.00 90.31  ? 473  ASN C CG    1 
ATOM   7860  O  OD1   . ASN C 1  90  ? -34.721 3.639   59.185  1.00 92.14  ? 473  ASN C OD1   1 
ATOM   7861  N  ND2   . ASN C 1  90  ? -34.700 5.365   57.737  1.00 86.29  ? 473  ASN C ND2   1 
ATOM   7862  N  N     . THR C 1  91  ? -38.941 1.828   57.354  1.00 70.54  ? 474  THR C N     1 
ATOM   7863  C  CA    . THR C 1  91  ? -39.270 0.402   57.419  1.00 76.53  ? 474  THR C CA    1 
ATOM   7864  C  C     . THR C 1  91  ? -39.889 -0.130  56.132  1.00 70.79  ? 474  THR C C     1 
ATOM   7865  O  O     . THR C 1  91  ? -40.437 -1.233  56.139  1.00 67.66  ? 474  THR C O     1 
ATOM   7866  C  CB    . THR C 1  91  ? -40.222 0.076   58.563  1.00 67.46  ? 474  THR C CB    1 
ATOM   7867  O  OG1   . THR C 1  91  ? -41.486 0.674   58.301  1.00 58.29  ? 474  THR C OG1   1 
ATOM   7868  C  CG2   . THR C 1  91  ? -39.659 0.563   59.884  1.00 66.80  ? 474  THR C CG2   1 
ATOM   7869  N  N     . PHE C 1  92  ? -39.906 0.662   55.065  1.00 68.81  ? 475  PHE C N     1 
ATOM   7870  C  CA    . PHE C 1  92  ? -40.274 0.207   53.721  1.00 65.25  ? 475  PHE C CA    1 
ATOM   7871  C  C     . PHE C 1  92  ? -41.731 -0.202  53.609  1.00 62.99  ? 475  PHE C C     1 
ATOM   7872  O  O     . PHE C 1  92  ? -42.093 -1.007  52.750  1.00 70.58  ? 475  PHE C O     1 
ATOM   7873  C  CB    . PHE C 1  92  ? -39.353 -0.923  53.291  1.00 70.53  ? 475  PHE C CB    1 
ATOM   7874  C  CG    . PHE C 1  92  ? -37.915 -0.563  53.431  1.00 78.85  ? 475  PHE C CG    1 
ATOM   7875  C  CD1   . PHE C 1  92  ? -37.177 -0.978  54.534  1.00 77.43  ? 475  PHE C CD1   1 
ATOM   7876  C  CD2   . PHE C 1  92  ? -37.303 0.223   52.471  1.00 76.71  ? 475  PHE C CD2   1 
ATOM   7877  C  CE1   . PHE C 1  92  ? -35.853 -0.633  54.665  1.00 82.78  ? 475  PHE C CE1   1 
ATOM   7878  C  CE2   . PHE C 1  92  ? -35.991 0.574   52.599  1.00 76.68  ? 475  PHE C CE2   1 
ATOM   7879  C  CZ    . PHE C 1  92  ? -35.259 0.145   53.697  1.00 83.40  ? 475  PHE C CZ    1 
ATOM   7880  N  N     . LEU C 1  93  ? -42.569 0.391   54.453  1.00 61.43  ? 476  LEU C N     1 
ATOM   7881  C  CA    . LEU C 1  93  ? -44.001 0.144   54.415  1.00 61.62  ? 476  LEU C CA    1 
ATOM   7882  C  C     . LEU C 1  93  ? -44.640 0.841   53.222  1.00 67.41  ? 476  LEU C C     1 
ATOM   7883  O  O     . LEU C 1  93  ? -44.367 2.008   52.952  1.00 70.48  ? 476  LEU C O     1 
ATOM   7884  C  CB    . LEU C 1  93  ? -44.656 0.638   55.696  1.00 58.28  ? 476  LEU C CB    1 
ATOM   7885  C  CG    . LEU C 1  93  ? -44.369 -0.226  56.905  1.00 60.71  ? 476  LEU C CG    1 
ATOM   7886  C  CD1   . LEU C 1  93  ? -44.799 0.544   58.109  1.00 68.54  ? 476  LEU C CD1   1 
ATOM   7887  C  CD2   . LEU C 1  93  ? -45.062 -1.586  56.841  1.00 77.73  ? 476  LEU C CD2   1 
ATOM   7888  N  N     . SER C 1  94  ? -45.470 0.122   52.486  1.00 74.98  ? 477  SER C N     1 
ATOM   7889  C  CA    . SER C 1  94  ? -46.269 0.771   51.468  1.00 74.49  ? 477  SER C CA    1 
ATOM   7890  C  C     . SER C 1  94  ? -47.344 1.631   52.114  1.00 81.47  ? 477  SER C C     1 
ATOM   7891  O  O     . SER C 1  94  ? -47.595 1.572   53.320  1.00 79.46  ? 477  SER C O     1 
ATOM   7892  C  CB    . SER C 1  94  ? -46.913 -0.260  50.554  1.00 87.90  ? 477  SER C CB    1 
ATOM   7893  O  OG    . SER C 1  94  ? -47.924 -0.971  51.244  1.00 95.61  ? 477  SER C OG    1 
ATOM   7894  N  N     . CYS C 1  95  ? -47.968 2.467   51.295  1.00 88.94  ? 478  CYS C N     1 
ATOM   7895  C  CA    . CYS C 1  95  ? -49.076 3.260   51.795  1.00 85.76  ? 478  CYS C CA    1 
ATOM   7896  C  C     . CYS C 1  95  ? -50.217 2.368   52.251  1.00 80.15  ? 478  CYS C C     1 
ATOM   7897  O  O     . CYS C 1  95  ? -50.856 2.652   53.266  1.00 75.70  ? 478  CYS C O     1 
ATOM   7898  C  CB    . CYS C 1  95  ? -49.515 4.269   50.746  1.00 88.79  ? 478  CYS C CB    1 
ATOM   7899  S  SG    . CYS C 1  95  ? -48.257 5.549   50.543  1.00 97.95  ? 478  CYS C SG    1 
ATOM   7900  N  N     . SER C 1  96  ? -50.501 1.291   51.513  1.00 89.35  ? 479  SER C N     1 
ATOM   7901  C  CA    . SER C 1  96  ? -51.574 0.382   51.923  1.00 95.87  ? 479  SER C CA    1 
ATOM   7902  C  C     . SER C 1  96  ? -51.270 -0.266  53.274  1.00 90.68  ? 479  SER C C     1 
ATOM   7903  O  O     . SER C 1  96  ? -52.128 -0.302  54.170  1.00 91.25  ? 479  SER C O     1 
ATOM   7904  C  CB    . SER C 1  96  ? -51.799 -0.676  50.843  1.00 97.07  ? 479  SER C CB    1 
ATOM   7905  O  OG    . SER C 1  96  ? -50.680 -1.533  50.742  1.00 110.63 ? 479  SER C OG    1 
ATOM   7906  N  N     . GLN C 1  97  ? -50.042 -0.775  53.436  1.00 85.12  ? 480  GLN C N     1 
ATOM   7907  C  CA    . GLN C 1  97  ? -49.633 -1.409  54.686  1.00 80.26  ? 480  GLN C CA    1 
ATOM   7908  C  C     . GLN C 1  97  ? -49.567 -0.398  55.824  1.00 83.55  ? 480  GLN C C     1 
ATOM   7909  O  O     . GLN C 1  97  ? -49.997 -0.680  56.955  1.00 90.82  ? 480  GLN C O     1 
ATOM   7910  C  CB    . GLN C 1  97  ? -48.274 -2.090  54.516  1.00 86.60  ? 480  GLN C CB    1 
ATOM   7911  C  CG    . GLN C 1  97  ? -48.117 -3.089  53.370  1.00 95.19  ? 480  GLN C CG    1 
ATOM   7912  C  CD    . GLN C 1  97  ? -49.116 -4.248  53.419  1.00 115.14 ? 480  GLN C CD    1 
ATOM   7913  O  OE1   . GLN C 1  97  ? -49.638 -4.588  54.487  1.00 119.38 ? 480  GLN C OE1   1 
ATOM   7914  N  NE2   . GLN C 1  97  ? -49.335 -4.903  52.267  1.00 108.37 ? 480  GLN C NE2   1 
ATOM   7915  N  N     . TYR C 1  98  ? -48.998 0.775   55.562  1.00 80.81  ? 481  TYR C N     1 
ATOM   7916  C  CA    . TYR C 1  98  ? -49.023 1.806   56.585  1.00 77.43  ? 481  TYR C CA    1 
ATOM   7917  C  C     . TYR C 1  98  ? -50.447 2.132   57.000  1.00 78.65  ? 481  TYR C C     1 
ATOM   7918  O  O     . TYR C 1  98  ? -50.729 2.261   58.191  1.00 81.36  ? 481  TYR C O     1 
ATOM   7919  C  CB    . TYR C 1  98  ? -48.332 3.078   56.113  1.00 83.28  ? 481  TYR C CB    1 
ATOM   7920  C  CG    . TYR C 1  98  ? -48.428 4.184   57.140  1.00 75.39  ? 481  TYR C CG    1 
ATOM   7921  C  CD1   . TYR C 1  98  ? -47.525 4.241   58.182  1.00 76.03  ? 481  TYR C CD1   1 
ATOM   7922  C  CD2   . TYR C 1  98  ? -49.404 5.166   57.061  1.00 65.62  ? 481  TYR C CD2   1 
ATOM   7923  C  CE1   . TYR C 1  98  ? -47.588 5.216   59.115  1.00 73.89  ? 481  TYR C CE1   1 
ATOM   7924  C  CE2   . TYR C 1  98  ? -49.472 6.157   58.001  1.00 75.22  ? 481  TYR C CE2   1 
ATOM   7925  C  CZ    . TYR C 1  98  ? -48.553 6.175   59.032  1.00 75.36  ? 481  TYR C CZ    1 
ATOM   7926  O  OH    . TYR C 1  98  ? -48.571 7.150   60.003  1.00 87.91  ? 481  TYR C OH    1 
ATOM   7927  N  N     . HIS C 1  99  ? -51.354 2.292   56.029  1.00 78.50  ? 482  HIS C N     1 
ATOM   7928  C  CA    . HIS C 1  99  ? -52.720 2.683   56.365  1.00 80.25  ? 482  HIS C CA    1 
ATOM   7929  C  C     . HIS C 1  99  ? -53.413 1.626   57.188  1.00 81.14  ? 482  HIS C C     1 
ATOM   7930  O  O     . HIS C 1  99  ? -54.230 1.946   58.059  1.00 81.88  ? 482  HIS C O     1 
ATOM   7931  C  CB    . HIS C 1  99  ? -53.569 2.951   55.132  1.00 80.35  ? 482  HIS C CB    1 
ATOM   7932  C  CG    . HIS C 1  99  ? -54.990 3.264   55.482  1.00 84.58  ? 482  HIS C CG    1 
ATOM   7933  N  ND1   . HIS C 1  99  ? -55.342 4.399   56.182  1.00 94.81  ? 482  HIS C ND1   1 
ATOM   7934  C  CD2   . HIS C 1  99  ? -56.138 2.577   55.280  1.00 90.92  ? 482  HIS C CD2   1 
ATOM   7935  C  CE1   . HIS C 1  99  ? -56.648 4.410   56.373  1.00 97.37  ? 482  HIS C CE1   1 
ATOM   7936  N  NE2   . HIS C 1  99  ? -57.156 3.314   55.837  1.00 97.45  ? 482  HIS C NE2   1 
ATOM   7937  N  N     . LYS C 1  100 ? -53.156 0.358   56.871  1.00 82.97  ? 483  LYS C N     1 
ATOM   7938  C  CA    . LYS C 1  100 ? -53.698 -0.740  57.662  1.00 81.01  ? 483  LYS C CA    1 
ATOM   7939  C  C     . LYS C 1  100 ? -53.220 -0.659  59.096  1.00 77.22  ? 483  LYS C C     1 
ATOM   7940  O  O     . LYS C 1  100 ? -54.008 -0.835  60.035  1.00 85.79  ? 483  LYS C O     1 
ATOM   7941  C  CB    . LYS C 1  100 ? -53.315 -2.065  57.029  1.00 83.28  ? 483  LYS C CB    1 
ATOM   7942  C  CG    . LYS C 1  100 ? -54.173 -2.373  55.824  1.00 94.87  ? 483  LYS C CG    1 
ATOM   7943  C  CD    . LYS C 1  100 ? -53.467 -3.259  54.802  1.00 98.24  ? 483  LYS C CD    1 
ATOM   7944  C  CE    . LYS C 1  100 ? -52.952 -4.564  55.376  1.00 96.30  ? 483  LYS C CE    1 
ATOM   7945  N  NZ    . LYS C 1  100 ? -52.261 -5.317  54.288  1.00 94.36  ? 483  LYS C NZ    1 
ATOM   7946  N  N     . MET C 1  101 ? -51.925 -0.395  59.288  1.00 65.75  ? 484  MET C N     1 
ATOM   7947  C  CA    . MET C 1  101 ? -51.423 -0.272  60.653  1.00 70.84  ? 484  MET C CA    1 
ATOM   7948  C  C     . MET C 1  101 ? -52.016 0.942   61.361  1.00 80.25  ? 484  MET C C     1 
ATOM   7949  O  O     . MET C 1  101 ? -52.408 0.872   62.536  1.00 80.40  ? 484  MET C O     1 
ATOM   7950  C  CB    . MET C 1  101 ? -49.914 -0.168  60.656  1.00 65.93  ? 484  MET C CB    1 
ATOM   7951  C  CG    . MET C 1  101 ? -49.374 -0.140  62.055  1.00 76.13  ? 484  MET C CG    1 
ATOM   7952  S  SD    . MET C 1  101 ? -47.616 0.197   62.083  1.00 95.88  ? 484  MET C SD    1 
ATOM   7953  C  CE    . MET C 1  101 ? -47.572 1.894   61.504  1.00 86.05  ? 484  MET C CE    1 
ATOM   7954  N  N     . TYR C 1  102 ? -52.059 2.074   60.667  1.00 81.61  ? 485  TYR C N     1 
ATOM   7955  C  CA    . TYR C 1  102 ? -52.624 3.278   61.247  1.00 83.64  ? 485  TYR C CA    1 
ATOM   7956  C  C     . TYR C 1  102 ? -54.038 3.024   61.709  1.00 82.10  ? 485  TYR C C     1 
ATOM   7957  O  O     . TYR C 1  102 ? -54.344 3.184   62.896  1.00 87.73  ? 485  TYR C O     1 
ATOM   7958  C  CB    . TYR C 1  102 ? -52.576 4.415   60.227  1.00 81.91  ? 485  TYR C CB    1 
ATOM   7959  C  CG    . TYR C 1  102 ? -53.607 5.517   60.403  1.00 83.63  ? 485  TYR C CG    1 
ATOM   7960  C  CD1   . TYR C 1  102 ? -53.402 6.539   61.316  1.00 84.94  ? 485  TYR C CD1   1 
ATOM   7961  C  CD2   . TYR C 1  102 ? -54.731 5.589   59.584  1.00 87.08  ? 485  TYR C CD2   1 
ATOM   7962  C  CE1   . TYR C 1  102 ? -54.309 7.560   61.460  1.00 97.62  ? 485  TYR C CE1   1 
ATOM   7963  C  CE2   . TYR C 1  102 ? -55.647 6.616   59.719  1.00 90.43  ? 485  TYR C CE2   1 
ATOM   7964  C  CZ    . TYR C 1  102 ? -55.427 7.601   60.666  1.00 95.23  ? 485  TYR C CZ    1 
ATOM   7965  O  OH    . TYR C 1  102 ? -56.308 8.652   60.841  1.00 101.48 ? 485  TYR C OH    1 
ATOM   7966  N  N     . ARG C 1  103 ? -54.895 2.548   60.802  1.00 84.00  ? 486  ARG C N     1 
ATOM   7967  C  CA    . ARG C 1  103 ? -56.301 2.405   61.147  1.00 89.32  ? 486  ARG C CA    1 
ATOM   7968  C  C     . ARG C 1  103 ? -56.487 1.369   62.244  1.00 87.97  ? 486  ARG C C     1 
ATOM   7969  O  O     . ARG C 1  103 ? -57.332 1.550   63.129  1.00 95.29  ? 486  ARG C O     1 
ATOM   7970  C  CB    . ARG C 1  103 ? -57.138 2.073   59.906  1.00 84.77  ? 486  ARG C CB    1 
ATOM   7971  C  CG    . ARG C 1  103 ? -57.342 0.602   59.628  1.00 93.54  ? 486  ARG C CG    1 
ATOM   7972  C  CD    . ARG C 1  103 ? -58.191 0.383   58.367  1.00 112.18 ? 486  ARG C CD    1 
ATOM   7973  N  NE    . ARG C 1  103 ? -58.049 -0.967  57.799  1.00 114.59 ? 486  ARG C NE    1 
ATOM   7974  C  CZ    . ARG C 1  103 ? -58.387 -1.291  56.554  1.00 116.34 ? 486  ARG C CZ    1 
ATOM   7975  N  NH1   . ARG C 1  103 ? -58.877 -0.363  55.745  1.00 121.65 ? 486  ARG C NH1   1 
ATOM   7976  N  NH2   . ARG C 1  103 ? -58.223 -2.531  56.111  1.00 119.06 ? 486  ARG C NH2   1 
ATOM   7977  N  N     . THR C 1  104 ? -55.677 0.308   62.253  1.00 77.67  ? 487  THR C N     1 
ATOM   7978  C  CA    . THR C 1  104 ? -55.863 -0.713  63.278  1.00 77.45  ? 487  THR C CA    1 
ATOM   7979  C  C     . THR C 1  104 ? -55.446 -0.215  64.661  1.00 77.15  ? 487  THR C C     1 
ATOM   7980  O  O     . THR C 1  104 ? -56.153 -0.447  65.649  1.00 81.11  ? 487  THR C O     1 
ATOM   7981  C  CB    . THR C 1  104 ? -55.128 -1.978  62.870  1.00 83.22  ? 487  THR C CB    1 
ATOM   7982  O  OG1   . THR C 1  104 ? -55.877 -2.614  61.825  1.00 90.11  ? 487  THR C OG1   1 
ATOM   7983  C  CG2   . THR C 1  104 ? -55.000 -2.919  64.031  1.00 82.87  ? 487  THR C CG2   1 
ATOM   7984  N  N     . VAL C 1  105 ? -54.297 0.455   64.765  1.00 74.38  ? 488  VAL C N     1 
ATOM   7985  C  CA    . VAL C 1  105 ? -53.869 0.989   66.061  1.00 83.92  ? 488  VAL C CA    1 
ATOM   7986  C  C     . VAL C 1  105 ? -54.879 2.015   66.568  1.00 92.99  ? 488  VAL C C     1 
ATOM   7987  O  O     . VAL C 1  105 ? -55.179 2.091   67.771  1.00 85.25  ? 488  VAL C O     1 
ATOM   7988  C  CB    . VAL C 1  105 ? -52.465 1.621   65.954  1.00 86.68  ? 488  VAL C CB    1 
ATOM   7989  C  CG1   . VAL C 1  105 ? -52.149 2.432   67.217  1.00 80.72  ? 488  VAL C CG1   1 
ATOM   7990  C  CG2   . VAL C 1  105 ? -51.397 0.575   65.679  1.00 87.51  ? 488  VAL C CG2   1 
ATOM   7991  N  N     . LYS C 1  106 ? -55.386 2.854   65.661  1.00 94.89  ? 489  LYS C N     1 
ATOM   7992  C  CA    . LYS C 1  106 ? -56.346 3.867   66.072  1.00 96.26  ? 489  LYS C CA    1 
ATOM   7993  C  C     . LYS C 1  106 ? -57.634 3.223   66.549  1.00 94.11  ? 489  LYS C C     1 
ATOM   7994  O  O     . LYS C 1  106 ? -58.186 3.622   67.580  1.00 98.26  ? 489  LYS C O     1 
ATOM   7995  C  CB    . LYS C 1  106 ? -56.618 4.836   64.921  1.00 97.23  ? 489  LYS C CB    1 
ATOM   7996  C  CG    . LYS C 1  106 ? -57.584 5.951   65.248  1.00 96.11  ? 489  LYS C CG    1 
ATOM   7997  C  CD    . LYS C 1  106 ? -57.804 6.815   64.029  1.00 98.85  ? 489  LYS C CD    1 
ATOM   7998  C  CE    . LYS C 1  106 ? -58.909 7.823   64.278  1.00 103.38 ? 489  LYS C CE    1 
ATOM   7999  N  NZ    . LYS C 1  106 ? -59.158 8.749   63.141  1.00 116.77 ? 489  LYS C NZ    1 
ATOM   8000  N  N     . ALA C 1  107 ? -58.086 2.176   65.858  1.00 89.33  ? 490  ALA C N     1 
ATOM   8001  C  CA    . ALA C 1  107 ? -59.348 1.550   66.230  1.00 91.37  ? 490  ALA C CA    1 
ATOM   8002  C  C     . ALA C 1  107 ? -59.257 0.812   67.564  1.00 92.79  ? 490  ALA C C     1 
ATOM   8003  O  O     . ALA C 1  107 ? -60.231 0.790   68.322  1.00 91.55  ? 490  ALA C O     1 
ATOM   8004  C  CB    . ALA C 1  107 ? -59.796 0.583   65.131  1.00 104.94 ? 490  ALA C CB    1 
ATOM   8005  N  N     . ILE C 1  108 ? -58.113 0.207   67.871  1.00 94.92  ? 491  ILE C N     1 
ATOM   8006  C  CA    . ILE C 1  108 ? -58.018 -0.602  69.084  1.00 81.75  ? 491  ILE C CA    1 
ATOM   8007  C  C     . ILE C 1  108 ? -57.651 0.243   70.308  1.00 82.63  ? 491  ILE C C     1 
ATOM   8008  O  O     . ILE C 1  108 ? -58.076 -0.078  71.423  1.00 79.11  ? 491  ILE C O     1 
ATOM   8009  C  CB    . ILE C 1  108 ? -57.029 -1.763  68.855  1.00 77.62  ? 491  ILE C CB    1 
ATOM   8010  C  CG1   . ILE C 1  108 ? -57.729 -2.896  68.098  1.00 71.10  ? 491  ILE C CG1   1 
ATOM   8011  C  CG2   . ILE C 1  108 ? -56.411 -2.270  70.166  1.00 69.10  ? 491  ILE C CG2   1 
ATOM   8012  C  CD1   . ILE C 1  108 ? -56.871 -4.125  67.873  1.00 73.11  ? 491  ILE C CD1   1 
ATOM   8013  N  N     . THR C 1  109 ? -56.848 1.307   70.136  1.00 85.50  ? 492  THR C N     1 
ATOM   8014  C  CA    . THR C 1  109 ? -56.533 2.224   71.233  1.00 89.91  ? 492  THR C CA    1 
ATOM   8015  C  C     . THR C 1  109 ? -57.418 3.460   71.278  1.00 96.14  ? 492  THR C C     1 
ATOM   8016  O  O     . THR C 1  109 ? -57.263 4.271   72.195  1.00 94.24  ? 492  THR C O     1 
ATOM   8017  C  CB    . THR C 1  109 ? -55.075 2.688   71.175  1.00 96.69  ? 492  THR C CB    1 
ATOM   8018  O  OG1   . THR C 1  109 ? -54.875 3.477   69.993  1.00 109.21 ? 492  THR C OG1   1 
ATOM   8019  C  CG2   . THR C 1  109 ? -54.128 1.517   71.212  1.00 98.59  ? 492  THR C CG2   1 
ATOM   8020  N  N     . GLY C 1  110 ? -58.296 3.653   70.302  1.00 98.27  ? 493  GLY C N     1 
ATOM   8021  C  CA    . GLY C 1  110 ? -59.100 4.860   70.269  1.00 106.24 ? 493  GLY C CA    1 
ATOM   8022  C  C     . GLY C 1  110 ? -58.354 6.156   69.989  1.00 107.73 ? 493  GLY C C     1 
ATOM   8023  O  O     . GLY C 1  110 ? -58.962 7.127   69.533  1.00 114.73 ? 493  GLY C O     1 
ATOM   8024  N  N     . ARG C 1  111 ? -57.049 6.196   70.241  1.00 109.35 ? 494  ARG C N     1 
ATOM   8025  C  CA    . ARG C 1  111 ? -56.237 7.383   69.996  1.00 108.19 ? 494  ARG C CA    1 
ATOM   8026  C  C     . ARG C 1  111 ? -55.498 7.268   68.664  1.00 108.88 ? 494  ARG C C     1 
ATOM   8027  O  O     . ARG C 1  111 ? -55.189 6.166   68.203  1.00 110.57 ? 494  ARG C O     1 
ATOM   8028  C  CB    . ARG C 1  111 ? -55.248 7.578   71.138  1.00 104.45 ? 494  ARG C CB    1 
ATOM   8029  C  CG    . ARG C 1  111 ? -55.859 7.154   72.438  1.00 103.62 ? 494  ARG C CG    1 
ATOM   8030  C  CD    . ARG C 1  111 ? -54.833 7.013   73.513  1.00 120.27 ? 494  ARG C CD    1 
ATOM   8031  N  NE    . ARG C 1  111 ? -54.081 8.242   73.738  1.00 120.31 ? 494  ARG C NE    1 
ATOM   8032  C  CZ    . ARG C 1  111 ? -53.419 8.487   74.862  1.00 130.04 ? 494  ARG C CZ    1 
ATOM   8033  N  NH1   . ARG C 1  111 ? -53.444 7.590   75.840  1.00 142.41 ? 494  ARG C NH1   1 
ATOM   8034  N  NH2   . ARG C 1  111 ? -52.746 9.615   75.021  1.00 130.07 ? 494  ARG C NH2   1 
ATOM   8035  N  N     . GLN C 1  112 ? -55.217 8.416   68.049  1.00 105.20 ? 495  GLN C N     1 
ATOM   8036  C  CA    . GLN C 1  112 ? -54.600 8.477   66.720  1.00 97.05  ? 495  GLN C CA    1 
ATOM   8037  C  C     . GLN C 1  112 ? -53.084 8.634   66.883  1.00 96.84  ? 495  GLN C C     1 
ATOM   8038  O  O     . GLN C 1  112 ? -52.494 9.696   66.679  1.00 100.58 ? 495  GLN C O     1 
ATOM   8039  C  CB    . GLN C 1  112 ? -55.242 9.598   65.905  1.00 95.34  ? 495  GLN C CB    1 
ATOM   8040  C  CG    . GLN C 1  112 ? -54.763 9.830   64.470  1.00 91.68  ? 495  GLN C CG    1 
ATOM   8041  C  CD    . GLN C 1  112 ? -55.741 10.705  63.655  1.00 101.52 ? 495  GLN C CD    1 
ATOM   8042  O  OE1   . GLN C 1  112 ? -56.893 10.334  63.426  1.00 105.92 ? 495  GLN C OE1   1 
ATOM   8043  N  NE2   . GLN C 1  112 ? -55.298 11.909  63.295  1.00 105.48 ? 495  GLN C NE2   1 
ATOM   8044  N  N     . ILE C 1  113 ? -52.457 7.517   67.269  1.00 95.43  ? 496  ILE C N     1 
ATOM   8045  C  CA    . ILE C 1  113 ? -51.021 7.497   67.536  1.00 90.88  ? 496  ILE C CA    1 
ATOM   8046  C  C     . ILE C 1  113 ? -50.242 7.815   66.260  1.00 92.17  ? 496  ILE C C     1 
ATOM   8047  O  O     . ILE C 1  113 ? -49.416 8.736   66.233  1.00 95.79  ? 496  ILE C O     1 
ATOM   8048  C  CB    . ILE C 1  113 ? -50.616 6.137   68.133  1.00 92.72  ? 496  ILE C CB    1 
ATOM   8049  C  CG1   . ILE C 1  113 ? -51.328 5.912   69.457  1.00 100.69 ? 496  ILE C CG1   1 
ATOM   8050  C  CG2   . ILE C 1  113 ? -49.152 6.102   68.436  1.00 92.09  ? 496  ILE C CG2   1 
ATOM   8051  C  CD1   . ILE C 1  113 ? -51.219 7.067   70.374  1.00 111.86 ? 496  ILE C CD1   1 
ATOM   8052  N  N     . PHE C 1  114 ? -50.522 7.092   65.174  1.00 83.14  ? 497  PHE C N     1 
ATOM   8053  C  CA    . PHE C 1  114 ? -49.952 7.420   63.873  1.00 86.54  ? 497  PHE C CA    1 
ATOM   8054  C  C     . PHE C 1  114 ? -50.860 8.406   63.153  1.00 88.55  ? 497  PHE C C     1 
ATOM   8055  O  O     . PHE C 1  114 ? -52.065 8.453   63.406  1.00 94.48  ? 497  PHE C O     1 
ATOM   8056  C  CB    . PHE C 1  114 ? -49.752 6.165   63.024  1.00 85.79  ? 497  PHE C CB    1 
ATOM   8057  C  CG    . PHE C 1  114 ? -48.689 5.296   63.544  1.00 79.37  ? 497  PHE C CG    1 
ATOM   8058  C  CD1   . PHE C 1  114 ? -47.383 5.502   63.169  1.00 75.37  ? 497  PHE C CD1   1 
ATOM   8059  C  CD2   . PHE C 1  114 ? -48.977 4.331   64.487  1.00 85.15  ? 497  PHE C CD2   1 
ATOM   8060  C  CE1   . PHE C 1  114 ? -46.389 4.734   63.690  1.00 81.92  ? 497  PHE C CE1   1 
ATOM   8061  C  CE2   . PHE C 1  114 ? -47.992 3.554   65.015  1.00 79.37  ? 497  PHE C CE2   1 
ATOM   8062  C  CZ    . PHE C 1  114 ? -46.690 3.755   64.618  1.00 79.70  ? 497  PHE C CZ    1 
ATOM   8063  N  N     . GLN C 1  115 ? -50.251 9.242   62.272  1.00 86.73  ? 498  GLN C N     1 
ATOM   8064  C  CA    . GLN C 1  115 ? -50.981 10.242  61.509  1.00 82.70  ? 498  GLN C CA    1 
ATOM   8065  C  C     . GLN C 1  115 ? -51.441 9.665   60.179  1.00 81.61  ? 498  GLN C C     1 
ATOM   8066  O  O     . GLN C 1  115 ? -50.832 8.738   59.649  1.00 81.76  ? 498  GLN C O     1 
ATOM   8067  C  CB    . GLN C 1  115 ? -50.103 11.475  61.282  1.00 84.26  ? 498  GLN C CB    1 
ATOM   8068  C  CG    . GLN C 1  115 ? -49.710 12.159  62.562  1.00 85.99  ? 498  GLN C CG    1 
ATOM   8069  C  CD    . GLN C 1  115 ? -50.874 12.241  63.521  1.00 102.60 ? 498  GLN C CD    1 
ATOM   8070  O  OE1   . GLN C 1  115 ? -51.909 12.821  63.191  1.00 113.85 ? 498  GLN C OE1   1 
ATOM   8071  N  NE2   . GLN C 1  115 ? -50.729 11.633  64.704  1.00 97.20  ? 498  GLN C NE2   1 
ATOM   8072  N  N     . PRO C 1  116 ? -52.498 10.217  59.596  1.00 79.76  ? 499  PRO C N     1 
ATOM   8073  C  CA    . PRO C 1  116 ? -53.042 9.658   58.354  1.00 84.03  ? 499  PRO C CA    1 
ATOM   8074  C  C     . PRO C 1  116 ? -52.114 9.891   57.174  1.00 82.68  ? 499  PRO C C     1 
ATOM   8075  O  O     . PRO C 1  116 ? -51.086 10.558  57.263  1.00 91.61  ? 499  PRO C O     1 
ATOM   8076  C  CB    . PRO C 1  116 ? -54.363 10.412  58.168  1.00 93.38  ? 499  PRO C CB    1 
ATOM   8077  C  CG    . PRO C 1  116 ? -54.621 11.080  59.488  1.00 98.18  ? 499  PRO C CG    1 
ATOM   8078  C  CD    . PRO C 1  116 ? -53.283 11.367  60.063  1.00 85.47  ? 499  PRO C CD    1 
ATOM   8079  N  N     . LEU C 1  117 ? -52.483 9.292   56.049  1.00 84.69  ? 500  LEU C N     1 
ATOM   8080  C  CA    . LEU C 1  117 ? -51.599 9.340   54.897  1.00 84.55  ? 500  LEU C CA    1 
ATOM   8081  C  C     . LEU C 1  117 ? -51.449 10.755  54.367  1.00 88.95  ? 500  LEU C C     1 
ATOM   8082  O  O     . LEU C 1  117 ? -50.353 11.144  53.934  1.00 98.96  ? 500  LEU C O     1 
ATOM   8083  C  CB    . LEU C 1  117 ? -52.132 8.429   53.805  1.00 88.19  ? 500  LEU C CB    1 
ATOM   8084  C  CG    . LEU C 1  117 ? -51.808 6.986   54.129  1.00 86.27  ? 500  LEU C CG    1 
ATOM   8085  C  CD1   . LEU C 1  117 ? -52.601 6.125   53.196  1.00 86.21  ? 500  LEU C CD1   1 
ATOM   8086  C  CD2   . LEU C 1  117 ? -50.305 6.758   53.959  1.00 87.69  ? 500  LEU C CD2   1 
ATOM   8087  N  N     . HIS C 1  118 ? -52.517 11.550  54.405  1.00 87.63  ? 501  HIS C N     1 
ATOM   8088  C  CA    . HIS C 1  118 ? -52.380 12.889  53.857  1.00 89.97  ? 501  HIS C CA    1 
ATOM   8089  C  C     . HIS C 1  118 ? -51.379 13.705  54.659  1.00 90.83  ? 501  HIS C C     1 
ATOM   8090  O  O     . HIS C 1  118 ? -50.572 14.434  54.072  1.00 97.35  ? 501  HIS C O     1 
ATOM   8091  C  CB    . HIS C 1  118 ? -53.751 13.575  53.780  1.00 93.31  ? 501  HIS C CB    1 
ATOM   8092  C  CG    . HIS C 1  118 ? -54.280 14.053  55.098  1.00 105.35 ? 501  HIS C CG    1 
ATOM   8093  N  ND1   . HIS C 1  118 ? -53.987 15.296  55.620  1.00 116.87 ? 501  HIS C ND1   1 
ATOM   8094  C  CD2   . HIS C 1  118 ? -55.101 13.456  55.995  1.00 108.45 ? 501  HIS C CD2   1 
ATOM   8095  C  CE1   . HIS C 1  118 ? -54.598 15.440  56.784  1.00 115.18 ? 501  HIS C CE1   1 
ATOM   8096  N  NE2   . HIS C 1  118 ? -55.282 14.338  57.034  1.00 115.27 ? 501  HIS C NE2   1 
ATOM   8097  N  N     . ALA C 1  119 ? -51.331 13.501  55.976  1.00 90.06  ? 502  ALA C N     1 
ATOM   8098  C  CA    . ALA C 1  119 ? -50.375 14.223  56.808  1.00 84.44  ? 502  ALA C CA    1 
ATOM   8099  C  C     . ALA C 1  119 ? -48.944 13.843  56.479  1.00 82.10  ? 502  ALA C C     1 
ATOM   8100  O  O     . ALA C 1  119 ? -48.054 14.698  56.477  1.00 87.32  ? 502  ALA C O     1 
ATOM   8101  C  CB    . ALA C 1  119 ? -50.660 13.949  58.274  1.00 92.51  ? 502  ALA C CB    1 
ATOM   8102  N  N     . LEU C 1  120 ? -48.694 12.566  56.218  1.00 82.92  ? 503  LEU C N     1 
ATOM   8103  C  CA    . LEU C 1  120 ? -47.350 12.180  55.824  1.00 84.24  ? 503  LEU C CA    1 
ATOM   8104  C  C     . LEU C 1  120 ? -46.991 12.775  54.472  1.00 84.51  ? 503  LEU C C     1 
ATOM   8105  O  O     . LEU C 1  120 ? -45.846 13.171  54.259  1.00 87.28  ? 503  LEU C O     1 
ATOM   8106  C  CB    . LEU C 1  120 ? -47.202 10.665  55.803  1.00 86.77  ? 503  LEU C CB    1 
ATOM   8107  C  CG    . LEU C 1  120 ? -46.895 10.066  57.181  1.00 80.45  ? 503  LEU C CG    1 
ATOM   8108  C  CD1   . LEU C 1  120 ? -48.076 10.150  58.150  1.00 78.78  ? 503  LEU C CD1   1 
ATOM   8109  C  CD2   . LEU C 1  120 ? -46.408 8.644   57.040  1.00 82.14  ? 503  LEU C CD2   1 
ATOM   8110  N  N     . ARG C 1  121 ? -47.948 12.873  53.547  1.00 80.17  ? 504  ARG C N     1 
ATOM   8111  C  CA    . ARG C 1  121 ? -47.612 13.495  52.268  1.00 88.49  ? 504  ARG C CA    1 
ATOM   8112  C  C     . ARG C 1  121 ? -47.234 14.954  52.471  1.00 90.86  ? 504  ARG C C     1 
ATOM   8113  O  O     . ARG C 1  121 ? -46.227 15.438  51.930  1.00 104.43 ? 504  ARG C O     1 
ATOM   8114  C  CB    . ARG C 1  121 ? -48.766 13.377  51.277  1.00 88.74  ? 504  ARG C CB    1 
ATOM   8115  N  N     . ASN C 1  122 ? -48.026 15.668  53.265  1.00 89.14  ? 505  ASN C N     1 
ATOM   8116  C  CA    . ASN C 1  122 ? -47.720 17.071  53.500  1.00 93.34  ? 505  ASN C CA    1 
ATOM   8117  C  C     . ASN C 1  122 ? -46.348 17.213  54.161  1.00 90.36  ? 505  ASN C C     1 
ATOM   8118  O  O     . ASN C 1  122 ? -45.561 18.087  53.786  1.00 97.87  ? 505  ASN C O     1 
ATOM   8119  C  CB    . ASN C 1  122 ? -48.828 17.715  54.341  1.00 104.40 ? 505  ASN C CB    1 
ATOM   8120  C  CG    . ASN C 1  122 ? -49.025 19.196  54.028  1.00 121.68 ? 505  ASN C CG    1 
ATOM   8121  O  OD1   . ASN C 1  122 ? -48.683 19.670  52.937  1.00 118.97 ? 505  ASN C OD1   1 
ATOM   8122  N  ND2   . ASN C 1  122 ? -49.611 19.925  54.972  1.00 140.07 ? 505  ASN C ND2   1 
ATOM   8123  N  N     . ALA C 1  123 ? -46.016 16.334  55.111  1.00 82.95  ? 506  ALA C N     1 
ATOM   8124  C  CA    . ALA C 1  123 ? -44.684 16.414  55.700  1.00 81.46  ? 506  ALA C CA    1 
ATOM   8125  C  C     . ALA C 1  123 ? -43.609 16.027  54.697  1.00 78.09  ? 506  ALA C C     1 
ATOM   8126  O  O     . ALA C 1  123 ? -42.463 16.463  54.837  1.00 80.02  ? 506  ALA C O     1 
ATOM   8127  C  CB    . ALA C 1  123 ? -44.585 15.565  56.958  1.00 83.05  ? 506  ALA C CB    1 
ATOM   8128  N  N     . GLU C 1  124 ? -43.936 15.193  53.701  1.00 81.53  ? 507  GLU C N     1 
ATOM   8129  C  CA    . GLU C 1  124 ? -42.960 14.895  52.653  1.00 83.70  ? 507  GLU C CA    1 
ATOM   8130  C  C     . GLU C 1  124 ? -42.590 16.155  51.892  1.00 85.09  ? 507  GLU C C     1 
ATOM   8131  O  O     . GLU C 1  124 ? -41.406 16.400  51.629  1.00 79.19  ? 507  GLU C O     1 
ATOM   8132  C  CB    . GLU C 1  124 ? -43.487 13.868  51.654  1.00 89.20  ? 507  GLU C CB    1 
ATOM   8133  C  CG    . GLU C 1  124 ? -43.369 12.435  52.052  1.00 96.86  ? 507  GLU C CG    1 
ATOM   8134  C  CD    . GLU C 1  124 ? -44.141 11.528  51.094  1.00 120.05 ? 507  GLU C CD    1 
ATOM   8135  O  OE1   . GLU C 1  124 ? -44.641 12.056  50.067  1.00 106.44 ? 507  GLU C OE1   1 
ATOM   8136  O  OE2   . GLU C 1  124 ? -44.239 10.296  51.359  1.00 116.93 ? 507  GLU C OE2   1 
ATOM   8137  N  N     . LYS C 1  125 ? -43.591 16.985  51.562  1.00 85.72  ? 508  LYS C N     1 
ATOM   8138  C  CA    . LYS C 1  125 ? -43.305 18.157  50.732  1.00 78.50  ? 508  LYS C CA    1 
ATOM   8139  C  C     . LYS C 1  125 ? -42.163 18.979  51.307  1.00 74.33  ? 508  LYS C C     1 
ATOM   8140  O  O     . LYS C 1  125 ? -41.290 19.441  50.566  1.00 72.87  ? 508  LYS C O     1 
ATOM   8141  C  CB    . LYS C 1  125 ? -44.530 19.062  50.581  1.00 90.37  ? 508  LYS C CB    1 
ATOM   8142  C  CG    . LYS C 1  125 ? -45.723 18.519  49.826  1.00 94.60  ? 508  LYS C CG    1 
ATOM   8143  C  CD    . LYS C 1  125 ? -46.809 19.602  49.752  1.00 111.18 ? 508  LYS C CD    1 
ATOM   8144  C  CE    . LYS C 1  125 ? -48.009 19.141  48.949  1.00 130.40 ? 508  LYS C CE    1 
ATOM   8145  N  NZ    . LYS C 1  125 ? -48.904 18.261  49.734  1.00 124.30 ? 508  LYS C NZ    1 
ATOM   8146  N  N     . VAL C 1  126 ? -42.122 19.122  52.630  1.00 75.48  ? 509  VAL C N     1 
ATOM   8147  C  CA    . VAL C 1  126 ? -41.088 19.927  53.275  1.00 71.88  ? 509  VAL C CA    1 
ATOM   8148  C  C     . VAL C 1  126 ? -39.700 19.340  53.071  1.00 78.05  ? 509  VAL C C     1 
ATOM   8149  O  O     . VAL C 1  126 ? -38.720 20.080  52.896  1.00 82.29  ? 509  VAL C O     1 
ATOM   8150  C  CB    . VAL C 1  126 ? -41.392 20.077  54.769  1.00 76.79  ? 509  VAL C CB    1 
ATOM   8151  C  CG1   . VAL C 1  126 ? -40.314 20.935  55.423  1.00 76.83  ? 509  VAL C CG1   1 
ATOM   8152  C  CG2   . VAL C 1  126 ? -42.776 20.673  54.950  1.00 78.81  ? 509  VAL C CG2   1 
ATOM   8153  N  N     . LEU C 1  127 ? -39.583 18.014  53.131  1.00 78.32  ? 510  LEU C N     1 
ATOM   8154  C  CA    . LEU C 1  127 ? -38.275 17.369  53.141  1.00 73.56  ? 510  LEU C CA    1 
ATOM   8155  C  C     . LEU C 1  127 ? -37.714 17.123  51.750  1.00 77.23  ? 510  LEU C C     1 
ATOM   8156  O  O     . LEU C 1  127 ? -36.532 16.769  51.632  1.00 76.95  ? 510  LEU C O     1 
ATOM   8157  C  CB    . LEU C 1  127 ? -38.345 16.048  53.891  1.00 69.87  ? 510  LEU C CB    1 
ATOM   8158  C  CG    . LEU C 1  127 ? -38.933 16.232  55.274  1.00 65.00  ? 510  LEU C CG    1 
ATOM   8159  C  CD1   . LEU C 1  127 ? -39.402 14.937  55.894  1.00 73.97  ? 510  LEU C CD1   1 
ATOM   8160  C  CD2   . LEU C 1  127 ? -37.822 16.805  56.067  1.00 73.77  ? 510  LEU C CD2   1 
ATOM   8161  N  N     . LEU C 1  128 ? -38.548 17.332  50.670  1.00 76.68  ? 511  LEU C N     1 
ATOM   8162  C  CA    . LEU C 1  128 ? -38.154 17.154  49.286  1.00 73.98  ? 511  LEU C CA    1 
ATOM   8163  C  C     . LEU C 1  128 ? -37.654 18.466  48.712  1.00 69.90  ? 511  LEU C C     1 
ATOM   8164  O  O     . LEU C 1  128 ? -38.059 19.542  49.160  1.00 71.47  ? 511  LEU C O     1 
ATOM   8165  C  CB    . LEU C 1  128 ? -39.327 16.662  48.451  1.00 82.91  ? 511  LEU C CB    1 
ATOM   8166  C  CG    . LEU C 1  128 ? -39.780 15.243  48.739  1.00 74.06  ? 511  LEU C CG    1 
ATOM   8167  C  CD1   . LEU C 1  128 ? -41.010 14.956  47.914  1.00 78.15  ? 511  LEU C CD1   1 
ATOM   8168  C  CD2   . LEU C 1  128 ? -38.656 14.306  48.414  1.00 68.00  ? 511  LEU C CD2   1 
ATOM   8169  N  N     . PRO C 1  129 ? -36.779 18.370  47.718  1.00 68.74  ? 512  PRO C N     1 
ATOM   8170  C  CA    . PRO C 1  129 ? -36.318 19.572  47.026  1.00 70.26  ? 512  PRO C CA    1 
ATOM   8171  C  C     . PRO C 1  129 ? -37.470 20.352  46.427  1.00 76.12  ? 512  PRO C C     1 
ATOM   8172  O  O     . PRO C 1  129 ? -38.507 19.793  46.069  1.00 72.08  ? 512  PRO C O     1 
ATOM   8173  C  CB    . PRO C 1  129 ? -35.388 19.018  45.944  1.00 68.36  ? 512  PRO C CB    1 
ATOM   8174  C  CG    . PRO C 1  129 ? -34.933 17.707  46.483  1.00 67.12  ? 512  PRO C CG    1 
ATOM   8175  C  CD    . PRO C 1  129 ? -36.077 17.162  47.254  1.00 71.72  ? 512  PRO C CD    1 
ATOM   8176  N  N     . GLY C 1  130 ? -37.283 21.669  46.367  1.00 95.56  ? 513  GLY C N     1 
ATOM   8177  C  CA    . GLY C 1  130 ? -38.245 22.575  45.781  1.00 94.64  ? 513  GLY C CA    1 
ATOM   8178  C  C     . GLY C 1  130 ? -39.192 23.274  46.732  1.00 91.91  ? 513  GLY C C     1 
ATOM   8179  O  O     . GLY C 1  130 ? -40.166 23.882  46.269  1.00 98.94  ? 513  GLY C O     1 
ATOM   8180  N  N     . TYR C 1  131 ? -38.934 23.243  48.035  1.00 85.39  ? 514  TYR C N     1 
ATOM   8181  C  CA    . TYR C 1  131 ? -39.883 23.811  48.981  1.00 87.26  ? 514  TYR C CA    1 
ATOM   8182  C  C     . TYR C 1  131 ? -39.444 25.171  49.488  1.00 87.83  ? 514  TYR C C     1 
ATOM   8183  O  O     . TYR C 1  131 ? -40.204 26.138  49.406  1.00 95.15  ? 514  TYR C O     1 
ATOM   8184  C  CB    . TYR C 1  131 ? -40.079 22.855  50.160  1.00 92.87  ? 514  TYR C CB    1 
ATOM   8185  C  CG    . TYR C 1  131 ? -41.013 23.341  51.262  1.00 88.59  ? 514  TYR C CG    1 
ATOM   8186  C  CD1   . TYR C 1  131 ? -42.394 23.305  51.095  1.00 90.19  ? 514  TYR C CD1   1 
ATOM   8187  C  CD2   . TYR C 1  131 ? -40.518 23.737  52.494  1.00 78.67  ? 514  TYR C CD2   1 
ATOM   8188  C  CE1   . TYR C 1  131 ? -43.241 23.711  52.097  1.00 85.83  ? 514  TYR C CE1   1 
ATOM   8189  C  CE2   . TYR C 1  131 ? -41.356 24.138  53.501  1.00 73.21  ? 514  TYR C CE2   1 
ATOM   8190  C  CZ    . TYR C 1  131 ? -42.716 24.126  53.300  1.00 79.49  ? 514  TYR C CZ    1 
ATOM   8191  O  OH    . TYR C 1  131 ? -43.550 24.538  54.319  1.00 87.70  ? 514  TYR C OH    1 
ATOM   8192  N  N     . HIS C 1  132 ? -38.226 25.272  49.930  1.00 84.29  ? 515  HIS C N     1 
ATOM   8193  C  CA    . HIS C 1  132 ? -37.758 26.530  50.463  1.00 83.92  ? 515  HIS C CA    1 
ATOM   8194  C  C     . HIS C 1  132 ? -37.356 27.492  49.347  1.00 86.57  ? 515  HIS C C     1 
ATOM   8195  O  O     . HIS C 1  132 ? -37.043 27.069  48.232  1.00 92.05  ? 515  HIS C O     1 
ATOM   8196  C  CB    . HIS C 1  132 ? -36.577 26.283  51.378  1.00 82.85  ? 515  HIS C CB    1 
ATOM   8197  C  CG    . HIS C 1  132 ? -36.919 25.456  52.566  1.00 80.42  ? 515  HIS C CG    1 
ATOM   8198  N  ND1   . HIS C 1  132 ? -36.118 24.432  53.011  1.00 86.81  ? 515  HIS C ND1   1 
ATOM   8199  C  CD2   . HIS C 1  132 ? -37.985 25.490  53.398  1.00 90.96  ? 515  HIS C CD2   1 
ATOM   8200  C  CE1   . HIS C 1  132 ? -36.667 23.877  54.076  1.00 96.96  ? 515  HIS C CE1   1 
ATOM   8201  N  NE2   . HIS C 1  132 ? -37.806 24.496  54.327  1.00 95.87  ? 515  HIS C NE2   1 
ATOM   8202  N  N     . PRO C 1  133 ? -37.437 28.791  49.598  1.00 82.88  ? 516  PRO C N     1 
ATOM   8203  C  CA    . PRO C 1  133 ? -36.894 29.770  48.657  1.00 84.31  ? 516  PRO C CA    1 
ATOM   8204  C  C     . PRO C 1  133 ? -35.429 30.078  48.933  1.00 79.04  ? 516  PRO C C     1 
ATOM   8205  O  O     . PRO C 1  133 ? -34.922 29.913  50.046  1.00 81.62  ? 516  PRO C O     1 
ATOM   8206  C  CB    . PRO C 1  133 ? -37.779 30.996  48.910  1.00 89.84  ? 516  PRO C CB    1 
ATOM   8207  C  CG    . PRO C 1  133 ? -38.113 30.882  50.361  1.00 77.20  ? 516  PRO C CG    1 
ATOM   8208  C  CD    . PRO C 1  133 ? -38.284 29.422  50.625  1.00 74.68  ? 516  PRO C CD    1 
ATOM   8209  N  N     . PHE C 1  134 ? -34.743 30.516  47.877  1.00 78.36  ? 517  PHE C N     1 
ATOM   8210  C  CA    . PHE C 1  134 ? -33.315 30.808  47.946  1.00 82.29  ? 517  PHE C CA    1 
ATOM   8211  C  C     . PHE C 1  134 ? -32.956 31.773  46.819  1.00 82.35  ? 517  PHE C C     1 
ATOM   8212  O  O     . PHE C 1  134 ? -33.761 32.028  45.921  1.00 84.02  ? 517  PHE C O     1 
ATOM   8213  C  CB    . PHE C 1  134 ? -32.496 29.513  47.878  1.00 88.58  ? 517  PHE C CB    1 
ATOM   8214  C  CG    . PHE C 1  134 ? -32.760 28.687  46.638  1.00 88.74  ? 517  PHE C CG    1 
ATOM   8215  C  CD1   . PHE C 1  134 ? -31.905 28.748  45.549  1.00 83.81  ? 517  PHE C CD1   1 
ATOM   8216  C  CD2   . PHE C 1  134 ? -33.844 27.825  46.582  1.00 88.28  ? 517  PHE C CD2   1 
ATOM   8217  C  CE1   . PHE C 1  134 ? -32.140 27.996  44.421  1.00 76.44  ? 517  PHE C CE1   1 
ATOM   8218  C  CE2   . PHE C 1  134 ? -34.086 27.074  45.462  1.00 87.19  ? 517  PHE C CE2   1 
ATOM   8219  C  CZ    . PHE C 1  134 ? -33.234 27.165  44.373  1.00 81.08  ? 517  PHE C CZ    1 
ATOM   8220  N  N     . GLU C 1  135 ? -31.729 32.301  46.863  1.00 77.90  ? 518  GLU C N     1 
ATOM   8221  C  CA    . GLU C 1  135 ? -31.247 33.157  45.783  1.00 78.04  ? 518  GLU C CA    1 
ATOM   8222  C  C     . GLU C 1  135 ? -29.785 32.876  45.476  1.00 81.96  ? 518  GLU C C     1 
ATOM   8223  O  O     . GLU C 1  135 ? -28.991 32.597  46.373  1.00 81.72  ? 518  GLU C O     1 
ATOM   8224  C  CB    . GLU C 1  135 ? -31.361 34.642  46.107  1.00 94.93  ? 518  GLU C CB    1 
ATOM   8225  C  CG    . GLU C 1  135 ? -32.764 35.167  46.368  1.00 108.51 ? 518  GLU C CG    1 
ATOM   8226  C  CD    . GLU C 1  135 ? -32.751 36.556  46.985  1.00 120.66 ? 518  GLU C CD    1 
ATOM   8227  O  OE1   . GLU C 1  135 ? -31.709 36.963  47.564  1.00 124.40 ? 518  GLU C OE1   1 
ATOM   8228  O  OE2   . GLU C 1  135 ? -33.778 37.253  46.837  1.00 119.60 ? 518  GLU C OE2   1 
ATOM   8229  N  N     . TRP C 1  136 ? -29.415 33.033  44.207  1.00 77.27  ? 519  TRP C N     1 
ATOM   8230  C  CA    . TRP C 1  136 ? -28.024 32.926  43.774  1.00 82.91  ? 519  TRP C CA    1 
ATOM   8231  C  C     . TRP C 1  136 ? -27.541 34.291  43.301  1.00 86.23  ? 519  TRP C C     1 
ATOM   8232  O  O     . TRP C 1  136 ? -28.168 34.925  42.445  1.00 98.44  ? 519  TRP C O     1 
ATOM   8233  C  CB    . TRP C 1  136 ? -27.862 31.856  42.676  1.00 81.06  ? 519  TRP C CB    1 
ATOM   8234  C  CG    . TRP C 1  136 ? -28.004 30.457  43.223  1.00 75.56  ? 519  TRP C CG    1 
ATOM   8235  C  CD1   . TRP C 1  136 ? -29.150 29.745  43.322  1.00 72.40  ? 519  TRP C CD1   1 
ATOM   8236  C  CD2   . TRP C 1  136 ? -26.964 29.620  43.759  1.00 69.08  ? 519  TRP C CD2   1 
ATOM   8237  N  NE1   . TRP C 1  136 ? -28.901 28.533  43.901  1.00 71.19  ? 519  TRP C NE1   1 
ATOM   8238  C  CE2   . TRP C 1  136 ? -27.563 28.431  44.171  1.00 70.49  ? 519  TRP C CE2   1 
ATOM   8239  C  CE3   . TRP C 1  136 ? -25.587 29.764  43.925  1.00 73.26  ? 519  TRP C CE3   1 
ATOM   8240  C  CZ2   . TRP C 1  136 ? -26.835 27.385  44.737  1.00 72.78  ? 519  TRP C CZ2   1 
ATOM   8241  C  CZ3   . TRP C 1  136 ? -24.869 28.719  44.493  1.00 72.38  ? 519  TRP C CZ3   1 
ATOM   8242  C  CH2   . TRP C 1  136 ? -25.496 27.553  44.895  1.00 65.05  ? 519  TRP C CH2   1 
ATOM   8243  N  N     . GLN C 1  137 ? -26.434 34.748  43.869  1.00 85.31  ? 520  GLN C N     1 
ATOM   8244  C  CA    . GLN C 1  137 ? -25.884 36.054  43.522  1.00 87.84  ? 520  GLN C CA    1 
ATOM   8245  C  C     . GLN C 1  137 ? -24.441 35.894  43.094  1.00 83.44  ? 520  GLN C C     1 
ATOM   8246  O  O     . GLN C 1  137 ? -23.577 35.596  43.947  1.00 88.02  ? 520  GLN C O     1 
ATOM   8247  C  CB    . GLN C 1  137 ? -25.991 37.040  44.673  1.00 100.36 ? 520  GLN C CB    1 
ATOM   8248  C  CG    . GLN C 1  137 ? -25.619 38.420  44.240  1.00 105.21 ? 520  GLN C CG    1 
ATOM   8249  C  CD    . GLN C 1  137 ? -24.876 39.133  45.315  1.00 122.13 ? 520  GLN C CD    1 
ATOM   8250  O  OE1   . GLN C 1  137 ? -24.417 38.504  46.267  1.00 129.57 ? 520  GLN C OE1   1 
ATOM   8251  N  NE2   . GLN C 1  137 ? -24.757 40.450  45.193  1.00 129.65 ? 520  GLN C NE2   1 
ATOM   8252  N  N     . PRO C 1  138 ? -24.140 36.067  41.801  1.00 81.99  ? 521  PRO C N     1 
ATOM   8253  C  CA    . PRO C 1  138 ? -25.129 36.413  40.770  1.00 80.75  ? 521  PRO C CA    1 
ATOM   8254  C  C     . PRO C 1  138 ? -25.934 35.226  40.283  1.00 78.42  ? 521  PRO C C     1 
ATOM   8255  O  O     . PRO C 1  138 ? -25.461 34.115  40.433  1.00 79.60  ? 521  PRO C O     1 
ATOM   8256  C  CB    . PRO C 1  138 ? -24.267 36.955  39.626  1.00 85.81  ? 521  PRO C CB    1 
ATOM   8257  C  CG    . PRO C 1  138 ? -22.890 36.461  39.879  1.00 84.52  ? 521  PRO C CG    1 
ATOM   8258  C  CD    . PRO C 1  138 ? -22.810 35.818  41.228  1.00 75.32  ? 521  PRO C CD    1 
ATOM   8259  N  N     . PRO C 1  139 ? -27.106 35.480  39.705  1.00 79.77  ? 522  PRO C N     1 
ATOM   8260  C  CA    . PRO C 1  139 ? -27.951 34.388  39.203  1.00 87.23  ? 522  PRO C CA    1 
ATOM   8261  C  C     . PRO C 1  139 ? -27.186 33.355  38.380  1.00 89.42  ? 522  PRO C C     1 
ATOM   8262  O  O     . PRO C 1  139 ? -26.275 33.688  37.621  1.00 98.04  ? 522  PRO C O     1 
ATOM   8263  C  CB    . PRO C 1  139 ? -28.996 35.129  38.365  1.00 84.86  ? 522  PRO C CB    1 
ATOM   8264  C  CG    . PRO C 1  139 ? -29.183 36.420  39.158  1.00 76.45  ? 522  PRO C CG    1 
ATOM   8265  C  CD    . PRO C 1  139 ? -27.810 36.773  39.680  1.00 82.26  ? 522  PRO C CD    1 
ATOM   8266  N  N     . LEU C 1  140 ? -27.563 32.084  38.535  1.00 81.89  ? 523  LEU C N     1 
ATOM   8267  C  CA    . LEU C 1  140 ? -26.776 31.016  37.934  1.00 86.41  ? 523  LEU C CA    1 
ATOM   8268  C  C     . LEU C 1  140 ? -26.914 31.057  36.421  1.00 88.20  ? 523  LEU C C     1 
ATOM   8269  O  O     . LEU C 1  140 ? -27.984 31.364  35.889  1.00 86.65  ? 523  LEU C O     1 
ATOM   8270  C  CB    . LEU C 1  140 ? -27.201 29.656  38.491  1.00 82.95  ? 523  LEU C CB    1 
ATOM   8271  C  CG    . LEU C 1  140 ? -26.921 29.471  39.989  1.00 75.23  ? 523  LEU C CG    1 
ATOM   8272  C  CD1   . LEU C 1  140 ? -27.532 28.204  40.519  1.00 80.29  ? 523  LEU C CD1   1 
ATOM   8273  C  CD2   . LEU C 1  140 ? -25.438 29.447  40.259  1.00 80.48  ? 523  LEU C CD2   1 
ATOM   8274  N  N     . LYS C 1  141 ? -25.811 30.772  35.732  1.00 93.05  ? 524  LYS C N     1 
ATOM   8275  C  CA    . LYS C 1  141 ? -25.780 30.819  34.273  1.00 101.26 ? 524  LYS C CA    1 
ATOM   8276  C  C     . LYS C 1  141 ? -26.525 29.624  33.666  1.00 102.18 ? 524  LYS C C     1 
ATOM   8277  O  O     . LYS C 1  141 ? -26.122 28.470  33.859  1.00 93.29  ? 524  LYS C O     1 
ATOM   8278  C  CB    . LYS C 1  141 ? -24.332 30.841  33.785  1.00 108.15 ? 524  LYS C CB    1 
ATOM   8279  C  CG    . LYS C 1  141 ? -24.201 30.787  32.266  1.00 128.62 ? 524  LYS C CG    1 
ATOM   8280  C  CD    . LYS C 1  141 ? -22.795 30.375  31.819  1.00 145.27 ? 524  LYS C CD    1 
ATOM   8281  C  CE    . LYS C 1  141 ? -21.743 31.430  32.168  1.00 158.53 ? 524  LYS C CE    1 
ATOM   8282  N  NZ    . LYS C 1  141 ? -20.389 31.047  31.652  1.00 158.63 ? 524  LYS C NZ    1 
ATOM   8283  N  N     . ASN C 1  142 ? -27.591 29.909  32.903  1.00 100.41 ? 525  ASN C N     1 
ATOM   8284  C  CA    . ASN C 1  142 ? -28.400 28.928  32.174  1.00 85.20  ? 525  ASN C CA    1 
ATOM   8285  C  C     . ASN C 1  142 ? -29.257 28.065  33.077  1.00 85.02  ? 525  ASN C C     1 
ATOM   8286  O  O     . ASN C 1  142 ? -29.842 27.093  32.607  1.00 91.23  ? 525  ASN C O     1 
ATOM   8287  C  CB    . ASN C 1  142 ? -27.544 28.011  31.291  1.00 86.05  ? 525  ASN C CB    1 
ATOM   8288  C  CG    . ASN C 1  142 ? -26.968 28.718  30.097  1.00 98.40  ? 525  ASN C CG    1 
ATOM   8289  O  OD1   . ASN C 1  142 ? -27.316 29.863  29.812  1.00 107.66 ? 525  ASN C OD1   1 
ATOM   8290  N  ND2   . ASN C 1  142 ? -26.070 28.042  29.388  1.00 99.43  ? 525  ASN C ND2   1 
ATOM   8291  N  N     . VAL C 1  143 ? -29.413 28.437  34.344  1.00 82.23  ? 526  VAL C N     1 
ATOM   8292  C  CA    . VAL C 1  143 ? -30.254 27.711  35.286  1.00 78.12  ? 526  VAL C CA    1 
ATOM   8293  C  C     . VAL C 1  143 ? -31.455 28.572  35.613  1.00 72.21  ? 526  VAL C C     1 
ATOM   8294  O  O     . VAL C 1  143 ? -31.313 29.765  35.882  1.00 83.72  ? 526  VAL C O     1 
ATOM   8295  C  CB    . VAL C 1  143 ? -29.495 27.353  36.577  1.00 74.85  ? 526  VAL C CB    1 
ATOM   8296  C  CG1   . VAL C 1  143 ? -30.407 26.638  37.519  1.00 79.34  ? 526  VAL C CG1   1 
ATOM   8297  C  CG2   . VAL C 1  143 ? -28.292 26.484  36.277  1.00 76.17  ? 526  VAL C CG2   1 
ATOM   8298  N  N     . SER C 1  144 ? -32.631 27.965  35.619  1.00 81.95  ? 527  SER C N     1 
ATOM   8299  C  CA    . SER C 1  144 ? -33.812 28.722  35.981  1.00 82.97  ? 527  SER C CA    1 
ATOM   8300  C  C     . SER C 1  144 ? -33.665 29.233  37.409  1.00 89.16  ? 527  SER C C     1 
ATOM   8301  O  O     . SER C 1  144 ? -32.935 28.663  38.225  1.00 88.67  ? 527  SER C O     1 
ATOM   8302  C  CB    . SER C 1  144 ? -35.070 27.865  35.844  1.00 96.43  ? 527  SER C CB    1 
ATOM   8303  O  OG    . SER C 1  144 ? -36.182 28.555  36.387  1.00 102.78 ? 527  SER C OG    1 
ATOM   8304  N  N     . SER C 1  145 ? -34.293 30.374  37.679  1.00 87.52  ? 528  SER C N     1 
ATOM   8305  C  CA    . SER C 1  145 ? -34.341 30.953  39.012  1.00 80.51  ? 528  SER C CA    1 
ATOM   8306  C  C     . SER C 1  145 ? -35.544 30.509  39.823  1.00 86.05  ? 528  SER C C     1 
ATOM   8307  O  O     . SER C 1  145 ? -35.622 30.851  41.008  1.00 93.83  ? 528  SER C O     1 
ATOM   8308  C  CB    . SER C 1  145 ? -34.311 32.481  38.916  1.00 88.06  ? 528  SER C CB    1 
ATOM   8309  O  OG    . SER C 1  145 ? -35.378 32.978  38.125  1.00 89.28  ? 528  SER C OG    1 
ATOM   8310  N  N     . ARG C 1  146 ? -36.474 29.766  39.223  1.00 84.25  ? 529  ARG C N     1 
ATOM   8311  C  CA    . ARG C 1  146 ? -37.617 29.259  39.971  1.00 92.30  ? 529  ARG C CA    1 
ATOM   8312  C  C     . ARG C 1  146 ? -37.118 28.337  41.072  1.00 90.27  ? 529  ARG C C     1 
ATOM   8313  O  O     . ARG C 1  146 ? -36.195 27.546  40.863  1.00 94.12  ? 529  ARG C O     1 
ATOM   8314  C  CB    . ARG C 1  146 ? -38.585 28.513  39.055  1.00 103.98 ? 529  ARG C CB    1 
ATOM   8315  C  CG    . ARG C 1  146 ? -39.622 29.380  38.365  1.00 107.81 ? 529  ARG C CG    1 
ATOM   8316  C  CD    . ARG C 1  146 ? -40.459 28.544  37.394  1.00 129.30 ? 529  ARG C CD    1 
ATOM   8317  N  NE    . ARG C 1  146 ? -41.215 29.381  36.463  1.00 144.37 ? 529  ARG C NE    1 
ATOM   8318  C  CZ    . ARG C 1  146 ? -41.866 28.927  35.394  1.00 149.55 ? 529  ARG C CZ    1 
ATOM   8319  N  NH1   . ARG C 1  146 ? -41.864 27.630  35.101  1.00 145.17 ? 529  ARG C NH1   1 
ATOM   8320  N  NH2   . ARG C 1  146 ? -42.523 29.774  34.613  1.00 147.32 ? 529  ARG C NH2   1 
ATOM   8321  N  N     . THR C 1  147 ? -37.671 28.492  42.265  1.00 80.79  ? 530  THR C N     1 
ATOM   8322  C  CA    . THR C 1  147 ? -37.246 27.703  43.406  1.00 86.30  ? 530  THR C CA    1 
ATOM   8323  C  C     . THR C 1  147 ? -38.236 26.608  43.786  1.00 97.34  ? 530  THR C C     1 
ATOM   8324  O  O     . THR C 1  147 ? -37.918 25.766  44.636  1.00 98.26  ? 530  THR C O     1 
ATOM   8325  C  CB    . THR C 1  147 ? -36.988 28.634  44.585  1.00 89.29  ? 530  THR C CB    1 
ATOM   8326  O  OG1   . THR C 1  147 ? -38.204 29.301  44.938  1.00 98.78  ? 530  THR C OG1   1 
ATOM   8327  C  CG2   . THR C 1  147 ? -35.938 29.659  44.203  1.00 89.43  ? 530  THR C CG2   1 
ATOM   8328  N  N     . ASP C 1  148 ? -39.410 26.565  43.152  1.00 99.01  ? 531  ASP C N     1 
ATOM   8329  C  CA    . ASP C 1  148 ? -40.405 25.545  43.448  1.00 93.68  ? 531  ASP C CA    1 
ATOM   8330  C  C     . ASP C 1  148 ? -40.265 24.325  42.561  1.00 97.54  ? 531  ASP C C     1 
ATOM   8331  O  O     . ASP C 1  148 ? -41.255 23.621  42.329  1.00 108.52 ? 531  ASP C O     1 
ATOM   8332  C  CB    . ASP C 1  148 ? -41.811 26.127  43.300  1.00 90.47  ? 531  ASP C CB    1 
ATOM   8333  C  CG    . ASP C 1  148 ? -42.137 26.525  41.865  1.00 97.94  ? 531  ASP C CG    1 
ATOM   8334  O  OD1   . ASP C 1  148 ? -41.214 26.589  41.020  1.00 101.97 ? 531  ASP C OD1   1 
ATOM   8335  O  OD2   . ASP C 1  148 ? -43.330 26.758  41.579  1.00 102.30 ? 531  ASP C OD2   1 
ATOM   8336  N  N     . VAL C 1  149 ? -39.058 24.018  42.104  1.00 92.37  ? 532  VAL C N     1 
ATOM   8337  C  CA    . VAL C 1  149 ? -38.837 22.899  41.204  1.00 86.20  ? 532  VAL C CA    1 
ATOM   8338  C  C     . VAL C 1  149 ? -38.370 21.703  42.019  1.00 92.03  ? 532  VAL C C     1 
ATOM   8339  O  O     . VAL C 1  149 ? -37.442 21.810  42.827  1.00 86.72  ? 532  VAL C O     1 
ATOM   8340  C  CB    . VAL C 1  149 ? -37.831 23.277  40.106  1.00 86.78  ? 532  VAL C CB    1 
ATOM   8341  C  CG1   . VAL C 1  149 ? -36.432 23.492  40.687  1.00 88.85  ? 532  VAL C CG1   1 
ATOM   8342  C  CG2   . VAL C 1  149 ? -37.838 22.249  39.014  1.00 93.31  ? 532  VAL C CG2   1 
ATOM   8343  N  N     . GLY C 1  150 ? -39.013 20.562  41.807  1.00 92.13  ? 533  GLY C N     1 
ATOM   8344  C  CA    . GLY C 1  150 ? -38.659 19.349  42.517  1.00 91.99  ? 533  GLY C CA    1 
ATOM   8345  C  C     . GLY C 1  150 ? -38.085 18.258  41.641  1.00 90.17  ? 533  GLY C C     1 
ATOM   8346  O  O     . GLY C 1  150 ? -36.971 18.382  41.116  1.00 87.72  ? 533  GLY C O     1 
ATOM   8347  N  N     . ILE C 1  151 ? -38.817 17.151  41.528  1.00 80.90  ? 534  ILE C N     1 
ATOM   8348  C  CA    . ILE C 1  151 ? -38.412 16.106  40.603  1.00 86.47  ? 534  ILE C CA    1 
ATOM   8349  C  C     . ILE C 1  151 ? -38.659 16.597  39.184  1.00 75.42  ? 534  ILE C C     1 
ATOM   8350  O  O     . ILE C 1  151 ? -39.691 17.213  38.891  1.00 77.10  ? 534  ILE C O     1 
ATOM   8351  C  CB    . ILE C 1  151 ? -39.141 14.786  40.905  1.00 76.29  ? 534  ILE C CB    1 
ATOM   8352  C  CG1   . ILE C 1  151 ? -38.665 14.238  42.246  1.00 73.00  ? 534  ILE C CG1   1 
ATOM   8353  C  CG2   . ILE C 1  151 ? -38.855 13.756  39.834  1.00 76.10  ? 534  ILE C CG2   1 
ATOM   8354  C  CD1   . ILE C 1  151 ? -39.250 12.923  42.626  1.00 79.27  ? 534  ILE C CD1   1 
ATOM   8355  N  N     . ILE C 1  152 ? -37.650 16.443  38.335  1.00 69.59  ? 535  ILE C N     1 
ATOM   8356  C  CA    . ILE C 1  152 ? -37.714 16.825  36.940  1.00 72.04  ? 535  ILE C CA    1 
ATOM   8357  C  C     . ILE C 1  152 ? -37.212 15.662  36.103  1.00 82.42  ? 535  ILE C C     1 
ATOM   8358  O  O     . ILE C 1  152 ? -36.456 14.800  36.571  1.00 80.88  ? 535  ILE C O     1 
ATOM   8359  C  CB    . ILE C 1  152 ? -36.900 18.084  36.643  1.00 82.78  ? 535  ILE C CB    1 
ATOM   8360  C  CG1   . ILE C 1  152 ? -35.480 17.943  37.180  1.00 85.44  ? 535  ILE C CG1   1 
ATOM   8361  C  CG2   . ILE C 1  152 ? -37.531 19.253  37.298  1.00 94.10  ? 535  ILE C CG2   1 
ATOM   8362  C  CD1   . ILE C 1  152 ? -34.645 19.159  36.919  1.00 88.92  ? 535  ILE C CD1   1 
ATOM   8363  N  N     . ASP C 1  153 ? -37.644 15.656  34.843  1.00 82.16  ? 536  ASP C N     1 
ATOM   8364  C  CA    . ASP C 1  153 ? -37.274 14.592  33.924  1.00 82.54  ? 536  ASP C CA    1 
ATOM   8365  C  C     . ASP C 1  153 ? -35.768 14.571  33.708  1.00 81.87  ? 536  ASP C C     1 
ATOM   8366  O  O     . ASP C 1  153 ? -35.171 15.583  33.333  1.00 85.22  ? 536  ASP C O     1 
ATOM   8367  C  CB    . ASP C 1  153 ? -37.996 14.797  32.596  1.00 87.32  ? 536  ASP C CB    1 
ATOM   8368  C  CG    . ASP C 1  153 ? -37.529 13.839  31.516  1.00 104.06 ? 536  ASP C CG    1 
ATOM   8369  O  OD1   . ASP C 1  153 ? -37.822 12.621  31.650  1.00 110.30 ? 536  ASP C OD1   1 
ATOM   8370  O  OD2   . ASP C 1  153 ? -36.915 14.309  30.523  1.00 89.94  ? 536  ASP C OD2   1 
ATOM   8371  N  N     . GLY C 1  154 ? -35.155 13.412  33.957  1.00 77.33  ? 537  GLY C N     1 
ATOM   8372  C  CA    . GLY C 1  154 ? -33.714 13.278  33.841  1.00 82.36  ? 537  GLY C CA    1 
ATOM   8373  C  C     . GLY C 1  154 ? -33.208 13.384  32.422  1.00 82.88  ? 537  GLY C C     1 
ATOM   8374  O  O     . GLY C 1  154 ? -32.008 13.602  32.209  1.00 88.89  ? 537  GLY C O     1 
ATOM   8375  N  N     . LEU C 1  155 ? -34.093 13.201  31.445  1.00 86.78  ? 538  LEU C N     1 
ATOM   8376  C  CA    . LEU C 1  155 ? -33.704 13.360  30.055  1.00 87.59  ? 538  LEU C CA    1 
ATOM   8377  C  C     . LEU C 1  155 ? -33.489 14.822  29.693  1.00 91.11  ? 538  LEU C C     1 
ATOM   8378  O  O     . LEU C 1  155 ? -32.844 15.111  28.677  1.00 89.88  ? 538  LEU C O     1 
ATOM   8379  C  CB    . LEU C 1  155 ? -34.757 12.728  29.148  1.00 91.78  ? 538  LEU C CB    1 
ATOM   8380  C  CG    . LEU C 1  155 ? -34.801 11.208  29.193  1.00 92.90  ? 538  LEU C CG    1 
ATOM   8381  C  CD1   . LEU C 1  155 ? -35.727 10.696  28.107  1.00 98.95  ? 538  LEU C CD1   1 
ATOM   8382  C  CD2   . LEU C 1  155 ? -33.398 10.667  29.034  1.00 83.78  ? 538  LEU C CD2   1 
ATOM   8383  N  N     . SER C 1  156 ? -33.983 15.742  30.514  1.00 86.32  ? 539  SER C N     1 
ATOM   8384  C  CA    . SER C 1  156 ? -33.763 17.169  30.307  1.00 88.50  ? 539  SER C CA    1 
ATOM   8385  C  C     . SER C 1  156 ? -34.148 17.572  28.882  1.00 91.34  ? 539  SER C C     1 
ATOM   8386  O  O     . SER C 1  156 ? -33.383 18.217  28.160  1.00 92.88  ? 539  SER C O     1 
ATOM   8387  C  CB    . SER C 1  156 ? -32.311 17.557  30.621  1.00 86.59  ? 539  SER C CB    1 
ATOM   8388  O  OG    . SER C 1  156 ? -31.938 17.235  31.950  1.00 79.24  ? 539  SER C OG    1 
ATOM   8389  N  N     . GLY C 1  157 ? -35.339 17.146  28.461  1.00 89.82  ? 540  GLY C N     1 
ATOM   8390  C  CA    . GLY C 1  157 ? -35.839 17.541  27.157  1.00 89.06  ? 540  GLY C CA    1 
ATOM   8391  C  C     . GLY C 1  157 ? -35.180 16.880  25.970  1.00 88.89  ? 540  GLY C C     1 
ATOM   8392  O  O     . GLY C 1  157 ? -35.231 17.424  24.861  1.00 94.32  ? 540  GLY C O     1 
ATOM   8393  N  N     . LEU C 1  158 ? -34.492 15.766  26.188  1.00 84.13  ? 541  LEU C N     1 
ATOM   8394  C  CA    . LEU C 1  158 ? -33.915 15.006  25.091  1.00 85.39  ? 541  LEU C CA    1 
ATOM   8395  C  C     . LEU C 1  158 ? -34.999 14.599  24.096  1.00 95.81  ? 541  LEU C C     1 
ATOM   8396  O  O     . LEU C 1  158 ? -36.065 14.113  24.483  1.00 100.11 ? 541  LEU C O     1 
ATOM   8397  C  CB    . LEU C 1  158 ? -33.215 13.780  25.646  1.00 80.39  ? 541  LEU C CB    1 
ATOM   8398  C  CG    . LEU C 1  158 ? -32.408 12.988  24.641  1.00 80.02  ? 541  LEU C CG    1 
ATOM   8399  C  CD1   . LEU C 1  158 ? -31.254 13.822  24.122  1.00 83.24  ? 541  LEU C CD1   1 
ATOM   8400  C  CD2   . LEU C 1  158 ? -31.913 11.744  25.308  1.00 83.85  ? 541  LEU C CD2   1 
ATOM   8401  N  N     . ALA C 1  159 ? -34.731 14.813  22.810  1.00 104.03 ? 542  ALA C N     1 
ATOM   8402  C  CA    . ALA C 1  159 ? -35.711 14.510  21.773  1.00 106.36 ? 542  ALA C CA    1 
ATOM   8403  C  C     . ALA C 1  159 ? -35.999 13.012  21.704  1.00 108.22 ? 542  ALA C C     1 
ATOM   8404  O  O     . ALA C 1  159 ? -35.099 12.181  21.837  1.00 103.53 ? 542  ALA C O     1 
ATOM   8405  C  CB    . ALA C 1  159 ? -35.222 15.039  20.422  1.00 109.46 ? 542  ALA C CB    1 
ATOM   8406  N  N     . SER C 1  160 ? -37.273 12.666  21.506  1.00 116.47 ? 543  SER C N     1 
ATOM   8407  C  CA    . SER C 1  160 ? -37.713 11.276  21.531  1.00 119.99 ? 543  SER C CA    1 
ATOM   8408  C  C     . SER C 1  160 ? -38.434 10.830  20.268  1.00 124.70 ? 543  SER C C     1 
ATOM   8409  O  O     . SER C 1  160 ? -38.962 9.712   20.245  1.00 125.47 ? 543  SER C O     1 
ATOM   8410  C  CB    . SER C 1  160 ? -38.636 11.025  22.732  1.00 129.45 ? 543  SER C CB    1 
ATOM   8411  O  OG    . SER C 1  160 ? -37.988 11.316  23.960  1.00 139.18 ? 543  SER C OG    1 
ATOM   8412  N  N     . SER C 1  161 ? -38.506 11.671  19.239  1.00 132.09 ? 544  SER C N     1 
ATOM   8413  C  CA    . SER C 1  161 ? -39.182 11.299  18.005  1.00 124.84 ? 544  SER C CA    1 
ATOM   8414  C  C     . SER C 1  161 ? -38.493 10.115  17.340  1.00 115.55 ? 544  SER C C     1 
ATOM   8415  O  O     . SER C 1  161 ? -37.316 9.824   17.582  1.00 116.99 ? 544  SER C O     1 
ATOM   8416  C  CB    . SER C 1  161 ? -39.222 12.472  17.027  1.00 132.78 ? 544  SER C CB    1 
ATOM   8417  O  OG    . SER C 1  161 ? -39.740 12.050  15.775  1.00 131.65 ? 544  SER C OG    1 
ATOM   8418  N  N     . VAL C 1  162 ? -39.251 9.426   16.482  1.00 116.31 ? 545  VAL C N     1 
ATOM   8419  C  CA    . VAL C 1  162 ? -38.718 8.239   15.823  1.00 119.48 ? 545  VAL C CA    1 
ATOM   8420  C  C     . VAL C 1  162 ? -37.527 8.569   14.935  1.00 115.93 ? 545  VAL C C     1 
ATOM   8421  O  O     . VAL C 1  162 ? -36.651 7.718   14.737  1.00 107.69 ? 545  VAL C O     1 
ATOM   8422  C  CB    . VAL C 1  162 ? -39.828 7.525   15.016  1.00 111.74 ? 545  VAL C CB    1 
ATOM   8423  C  CG1   . VAL C 1  162 ? -40.832 6.858   15.954  1.00 122.05 ? 545  VAL C CG1   1 
ATOM   8424  C  CG2   . VAL C 1  162 ? -40.520 8.501   14.074  1.00 110.58 ? 545  VAL C CG2   1 
ATOM   8425  N  N     . ASP C 1  163 ? -37.424 9.813   14.458  1.00 116.58 ? 546  ASP C N     1 
ATOM   8426  C  CA    . ASP C 1  163 ? -36.308 10.183  13.590  1.00 110.15 ? 546  ASP C CA    1 
ATOM   8427  C  C     . ASP C 1  163 ? -35.011 10.262  14.376  1.00 111.49 ? 546  ASP C C     1 
ATOM   8428  O  O     . ASP C 1  163 ? -33.947 9.878   13.875  1.00 104.91 ? 546  ASP C O     1 
ATOM   8429  C  CB    . ASP C 1  163 ? -36.592 11.527  12.924  1.00 106.16 ? 546  ASP C CB    1 
ATOM   8430  C  CG    . ASP C 1  163 ? -37.883 11.526  12.147  1.00 113.03 ? 546  ASP C CG    1 
ATOM   8431  O  OD1   . ASP C 1  163 ? -38.036 10.677  11.243  1.00 109.99 ? 546  ASP C OD1   1 
ATOM   8432  O  OD2   . ASP C 1  163 ? -38.760 12.354  12.473  1.00 121.92 ? 546  ASP C OD2   1 
ATOM   8433  N  N     . GLU C 1  164 ? -35.093 10.740  15.615  1.00 113.11 ? 547  GLU C N     1 
ATOM   8434  C  CA    . GLU C 1  164 ? -33.923 10.998  16.431  1.00 107.46 ? 547  GLU C CA    1 
ATOM   8435  C  C     . GLU C 1  164 ? -33.290 9.691   16.887  1.00 100.96 ? 547  GLU C C     1 
ATOM   8436  O  O     . GLU C 1  164 ? -33.790 8.592   16.626  1.00 105.33 ? 547  GLU C O     1 
ATOM   8437  C  CB    . GLU C 1  164 ? -34.307 11.858  17.629  1.00 102.09 ? 547  GLU C CB    1 
ATOM   8438  C  CG    . GLU C 1  164 ? -35.094 13.101  17.248  1.00 110.54 ? 547  GLU C CG    1 
ATOM   8439  C  CD    . GLU C 1  164 ? -34.201 14.310  17.023  1.00 114.67 ? 547  GLU C CD    1 
ATOM   8440  O  OE1   . GLU C 1  164 ? -34.719 15.361  16.582  1.00 115.14 ? 547  GLU C OE1   1 
ATOM   8441  O  OE2   . GLU C 1  164 ? -32.978 14.206  17.281  1.00 114.98 ? 547  GLU C OE2   1 
ATOM   8442  N  N     . TYR C 1  165 ? -32.188 9.826   17.606  1.00 92.83  ? 548  TYR C N     1 
ATOM   8443  C  CA    . TYR C 1  165 ? -31.539 8.669   18.186  1.00 91.72  ? 548  TYR C CA    1 
ATOM   8444  C  C     . TYR C 1  165 ? -32.501 7.964   19.133  1.00 103.30 ? 548  TYR C C     1 
ATOM   8445  O  O     . TYR C 1  165 ? -33.267 8.628   19.844  1.00 106.46 ? 548  TYR C O     1 
ATOM   8446  C  CB    . TYR C 1  165 ? -30.305 9.095   18.956  1.00 85.56  ? 548  TYR C CB    1 
ATOM   8447  C  CG    . TYR C 1  165 ? -29.287 8.029   19.165  1.00 82.34  ? 548  TYR C CG    1 
ATOM   8448  C  CD1   . TYR C 1  165 ? -28.518 7.579   18.113  1.00 83.41  ? 548  TYR C CD1   1 
ATOM   8449  C  CD2   . TYR C 1  165 ? -29.056 7.504   20.424  1.00 86.70  ? 548  TYR C CD2   1 
ATOM   8450  C  CE1   . TYR C 1  165 ? -27.548 6.623   18.301  1.00 85.17  ? 548  TYR C CE1   1 
ATOM   8451  C  CE2   . TYR C 1  165 ? -28.085 6.537   20.630  1.00 92.54  ? 548  TYR C CE2   1 
ATOM   8452  C  CZ    . TYR C 1  165 ? -27.334 6.102   19.563  1.00 88.71  ? 548  TYR C CZ    1 
ATOM   8453  O  OH    . TYR C 1  165 ? -26.371 5.147   19.766  1.00 81.45  ? 548  TYR C OH    1 
ATOM   8454  N  N     . PRO C 1  166 ? -32.486 6.631   19.170  1.00 108.98 ? 549  PRO C N     1 
ATOM   8455  C  CA    . PRO C 1  166 ? -33.444 5.898   20.008  1.00 104.58 ? 549  PRO C CA    1 
ATOM   8456  C  C     . PRO C 1  166 ? -33.098 6.014   21.487  1.00 107.82 ? 549  PRO C C     1 
ATOM   8457  O  O     . PRO C 1  166 ? -31.996 5.655   21.914  1.00 105.67 ? 549  PRO C O     1 
ATOM   8458  C  CB    . PRO C 1  166 ? -33.300 4.455   19.518  1.00 100.67 ? 549  PRO C CB    1 
ATOM   8459  C  CG    . PRO C 1  166 ? -31.920 4.398   18.966  1.00 94.12  ? 549  PRO C CG    1 
ATOM   8460  C  CD    . PRO C 1  166 ? -31.642 5.728   18.372  1.00 97.74  ? 549  PRO C CD    1 
ATOM   8461  N  N     . VAL C 1  167 ? -34.077 6.449   22.275  1.00 107.67 ? 550  VAL C N     1 
ATOM   8462  C  CA    . VAL C 1  167 ? -33.923 6.634   23.710  1.00 103.65 ? 550  VAL C CA    1 
ATOM   8463  C  C     . VAL C 1  167 ? -34.470 5.396   24.405  1.00 108.82 ? 550  VAL C C     1 
ATOM   8464  O  O     . VAL C 1  167 ? -35.678 5.137   24.382  1.00 104.64 ? 550  VAL C O     1 
ATOM   8465  C  CB    . VAL C 1  167 ? -34.627 7.906   24.185  1.00 107.71 ? 550  VAL C CB    1 
ATOM   8466  C  CG1   . VAL C 1  167 ? -34.618 7.969   25.694  1.00 109.12 ? 550  VAL C CG1   1 
ATOM   8467  C  CG2   . VAL C 1  167 ? -33.937 9.115   23.588  1.00 107.46 ? 550  VAL C CG2   1 
ATOM   8468  N  N     . ASP C 1  168 ? -33.575 4.627   25.019  1.00 117.85 ? 551  ASP C N     1 
ATOM   8469  C  CA    . ASP C 1  168 ? -33.911 3.363   25.659  1.00 118.79 ? 551  ASP C CA    1 
ATOM   8470  C  C     . ASP C 1  168 ? -33.956 3.477   27.171  1.00 120.58 ? 551  ASP C C     1 
ATOM   8471  O  O     . ASP C 1  168 ? -33.991 2.447   27.853  1.00 118.97 ? 551  ASP C O     1 
ATOM   8472  C  CB    . ASP C 1  168 ? -32.881 2.280   25.293  1.00 128.64 ? 551  ASP C CB    1 
ATOM   8473  C  CG    . ASP C 1  168 ? -32.938 1.852   23.830  1.00 141.83 ? 551  ASP C CG    1 
ATOM   8474  O  OD1   . ASP C 1  168 ? -34.005 1.973   23.189  1.00 142.35 ? 551  ASP C OD1   1 
ATOM   8475  O  OD2   . ASP C 1  168 ? -31.887 1.402   23.314  1.00 148.07 ? 551  ASP C OD2   1 
ATOM   8476  N  N     . THR C 1  169 ? -33.967 4.694   27.716  1.00 109.93 ? 552  THR C N     1 
ATOM   8477  C  CA    . THR C 1  169 ? -33.764 4.871   29.144  1.00 91.34  ? 552  THR C CA    1 
ATOM   8478  C  C     . THR C 1  169 ? -34.842 5.748   29.756  1.00 83.30  ? 552  THR C C     1 
ATOM   8479  O  O     . THR C 1  169 ? -35.476 6.551   29.072  1.00 82.05  ? 552  THR C O     1 
ATOM   8480  C  CB    . THR C 1  169 ? -32.390 5.482   29.417  1.00 82.68  ? 552  THR C CB    1 
ATOM   8481  O  OG1   . THR C 1  169 ? -32.225 5.678   30.822  1.00 88.59  ? 552  THR C OG1   1 
ATOM   8482  C  CG2   . THR C 1  169 ? -32.259 6.799   28.707  1.00 83.68  ? 552  THR C CG2   1 
ATOM   8483  N  N     . ILE C 1  170 ? -35.113 5.502   31.036  1.00 88.54  ? 553  ILE C N     1 
ATOM   8484  C  CA    . ILE C 1  170 ? -35.947 6.370   31.859  1.00 85.96  ? 553  ILE C CA    1 
ATOM   8485  C  C     . ILE C 1  170 ? -35.135 6.792   33.076  1.00 88.18  ? 553  ILE C C     1 
ATOM   8486  O  O     . ILE C 1  170 ? -34.536 5.946   33.752  1.00 86.30  ? 553  ILE C O     1 
ATOM   8487  C  CB    . ILE C 1  170 ? -37.269 5.707   32.285  1.00 80.29  ? 553  ILE C CB    1 
ATOM   8488  C  CG1   . ILE C 1  170 ? -37.017 4.420   33.054  1.00 97.31  ? 553  ILE C CG1   1 
ATOM   8489  C  CG2   . ILE C 1  170 ? -38.149 5.436   31.089  1.00 85.08  ? 553  ILE C CG2   1 
ATOM   8490  C  CD1   . ILE C 1  170 ? -38.290 3.707   33.406  1.00 115.01 ? 553  ILE C CD1   1 
ATOM   8491  N  N     . ALA C 1  171 ? -35.169 8.087   33.387  1.00 89.17  ? 554  ALA C N     1 
ATOM   8492  C  CA    . ALA C 1  171 ? -34.376 8.664   34.463  1.00 84.79  ? 554  ALA C CA    1 
ATOM   8493  C  C     . ALA C 1  171 ? -35.147 9.811   35.098  1.00 88.89  ? 554  ALA C C     1 
ATOM   8494  O  O     . ALA C 1  171 ? -35.968 10.462  34.446  1.00 86.45  ? 554  ALA C O     1 
ATOM   8495  C  CB    . ALA C 1  171 ? -33.035 9.192   33.948  1.00 78.20  ? 554  ALA C CB    1 
ATOM   8496  N  N     . LYS C 1  172 ? -34.893 10.047  36.385  1.00 77.35  ? 555  LYS C N     1 
ATOM   8497  C  CA    . LYS C 1  172 ? -35.469 11.211  37.050  1.00 79.87  ? 555  LYS C CA    1 
ATOM   8498  C  C     . LYS C 1  172 ? -34.392 11.854  37.914  1.00 83.67  ? 555  LYS C C     1 
ATOM   8499  O  O     . LYS C 1  172 ? -33.486 11.175  38.414  1.00 75.06  ? 555  LYS C O     1 
ATOM   8500  C  CB    . LYS C 1  172 ? -36.704 10.892  37.904  1.00 72.06  ? 555  LYS C CB    1 
ATOM   8501  C  CG    . LYS C 1  172 ? -37.841 10.326  37.102  1.00 82.46  ? 555  LYS C CG    1 
ATOM   8502  C  CD    . LYS C 1  172 ? -38.444 11.324  36.142  1.00 80.78  ? 555  LYS C CD    1 
ATOM   8503  C  CE    . LYS C 1  172 ? -39.517 10.667  35.292  1.00 95.57  ? 555  LYS C CE    1 
ATOM   8504  N  NZ    . LYS C 1  172 ? -40.218 11.623  34.399  1.00 104.01 ? 555  LYS C NZ    1 
ATOM   8505  N  N     . ARG C 1  173 ? -34.485 13.175  38.087  1.00 74.66  ? 556  ARG C N     1 
ATOM   8506  C  CA    . ARG C 1  173 ? -33.427 13.869  38.796  1.00 69.28  ? 556  ARG C CA    1 
ATOM   8507  C  C     . ARG C 1  173 ? -33.986 15.058  39.552  1.00 71.79  ? 556  ARG C C     1 
ATOM   8508  O  O     . ARG C 1  173 ? -35.140 15.455  39.377  1.00 72.00  ? 556  ARG C O     1 
ATOM   8509  C  CB    . ARG C 1  173 ? -32.352 14.370  37.842  1.00 76.84  ? 556  ARG C CB    1 
ATOM   8510  C  CG    . ARG C 1  173 ? -32.773 15.567  36.967  1.00 76.66  ? 556  ARG C CG    1 
ATOM   8511  C  CD    . ARG C 1  173 ? -31.584 15.986  36.109  1.00 77.52  ? 556  ARG C CD    1 
ATOM   8512  N  NE    . ARG C 1  173 ? -31.839 17.119  35.226  1.00 81.54  ? 556  ARG C NE    1 
ATOM   8513  C  CZ    . ARG C 1  173 ? -31.378 18.348  35.443  1.00 83.05  ? 556  ARG C CZ    1 
ATOM   8514  N  NH1   . ARG C 1  173 ? -30.653 18.604  36.522  1.00 83.22  ? 556  ARG C NH1   1 
ATOM   8515  N  NH2   . ARG C 1  173 ? -31.639 19.325  34.586  1.00 83.86  ? 556  ARG C NH2   1 
ATOM   8516  N  N     . PHE C 1  174 ? -33.133 15.622  40.398  1.00 75.05  ? 557  PHE C N     1 
ATOM   8517  C  CA    . PHE C 1  174 ? -33.333 16.932  40.991  1.00 75.74  ? 557  PHE C CA    1 
ATOM   8518  C  C     . PHE C 1  174 ? -32.463 17.975  40.279  1.00 83.98  ? 557  PHE C C     1 
ATOM   8519  O  O     . PHE C 1  174 ? -31.434 17.657  39.672  1.00 81.16  ? 557  PHE C O     1 
ATOM   8520  C  CB    . PHE C 1  174 ? -32.980 16.892  42.471  1.00 73.25  ? 557  PHE C CB    1 
ATOM   8521  C  CG    . PHE C 1  174 ? -33.849 15.993  43.268  1.00 65.74  ? 557  PHE C CG    1 
ATOM   8522  C  CD1   . PHE C 1  174 ? -35.222 16.053  43.142  1.00 64.88  ? 557  PHE C CD1   1 
ATOM   8523  C  CD2   . PHE C 1  174 ? -33.294 15.103  44.165  1.00 70.04  ? 557  PHE C CD2   1 
ATOM   8524  C  CE1   . PHE C 1  174 ? -36.017 15.244  43.881  1.00 64.77  ? 557  PHE C CE1   1 
ATOM   8525  C  CE2   . PHE C 1  174 ? -34.092 14.289  44.909  1.00 68.79  ? 557  PHE C CE2   1 
ATOM   8526  C  CZ    . PHE C 1  174 ? -35.456 14.355  44.761  1.00 65.28  ? 557  PHE C CZ    1 
ATOM   8527  N  N     . ARG C 1  175 ? -32.871 19.239  40.366  1.00 76.58  ? 558  ARG C N     1 
ATOM   8528  C  CA    . ARG C 1  175 ? -31.968 20.312  39.964  1.00 78.64  ? 558  ARG C CA    1 
ATOM   8529  C  C     . ARG C 1  175 ? -30.928 20.488  41.066  1.00 77.55  ? 558  ARG C C     1 
ATOM   8530  O  O     . ARG C 1  175 ? -31.269 20.477  42.257  1.00 79.37  ? 558  ARG C O     1 
ATOM   8531  C  CB    . ARG C 1  175 ? -32.732 21.608  39.683  1.00 87.35  ? 558  ARG C CB    1 
ATOM   8532  C  CG    . ARG C 1  175 ? -32.259 22.342  38.423  1.00 77.61  ? 558  ARG C CG    1 
ATOM   8533  C  CD    . ARG C 1  175 ? -33.066 23.604  38.161  1.00 77.64  ? 558  ARG C CD    1 
ATOM   8534  N  NE    . ARG C 1  175 ? -32.992 24.524  39.288  1.00 82.37  ? 558  ARG C NE    1 
ATOM   8535  C  CZ    . ARG C 1  175 ? -33.861 25.501  39.515  1.00 81.08  ? 558  ARG C CZ    1 
ATOM   8536  N  NH1   . ARG C 1  175 ? -34.883 25.691  38.683  1.00 86.14  ? 558  ARG C NH1   1 
ATOM   8537  N  NH2   . ARG C 1  175 ? -33.708 26.286  40.576  1.00 76.79  ? 558  ARG C NH2   1 
ATOM   8538  N  N     . TYR C 1  176 ? -29.651 20.555  40.668  1.00 70.40  ? 559  TYR C N     1 
ATOM   8539  C  CA    . TYR C 1  176 ? -28.544 20.358  41.608  1.00 68.60  ? 559  TYR C CA    1 
ATOM   8540  C  C     . TYR C 1  176 ? -28.573 21.375  42.740  1.00 74.25  ? 559  TYR C C     1 
ATOM   8541  O  O     . TYR C 1  176 ? -28.393 21.022  43.916  1.00 74.93  ? 559  TYR C O     1 
ATOM   8542  C  CB    . TYR C 1  176 ? -27.228 20.423  40.831  1.00 61.95  ? 559  TYR C CB    1 
ATOM   8543  C  CG    . TYR C 1  176 ? -26.020 19.735  41.432  1.00 60.86  ? 559  TYR C CG    1 
ATOM   8544  C  CD1   . TYR C 1  176 ? -25.823 19.670  42.803  1.00 64.50  ? 559  TYR C CD1   1 
ATOM   8545  C  CD2   . TYR C 1  176 ? -25.064 19.144  40.608  1.00 68.39  ? 559  TYR C CD2   1 
ATOM   8546  C  CE1   . TYR C 1  176 ? -24.695 19.035  43.340  1.00 68.63  ? 559  TYR C CE1   1 
ATOM   8547  C  CE2   . TYR C 1  176 ? -23.934 18.510  41.130  1.00 69.43  ? 559  TYR C CE2   1 
ATOM   8548  C  CZ    . TYR C 1  176 ? -23.757 18.458  42.493  1.00 66.29  ? 559  TYR C CZ    1 
ATOM   8549  O  OH    . TYR C 1  176 ? -22.636 17.832  42.990  1.00 69.69  ? 559  TYR C OH    1 
ATOM   8550  N  N     . ASP C 1  177 ? -28.816 22.644  42.401  1.00 76.96  ? 560  ASP C N     1 
ATOM   8551  C  CA    . ASP C 1  177 ? -28.936 23.707  43.403  1.00 78.74  ? 560  ASP C CA    1 
ATOM   8552  C  C     . ASP C 1  177 ? -30.139 23.478  44.317  1.00 80.04  ? 560  ASP C C     1 
ATOM   8553  O  O     . ASP C 1  177 ? -30.063 23.690  45.536  1.00 80.25  ? 560  ASP C O     1 
ATOM   8554  C  CB    . ASP C 1  177 ? -29.039 25.054  42.696  1.00 65.60  ? 560  ASP C CB    1 
ATOM   8555  C  CG    . ASP C 1  177 ? -30.234 25.114  41.773  1.00 73.89  ? 560  ASP C CG    1 
ATOM   8556  O  OD1   . ASP C 1  177 ? -30.619 24.037  41.262  1.00 77.92  ? 560  ASP C OD1   1 
ATOM   8557  O  OD2   . ASP C 1  177 ? -30.795 26.223  41.570  1.00 79.60  ? 560  ASP C OD2   1 
ATOM   8558  N  N     . SER C 1  178 ? -31.290 23.137  43.725  1.00 71.06  ? 561  SER C N     1 
ATOM   8559  C  CA    . SER C 1  178 ? -32.452 22.895  44.545  1.00 76.11  ? 561  SER C CA    1 
ATOM   8560  C  C     . SER C 1  178 ? -32.169 21.784  45.557  1.00 74.92  ? 561  SER C C     1 
ATOM   8561  O  O     . SER C 1  178 ? -32.549 21.881  46.739  1.00 75.20  ? 561  SER C O     1 
ATOM   8562  C  CB    . SER C 1  178 ? -33.623 22.575  43.639  1.00 80.57  ? 561  SER C CB    1 
ATOM   8563  O  OG    . SER C 1  178 ? -34.847 22.594  44.349  1.00 98.94  ? 561  SER C OG    1 
ATOM   8564  N  N     . ALA C 1  179 ? -31.467 20.732  45.120  1.00 73.77  ? 562  ALA C N     1 
ATOM   8565  C  CA    . ALA C 1  179 ? -31.094 19.673  46.051  1.00 72.35  ? 562  ALA C CA    1 
ATOM   8566  C  C     . ALA C 1  179 ? -30.150 20.177  47.130  1.00 74.09  ? 562  ALA C C     1 
ATOM   8567  O  O     . ALA C 1  179 ? -30.307 19.832  48.306  1.00 71.97  ? 562  ALA C O     1 
ATOM   8568  C  CB    . ALA C 1  179 ? -30.439 18.502  45.316  1.00 71.22  ? 562  ALA C CB    1 
ATOM   8569  N  N     . LEU C 1  180 ? -29.185 21.015  46.765  1.00 74.55  ? 563  LEU C N     1 
ATOM   8570  C  CA    . LEU C 1  180 ? -28.280 21.542  47.779  1.00 78.00  ? 563  LEU C CA    1 
ATOM   8571  C  C     . LEU C 1  180 ? -29.050 22.307  48.838  1.00 77.40  ? 563  LEU C C     1 
ATOM   8572  O  O     . LEU C 1  180 ? -28.820 22.133  50.042  1.00 78.58  ? 563  LEU C O     1 
ATOM   8573  C  CB    . LEU C 1  180 ? -27.239 22.423  47.106  1.00 74.10  ? 563  LEU C CB    1 
ATOM   8574  C  CG    . LEU C 1  180 ? -26.105 21.491  46.720  1.00 82.15  ? 563  LEU C CG    1 
ATOM   8575  C  CD1   . LEU C 1  180 ? -25.177 22.115  45.737  1.00 76.37  ? 563  LEU C CD1   1 
ATOM   8576  C  CD2   . LEU C 1  180 ? -25.382 21.167  47.994  1.00 74.57  ? 563  LEU C CD2   1 
ATOM   8577  N  N     . VAL C 1  181 ? -30.022 23.103  48.400  1.00 75.25  ? 564  VAL C N     1 
ATOM   8578  C  CA    . VAL C 1  181 ? -30.873 23.832  49.334  1.00 73.15  ? 564  VAL C CA    1 
ATOM   8579  C  C     . VAL C 1  181 ? -31.563 22.867  50.282  1.00 76.41  ? 564  VAL C C     1 
ATOM   8580  O  O     . VAL C 1  181 ? -31.568 23.061  51.510  1.00 71.71  ? 564  VAL C O     1 
ATOM   8581  C  CB    . VAL C 1  181 ? -31.917 24.658  48.567  1.00 73.82  ? 564  VAL C CB    1 
ATOM   8582  C  CG1   . VAL C 1  181 ? -32.872 25.284  49.536  1.00 75.49  ? 564  VAL C CG1   1 
ATOM   8583  C  CG2   . VAL C 1  181 ? -31.245 25.727  47.720  1.00 73.57  ? 564  VAL C CG2   1 
ATOM   8584  N  N     . SER C 1  182 ? -32.200 21.836  49.724  1.00 74.55  ? 565  SER C N     1 
ATOM   8585  C  CA    . SER C 1  182 ? -32.952 20.949  50.595  1.00 71.40  ? 565  SER C CA    1 
ATOM   8586  C  C     . SER C 1  182 ? -32.032 20.248  51.574  1.00 67.46  ? 565  SER C C     1 
ATOM   8587  O  O     . SER C 1  182 ? -32.392 20.052  52.734  1.00 75.30  ? 565  SER C O     1 
ATOM   8588  C  CB    . SER C 1  182 ? -33.771 19.935  49.795  1.00 70.98  ? 565  SER C CB    1 
ATOM   8589  O  OG    . SER C 1  182 ? -34.697 19.315  50.672  1.00 65.92  ? 565  SER C OG    1 
ATOM   8590  N  N     . ALA C 1  183 ? -30.837 19.894  51.138  1.00 66.78  ? 566  ALA C N     1 
ATOM   8591  C  CA    . ALA C 1  183 ? -29.910 19.184  52.013  1.00 70.03  ? 566  ALA C CA    1 
ATOM   8592  C  C     . ALA C 1  183 ? -29.427 20.064  53.153  1.00 71.27  ? 566  ALA C C     1 
ATOM   8593  O  O     . ALA C 1  183 ? -29.287 19.591  54.283  1.00 72.20  ? 566  ALA C O     1 
ATOM   8594  C  CB    . ALA C 1  183 ? -28.715 18.644  51.222  1.00 73.80  ? 566  ALA C CB    1 
ATOM   8595  N  N     . LEU C 1  184 ? -29.149 21.338  52.880  1.00 72.80  ? 567  LEU C N     1 
ATOM   8596  C  CA    . LEU C 1  184 ? -28.728 22.225  53.960  1.00 69.06  ? 567  LEU C CA    1 
ATOM   8597  C  C     . LEU C 1  184 ? -29.855 22.444  54.959  1.00 75.62  ? 567  LEU C C     1 
ATOM   8598  O  O     . LEU C 1  184 ? -29.637 22.439  56.177  1.00 77.44  ? 567  LEU C O     1 
ATOM   8599  C  CB    . LEU C 1  184 ? -28.214 23.564  53.423  1.00 61.66  ? 567  LEU C CB    1 
ATOM   8600  C  CG    . LEU C 1  184 ? -26.729 23.660  53.055  1.00 58.47  ? 567  LEU C CG    1 
ATOM   8601  C  CD1   . LEU C 1  184 ? -26.254 22.487  52.278  1.00 76.06  ? 567  LEU C CD1   1 
ATOM   8602  C  CD2   . LEU C 1  184 ? -26.495 24.932  52.283  1.00 70.70  ? 567  LEU C CD2   1 
ATOM   8603  N  N     . MET C 1  185 ? -31.067 22.670  54.457  1.00 73.78  ? 568  MET C N     1 
ATOM   8604  C  CA    . MET C 1  185 ? -32.191 22.870  55.356  1.00 69.32  ? 568  MET C CA    1 
ATOM   8605  C  C     . MET C 1  185 ? -32.443 21.639  56.205  1.00 82.32  ? 568  MET C C     1 
ATOM   8606  O  O     . MET C 1  185 ? -32.818 21.758  57.376  1.00 93.19  ? 568  MET C O     1 
ATOM   8607  C  CB    . MET C 1  185 ? -33.424 23.249  54.560  1.00 70.49  ? 568  MET C CB    1 
ATOM   8608  C  CG    . MET C 1  185 ? -33.371 24.614  53.912  1.00 82.72  ? 568  MET C CG    1 
ATOM   8609  S  SD    . MET C 1  185 ? -33.071 25.989  55.056  1.00 87.77  ? 568  MET C SD    1 
ATOM   8610  C  CE    . MET C 1  185 ? -34.619 26.151  55.985  1.00 90.90  ? 568  MET C CE    1 
ATOM   8611  N  N     . ASP C 1  186 ? -32.217 20.452  55.644  1.00 80.04  ? 569  ASP C N     1 
ATOM   8612  C  CA    . ASP C 1  186 ? -32.307 19.221  56.423  1.00 73.92  ? 569  ASP C CA    1 
ATOM   8613  C  C     . ASP C 1  186 ? -31.388 19.271  57.643  1.00 74.64  ? 569  ASP C C     1 
ATOM   8614  O  O     . ASP C 1  186 ? -31.820 18.991  58.764  1.00 82.70  ? 569  ASP C O     1 
ATOM   8615  C  CB    . ASP C 1  186 ? -31.951 18.053  55.493  1.00 83.55  ? 569  ASP C CB    1 
ATOM   8616  C  CG    . ASP C 1  186 ? -32.138 16.713  56.126  1.00 88.86  ? 569  ASP C CG    1 
ATOM   8617  O  OD1   . ASP C 1  186 ? -33.310 16.343  56.389  1.00 94.42  ? 569  ASP C OD1   1 
ATOM   8618  O  OD2   . ASP C 1  186 ? -31.110 16.032  56.317  1.00 88.72  ? 569  ASP C OD2   1 
ATOM   8619  N  N     . MET C 1  187 ? -30.135 19.694  57.452  1.00 75.71  ? 570  MET C N     1 
ATOM   8620  C  CA    . MET C 1  187 ? -29.129 19.747  58.513  1.00 81.34  ? 570  MET C CA    1 
ATOM   8621  C  C     . MET C 1  187 ? -29.090 21.066  59.267  1.00 86.05  ? 570  MET C C     1 
ATOM   8622  O  O     . MET C 1  187 ? -28.142 21.293  60.032  1.00 87.18  ? 570  MET C O     1 
ATOM   8623  C  CB    . MET C 1  187 ? -27.736 19.447  57.972  1.00 83.10  ? 570  MET C CB    1 
ATOM   8624  C  CG    . MET C 1  187 ? -27.390 20.017  56.611  1.00 81.34  ? 570  MET C CG    1 
ATOM   8625  S  SD    . MET C 1  187 ? -25.683 19.572  56.273  1.00 82.33  ? 570  MET C SD    1 
ATOM   8626  C  CE    . MET C 1  187 ? -25.769 17.792  56.459  1.00 92.27  ? 570  MET C CE    1 
ATOM   8627  N  N     . GLU C 1  188 ? -30.075 21.943  59.054  1.00 88.83  ? 571  GLU C N     1 
ATOM   8628  C  CA    . GLU C 1  188 ? -30.136 23.207  59.776  1.00 84.91  ? 571  GLU C CA    1 
ATOM   8629  C  C     . GLU C 1  188 ? -29.829 23.038  61.252  1.00 84.44  ? 571  GLU C C     1 
ATOM   8630  O  O     . GLU C 1  188 ? -28.971 23.726  61.802  1.00 87.63  ? 571  GLU C O     1 
ATOM   8631  C  CB    . GLU C 1  188 ? -31.514 23.848  59.579  1.00 86.47  ? 571  GLU C CB    1 
ATOM   8632  C  CG    . GLU C 1  188 ? -31.726 25.068  60.468  1.00 101.36 ? 571  GLU C CG    1 
ATOM   8633  C  CD    . GLU C 1  188 ? -33.086 25.777  60.319  1.00 109.82 ? 571  GLU C CD    1 
ATOM   8634  O  OE1   . GLU C 1  188 ? -33.610 25.903  59.185  1.00 104.31 ? 571  GLU C OE1   1 
ATOM   8635  O  OE2   . GLU C 1  188 ? -33.611 26.256  61.351  1.00 113.29 ? 571  GLU C OE2   1 
ATOM   8636  N  N     . GLU C 1  189 ? -30.474 22.077  61.892  1.00 88.78  ? 572  GLU C N     1 
ATOM   8637  C  CA    . GLU C 1  189 ? -30.289 21.899  63.321  1.00 95.12  ? 572  GLU C CA    1 
ATOM   8638  C  C     . GLU C 1  189 ? -28.834 21.589  63.653  1.00 87.70  ? 572  GLU C C     1 
ATOM   8639  O  O     . GLU C 1  189 ? -28.275 22.151  64.603  1.00 91.60  ? 572  GLU C O     1 
ATOM   8640  C  CB    . GLU C 1  189 ? -31.224 20.783  63.791  1.00 112.45 ? 572  GLU C CB    1 
ATOM   8641  C  CG    . GLU C 1  189 ? -32.697 21.193  63.814  1.00 127.67 ? 572  GLU C CG    1 
ATOM   8642  C  CD    . GLU C 1  189 ? -33.615 20.113  64.372  1.00 130.67 ? 572  GLU C CD    1 
ATOM   8643  O  OE1   . GLU C 1  189 ? -33.105 19.030  64.720  1.00 122.54 ? 572  GLU C OE1   1 
ATOM   8644  O  OE2   . GLU C 1  189 ? -34.836 20.367  64.503  1.00 134.44 ? 572  GLU C OE2   1 
ATOM   8645  N  N     . ASP C 1  190 ? -28.179 20.762  62.826  1.00 85.93  ? 573  ASP C N     1 
ATOM   8646  C  CA    . ASP C 1  190 ? -26.784 20.397  63.075  1.00 89.14  ? 573  ASP C CA    1 
ATOM   8647  C  C     . ASP C 1  190 ? -25.856 21.583  62.885  1.00 90.03  ? 573  ASP C C     1 
ATOM   8648  O  O     . ASP C 1  190 ? -24.865 21.729  63.608  1.00 90.84  ? 573  ASP C O     1 
ATOM   8649  C  CB    . ASP C 1  190 ? -26.358 19.255  62.147  1.00 93.14  ? 573  ASP C CB    1 
ATOM   8650  C  CG    . ASP C 1  190 ? -27.221 18.006  62.308  1.00 103.16 ? 573  ASP C CG    1 
ATOM   8651  O  OD1   . ASP C 1  190 ? -28.416 18.044  61.929  1.00 111.04 ? 573  ASP C OD1   1 
ATOM   8652  O  OD2   . ASP C 1  190 ? -26.702 16.982  62.817  1.00 104.10 ? 573  ASP C OD2   1 
ATOM   8653  N  N     . ILE C 1  191 ? -26.187 22.459  61.946  1.00 96.38  ? 574  ILE C N     1 
ATOM   8654  C  CA    . ILE C 1  191 ? -25.362 23.627  61.700  1.00 85.00  ? 574  ILE C CA    1 
ATOM   8655  C  C     . ILE C 1  191 ? -25.456 24.574  62.878  1.00 90.84  ? 574  ILE C C     1 
ATOM   8656  O  O     . ILE C 1  191 ? -24.444 25.010  63.430  1.00 101.70 ? 574  ILE C O     1 
ATOM   8657  C  CB    . ILE C 1  191 ? -25.812 24.311  60.404  1.00 82.91  ? 574  ILE C CB    1 
ATOM   8658  C  CG1   . ILE C 1  191 ? -25.605 23.385  59.223  1.00 80.76  ? 574  ILE C CG1   1 
ATOM   8659  C  CG2   . ILE C 1  191 ? -25.035 25.544  60.188  1.00 80.24  ? 574  ILE C CG2   1 
ATOM   8660  C  CD1   . ILE C 1  191 ? -26.139 23.944  57.948  1.00 80.77  ? 574  ILE C CD1   1 
ATOM   8661  N  N     . LEU C 1  192 ? -26.678 24.889  63.301  1.00 95.47  ? 575  LEU C N     1 
ATOM   8662  C  CA    . LEU C 1  192 ? -26.833 25.809  64.422  1.00 93.88  ? 575  LEU C CA    1 
ATOM   8663  C  C     . LEU C 1  192 ? -26.191 25.244  65.684  1.00 93.93  ? 575  LEU C C     1 
ATOM   8664  O  O     . LEU C 1  192 ? -25.480 25.958  66.405  1.00 104.65 ? 575  LEU C O     1 
ATOM   8665  C  CB    . LEU C 1  192 ? -28.311 26.140  64.656  1.00 86.39  ? 575  LEU C CB    1 
ATOM   8666  C  CG    . LEU C 1  192 ? -29.131 26.676  63.471  1.00 78.87  ? 575  LEU C CG    1 
ATOM   8667  C  CD1   . LEU C 1  192 ? -30.526 27.114  63.919  1.00 85.33  ? 575  LEU C CD1   1 
ATOM   8668  C  CD2   . LEU C 1  192 ? -28.432 27.759  62.675  1.00 75.00  ? 575  LEU C CD2   1 
ATOM   8669  N  N     . GLU C 1  193 ? -26.436 23.964  65.979  1.00 89.51  ? 576  GLU C N     1 
ATOM   8670  C  CA    . GLU C 1  193 ? -25.855 23.395  67.185  1.00 96.01  ? 576  GLU C CA    1 
ATOM   8671  C  C     . GLU C 1  193 ? -24.340 23.335  67.105  1.00 95.38  ? 576  GLU C C     1 
ATOM   8672  O  O     . GLU C 1  193 ? -23.660 23.396  68.136  1.00 98.99  ? 576  GLU C O     1 
ATOM   8673  C  CB    . GLU C 1  193 ? -26.419 22.013  67.466  1.00 101.29 ? 576  GLU C CB    1 
ATOM   8674  C  CG    . GLU C 1  193 ? -26.071 21.550  68.867  1.00 111.95 ? 576  GLU C CG    1 
ATOM   8675  C  CD    . GLU C 1  193 ? -25.957 20.053  68.982  1.00 131.87 ? 576  GLU C CD    1 
ATOM   8676  O  OE1   . GLU C 1  193 ? -26.387 19.358  68.038  1.00 131.04 ? 576  GLU C OE1   1 
ATOM   8677  O  OE2   . GLU C 1  193 ? -25.464 19.572  70.029  1.00 145.32 ? 576  GLU C OE2   1 
ATOM   8678  N  N     . GLY C 1  194 ? -23.785 23.187  65.904  1.00 98.12  ? 577  GLY C N     1 
ATOM   8679  C  CA    . GLY C 1  194 ? -22.342 23.192  65.793  1.00 95.90  ? 577  GLY C CA    1 
ATOM   8680  C  C     . GLY C 1  194 ? -21.782 24.577  66.017  1.00 97.79  ? 577  GLY C C     1 
ATOM   8681  O  O     . GLY C 1  194 ? -20.752 24.741  66.674  1.00 101.49 ? 577  GLY C O     1 
ATOM   8682  N  N     . MET C 1  195 ? -22.472 25.594  65.496  1.00 104.75 ? 578  MET C N     1 
ATOM   8683  C  CA    . MET C 1  195 ? -22.094 26.975  65.777  1.00 105.41 ? 578  MET C CA    1 
ATOM   8684  C  C     . MET C 1  195 ? -22.069 27.233  67.275  1.00 112.09 ? 578  MET C C     1 
ATOM   8685  O  O     . MET C 1  195 ? -21.121 27.834  67.792  1.00 114.57 ? 578  MET C O     1 
ATOM   8686  C  CB    . MET C 1  195 ? -23.060 27.939  65.090  1.00 97.12  ? 578  MET C CB    1 
ATOM   8687  C  CG    . MET C 1  195 ? -22.949 27.988  63.582  1.00 89.07  ? 578  MET C CG    1 
ATOM   8688  S  SD    . MET C 1  195 ? -24.263 29.021  62.905  1.00 99.84  ? 578  MET C SD    1 
ATOM   8689  C  CE    . MET C 1  195 ? -23.587 30.655  63.127  1.00 120.56 ? 578  MET C CE    1 
ATOM   8690  N  N     . ARG C 1  196 ? -23.099 26.778  67.990  1.00 113.55 ? 579  ARG C N     1 
ATOM   8691  C  CA    . ARG C 1  196 ? -23.080 26.895  69.447  1.00 106.19 ? 579  ARG C CA    1 
ATOM   8692  C  C     . ARG C 1  196 ? -21.873 26.165  70.031  1.00 110.39 ? 579  ARG C C     1 
ATOM   8693  O  O     . ARG C 1  196 ? -21.168 26.691  70.900  1.00 117.22 ? 579  ARG C O     1 
ATOM   8694  C  CB    . ARG C 1  196 ? -24.357 26.327  70.042  1.00 100.36 ? 579  ARG C CB    1 
ATOM   8695  C  CG    . ARG C 1  196 ? -25.593 27.106  69.749  1.00 99.09  ? 579  ARG C CG    1 
ATOM   8696  C  CD    . ARG C 1  196 ? -26.691 26.588  70.624  1.00 115.59 ? 579  ARG C CD    1 
ATOM   8697  N  NE    . ARG C 1  196 ? -27.415 25.434  70.084  1.00 118.92 ? 579  ARG C NE    1 
ATOM   8698  C  CZ    . ARG C 1  196 ? -28.396 25.470  69.181  1.00 116.78 ? 579  ARG C CZ    1 
ATOM   8699  N  NH1   . ARG C 1  196 ? -28.809 26.617  68.636  1.00 104.69 ? 579  ARG C NH1   1 
ATOM   8700  N  NH2   . ARG C 1  196 ? -28.965 24.326  68.818  1.00 106.60 ? 579  ARG C NH2   1 
ATOM   8701  N  N     . SER C 1  197 ? -21.634 24.933  69.576  1.00 107.43 ? 580  SER C N     1 
ATOM   8702  C  CA    . SER C 1  197 ? -20.566 24.126  70.147  1.00 108.77 ? 580  SER C CA    1 
ATOM   8703  C  C     . SER C 1  197 ? -19.188 24.728  69.908  1.00 109.53 ? 580  SER C C     1 
ATOM   8704  O  O     . SER C 1  197 ? -18.254 24.422  70.654  1.00 118.01 ? 580  SER C O     1 
ATOM   8705  C  CB    . SER C 1  197 ? -20.634 22.706  69.564  1.00 120.09 ? 580  SER C CB    1 
ATOM   8706  O  OG    . SER C 1  197 ? -19.480 21.937  69.886  1.00 130.19 ? 580  SER C OG    1 
ATOM   8707  N  N     . GLN C 1  198 ? -19.039 25.612  68.927  1.00 109.59 ? 581  GLN C N     1 
ATOM   8708  C  CA    . GLN C 1  198 ? -17.772 26.293  68.719  1.00 112.07 ? 581  GLN C CA    1 
ATOM   8709  C  C     . GLN C 1  198 ? -17.718 27.651  69.403  1.00 119.69 ? 581  GLN C C     1 
ATOM   8710  O  O     . GLN C 1  198 ? -16.825 28.452  69.105  1.00 123.13 ? 581  GLN C O     1 
ATOM   8711  C  CB    . GLN C 1  198 ? -17.485 26.414  67.224  1.00 110.28 ? 581  GLN C CB    1 
ATOM   8712  C  CG    . GLN C 1  198 ? -17.034 25.111  66.627  1.00 101.78 ? 581  GLN C CG    1 
ATOM   8713  C  CD    . GLN C 1  198 ? -15.727 24.656  67.234  1.00 108.07 ? 581  GLN C CD    1 
ATOM   8714  O  OE1   . GLN C 1  198 ? -14.662 25.154  66.881  1.00 116.84 ? 581  GLN C OE1   1 
ATOM   8715  N  NE2   . GLN C 1  198 ? -15.803 23.726  68.178  1.00 113.30 ? 581  GLN C NE2   1 
ATOM   8716  N  N     . ASP C 1  199 ? -18.651 27.912  70.323  1.00 121.10 ? 582  ASP C N     1 
ATOM   8717  C  CA    . ASP C 1  199 ? -18.738 29.166  71.086  1.00 118.78 ? 582  ASP C CA    1 
ATOM   8718  C  C     . ASP C 1  199 ? -18.988 30.365  70.177  1.00 116.37 ? 582  ASP C C     1 
ATOM   8719  O  O     . ASP C 1  199 ? -18.451 31.452  70.400  1.00 134.39 ? 582  ASP C O     1 
ATOM   8720  C  CB    . ASP C 1  199 ? -17.501 29.395  71.971  1.00 125.38 ? 582  ASP C CB    1 
ATOM   8721  N  N     . LEU C 1  200 ? -19.777 30.157  69.131  1.00 113.26 ? 583  LEU C N     1 
ATOM   8722  C  CA    . LEU C 1  200 ? -20.194 31.201  68.210  1.00 122.54 ? 583  LEU C CA    1 
ATOM   8723  C  C     . LEU C 1  200 ? -21.679 31.480  68.382  1.00 119.94 ? 583  LEU C C     1 
ATOM   8724  O  O     . LEU C 1  200 ? -22.407 30.726  69.026  1.00 127.61 ? 583  LEU C O     1 
ATOM   8725  C  CB    . LEU C 1  200 ? -19.903 30.809  66.761  1.00 118.94 ? 583  LEU C CB    1 
ATOM   8726  C  CG    . LEU C 1  200 ? -18.525 31.224  66.265  1.00 120.93 ? 583  LEU C CG    1 
ATOM   8727  C  CD1   . LEU C 1  200 ? -17.422 30.547  67.057  1.00 116.56 ? 583  LEU C CD1   1 
ATOM   8728  C  CD2   . LEU C 1  200 ? -18.407 30.900  64.802  1.00 114.48 ? 583  LEU C CD2   1 
ATOM   8729  N  N     . ASP C 1  201 ? -22.127 32.573  67.782  1.00 117.55 ? 584  ASP C N     1 
ATOM   8730  C  CA    . ASP C 1  201 ? -23.493 33.048  67.953  1.00 125.58 ? 584  ASP C CA    1 
ATOM   8731  C  C     . ASP C 1  201 ? -24.415 32.384  66.941  1.00 125.73 ? 584  ASP C C     1 
ATOM   8732  O  O     . ASP C 1  201 ? -24.027 32.160  65.793  1.00 128.82 ? 584  ASP C O     1 
ATOM   8733  C  CB    . ASP C 1  201 ? -23.545 34.567  67.795  1.00 136.40 ? 584  ASP C CB    1 
ATOM   8734  C  CG    . ASP C 1  201 ? -22.951 35.294  68.985  1.00 148.75 ? 584  ASP C CG    1 
ATOM   8735  O  OD1   . ASP C 1  201 ? -23.652 35.392  70.017  1.00 156.96 ? 584  ASP C OD1   1 
ATOM   8736  O  OD2   . ASP C 1  201 ? -21.780 35.738  68.901  1.00 147.87 ? 584  ASP C OD2   1 
ATOM   8737  N  N     . ASP C 1  202 ? -25.634 32.051  67.380  1.00 127.91 ? 585  ASP C N     1 
ATOM   8738  C  CA    . ASP C 1  202 ? -26.614 31.430  66.487  1.00 119.86 ? 585  ASP C CA    1 
ATOM   8739  C  C     . ASP C 1  202 ? -26.902 32.291  65.264  1.00 121.84 ? 585  ASP C C     1 
ATOM   8740  O  O     . ASP C 1  202 ? -27.077 31.764  64.159  1.00 117.56 ? 585  ASP C O     1 
ATOM   8741  C  CB    . ASP C 1  202 ? -27.918 31.146  67.233  1.00 123.70 ? 585  ASP C CB    1 
ATOM   8742  C  CG    . ASP C 1  202 ? -27.905 29.807  67.944  1.00 127.46 ? 585  ASP C CG    1 
ATOM   8743  O  OD1   . ASP C 1  202 ? -26.827 29.182  67.990  1.00 123.25 ? 585  ASP C OD1   1 
ATOM   8744  O  OD2   . ASP C 1  202 ? -28.967 29.380  68.452  1.00 132.65 ? 585  ASP C OD2   1 
ATOM   8745  N  N     . TYR C 1  203 ? -26.970 33.615  65.443  1.00 127.30 ? 586  TYR C N     1 
ATOM   8746  C  CA    . TYR C 1  203 ? -27.460 34.512  64.399  1.00 122.31 ? 586  TYR C CA    1 
ATOM   8747  C  C     . TYR C 1  203 ? -26.409 34.900  63.366  1.00 113.86 ? 586  TYR C C     1 
ATOM   8748  O  O     . TYR C 1  203 ? -26.764 35.532  62.363  1.00 109.53 ? 586  TYR C O     1 
ATOM   8749  C  CB    . TYR C 1  203 ? -28.046 35.779  65.031  1.00 123.29 ? 586  TYR C CB    1 
ATOM   8750  C  CG    . TYR C 1  203 ? -27.194 36.391  66.123  1.00 136.32 ? 586  TYR C CG    1 
ATOM   8751  C  CD1   . TYR C 1  203 ? -26.048 37.118  65.815  1.00 137.46 ? 586  TYR C CD1   1 
ATOM   8752  C  CD2   . TYR C 1  203 ? -27.538 36.244  67.464  1.00 132.55 ? 586  TYR C CD2   1 
ATOM   8753  C  CE1   . TYR C 1  203 ? -25.267 37.679  66.809  1.00 137.96 ? 586  TYR C CE1   1 
ATOM   8754  C  CE2   . TYR C 1  203 ? -26.762 36.803  68.464  1.00 136.11 ? 586  TYR C CE2   1 
ATOM   8755  C  CZ    . TYR C 1  203 ? -25.627 37.520  68.128  1.00 140.08 ? 586  TYR C CZ    1 
ATOM   8756  O  OH    . TYR C 1  203 ? -24.841 38.081  69.105  1.00 141.91 ? 586  TYR C OH    1 
ATOM   8757  N  N     . LEU C 1  204 ? -25.147 34.530  63.571  1.00 111.37 ? 587  LEU C N     1 
ATOM   8758  C  CA    . LEU C 1  204 ? -24.112 34.848  62.600  1.00 112.64 ? 587  LEU C CA    1 
ATOM   8759  C  C     . LEU C 1  204 ? -24.513 34.351  61.221  1.00 112.10 ? 587  LEU C C     1 
ATOM   8760  O  O     . LEU C 1  204 ? -25.134 33.297  61.091  1.00 118.26 ? 587  LEU C O     1 
ATOM   8761  C  CB    . LEU C 1  204 ? -22.796 34.194  63.005  1.00 115.80 ? 587  LEU C CB    1 
ATOM   8762  C  CG    . LEU C 1  204 ? -22.163 34.685  64.291  1.00 124.62 ? 587  LEU C CG    1 
ATOM   8763  C  CD1   . LEU C 1  204 ? -20.991 33.773  64.639  1.00 121.12 ? 587  LEU C CD1   1 
ATOM   8764  C  CD2   . LEU C 1  204 ? -21.728 36.138  64.109  1.00 122.66 ? 587  LEU C CD2   1 
ATOM   8765  N  N     . ASN C 1  205 ? -24.189 35.127  60.191  1.00 113.29 ? 588  ASN C N     1 
ATOM   8766  C  CA    . ASN C 1  205 ? -24.535 34.745  58.830  1.00 109.86 ? 588  ASN C CA    1 
ATOM   8767  C  C     . ASN C 1  205 ? -23.375 34.823  57.851  1.00 109.70 ? 588  ASN C C     1 
ATOM   8768  O  O     . ASN C 1  205 ? -23.598 34.632  56.649  1.00 100.31 ? 588  ASN C O     1 
ATOM   8769  C  CB    . ASN C 1  205 ? -25.710 35.592  58.319  1.00 108.37 ? 588  ASN C CB    1 
ATOM   8770  C  CG    . ASN C 1  205 ? -25.371 37.054  58.189  1.00 116.25 ? 588  ASN C CG    1 
ATOM   8771  O  OD1   . ASN C 1  205 ? -24.205 37.446  58.122  1.00 126.35 ? 588  ASN C OD1   1 
ATOM   8772  N  ND2   . ASN C 1  205 ? -26.401 37.881  58.159  1.00 119.13 ? 588  ASN C ND2   1 
ATOM   8773  N  N     . GLY C 1  206 ? -22.166 35.160  58.320  1.00 117.92 ? 589  GLY C N     1 
ATOM   8774  C  CA    . GLY C 1  206 ? -21.001 35.310  57.478  1.00 109.42 ? 589  GLY C CA    1 
ATOM   8775  C  C     . GLY C 1  206 ? -20.796 34.080  56.616  1.00 114.97 ? 589  GLY C C     1 
ATOM   8776  O  O     . GLY C 1  206 ? -21.245 32.981  56.954  1.00 122.11 ? 589  GLY C O     1 
ATOM   8777  N  N     . PRO C 1  207 ? -20.089 34.233  55.504  1.00 106.00 ? 590  PRO C N     1 
ATOM   8778  C  CA    . PRO C 1  207 ? -20.103 33.193  54.463  1.00 102.71 ? 590  PRO C CA    1 
ATOM   8779  C  C     . PRO C 1  207 ? -19.729 31.792  54.945  1.00 103.49 ? 590  PRO C C     1 
ATOM   8780  O  O     . PRO C 1  207 ? -18.582 31.534  55.330  1.00 105.16 ? 590  PRO C O     1 
ATOM   8781  C  CB    . PRO C 1  207 ? -19.092 33.725  53.437  1.00 103.40 ? 590  PRO C CB    1 
ATOM   8782  C  CG    . PRO C 1  207 ? -18.222 34.690  54.201  1.00 110.78 ? 590  PRO C CG    1 
ATOM   8783  C  CD    . PRO C 1  207 ? -19.129 35.310  55.213  1.00 112.33 ? 590  PRO C CD    1 
ATOM   8784  N  N     . PHE C 1  208 ? -20.709 30.885  54.947  1.00 94.06  ? 591  PHE C N     1 
ATOM   8785  C  CA    . PHE C 1  208 ? -20.439 29.477  55.185  1.00 86.01  ? 591  PHE C CA    1 
ATOM   8786  C  C     . PHE C 1  208 ? -19.867 28.833  53.927  1.00 86.22  ? 591  PHE C C     1 
ATOM   8787  O  O     . PHE C 1  208 ? -20.359 29.047  52.816  1.00 79.47  ? 591  PHE C O     1 
ATOM   8788  C  CB    . PHE C 1  208 ? -21.708 28.729  55.562  1.00 87.73  ? 591  PHE C CB    1 
ATOM   8789  C  CG    . PHE C 1  208 ? -22.419 29.248  56.767  1.00 93.50  ? 591  PHE C CG    1 
ATOM   8790  C  CD1   . PHE C 1  208 ? -23.386 30.227  56.648  1.00 91.52  ? 591  PHE C CD1   1 
ATOM   8791  C  CD2   . PHE C 1  208 ? -22.187 28.686  58.018  1.00 97.54  ? 591  PHE C CD2   1 
ATOM   8792  C  CE1   . PHE C 1  208 ? -24.081 30.671  57.763  1.00 100.57 ? 591  PHE C CE1   1 
ATOM   8793  C  CE2   . PHE C 1  208 ? -22.881 29.127  59.141  1.00 91.78  ? 591  PHE C CE2   1 
ATOM   8794  C  CZ    . PHE C 1  208 ? -23.826 30.119  59.011  1.00 92.36  ? 591  PHE C CZ    1 
ATOM   8795  N  N     . THR C 1  209 ? -18.843 28.021  54.101  1.00 85.59  ? 592  THR C N     1 
ATOM   8796  C  CA    . THR C 1  209 ? -18.299 27.246  53.005  1.00 84.09  ? 592  THR C CA    1 
ATOM   8797  C  C     . THR C 1  209 ? -18.693 25.788  53.195  1.00 90.36  ? 592  THR C C     1 
ATOM   8798  O  O     . THR C 1  209 ? -18.449 25.204  54.261  1.00 95.61  ? 592  THR C O     1 
ATOM   8799  C  CB    . THR C 1  209 ? -16.789 27.419  52.913  1.00 91.85  ? 592  THR C CB    1 
ATOM   8800  O  OG1   . THR C 1  209 ? -16.503 28.770  52.523  1.00 102.42 ? 592  THR C OG1   1 
ATOM   8801  C  CG2   . THR C 1  209 ? -16.240 26.482  51.872  1.00 88.67  ? 592  THR C CG2   1 
ATOM   8802  N  N     . VAL C 1  210 ? -19.329 25.215  52.172  1.00 91.38  ? 593  VAL C N     1 
ATOM   8803  C  CA    . VAL C 1  210 ? -19.793 23.831  52.191  1.00 77.70  ? 593  VAL C CA    1 
ATOM   8804  C  C     . VAL C 1  210 ? -18.932 23.019  51.234  1.00 72.46  ? 593  VAL C C     1 
ATOM   8805  O  O     . VAL C 1  210 ? -18.877 23.316  50.035  1.00 77.63  ? 593  VAL C O     1 
ATOM   8806  C  CB    . VAL C 1  210 ? -21.273 23.715  51.795  1.00 70.49  ? 593  VAL C CB    1 
ATOM   8807  C  CG1   . VAL C 1  210 ? -21.765 22.316  52.101  1.00 75.66  ? 593  VAL C CG1   1 
ATOM   8808  C  CG2   . VAL C 1  210 ? -22.132 24.781  52.473  1.00 73.98  ? 593  VAL C CG2   1 
ATOM   8809  N  N     . VAL C 1  211 ? -18.278 21.989  51.751  1.00 71.81  ? 594  VAL C N     1 
ATOM   8810  C  CA    . VAL C 1  211 ? -17.537 21.030  50.936  1.00 65.96  ? 594  VAL C CA    1 
ATOM   8811  C  C     . VAL C 1  211 ? -18.450 19.858  50.587  1.00 75.47  ? 594  VAL C C     1 
ATOM   8812  O  O     . VAL C 1  211 ? -19.077 19.260  51.471  1.00 85.02  ? 594  VAL C O     1 
ATOM   8813  C  CB    . VAL C 1  211 ? -16.289 20.537  51.678  1.00 69.93  ? 594  VAL C CB    1 
ATOM   8814  C  CG1   . VAL C 1  211 ? -15.713 19.350  50.967  1.00 69.93  ? 594  VAL C CG1   1 
ATOM   8815  C  CG2   . VAL C 1  211 ? -15.268 21.643  51.793  1.00 73.48  ? 594  VAL C CG2   1 
ATOM   8816  N  N     . VAL C 1  212 ? -18.497 19.496  49.307  1.00 73.69  ? 595  VAL C N     1 
ATOM   8817  C  CA    . VAL C 1  212 ? -19.487 18.557  48.788  1.00 63.24  ? 595  VAL C CA    1 
ATOM   8818  C  C     . VAL C 1  212 ? -18.755 17.465  48.025  1.00 66.56  ? 595  VAL C C     1 
ATOM   8819  O  O     . VAL C 1  212 ? -18.229 17.719  46.937  1.00 76.41  ? 595  VAL C O     1 
ATOM   8820  C  CB    . VAL C 1  212 ? -20.512 19.253  47.880  1.00 61.52  ? 595  VAL C CB    1 
ATOM   8821  C  CG1   . VAL C 1  212 ? -21.321 18.245  47.133  1.00 68.35  ? 595  VAL C CG1   1 
ATOM   8822  C  CG2   . VAL C 1  212 ? -21.437 20.102  48.682  1.00 63.24  ? 595  VAL C CG2   1 
ATOM   8823  N  N     . LYS C 1  213 ? -18.722 16.253  48.577  1.00 75.67  ? 596  LYS C N     1 
ATOM   8824  C  CA    . LYS C 1  213 ? -18.211 15.109  47.828  1.00 72.82  ? 596  LYS C CA    1 
ATOM   8825  C  C     . LYS C 1  213 ? -19.238 14.721  46.780  1.00 71.45  ? 596  LYS C C     1 
ATOM   8826  O  O     . LYS C 1  213 ? -20.418 14.555  47.085  1.00 73.53  ? 596  LYS C O     1 
ATOM   8827  C  CB    . LYS C 1  213 ? -17.908 13.924  48.745  1.00 73.06  ? 596  LYS C CB    1 
ATOM   8828  C  CG    . LYS C 1  213 ? -17.226 12.756  48.062  1.00 79.32  ? 596  LYS C CG    1 
ATOM   8829  C  CD    . LYS C 1  213 ? -16.882 11.653  49.060  1.00 90.88  ? 596  LYS C CD    1 
ATOM   8830  C  CE    . LYS C 1  213 ? -18.102 11.198  49.833  1.00 93.03  ? 596  LYS C CE    1 
ATOM   8831  N  NZ    . LYS C 1  213 ? -17.738 10.061  50.720  1.00 108.98 ? 596  LYS C NZ    1 
ATOM   8832  N  N     . GLU C 1  214 ? -18.799 14.628  45.540  1.00 73.45  ? 597  GLU C N     1 
ATOM   8833  C  CA    . GLU C 1  214 ? -19.654 14.265  44.425  1.00 75.02  ? 597  GLU C CA    1 
ATOM   8834  C  C     . GLU C 1  214 ? -19.298 12.847  44.003  1.00 85.80  ? 597  GLU C C     1 
ATOM   8835  O  O     . GLU C 1  214 ? -18.120 12.477  43.990  1.00 89.86  ? 597  GLU C O     1 
ATOM   8836  C  CB    . GLU C 1  214 ? -19.458 15.241  43.275  1.00 75.77  ? 597  GLU C CB    1 
ATOM   8837  C  CG    . GLU C 1  214 ? -20.489 15.202  42.197  1.00 78.92  ? 597  GLU C CG    1 
ATOM   8838  C  CD    . GLU C 1  214 ? -20.004 15.974  41.002  1.00 93.03  ? 597  GLU C CD    1 
ATOM   8839  O  OE1   . GLU C 1  214 ? -19.685 17.168  41.175  1.00 95.23  ? 597  GLU C OE1   1 
ATOM   8840  O  OE2   . GLU C 1  214 ? -19.884 15.377  39.910  1.00 103.86 ? 597  GLU C OE2   1 
ATOM   8841  N  N     . SER C 1  215 ? -20.317 12.045  43.684  1.00 87.25  ? 598  SER C N     1 
ATOM   8842  C  CA    . SER C 1  215 ? -20.147 10.602  43.569  1.00 81.50  ? 598  SER C CA    1 
ATOM   8843  C  C     . SER C 1  215 ? -20.989 10.051  42.419  1.00 78.75  ? 598  SER C C     1 
ATOM   8844  O  O     . SER C 1  215 ? -22.056 10.586  42.097  1.00 75.37  ? 598  SER C O     1 
ATOM   8845  C  CB    . SER C 1  215 ? -20.506 9.923   44.902  1.00 85.48  ? 598  SER C CB    1 
ATOM   8846  O  OG    . SER C 1  215 ? -20.338 8.523   44.819  1.00 99.88  ? 598  SER C OG    1 
ATOM   8847  N  N     . CYS C 1  216 ? -20.485 8.978   41.794  1.00 79.95  ? 599  CYS C N     1 
ATOM   8848  C  CA    . CYS C 1  216 ? -21.180 8.308   40.697  1.00 74.93  ? 599  CYS C CA    1 
ATOM   8849  C  C     . CYS C 1  216 ? -20.738 6.858   40.557  1.00 77.64  ? 599  CYS C C     1 
ATOM   8850  O  O     . CYS C 1  216 ? -19.541 6.552   40.584  1.00 73.51  ? 599  CYS C O     1 
ATOM   8851  C  CB    . CYS C 1  216 ? -20.949 9.020   39.376  1.00 71.28  ? 599  CYS C CB    1 
ATOM   8852  S  SG    . CYS C 1  216 ? -22.152 8.532   38.184  1.00 70.63  ? 599  CYS C SG    1 
ATOM   8853  N  N     . ASP C 1  217 ? -21.715 5.984   40.346  1.00 82.10  ? 600  ASP C N     1 
ATOM   8854  C  CA    . ASP C 1  217 ? -21.475 4.562   40.191  1.00 84.79  ? 600  ASP C CA    1 
ATOM   8855  C  C     . ASP C 1  217 ? -22.660 3.957   39.451  1.00 87.15  ? 600  ASP C C     1 
ATOM   8856  O  O     . ASP C 1  217 ? -23.782 4.458   39.554  1.00 79.89  ? 600  ASP C O     1 
ATOM   8857  C  CB    . ASP C 1  217 ? -21.271 3.883   41.549  1.00 94.95  ? 600  ASP C CB    1 
ATOM   8858  C  CG    . ASP C 1  217 ? -20.434 2.634   41.427  1.00 95.67  ? 600  ASP C CG    1 
ATOM   8859  O  OD1   . ASP C 1  217 ? -19.986 2.398   40.282  1.00 89.93  ? 600  ASP C OD1   1 
ATOM   8860  O  OD2   . ASP C 1  217 ? -20.209 1.897   42.417  1.00 101.27 ? 600  ASP C OD2   1 
ATOM   8861  N  N     . GLY C 1  218 ? -22.387 2.919   38.655  1.00 93.34  ? 601  GLY C N     1 
ATOM   8862  C  CA    . GLY C 1  218 ? -23.449 2.074   38.153  1.00 92.01  ? 601  GLY C CA    1 
ATOM   8863  C  C     . GLY C 1  218 ? -23.806 1.009   39.168  1.00 95.10  ? 601  GLY C C     1 
ATOM   8864  O  O     . GLY C 1  218 ? -22.979 0.584   39.976  1.00 98.39  ? 601  GLY C O     1 
ATOM   8865  N  N     . MET C 1  219 ? -25.065 0.578   39.131  1.00 94.83  ? 602  MET C N     1 
ATOM   8866  C  CA    . MET C 1  219 ? -25.592 -0.290  40.171  1.00 101.04 ? 602  MET C CA    1 
ATOM   8867  C  C     . MET C 1  219 ? -25.826 -1.716  39.693  1.00 104.13 ? 602  MET C C     1 
ATOM   8868  O  O     . MET C 1  219 ? -26.575 -2.460  40.331  1.00 104.69 ? 602  MET C O     1 
ATOM   8869  C  CB    . MET C 1  219 ? -26.871 0.317   40.738  1.00 90.53  ? 602  MET C CB    1 
ATOM   8870  C  CG    . MET C 1  219 ? -26.579 1.557   41.532  1.00 89.49  ? 602  MET C CG    1 
ATOM   8871  S  SD    . MET C 1  219 ? -27.996 2.252   42.387  1.00 106.84 ? 602  MET C SD    1 
ATOM   8872  C  CE    . MET C 1  219 ? -29.057 2.681   41.030  1.00 83.56  ? 602  MET C CE    1 
ATOM   8873  N  N     . GLY C 1  220 ? -25.185 -2.122  38.597  1.00 106.65 ? 603  GLY C N     1 
ATOM   8874  C  CA    . GLY C 1  220 ? -25.294 -3.507  38.176  1.00 103.79 ? 603  GLY C CA    1 
ATOM   8875  C  C     . GLY C 1  220 ? -26.675 -3.831  37.632  1.00 105.39 ? 603  GLY C C     1 
ATOM   8876  O  O     . GLY C 1  220 ? -27.361 -2.986  37.052  1.00 105.29 ? 603  GLY C O     1 
ATOM   8877  N  N     . ASP C 1  221 ? -27.084 -5.081  37.827  1.00 101.86 ? 604  ASP C N     1 
ATOM   8878  C  CA    . ASP C 1  221 ? -28.416 -5.519  37.433  1.00 102.69 ? 604  ASP C CA    1 
ATOM   8879  C  C     . ASP C 1  221 ? -29.428 -5.059  38.476  1.00 107.00 ? 604  ASP C C     1 
ATOM   8880  O  O     . ASP C 1  221 ? -29.280 -5.348  39.668  1.00 110.71 ? 604  ASP C O     1 
ATOM   8881  C  CB    . ASP C 1  221 ? -28.456 -7.039  37.286  1.00 114.42 ? 604  ASP C CB    1 
ATOM   8882  C  CG    . ASP C 1  221 ? -29.625 -7.517  36.439  1.00 121.61 ? 604  ASP C CG    1 
ATOM   8883  O  OD1   . ASP C 1  221 ? -29.406 -8.315  35.496  1.00 121.63 ? 604  ASP C OD1   1 
ATOM   8884  O  OD2   . ASP C 1  221 ? -30.762 -7.077  36.704  1.00 117.34 ? 604  ASP C OD2   1 
ATOM   8885  N  N     . VAL C 1  222 ? -30.449 -4.331  38.031  1.00 106.91 ? 605  VAL C N     1 
ATOM   8886  C  CA    . VAL C 1  222 ? -31.532 -3.920  38.915  1.00 102.69 ? 605  VAL C CA    1 
ATOM   8887  C  C     . VAL C 1  222 ? -32.781 -4.758  38.698  1.00 123.32 ? 605  VAL C C     1 
ATOM   8888  O  O     . VAL C 1  222 ? -33.652 -4.796  39.585  1.00 135.04 ? 605  VAL C O     1 
ATOM   8889  C  CB    . VAL C 1  222 ? -31.807 -2.412  38.734  1.00 99.44  ? 605  VAL C CB    1 
ATOM   8890  C  CG1   . VAL C 1  222 ? -33.245 -2.033  39.028  1.00 97.84  ? 605  VAL C CG1   1 
ATOM   8891  C  CG2   . VAL C 1  222 ? -30.874 -1.641  39.627  1.00 98.13  ? 605  VAL C CG2   1 
ATOM   8892  N  N     . SER C 1  223 ? -32.840 -5.516  37.603  1.00 118.72 ? 606  SER C N     1 
ATOM   8893  C  CA    . SER C 1  223 ? -34.064 -6.147  37.131  1.00 114.87 ? 606  SER C CA    1 
ATOM   8894  C  C     . SER C 1  223 ? -34.785 -6.929  38.221  1.00 127.21 ? 606  SER C C     1 
ATOM   8895  O  O     . SER C 1  223 ? -34.169 -7.504  39.126  1.00 129.49 ? 606  SER C O     1 
ATOM   8896  C  CB    . SER C 1  223 ? -33.736 -7.089  35.981  1.00 118.69 ? 606  SER C CB    1 
ATOM   8897  O  OG    . SER C 1  223 ? -34.831 -7.938  35.720  1.00 134.15 ? 606  SER C OG    1 
ATOM   8898  N  N     . GLU C 1  224 ? -36.116 -6.936  38.109  1.00 140.25 ? 607  GLU C N     1 
ATOM   8899  C  CA    . GLU C 1  224 ? -37.000 -7.842  38.835  1.00 144.80 ? 607  GLU C CA    1 
ATOM   8900  C  C     . GLU C 1  224 ? -37.554 -8.885  37.867  1.00 145.01 ? 607  GLU C C     1 
ATOM   8901  O  O     . GLU C 1  224 ? -38.106 -8.534  36.819  1.00 149.65 ? 607  GLU C O     1 
ATOM   8902  C  CB    . GLU C 1  224 ? -38.146 -7.071  39.496  1.00 140.66 ? 607  GLU C CB    1 
ATOM   8903  C  CG    . GLU C 1  224 ? -38.782 -5.999  38.591  1.00 139.88 ? 607  GLU C CG    1 
ATOM   8904  C  CD    . GLU C 1  224 ? -39.923 -5.224  39.263  1.00 138.02 ? 607  GLU C CD    1 
ATOM   8905  O  OE1   . GLU C 1  224 ? -40.349 -5.602  40.381  1.00 145.22 ? 607  GLU C OE1   1 
ATOM   8906  O  OE2   . GLU C 1  224 ? -40.396 -4.229  38.666  1.00 126.18 ? 607  GLU C OE2   1 
ATOM   8907  N  N     . LYS C 1  225 ? -37.413 -10.160 38.215  1.00 139.73 ? 608  LYS C N     1 
ATOM   8908  C  CA    . LYS C 1  225 ? -37.736 -11.216 37.259  1.00 146.00 ? 608  LYS C CA    1 
ATOM   8909  C  C     . LYS C 1  225 ? -38.443 -12.404 37.907  1.00 157.55 ? 608  LYS C C     1 
ATOM   8910  O  O     . LYS C 1  225 ? -38.174 -12.758 39.055  1.00 157.03 ? 608  LYS C O     1 
ATOM   8911  C  CB    . LYS C 1  225 ? -36.462 -11.680 36.543  1.00 152.85 ? 608  LYS C CB    1 
ATOM   8912  N  N     . VAL C 1  232 ? -33.501 -10.667 31.338  1.00 128.81 ? 615  VAL C N     1 
ATOM   8913  C  CA    . VAL C 1  232 ? -32.809 -9.553  30.712  1.00 123.47 ? 615  VAL C CA    1 
ATOM   8914  C  C     . VAL C 1  232 ? -32.240 -8.675  31.802  1.00 125.06 ? 615  VAL C C     1 
ATOM   8915  O  O     . VAL C 1  232 ? -32.855 -8.520  32.855  1.00 123.61 ? 615  VAL C O     1 
ATOM   8916  C  CB    . VAL C 1  232 ? -33.742 -8.768  29.797  1.00 121.39 ? 615  VAL C CB    1 
ATOM   8917  C  CG1   . VAL C 1  232 ? -34.100 -9.604  28.596  1.00 129.80 ? 615  VAL C CG1   1 
ATOM   8918  C  CG2   . VAL C 1  232 ? -34.999 -8.379  30.555  1.00 120.20 ? 615  VAL C CG2   1 
ATOM   8919  N  N     . PRO C 1  233 ? -31.053 -8.123  31.569  1.00 124.97 ? 616  PRO C N     1 
ATOM   8920  C  CA    . PRO C 1  233 ? -30.445 -7.244  32.570  1.00 121.33 ? 616  PRO C CA    1 
ATOM   8921  C  C     . PRO C 1  233 ? -30.944 -5.820  32.409  1.00 118.91 ? 616  PRO C C     1 
ATOM   8922  O  O     . PRO C 1  233 ? -31.069 -5.301  31.297  1.00 117.26 ? 616  PRO C O     1 
ATOM   8923  C  CB    . PRO C 1  233 ? -28.942 -7.341  32.272  1.00 113.39 ? 616  PRO C CB    1 
ATOM   8924  C  CG    . PRO C 1  233 ? -28.805 -8.332  31.138  1.00 124.78 ? 616  PRO C CG    1 
ATOM   8925  C  CD    . PRO C 1  233 ? -30.133 -8.393  30.459  1.00 122.42 ? 616  PRO C CD    1 
ATOM   8926  N  N     . GLU C 1  234 ? -31.231 -5.190  33.538  1.00 116.03 ? 617  GLU C N     1 
ATOM   8927  C  CA    . GLU C 1  234 ? -31.616 -3.791  33.570  1.00 101.81 ? 617  GLU C CA    1 
ATOM   8928  C  C     . GLU C 1  234 ? -30.634 -3.087  34.491  1.00 110.36 ? 617  GLU C C     1 
ATOM   8929  O  O     . GLU C 1  234 ? -30.622 -3.337  35.703  1.00 113.64 ? 617  GLU C O     1 
ATOM   8930  C  CB    . GLU C 1  234 ? -33.053 -3.633  34.040  1.00 97.81  ? 617  GLU C CB    1 
ATOM   8931  C  CG    . GLU C 1  234 ? -33.543 -2.217  34.007  1.00 102.54 ? 617  GLU C CG    1 
ATOM   8932  C  CD    . GLU C 1  234 ? -35.036 -2.151  33.864  1.00 107.93 ? 617  GLU C CD    1 
ATOM   8933  O  OE1   . GLU C 1  234 ? -35.734 -2.941  34.534  1.00 113.71 ? 617  GLU C OE1   1 
ATOM   8934  O  OE2   . GLU C 1  234 ? -35.513 -1.319  33.071  1.00 112.18 ? 617  GLU C OE2   1 
ATOM   8935  N  N     . LYS C 1  235 ? -29.793 -2.238  33.913  1.00 96.03  ? 618  LYS C N     1 
ATOM   8936  C  CA    . LYS C 1  235 ? -28.748 -1.573  34.663  1.00 90.63  ? 618  LYS C CA    1 
ATOM   8937  C  C     . LYS C 1  235 ? -29.191 -0.173  35.060  1.00 88.04  ? 618  LYS C C     1 
ATOM   8938  O  O     . LYS C 1  235 ? -30.128 0.387   34.490  1.00 87.06  ? 618  LYS C O     1 
ATOM   8939  C  CB    . LYS C 1  235 ? -27.457 -1.543  33.850  1.00 89.18  ? 618  LYS C CB    1 
ATOM   8940  C  CG    . LYS C 1  235 ? -26.850 -2.940  33.671  1.00 103.02 ? 618  LYS C CG    1 
ATOM   8941  C  CD    . LYS C 1  235 ? -25.454 -2.902  33.045  1.00 102.26 ? 618  LYS C CD    1 
ATOM   8942  C  CE    . LYS C 1  235 ? -24.847 -4.292  32.971  1.00 113.79 ? 618  LYS C CE    1 
ATOM   8943  N  NZ    . LYS C 1  235 ? -24.827 -4.915  34.328  1.00 113.97 ? 618  LYS C NZ    1 
ATOM   8944  N  N     . ALA C 1  236 ? -28.540 0.367   36.081  1.00 88.55  ? 619  ALA C N     1 
ATOM   8945  C  CA    . ALA C 1  236 ? -28.906 1.672   36.597  1.00 83.05  ? 619  ALA C CA    1 
ATOM   8946  C  C     . ALA C 1  236 ? -27.654 2.419   37.024  1.00 81.71  ? 619  ALA C C     1 
ATOM   8947  O  O     . ALA C 1  236 ? -26.712 1.818   37.545  1.00 79.94  ? 619  ALA C O     1 
ATOM   8948  C  CB    . ALA C 1  236 ? -29.885 1.547   37.770  1.00 85.64  ? 619  ALA C CB    1 
ATOM   8949  N  N     . VAL C 1  237 ? -27.652 3.729   36.779  1.00 80.39  ? 620  VAL C N     1 
ATOM   8950  C  CA    . VAL C 1  237 ? -26.626 4.644   37.267  1.00 76.73  ? 620  VAL C CA    1 
ATOM   8951  C  C     . VAL C 1  237 ? -27.237 5.526   38.343  1.00 76.11  ? 620  VAL C C     1 
ATOM   8952  O  O     . VAL C 1  237 ? -28.415 5.910   38.260  1.00 72.88  ? 620  VAL C O     1 
ATOM   8953  C  CB    . VAL C 1  237 ? -26.039 5.517   36.143  1.00 74.18  ? 620  VAL C CB    1 
ATOM   8954  C  CG1   . VAL C 1  237 ? -24.728 6.119   36.588  1.00 81.72  ? 620  VAL C CG1   1 
ATOM   8955  C  CG2   . VAL C 1  237 ? -25.860 4.719   34.880  1.00 89.63  ? 620  VAL C CG2   1 
ATOM   8956  N  N     . ARG C 1  238 ? -26.430 5.857   39.346  1.00 73.26  ? 621  ARG C N     1 
ATOM   8957  C  CA    . ARG C 1  238 ? -26.840 6.722   40.443  1.00 72.54  ? 621  ARG C CA    1 
ATOM   8958  C  C     . ARG C 1  238 ? -25.808 7.827   40.570  1.00 79.59  ? 621  ARG C C     1 
ATOM   8959  O  O     . ARG C 1  238 ? -24.633 7.544   40.818  1.00 83.82  ? 621  ARG C O     1 
ATOM   8960  C  CB    . ARG C 1  238 ? -26.951 5.938   41.752  1.00 79.19  ? 621  ARG C CB    1 
ATOM   8961  C  CG    . ARG C 1  238 ? -27.357 6.760   42.981  1.00 88.95  ? 621  ARG C CG    1 
ATOM   8962  C  CD    . ARG C 1  238 ? -26.679 6.224   44.220  1.00 96.63  ? 621  ARG C CD    1 
ATOM   8963  N  NE    . ARG C 1  238 ? -25.234 6.384   44.094  1.00 109.22 ? 621  ARG C NE    1 
ATOM   8964  C  CZ    . ARG C 1  238 ? -24.348 5.567   44.649  1.00 111.84 ? 621  ARG C CZ    1 
ATOM   8965  N  NH1   . ARG C 1  238 ? -24.777 4.528   45.364  1.00 115.55 ? 621  ARG C NH1   1 
ATOM   8966  N  NH2   . ARG C 1  238 ? -23.045 5.786   44.479  1.00 95.45  ? 621  ARG C NH2   1 
ATOM   8967  N  N     . PHE C 1  239 ? -26.241 9.074   40.374  1.00 76.33  ? 622  PHE C N     1 
ATOM   8968  C  CA    . PHE C 1  239 ? -25.425 10.264  40.570  1.00 74.35  ? 622  PHE C CA    1 
ATOM   8969  C  C     . PHE C 1  239 ? -25.894 10.912  41.862  1.00 77.00  ? 622  PHE C C     1 
ATOM   8970  O  O     . PHE C 1  239 ? -27.081 11.217  42.003  1.00 72.22  ? 622  PHE C O     1 
ATOM   8971  C  CB    . PHE C 1  239 ? -25.564 11.215  39.381  1.00 71.08  ? 622  PHE C CB    1 
ATOM   8972  C  CG    . PHE C 1  239 ? -24.578 12.354  39.388  1.00 75.40  ? 622  PHE C CG    1 
ATOM   8973  C  CD1   . PHE C 1  239 ? -23.244 12.144  39.107  1.00 78.37  ? 622  PHE C CD1   1 
ATOM   8974  C  CD2   . PHE C 1  239 ? -24.993 13.640  39.647  1.00 83.78  ? 622  PHE C CD2   1 
ATOM   8975  C  CE1   . PHE C 1  239 ? -22.349 13.188  39.106  1.00 73.01  ? 622  PHE C CE1   1 
ATOM   8976  C  CE2   . PHE C 1  239 ? -24.101 14.687  39.639  1.00 93.44  ? 622  PHE C CE2   1 
ATOM   8977  C  CZ    . PHE C 1  239 ? -22.781 14.457  39.375  1.00 82.83  ? 622  PHE C CZ    1 
ATOM   8978  N  N     . SER C 1  240 ? -24.968 11.114  42.798  1.00 77.00  ? 623  SER C N     1 
ATOM   8979  C  CA    . SER C 1  240 ? -25.312 11.442  44.171  1.00 73.03  ? 623  SER C CA    1 
ATOM   8980  C  C     . SER C 1  240 ? -24.264 12.376  44.762  1.00 77.39  ? 623  SER C C     1 
ATOM   8981  O  O     . SER C 1  240 ? -23.180 12.549  44.204  1.00 81.40  ? 623  SER C O     1 
ATOM   8982  C  CB    . SER C 1  240 ? -25.420 10.168  45.007  1.00 78.82  ? 623  SER C CB    1 
ATOM   8983  O  OG    . SER C 1  240 ? -24.355 9.290   44.691  1.00 82.00  ? 623  SER C OG    1 
ATOM   8984  N  N     . PHE C 1  241 ? -24.593 12.979  45.913  1.00 78.05  ? 624  PHE C N     1 
ATOM   8985  C  CA    . PHE C 1  241 ? -23.667 13.870  46.605  1.00 80.19  ? 624  PHE C CA    1 
ATOM   8986  C  C     . PHE C 1  241 ? -23.807 13.773  48.118  1.00 75.16  ? 624  PHE C C     1 
ATOM   8987  O  O     . PHE C 1  241 ? -24.849 13.396  48.660  1.00 70.46  ? 624  PHE C O     1 
ATOM   8988  C  CB    . PHE C 1  241 ? -23.822 15.341  46.179  1.00 72.99  ? 624  PHE C CB    1 
ATOM   8989  C  CG    . PHE C 1  241 ? -25.007 16.063  46.786  1.00 73.43  ? 624  PHE C CG    1 
ATOM   8990  C  CD1   . PHE C 1  241 ? -26.161 16.252  46.042  1.00 71.80  ? 624  PHE C CD1   1 
ATOM   8991  C  CD2   . PHE C 1  241 ? -24.942 16.621  48.061  1.00 66.05  ? 624  PHE C CD2   1 
ATOM   8992  C  CE1   . PHE C 1  241 ? -27.246 16.937  46.570  1.00 69.35  ? 624  PHE C CE1   1 
ATOM   8993  C  CE2   . PHE C 1  241 ? -26.029 17.308  48.593  1.00 69.68  ? 624  PHE C CE2   1 
ATOM   8994  C  CZ    . PHE C 1  241 ? -27.177 17.466  47.846  1.00 66.06  ? 624  PHE C CZ    1 
ATOM   8995  N  N     . THR C 1  242 ? -22.733 14.197  48.780  1.00 75.12  ? 625  THR C N     1 
ATOM   8996  C  CA    . THR C 1  242 ? -22.540 14.085  50.216  1.00 75.02  ? 625  THR C CA    1 
ATOM   8997  C  C     . THR C 1  242 ? -21.995 15.384  50.764  1.00 75.99  ? 625  THR C C     1 
ATOM   8998  O  O     . THR C 1  242 ? -20.903 15.801  50.376  1.00 84.75  ? 625  THR C O     1 
ATOM   8999  C  CB    . THR C 1  242 ? -21.527 13.007  50.564  1.00 72.57  ? 625  THR C CB    1 
ATOM   9000  O  OG1   . THR C 1  242 ? -22.042 11.716  50.221  1.00 93.79  ? 625  THR C OG1   1 
ATOM   9001  C  CG2   . THR C 1  242 ? -21.204 13.081  52.040  1.00 72.79  ? 625  THR C CG2   1 
ATOM   9002  N  N     . VAL C 1  243 ? -22.694 15.981  51.721  1.00 85.94  ? 626  VAL C N     1 
ATOM   9003  C  CA    . VAL C 1  243 ? -22.171 17.167  52.391  1.00 74.43  ? 626  VAL C CA    1 
ATOM   9004  C  C     . VAL C 1  243 ? -21.096 16.730  53.387  1.00 80.50  ? 626  VAL C C     1 
ATOM   9005  O  O     . VAL C 1  243 ? -21.395 16.097  54.400  1.00 86.98  ? 626  VAL C O     1 
ATOM   9006  C  CB    . VAL C 1  243 ? -23.279 17.951  53.086  1.00 70.70  ? 626  VAL C CB    1 
ATOM   9007  C  CG1   . VAL C 1  243 ? -22.665 19.113  53.759  1.00 76.01  ? 626  VAL C CG1   1 
ATOM   9008  C  CG2   . VAL C 1  243 ? -24.333 18.399  52.082  1.00 64.50  ? 626  VAL C CG2   1 
ATOM   9009  N  N     . MET C 1  244 ? -19.844 17.101  53.117  1.00 80.48  ? 627  MET C N     1 
ATOM   9010  C  CA    . MET C 1  244 ? -18.702 16.599  53.872  1.00 79.14  ? 627  MET C CA    1 
ATOM   9011  C  C     . MET C 1  244 ? -18.267 17.491  55.023  1.00 86.39  ? 627  MET C C     1 
ATOM   9012  O  O     . MET C 1  244 ? -17.643 16.991  55.966  1.00 88.95  ? 627  MET C O     1 
ATOM   9013  C  CB    . MET C 1  244 ? -17.505 16.414  52.947  1.00 78.24  ? 627  MET C CB    1 
ATOM   9014  C  CG    . MET C 1  244 ? -17.697 15.290  52.009  1.00 81.24  ? 627  MET C CG    1 
ATOM   9015  S  SD    . MET C 1  244 ? -17.723 13.774  52.940  1.00 85.33  ? 627  MET C SD    1 
ATOM   9016  C  CE    . MET C 1  244 ? -16.001 13.702  53.459  1.00 94.80  ? 627  MET C CE    1 
ATOM   9017  N  N     . ARG C 1  245 ? -18.546 18.791  54.962  1.00 85.93  ? 628  ARG C N     1 
ATOM   9018  C  CA    . ARG C 1  245 ? -18.001 19.719  55.939  1.00 80.27  ? 628  ARG C CA    1 
ATOM   9019  C  C     . ARG C 1  245 ? -18.570 21.101  55.676  1.00 80.12  ? 628  ARG C C     1 
ATOM   9020  O  O     . ARG C 1  245 ? -18.670 21.527  54.527  1.00 85.54  ? 628  ARG C O     1 
ATOM   9021  C  CB    . ARG C 1  245 ? -16.464 19.736  55.866  1.00 81.67  ? 628  ARG C CB    1 
ATOM   9022  C  CG    . ARG C 1  245 ? -15.747 20.323  57.063  1.00 95.74  ? 628  ARG C CG    1 
ATOM   9023  C  CD    . ARG C 1  245 ? -14.235 20.043  57.018  1.00 104.51 ? 628  ARG C CD    1 
ATOM   9024  N  NE    . ARG C 1  245 ? -13.640 20.364  55.721  1.00 106.36 ? 628  ARG C NE    1 
ATOM   9025  C  CZ    . ARG C 1  245 ? -13.055 19.477  54.920  1.00 112.03 ? 628  ARG C CZ    1 
ATOM   9026  N  NH1   . ARG C 1  245 ? -12.966 18.202  55.284  1.00 122.22 ? 628  ARG C NH1   1 
ATOM   9027  N  NH2   . ARG C 1  245 ? -12.547 19.864  53.755  1.00 100.39 ? 628  ARG C NH2   1 
ATOM   9028  N  N     . ILE C 1  246 ? -18.976 21.782  56.736  1.00 79.53  ? 629  ILE C N     1 
ATOM   9029  C  CA    . ILE C 1  246 ? -19.482 23.143  56.644  1.00 82.90  ? 629  ILE C CA    1 
ATOM   9030  C  C     . ILE C 1  246 ? -18.708 23.989  57.647  1.00 93.38  ? 629  ILE C C     1 
ATOM   9031  O  O     . ILE C 1  246 ? -18.770 23.728  58.866  1.00 99.13  ? 629  ILE C O     1 
ATOM   9032  C  CB    . ILE C 1  246 ? -20.995 23.222  56.916  1.00 74.05  ? 629  ILE C CB    1 
ATOM   9033  C  CG1   . ILE C 1  246 ? -21.775 22.396  55.907  1.00 73.82  ? 629  ILE C CG1   1 
ATOM   9034  C  CG2   . ILE C 1  246 ? -21.483 24.644  56.790  1.00 78.86  ? 629  ILE C CG2   1 
ATOM   9035  C  CD1   . ILE C 1  246 ? -23.285 22.630  55.996  1.00 71.20  ? 629  ILE C CD1   1 
ATOM   9036  N  N     . THR C 1  247 ? -17.961 24.980  57.126  1.00 100.48 ? 630  THR C N     1 
ATOM   9037  C  CA    . THR C 1  247 ? -17.176 25.909  57.923  1.00 99.30  ? 630  THR C CA    1 
ATOM   9038  C  C     . THR C 1  247 ? -17.782 27.310  57.846  1.00 102.90 ? 630  THR C C     1 
ATOM   9039  O  O     . THR C 1  247 ? -18.333 27.720  56.823  1.00 98.35  ? 630  THR C O     1 
ATOM   9040  C  CB    . THR C 1  247 ? -15.708 25.976  57.455  1.00 96.78  ? 630  THR C CB    1 
ATOM   9041  O  OG1   . THR C 1  247 ? -15.626 26.649  56.171  1.00 94.26  ? 630  THR C OG1   1 
ATOM   9042  C  CG2   . THR C 1  247 ? -15.115 24.584  57.333  1.00 90.71  ? 630  THR C CG2   1 
ATOM   9043  N  N     . ILE C 1  248 ? -17.666 28.056  58.945  1.00 103.27 ? 631  ILE C N     1 
ATOM   9044  C  CA    . ILE C 1  248 ? -18.076 29.451  58.975  1.00 93.27  ? 631  ILE C CA    1 
ATOM   9045  C  C     . ILE C 1  248 ? -16.838 30.275  59.262  1.00 98.10  ? 631  ILE C C     1 
ATOM   9046  O  O     . ILE C 1  248 ? -15.893 29.807  59.902  1.00 98.25  ? 631  ILE C O     1 
ATOM   9047  C  CB    . ILE C 1  248 ? -19.183 29.736  60.017  1.00 85.74  ? 631  ILE C CB    1 
ATOM   9048  C  CG1   . ILE C 1  248 ? -19.924 31.015  59.669  1.00 94.79  ? 631  ILE C CG1   1 
ATOM   9049  C  CG2   . ILE C 1  248 ? -18.596 29.919  61.380  1.00 81.85  ? 631  ILE C CG2   1 
ATOM   9050  C  CD1   . ILE C 1  248 ? -20.858 31.461  60.764  1.00 101.57 ? 631  ILE C CD1   1 
ATOM   9051  N  N     . GLU C 1  249 ? -16.841 31.503  58.760  1.00 103.79 ? 632  GLU C N     1 
ATOM   9052  C  CA    . GLU C 1  249 ? -15.727 32.430  58.915  1.00 108.51 ? 632  GLU C CA    1 
ATOM   9053  C  C     . GLU C 1  249 ? -16.033 33.426  60.040  1.00 108.27 ? 632  GLU C C     1 
ATOM   9054  O  O     . GLU C 1  249 ? -16.924 34.274  59.890  1.00 106.44 ? 632  GLU C O     1 
ATOM   9055  C  CB    . GLU C 1  249 ? -15.480 33.171  57.596  1.00 125.99 ? 632  GLU C CB    1 
ATOM   9056  N  N     . HIS C 1  250 ? -15.296 33.340  61.161  1.00 115.85 ? 633  HIS C N     1 
ATOM   9057  C  CA    . HIS C 1  250 ? -15.328 34.384  62.201  1.00 118.25 ? 633  HIS C CA    1 
ATOM   9058  C  C     . HIS C 1  250 ? -13.979 35.102  62.200  1.00 129.30 ? 633  HIS C C     1 
ATOM   9059  O  O     . HIS C 1  250 ? -12.936 34.478  62.434  1.00 129.36 ? 633  HIS C O     1 
ATOM   9060  C  CB    . HIS C 1  250 ? -15.656 33.830  63.600  1.00 104.33 ? 633  HIS C CB    1 
ATOM   9061  N  N     . GLY C 1  251 ? -14.005 36.421  61.978  1.00 126.99 ? 634  GLY C N     1 
ATOM   9062  C  CA    . GLY C 1  251 ? -12.799 37.175  61.690  1.00 132.05 ? 634  GLY C CA    1 
ATOM   9063  C  C     . GLY C 1  251 ? -12.040 36.602  60.507  1.00 132.35 ? 634  GLY C C     1 
ATOM   9064  O  O     . GLY C 1  251 ? -12.503 36.679  59.361  1.00 125.31 ? 634  GLY C O     1 
ATOM   9065  N  N     . SER C 1  252 ? -10.870 36.017  60.780  1.00 131.64 ? 635  SER C N     1 
ATOM   9066  C  CA    . SER C 1  252 ? -10.083 35.297  59.779  1.00 132.74 ? 635  SER C CA    1 
ATOM   9067  C  C     . SER C 1  252 ? -9.604  33.961  60.328  1.00 137.10 ? 635  SER C C     1 
ATOM   9068  O  O     . SER C 1  252 ? -8.474  33.529  60.077  1.00 142.86 ? 635  SER C O     1 
ATOM   9069  C  CB    . SER C 1  252 ? -8.901  36.125  59.272  1.00 132.90 ? 635  SER C CB    1 
ATOM   9070  N  N     . GLN C 1  253 ? -10.462 33.294  61.093  1.00 136.58 ? 636  GLN C N     1 
ATOM   9071  C  CA    . GLN C 1  253 ? -10.383 31.857  61.303  1.00 129.24 ? 636  GLN C CA    1 
ATOM   9072  C  C     . GLN C 1  253 ? -11.589 31.192  60.648  1.00 119.87 ? 636  GLN C C     1 
ATOM   9073  O  O     . GLN C 1  253 ? -12.722 31.689  60.746  1.00 115.44 ? 636  GLN C O     1 
ATOM   9074  C  CB    . GLN C 1  253 ? -10.325 31.503  62.803  1.00 127.35 ? 636  GLN C CB    1 
ATOM   9075  N  N     . ASN C 1  254 ? -11.327 30.074  59.964  1.00 114.81 ? 637  ASN C N     1 
ATOM   9076  C  CA    . ASN C 1  254 ? -12.361 29.213  59.402  1.00 116.03 ? 637  ASN C CA    1 
ATOM   9077  C  C     . ASN C 1  254 ? -12.654 28.085  60.392  1.00 111.30 ? 637  ASN C C     1 
ATOM   9078  O  O     . ASN C 1  254 ? -11.957 27.063  60.409  1.00 107.52 ? 637  ASN C O     1 
ATOM   9079  C  CB    . ASN C 1  254 ? -11.922 28.672  58.041  1.00 108.73 ? 637  ASN C CB    1 
ATOM   9080  C  CG    . ASN C 1  254 ? -12.056 29.706  56.942  1.00 108.69 ? 637  ASN C CG    1 
ATOM   9081  O  OD1   . ASN C 1  254 ? -13.087 30.377  56.832  1.00 100.82 ? 637  ASN C OD1   1 
ATOM   9082  N  ND2   . ASN C 1  254 ? -11.013 29.845  56.125  1.00 117.66 ? 637  ASN C ND2   1 
ATOM   9083  N  N     . VAL C 1  255 ? -13.674 28.293  61.224  1.00 103.23 ? 638  VAL C N     1 
ATOM   9084  C  CA    . VAL C 1  255 ? -14.076 27.355  62.259  1.00 105.68 ? 638  VAL C CA    1 
ATOM   9085  C  C     . VAL C 1  255 ? -15.084 26.399  61.641  1.00 106.34 ? 638  VAL C C     1 
ATOM   9086  O  O     . VAL C 1  255 ? -16.051 26.838  61.000  1.00 107.36 ? 638  VAL C O     1 
ATOM   9087  C  CB    . VAL C 1  255 ? -14.661 28.097  63.472  1.00 101.49 ? 638  VAL C CB    1 
ATOM   9088  C  CG1   . VAL C 1  255 ? -15.758 29.042  63.056  1.00 93.52  ? 638  VAL C CG1   1 
ATOM   9089  C  CG2   . VAL C 1  255 ? -15.150 27.113  64.509  1.00 109.09 ? 638  VAL C CG2   1 
ATOM   9090  N  N     . LYS C 1  256 ? -14.856 25.094  61.789  1.00 105.46 ? 639  LYS C N     1 
ATOM   9091  C  CA    . LYS C 1  256 ? -15.804 24.139  61.242  1.00 102.55 ? 639  LYS C CA    1 
ATOM   9092  C  C     . LYS C 1  256 ? -17.018 24.031  62.153  1.00 93.91  ? 639  LYS C C     1 
ATOM   9093  O  O     . LYS C 1  256 ? -16.889 23.965  63.376  1.00 95.82  ? 639  LYS C O     1 
ATOM   9094  C  CB    . LYS C 1  256 ? -15.143 22.774  61.028  1.00 104.31 ? 639  LYS C CB    1 
ATOM   9095  C  CG    . LYS C 1  256 ? -14.480 22.120  62.207  1.00 113.14 ? 639  LYS C CG    1 
ATOM   9096  C  CD    . LYS C 1  256 ? -14.017 20.701  61.815  1.00 119.18 ? 639  LYS C CD    1 
ATOM   9097  C  CE    . LYS C 1  256 ? -13.303 20.695  60.452  1.00 112.77 ? 639  LYS C CE    1 
ATOM   9098  N  NZ    . LYS C 1  256 ? -12.686 19.405  60.013  1.00 103.73 ? 639  LYS C NZ    1 
ATOM   9099  N  N     . VAL C 1  257 ? -18.197 24.030  61.546  1.00 87.34  ? 640  VAL C N     1 
ATOM   9100  C  CA    . VAL C 1  257 ? -19.458 24.035  62.265  1.00 84.51  ? 640  VAL C CA    1 
ATOM   9101  C  C     . VAL C 1  257 ? -20.105 22.660  62.171  1.00 92.60  ? 640  VAL C C     1 
ATOM   9102  O  O     . VAL C 1  257 ? -20.875 22.258  63.056  1.00 88.88  ? 640  VAL C O     1 
ATOM   9103  C  CB    . VAL C 1  257 ? -20.384 25.121  61.696  1.00 90.22  ? 640  VAL C CB    1 
ATOM   9104  C  CG1   . VAL C 1  257 ? -21.811 24.884  62.116  1.00 102.66 ? 640  VAL C CG1   1 
ATOM   9105  C  CG2   . VAL C 1  257 ? -19.950 26.492  62.152  1.00 90.16  ? 640  VAL C CG2   1 
ATOM   9106  N  N     . PHE C 1  258 ? -19.796 21.935  61.091  1.00 99.24  ? 641  PHE C N     1 
ATOM   9107  C  CA    . PHE C 1  258 ? -20.274 20.567  60.914  1.00 99.53  ? 641  PHE C CA    1 
ATOM   9108  C  C     . PHE C 1  258 ? -19.289 19.761  60.079  1.00 96.42  ? 641  PHE C C     1 
ATOM   9109  O  O     . PHE C 1  258 ? -18.669 20.297  59.158  1.00 96.03  ? 641  PHE C O     1 
ATOM   9110  C  CB    . PHE C 1  258 ? -21.647 20.555  60.235  1.00 94.70  ? 641  PHE C CB    1 
ATOM   9111  C  CG    . PHE C 1  258 ? -21.994 19.248  59.590  1.00 94.17  ? 641  PHE C CG    1 
ATOM   9112  C  CD1   . PHE C 1  258 ? -22.105 18.097  60.344  1.00 97.84  ? 641  PHE C CD1   1 
ATOM   9113  C  CD2   . PHE C 1  258 ? -22.232 19.180  58.239  1.00 93.29  ? 641  PHE C CD2   1 
ATOM   9114  C  CE1   . PHE C 1  258 ? -22.425 16.904  59.751  1.00 98.68  ? 641  PHE C CE1   1 
ATOM   9115  C  CE2   . PHE C 1  258 ? -22.556 17.994  57.646  1.00 87.30  ? 641  PHE C CE2   1 
ATOM   9116  C  CZ    . PHE C 1  258 ? -22.654 16.853  58.395  1.00 88.55  ? 641  PHE C CZ    1 
ATOM   9117  N  N     . GLU C 1  259 ? -19.153 18.476  60.390  1.00 89.84  ? 642  GLU C N     1 
ATOM   9118  C  CA    . GLU C 1  259 ? -18.580 17.569  59.410  1.00 95.90  ? 642  GLU C CA    1 
ATOM   9119  C  C     . GLU C 1  259 ? -19.157 16.182  59.633  1.00 94.90  ? 642  GLU C C     1 
ATOM   9120  O  O     . GLU C 1  259 ? -19.334 15.749  60.775  1.00 96.67  ? 642  GLU C O     1 
ATOM   9121  C  CB    . GLU C 1  259 ? -17.044 17.557  59.446  1.00 101.66 ? 642  GLU C CB    1 
ATOM   9122  C  CG    . GLU C 1  259 ? -16.382 16.866  60.616  1.00 108.77 ? 642  GLU C CG    1 
ATOM   9123  C  CD    . GLU C 1  259 ? -14.862 16.815  60.448  1.00 122.82 ? 642  GLU C CD    1 
ATOM   9124  O  OE1   . GLU C 1  259 ? -14.384 16.730  59.284  1.00 121.74 ? 642  GLU C OE1   1 
ATOM   9125  O  OE2   . GLU C 1  259 ? -14.146 16.871  61.475  1.00 126.26 ? 642  GLU C OE2   1 
ATOM   9126  N  N     . GLU C 1  260 ? -19.468 15.511  58.525  1.00 102.23 ? 643  GLU C N     1 
ATOM   9127  C  CA    . GLU C 1  260 ? -20.127 14.209  58.558  1.00 91.56  ? 643  GLU C CA    1 
ATOM   9128  C  C     . GLU C 1  260 ? -19.262 13.183  59.282  1.00 88.79  ? 643  GLU C C     1 
ATOM   9129  O  O     . GLU C 1  260 ? -18.065 13.078  59.001  1.00 91.63  ? 643  GLU C O     1 
ATOM   9130  C  CB    . GLU C 1  260 ? -20.420 13.757  57.132  1.00 87.99  ? 643  GLU C CB    1 
ATOM   9131  C  CG    . GLU C 1  260 ? -20.882 12.331  56.993  1.00 94.10  ? 643  GLU C CG    1 
ATOM   9132  C  CD    . GLU C 1  260 ? -22.305 12.123  57.465  1.00 97.44  ? 643  GLU C CD    1 
ATOM   9133  O  OE1   . GLU C 1  260 ? -23.053 13.121  57.573  1.00 95.80  ? 643  GLU C OE1   1 
ATOM   9134  O  OE2   . GLU C 1  260 ? -22.668 10.950  57.730  1.00 102.54 ? 643  GLU C OE2   1 
ATOM   9135  N  N     . PRO C 1  261 ? -19.828 12.423  60.218  1.00 85.86  ? 644  PRO C N     1 
ATOM   9136  C  CA    . PRO C 1  261 ? -19.070 11.362  60.899  1.00 95.74  ? 644  PRO C CA    1 
ATOM   9137  C  C     . PRO C 1  261 ? -18.849 10.123  60.039  1.00 92.84  ? 644  PRO C C     1 
ATOM   9138  O  O     . PRO C 1  261 ? -17.769 9.523   60.064  1.00 100.24 ? 644  PRO C O     1 
ATOM   9139  C  CB    . PRO C 1  261 ? -19.950 11.041  62.112  1.00 100.24 ? 644  PRO C CB    1 
ATOM   9140  C  CG    . PRO C 1  261 ? -21.344 11.416  61.660  1.00 95.27  ? 644  PRO C CG    1 
ATOM   9141  C  CD    . PRO C 1  261 ? -21.183 12.596  60.767  1.00 84.79  ? 644  PRO C CD    1 
ATOM   9142  N  N     . LYS C 1  262 ? -19.871 9.728   59.285  1.00 92.47  ? 645  LYS C N     1 
ATOM   9143  C  CA    . LYS C 1  262 ? -19.758 8.576   58.405  1.00 96.13  ? 645  LYS C CA    1 
ATOM   9144  C  C     . LYS C 1  262 ? -19.854 9.026   56.956  1.00 96.53  ? 645  LYS C C     1 
ATOM   9145  O  O     . LYS C 1  262 ? -20.957 9.096   56.408  1.00 93.69  ? 645  LYS C O     1 
ATOM   9146  C  CB    . LYS C 1  262 ? -20.849 7.562   58.730  1.00 104.99 ? 645  LYS C CB    1 
ATOM   9147  C  CG    . LYS C 1  262 ? -20.760 7.040   60.154  1.00 104.19 ? 645  LYS C CG    1 
ATOM   9148  C  CD    . LYS C 1  262 ? -22.045 6.360   60.580  1.00 116.06 ? 645  LYS C CD    1 
ATOM   9149  C  CE    . LYS C 1  262 ? -23.231 7.324   60.494  1.00 115.79 ? 645  LYS C CE    1 
ATOM   9150  N  NZ    . LYS C 1  262 ? -24.525 6.741   60.958  1.00 114.73 ? 645  LYS C NZ    1 
ATOM   9151  N  N     . PRO C 1  263 ? -18.737 9.351   56.305  1.00 102.22 ? 646  PRO C N     1 
ATOM   9152  C  CA    . PRO C 1  263 ? -18.834 9.941   54.958  1.00 97.14  ? 646  PRO C CA    1 
ATOM   9153  C  C     . PRO C 1  263 ? -19.234 8.937   53.893  1.00 99.01  ? 646  PRO C C     1 
ATOM   9154  O  O     . PRO C 1  263 ? -19.904 9.284   52.909  1.00 87.60  ? 646  PRO C O     1 
ATOM   9155  C  CB    . PRO C 1  263 ? -17.421 10.492  54.714  1.00 108.59 ? 646  PRO C CB    1 
ATOM   9156  C  CG    . PRO C 1  263 ? -16.737 10.453  56.069  1.00 110.74 ? 646  PRO C CG    1 
ATOM   9157  C  CD    . PRO C 1  263 ? -17.347 9.295   56.781  1.00 104.13 ? 646  PRO C CD    1 
ATOM   9158  N  N     . ASN C 1  264 ? -18.849 7.685   54.082  1.00 101.41 ? 647  ASN C N     1 
ATOM   9159  C  CA    . ASN C 1  264 ? -19.109 6.627   53.127  1.00 99.15  ? 647  ASN C CA    1 
ATOM   9160  C  C     . ASN C 1  264 ? -20.378 5.833   53.440  1.00 98.03  ? 647  ASN C C     1 
ATOM   9161  O  O     . ASN C 1  264 ? -20.599 4.778   52.838  1.00 101.00 ? 647  ASN C O     1 
ATOM   9162  C  CB    . ASN C 1  264 ? -17.900 5.696   53.067  1.00 104.59 ? 647  ASN C CB    1 
ATOM   9163  C  CG    . ASN C 1  264 ? -16.631 6.424   52.697  1.00 105.84 ? 647  ASN C CG    1 
ATOM   9164  O  OD1   . ASN C 1  264 ? -16.465 6.864   51.561  1.00 113.13 ? 647  ASN C OD1   1 
ATOM   9165  N  ND2   . ASN C 1  264 ? -15.721 6.548   53.652  1.00 113.19 ? 647  ASN C ND2   1 
ATOM   9166  N  N     . SER C 1  265 ? -21.218 6.307   54.357  1.00 94.70  ? 648  SER C N     1 
ATOM   9167  C  CA    . SER C 1  265 ? -22.468 5.612   54.649  1.00 91.64  ? 648  SER C CA    1 
ATOM   9168  C  C     . SER C 1  265 ? -23.501 5.858   53.557  1.00 81.63  ? 648  SER C C     1 
ATOM   9169  O  O     . SER C 1  265 ? -23.566 6.931   52.956  1.00 89.75  ? 648  SER C O     1 
ATOM   9170  C  CB    . SER C 1  265 ? -23.043 6.055   55.999  1.00 94.34  ? 648  SER C CB    1 
ATOM   9171  O  OG    . SER C 1  265 ? -24.352 5.539   56.201  1.00 98.53  ? 648  SER C OG    1 
ATOM   9172  N  N     . GLU C 1  266 ? -24.331 4.848   53.313  1.00 76.39  ? 649  GLU C N     1 
ATOM   9173  C  CA    . GLU C 1  266 ? -25.434 5.020   52.380  1.00 79.91  ? 649  GLU C CA    1 
ATOM   9174  C  C     . GLU C 1  266 ? -26.426 6.065   52.871  1.00 75.17  ? 649  GLU C C     1 
ATOM   9175  O  O     . GLU C 1  266 ? -27.223 6.571   52.071  1.00 70.19  ? 649  GLU C O     1 
ATOM   9176  C  CB    . GLU C 1  266 ? -26.129 3.672   52.152  1.00 92.12  ? 649  GLU C CB    1 
ATOM   9177  N  N     . LEU C 1  267 ? -26.356 6.423   54.159  1.00 80.67  ? 650  LEU C N     1 
ATOM   9178  C  CA    . LEU C 1  267 ? -27.360 7.246   54.835  1.00 78.42  ? 650  LEU C CA    1 
ATOM   9179  C  C     . LEU C 1  267 ? -27.265 8.717   54.470  1.00 81.72  ? 650  LEU C C     1 
ATOM   9180  O  O     . LEU C 1  267 ? -28.273 9.431   54.495  1.00 87.73  ? 650  LEU C O     1 
ATOM   9181  C  CB    . LEU C 1  267 ? -27.202 7.128   56.347  1.00 85.82  ? 650  LEU C CB    1 
ATOM   9182  C  CG    . LEU C 1  267 ? -27.544 5.822   57.044  1.00 78.16  ? 650  LEU C CG    1 
ATOM   9183  C  CD1   . LEU C 1  267 ? -26.858 5.728   58.404  1.00 79.35  ? 650  LEU C CD1   1 
ATOM   9184  C  CD2   . LEU C 1  267 ? -29.053 5.719   57.185  1.00 72.04  ? 650  LEU C CD2   1 
ATOM   9185  N  N     . CYS C 1  268 ? -26.056 9.198   54.204  1.00 88.30  ? 651  CYS C N     1 
ATOM   9186  C  CA    . CYS C 1  268 ? -25.806 10.603  53.924  1.00 86.33  ? 651  CYS C CA    1 
ATOM   9187  C  C     . CYS C 1  268 ? -25.485 10.844  52.457  1.00 85.41  ? 651  CYS C C     1 
ATOM   9188  O  O     . CYS C 1  268 ? -25.172 11.977  52.075  1.00 87.91  ? 651  CYS C O     1 
ATOM   9189  C  CB    . CYS C 1  268 ? -24.668 11.112  54.805  1.00 86.82  ? 651  CYS C CB    1 
ATOM   9190  S  SG    . CYS C 1  268 ? -23.183 10.170  54.584  1.00 73.07  ? 651  CYS C SG    1 
ATOM   9191  N  N     . CYS C 1  269 ? -25.570 9.803   51.629  1.00 82.26  ? 652  CYS C N     1 
ATOM   9192  C  CA    . CYS C 1  269 ? -25.284 9.898   50.201  1.00 78.64  ? 652  CYS C CA    1 
ATOM   9193  C  C     . CYS C 1  269 ? -26.549 10.321  49.462  1.00 75.67  ? 652  CYS C C     1 
ATOM   9194  O  O     . CYS C 1  269 ? -27.300 9.504   48.919  1.00 72.99  ? 652  CYS C O     1 
ATOM   9195  C  CB    . CYS C 1  269 ? -24.735 8.584   49.683  1.00 76.58  ? 652  CYS C CB    1 
ATOM   9196  S  SG    . CYS C 1  269 ? -24.434 8.640   47.918  1.00 103.37 ? 652  CYS C SG    1 
ATOM   9197  N  N     . LYS C 1  270 ? -26.750 11.628  49.416  1.00 68.44  ? 653  LYS C N     1 
ATOM   9198  C  CA    . LYS C 1  270 ? -27.976 12.210  48.903  1.00 69.69  ? 653  LYS C CA    1 
ATOM   9199  C  C     . LYS C 1  270 ? -28.114 11.960  47.407  1.00 69.03  ? 653  LYS C C     1 
ATOM   9200  O  O     . LYS C 1  270 ? -27.242 12.369  46.641  1.00 77.02  ? 653  LYS C O     1 
ATOM   9201  C  CB    . LYS C 1  270 ? -27.997 13.697  49.209  1.00 68.33  ? 653  LYS C CB    1 
ATOM   9202  C  CG    . LYS C 1  270 ? -28.200 13.990  50.684  1.00 69.16  ? 653  LYS C CG    1 
ATOM   9203  C  CD    . LYS C 1  270 ? -29.453 14.811  50.872  1.00 65.59  ? 653  LYS C CD    1 
ATOM   9204  C  CE    . LYS C 1  270 ? -30.171 14.475  52.171  1.00 85.25  ? 653  LYS C CE    1 
ATOM   9205  N  NZ    . LYS C 1  270 ? -29.408 14.870  53.403  1.00 95.00  ? 653  LYS C NZ    1 
ATOM   9206  N  N     . PRO C 1  271 ? -29.193 11.330  46.957  1.00 60.94  ? 654  PRO C N     1 
ATOM   9207  C  CA    . PRO C 1  271 ? -29.342 11.016  45.532  1.00 65.95  ? 654  PRO C CA    1 
ATOM   9208  C  C     . PRO C 1  271 ? -29.754 12.213  44.705  1.00 62.91  ? 654  PRO C C     1 
ATOM   9209  O  O     . PRO C 1  271 ? -30.700 12.923  45.038  1.00 67.60  ? 654  PRO C O     1 
ATOM   9210  C  CB    . PRO C 1  271 ? -30.459 9.974   45.530  1.00 72.28  ? 654  PRO C CB    1 
ATOM   9211  C  CG    . PRO C 1  271 ? -31.302 10.407  46.695  1.00 70.36  ? 654  PRO C CG    1 
ATOM   9212  C  CD    . PRO C 1  271 ? -30.284 10.751  47.751  1.00 69.69  ? 654  PRO C CD    1 
ATOM   9213  N  N     . LEU C 1  272 ? -29.078 12.388  43.581  1.00 63.57  ? 655  LEU C N     1 
ATOM   9214  C  CA    . LEU C 1  272 ? -29.277 13.536  42.712  1.00 71.69  ? 655  LEU C CA    1 
ATOM   9215  C  C     . LEU C 1  272 ? -29.963 13.186  41.406  1.00 70.04  ? 655  LEU C C     1 
ATOM   9216  O  O     . LEU C 1  272 ? -30.788 13.955  40.896  1.00 67.77  ? 655  LEU C O     1 
ATOM   9217  C  CB    . LEU C 1  272 ? -27.916 14.165  42.415  1.00 73.44  ? 655  LEU C CB    1 
ATOM   9218  C  CG    . LEU C 1  272 ? -27.890 15.601  41.955  1.00 72.86  ? 655  LEU C CG    1 
ATOM   9219  C  CD1   . LEU C 1  272 ? -29.021 16.268  42.643  1.00 71.01  ? 655  LEU C CD1   1 
ATOM   9220  C  CD2   . LEU C 1  272 ? -26.584 16.210  42.373  1.00 86.23  ? 655  LEU C CD2   1 
ATOM   9221  N  N     . CYS C 1  273 ? -29.606 12.048  40.841  1.00 63.91  ? 656  CYS C N     1 
ATOM   9222  C  CA    . CYS C 1  273 ? -30.202 11.609  39.604  1.00 67.99  ? 656  CYS C CA    1 
ATOM   9223  C  C     . CYS C 1  273 ? -30.109 10.101  39.546  1.00 76.55  ? 656  CYS C C     1 
ATOM   9224  O  O     . CYS C 1  273 ? -29.052 9.527   39.820  1.00 76.75  ? 656  CYS C O     1 
ATOM   9225  C  CB    . CYS C 1  273 ? -29.509 12.214  38.401  1.00 73.34  ? 656  CYS C CB    1 
ATOM   9226  S  SG    . CYS C 1  273 ? -29.841 11.258  36.918  1.00 86.46  ? 656  CYS C SG    1 
ATOM   9227  N  N     . LEU C 1  274 ? -31.221 9.464   39.194  1.00 78.48  ? 657  LEU C N     1 
ATOM   9228  C  CA    . LEU C 1  274 ? -31.290 8.016   39.081  1.00 64.27  ? 657  LEU C CA    1 
ATOM   9229  C  C     . LEU C 1  274 ? -31.768 7.653   37.688  1.00 70.84  ? 657  LEU C C     1 
ATOM   9230  O  O     . LEU C 1  274 ? -32.781 8.181   37.210  1.00 69.46  ? 657  LEU C O     1 
ATOM   9231  C  CB    . LEU C 1  274 ? -32.220 7.420   40.129  1.00 69.68  ? 657  LEU C CB    1 
ATOM   9232  C  CG    . LEU C 1  274 ? -31.782 7.450   41.587  1.00 74.33  ? 657  LEU C CG    1 
ATOM   9233  C  CD1   . LEU C 1  274 ? -32.834 6.706   42.423  1.00 81.25  ? 657  LEU C CD1   1 
ATOM   9234  C  CD2   . LEU C 1  274 ? -30.428 6.821   41.733  1.00 72.13  ? 657  LEU C CD2   1 
ATOM   9235  N  N     . MET C 1  275 ? -31.038 6.759   37.033  1.00 75.02  ? 658  MET C N     1 
ATOM   9236  C  CA    . MET C 1  275 ? -31.335 6.445   35.650  1.00 76.48  ? 658  MET C CA    1 
ATOM   9237  C  C     . MET C 1  275 ? -31.195 4.951   35.419  1.00 84.24  ? 658  MET C C     1 
ATOM   9238  O  O     . MET C 1  275 ? -30.417 4.273   36.094  1.00 85.11  ? 658  MET C O     1 
ATOM   9239  C  CB    . MET C 1  275 ? -30.416 7.214   34.705  1.00 78.29  ? 658  MET C CB    1 
ATOM   9240  C  CG    . MET C 1  275 ? -29.029 6.650   34.559  1.00 83.95  ? 658  MET C CG    1 
ATOM   9241  S  SD    . MET C 1  275 ? -28.084 7.814   33.576  1.00 94.91  ? 658  MET C SD    1 
ATOM   9242  C  CE    . MET C 1  275 ? -27.662 9.006   34.839  1.00 84.51  ? 658  MET C CE    1 
ATOM   9243  N  N     . LEU C 1  276 ? -31.976 4.446   34.460  1.00 90.60  ? 659  LEU C N     1 
ATOM   9244  C  CA    . LEU C 1  276 ? -31.904 3.053   34.017  1.00 88.46  ? 659  LEU C CA    1 
ATOM   9245  C  C     . LEU C 1  276 ? -31.072 3.000   32.732  1.00 86.94  ? 659  LEU C C     1 
ATOM   9246  O  O     . LEU C 1  276 ? -31.592 3.001   31.617  1.00 86.39  ? 659  LEU C O     1 
ATOM   9247  C  CB    . LEU C 1  276 ? -33.315 2.489   33.839  1.00 83.87  ? 659  LEU C CB    1 
ATOM   9248  C  CG    . LEU C 1  276 ? -34.010 2.311   35.191  1.00 86.24  ? 659  LEU C CG    1 
ATOM   9249  C  CD1   . LEU C 1  276 ? -35.486 1.965   35.061  1.00 88.81  ? 659  LEU C CD1   1 
ATOM   9250  C  CD2   . LEU C 1  276 ? -33.258 1.252   35.996  1.00 86.14  ? 659  LEU C CD2   1 
ATOM   9251  N  N     . ALA C 1  277 ? -29.746 2.972   32.901  1.00 82.41  ? 660  ALA C N     1 
ATOM   9252  C  CA    . ALA C 1  277 ? -28.824 2.959   31.769  1.00 80.65  ? 660  ALA C CA    1 
ATOM   9253  C  C     . ALA C 1  277 ? -27.499 2.327   32.189  1.00 89.03  ? 660  ALA C C     1 
ATOM   9254  O  O     . ALA C 1  277 ? -27.180 2.232   33.377  1.00 91.50  ? 660  ALA C O     1 
ATOM   9255  C  CB    . ALA C 1  277 ? -28.602 4.370   31.215  1.00 78.75  ? 660  ALA C CB    1 
ATOM   9256  N  N     . ASP C 1  278 ? -26.737 1.881   31.191  1.00 82.90  ? 661  ASP C N     1 
ATOM   9257  C  CA    . ASP C 1  278 ? -25.431 1.275   31.415  1.00 81.12  ? 661  ASP C CA    1 
ATOM   9258  C  C     . ASP C 1  278 ? -24.394 2.378   31.583  1.00 88.43  ? 661  ASP C C     1 
ATOM   9259  O  O     . ASP C 1  278 ? -24.365 3.323   30.792  1.00 91.24  ? 661  ASP C O     1 
ATOM   9260  C  CB    . ASP C 1  278 ? -25.069 0.354   30.244  1.00 91.94  ? 661  ASP C CB    1 
ATOM   9261  C  CG    . ASP C 1  278 ? -23.951 -0.643  30.587  1.00 113.07 ? 661  ASP C CG    1 
ATOM   9262  O  OD1   . ASP C 1  278 ? -22.860 -0.206  31.027  1.00 118.21 ? 661  ASP C OD1   1 
ATOM   9263  O  OD2   . ASP C 1  278 ? -24.164 -1.872  30.416  1.00 113.98 ? 661  ASP C OD2   1 
ATOM   9264  N  N     . GLU C 1  279 ? -23.556 2.269   32.623  1.00 95.90  ? 662  GLU C N     1 
ATOM   9265  C  CA    . GLU C 1  279 ? -22.498 3.265   32.826  1.00 100.93 ? 662  GLU C CA    1 
ATOM   9266  C  C     . GLU C 1  279 ? -21.474 3.272   31.691  1.00 102.49 ? 662  GLU C C     1 
ATOM   9267  O  O     . GLU C 1  279 ? -20.665 4.205   31.603  1.00 98.86  ? 662  GLU C O     1 
ATOM   9268  C  CB    . GLU C 1  279 ? -21.770 3.044   34.163  1.00 92.63  ? 662  GLU C CB    1 
ATOM   9269  C  CG    . GLU C 1  279 ? -20.825 1.834   34.205  1.00 98.08  ? 662  GLU C CG    1 
ATOM   9270  C  CD    . GLU C 1  279 ? -20.131 1.667   35.555  1.00 103.16 ? 662  GLU C CD    1 
ATOM   9271  O  OE1   . GLU C 1  279 ? -19.130 2.374   35.808  1.00 109.26 ? 662  GLU C OE1   1 
ATOM   9272  O  OE2   . GLU C 1  279 ? -20.585 0.820   36.357  1.00 113.52 ? 662  GLU C OE2   1 
ATOM   9273  N  N     . SER C 1  280 ? -21.478 2.243   30.842  1.00 97.60  ? 663  SER C N     1 
ATOM   9274  C  CA    . SER C 1  280 ? -20.649 2.187   29.648  1.00 87.56  ? 663  SER C CA    1 
ATOM   9275  C  C     . SER C 1  280 ? -21.411 2.613   28.405  1.00 85.78  ? 663  SER C C     1 
ATOM   9276  O  O     . SER C 1  280 ? -20.887 2.476   27.298  1.00 97.56  ? 663  SER C O     1 
ATOM   9277  C  CB    . SER C 1  280 ? -20.085 0.778   29.447  1.00 90.80  ? 663  SER C CB    1 
ATOM   9278  O  OG    . SER C 1  280 ? -19.455 0.287   30.618  1.00 107.82 ? 663  SER C OG    1 
ATOM   9279  N  N     . ASP C 1  281 ? -22.640 3.110   28.560  1.00 85.34  ? 664  ASP C N     1 
ATOM   9280  C  CA    . ASP C 1  281 ? -23.417 3.666   27.445  1.00 89.78  ? 664  ASP C CA    1 
ATOM   9281  C  C     . ASP C 1  281 ? -23.128 5.158   27.340  1.00 85.97  ? 664  ASP C C     1 
ATOM   9282  O  O     . ASP C 1  281 ? -23.926 6.015   27.716  1.00 86.32  ? 664  ASP C O     1 
ATOM   9283  C  CB    . ASP C 1  281 ? -24.905 3.397   27.633  1.00 96.71  ? 664  ASP C CB    1 
ATOM   9284  C  CG    . ASP C 1  281 ? -25.767 4.029   26.542  1.00 88.22  ? 664  ASP C CG    1 
ATOM   9285  O  OD1   . ASP C 1  281 ? -25.228 4.690   25.625  1.00 84.54  ? 664  ASP C OD1   1 
ATOM   9286  O  OD2   . ASP C 1  281 ? -27.000 3.855   26.609  1.00 94.43  ? 664  ASP C OD2   1 
ATOM   9287  N  N     . HIS C 1  282 ? -21.980 5.458   26.750  1.00 74.63  ? 665  HIS C N     1 
ATOM   9288  C  CA    . HIS C 1  282 ? -21.420 6.798   26.840  1.00 77.32  ? 665  HIS C CA    1 
ATOM   9289  C  C     . HIS C 1  282 ? -22.368 7.864   26.289  1.00 71.79  ? 665  HIS C C     1 
ATOM   9290  O  O     . HIS C 1  282 ? -22.479 8.954   26.857  1.00 75.67  ? 665  HIS C O     1 
ATOM   9291  C  CB    . HIS C 1  282 ? -20.083 6.825   26.112  1.00 80.12  ? 665  HIS C CB    1 
ATOM   9292  C  CG    . HIS C 1  282 ? -19.187 7.934   26.554  1.00 75.73  ? 665  HIS C CG    1 
ATOM   9293  N  ND1   . HIS C 1  282 ? -18.032 7.715   27.272  1.00 77.09  ? 665  HIS C ND1   1 
ATOM   9294  C  CD2   . HIS C 1  282 ? -19.279 9.273   26.386  1.00 75.81  ? 665  HIS C CD2   1 
ATOM   9295  C  CE1   . HIS C 1  282 ? -17.446 8.873   27.524  1.00 77.42  ? 665  HIS C CE1   1 
ATOM   9296  N  NE2   . HIS C 1  282 ? -18.185 9.835   27.000  1.00 77.94  ? 665  HIS C NE2   1 
ATOM   9297  N  N     . GLU C 1  283 ? -23.060 7.578   25.189  1.00 76.93  ? 666  GLU C N     1 
ATOM   9298  C  CA    . GLU C 1  283 ? -23.934 8.585   24.589  1.00 76.57  ? 666  GLU C CA    1 
ATOM   9299  C  C     . GLU C 1  283 ? -25.046 8.976   25.549  1.00 76.86  ? 666  GLU C C     1 
ATOM   9300  O  O     . GLU C 1  283 ? -25.250 10.159  25.842  1.00 73.50  ? 666  GLU C O     1 
ATOM   9301  C  CB    . GLU C 1  283 ? -24.516 8.059   23.277  1.00 85.89  ? 666  GLU C CB    1 
ATOM   9302  C  CG    . GLU C 1  283 ? -23.573 8.090   22.061  1.00 82.38  ? 666  GLU C CG    1 
ATOM   9303  C  CD    . GLU C 1  283 ? -22.518 6.996   22.061  1.00 81.74  ? 666  GLU C CD    1 
ATOM   9304  O  OE1   . GLU C 1  283 ? -21.510 7.198   21.353  1.00 86.30  ? 666  GLU C OE1   1 
ATOM   9305  O  OE2   . GLU C 1  283 ? -22.680 5.955   22.745  1.00 80.00  ? 666  GLU C OE2   1 
ATOM   9306  N  N     . THR C 1  284 ? -25.752 7.979   26.077  1.00 80.10  ? 667  THR C N     1 
ATOM   9307  C  CA    . THR C 1  284 ? -26.847 8.220   27.008  1.00 77.63  ? 667  THR C CA    1 
ATOM   9308  C  C     . THR C 1  284 ? -26.357 8.828   28.310  1.00 76.94  ? 667  THR C C     1 
ATOM   9309  O  O     . THR C 1  284 ? -27.015 9.706   28.881  1.00 85.39  ? 667  THR C O     1 
ATOM   9310  C  CB    . THR C 1  284 ? -27.554 6.912   27.323  1.00 75.88  ? 667  THR C CB    1 
ATOM   9311  O  OG1   . THR C 1  284 ? -27.882 6.224   26.112  1.00 81.80  ? 667  THR C OG1   1 
ATOM   9312  C  CG2   . THR C 1  284 ? -28.795 7.189   28.089  1.00 80.73  ? 667  THR C CG2   1 
ATOM   9313  N  N     . LEU C 1  285 ? -25.222 8.344   28.814  1.00 78.17  ? 668  LEU C N     1 
ATOM   9314  C  CA    . LEU C 1  285 ? -24.668 8.863   30.059  1.00 73.68  ? 668  LEU C CA    1 
ATOM   9315  C  C     . LEU C 1  285 ? -24.371 10.344  29.947  1.00 76.87  ? 668  LEU C C     1 
ATOM   9316  O  O     . LEU C 1  285 ? -24.742 11.132  30.822  1.00 73.24  ? 668  LEU C O     1 
ATOM   9317  C  CB    . LEU C 1  285 ? -23.392 8.117   30.424  1.00 76.02  ? 668  LEU C CB    1 
ATOM   9318  C  CG    . LEU C 1  285 ? -22.827 8.567   31.761  1.00 74.71  ? 668  LEU C CG    1 
ATOM   9319  C  CD1   . LEU C 1  285 ? -23.813 8.142   32.818  1.00 83.99  ? 668  LEU C CD1   1 
ATOM   9320  C  CD2   . LEU C 1  285 ? -21.453 7.968   32.037  1.00 74.31  ? 668  LEU C CD2   1 
ATOM   9321  N  N     . THR C 1  286 ? -23.665 10.736  28.890  1.00 76.01  ? 669  THR C N     1 
ATOM   9322  C  CA    . THR C 1  286 ? -23.367 12.147  28.722  1.00 72.11  ? 669  THR C CA    1 
ATOM   9323  C  C     . THR C 1  286 ? -24.646 12.945  28.557  1.00 70.06  ? 669  THR C C     1 
ATOM   9324  O  O     . THR C 1  286 ? -24.810 13.989  29.191  1.00 76.89  ? 669  THR C O     1 
ATOM   9325  C  CB    . THR C 1  286 ? -22.435 12.369  27.530  1.00 77.32  ? 669  THR C CB    1 
ATOM   9326  O  OG1   . THR C 1  286 ? -23.099 11.993  26.315  1.00 75.81  ? 669  THR C OG1   1 
ATOM   9327  C  CG2   . THR C 1  286 ? -21.139 11.576  27.706  1.00 70.84  ? 669  THR C CG2   1 
ATOM   9328  N  N     . ALA C 1  287 ? -25.575 12.453  27.733  1.00 73.76  ? 670  ALA C N     1 
ATOM   9329  C  CA    . ALA C 1  287 ? -26.811 13.187  27.487  1.00 74.48  ? 670  ALA C CA    1 
ATOM   9330  C  C     . ALA C 1  287 ? -27.576 13.451  28.774  1.00 70.46  ? 670  ALA C C     1 
ATOM   9331  O  O     . ALA C 1  287 ? -28.194 14.510  28.922  1.00 71.85  ? 670  ALA C O     1 
ATOM   9332  C  CB    . ALA C 1  287 ? -27.698 12.421  26.511  1.00 81.82  ? 670  ALA C CB    1 
ATOM   9333  N  N     . ILE C 1  288 ? -27.566 12.499  29.705  1.00 74.13  ? 671  ILE C N     1 
ATOM   9334  C  CA    . ILE C 1  288 ? -28.348 12.650  30.935  1.00 80.15  ? 671  ILE C CA    1 
ATOM   9335  C  C     . ILE C 1  288 ? -27.593 13.456  31.989  1.00 74.76  ? 671  ILE C C     1 
ATOM   9336  O  O     . ILE C 1  288 ? -28.188 14.285  32.680  1.00 73.23  ? 671  ILE C O     1 
ATOM   9337  C  CB    . ILE C 1  288 ? -28.770 11.269  31.487  1.00 85.28  ? 671  ILE C CB    1 
ATOM   9338  C  CG1   . ILE C 1  288 ? -29.834 10.609  30.594  1.00 75.76  ? 671  ILE C CG1   1 
ATOM   9339  C  CG2   . ILE C 1  288 ? -29.271 11.406  32.926  1.00 87.44  ? 671  ILE C CG2   1 
ATOM   9340  C  CD1   . ILE C 1  288 ? -30.181 9.168   30.998  1.00 90.21  ? 671  ILE C CD1   1 
ATOM   9341  N  N     . LEU C 1  289 ? -26.284 13.231  32.123  1.00 71.87  ? 672  LEU C N     1 
ATOM   9342  C  CA    . LEU C 1  289 ? -25.493 13.854  33.176  1.00 70.48  ? 672  LEU C CA    1 
ATOM   9343  C  C     . LEU C 1  289 ? -24.970 15.251  32.823  1.00 79.38  ? 672  LEU C C     1 
ATOM   9344  O  O     . LEU C 1  289 ? -24.562 15.985  33.731  1.00 80.42  ? 672  LEU C O     1 
ATOM   9345  C  CB    . LEU C 1  289 ? -24.313 12.947  33.530  1.00 70.16  ? 672  LEU C CB    1 
ATOM   9346  C  CG    . LEU C 1  289 ? -24.650 11.717  34.356  1.00 67.50  ? 672  LEU C CG    1 
ATOM   9347  C  CD1   . LEU C 1  289 ? -23.398 10.981  34.788  1.00 59.37  ? 672  LEU C CD1   1 
ATOM   9348  C  CD2   . LEU C 1  289 ? -25.410 12.196  35.555  1.00 83.99  ? 672  LEU C CD2   1 
ATOM   9349  N  N     . SER C 1  290 ? -24.963 15.646  31.546  1.00 81.77  ? 673  SER C N     1 
ATOM   9350  C  CA    . SER C 1  290 ? -24.408 16.945  31.191  1.00 76.54  ? 673  SER C CA    1 
ATOM   9351  C  C     . SER C 1  290 ? -25.196 18.097  31.819  1.00 72.83  ? 673  SER C C     1 
ATOM   9352  O  O     . SER C 1  290 ? -24.576 19.063  32.278  1.00 85.14  ? 673  SER C O     1 
ATOM   9353  C  CB    . SER C 1  290 ? -24.299 17.088  29.660  1.00 82.86  ? 673  SER C CB    1 
ATOM   9354  O  OG    . SER C 1  290 ? -25.548 17.173  28.982  1.00 86.79  ? 673  SER C OG    1 
ATOM   9355  N  N     . PRO C 1  291 ? -26.531 18.054  31.891  1.00 63.81  ? 674  PRO C N     1 
ATOM   9356  C  CA    . PRO C 1  291 ? -27.235 19.178  32.536  1.00 70.22  ? 674  PRO C CA    1 
ATOM   9357  C  C     . PRO C 1  291 ? -26.904 19.361  34.012  1.00 74.84  ? 674  PRO C C     1 
ATOM   9358  O  O     . PRO C 1  291 ? -26.850 20.501  34.502  1.00 83.70  ? 674  PRO C O     1 
ATOM   9359  C  CB    . PRO C 1  291 ? -28.713 18.830  32.315  1.00 75.72  ? 674  PRO C CB    1 
ATOM   9360  C  CG    . PRO C 1  291 ? -28.716 17.986  31.109  1.00 78.17  ? 674  PRO C CG    1 
ATOM   9361  C  CD    . PRO C 1  291 ? -27.475 17.174  31.183  1.00 70.49  ? 674  PRO C CD    1 
ATOM   9362  N  N     . LEU C 1  292 ? -26.661 18.274  34.737  1.00 69.67  ? 675  LEU C N     1 
ATOM   9363  C  CA    . LEU C 1  292 ? -26.249 18.407  36.128  1.00 69.59  ? 675  LEU C CA    1 
ATOM   9364  C  C     . LEU C 1  292 ? -24.864 19.014  36.220  1.00 71.47  ? 675  LEU C C     1 
ATOM   9365  O  O     . LEU C 1  292 ? -24.581 19.802  37.126  1.00 76.69  ? 675  LEU C O     1 
ATOM   9366  C  CB    . LEU C 1  292 ? -26.265 17.050  36.834  1.00 82.05  ? 675  LEU C CB    1 
ATOM   9367  C  CG    . LEU C 1  292 ? -27.587 16.377  37.182  1.00 77.55  ? 675  LEU C CG    1 
ATOM   9368  C  CD1   . LEU C 1  292 ? -27.343 14.937  37.593  1.00 75.59  ? 675  LEU C CD1   1 
ATOM   9369  C  CD2   . LEU C 1  292 ? -28.270 17.168  38.291  1.00 79.04  ? 675  LEU C CD2   1 
ATOM   9370  N  N     . ILE C 1  293 ? -23.985 18.675  35.283  1.00 69.67  ? 676  ILE C N     1 
ATOM   9371  C  CA    . ILE C 1  293 ? -22.639 19.233  35.339  1.00 78.24  ? 676  ILE C CA    1 
ATOM   9372  C  C     . ILE C 1  293 ? -22.676 20.722  35.020  1.00 79.38  ? 676  ILE C C     1 
ATOM   9373  O  O     . ILE C 1  293 ? -21.937 21.513  35.613  1.00 75.09  ? 676  ILE C O     1 
ATOM   9374  C  CB    . ILE C 1  293 ? -21.691 18.465  34.397  1.00 82.28  ? 676  ILE C CB    1 
ATOM   9375  C  CG1   . ILE C 1  293 ? -21.695 16.986  34.745  1.00 78.64  ? 676  ILE C CG1   1 
ATOM   9376  C  CG2   . ILE C 1  293 ? -20.261 18.974  34.552  1.00 90.12  ? 676  ILE C CG2   1 
ATOM   9377  C  CD1   . ILE C 1  293 ? -20.969 16.702  36.036  1.00 77.34  ? 676  ILE C CD1   1 
ATOM   9378  N  N     . ALA C 1  294 ? -23.543 21.125  34.082  1.00 80.88  ? 677  ALA C N     1 
ATOM   9379  C  CA    . ALA C 1  294 ? -23.764 22.540  33.798  1.00 72.46  ? 677  ALA C CA    1 
ATOM   9380  C  C     . ALA C 1  294 ? -24.190 23.294  35.047  1.00 74.51  ? 677  ALA C C     1 
ATOM   9381  O  O     . ALA C 1  294 ? -23.598 24.320  35.397  1.00 79.86  ? 677  ALA C O     1 
ATOM   9382  C  CB    . ALA C 1  294 ? -24.827 22.691  32.717  1.00 64.23  ? 677  ALA C CB    1 
ATOM   9383  N  N     . GLU C 1  295 ? -25.249 22.812  35.708  1.00 73.55  ? 678  GLU C N     1 
ATOM   9384  C  CA    . GLU C 1  295 ? -25.695 23.432  36.954  1.00 71.23  ? 678  GLU C CA    1 
ATOM   9385  C  C     . GLU C 1  295 ? -24.568 23.523  37.983  1.00 70.07  ? 678  GLU C C     1 
ATOM   9386  O  O     . GLU C 1  295 ? -24.396 24.561  38.629  1.00 77.70  ? 678  GLU C O     1 
ATOM   9387  C  CB    . GLU C 1  295 ? -26.879 22.654  37.510  1.00 72.65  ? 678  GLU C CB    1 
ATOM   9388  C  CG    . GLU C 1  295 ? -28.058 22.612  36.548  1.00 78.37  ? 678  GLU C CG    1 
ATOM   9389  C  CD    . GLU C 1  295 ? -29.137 21.590  36.939  1.00 92.36  ? 678  GLU C CD    1 
ATOM   9390  O  OE1   . GLU C 1  295 ? -28.934 20.826  37.912  1.00 89.50  ? 678  GLU C OE1   1 
ATOM   9391  O  OE2   . GLU C 1  295 ? -30.192 21.549  36.260  1.00 89.23  ? 678  GLU C OE2   1 
ATOM   9392  N  N     . ARG C 1  296 ? -23.778 22.459  38.150  1.00 80.66  ? 679  ARG C N     1 
ATOM   9393  C  CA    . ARG C 1  296 ? -22.679 22.510  39.127  1.00 84.64  ? 679  ARG C CA    1 
ATOM   9394  C  C     . ARG C 1  296 ? -21.610 23.511  38.715  1.00 89.96  ? 679  ARG C C     1 
ATOM   9395  O  O     . ARG C 1  296 ? -21.063 24.245  39.557  1.00 96.87  ? 679  ARG C O     1 
ATOM   9396  C  CB    . ARG C 1  296 ? -22.054 21.125  39.312  1.00 83.94  ? 679  ARG C CB    1 
ATOM   9397  C  CG    . ARG C 1  296 ? -20.587 21.087  39.772  1.00 81.25  ? 679  ARG C CG    1 
ATOM   9398  C  CD    . ARG C 1  296 ? -20.028 19.723  39.368  1.00 93.96  ? 679  ARG C CD    1 
ATOM   9399  N  NE    . ARG C 1  296 ? -18.727 19.375  39.940  1.00 104.81 ? 679  ARG C NE    1 
ATOM   9400  C  CZ    . ARG C 1  296 ? -17.641 19.105  39.222  1.00 100.45 ? 679  ARG C CZ    1 
ATOM   9401  N  NH1   . ARG C 1  296 ? -16.501 18.781  39.827  1.00 95.15  ? 679  ARG C NH1   1 
ATOM   9402  N  NH2   . ARG C 1  296 ? -17.699 19.161  37.900  1.00 107.46 ? 679  ARG C NH2   1 
ATOM   9403  N  N     . GLU C 1  297 ? -21.293 23.551  37.426  1.00 82.92  ? 680  GLU C N     1 
ATOM   9404  C  CA    . GLU C 1  297 ? -20.372 24.558  36.940  1.00 79.79  ? 680  GLU C CA    1 
ATOM   9405  C  C     . GLU C 1  297 ? -20.882 25.939  37.294  1.00 86.23  ? 680  GLU C C     1 
ATOM   9406  O  O     . GLU C 1  297 ? -20.121 26.794  37.758  1.00 94.39  ? 680  GLU C O     1 
ATOM   9407  C  CB    . GLU C 1  297 ? -20.183 24.408  35.439  1.00 82.57  ? 680  GLU C CB    1 
ATOM   9408  C  CG    . GLU C 1  297 ? -18.732 24.520  35.052  1.00 99.36  ? 680  GLU C CG    1 
ATOM   9409  C  CD    . GLU C 1  297 ? -17.816 23.665  35.938  1.00 107.89 ? 680  GLU C CD    1 
ATOM   9410  O  OE1   . GLU C 1  297 ? -16.708 24.148  36.270  1.00 109.95 ? 680  GLU C OE1   1 
ATOM   9411  O  OE2   . GLU C 1  297 ? -18.191 22.513  36.290  1.00 94.97  ? 680  GLU C OE2   1 
ATOM   9412  N  N     . ALA C 1  298 ? -22.192 26.151  37.145  1.00 86.83  ? 681  ALA C N     1 
ATOM   9413  C  CA    . ALA C 1  298 ? -22.778 27.463  37.429  1.00 94.01  ? 681  ALA C CA    1 
ATOM   9414  C  C     . ALA C 1  298 ? -22.625 27.832  38.900  1.00 83.79  ? 681  ALA C C     1 
ATOM   9415  O  O     . ALA C 1  298 ? -22.296 28.971  39.244  1.00 81.21  ? 681  ALA C O     1 
ATOM   9416  C  CB    . ALA C 1  298 ? -24.250 27.479  37.020  1.00 92.97  ? 681  ALA C CB    1 
ATOM   9417  N  N     . MET C 1  299 ? -22.872 26.880  39.783  1.00 77.24  ? 682  MET C N     1 
ATOM   9418  C  CA    . MET C 1  299 ? -22.743 27.179  41.200  1.00 77.58  ? 682  MET C CA    1 
ATOM   9419  C  C     . MET C 1  299 ? -21.297 27.388  41.610  1.00 81.31  ? 682  MET C C     1 
ATOM   9420  O  O     . MET C 1  299 ? -21.052 27.886  42.713  1.00 82.08  ? 682  MET C O     1 
ATOM   9421  C  CB    . MET C 1  299 ? -23.332 26.054  42.057  1.00 90.28  ? 682  MET C CB    1 
ATOM   9422  C  CG    . MET C 1  299 ? -24.834 25.854  41.939  1.00 80.30  ? 682  MET C CG    1 
ATOM   9423  S  SD    . MET C 1  299 ? -25.426 24.383  42.775  1.00 77.88  ? 682  MET C SD    1 
ATOM   9424  C  CE    . MET C 1  299 ? -24.690 23.036  41.854  1.00 82.51  ? 682  MET C CE    1 
ATOM   9425  N  N     . LYS C 1  300 ? -20.337 26.956  40.789  1.00 76.26  ? 683  LYS C N     1 
ATOM   9426  C  CA    . LYS C 1  300 ? -18.938 27.137  41.181  1.00 81.87  ? 683  LYS C CA    1 
ATOM   9427  C  C     . LYS C 1  300 ? -18.521 28.612  41.282  1.00 88.43  ? 683  LYS C C     1 
ATOM   9428  O  O     . LYS C 1  300 ? -17.420 28.903  41.770  1.00 84.77  ? 683  LYS C O     1 
ATOM   9429  C  CB    . LYS C 1  300 ? -18.019 26.417  40.201  1.00 74.29  ? 683  LYS C CB    1 
ATOM   9430  C  CG    . LYS C 1  300 ? -17.713 24.978  40.515  1.00 79.36  ? 683  LYS C CG    1 
ATOM   9431  C  CD    . LYS C 1  300 ? -16.838 24.407  39.403  1.00 93.94  ? 683  LYS C CD    1 
ATOM   9432  C  CE    . LYS C 1  300 ? -16.404 22.966  39.659  1.00 97.88  ? 683  LYS C CE    1 
ATOM   9433  N  NZ    . LYS C 1  300 ? -15.594 22.391  38.530  1.00 97.24  ? 683  LYS C NZ    1 
ATOM   9434  N  N     . SER C 1  301 ? -19.358 29.550  40.835  1.00 81.81  ? 684  SER C N     1 
ATOM   9435  C  CA    . SER C 1  301 ? -19.032 30.972  40.895  1.00 80.91  ? 684  SER C CA    1 
ATOM   9436  C  C     . SER C 1  301 ? -20.285 31.788  41.228  1.00 87.09  ? 684  SER C C     1 
ATOM   9437  O  O     . SER C 1  301 ? -20.790 32.581  40.431  1.00 80.74  ? 684  SER C O     1 
ATOM   9438  C  CB    . SER C 1  301 ? -18.404 31.427  39.582  1.00 83.75  ? 684  SER C CB    1 
ATOM   9439  O  OG    . SER C 1  301 ? -19.250 31.101  38.496  1.00 88.62  ? 684  SER C OG    1 
ATOM   9440  N  N     . SER C 1  302 ? -20.795 31.595  42.443  1.00 79.73  ? 685  SER C N     1 
ATOM   9441  C  CA    . SER C 1  302 ? -22.004 32.272  42.891  1.00 75.59  ? 685  SER C CA    1 
ATOM   9442  C  C     . SER C 1  302 ? -22.171 32.008  44.377  1.00 73.70  ? 685  SER C C     1 
ATOM   9443  O  O     . SER C 1  302 ? -21.590 31.070  44.916  1.00 78.50  ? 685  SER C O     1 
ATOM   9444  C  CB    . SER C 1  302 ? -23.229 31.798  42.114  1.00 75.67  ? 685  SER C CB    1 
ATOM   9445  O  OG    . SER C 1  302 ? -24.276 32.739  42.214  1.00 85.58  ? 685  SER C OG    1 
ATOM   9446  N  N     . GLU C 1  303 ? -22.952 32.857  45.038  1.00 75.98  ? 686  GLU C N     1 
ATOM   9447  C  CA    . GLU C 1  303 ? -23.251 32.686  46.452  1.00 76.61  ? 686  GLU C CA    1 
ATOM   9448  C  C     . GLU C 1  303 ? -24.723 32.371  46.645  1.00 81.38  ? 686  GLU C C     1 
ATOM   9449  O  O     . GLU C 1  303 ? -25.588 32.928  45.964  1.00 80.65  ? 686  GLU C O     1 
ATOM   9450  C  CB    . GLU C 1  303 ? -22.934 33.941  47.264  1.00 104.24 ? 686  GLU C CB    1 
ATOM   9451  C  CG    . GLU C 1  303 ? -21.493 34.385  47.335  1.00 109.35 ? 686  GLU C CG    1 
ATOM   9452  C  CD    . GLU C 1  303 ? -21.377 35.753  48.014  1.00 130.00 ? 686  GLU C CD    1 
ATOM   9453  O  OE1   . GLU C 1  303 ? -22.377 36.203  48.635  1.00 111.84 ? 686  GLU C OE1   1 
ATOM   9454  O  OE2   . GLU C 1  303 ? -20.294 36.378  47.916  1.00 142.81 ? 686  GLU C OE2   1 
ATOM   9455  N  N     . LEU C 1  304 ? -25.003 31.509  47.615  1.00 75.04  ? 687  LEU C N     1 
ATOM   9456  C  CA    . LEU C 1  304 ? -26.357 31.072  47.908  1.00 80.31  ? 687  LEU C CA    1 
ATOM   9457  C  C     . LEU C 1  304 ? -26.847 31.788  49.157  1.00 77.46  ? 687  LEU C C     1 
ATOM   9458  O  O     . LEU C 1  304 ? -26.240 31.691  50.228  1.00 73.62  ? 687  LEU C O     1 
ATOM   9459  C  CB    . LEU C 1  304 ? -26.416 29.553  48.088  1.00 81.89  ? 687  LEU C CB    1 
ATOM   9460  C  CG    . LEU C 1  304 ? -27.727 28.846  48.457  1.00 79.06  ? 687  LEU C CG    1 
ATOM   9461  C  CD1   . LEU C 1  304 ? -28.738 28.910  47.320  1.00 72.26  ? 687  LEU C CD1   1 
ATOM   9462  C  CD2   . LEU C 1  304 ? -27.449 27.399  48.876  1.00 72.50  ? 687  LEU C CD2   1 
ATOM   9463  N  N     . THR C 1  305 ? -27.947 32.495  49.011  1.00 80.47  ? 688  THR C N     1 
ATOM   9464  C  CA    . THR C 1  305 ? -28.625 33.130  50.116  1.00 87.07  ? 688  THR C CA    1 
ATOM   9465  C  C     . THR C 1  305 ? -29.838 32.289  50.476  1.00 86.97  ? 688  THR C C     1 
ATOM   9466  O  O     . THR C 1  305 ? -30.657 31.963  49.604  1.00 82.68  ? 688  THR C O     1 
ATOM   9467  C  CB    . THR C 1  305 ? -29.035 34.550  49.742  1.00 98.81  ? 688  THR C CB    1 
ATOM   9468  O  OG1   . THR C 1  305 ? -27.876 35.278  49.316  1.00 102.92 ? 688  THR C OG1   1 
ATOM   9469  C  CG2   . THR C 1  305 ? -29.650 35.240  50.939  1.00 103.19 ? 688  THR C CG2   1 
ATOM   9470  N  N     . LEU C 1  306 ? -29.941 31.952  51.761  1.00 90.89  ? 689  LEU C N     1 
ATOM   9471  C  CA    . LEU C 1  306 ? -30.877 30.952  52.252  1.00 90.25  ? 689  LEU C CA    1 
ATOM   9472  C  C     . LEU C 1  306 ? -31.245 31.269  53.692  1.00 86.95  ? 689  LEU C C     1 
ATOM   9473  O  O     . LEU C 1  306 ? -30.365 31.521  54.511  1.00 85.36  ? 689  LEU C O     1 
ATOM   9474  C  CB    . LEU C 1  306 ? -30.244 29.561  52.164  1.00 84.72  ? 689  LEU C CB    1 
ATOM   9475  C  CG    . LEU C 1  306 ? -31.141 28.438  52.660  1.00 87.12  ? 689  LEU C CG    1 
ATOM   9476  C  CD1   . LEU C 1  306 ? -32.391 28.358  51.776  1.00 89.72  ? 689  LEU C CD1   1 
ATOM   9477  C  CD2   . LEU C 1  306 ? -30.392 27.109  52.739  1.00 73.14  ? 689  LEU C CD2   1 
ATOM   9478  N  N     . GLU C 1  307 ? -32.523 31.225  54.016  1.00 85.79  ? 690  GLU C N     1 
ATOM   9479  C  CA    . GLU C 1  307 ? -32.963 31.639  55.340  1.00 91.31  ? 690  GLU C CA    1 
ATOM   9480  C  C     . GLU C 1  307 ? -32.932 30.454  56.296  1.00 95.60  ? 690  GLU C C     1 
ATOM   9481  O  O     . GLU C 1  307 ? -33.652 29.475  56.086  1.00 110.32 ? 690  GLU C O     1 
ATOM   9482  C  CB    . GLU C 1  307 ? -34.369 32.218  55.259  1.00 98.22  ? 690  GLU C CB    1 
ATOM   9483  C  CG    . GLU C 1  307 ? -34.874 32.760  56.555  1.00 108.68 ? 690  GLU C CG    1 
ATOM   9484  C  CD    . GLU C 1  307 ? -36.243 33.369  56.399  1.00 133.66 ? 690  GLU C CD    1 
ATOM   9485  O  OE1   . GLU C 1  307 ? -36.840 33.202  55.308  1.00 126.81 ? 690  GLU C OE1   1 
ATOM   9486  O  OE2   . GLU C 1  307 ? -36.716 34.017  57.363  1.00 148.83 ? 690  GLU C OE2   1 
ATOM   9487  N  N     . MET C 1  308 ? -32.115 30.528  57.345  1.00 85.39  ? 691  MET C N     1 
ATOM   9488  C  CA    . MET C 1  308 ? -32.179 29.531  58.410  1.00 91.47  ? 691  MET C CA    1 
ATOM   9489  C  C     . MET C 1  308 ? -32.479 30.207  59.737  1.00 102.10 ? 691  MET C C     1 
ATOM   9490  O  O     . MET C 1  308 ? -31.908 31.258  60.051  1.00 104.80 ? 691  MET C O     1 
ATOM   9491  C  CB    . MET C 1  308 ? -30.894 28.715  58.530  1.00 88.16  ? 691  MET C CB    1 
ATOM   9492  C  CG    . MET C 1  308 ? -30.498 28.013  57.246  1.00 90.00  ? 691  MET C CG    1 
ATOM   9493  S  SD