data_6CLZ
# 
_entry.id   6CLZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CLZ         
WWPDB D_1000232929 
BMRB  30425        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs' 
_pdbx_database_related.db_id          30425 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6CLZ 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Marcink, T.C.'   1 0000-0003-4295-1229 
'Van Doren, S.R.' 2 0000-0003-2838-4598 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                281 
_citation.page_last                 292.e6 
_citation.title                     
'MT1-MMP Binds Membranes by Opposite Tips of Its beta Propeller to Position It for Pericellular Proteolysis.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2018.10.008 
_citation.pdbx_database_id_PubMed   30471921 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Marcink, T.C.'   1 ? 
primary 'Simoncic, J.A.'  2 ? 
primary 'An, B.'          3 ? 
primary 'Knapinska, A.M.' 4 ? 
primary 'Fulcher, Y.G.'   5 ? 
primary 'Akkaladevi, N.'  6 ? 
primary 'Fields, G.B.'    7 ? 
primary 'Van Doren, S.R.' 8 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Matrix metalloproteinase-14'               23131.346 1   3.4.24.80 ? 'residues 316-511' ? 
2 polymer     man 'Apolipoprotein A-I'                        24912.156 2   ?         ? 'residues 79-267'  ? 
3 non-polymer syn 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE 678.940   218 ?         ? ?                  ? 
4 non-polymer syn 'SODIUM ION'                                22.990    1   ?         ? ?                  ? 
5 non-polymer syn 'CHLORIDE ION'                              35.453    1   ?         ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MMP-14,MMP-X1,Membrane-type matrix metalloproteinase 1,MTMMP1,Membrane-type-1 matrix metalloproteinase,MT1MMP' 
2 'ApoA-I,Apolipoprotein A1'                                                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
A   ? 
2 'polypeptide(L)' no no 
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPYLDDFQKKWQEEM
ELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY
HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPYLDDFQKKWQEEM
ELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEY
HAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ASN n 
1 3   ILE n 
1 4   CYS n 
1 5   ASP n 
1 6   GLY n 
1 7   ASN n 
1 8   PHE n 
1 9   ASP n 
1 10  THR n 
1 11  VAL n 
1 12  ALA n 
1 13  MET n 
1 14  LEU n 
1 15  ARG n 
1 16  GLY n 
1 17  GLU n 
1 18  MET n 
1 19  PHE n 
1 20  VAL n 
1 21  PHE n 
1 22  LYS n 
1 23  GLU n 
1 24  ARG n 
1 25  TRP n 
1 26  PHE n 
1 27  TRP n 
1 28  ARG n 
1 29  VAL n 
1 30  ARG n 
1 31  ASN n 
1 32  ASN n 
1 33  GLN n 
1 34  VAL n 
1 35  MET n 
1 36  ASP n 
1 37  GLY n 
1 38  TYR n 
1 39  PRO n 
1 40  MET n 
1 41  PRO n 
1 42  ILE n 
1 43  GLY n 
1 44  GLN n 
1 45  PHE n 
1 46  TRP n 
1 47  ARG n 
1 48  GLY n 
1 49  LEU n 
1 50  PRO n 
1 51  ALA n 
1 52  SER n 
1 53  ILE n 
1 54  ASN n 
1 55  THR n 
1 56  ALA n 
1 57  TYR n 
1 58  GLU n 
1 59  ARG n 
1 60  LYS n 
1 61  ASP n 
1 62  GLY n 
1 63  LYS n 
1 64  PHE n 
1 65  VAL n 
1 66  PHE n 
1 67  PHE n 
1 68  LYS n 
1 69  GLY n 
1 70  ASP n 
1 71  LYS n 
1 72  HIS n 
1 73  TRP n 
1 74  VAL n 
1 75  PHE n 
1 76  ASP n 
1 77  GLU n 
1 78  ALA n 
1 79  SER n 
1 80  LEU n 
1 81  GLU n 
1 82  PRO n 
1 83  GLY n 
1 84  TYR n 
1 85  PRO n 
1 86  LYS n 
1 87  HIS n 
1 88  ILE n 
1 89  LYS n 
1 90  GLU n 
1 91  LEU n 
1 92  GLY n 
1 93  ARG n 
1 94  GLY n 
1 95  LEU n 
1 96  PRO n 
1 97  THR n 
1 98  ASP n 
1 99  LYS n 
1 100 ILE n 
1 101 ASP n 
1 102 ALA n 
1 103 ALA n 
1 104 LEU n 
1 105 PHE n 
1 106 TRP n 
1 107 MET n 
1 108 PRO n 
1 109 ASN n 
1 110 GLY n 
1 111 LYS n 
1 112 THR n 
1 113 TYR n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASN n 
1 119 LYS n 
1 120 TYR n 
1 121 TYR n 
1 122 ARG n 
1 123 PHE n 
1 124 ASN n 
1 125 GLU n 
1 126 GLU n 
1 127 LEU n 
1 128 ARG n 
1 129 ALA n 
1 130 VAL n 
1 131 ASP n 
1 132 SER n 
1 133 GLU n 
1 134 TYR n 
1 135 PRO n 
1 136 LYS n 
1 137 ASN n 
1 138 ILE n 
1 139 LYS n 
1 140 VAL n 
1 141 TRP n 
1 142 GLU n 
1 143 GLY n 
1 144 ILE n 
1 145 PRO n 
1 146 GLU n 
1 147 SER n 
1 148 PRO n 
1 149 ARG n 
1 150 GLY n 
1 151 SER n 
1 152 PHE n 
1 153 MET n 
1 154 GLY n 
1 155 SER n 
1 156 ASP n 
1 157 GLU n 
1 158 VAL n 
1 159 PHE n 
1 160 THR n 
1 161 TYR n 
1 162 PHE n 
1 163 TYR n 
1 164 LYS n 
1 165 GLY n 
1 166 ASN n 
1 167 LYS n 
1 168 TYR n 
1 169 TRP n 
1 170 LYS n 
1 171 PHE n 
1 172 ASN n 
1 173 ASN n 
1 174 GLN n 
1 175 LYS n 
1 176 LEU n 
1 177 LYS n 
1 178 VAL n 
1 179 GLU n 
1 180 PRO n 
1 181 GLY n 
1 182 TYR n 
1 183 PRO n 
1 184 LYS n 
1 185 SER n 
1 186 ALA n 
1 187 LEU n 
1 188 ARG n 
1 189 ASP n 
1 190 TRP n 
1 191 MET n 
1 192 GLY n 
1 193 CYS n 
1 194 PRO n 
1 195 SER n 
1 196 GLY n 
2 1   SER n 
2 2   THR n 
2 3   PHE n 
2 4   SER n 
2 5   LYS n 
2 6   LEU n 
2 7   ARG n 
2 8   GLU n 
2 9   GLN n 
2 10  LEU n 
2 11  GLY n 
2 12  PRO n 
2 13  VAL n 
2 14  THR n 
2 15  GLN n 
2 16  GLU n 
2 17  PHE n 
2 18  TRP n 
2 19  ASP n 
2 20  ASN n 
2 21  LEU n 
2 22  GLU n 
2 23  LYS n 
2 24  GLU n 
2 25  THR n 
2 26  GLU n 
2 27  GLY n 
2 28  LEU n 
2 29  ARG n 
2 30  GLN n 
2 31  GLU n 
2 32  MET n 
2 33  SER n 
2 34  LYS n 
2 35  ASP n 
2 36  LEU n 
2 37  GLU n 
2 38  GLU n 
2 39  VAL n 
2 40  LYS n 
2 41  ALA n 
2 42  LYS n 
2 43  VAL n 
2 44  GLN n 
2 45  PRO n 
2 46  TYR n 
2 47  LEU n 
2 48  ASP n 
2 49  ASP n 
2 50  PHE n 
2 51  GLN n 
2 52  LYS n 
2 53  LYS n 
2 54  TRP n 
2 55  GLN n 
2 56  GLU n 
2 57  GLU n 
2 58  MET n 
2 59  GLU n 
2 60  LEU n 
2 61  TYR n 
2 62  ARG n 
2 63  GLN n 
2 64  LYS n 
2 65  VAL n 
2 66  GLU n 
2 67  PRO n 
2 68  TYR n 
2 69  LEU n 
2 70  ASP n 
2 71  ASP n 
2 72  PHE n 
2 73  GLN n 
2 74  LYS n 
2 75  LYS n 
2 76  TRP n 
2 77  GLN n 
2 78  GLU n 
2 79  GLU n 
2 80  MET n 
2 81  GLU n 
2 82  LEU n 
2 83  TYR n 
2 84  ARG n 
2 85  GLN n 
2 86  LYS n 
2 87  VAL n 
2 88  GLU n 
2 89  PRO n 
2 90  LEU n 
2 91  ARG n 
2 92  ALA n 
2 93  GLU n 
2 94  LEU n 
2 95  GLN n 
2 96  GLU n 
2 97  GLY n 
2 98  ALA n 
2 99  ARG n 
2 100 GLN n 
2 101 LYS n 
2 102 LEU n 
2 103 HIS n 
2 104 GLU n 
2 105 LEU n 
2 106 GLN n 
2 107 GLU n 
2 108 LYS n 
2 109 LEU n 
2 110 SER n 
2 111 PRO n 
2 112 LEU n 
2 113 GLY n 
2 114 GLU n 
2 115 GLU n 
2 116 MET n 
2 117 ARG n 
2 118 ASP n 
2 119 ARG n 
2 120 ALA n 
2 121 ARG n 
2 122 ALA n 
2 123 HIS n 
2 124 VAL n 
2 125 ASP n 
2 126 ALA n 
2 127 LEU n 
2 128 ARG n 
2 129 THR n 
2 130 HIS n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 TYR n 
2 135 SER n 
2 136 ASP n 
2 137 GLU n 
2 138 LEU n 
2 139 ARG n 
2 140 GLN n 
2 141 ARG n 
2 142 LEU n 
2 143 ALA n 
2 144 ALA n 
2 145 ARG n 
2 146 LEU n 
2 147 GLU n 
2 148 ALA n 
2 149 LEU n 
2 150 LYS n 
2 151 GLU n 
2 152 ASN n 
2 153 GLY n 
2 154 GLY n 
2 155 ALA n 
2 156 ARG n 
2 157 LEU n 
2 158 ALA n 
2 159 GLU n 
2 160 TYR n 
2 161 HIS n 
2 162 ALA n 
2 163 LYS n 
2 164 ALA n 
2 165 THR n 
2 166 GLU n 
2 167 HIS n 
2 168 LEU n 
2 169 SER n 
2 170 THR n 
2 171 LEU n 
2 172 SER n 
2 173 GLU n 
2 174 LYS n 
2 175 ALA n 
2 176 LYS n 
2 177 PRO n 
2 178 ALA n 
2 179 LEU n 
2 180 GLU n 
2 181 ASP n 
2 182 LEU n 
2 183 ARG n 
2 184 GLN n 
2 185 GLY n 
2 186 LEU n 
2 187 LEU n 
2 188 PRO n 
2 189 VAL n 
2 190 LEU n 
2 191 GLU n 
2 192 SER n 
2 193 PHE n 
2 194 LYS n 
2 195 VAL n 
2 196 SER n 
2 197 PHE n 
2 198 LEU n 
2 199 SER n 
2 200 ALA n 
2 201 LEU n 
2 202 GLU n 
2 203 GLU n 
2 204 TYR n 
2 205 THR n 
2 206 LYS n 
2 207 LYS n 
2 208 LEU n 
2 209 ASN n 
2 210 THR n 
2 211 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 196 Human ? MMP14 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 211 Human ? APOA1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MMP14_HUMAN P50281 ? 1 
;PNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASL
EPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT
YFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSG
;
316 
2 UNP APOA1_HUMAN P02647 ? 2 
;STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKL
HELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDL
RQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
79  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6CLZ A 1 ? 196 ? P50281 316 ? 511 ? 316 511 
2 2 6CLZ B 1 ? 211 ? P02647 79  ? 267 ? 55  265 
3 2 6CLZ C 1 ? 211 ? P02647 79  ? 267 ? 55  265 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6CLZ PRO B 45 ? UNP P02647 ? ? insertion 99  1  
2 6CLZ TYR B 46 ? UNP P02647 ? ? insertion 100 2  
2 6CLZ LEU B 47 ? UNP P02647 ? ? insertion 101 3  
2 6CLZ ASP B 48 ? UNP P02647 ? ? insertion 102 4  
2 6CLZ ASP B 49 ? UNP P02647 ? ? insertion 103 5  
2 6CLZ PHE B 50 ? UNP P02647 ? ? insertion 104 6  
2 6CLZ GLN B 51 ? UNP P02647 ? ? insertion 105 7  
2 6CLZ LYS B 52 ? UNP P02647 ? ? insertion 106 8  
2 6CLZ LYS B 53 ? UNP P02647 ? ? insertion 107 9  
2 6CLZ TRP B 54 ? UNP P02647 ? ? insertion 108 10 
2 6CLZ GLN B 55 ? UNP P02647 ? ? insertion 109 11 
2 6CLZ GLU B 56 ? UNP P02647 ? ? insertion 110 12 
2 6CLZ GLU B 57 ? UNP P02647 ? ? insertion 111 13 
2 6CLZ MET B 58 ? UNP P02647 ? ? insertion 112 14 
2 6CLZ GLU B 59 ? UNP P02647 ? ? insertion 113 15 
2 6CLZ LEU B 60 ? UNP P02647 ? ? insertion 114 16 
2 6CLZ TYR B 61 ? UNP P02647 ? ? insertion 115 17 
2 6CLZ ARG B 62 ? UNP P02647 ? ? insertion 116 18 
2 6CLZ GLN B 63 ? UNP P02647 ? ? insertion 117 19 
2 6CLZ LYS B 64 ? UNP P02647 ? ? insertion 118 20 
2 6CLZ VAL B 65 ? UNP P02647 ? ? insertion 119 21 
2 6CLZ GLU B 66 ? UNP P02647 ? ? insertion 120 22 
3 6CLZ PRO C 45 ? UNP P02647 ? ? insertion 99  23 
3 6CLZ TYR C 46 ? UNP P02647 ? ? insertion 100 24 
3 6CLZ LEU C 47 ? UNP P02647 ? ? insertion 101 25 
3 6CLZ ASP C 48 ? UNP P02647 ? ? insertion 102 26 
3 6CLZ ASP C 49 ? UNP P02647 ? ? insertion 103 27 
3 6CLZ PHE C 50 ? UNP P02647 ? ? insertion 104 28 
3 6CLZ GLN C 51 ? UNP P02647 ? ? insertion 105 29 
3 6CLZ LYS C 52 ? UNP P02647 ? ? insertion 106 30 
3 6CLZ LYS C 53 ? UNP P02647 ? ? insertion 107 31 
3 6CLZ TRP C 54 ? UNP P02647 ? ? insertion 108 32 
3 6CLZ GLN C 55 ? UNP P02647 ? ? insertion 109 33 
3 6CLZ GLU C 56 ? UNP P02647 ? ? insertion 110 34 
3 6CLZ GLU C 57 ? UNP P02647 ? ? insertion 111 35 
3 6CLZ MET C 58 ? UNP P02647 ? ? insertion 112 36 
3 6CLZ GLU C 59 ? UNP P02647 ? ? insertion 113 37 
3 6CLZ LEU C 60 ? UNP P02647 ? ? insertion 114 38 
3 6CLZ TYR C 61 ? UNP P02647 ? ? insertion 115 39 
3 6CLZ ARG C 62 ? UNP P02647 ? ? insertion 116 40 
3 6CLZ GLN C 63 ? UNP P02647 ? ? insertion 117 41 
3 6CLZ LYS C 64 ? UNP P02647 ? ? insertion 118 42 
3 6CLZ VAL C 65 ? UNP P02647 ? ? insertion 119 43 
3 6CLZ GLU C 66 ? UNP P02647 ? ? insertion 120 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                    ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ? 'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION'                              ? 'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE                                    ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                   ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                     ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ? 'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                  ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                     ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                      ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                  ? 'C5 H11 N O2 S'    149.211 
NA  non-polymer         . 'SODIUM ION'                                ? 'Na 1'             22.990  
PHE 'L-peptide linking' y PHENYLALANINE                               ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                     ? 'C5 H9 N O2'       115.130 
PX4 non-polymer         . 1,2-DIMYRISTOYL-SN-GLYCERO-3-PHOSPHOCHOLINE ? 'C36 H73 N O8 P 1' 678.940 
SER 'L-peptide linking' y SERINE                                      ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                   ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                    ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                      ? 'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 HMQC      1 isotropic 
2 1 1 TROSY     1 isotropic 
3 1 1 CPMG-HMQC 1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            303 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         300 
_pdbx_nmr_exptl_sample_conditions.details                
;MT1-MMP hemopxin-like domain was along with MSP1D1 and PX4 lipids were in a buffer containing 300 mM NaCl, 0.02% sodium azide, 93% water, 7% D2O, 20 mM Tris-HCl pH 7.2
;
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  'NMR Buffer' 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;20 mM Tris-HCl, 300 mM NaCl, 0.02 % sodium azide, 93 % H2O, 7 % [U-100% 2H] D2O, 90 uM 2H, 13C, 15N MT1-MMP hemopexin-like domain, 180 uM MSP1D1, 14.4 mM PX4, 93% H2O/7% D2O
;
_pdbx_nmr_sample_details.solvent_system   '93% H2O/7% D2O' 
_pdbx_nmr_sample_details.label            '2H, 13C, 15N' 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
;300 mM NaCl was used to reduce affinity of HPX to the nanodisc and recover sample. Shaped NMR tubes were used to obtain better spectra.
;
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE III' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.details            'restrained molecular dynamics' 
_pdbx_nmr_refine.entry_id           6CLZ 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.software_ordinal   5 
# 
_pdbx_nmr_ensemble.entry_id                             6CLZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number   500 
_pdbx_nmr_ensemble.conformers_submitted_total_number    15 
_pdbx_nmr_ensemble.conformer_selection_criteria         'structures with the lowest energy' 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             6CLZ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 processing              TopSpin  3.2                                Bruker 
2 'data analysis'         Analysis 2.4                                CCPN 
3 'structure calculation' HADDOCK  HADDOCK2.1                         Bonvin 
4 'structure calculation' NAMD     'NAMD2.1 with CUDA GPU processing' 
;Theoretical and Computational Biophysics Group in the Beckman Institute for Advanced Science and Technology at the University of Illinois at Urbana-Champaign
;
5 refinement              NAMD     'NAMD2.1 with CUDA GPU processing' 
;Theoretical and Computational Biophysics Group in the Beckman Institute for Advanced Science and Technology at the University of Illinois at Urbana-Champaign
;
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CLZ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6CLZ 
_struct.title                        'MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs' 
_struct.pdbx_descriptor              'Matrix metalloproteinase-14 (E.C.3.4.24.80), Apolipoprotein A-I' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CLZ 
_struct_keywords.text            
'MT1-MMP, MMP-14, Nanodisc, lipids, peripheral membrane protein, protease domain, LIPID BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 3 ? 
WA N N 3 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 4 ? 
AB N N 5 ? 
BB N N 3 ? 
CB N N 3 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 3 ? 
GB N N 3 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 3 ? 
KB N N 3 ? 
LB N N 3 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 3 ? 
VB N N 3 ? 
WB N N 3 ? 
XB N N 3 ? 
YB N N 3 ? 
ZB N N 3 ? 
AC N N 3 ? 
BC N N 3 ? 
CC N N 3 ? 
DC N N 3 ? 
EC N N 3 ? 
FC N N 3 ? 
GC N N 3 ? 
HC N N 3 ? 
IC N N 3 ? 
JC N N 3 ? 
KC N N 3 ? 
LC N N 3 ? 
MC N N 3 ? 
NC N N 3 ? 
OC N N 3 ? 
PC N N 3 ? 
QC N N 3 ? 
RC N N 3 ? 
SC N N 3 ? 
TC N N 3 ? 
UC N N 3 ? 
VC N N 3 ? 
WC N N 3 ? 
XC N N 3 ? 
YC N N 3 ? 
ZC N N 3 ? 
AD N N 3 ? 
BD N N 3 ? 
CD N N 3 ? 
DD N N 3 ? 
ED N N 3 ? 
FD N N 3 ? 
GD N N 3 ? 
HD N N 3 ? 
ID N N 3 ? 
JD N N 3 ? 
KD N N 3 ? 
LD N N 3 ? 
MD N N 3 ? 
ND N N 3 ? 
OD N N 3 ? 
PD N N 3 ? 
QD N N 3 ? 
RD N N 3 ? 
SD N N 3 ? 
TD N N 3 ? 
UD N N 3 ? 
VD N N 3 ? 
WD N N 3 ? 
XD N N 3 ? 
YD N N 3 ? 
ZD N N 3 ? 
AE N N 3 ? 
BE N N 3 ? 
CE N N 3 ? 
DE N N 3 ? 
EE N N 3 ? 
FE N N 3 ? 
GE N N 3 ? 
HE N N 3 ? 
IE N N 3 ? 
JE N N 3 ? 
KE N N 3 ? 
LE N N 3 ? 
ME N N 3 ? 
NE N N 3 ? 
OE N N 3 ? 
PE N N 3 ? 
QE N N 3 ? 
RE N N 3 ? 
SE N N 3 ? 
TE N N 3 ? 
UE N N 3 ? 
VE N N 3 ? 
WE N N 3 ? 
XE N N 3 ? 
YE N N 3 ? 
ZE N N 3 ? 
AF N N 3 ? 
BF N N 3 ? 
CF N N 3 ? 
DF N N 3 ? 
EF N N 3 ? 
FF N N 3 ? 
GF N N 3 ? 
HF N N 3 ? 
IF N N 3 ? 
JF N N 3 ? 
KF N N 3 ? 
LF N N 3 ? 
MF N N 3 ? 
NF N N 3 ? 
OF N N 3 ? 
PF N N 3 ? 
QF N N 3 ? 
RF N N 3 ? 
SF N N 3 ? 
TF N N 3 ? 
UF N N 3 ? 
VF N N 3 ? 
WF N N 3 ? 
XF N N 3 ? 
YF N N 3 ? 
ZF N N 3 ? 
AG N N 3 ? 
BG N N 3 ? 
CG N N 3 ? 
DG N N 3 ? 
EG N N 3 ? 
FG N N 3 ? 
GG N N 3 ? 
HG N N 3 ? 
IG N N 3 ? 
JG N N 3 ? 
KG N N 3 ? 
LG N N 3 ? 
MG N N 3 ? 
NG N N 3 ? 
OG N N 3 ? 
PG N N 3 ? 
QG N N 3 ? 
RG N N 3 ? 
SG N N 3 ? 
TG N N 3 ? 
UG N N 3 ? 
VG N N 3 ? 
WG N N 3 ? 
XG N N 3 ? 
YG N N 3 ? 
ZG N N 3 ? 
AH N N 3 ? 
BH N N 3 ? 
CH N N 3 ? 
DH N N 3 ? 
EH N N 3 ? 
FH N N 3 ? 
GH N N 3 ? 
HH N N 3 ? 
IH N N 3 ? 
JH N N 3 ? 
KH N N 3 ? 
LH N N 3 ? 
MH N N 3 ? 
NH N N 3 ? 
OH N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 2   ? GLY A 6   ? ASN A 317 GLY A 321 5 ? 5   
HELX_P HELX_P2  AA2 ILE A 42  ? TRP A 46  ? ILE A 357 TRP A 361 1 ? 5   
HELX_P HELX_P3  AA3 ILE A 88  ? GLY A 92  ? ILE A 403 GLY A 407 1 ? 5   
HELX_P HELX_P4  AA4 LYS A 139 ? TRP A 141 ? LYS A 454 TRP A 456 5 ? 3   
HELX_P HELX_P5  AA5 ALA A 186 ? TRP A 190 ? ALA A 501 TRP A 505 1 ? 5   
HELX_P HELX_P6  AA6 THR B 2   ? ARG B 91  ? THR B 56  ARG B 145 1 ? 90  
HELX_P HELX_P7  AA7 ARG B 91  ? ASN B 209 ? ARG B 145 ASN B 263 1 ? 119 
HELX_P HELX_P8  AA8 THR C 2   ? PHE C 50  ? THR C 56  PHE C 104 1 ? 49  
HELX_P HELX_P9  AA9 GLN C 51  ? LEU C 131 ? GLN C 105 LEU C 185 1 ? 81  
HELX_P HELX_P10 AB1 LEU C 131 ? ASN C 152 ? LEU C 185 ASN C 206 1 ? 22  
HELX_P HELX_P11 AB2 ASN C 152 ? LYS C 176 ? ASN C 206 LYS C 230 1 ? 25  
HELX_P HELX_P12 AB3 ALA C 178 ? ASN C 209 ? ALA C 232 ASN C 263 1 ? 32  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ASN 54  O ? ? ? 1_555 ZA NA . NA ? ? A ASN 369 A NA 649 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc2 metalc ? ? A ASP 101 O ? ? ? 1_555 ZA NA . NA ? ? A ASP 416 A NA 649 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc3 metalc ? ? A PRO 148 O ? ? ? 1_555 ZA NA . NA ? ? A PRO 463 A NA 649 1_555 ? ? ? ? ? ? ? 2.244 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 1  -4.28  
2  TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 1  3.74   
3  TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 1  -26.86 
4  TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 1  7.58   
5  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 2  15.49  
6  TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 2  -1.35  
7  TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 2  -3.03  
8  TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 2  18.75  
9  TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 3  -2.16  
10 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 3  -5.90  
11 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 3  -18.75 
12 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 3  17.89  
13 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 4  -13.27 
14 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 4  -6.88  
15 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 4  0.57   
16 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 4  -15.28 
17 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 5  -12.64 
18 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 5  9.46   
19 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 5  -10.87 
20 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 5  -6.92  
21 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 6  7.65   
22 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 6  6.30   
23 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 6  -7.72  
24 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 6  19.58  
25 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 7  -6.28  
26 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 7  -21.66 
27 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 7  -0.98  
28 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 8  -3.13  
29 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 8  -8.63  
30 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 8  -7.50  
31 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 8  -9.38  
32 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 9  -19.56 
33 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 9  4.75   
34 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 9  4.33   
35 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 9  -14.43 
36 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 10 -18.42 
37 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 10 -6.34  
38 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 10 -10.32 
39 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 10 8.46   
40 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 11 -7.66  
41 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 11 -15.54 
42 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 11 -5.02  
43 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 11 10.09  
44 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 12 -10.34 
45 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 12 6.65   
46 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 12 -4.32  
47 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 12 20.25  
48 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 13 -19.99 
49 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 13 -5.86  
50 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 13 -10.56 
51 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 13 6.74   
52 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 14 5.10   
53 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 14 -11.79 
54 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 14 -9.80  
55 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 14 19.25  
56 TYR 38  A . ? TYR 353 A PRO 39  A ? PRO 354 A 15 14.72  
57 TYR 84  A . ? TYR 399 A PRO 85  A ? PRO 400 A 15 -14.87 
58 TYR 134 A . ? TYR 449 A PRO 135 A ? PRO 450 A 15 -23.53 
59 TYR 182 A . ? TYR 497 A PRO 183 A ? PRO 498 A 15 8.86   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 10  ? LEU A 14  ? THR A 325 LEU A 329 
AA1 2 GLU A 17  ? LYS A 22  ? GLU A 332 LYS A 337 
AA1 3 TRP A 25  ? ARG A 30  ? TRP A 340 ARG A 345 
AA1 4 GLN A 33  ? VAL A 34  ? GLN A 348 VAL A 349 
AA2 1 THR A 10  ? LEU A 14  ? THR A 325 LEU A 329 
AA2 2 GLU A 17  ? LYS A 22  ? GLU A 332 LYS A 337 
AA2 3 TRP A 25  ? ARG A 30  ? TRP A 340 ARG A 345 
AA2 4 MET A 40  ? PRO A 41  ? MET A 355 PRO A 356 
AA3 1 THR A 55  ? GLU A 58  ? THR A 370 GLU A 373 
AA3 2 PHE A 64  ? LYS A 68  ? PHE A 379 LYS A 383 
AA3 3 LYS A 71  ? ASP A 76  ? LYS A 386 ASP A 391 
AA3 4 SER A 79  ? LEU A 80  ? SER A 394 LEU A 395 
AA4 1 THR A 55  ? GLU A 58  ? THR A 370 GLU A 373 
AA4 2 PHE A 64  ? LYS A 68  ? PHE A 379 LYS A 383 
AA4 3 LYS A 71  ? ASP A 76  ? LYS A 386 ASP A 391 
AA4 4 LYS A 86  ? HIS A 87  ? LYS A 401 HIS A 402 
AA5 1 ALA A 102 ? TRP A 106 ? ALA A 417 TRP A 421 
AA5 2 LYS A 111 ? ARG A 116 ? LYS A 426 ARG A 431 
AA5 3 LYS A 119 ? ASN A 124 ? LYS A 434 ASN A 439 
AA5 4 ALA A 129 ? VAL A 130 ? ALA A 444 VAL A 445 
AA6 1 ALA A 102 ? TRP A 106 ? ALA A 417 TRP A 421 
AA6 2 LYS A 111 ? ARG A 116 ? LYS A 426 ARG A 431 
AA6 3 LYS A 119 ? ASN A 124 ? LYS A 434 ASN A 439 
AA6 4 LYS A 136 ? ASN A 137 ? LYS A 451 ASN A 452 
AA7 1 GLY A 150 ? MET A 153 ? GLY A 465 MET A 468 
AA7 2 PHE A 159 ? LYS A 164 ? PHE A 474 LYS A 479 
AA7 3 LYS A 167 ? ASN A 172 ? LYS A 482 ASN A 487 
AA7 4 LYS A 177 ? VAL A 178 ? LYS A 492 VAL A 493 
AA8 1 GLY A 150 ? MET A 153 ? GLY A 465 MET A 468 
AA8 2 PHE A 159 ? LYS A 164 ? PHE A 474 LYS A 479 
AA8 3 LYS A 167 ? ASN A 172 ? LYS A 482 ASN A 487 
AA8 4 LYS A 184 ? SER A 185 ? LYS A 499 SER A 500 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 12  ? N ALA A 327 O PHE A 19  ? O PHE A 334 
AA1 2 3 N LYS A 22  ? N LYS A 337 O TRP A 25  ? O TRP A 340 
AA1 3 4 N ARG A 30  ? N ARG A 345 O GLN A 33  ? O GLN A 348 
AA2 1 2 N ALA A 12  ? N ALA A 327 O PHE A 19  ? O PHE A 334 
AA2 2 3 N LYS A 22  ? N LYS A 337 O TRP A 25  ? O TRP A 340 
AA2 3 4 N PHE A 26  ? N PHE A 341 O MET A 40  ? O MET A 355 
AA3 1 2 N TYR A 57  ? N TYR A 372 O VAL A 65  ? O VAL A 380 
AA3 2 3 N PHE A 66  ? N PHE A 381 O TRP A 73  ? O TRP A 388 
AA3 3 4 N ASP A 76  ? N ASP A 391 O SER A 79  ? O SER A 394 
AA4 1 2 N TYR A 57  ? N TYR A 372 O VAL A 65  ? O VAL A 380 
AA4 2 3 N PHE A 66  ? N PHE A 381 O TRP A 73  ? O TRP A 388 
AA4 3 4 N HIS A 72  ? N HIS A 387 O LYS A 86  ? O LYS A 401 
AA5 1 2 N LEU A 104 ? N LEU A 419 O TYR A 113 ? O TYR A 428 
AA5 2 3 N PHE A 114 ? N PHE A 429 O TYR A 121 ? O TYR A 436 
AA5 3 4 N ASN A 124 ? N ASN A 439 O ALA A 129 ? O ALA A 444 
AA6 1 2 N LEU A 104 ? N LEU A 419 O TYR A 113 ? O TYR A 428 
AA6 2 3 N PHE A 114 ? N PHE A 429 O TYR A 121 ? O TYR A 436 
AA6 3 4 N TYR A 120 ? N TYR A 435 O LYS A 136 ? O LYS A 451 
AA7 1 2 N PHE A 152 ? N PHE A 467 O TYR A 161 ? O TYR A 476 
AA7 2 3 N PHE A 162 ? N PHE A 477 O TRP A 169 ? O TRP A 484 
AA7 3 4 N ASN A 172 ? N ASN A 487 O LYS A 177 ? O LYS A 492 
AA8 1 2 N PHE A 152 ? N PHE A 467 O TYR A 161 ? O TYR A 476 
AA8 2 3 N PHE A 162 ? N PHE A 477 O TRP A 169 ? O TRP A 484 
AA8 3 4 N TYR A 168 ? N TYR A 483 O LYS A 184 ? O LYS A 499 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PX4 601 ? 5  'binding site for residue PX4 A 601' 
AC2 Software A PX4 602 ? 8  'binding site for residue PX4 A 602' 
AC3 Software A PX4 603 ? 6  'binding site for residue PX4 A 603' 
AC4 Software A PX4 604 ? 6  'binding site for residue PX4 A 604' 
AC5 Software A PX4 605 ? 5  'binding site for residue PX4 A 605' 
AC6 Software A PX4 606 ? 3  'binding site for residue PX4 A 606' 
AC7 Software A PX4 607 ? 6  'binding site for residue PX4 A 607' 
AC8 Software A PX4 608 ? 5  'binding site for residue PX4 A 608' 
AC9 Software A PX4 609 ? 2  'binding site for residue PX4 A 609' 
AD1 Software A PX4 610 ? 5  'binding site for residue PX4 A 610' 
AD2 Software A PX4 611 ? 5  'binding site for residue PX4 A 611' 
AD3 Software A PX4 612 ? 3  'binding site for residue PX4 A 612' 
AD4 Software A PX4 613 ? 6  'binding site for residue PX4 A 613' 
AD5 Software A PX4 614 ? 3  'binding site for residue PX4 A 614' 
AD6 Software A PX4 615 ? 5  'binding site for residue PX4 A 615' 
AD7 Software A PX4 616 ? 4  'binding site for residue PX4 A 616' 
AD8 Software A PX4 617 ? 7  'binding site for residue PX4 A 617' 
AD9 Software A PX4 618 ? 6  'binding site for residue PX4 A 618' 
AE1 Software A PX4 619 ? 3  'binding site for residue PX4 A 619' 
AE2 Software A PX4 620 ? 7  'binding site for residue PX4 A 620' 
AE3 Software A PX4 621 ? 5  'binding site for residue PX4 A 621' 
AE4 Software A PX4 622 ? 4  'binding site for residue PX4 A 622' 
AE5 Software A PX4 623 ? 4  'binding site for residue PX4 A 623' 
AE6 Software A PX4 624 ? 5  'binding site for residue PX4 A 624' 
AE7 Software A PX4 625 ? 4  'binding site for residue PX4 A 625' 
AE8 Software A PX4 626 ? 6  'binding site for residue PX4 A 626' 
AE9 Software A PX4 627 ? 3  'binding site for residue PX4 A 627' 
AF1 Software A PX4 628 ? 4  'binding site for residue PX4 A 628' 
AF2 Software A PX4 629 ? 8  'binding site for residue PX4 A 629' 
AF3 Software A PX4 630 ? 6  'binding site for residue PX4 A 630' 
AF4 Software A PX4 631 ? 5  'binding site for residue PX4 A 631' 
AF5 Software A PX4 632 ? 5  'binding site for residue PX4 A 632' 
AF6 Software A PX4 633 ? 7  'binding site for residue PX4 A 633' 
AF7 Software A PX4 634 ? 4  'binding site for residue PX4 A 634' 
AF8 Software A PX4 635 ? 6  'binding site for residue PX4 A 635' 
AF9 Software A PX4 636 ? 5  'binding site for residue PX4 A 636' 
AG1 Software A PX4 637 ? 4  'binding site for residue PX4 A 637' 
AG2 Software A PX4 638 ? 3  'binding site for residue PX4 A 638' 
AG3 Software A PX4 639 ? 5  'binding site for residue PX4 A 639' 
AG4 Software A PX4 640 ? 5  'binding site for residue PX4 A 640' 
AG5 Software A PX4 641 ? 4  'binding site for residue PX4 A 641' 
AG6 Software A PX4 642 ? 5  'binding site for residue PX4 A 642' 
AG7 Software A PX4 643 ? 11 'binding site for residue PX4 A 643' 
AG8 Software A PX4 644 ? 7  'binding site for residue PX4 A 644' 
AG9 Software A PX4 645 ? 8  'binding site for residue PX4 A 645' 
AH1 Software A PX4 646 ? 7  'binding site for residue PX4 A 646' 
AH2 Software A PX4 647 ? 5  'binding site for residue PX4 A 647' 
AH3 Software A PX4 648 ? 10 'binding site for residue PX4 A 648' 
AH4 Software A NA  649 ? 4  'binding site for residue NA A 649'  
AH5 Software A CL  650 ? 7  'binding site for residue CL A 650'  
AH6 Software B PX4 301 ? 5  'binding site for residue PX4 B 301' 
AH7 Software B PX4 302 ? 4  'binding site for residue PX4 B 302' 
AH8 Software B PX4 303 ? 5  'binding site for residue PX4 B 303' 
AH9 Software B PX4 304 ? 10 'binding site for residue PX4 B 304' 
AI1 Software B PX4 305 ? 9  'binding site for residue PX4 B 305' 
AI2 Software B PX4 306 ? 5  'binding site for residue PX4 B 306' 
AI3 Software B PX4 307 ? 5  'binding site for residue PX4 B 307' 
AI4 Software B PX4 308 ? 3  'binding site for residue PX4 B 308' 
AI5 Software B PX4 309 ? 5  'binding site for residue PX4 B 309' 
AI6 Software B PX4 310 ? 2  'binding site for residue PX4 B 310' 
AI7 Software B PX4 311 ? 5  'binding site for residue PX4 B 311' 
AI8 Software B PX4 312 ? 9  'binding site for residue PX4 B 312' 
AI9 Software B PX4 313 ? 3  'binding site for residue PX4 B 313' 
AJ1 Software B PX4 314 ? 3  'binding site for residue PX4 B 314' 
AJ2 Software B PX4 315 ? 4  'binding site for residue PX4 B 315' 
AJ3 Software B PX4 316 ? 3  'binding site for residue PX4 B 316' 
AJ4 Software B PX4 317 ? 7  'binding site for residue PX4 B 317' 
AJ5 Software B PX4 318 ? 3  'binding site for residue PX4 B 318' 
AJ6 Software B PX4 319 ? 7  'binding site for residue PX4 B 319' 
AJ7 Software B PX4 320 ? 6  'binding site for residue PX4 B 320' 
AJ8 Software B PX4 321 ? 5  'binding site for residue PX4 B 321' 
AJ9 Software B PX4 322 ? 4  'binding site for residue PX4 B 322' 
AK1 Software B PX4 323 ? 7  'binding site for residue PX4 B 323' 
AK2 Software B PX4 324 ? 4  'binding site for residue PX4 B 324' 
AK3 Software B PX4 325 ? 4  'binding site for residue PX4 B 325' 
AK4 Software B PX4 326 ? 7  'binding site for residue PX4 B 326' 
AK5 Software B PX4 327 ? 4  'binding site for residue PX4 B 327' 
AK6 Software B PX4 328 ? 5  'binding site for residue PX4 B 328' 
AK7 Software B PX4 329 ? 10 'binding site for residue PX4 B 329' 
AK8 Software B PX4 330 ? 5  'binding site for residue PX4 B 330' 
AK9 Software B PX4 331 ? 5  'binding site for residue PX4 B 331' 
AL1 Software B PX4 332 ? 8  'binding site for residue PX4 B 332' 
AL2 Software B PX4 333 ? 4  'binding site for residue PX4 B 333' 
AL3 Software B PX4 334 ? 3  'binding site for residue PX4 B 334' 
AL4 Software B PX4 335 ? 6  'binding site for residue PX4 B 335' 
AL5 Software B PX4 336 ? 4  'binding site for residue PX4 B 336' 
AL6 Software B PX4 337 ? 3  'binding site for residue PX4 B 337' 
AL7 Software B PX4 338 ? 4  'binding site for residue PX4 B 338' 
AL8 Software B PX4 339 ? 5  'binding site for residue PX4 B 339' 
AL9 Software B PX4 340 ? 3  'binding site for residue PX4 B 340' 
AM1 Software B PX4 341 ? 5  'binding site for residue PX4 B 341' 
AM2 Software B PX4 342 ? 5  'binding site for residue PX4 B 342' 
AM3 Software B PX4 343 ? 4  'binding site for residue PX4 B 343' 
AM4 Software B PX4 344 ? 3  'binding site for residue PX4 B 344' 
AM5 Software B PX4 345 ? 4  'binding site for residue PX4 B 345' 
AM6 Software B PX4 346 ? 4  'binding site for residue PX4 B 346' 
AM7 Software B PX4 347 ? 4  'binding site for residue PX4 B 347' 
AM8 Software B PX4 348 ? 4  'binding site for residue PX4 B 348' 
AM9 Software B PX4 349 ? 4  'binding site for residue PX4 B 349' 
AN1 Software B PX4 350 ? 5  'binding site for residue PX4 B 350' 
AN2 Software B PX4 351 ? 5  'binding site for residue PX4 B 351' 
AN3 Software B PX4 352 ? 3  'binding site for residue PX4 B 352' 
AN4 Software B PX4 353 ? 3  'binding site for residue PX4 B 353' 
AN5 Software B PX4 354 ? 7  'binding site for residue PX4 B 354' 
AN6 Software B PX4 355 ? 5  'binding site for residue PX4 B 355' 
AN7 Software B PX4 356 ? 3  'binding site for residue PX4 B 356' 
AN8 Software B PX4 357 ? 4  'binding site for residue PX4 B 357' 
AN9 Software B PX4 358 ? 6  'binding site for residue PX4 B 358' 
AO1 Software B PX4 359 ? 5  'binding site for residue PX4 B 359' 
AO2 Software B PX4 360 ? 2  'binding site for residue PX4 B 360' 
AO3 Software B PX4 361 ? 4  'binding site for residue PX4 B 361' 
AO4 Software B PX4 362 ? 3  'binding site for residue PX4 B 362' 
AO5 Software B PX4 363 ? 3  'binding site for residue PX4 B 363' 
AO6 Software B PX4 364 ? 7  'binding site for residue PX4 B 364' 
AO7 Software B PX4 365 ? 6  'binding site for residue PX4 B 365' 
AO8 Software B PX4 366 ? 3  'binding site for residue PX4 B 366' 
AO9 Software B PX4 367 ? 6  'binding site for residue PX4 B 367' 
AP1 Software B PX4 368 ? 4  'binding site for residue PX4 B 368' 
AP2 Software B PX4 369 ? 5  'binding site for residue PX4 B 369' 
AP3 Software B PX4 370 ? 3  'binding site for residue PX4 B 370' 
AP4 Software B PX4 371 ? 4  'binding site for residue PX4 B 371' 
AP5 Software B PX4 372 ? 3  'binding site for residue PX4 B 372' 
AP6 Software B PX4 373 ? 4  'binding site for residue PX4 B 373' 
AP7 Software B PX4 374 ? 4  'binding site for residue PX4 B 374' 
AP8 Software B PX4 375 ? 4  'binding site for residue PX4 B 375' 
AP9 Software B PX4 376 ? 5  'binding site for residue PX4 B 376' 
AQ1 Software B PX4 377 ? 2  'binding site for residue PX4 B 377' 
AQ2 Software B PX4 378 ? 5  'binding site for residue PX4 B 378' 
AQ3 Software B PX4 379 ? 4  'binding site for residue PX4 B 379' 
AQ4 Software B PX4 380 ? 4  'binding site for residue PX4 B 380' 
AQ5 Software B PX4 381 ? 3  'binding site for residue PX4 B 381' 
AQ6 Software B PX4 382 ? 5  'binding site for residue PX4 B 382' 
AQ7 Software B PX4 383 ? 3  'binding site for residue PX4 B 383' 
AQ8 Software B PX4 384 ? 5  'binding site for residue PX4 B 384' 
AQ9 Software B PX4 385 ? 7  'binding site for residue PX4 B 385' 
AR1 Software B PX4 386 ? 4  'binding site for residue PX4 B 386' 
AR2 Software B PX4 387 ? 5  'binding site for residue PX4 B 387' 
AR3 Software B PX4 388 ? 5  'binding site for residue PX4 B 388' 
AR4 Software B PX4 389 ? 6  'binding site for residue PX4 B 389' 
AR5 Software B PX4 390 ? 4  'binding site for residue PX4 B 390' 
AR6 Software B PX4 391 ? 2  'binding site for residue PX4 B 391' 
AR7 Software B PX4 392 ? 3  'binding site for residue PX4 B 392' 
AR8 Software B PX4 393 ? 7  'binding site for residue PX4 B 393' 
AR9 Software B PX4 394 ? 5  'binding site for residue PX4 B 394' 
AS1 Software B PX4 395 ? 3  'binding site for residue PX4 B 395' 
AS2 Software B PX4 396 ? 5  'binding site for residue PX4 B 396' 
AS3 Software B PX4 397 ? 6  'binding site for residue PX4 B 397' 
AS4 Software B PX4 398 ? 4  'binding site for residue PX4 B 398' 
AS5 Software B PX4 399 ? 8  'binding site for residue PX4 B 399' 
AS6 Software B PX4 400 ? 4  'binding site for residue PX4 B 400' 
AS7 Software C PX4 301 ? 4  'binding site for residue PX4 C 301' 
AS8 Software C PX4 302 ? 5  'binding site for residue PX4 C 302' 
AS9 Software C PX4 303 ? 5  'binding site for residue PX4 C 303' 
AT1 Software C PX4 304 ? 4  'binding site for residue PX4 C 304' 
AT2 Software C PX4 305 ? 3  'binding site for residue PX4 C 305' 
AT3 Software C PX4 306 ? 5  'binding site for residue PX4 C 306' 
AT4 Software C PX4 307 ? 4  'binding site for residue PX4 C 307' 
AT5 Software C PX4 308 ? 6  'binding site for residue PX4 C 308' 
AT6 Software C PX4 309 ? 3  'binding site for residue PX4 C 309' 
AT7 Software C PX4 310 ? 5  'binding site for residue PX4 C 310' 
AT8 Software C PX4 311 ? 6  'binding site for residue PX4 C 311' 
AT9 Software C PX4 312 ? 3  'binding site for residue PX4 C 312' 
AU1 Software C PX4 313 ? 8  'binding site for residue PX4 C 313' 
AU2 Software C PX4 314 ? 6  'binding site for residue PX4 C 314' 
AU3 Software C PX4 315 ? 2  'binding site for residue PX4 C 315' 
AU4 Software C PX4 316 ? 2  'binding site for residue PX4 C 316' 
AU5 Software C PX4 317 ? 3  'binding site for residue PX4 C 317' 
AU6 Software C PX4 318 ? 2  'binding site for residue PX4 C 318' 
AU7 Software C PX4 319 ? 2  'binding site for residue PX4 C 319' 
AU8 Software C PX4 320 ? 7  'binding site for residue PX4 C 320' 
AU9 Software C PX4 321 ? 5  'binding site for residue PX4 C 321' 
AV1 Software C PX4 322 ? 4  'binding site for residue PX4 C 322' 
AV2 Software C PX4 323 ? 7  'binding site for residue PX4 C 323' 
AV3 Software C PX4 324 ? 6  'binding site for residue PX4 C 324' 
AV4 Software C PX4 325 ? 8  'binding site for residue PX4 C 325' 
AV5 Software C PX4 326 ? 7  'binding site for residue PX4 C 326' 
AV6 Software C PX4 327 ? 6  'binding site for residue PX4 C 327' 
AV7 Software C PX4 328 ? 7  'binding site for residue PX4 C 328' 
AV8 Software C PX4 329 ? 2  'binding site for residue PX4 C 329' 
AV9 Software C PX4 330 ? 8  'binding site for residue PX4 C 330' 
AW1 Software C PX4 331 ? 5  'binding site for residue PX4 C 331' 
AW2 Software C PX4 332 ? 6  'binding site for residue PX4 C 332' 
AW3 Software C PX4 333 ? 4  'binding site for residue PX4 C 333' 
AW4 Software C PX4 334 ? 3  'binding site for residue PX4 C 334' 
AW5 Software C PX4 335 ? 7  'binding site for residue PX4 C 335' 
AW6 Software C PX4 336 ? 7  'binding site for residue PX4 C 336' 
AW7 Software C PX4 337 ? 6  'binding site for residue PX4 C 337' 
AW8 Software C PX4 338 ? 4  'binding site for residue PX4 C 338' 
AW9 Software C PX4 339 ? 2  'binding site for residue PX4 C 339' 
AX1 Software C PX4 340 ? 7  'binding site for residue PX4 C 340' 
AX2 Software C PX4 341 ? 5  'binding site for residue PX4 C 341' 
AX3 Software C PX4 342 ? 5  'binding site for residue PX4 C 342' 
AX4 Software C PX4 343 ? 5  'binding site for residue PX4 C 343' 
AX5 Software C PX4 344 ? 4  'binding site for residue PX4 C 344' 
AX6 Software C PX4 345 ? 4  'binding site for residue PX4 C 345' 
AX7 Software C PX4 346 ? 4  'binding site for residue PX4 C 346' 
AX8 Software C PX4 347 ? 3  'binding site for residue PX4 C 347' 
AX9 Software C PX4 348 ? 8  'binding site for residue PX4 C 348' 
AY1 Software C PX4 349 ? 4  'binding site for residue PX4 C 349' 
AY2 Software C PX4 350 ? 3  'binding site for residue PX4 C 350' 
AY3 Software C PX4 351 ? 4  'binding site for residue PX4 C 351' 
AY4 Software C PX4 352 ? 6  'binding site for residue PX4 C 352' 
AY5 Software C PX4 353 ? 3  'binding site for residue PX4 C 353' 
AY6 Software C PX4 354 ? 4  'binding site for residue PX4 C 354' 
AY7 Software C PX4 355 ? 4  'binding site for residue PX4 C 355' 
AY8 Software C PX4 356 ? 3  'binding site for residue PX4 C 356' 
AY9 Software C PX4 357 ? 4  'binding site for residue PX4 C 357' 
AZ1 Software C PX4 358 ? 5  'binding site for residue PX4 C 358' 
AZ2 Software C PX4 359 ? 6  'binding site for residue PX4 C 359' 
AZ3 Software C PX4 360 ? 6  'binding site for residue PX4 C 360' 
AZ4 Software C PX4 361 ? 7  'binding site for residue PX4 C 361' 
AZ5 Software C PX4 362 ? 3  'binding site for residue PX4 C 362' 
AZ6 Software C PX4 363 ? 4  'binding site for residue PX4 C 363' 
AZ7 Software C PX4 364 ? 3  'binding site for residue PX4 C 364' 
AZ8 Software C PX4 365 ? 5  'binding site for residue PX4 C 365' 
AZ9 Software C PX4 366 ? 5  'binding site for residue PX4 C 366' 
BC1 Software C PX4 367 ? 5  'binding site for residue PX4 C 367' 
BC2 Software C PX4 368 ? 2  'binding site for residue PX4 C 368' 
BC3 Software C PX4 369 ? 3  'binding site for residue PX4 C 369' 
BC4 Software C PX4 370 ? 4  'binding site for residue PX4 C 370' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 5  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
2    AC1 5  PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
3    AC1 5  PX4 DE .   ? PX4 B 381 . ? 1_555 ? 
4    AC1 5  PX4 GE .   ? PX4 B 384 . ? 1_555 ? 
5    AC1 5  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
6    AC2 8  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
7    AC2 8  PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
8    AC2 8  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
9    AC2 8  PX4 FD .   ? PX4 B 357 . ? 1_555 ? 
10   AC2 8  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
11   AC2 8  PX4 ZD .   ? PX4 B 377 . ? 1_555 ? 
12   AC2 8  PX4 EE .   ? PX4 B 382 . ? 1_555 ? 
13   AC2 8  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
14   AC3 6  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
15   AC3 6  PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
16   AC3 6  PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
17   AC3 6  PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
18   AC3 6  PX4 ZD .   ? PX4 B 377 . ? 1_555 ? 
19   AC3 6  PX4 CE .   ? PX4 B 380 . ? 1_555 ? 
20   AC4 6  PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
21   AC4 6  PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
22   AC4 6  PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
23   AC4 6  PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
24   AC4 6  PX4 GE .   ? PX4 B 384 . ? 1_555 ? 
25   AC4 6  PX4 QE .   ? PX4 B 394 . ? 1_555 ? 
26   AC5 5  PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
27   AC5 5  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
28   AC5 5  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
29   AC5 5  PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
30   AC5 5  PX4 CE .   ? PX4 B 380 . ? 1_555 ? 
31   AC6 3  PX4 XD .   ? PX4 B 375 . ? 1_555 ? 
32   AC6 3  PX4 EE .   ? PX4 B 382 . ? 1_555 ? 
33   AC6 3  PX4 IE .   ? PX4 B 386 . ? 1_555 ? 
34   AC7 6  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
35   AC7 6  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
36   AC7 6  PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
37   AC7 6  PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
38   AC7 6  PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
39   AC7 6  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
40   AC8 5  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
41   AC8 5  PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
42   AC8 5  PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
43   AC8 5  PX4 QE .   ? PX4 B 394 . ? 1_555 ? 
44   AC8 5  PX4 RE .   ? PX4 B 395 . ? 1_555 ? 
45   AC9 2  PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
46   AC9 2  PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
47   AD1 5  PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
48   AD1 5  PX4 TE .   ? PX4 B 397 . ? 1_555 ? 
49   AD1 5  PX4 MG .   ? PX4 C 342 . ? 1_555 ? 
50   AD1 5  PX4 NG .   ? PX4 C 343 . ? 1_555 ? 
51   AD1 5  PX4 MH .   ? PX4 C 368 . ? 1_555 ? 
52   AD2 5  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
53   AD2 5  PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
54   AD2 5  PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
55   AD2 5  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
56   AD2 5  PX4 VG .   ? PX4 C 351 . ? 1_555 ? 
57   AD3 3  PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
58   AD3 3  PX4 VG .   ? PX4 C 351 . ? 1_555 ? 
59   AD3 3  PX4 CH .   ? PX4 C 358 . ? 1_555 ? 
60   AD4 6  PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
61   AD4 6  PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
62   AD4 6  PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
63   AD4 6  PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
64   AD4 6  PX4 QG .   ? PX4 C 346 . ? 1_555 ? 
65   AD4 6  PX4 GH .   ? PX4 C 362 . ? 1_555 ? 
66   AD5 3  PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
67   AD5 3  PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
68   AD5 3  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
69   AD6 5  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
70   AD6 5  PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
71   AD6 5  PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
72   AD6 5  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
73   AD6 5  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
74   AD7 4  PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
75   AD7 4  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
76   AD7 4  PX4 ZG .   ? PX4 C 355 . ? 1_555 ? 
77   AD7 4  PX4 LH .   ? PX4 C 367 . ? 1_555 ? 
78   AD8 7  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
79   AD8 7  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
80   AD8 7  PX4 TD .   ? PX4 B 371 . ? 1_555 ? 
81   AD8 7  PX4 CF .   ? PX4 C 306 . ? 1_555 ? 
82   AD8 7  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
83   AD8 7  PX4 XG .   ? PX4 C 353 . ? 1_555 ? 
84   AD8 7  PX4 JH .   ? PX4 C 365 . ? 1_555 ? 
85   AD9 6  PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
86   AD9 6  PX4 VE .   ? PX4 B 399 . ? 1_555 ? 
87   AD9 6  PX4 WE .   ? PX4 B 400 . ? 1_555 ? 
88   AD9 6  PX4 GG .   ? PX4 C 336 . ? 1_555 ? 
89   AD9 6  PX4 AH .   ? PX4 C 356 . ? 1_555 ? 
90   AD9 6  PX4 BH .   ? PX4 C 357 . ? 1_555 ? 
91   AE1 3  PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
92   AE1 3  PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
93   AE1 3  PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
94   AE2 7  PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
95   AE2 7  PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
96   AE2 7  PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
97   AE2 7  PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
98   AE2 7  PX4 VD .   ? PX4 B 373 . ? 1_555 ? 
99   AE2 7  PX4 AE .   ? PX4 B 378 . ? 1_555 ? 
100  AE2 7  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
101  AE3 5  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
102  AE3 5  PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
103  AE3 5  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
104  AE3 5  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
105  AE3 5  PX4 JH .   ? PX4 C 365 . ? 1_555 ? 
106  AE4 4  VAL A  140 ? VAL A 455 . ? 1_555 ? 
107  AE4 4  PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
108  AE4 4  PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
109  AE4 4  PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
110  AE5 4  PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
111  AE5 4  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
112  AE5 4  PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
113  AE5 4  PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
114  AE6 5  PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
115  AE6 5  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
116  AE6 5  PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
117  AE6 5  PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
118  AE6 5  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
119  AE7 4  PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
120  AE7 4  PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
121  AE7 4  PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
122  AE7 4  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
123  AE8 6  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
124  AE8 6  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
125  AE8 6  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
126  AE8 6  PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
127  AE8 6  PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
128  AE8 6  PX4 JH .   ? PX4 C 365 . ? 1_555 ? 
129  AE9 3  PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
130  AE9 3  PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
131  AE9 3  PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
132  AF1 4  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
133  AF1 4  PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
134  AF1 4  PX4 AG .   ? PX4 C 330 . ? 1_555 ? 
135  AF1 4  PX4 BH .   ? PX4 C 357 . ? 1_555 ? 
136  AF2 8  LYS A  175 ? LYS A 490 . ? 1_555 ? 
137  AF2 8  PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
138  AF2 8  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
139  AF2 8  PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
140  AF2 8  PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
141  AF2 8  PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
142  AF2 8  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
143  AF2 8  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
144  AF3 6  PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
145  AF3 6  PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
146  AF3 6  PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
147  AF3 6  PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
148  AF3 6  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
149  AF3 6  PX4 LH .   ? PX4 C 367 . ? 1_555 ? 
150  AF4 5  LYS A  175 ? LYS A 490 . ? 1_555 ? 
151  AF4 5  PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
152  AF4 5  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
153  AF4 5  PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
154  AF4 5  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
155  AF5 5  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
156  AF5 5  PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
157  AF5 5  PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
158  AF5 5  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
159  AF5 5  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
160  AF6 7  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
161  AF6 7  PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
162  AF6 7  PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
163  AF6 7  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
164  AF6 7  PX4 WE .   ? PX4 B 400 . ? 1_555 ? 
165  AF6 7  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
166  AF6 7  PX4 OH .   ? PX4 C 370 . ? 1_555 ? 
167  AF7 4  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
168  AF7 4  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
169  AF7 4  PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
170  AF7 4  PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
171  AF8 6  LYS A  175 ? LYS A 490 . ? 1_555 ? 
172  AF8 6  PX4 V  .   ? PX4 A 619 . ? 1_555 ? 
173  AF8 6  PX4 Y  .   ? PX4 A 622 . ? 1_555 ? 
174  AF8 6  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
175  AF8 6  PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
176  AF8 6  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
177  AF9 5  GLU A  142 ? GLU A 457 . ? 1_555 ? 
178  AF9 5  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
179  AF9 5  PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
180  AF9 5  PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
181  AF9 5  PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
182  AG1 4  PRO A  180 ? PRO A 495 . ? 1_555 ? 
183  AG1 4  PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
184  AG1 4  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
185  AG1 4  PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
186  AG2 3  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
187  AG2 3  PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
188  AG2 3  PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
189  AG3 5  PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
190  AG3 5  PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
191  AG3 5  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
192  AG3 5  PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
193  AG3 5  PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
194  AG4 5  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
195  AG4 5  PX4 Z  .   ? PX4 A 623 . ? 1_555 ? 
196  AG4 5  PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
197  AG4 5  PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
198  AG4 5  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
199  AG5 4  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
200  AG5 4  PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
201  AG5 4  PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
202  AG5 4  PX4 WA .   ? PX4 A 646 . ? 1_555 ? 
203  AG6 5  PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
204  AG6 5  PX4 DA .   ? PX4 A 627 . ? 1_555 ? 
205  AG6 5  PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
206  AG6 5  PX4 PA .   ? PX4 A 639 . ? 1_555 ? 
207  AG6 5  PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
208  AG7 11 LYS A  175 ? LYS A 490 . ? 1_555 ? 
209  AG7 11 LYS A  177 ? LYS A 492 . ? 1_555 ? 
210  AG7 11 VAL A  178 ? VAL A 493 . ? 1_555 ? 
211  AG7 11 GLU A  179 ? GLU A 494 . ? 1_555 ? 
212  AG7 11 PX4 J  .   ? PX4 A 607 . ? 1_555 ? 
213  AG7 11 PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
214  AG7 11 PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
215  AG7 11 PX4 HA .   ? PX4 A 631 . ? 1_555 ? 
216  AG7 11 PX4 LA .   ? PX4 A 635 . ? 1_555 ? 
217  AG7 11 PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
218  AG7 11 PX4 CE .   ? PX4 B 380 . ? 1_555 ? 
219  AG8 7  ARG A  188 ? ARG A 503 . ? 1_555 ? 
220  AG8 7  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
221  AG8 7  PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
222  AG8 7  PX4 KA .   ? PX4 A 634 . ? 1_555 ? 
223  AG8 7  PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
224  AG8 7  PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
225  AG8 7  PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
226  AG9 8  LYS A  177 ? LYS A 492 . ? 1_555 ? 
227  AG9 8  VAL A  178 ? VAL A 493 . ? 1_555 ? 
228  AG9 8  GLU A  179 ? GLU A 494 . ? 1_555 ? 
229  AG9 8  TYR A  182 ? TYR A 497 . ? 1_555 ? 
230  AG9 8  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
231  AG9 8  PX4 MA .   ? PX4 A 636 . ? 1_555 ? 
232  AG9 8  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
233  AG9 8  PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
234  AH1 7  GLU A  179 ? GLU A 494 . ? 1_555 ? 
235  AH1 7  PRO A  180 ? PRO A 495 . ? 1_555 ? 
236  AH1 7  TYR A  182 ? TYR A 497 . ? 1_555 ? 
237  AH1 7  LYS A  184 ? LYS A 499 . ? 1_555 ? 
238  AH1 7  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
239  AH1 7  PX4 NA .   ? PX4 A 637 . ? 1_555 ? 
240  AH1 7  PX4 RA .   ? PX4 A 641 . ? 1_555 ? 
241  AH2 5  PRO A  183 ? PRO A 498 . ? 1_555 ? 
242  AH2 5  PX4 L  .   ? PX4 A 609 . ? 1_555 ? 
243  AH2 5  PX4 SA .   ? PX4 A 642 . ? 1_555 ? 
244  AH2 5  PX4 VA .   ? PX4 A 645 . ? 1_555 ? 
245  AH2 5  PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
246  AH3 10 GLY A  181 ? GLY A 496 . ? 1_555 ? 
247  AH3 10 PRO A  183 ? PRO A 498 . ? 1_555 ? 
248  AH3 10 LYS A  184 ? LYS A 499 . ? 1_555 ? 
249  AH3 10 SER A  185 ? SER A 500 . ? 1_555 ? 
250  AH3 10 ARG A  188 ? ARG A 503 . ? 1_555 ? 
251  AH3 10 GLY A  196 ? GLY A 511 . ? 1_555 ? 
252  AH3 10 PX4 OA .   ? PX4 A 638 . ? 1_555 ? 
253  AH3 10 PX4 UA .   ? PX4 A 644 . ? 1_555 ? 
254  AH3 10 PX4 XA .   ? PX4 A 647 . ? 1_555 ? 
255  AH3 10 PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
256  AH4 4  ASN A  54  ? ASN A 369 . ? 1_555 ? 
257  AH4 4  ASP A  101 ? ASP A 416 . ? 1_555 ? 
258  AH4 4  PRO A  148 ? PRO A 463 . ? 1_555 ? 
259  AH4 4  CL  AB .   ? CL  A 650 . ? 1_555 ? 
260  AH5 7  THR A  10  ? THR A 325 . ? 1_555 ? 
261  AH5 7  ASN A  54  ? ASN A 369 . ? 1_555 ? 
262  AH5 7  THR A  55  ? THR A 370 . ? 1_555 ? 
263  AH5 7  PRO A  148 ? PRO A 463 . ? 1_555 ? 
264  AH5 7  ARG A  149 ? ARG A 464 . ? 1_555 ? 
265  AH5 7  GLY A  150 ? GLY A 465 . ? 1_555 ? 
266  AH5 7  NA  ZA .   ? NA  A 649 . ? 1_555 ? 
267  AH6 5  TRP B  54  ? TRP B 108 . ? 1_555 ? 
268  AH6 5  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
269  AH6 5  PX4 XE .   ? PX4 C 301 . ? 1_555 ? 
270  AH6 5  PX4 YE .   ? PX4 C 302 . ? 1_555 ? 
271  AH6 5  PX4 UG .   ? PX4 C 350 . ? 1_555 ? 
272  AH7 4  SER B  110 ? SER B 164 . ? 1_555 ? 
273  AH7 4  ARG B  117 ? ARG B 171 . ? 1_555 ? 
274  AH7 4  PX4 HB .   ? PX4 B 307 . ? 1_555 ? 
275  AH7 4  PX4 KC .   ? PX4 B 336 . ? 1_555 ? 
276  AH8 5  LEU B  47  ? LEU B 101 . ? 1_555 ? 
277  AH8 5  PHE B  50  ? PHE B 104 . ? 1_555 ? 
278  AH8 5  PX4 QD .   ? PX4 B 368 . ? 1_555 ? 
279  AH8 5  PX4 XE .   ? PX4 C 301 . ? 1_555 ? 
280  AH8 5  PX4 YE .   ? PX4 C 302 . ? 1_555 ? 
281  AH9 10 MET B  58  ? MET B 112 . ? 1_555 ? 
282  AH9 10 ARG B  62  ? ARG B 116 . ? 1_555 ? 
283  AH9 10 PX4 BB .   ? PX4 B 301 . ? 1_555 ? 
284  AH9 10 PX4 LB .   ? PX4 B 311 . ? 1_555 ? 
285  AH9 10 PX4 UB .   ? PX4 B 320 . ? 1_555 ? 
286  AH9 10 PX4 ZC .   ? PX4 B 351 . ? 1_555 ? 
287  AH9 10 TYR C  134 ? TYR C 188 . ? 1_555 ? 
288  AH9 10 LEU C  138 ? LEU C 192 . ? 1_555 ? 
289  AH9 10 PX4 XE .   ? PX4 C 301 . ? 1_555 ? 
290  AH9 10 PX4 FG .   ? PX4 C 335 . ? 1_555 ? 
291  AI1 9  VAL B  13  ? VAL B 67  . ? 1_555 ? 
292  AI1 9  THR B  14  ? THR B 68  . ? 1_555 ? 
293  AI1 9  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
294  AI1 9  PX4 OC .   ? PX4 B 340 . ? 1_555 ? 
295  AI1 9  LEU C  171 ? LEU C 225 . ? 1_555 ? 
296  AI1 9  ASP C  181 ? ASP C 235 . ? 1_555 ? 
297  AI1 9  LEU C  182 ? LEU C 236 . ? 1_555 ? 
298  AI1 9  GLY C  185 ? GLY C 239 . ? 1_555 ? 
299  AI1 9  PX4 AF .   ? PX4 C 304 . ? 1_555 ? 
300  AI2 5  ARG B  139 ? ARG B 193 . ? 1_555 ? 
301  AI2 5  PX4 NB .   ? PX4 B 313 . ? 1_555 ? 
302  AI2 5  PX4 UC .   ? PX4 B 346 . ? 1_555 ? 
303  AI2 5  PX4 HD .   ? PX4 B 359 . ? 1_555 ? 
304  AI2 5  PX4 SE .   ? PX4 B 396 . ? 1_555 ? 
305  AI3 5  ARG B  117 ? ARG B 171 . ? 1_555 ? 
306  AI3 5  ARG B  121 ? ARG B 175 . ? 1_555 ? 
307  AI3 5  PX4 CB .   ? PX4 B 302 . ? 1_555 ? 
308  AI3 5  PX4 SB .   ? PX4 B 318 . ? 1_555 ? 
309  AI3 5  PX4 CH .   ? PX4 C 358 . ? 1_555 ? 
310  AI4 3  ARG B  29  ? ARG B 83  . ? 1_555 ? 
311  AI4 3  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
312  AI4 3  PX4 ZE .   ? PX4 C 303 . ? 1_555 ? 
313  AI5 5  PX4 PB .   ? PX4 B 315 . ? 1_555 ? 
314  AI5 5  PX4 HC .   ? PX4 B 333 . ? 1_555 ? 
315  AI5 5  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
316  AI5 5  PX4 QC .   ? PX4 B 342 . ? 1_555 ? 
317  AI5 5  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
318  AI6 2  ARG B  84  ? ARG B 138 . ? 1_555 ? 
319  AI6 2  PX4 CC .   ? PX4 B 328 . ? 1_555 ? 
320  AI7 5  TYR B  61  ? TYR B 115 . ? 1_555 ? 
321  AI7 5  ARG B  62  ? ARG B 116 . ? 1_555 ? 
322  AI7 5  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
323  AI7 5  PX4 SC .   ? PX4 B 344 . ? 1_555 ? 
324  AI7 5  LEU C  127 ? LEU C 181 . ? 1_555 ? 
325  AI8 9  PHE B  3   ? PHE B 57  . ? 1_555 ? 
326  AI8 9  LEU B  10  ? LEU B 64  . ? 1_555 ? 
327  AI8 9  GLN B  15  ? GLN B 69  . ? 1_555 ? 
328  AI8 9  TRP B  18  ? TRP B 72  . ? 1_555 ? 
329  AI8 9  ASP B  19  ? ASP B 73  . ? 1_555 ? 
330  AI8 9  PX4 RB .   ? PX4 B 317 . ? 1_555 ? 
331  AI8 9  PX4 FC .   ? PX4 B 331 . ? 1_555 ? 
332  AI8 9  VAL C  189 ? VAL C 243 . ? 1_555 ? 
333  AI8 9  PX4 AF .   ? PX4 C 304 . ? 1_555 ? 
334  AI9 3  GLU B  147 ? GLU B 201 . ? 1_555 ? 
335  AI9 3  LYS B  150 ? LYS B 204 . ? 1_555 ? 
336  AI9 3  PX4 GB .   ? PX4 B 306 . ? 1_555 ? 
337  AJ1 3  LEU B  127 ? LEU B 181 . ? 1_555 ? 
338  AJ1 3  LEU B  131 ? LEU B 185 . ? 1_555 ? 
339  AJ1 3  PX4 UC .   ? PX4 B 346 . ? 1_555 ? 
340  AJ2 4  PX4 JB .   ? PX4 B 309 . ? 1_555 ? 
341  AJ2 4  PX4 CC .   ? PX4 B 328 . ? 1_555 ? 
342  AJ2 4  PX4 QC .   ? PX4 B 342 . ? 1_555 ? 
343  AJ2 4  PX4 EF .   ? PX4 C 308 . ? 1_555 ? 
344  AJ3 3  PX4 RC .   ? PX4 B 343 . ? 1_555 ? 
345  AJ3 3  PX4 WC .   ? PX4 B 348 . ? 1_555 ? 
346  AJ3 3  PX4 TG .   ? PX4 C 349 . ? 1_555 ? 
347  AJ4 7  ARG B  7   ? ARG B 61  . ? 1_555 ? 
348  AJ4 7  GLN B  15  ? GLN B 69  . ? 1_555 ? 
349  AJ4 7  PX4 MB .   ? PX4 B 312 . ? 1_555 ? 
350  AJ4 7  PX4 VC .   ? PX4 B 347 . ? 1_555 ? 
351  AJ4 7  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
352  AJ4 7  PX4 AF .   ? PX4 C 304 . ? 1_555 ? 
353  AJ4 7  PX4 BG .   ? PX4 C 331 . ? 1_555 ? 
354  AJ5 3  ARG B  128 ? ARG B 182 . ? 1_555 ? 
355  AJ5 3  PX4 HB .   ? PX4 B 307 . ? 1_555 ? 
356  AJ5 3  PX4 IC .   ? PX4 B 334 . ? 1_555 ? 
357  AJ6 7  GLN B  73  ? GLN B 127 . ? 1_555 ? 
358  AJ6 7  TRP B  76  ? TRP B 130 . ? 1_555 ? 
359  AJ6 7  GLN B  77  ? GLN B 131 . ? 1_555 ? 
360  AJ6 7  ARG B  84  ? ARG B 138 . ? 1_555 ? 
361  AJ6 7  PX4 LC .   ? PX4 B 337 . ? 1_555 ? 
362  AJ6 7  PX4 NC .   ? PX4 B 339 . ? 1_555 ? 
363  AJ6 7  HIS C  123 ? HIS C 177 . ? 1_555 ? 
364  AJ7 6  GLU B  66  ? GLU B 120 . ? 1_555 ? 
365  AJ7 6  ASP B  70  ? ASP B 124 . ? 1_555 ? 
366  AJ7 6  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
367  AJ7 6  PX4 NC .   ? PX4 B 339 . ? 1_555 ? 
368  AJ7 6  PX4 YD .   ? PX4 B 376 . ? 1_555 ? 
369  AJ7 6  TYR C  134 ? TYR C 188 . ? 1_555 ? 
370  AJ8 5  LYS B  150 ? LYS B 204 . ? 1_555 ? 
371  AJ8 5  GLY B  154 ? GLY B 208 . ? 1_555 ? 
372  AJ8 5  LEU B  157 ? LEU B 211 . ? 1_555 ? 
373  AJ8 5  PX4 RC .   ? PX4 B 343 . ? 1_555 ? 
374  AJ8 5  PX4 NG .   ? PX4 C 343 . ? 1_555 ? 
375  AJ9 4  HIS B  161 ? HIS B 215 . ? 1_555 ? 
376  AJ9 4  ALA B  164 ? ALA B 218 . ? 1_555 ? 
377  AJ9 4  PX4 GC .   ? PX4 B 332 . ? 1_555 ? 
378  AJ9 4  PX4 WC .   ? PX4 B 348 . ? 1_555 ? 
379  AK1 7  ARG B  29  ? ARG B 83  . ? 1_555 ? 
380  AK1 7  PX4 FB .   ? PX4 B 305 . ? 1_555 ? 
381  AK1 7  PX4 IB .   ? PX4 B 308 . ? 1_555 ? 
382  AK1 7  PX4 OC .   ? PX4 B 340 . ? 1_555 ? 
383  AK1 7  PX4 ZE .   ? PX4 C 303 . ? 1_555 ? 
384  AK1 7  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
385  AK1 7  PX4 EG .   ? PX4 C 334 . ? 1_555 ? 
386  AK2 4  PX4 ZB .   ? PX4 B 325 . ? 1_555 ? 
387  AK2 4  PX4 TC .   ? PX4 B 345 . ? 1_555 ? 
388  AK2 4  PX4 AD .   ? PX4 B 352 . ? 1_555 ? 
389  AK2 4  PX4 RD .   ? PX4 B 369 . ? 1_555 ? 
390  AK3 4  PHE B  3   ? PHE B 57  . ? 1_555 ? 
391  AK3 4  PX4 YB .   ? PX4 B 324 . ? 1_555 ? 
392  AK3 4  PX4 FC .   ? PX4 B 331 . ? 1_555 ? 
393  AK3 4  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
394  AK4 7  ARG B  183 ? ARG B 237 . ? 1_555 ? 
395  AK4 7  GLN B  184 ? GLN B 238 . ? 1_555 ? 
396  AK4 7  LEU B  187 ? LEU B 241 . ? 1_555 ? 
397  AK4 7  LEU B  190 ? LEU B 244 . ? 1_555 ? 
398  AK4 7  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
399  AK4 7  PX4 XC .   ? PX4 B 349 . ? 1_555 ? 
400  AK4 7  PX4 BD .   ? PX4 B 353 . ? 1_555 ? 
401  AK5 4  PHE B  193 ? PHE B 247 . ? 1_555 ? 
402  AK5 4  TYR B  204 ? TYR B 258 . ? 1_555 ? 
403  AK5 4  PX4 AD .   ? PX4 B 352 . ? 1_555 ? 
404  AK5 4  PX4 CG .   ? PX4 C 332 . ? 1_555 ? 
405  AK6 5  VAL B  87  ? VAL B 141 . ? 1_555 ? 
406  AK6 5  GLU B  88  ? GLU B 142 . ? 1_555 ? 
407  AK6 5  GLN B  95  ? GLN B 149 . ? 1_555 ? 
408  AK6 5  PX4 KB .   ? PX4 B 310 . ? 1_555 ? 
409  AK6 5  PX4 PB .   ? PX4 B 315 . ? 1_555 ? 
410  AK7 10 ALA B  175 ? ALA B 229 . ? 1_555 ? 
411  AK7 10 PX4 AC .   ? PX4 B 326 . ? 1_555 ? 
412  AK7 10 PX4 GC .   ? PX4 B 332 . ? 1_555 ? 
413  AK7 10 PX4 PC .   ? PX4 B 341 . ? 1_555 ? 
414  AK7 10 PX4 BD .   ? PX4 B 353 . ? 1_555 ? 
415  AK7 10 PHE C  17  ? PHE C 71  . ? 1_555 ? 
416  AK7 10 LEU C  21  ? LEU C 75  . ? 1_555 ? 
417  AK7 10 PX4 CF .   ? PX4 C 306 . ? 1_555 ? 
418  AK7 10 PX4 XF .   ? PX4 C 327 . ? 1_555 ? 
419  AK7 10 PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
420  AK8 5  PX4 MC .   ? PX4 B 338 . ? 1_555 ? 
421  AK8 5  PX4 FD .   ? PX4 B 357 . ? 1_555 ? 
422  AK8 5  PX4 TE .   ? PX4 B 397 . ? 1_555 ? 
423  AK8 5  PX4 OF .   ? PX4 C 318 . ? 1_555 ? 
424  AK8 5  PX4 UF .   ? PX4 C 324 . ? 1_555 ? 
425  AK9 5  PHE B  3   ? PHE B 57  . ? 1_555 ? 
426  AK9 5  SER B  4   ? SER B 58  . ? 1_555 ? 
427  AK9 5  PX4 MB .   ? PX4 B 312 . ? 1_555 ? 
428  AK9 5  PX4 ZB .   ? PX4 B 325 . ? 1_555 ? 
429  AK9 5  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
430  AL1 8  LEU B  168 ? LEU B 222 . ? 1_555 ? 
431  AL1 8  LEU B  171 ? LEU B 225 . ? 1_555 ? 
432  AL1 8  SER B  172 ? SER B 226 . ? 1_555 ? 
433  AL1 8  PX4 WB .   ? PX4 B 322 . ? 1_555 ? 
434  AL1 8  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
435  AL1 8  PX4 PC .   ? PX4 B 341 . ? 1_555 ? 
436  AL1 8  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
437  AL1 8  MET C  32  ? MET C 86  . ? 1_555 ? 
438  AL2 4  LEU B  102 ? LEU B 156 . ? 1_555 ? 
439  AL2 4  HIS B  103 ? HIS B 157 . ? 1_555 ? 
440  AL2 4  GLN B  106 ? GLN B 160 . ? 1_555 ? 
441  AL2 4  PX4 JB .   ? PX4 B 309 . ? 1_555 ? 
442  AL3 3  PX4 SB .   ? PX4 B 318 . ? 1_555 ? 
443  AL3 3  PX4 HD .   ? PX4 B 359 . ? 1_555 ? 
444  AL3 3  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
445  AL4 6  PX4 JB .   ? PX4 B 309 . ? 1_555 ? 
446  AL4 6  PX4 QC .   ? PX4 B 342 . ? 1_555 ? 
447  AL4 6  PX4 GD .   ? PX4 B 358 . ? 1_555 ? 
448  AL4 6  PX4 ID .   ? PX4 B 360 . ? 1_555 ? 
449  AL4 6  PX4 KD .   ? PX4 B 362 . ? 1_555 ? 
450  AL4 6  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
451  AL5 4  PX4 CB .   ? PX4 B 302 . ? 1_555 ? 
452  AL5 4  PX4 YC .   ? PX4 B 350 . ? 1_555 ? 
453  AL5 4  PX4 GD .   ? PX4 B 358 . ? 1_555 ? 
454  AL5 4  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
455  AL6 3  PX4 TB .   ? PX4 B 319 . ? 1_555 ? 
456  AL6 3  PX4 DD .   ? PX4 B 355 . ? 1_555 ? 
457  AL6 3  PX4 KD .   ? PX4 B 362 . ? 1_555 ? 
458  AL7 4  PX4 EC .   ? PX4 B 330 . ? 1_555 ? 
459  AL7 4  PX4 UC .   ? PX4 B 346 . ? 1_555 ? 
460  AL7 4  PX4 FD .   ? PX4 B 357 . ? 1_555 ? 
461  AL7 4  PX4 LD .   ? PX4 B 363 . ? 1_555 ? 
462  AL8 5  PX4 TB .   ? PX4 B 319 . ? 1_555 ? 
463  AL8 5  PX4 UB .   ? PX4 B 320 . ? 1_555 ? 
464  AL8 5  PX4 SC .   ? PX4 B 344 . ? 1_555 ? 
465  AL8 5  PX4 DD .   ? PX4 B 355 . ? 1_555 ? 
466  AL8 5  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
467  AL9 3  PX4 FB .   ? PX4 B 305 . ? 1_555 ? 
468  AL9 3  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
469  AL9 3  PX4 SD .   ? PX4 B 370 . ? 1_555 ? 
470  AM1 5  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
471  AM1 5  PX4 GC .   ? PX4 B 332 . ? 1_555 ? 
472  AM1 5  PX4 WC .   ? PX4 B 348 . ? 1_555 ? 
473  AM1 5  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
474  AM1 5  PX4 TD .   ? PX4 B 371 . ? 1_555 ? 
475  AM2 5  PX4 JB .   ? PX4 B 309 . ? 1_555 ? 
476  AM2 5  PX4 PB .   ? PX4 B 315 . ? 1_555 ? 
477  AM2 5  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
478  AM2 5  PX4 KD .   ? PX4 B 362 . ? 1_555 ? 
479  AM2 5  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
480  AM3 4  PX4 QB .   ? PX4 B 316 . ? 1_555 ? 
481  AM3 4  PX4 VB .   ? PX4 B 321 . ? 1_555 ? 
482  AM3 4  PX4 WC .   ? PX4 B 348 . ? 1_555 ? 
483  AM3 4  PX4 NG .   ? PX4 C 343 . ? 1_555 ? 
484  AM4 3  PX4 LB .   ? PX4 B 311 . ? 1_555 ? 
485  AM4 3  PX4 NC .   ? PX4 B 339 . ? 1_555 ? 
486  AM4 3  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
487  AM5 4  PX4 YB .   ? PX4 B 324 . ? 1_555 ? 
488  AM5 4  PX4 XC .   ? PX4 B 349 . ? 1_555 ? 
489  AM5 4  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
490  AM5 4  PX4 WD .   ? PX4 B 374 . ? 1_555 ? 
491  AM6 4  PX4 GB .   ? PX4 B 306 . ? 1_555 ? 
492  AM6 4  PX4 OB .   ? PX4 B 314 . ? 1_555 ? 
493  AM6 4  PX4 MC .   ? PX4 B 338 . ? 1_555 ? 
494  AM6 4  PX4 LD .   ? PX4 B 363 . ? 1_555 ? 
495  AM7 4  PX4 RB .   ? PX4 B 317 . ? 1_555 ? 
496  AM7 4  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
497  AM7 4  PX4 WD .   ? PX4 B 374 . ? 1_555 ? 
498  AM7 4  PX4 AF .   ? PX4 C 304 . ? 1_555 ? 
499  AM8 4  PX4 QB .   ? PX4 B 316 . ? 1_555 ? 
500  AM8 4  PX4 WB .   ? PX4 B 322 . ? 1_555 ? 
501  AM8 4  PX4 PC .   ? PX4 B 341 . ? 1_555 ? 
502  AM8 4  PX4 RC .   ? PX4 B 343 . ? 1_555 ? 
503  AM9 4  PX4 AC .   ? PX4 B 326 . ? 1_555 ? 
504  AM9 4  PX4 TC .   ? PX4 B 345 . ? 1_555 ? 
505  AM9 4  PX4 BD .   ? PX4 B 353 . ? 1_555 ? 
506  AM9 4  PX4 RD .   ? PX4 B 369 . ? 1_555 ? 
507  AN1 5  PX4 KC .   ? PX4 B 336 . ? 1_555 ? 
508  AN1 5  PX4 HD .   ? PX4 B 359 . ? 1_555 ? 
509  AN1 5  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
510  AN1 5  PX4 MG .   ? PX4 C 342 . ? 1_555 ? 
511  AN1 5  PX4 VG .   ? PX4 C 351 . ? 1_555 ? 
512  AN2 5  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
513  AN2 5  PX4 JD .   ? PX4 B 361 . ? 1_555 ? 
514  AN2 5  PX4 OD .   ? PX4 B 366 . ? 1_555 ? 
515  AN2 5  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
516  AN2 5  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
517  AN3 3  PX4 YB .   ? PX4 B 324 . ? 1_555 ? 
518  AN3 3  PX4 BC .   ? PX4 B 327 . ? 1_555 ? 
519  AN3 3  PX4 VE .   ? PX4 B 399 . ? 1_555 ? 
520  AN4 3  PX4 AC .   ? PX4 B 326 . ? 1_555 ? 
521  AN4 3  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
522  AN4 3  PX4 XC .   ? PX4 B 349 . ? 1_555 ? 
523  AN5 7  ARG B  7   ? ARG B 61  . ? 1_555 ? 
524  AN5 7  PX4 RB .   ? PX4 B 317 . ? 1_555 ? 
525  AN5 7  PX4 ZB .   ? PX4 B 325 . ? 1_555 ? 
526  AN5 7  PX4 FC .   ? PX4 B 331 . ? 1_555 ? 
527  AN5 7  PX4 TC .   ? PX4 B 345 . ? 1_555 ? 
528  AN5 7  PX4 VC .   ? PX4 B 347 . ? 1_555 ? 
529  AN5 7  PX4 VD .   ? PX4 B 373 . ? 1_555 ? 
530  AN6 5  PX4 LC .   ? PX4 B 337 . ? 1_555 ? 
531  AN6 5  PX4 NC .   ? PX4 B 339 . ? 1_555 ? 
532  AN6 5  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
533  AN6 5  PX4 YD .   ? PX4 B 376 . ? 1_555 ? 
534  AN6 5  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
535  AN7 3  PX4 SD .   ? PX4 B 370 . ? 1_555 ? 
536  AN7 3  PX4 ZE .   ? PX4 C 303 . ? 1_555 ? 
537  AN7 3  PX4 YG .   ? PX4 C 354 . ? 1_555 ? 
538  AN8 4  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
539  AN8 4  PX4 EC .   ? PX4 B 330 . ? 1_555 ? 
540  AN8 4  PX4 MC .   ? PX4 B 338 . ? 1_555 ? 
541  AN8 4  PX4 UD .   ? PX4 B 372 . ? 1_555 ? 
542  AN9 6  GLN B  106 ? GLN B 160 . ? 1_555 ? 
543  AN9 6  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
544  AN9 6  PX4 KC .   ? PX4 B 336 . ? 1_555 ? 
545  AN9 6  PX4 ID .   ? PX4 B 360 . ? 1_555 ? 
546  AN9 6  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
547  AN9 6  PX4 GE .   ? PX4 B 384 . ? 1_555 ? 
548  AO1 5  PX4 GB .   ? PX4 B 306 . ? 1_555 ? 
549  AO1 5  PX4 IC .   ? PX4 B 334 . ? 1_555 ? 
550  AO1 5  PX4 YC .   ? PX4 B 350 . ? 1_555 ? 
551  AO1 5  PX4 LD .   ? PX4 B 363 . ? 1_555 ? 
552  AO1 5  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
553  AO2 2  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
554  AO2 2  PX4 GD .   ? PX4 B 358 . ? 1_555 ? 
555  AO3 4  PX4 ZC .   ? PX4 B 351 . ? 1_555 ? 
556  AO3 4  PX4 QD .   ? PX4 B 368 . ? 1_555 ? 
557  AO3 4  PX4 BE .   ? PX4 B 379 . ? 1_555 ? 
558  AO3 4  PX4 BF .   ? PX4 C 305 . ? 1_555 ? 
559  AO4 3  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
560  AO4 3  PX4 LC .   ? PX4 B 337 . ? 1_555 ? 
561  AO4 3  PX4 QC .   ? PX4 B 342 . ? 1_555 ? 
562  AO5 3  PX4 MC .   ? PX4 B 338 . ? 1_555 ? 
563  AO5 3  PX4 UC .   ? PX4 B 346 . ? 1_555 ? 
564  AO5 3  PX4 HD .   ? PX4 B 359 . ? 1_555 ? 
565  AO6 7  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
566  AO6 7  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
567  AO6 7  PX4 GC .   ? PX4 B 332 . ? 1_555 ? 
568  AO6 7  PX4 PC .   ? PX4 B 341 . ? 1_555 ? 
569  AO6 7  PX4 UD .   ? PX4 B 372 . ? 1_555 ? 
570  AO6 7  PX4 XD .   ? PX4 B 375 . ? 1_555 ? 
571  AO6 7  PX4 EE .   ? PX4 B 382 . ? 1_555 ? 
572  AO7 6  PX4 JC .   ? PX4 B 335 . ? 1_555 ? 
573  AO7 6  PX4 KC .   ? PX4 B 336 . ? 1_555 ? 
574  AO7 6  PX4 YC .   ? PX4 B 350 . ? 1_555 ? 
575  AO7 6  PX4 GD .   ? PX4 B 358 . ? 1_555 ? 
576  AO7 6  PX4 HD .   ? PX4 B 359 . ? 1_555 ? 
577  AO7 6  PX4 GE .   ? PX4 B 384 . ? 1_555 ? 
578  AO8 3  PX4 ZC .   ? PX4 B 351 . ? 1_555 ? 
579  AO8 3  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
580  AO8 3  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
581  AO9 6  PX4 NC .   ? PX4 B 339 . ? 1_555 ? 
582  AO9 6  PX4 SC .   ? PX4 B 344 . ? 1_555 ? 
583  AO9 6  PX4 DD .   ? PX4 B 355 . ? 1_555 ? 
584  AO9 6  PX4 OD .   ? PX4 B 366 . ? 1_555 ? 
585  AO9 6  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
586  AO9 6  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
587  AP1 4  PX4 DB .   ? PX4 B 303 . ? 1_555 ? 
588  AP1 4  PX4 JD .   ? PX4 B 361 . ? 1_555 ? 
589  AP1 4  PX4 YE .   ? PX4 C 302 . ? 1_555 ? 
590  AP1 4  PX4 BF .   ? PX4 C 305 . ? 1_555 ? 
591  AP2 5  PX4 YB .   ? PX4 B 324 . ? 1_555 ? 
592  AP2 5  PX4 XC .   ? PX4 B 349 . ? 1_555 ? 
593  AP2 5  PX4 TD .   ? PX4 B 371 . ? 1_555 ? 
594  AP2 5  PX4 FE .   ? PX4 B 383 . ? 1_555 ? 
595  AP2 5  PX4 WE .   ? PX4 B 400 . ? 1_555 ? 
596  AP3 3  PX4 OC .   ? PX4 B 340 . ? 1_555 ? 
597  AP3 3  PX4 ED .   ? PX4 B 356 . ? 1_555 ? 
598  AP3 3  PX4 JE .   ? PX4 B 387 . ? 1_555 ? 
599  AP4 4  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
600  AP4 4  PX4 PC .   ? PX4 B 341 . ? 1_555 ? 
601  AP4 4  PX4 RD .   ? PX4 B 369 . ? 1_555 ? 
602  AP4 4  PX4 XD .   ? PX4 B 375 . ? 1_555 ? 
603  AP5 3  PX4 FD .   ? PX4 B 357 . ? 1_555 ? 
604  AP5 3  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
605  AP5 3  PX4 EE .   ? PX4 B 382 . ? 1_555 ? 
606  AP6 4  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
607  AP6 4  PX4 CD .   ? PX4 B 354 . ? 1_555 ? 
608  AP6 4  PX4 FE .   ? PX4 B 383 . ? 1_555 ? 
609  AP6 4  PX4 KE .   ? PX4 B 388 . ? 1_555 ? 
610  AP7 4  PX4 TC .   ? PX4 B 345 . ? 1_555 ? 
611  AP7 4  PX4 VC .   ? PX4 B 347 . ? 1_555 ? 
612  AP7 4  PX4 JE .   ? PX4 B 387 . ? 1_555 ? 
613  AP7 4  PX4 KE .   ? PX4 B 388 . ? 1_555 ? 
614  AP8 4  PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
615  AP8 4  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
616  AP8 4  PX4 TD .   ? PX4 B 371 . ? 1_555 ? 
617  AP8 4  PX4 EE .   ? PX4 B 382 . ? 1_555 ? 
618  AP9 5  PX4 UB .   ? PX4 B 320 . ? 1_555 ? 
619  AP9 5  PX4 DD .   ? PX4 B 355 . ? 1_555 ? 
620  AP9 5  PX4 DE .   ? PX4 B 381 . ? 1_555 ? 
621  AP9 5  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
622  AP9 5  PX4 LG .   ? PX4 C 341 . ? 1_555 ? 
623  AQ1 2  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
624  AQ1 2  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
625  AQ2 5  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
626  AQ2 5  PX4 JE .   ? PX4 B 387 . ? 1_555 ? 
627  AQ2 5  PX4 ME .   ? PX4 B 390 . ? 1_555 ? 
628  AQ2 5  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
629  AQ2 5  PX4 BF .   ? PX4 C 305 . ? 1_555 ? 
630  AQ3 4  PX4 JD .   ? PX4 B 361 . ? 1_555 ? 
631  AQ3 4  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
632  AQ3 4  PX4 NE .   ? PX4 B 391 . ? 1_555 ? 
633  AQ3 4  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
634  AQ4 4  PX4 F  .   ? PX4 A 603 . ? 1_555 ? 
635  AQ4 4  PX4 H  .   ? PX4 A 605 . ? 1_555 ? 
636  AQ4 4  PX4 TA .   ? PX4 A 643 . ? 1_555 ? 
637  AQ4 4  PX4 GE .   ? PX4 B 384 . ? 1_555 ? 
638  AQ5 3  PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
639  AQ5 3  PX4 YD .   ? PX4 B 376 . ? 1_555 ? 
640  AQ5 3  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
641  AQ6 5  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
642  AQ6 5  PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
643  AQ6 5  PX4 MD .   ? PX4 B 364 . ? 1_555 ? 
644  AQ6 5  PX4 UD .   ? PX4 B 372 . ? 1_555 ? 
645  AQ6 5  PX4 XD .   ? PX4 B 375 . ? 1_555 ? 
646  AQ7 3  PX4 RD .   ? PX4 B 369 . ? 1_555 ? 
647  AQ7 3  PX4 VD .   ? PX4 B 373 . ? 1_555 ? 
648  AQ7 3  PX4 IE .   ? PX4 B 386 . ? 1_555 ? 
649  AQ8 5  PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
650  AQ8 5  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
651  AQ8 5  PX4 GD .   ? PX4 B 358 . ? 1_555 ? 
652  AQ8 5  PX4 ND .   ? PX4 B 365 . ? 1_555 ? 
653  AQ8 5  PX4 CE .   ? PX4 B 380 . ? 1_555 ? 
654  AQ9 7  PX4 QA .   ? PX4 A 640 . ? 1_555 ? 
655  AQ9 7  PX4 OD .   ? PX4 B 366 . ? 1_555 ? 
656  AQ9 7  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
657  AQ9 7  PX4 BE .   ? PX4 B 379 . ? 1_555 ? 
658  AQ9 7  PX4 LE .   ? PX4 B 389 . ? 1_555 ? 
659  AQ9 7  PX4 QE .   ? PX4 B 394 . ? 1_555 ? 
660  AQ9 7  PX4 GH .   ? PX4 C 362 . ? 1_555 ? 
661  AR1 4  PX4 I  .   ? PX4 A 606 . ? 1_555 ? 
662  AR1 4  PX4 FE .   ? PX4 B 383 . ? 1_555 ? 
663  AR1 4  PX4 KE .   ? PX4 B 388 . ? 1_555 ? 
664  AR1 4  PX4 OE .   ? PX4 B 392 . ? 1_555 ? 
665  AR2 5  PX4 SD .   ? PX4 B 370 . ? 1_555 ? 
666  AR2 5  PX4 WD .   ? PX4 B 374 . ? 1_555 ? 
667  AR2 5  PX4 AE .   ? PX4 B 378 . ? 1_555 ? 
668  AR2 5  PX4 ME .   ? PX4 B 390 . ? 1_555 ? 
669  AR2 5  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
670  AR3 5  PX4 VD .   ? PX4 B 373 . ? 1_555 ? 
671  AR3 5  PX4 WD .   ? PX4 B 374 . ? 1_555 ? 
672  AR3 5  PX4 IE .   ? PX4 B 386 . ? 1_555 ? 
673  AR3 5  PX4 OE .   ? PX4 B 392 . ? 1_555 ? 
674  AR3 5  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
675  AR4 6  PX4 D  .   ? PX4 A 601 . ? 1_555 ? 
676  AR4 6  PX4 DD .   ? PX4 B 355 . ? 1_555 ? 
677  AR4 6  PX4 PD .   ? PX4 B 367 . ? 1_555 ? 
678  AR4 6  PX4 YD .   ? PX4 B 376 . ? 1_555 ? 
679  AR4 6  PX4 DE .   ? PX4 B 381 . ? 1_555 ? 
680  AR4 6  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
681  AR5 4  PX4 AE .   ? PX4 B 378 . ? 1_555 ? 
682  AR5 4  PX4 JE .   ? PX4 B 387 . ? 1_555 ? 
683  AR5 4  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
684  AR5 4  PX4 RE .   ? PX4 B 395 . ? 1_555 ? 
685  AR6 2  PX4 BE .   ? PX4 B 379 . ? 1_555 ? 
686  AR6 2  PX4 QE .   ? PX4 B 394 . ? 1_555 ? 
687  AR7 3  PX4 IE .   ? PX4 B 386 . ? 1_555 ? 
688  AR7 3  PX4 KE .   ? PX4 B 388 . ? 1_555 ? 
689  AR7 3  PX4 PE .   ? PX4 B 393 . ? 1_555 ? 
690  AR8 7  PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
691  AR8 7  PX4 YA .   ? PX4 A 648 . ? 1_555 ? 
692  AR8 7  PX4 AE .   ? PX4 B 378 . ? 1_555 ? 
693  AR8 7  PX4 JE .   ? PX4 B 387 . ? 1_555 ? 
694  AR8 7  PX4 KE .   ? PX4 B 388 . ? 1_555 ? 
695  AR8 7  PX4 ME .   ? PX4 B 390 . ? 1_555 ? 
696  AR8 7  PX4 OE .   ? PX4 B 392 . ? 1_555 ? 
697  AR9 5  PX4 G  .   ? PX4 A 604 . ? 1_555 ? 
698  AR9 5  PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
699  AR9 5  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
700  AR9 5  PX4 NE .   ? PX4 B 391 . ? 1_555 ? 
701  AR9 5  PX4 RE .   ? PX4 B 395 . ? 1_555 ? 
702  AS1 3  PX4 K  .   ? PX4 A 608 . ? 1_555 ? 
703  AS1 3  PX4 ME .   ? PX4 B 390 . ? 1_555 ? 
704  AS1 3  PX4 QE .   ? PX4 B 394 . ? 1_555 ? 
705  AS2 5  LEU B  127 ? LEU B 181 . ? 1_555 ? 
706  AS2 5  PX4 GB .   ? PX4 B 306 . ? 1_555 ? 
707  AS2 5  PX4 TE .   ? PX4 B 397 . ? 1_555 ? 
708  AS2 5  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
709  AS2 5  PX4 MG .   ? PX4 C 342 . ? 1_555 ? 
710  AS3 6  PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
711  AS3 6  TYR B  134 ? TYR B 188 . ? 1_555 ? 
712  AS3 6  PX4 EC .   ? PX4 B 330 . ? 1_555 ? 
713  AS3 6  PX4 SE .   ? PX4 B 396 . ? 1_555 ? 
714  AS3 6  GLU C  66  ? GLU C 120 . ? 1_555 ? 
715  AS3 6  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
716  AS4 4  PX4 VE .   ? PX4 B 399 . ? 1_555 ? 
717  AS4 4  PX4 CG .   ? PX4 C 332 . ? 1_555 ? 
718  AS4 4  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
719  AS4 4  PX4 OH .   ? PX4 C 370 . ? 1_555 ? 
720  AS5 8  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
721  AS5 8  SER B  196 ? SER B 250 . ? 1_555 ? 
722  AS5 8  ALA B  200 ? ALA B 254 . ? 1_555 ? 
723  AS5 8  PX4 AD .   ? PX4 B 352 . ? 1_555 ? 
724  AS5 8  PX4 UE .   ? PX4 B 398 . ? 1_555 ? 
725  AS5 8  PHE C  3   ? PHE C 57  . ? 1_555 ? 
726  AS5 8  TYR C  204 ? TYR C 258 . ? 1_555 ? 
727  AS5 8  PX4 GG .   ? PX4 C 336 . ? 1_555 ? 
728  AS6 4  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
729  AS6 4  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
730  AS6 4  PX4 RD .   ? PX4 B 369 . ? 1_555 ? 
731  AS6 4  PX4 OH .   ? PX4 C 370 . ? 1_555 ? 
732  AS7 4  PX4 BB .   ? PX4 B 301 . ? 1_555 ? 
733  AS7 4  PX4 DB .   ? PX4 B 303 . ? 1_555 ? 
734  AS7 4  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
735  AS7 4  PX4 YE .   ? PX4 C 302 . ? 1_555 ? 
736  AS8 5  PX4 BB .   ? PX4 B 301 . ? 1_555 ? 
737  AS8 5  PX4 DB .   ? PX4 B 303 . ? 1_555 ? 
738  AS8 5  PX4 QD .   ? PX4 B 368 . ? 1_555 ? 
739  AS8 5  PX4 XE .   ? PX4 C 301 . ? 1_555 ? 
740  AS8 5  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
741  AS9 5  PX4 IB .   ? PX4 B 308 . ? 1_555 ? 
742  AS9 5  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
743  AS9 5  PX4 ED .   ? PX4 B 356 . ? 1_555 ? 
744  AS9 5  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
745  AS9 5  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
746  AT1 4  PX4 FB .   ? PX4 B 305 . ? 1_555 ? 
747  AT1 4  PX4 MB .   ? PX4 B 312 . ? 1_555 ? 
748  AT1 4  PX4 RB .   ? PX4 B 317 . ? 1_555 ? 
749  AT1 4  PX4 VC .   ? PX4 B 347 . ? 1_555 ? 
750  AT2 3  PX4 JD .   ? PX4 B 361 . ? 1_555 ? 
751  AT2 3  PX4 QD .   ? PX4 B 368 . ? 1_555 ? 
752  AT2 3  PX4 AE .   ? PX4 B 378 . ? 1_555 ? 
753  AT3 5  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
754  AT3 5  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
755  AT3 5  TRP C  18  ? TRP C 72  . ? 1_555 ? 
756  AT3 5  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
757  AT3 5  PX4 XG .   ? PX4 C 353 . ? 1_555 ? 
758  AT4 4  LEU C  105 ? LEU C 159 . ? 1_555 ? 
759  AT4 4  GLN C  106 ? GLN C 160 . ? 1_555 ? 
760  AT4 4  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
761  AT4 4  PX4 VF .   ? PX4 C 325 . ? 1_555 ? 
762  AT5 6  PX4 PB .   ? PX4 B 315 . ? 1_555 ? 
763  AT5 6  ALA C  98  ? ALA C 152 . ? 1_555 ? 
764  AT5 6  ARG C  99  ? ARG C 153 . ? 1_555 ? 
765  AT5 6  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
766  AT5 6  PX4 SF .   ? PX4 C 322 . ? 1_555 ? 
767  AT5 6  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
768  AT6 3  ARG C  121 ? ARG C 175 . ? 1_555 ? 
769  AT6 3  ARG C  128 ? ARG C 182 . ? 1_555 ? 
770  AT6 3  PX4 OG .   ? PX4 C 344 . ? 1_555 ? 
771  AT7 5  MET C  80  ? MET C 134 . ? 1_555 ? 
772  AT7 5  ARG C  84  ? ARG C 138 . ? 1_555 ? 
773  AT7 5  PX4 QF .   ? PX4 C 320 . ? 1_555 ? 
774  AT7 5  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
775  AT7 5  PX4 CH .   ? PX4 C 358 . ? 1_555 ? 
776  AT8 6  LEU C  127 ? LEU C 181 . ? 1_555 ? 
777  AT8 6  ARG C  128 ? ARG C 182 . ? 1_555 ? 
778  AT8 6  LEU C  131 ? LEU C 185 . ? 1_555 ? 
779  AT8 6  ARG C  139 ? ARG C 193 . ? 1_555 ? 
780  AT8 6  PX4 NF .   ? PX4 C 317 . ? 1_555 ? 
781  AT8 6  PX4 YF .   ? PX4 C 328 . ? 1_555 ? 
782  AT9 3  PX4 VF .   ? PX4 C 325 . ? 1_555 ? 
783  AT9 3  PX4 JG .   ? PX4 C 339 . ? 1_555 ? 
784  AT9 3  PX4 LG .   ? PX4 C 341 . ? 1_555 ? 
785  AU1 8  PX4 JB .   ? PX4 B 309 . ? 1_555 ? 
786  AU1 8  PX4 QC .   ? PX4 B 342 . ? 1_555 ? 
787  AU1 8  ARG C  99  ? ARG C 153 . ? 1_555 ? 
788  AU1 8  PX4 DF .   ? PX4 C 307 . ? 1_555 ? 
789  AU1 8  PX4 EF .   ? PX4 C 308 . ? 1_555 ? 
790  AU1 8  PX4 SF .   ? PX4 C 322 . ? 1_555 ? 
791  AU1 8  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
792  AU1 8  PX4 QG .   ? PX4 C 346 . ? 1_555 ? 
793  AU2 6  HIS B  167 ? HIS B 221 . ? 1_555 ? 
794  AU2 6  LEU C  28  ? LEU C 82  . ? 1_555 ? 
795  AU2 6  ARG C  29  ? ARG C 83  . ? 1_555 ? 
796  AU2 6  MET C  32  ? MET C 86  . ? 1_555 ? 
797  AU2 6  SER C  33  ? SER C 87  . ? 1_555 ? 
798  AU2 6  PX4 TG .   ? PX4 C 349 . ? 1_555 ? 
799  AU3 2  PX4 AG .   ? PX4 C 330 . ? 1_555 ? 
800  AU3 2  PX4 HH .   ? PX4 C 363 . ? 1_555 ? 
801  AU4 2  LYS C  40  ? LYS C 94  . ? 1_555 ? 
802  AU4 2  PX4 DG .   ? PX4 C 333 . ? 1_555 ? 
803  AU5 3  PX4 HF .   ? PX4 C 311 . ? 1_555 ? 
804  AU5 3  PX4 OG .   ? PX4 C 344 . ? 1_555 ? 
805  AU5 3  PX4 ZG .   ? PX4 C 355 . ? 1_555 ? 
806  AU6 2  PX4 EC .   ? PX4 B 330 . ? 1_555 ? 
807  AU6 2  GLN C  55  ? GLN C 109 . ? 1_555 ? 
808  AU7 2  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
809  AU7 2  PX4 EG .   ? PX4 C 334 . ? 1_555 ? 
810  AU8 7  HIS B  123 ? HIS B 177 . ? 1_555 ? 
811  AU8 7  TYR C  83  ? TYR C 137 . ? 1_555 ? 
812  AU8 7  ARG C  91  ? ARG C 145 . ? 1_555 ? 
813  AU8 7  PX4 GF .   ? PX4 C 310 . ? 1_555 ? 
814  AU8 7  PX4 SF .   ? PX4 C 322 . ? 1_555 ? 
815  AU8 7  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
816  AU8 7  PX4 CH .   ? PX4 C 358 . ? 1_555 ? 
817  AU9 5  GLU C  203 ? GLU C 257 . ? 1_555 ? 
818  AU9 5  TYR C  204 ? TYR C 258 . ? 1_555 ? 
819  AU9 5  PX4 AG .   ? PX4 C 330 . ? 1_555 ? 
820  AU9 5  PX4 GG .   ? PX4 C 336 . ? 1_555 ? 
821  AU9 5  PX4 AH .   ? PX4 C 356 . ? 1_555 ? 
822  AV1 4  GLN C  95  ? GLN C 149 . ? 1_555 ? 
823  AV1 4  PX4 EF .   ? PX4 C 308 . ? 1_555 ? 
824  AV1 4  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
825  AV1 4  PX4 QF .   ? PX4 C 320 . ? 1_555 ? 
826  AV2 7  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
827  AV2 7  GLU C  159 ? GLU C 213 . ? 1_555 ? 
828  AV2 7  PX4 YE .   ? PX4 C 302 . ? 1_555 ? 
829  AV2 7  PX4 ZE .   ? PX4 C 303 . ? 1_555 ? 
830  AV2 7  PX4 PF .   ? PX4 C 319 . ? 1_555 ? 
831  AV2 7  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
832  AV2 7  PX4 PG .   ? PX4 C 345 . ? 1_555 ? 
833  AV3 6  LEU B  146 ? LEU B 200 . ? 1_555 ? 
834  AV3 6  GLY B  153 ? GLY B 207 . ? 1_555 ? 
835  AV3 6  PX4 EC .   ? PX4 B 330 . ? 1_555 ? 
836  AV3 6  TYR C  46  ? TYR C 100 . ? 1_555 ? 
837  AV3 6  LEU C  47  ? LEU C 101 . ? 1_555 ? 
838  AV3 6  LYS C  52  ? LYS C 106 . ? 1_555 ? 
839  AV4 8  SER C  110 ? SER C 164 . ? 1_555 ? 
840  AV4 8  LEU C  112 ? LEU C 166 . ? 1_555 ? 
841  AV4 8  GLY C  113 ? GLY C 167 . ? 1_555 ? 
842  AV4 8  GLU C  114 ? GLU C 168 . ? 1_555 ? 
843  AV4 8  ARG C  117 ? ARG C 171 . ? 1_555 ? 
844  AV4 8  ALA C  120 ? ALA C 174 . ? 1_555 ? 
845  AV4 8  PX4 DF .   ? PX4 C 307 . ? 1_555 ? 
846  AV4 8  PX4 IF .   ? PX4 C 312 . ? 1_555 ? 
847  AV5 7  GLU C  159 ? GLU C 213 . ? 1_555 ? 
848  AV5 7  PX4 ZE .   ? PX4 C 303 . ? 1_555 ? 
849  AV5 7  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
850  AV5 7  PX4 YF .   ? PX4 C 328 . ? 1_555 ? 
851  AV5 7  PX4 FG .   ? PX4 C 335 . ? 1_555 ? 
852  AV5 7  PX4 PG .   ? PX4 C 345 . ? 1_555 ? 
853  AV5 7  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
854  AV6 6  LEU B  186 ? LEU B 240 . ? 1_555 ? 
855  AV6 6  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
856  AV6 6  ARG C  7   ? ARG C 61  . ? 1_555 ? 
857  AV6 6  GLN C  15  ? GLN C 69  . ? 1_555 ? 
858  AV6 6  TRP C  18  ? TRP C 72  . ? 1_555 ? 
859  AV6 6  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
860  AV7 7  ARG C  145 ? ARG C 199 . ? 1_555 ? 
861  AV7 7  LEU C  146 ? LEU C 200 . ? 1_555 ? 
862  AV7 7  LEU C  149 ? LEU C 203 . ? 1_555 ? 
863  AV7 7  PX4 HF .   ? PX4 C 311 . ? 1_555 ? 
864  AV7 7  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
865  AV7 7  PX4 FG .   ? PX4 C 335 . ? 1_555 ? 
866  AV7 7  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
867  AV8 2  PX4 BG .   ? PX4 C 331 . ? 1_555 ? 
868  AV8 2  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
869  AV9 8  PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
870  AV9 8  PHE C  193 ? PHE C 247 . ? 1_555 ? 
871  AV9 8  SER C  196 ? SER C 250 . ? 1_555 ? 
872  AV9 8  PHE C  197 ? PHE C 251 . ? 1_555 ? 
873  AV9 8  PX4 LF .   ? PX4 C 315 . ? 1_555 ? 
874  AV9 8  PX4 RF .   ? PX4 C 321 . ? 1_555 ? 
875  AV9 8  PX4 AH .   ? PX4 C 356 . ? 1_555 ? 
876  AV9 8  PX4 BH .   ? PX4 C 357 . ? 1_555 ? 
877  AW1 5  PX4 RB .   ? PX4 B 317 . ? 1_555 ? 
878  AW1 5  VAL C  189 ? VAL C 243 . ? 1_555 ? 
879  AW1 5  LEU C  190 ? LEU C 244 . ? 1_555 ? 
880  AW1 5  PHE C  193 ? PHE C 247 . ? 1_555 ? 
881  AW1 5  PX4 ZF .   ? PX4 C 329 . ? 1_555 ? 
882  AW2 6  PHE B  193 ? PHE B 247 . ? 1_555 ? 
883  AW2 6  PX4 BC .   ? PX4 B 327 . ? 1_555 ? 
884  AW2 6  PX4 UE .   ? PX4 B 398 . ? 1_555 ? 
885  AW2 6  PHE C  3   ? PHE C 57  . ? 1_555 ? 
886  AW2 6  SER C  4   ? SER C 58  . ? 1_555 ? 
887  AW2 6  ARG C  7   ? ARG C 61  . ? 1_555 ? 
888  AW3 4  PX4 MF .   ? PX4 C 316 . ? 1_555 ? 
889  AW3 4  PX4 TG .   ? PX4 C 349 . ? 1_555 ? 
890  AW3 4  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
891  AW3 4  PX4 JH .   ? PX4 C 365 . ? 1_555 ? 
892  AW4 3  PX4 XB .   ? PX4 B 323 . ? 1_555 ? 
893  AW4 3  SER C  172 ? SER C 226 . ? 1_555 ? 
894  AW4 3  PX4 PF .   ? PX4 C 319 . ? 1_555 ? 
895  AW5 7  PX4 EB .   ? PX4 B 304 . ? 1_555 ? 
896  AW5 7  ARG C  145 ? ARG C 199 . ? 1_555 ? 
897  AW5 7  LEU C  149 ? LEU C 203 . ? 1_555 ? 
898  AW5 7  ARG C  156 ? ARG C 210 . ? 1_555 ? 
899  AW5 7  GLU C  159 ? GLU C 213 . ? 1_555 ? 
900  AW5 7  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
901  AW5 7  PX4 YF .   ? PX4 C 328 . ? 1_555 ? 
902  AW6 7  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
903  AW6 7  PX4 VE .   ? PX4 B 399 . ? 1_555 ? 
904  AW6 7  LYS C  207 ? LYS C 261 . ? 1_555 ? 
905  AW6 7  LEU C  208 ? LEU C 262 . ? 1_555 ? 
906  AW6 7  THR C  210 ? THR C 264 . ? 1_555 ? 
907  AW6 7  GLN C  211 ? GLN C 265 . ? 1_555 ? 
908  AW6 7  PX4 RF .   ? PX4 C 321 . ? 1_555 ? 
909  AW7 6  PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
910  AW7 6  PX4 BA .   ? PX4 A 625 . ? 1_555 ? 
911  AW7 6  PX4 EF .   ? PX4 C 308 . ? 1_555 ? 
912  AW7 6  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
913  AW7 6  PX4 QG .   ? PX4 C 346 . ? 1_555 ? 
914  AW7 6  PX4 VG .   ? PX4 C 351 . ? 1_555 ? 
915  AW8 4  PX4 RG .   ? PX4 C 347 . ? 1_555 ? 
916  AW8 4  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
917  AW8 4  PX4 HH .   ? PX4 C 363 . ? 1_555 ? 
918  AW8 4  PX4 KH .   ? PX4 C 366 . ? 1_555 ? 
919  AW9 2  PX4 IF .   ? PX4 C 312 . ? 1_555 ? 
920  AW9 2  PX4 QG .   ? PX4 C 346 . ? 1_555 ? 
921  AX1 7  PX4 Q  .   ? PX4 A 614 . ? 1_555 ? 
922  AX1 7  PX4 IC .   ? PX4 B 334 . ? 1_555 ? 
923  AX1 7  PX4 SE .   ? PX4 B 396 . ? 1_555 ? 
924  AX1 7  PX4 TE .   ? PX4 B 397 . ? 1_555 ? 
925  AX1 7  PX4 GF .   ? PX4 C 310 . ? 1_555 ? 
926  AX1 7  PX4 QF .   ? PX4 C 320 . ? 1_555 ? 
927  AX1 7  PX4 CH .   ? PX4 C 358 . ? 1_555 ? 
928  AX2 5  PX4 YD .   ? PX4 B 376 . ? 1_555 ? 
929  AX2 5  PX4 IF .   ? PX4 C 312 . ? 1_555 ? 
930  AX2 5  PX4 OG .   ? PX4 C 344 . ? 1_555 ? 
931  AX2 5  PX4 ZG .   ? PX4 C 355 . ? 1_555 ? 
932  AX2 5  PX4 GH .   ? PX4 C 362 . ? 1_555 ? 
933  AX3 5  PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
934  AX3 5  PX4 YC .   ? PX4 B 350 . ? 1_555 ? 
935  AX3 5  PX4 SE .   ? PX4 B 396 . ? 1_555 ? 
936  AX3 5  PX4 NG .   ? PX4 C 343 . ? 1_555 ? 
937  AX3 5  PX4 MH .   ? PX4 C 368 . ? 1_555 ? 
938  AX4 5  PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
939  AX4 5  PX4 VB .   ? PX4 B 321 . ? 1_555 ? 
940  AX4 5  PX4 RC .   ? PX4 B 343 . ? 1_555 ? 
941  AX4 5  PX4 MG .   ? PX4 C 342 . ? 1_555 ? 
942  AX4 5  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
943  AX5 4  ARG C  128 ? ARG C 182 . ? 1_555 ? 
944  AX5 4  PX4 FF .   ? PX4 C 309 . ? 1_555 ? 
945  AX5 4  PX4 NF .   ? PX4 C 317 . ? 1_555 ? 
946  AX5 4  PX4 LG .   ? PX4 C 341 . ? 1_555 ? 
947  AX6 4  PX4 TF .   ? PX4 C 323 . ? 1_555 ? 
948  AX6 4  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
949  AX6 4  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
950  AX6 4  PX4 IH .   ? PX4 C 364 . ? 1_555 ? 
951  AX7 4  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
952  AX7 4  PX4 JF .   ? PX4 C 313 . ? 1_555 ? 
953  AX7 4  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
954  AX7 4  PX4 JG .   ? PX4 C 339 . ? 1_555 ? 
955  AX8 3  PX4 IG .   ? PX4 C 338 . ? 1_555 ? 
956  AX8 3  PX4 YG .   ? PX4 C 354 . ? 1_555 ? 
957  AX8 3  PX4 KH .   ? PX4 C 366 . ? 1_555 ? 
958  AX9 8  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
959  AX9 8  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
960  AX9 8  PX4 DC .   ? PX4 B 329 . ? 1_555 ? 
961  AX9 8  PX4 UE .   ? PX4 B 398 . ? 1_555 ? 
962  AX9 8  TRP C  18  ? TRP C 72  . ? 1_555 ? 
963  AX9 8  PX4 CF .   ? PX4 C 306 . ? 1_555 ? 
964  AX9 8  PX4 XF .   ? PX4 C 327 . ? 1_555 ? 
965  AX9 8  PX4 OH .   ? PX4 C 370 . ? 1_555 ? 
966  AY1 4  PX4 QB .   ? PX4 B 316 . ? 1_555 ? 
967  AY1 4  PX4 KF .   ? PX4 C 314 . ? 1_555 ? 
968  AY1 4  PX4 DG .   ? PX4 C 333 . ? 1_555 ? 
969  AY1 4  PX4 XG .   ? PX4 C 353 . ? 1_555 ? 
970  AY2 3  PX4 BB .   ? PX4 B 301 . ? 1_555 ? 
971  AY2 3  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
972  AY2 3  PX4 LH .   ? PX4 C 367 . ? 1_555 ? 
973  AY3 4  PX4 N  .   ? PX4 A 611 . ? 1_555 ? 
974  AY3 4  PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
975  AY3 4  PX4 YC .   ? PX4 B 350 . ? 1_555 ? 
976  AY3 4  PX4 HG .   ? PX4 C 337 . ? 1_555 ? 
977  AY4 6  PX4 ZC .   ? PX4 B 351 . ? 1_555 ? 
978  AY4 6  PX4 WF .   ? PX4 C 326 . ? 1_555 ? 
979  AY4 6  PX4 YF .   ? PX4 C 328 . ? 1_555 ? 
980  AY4 6  PX4 PG .   ? PX4 C 345 . ? 1_555 ? 
981  AY4 6  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
982  AY4 6  PX4 IH .   ? PX4 C 364 . ? 1_555 ? 
983  AY5 3  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
984  AY5 3  PX4 CF .   ? PX4 C 306 . ? 1_555 ? 
985  AY5 3  PX4 TG .   ? PX4 C 349 . ? 1_555 ? 
986  AY6 4  PX4 ED .   ? PX4 B 356 . ? 1_555 ? 
987  AY6 4  PX4 RG .   ? PX4 C 347 . ? 1_555 ? 
988  AY6 4  PX4 KH .   ? PX4 C 366 . ? 1_555 ? 
989  AY6 4  PX4 NH .   ? PX4 C 369 . ? 1_555 ? 
990  AY7 4  PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
991  AY7 4  PX4 NF .   ? PX4 C 317 . ? 1_555 ? 
992  AY7 4  PX4 LG .   ? PX4 C 341 . ? 1_555 ? 
993  AY7 4  PX4 LH .   ? PX4 C 367 . ? 1_555 ? 
994  AY8 3  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
995  AY8 3  PX4 RF .   ? PX4 C 321 . ? 1_555 ? 
996  AY8 3  PX4 AG .   ? PX4 C 330 . ? 1_555 ? 
997  AY9 4  PX4 U  .   ? PX4 A 618 . ? 1_555 ? 
998  AY9 4  PX4 EA .   ? PX4 A 628 . ? 1_555 ? 
999  AY9 4  PX4 AG .   ? PX4 C 330 . ? 1_555 ? 
1000 AY9 4  PX4 HH .   ? PX4 C 363 . ? 1_555 ? 
1001 AZ1 5  PX4 O  .   ? PX4 A 612 . ? 1_555 ? 
1002 AZ1 5  PX4 HB .   ? PX4 B 307 . ? 1_555 ? 
1003 AZ1 5  PX4 GF .   ? PX4 C 310 . ? 1_555 ? 
1004 AZ1 5  PX4 QF .   ? PX4 C 320 . ? 1_555 ? 
1005 AZ1 5  PX4 KG .   ? PX4 C 340 . ? 1_555 ? 
1006 AZ2 6  PX4 W  .   ? PX4 A 620 . ? 1_555 ? 
1007 AZ2 6  PX4 IA .   ? PX4 A 632 . ? 1_555 ? 
1008 AZ2 6  PX4 ZF .   ? PX4 C 329 . ? 1_555 ? 
1009 AZ2 6  PX4 IG .   ? PX4 C 338 . ? 1_555 ? 
1010 AZ2 6  PX4 HH .   ? PX4 C 363 . ? 1_555 ? 
1011 AZ2 6  PX4 KH .   ? PX4 C 366 . ? 1_555 ? 
1012 AZ3 6  PX4 E  .   ? PX4 A 602 . ? 1_555 ? 
1013 AZ3 6  PX4 R  .   ? PX4 A 615 . ? 1_555 ? 
1014 AZ3 6  PX4 FA .   ? PX4 A 629 . ? 1_555 ? 
1015 AZ3 6  PX4 DG .   ? PX4 C 333 . ? 1_555 ? 
1016 AZ3 6  PX4 NG .   ? PX4 C 343 . ? 1_555 ? 
1017 AZ3 6  PX4 JH .   ? PX4 C 365 . ? 1_555 ? 
1018 AZ4 7  PX4 AA .   ? PX4 A 624 . ? 1_555 ? 
1019 AZ4 7  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
1020 AZ4 7  PX4 ZC .   ? PX4 B 351 . ? 1_555 ? 
1021 AZ4 7  PX4 BE .   ? PX4 B 379 . ? 1_555 ? 
1022 AZ4 7  PX4 UG .   ? PX4 C 350 . ? 1_555 ? 
1023 AZ4 7  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
1024 AZ4 7  PX4 LH .   ? PX4 C 367 . ? 1_555 ? 
1025 AZ5 3  PX4 P  .   ? PX4 A 613 . ? 1_555 ? 
1026 AZ5 3  PX4 HE .   ? PX4 B 385 . ? 1_555 ? 
1027 AZ5 3  PX4 LG .   ? PX4 C 341 . ? 1_555 ? 
1028 AZ6 4  PX4 LF .   ? PX4 C 315 . ? 1_555 ? 
1029 AZ6 4  PX4 IG .   ? PX4 C 338 . ? 1_555 ? 
1030 AZ6 4  PX4 BH .   ? PX4 C 357 . ? 1_555 ? 
1031 AZ6 4  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
1032 AZ7 3  PX4 PG .   ? PX4 C 345 . ? 1_555 ? 
1033 AZ7 3  PX4 WG .   ? PX4 C 352 . ? 1_555 ? 
1034 AZ7 3  PX4 NH .   ? PX4 C 369 . ? 1_555 ? 
1035 AZ8 5  PX4 T  .   ? PX4 A 617 . ? 1_555 ? 
1036 AZ8 5  PX4 X  .   ? PX4 A 621 . ? 1_555 ? 
1037 AZ8 5  PX4 CA .   ? PX4 A 626 . ? 1_555 ? 
1038 AZ8 5  PX4 DG .   ? PX4 C 333 . ? 1_555 ? 
1039 AZ8 5  PX4 EH .   ? PX4 C 360 . ? 1_555 ? 
1040 AZ9 5  PX4 IG .   ? PX4 C 338 . ? 1_555 ? 
1041 AZ9 5  PX4 RG .   ? PX4 C 347 . ? 1_555 ? 
1042 AZ9 5  PX4 YG .   ? PX4 C 354 . ? 1_555 ? 
1043 AZ9 5  PX4 DH .   ? PX4 C 359 . ? 1_555 ? 
1044 AZ9 5  PX4 NH .   ? PX4 C 369 . ? 1_555 ? 
1045 BC1 5  PX4 S  .   ? PX4 A 616 . ? 1_555 ? 
1046 BC1 5  PX4 GA .   ? PX4 A 630 . ? 1_555 ? 
1047 BC1 5  PX4 UG .   ? PX4 C 350 . ? 1_555 ? 
1048 BC1 5  PX4 ZG .   ? PX4 C 355 . ? 1_555 ? 
1049 BC1 5  PX4 FH .   ? PX4 C 361 . ? 1_555 ? 
1050 BC2 2  PX4 M  .   ? PX4 A 610 . ? 1_555 ? 
1051 BC2 2  PX4 MG .   ? PX4 C 342 . ? 1_555 ? 
1052 BC3 3  PX4 YG .   ? PX4 C 354 . ? 1_555 ? 
1053 BC3 3  PX4 IH .   ? PX4 C 364 . ? 1_555 ? 
1054 BC3 3  PX4 KH .   ? PX4 C 366 . ? 1_555 ? 
1055 BC4 4  PX4 JA .   ? PX4 A 633 . ? 1_555 ? 
1056 BC4 4  PX4 UE .   ? PX4 B 398 . ? 1_555 ? 
1057 BC4 4  PX4 WE .   ? PX4 B 400 . ? 1_555 ? 
1058 BC4 4  PX4 SG .   ? PX4 C 348 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6CLZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N    . PRO A  1 1   ? 9.739   -17.189 -40.541 1.00 0.00 ?  316 PRO A N    1  
ATOM   2      C  CA   . PRO A  1 1   ? 10.076  -17.267 -39.078 1.00 0.00 ?  316 PRO A CA   1  
ATOM   3      C  C    . PRO A  1 1   ? 8.908   -17.861 -38.301 1.00 0.00 ?  316 PRO A C    1  
ATOM   4      O  O    . PRO A  1 1   ? 7.797   -18.009 -38.794 1.00 0.00 ?  316 PRO A O    1  
ATOM   5      C  CB   . PRO A  1 1   ? 10.284  -15.743 -38.651 1.00 0.00 ?  316 PRO A CB   1  
ATOM   6      C  CG   . PRO A  1 1   ? 9.909   -14.889 -39.857 1.00 0.00 ?  316 PRO A CG   1  
ATOM   7      C  CD   . PRO A  1 1   ? 9.112   -15.835 -40.804 1.00 0.00 ?  316 PRO A CD   1  
ATOM   8      H  H2   . PRO A  1 1   ? 9.003   -17.835 -40.771 1.00 0.00 ?  316 PRO A H2   1  
ATOM   9      H  H3   . PRO A  1 1   ? 10.574  -17.361 -41.076 1.00 0.00 ?  316 PRO A H3   1  
ATOM   10     H  HA   . PRO A  1 1   ? 10.954  -17.893 -39.007 1.00 0.00 ?  316 PRO A HA   1  
ATOM   11     H  HB2  . PRO A  1 1   ? 9.881   -15.496 -37.645 1.00 0.00 ?  316 PRO A HB2  1  
ATOM   12     H  HB3  . PRO A  1 1   ? 11.360  -15.579 -38.428 1.00 0.00 ?  316 PRO A HB3  1  
ATOM   13     H  HG2  . PRO A  1 1   ? 9.369   -13.980 -39.517 1.00 0.00 ?  316 PRO A HG2  1  
ATOM   14     H  HG3  . PRO A  1 1   ? 10.835  -14.473 -40.309 1.00 0.00 ?  316 PRO A HG3  1  
ATOM   15     H  HD2  . PRO A  1 1   ? 8.036   -15.979 -40.570 1.00 0.00 ?  316 PRO A HD2  1  
ATOM   16     H  HD3  . PRO A  1 1   ? 9.325   -15.615 -41.872 1.00 0.00 ?  316 PRO A HD3  1  
ATOM   17     N  N    . ASN A  1 2   ? 9.154   -18.235 -37.007 1.00 0.00 ?  317 ASN A N    1  
ATOM   18     C  CA   . ASN A  1 2   ? 8.077   -18.627 -36.128 1.00 0.00 ?  317 ASN A CA   1  
ATOM   19     C  C    . ASN A  1 2   ? 7.356   -17.384 -35.583 1.00 0.00 ?  317 ASN A C    1  
ATOM   20     O  O    . ASN A  1 2   ? 7.959   -16.372 -35.274 1.00 0.00 ?  317 ASN A O    1  
ATOM   21     C  CB   . ASN A  1 2   ? 8.495   -19.439 -34.849 1.00 0.00 ?  317 ASN A CB   1  
ATOM   22     C  CG   . ASN A  1 2   ? 9.218   -20.760 -35.192 1.00 0.00 ?  317 ASN A CG   1  
ATOM   23     O  OD1  . ASN A  1 2   ? 8.746   -21.618 -35.954 1.00 0.00 ?  317 ASN A OD1  1  
ATOM   24     N  ND2  . ASN A  1 2   ? 10.461  -20.914 -34.644 1.00 0.00 ?  317 ASN A ND2  1  
ATOM   25     H  H    . ASN A  1 2   ? 10.059  -18.097 -36.613 1.00 0.00 ?  317 ASN A H    1  
ATOM   26     H  HA   . ASN A  1 2   ? 7.347   -19.175 -36.706 1.00 0.00 ?  317 ASN A HA   1  
ATOM   27     H  HB2  . ASN A  1 2   ? 9.090   -18.864 -34.107 1.00 0.00 ?  317 ASN A HB2  1  
ATOM   28     H  HB3  . ASN A  1 2   ? 7.600   -19.614 -34.214 1.00 0.00 ?  317 ASN A HB3  1  
ATOM   29     H  HD21 . ASN A  1 2   ? 10.967  -21.645 -35.104 1.00 0.00 ?  317 ASN A HD21 1  
ATOM   30     H  HD22 . ASN A  1 2   ? 10.800  -20.198 -34.035 1.00 0.00 ?  317 ASN A HD22 1  
ATOM   31     N  N    . ILE A  1 3   ? 6.011   -17.502 -35.351 1.00 0.00 ?  318 ILE A N    1  
ATOM   32     C  CA   . ILE A  1 3   ? 5.102   -16.586 -34.691 1.00 0.00 ?  318 ILE A CA   1  
ATOM   33     C  C    . ILE A  1 3   ? 5.513   -16.493 -33.223 1.00 0.00 ?  318 ILE A C    1  
ATOM   34     O  O    . ILE A  1 3   ? 5.563   -15.404 -32.606 1.00 0.00 ?  318 ILE A O    1  
ATOM   35     C  CB   . ILE A  1 3   ? 3.678   -16.889 -34.957 1.00 0.00 ?  318 ILE A CB   1  
ATOM   36     C  CG1  . ILE A  1 3   ? 2.728   -15.660 -34.712 1.00 0.00 ?  318 ILE A CG1  1  
ATOM   37     C  CG2  . ILE A  1 3   ? 3.091   -17.966 -33.976 1.00 0.00 ?  318 ILE A CG2  1  
ATOM   38     C  CD1  . ILE A  1 3   ? 2.827   -14.593 -35.822 1.00 0.00 ?  318 ILE A CD1  1  
ATOM   39     H  H    . ILE A  1 3   ? 5.528   -18.332 -35.619 1.00 0.00 ?  318 ILE A H    1  
ATOM   40     H  HA   . ILE A  1 3   ? 5.305   -15.570 -34.996 1.00 0.00 ?  318 ILE A HA   1  
ATOM   41     H  HB   . ILE A  1 3   ? 3.744   -17.301 -35.987 1.00 0.00 ?  318 ILE A HB   1  
ATOM   42     H  HG12 . ILE A  1 3   ? 1.661   -15.970 -34.744 1.00 0.00 ?  318 ILE A HG12 1  
ATOM   43     H  HG13 . ILE A  1 3   ? 2.970   -15.276 -33.698 1.00 0.00 ?  318 ILE A HG13 1  
ATOM   44     H  HG21 . ILE A  1 3   ? 2.790   -17.673 -32.947 1.00 0.00 ?  318 ILE A HG21 1  
ATOM   45     H  HG22 . ILE A  1 3   ? 3.758   -18.852 -33.912 1.00 0.00 ?  318 ILE A HG22 1  
ATOM   46     H  HG23 . ILE A  1 3   ? 2.087   -18.226 -34.372 1.00 0.00 ?  318 ILE A HG23 1  
ATOM   47     H  HD11 . ILE A  1 3   ? 2.327   -14.927 -36.757 1.00 0.00 ?  318 ILE A HD11 1  
ATOM   48     H  HD12 . ILE A  1 3   ? 3.846   -14.335 -36.183 1.00 0.00 ?  318 ILE A HD12 1  
ATOM   49     H  HD13 . ILE A  1 3   ? 2.207   -13.697 -35.604 1.00 0.00 ?  318 ILE A HD13 1  
ATOM   50     N  N    . CYS A  1 4   ? 5.918   -17.617 -32.568 1.00 0.00 ?  319 CYS A N    1  
ATOM   51     C  CA   . CYS A  1 4   ? 6.262   -17.632 -31.112 1.00 0.00 ?  319 CYS A CA   1  
ATOM   52     C  C    . CYS A  1 4   ? 7.495   -16.935 -30.734 1.00 0.00 ?  319 CYS A C    1  
ATOM   53     O  O    . CYS A  1 4   ? 7.731   -16.711 -29.554 1.00 0.00 ?  319 CYS A O    1  
ATOM   54     C  CB   . CYS A  1 4   ? 6.406   -19.044 -30.481 1.00 0.00 ?  319 CYS A CB   1  
ATOM   55     S  SG   . CYS A  1 4   ? 5.312   -20.270 -31.046 1.00 0.00 ?  319 CYS A SG   1  
ATOM   56     H  H    . CYS A  1 4   ? 5.706   -18.537 -32.888 1.00 0.00 ?  319 CYS A H    1  
ATOM   57     H  HA   . CYS A  1 4   ? 5.476   -17.015 -30.703 1.00 0.00 ?  319 CYS A HA   1  
ATOM   58     H  HB2  . CYS A  1 4   ? 7.474   -19.350 -30.496 1.00 0.00 ?  319 CYS A HB2  1  
ATOM   59     H  HB3  . CYS A  1 4   ? 6.101   -18.954 -29.416 1.00 0.00 ?  319 CYS A HB3  1  
ATOM   60     H  HG   . CYS A  1 4   ? 5.838   -21.285 -30.375 1.00 0.00 ?  319 CYS A HG   1  
ATOM   61     N  N    . ASP A  1 5   ? 8.295   -16.449 -31.725 1.00 0.00 ?  320 ASP A N    1  
ATOM   62     C  CA   . ASP A  1 5   ? 9.566   -15.875 -31.487 1.00 0.00 ?  320 ASP A CA   1  
ATOM   63     C  C    . ASP A  1 5   ? 9.417   -14.247 -31.603 1.00 0.00 ?  320 ASP A C    1  
ATOM   64     O  O    . ASP A  1 5   ? 10.394  -13.548 -31.222 1.00 0.00 ?  320 ASP A O    1  
ATOM   65     C  CB   . ASP A  1 5   ? 10.535  -16.351 -32.557 1.00 0.00 ?  320 ASP A CB   1  
ATOM   66     C  CG   . ASP A  1 5   ? 10.846  -17.829 -32.453 1.00 0.00 ?  320 ASP A CG   1  
ATOM   67     O  OD1  . ASP A  1 5   ? 10.625  -18.477 -31.415 1.00 0.00 ?  320 ASP A OD1  1  
ATOM   68     O  OD2  . ASP A  1 5   ? 11.566  -18.283 -33.373 1.00 0.00 -1 320 ASP A OD2  1  
ATOM   69     H  H    . ASP A  1 5   ? 7.970   -16.464 -32.667 1.00 0.00 ?  320 ASP A H    1  
ATOM   70     H  HA   . ASP A  1 5   ? 9.894   -16.106 -30.485 1.00 0.00 ?  320 ASP A HA   1  
ATOM   71     H  HB2  . ASP A  1 5   ? 10.224  -16.140 -33.603 1.00 0.00 ?  320 ASP A HB2  1  
ATOM   72     H  HB3  . ASP A  1 5   ? 11.519  -15.917 -32.279 1.00 0.00 ?  320 ASP A HB3  1  
ATOM   73     N  N    . GLY A  1 6   ? 8.204   -13.750 -31.975 1.00 0.00 ?  321 GLY A N    1  
ATOM   74     C  CA   . GLY A  1 6   ? 7.732   -12.363 -31.945 1.00 0.00 ?  321 GLY A CA   1  
ATOM   75     C  C    . GLY A  1 6   ? 8.598   -11.342 -32.604 1.00 0.00 ?  321 GLY A C    1  
ATOM   76     O  O    . GLY A  1 6   ? 9.338   -11.652 -33.543 1.00 0.00 ?  321 GLY A O    1  
ATOM   77     H  H    . GLY A  1 6   ? 7.563   -14.402 -32.373 1.00 0.00 ?  321 GLY A H    1  
ATOM   78     H  HA2  . GLY A  1 6   ? 6.792   -12.279 -32.470 1.00 0.00 ?  321 GLY A HA2  1  
ATOM   79     H  HA3  . GLY A  1 6   ? 7.553   -12.055 -30.926 1.00 0.00 ?  321 GLY A HA3  1  
ATOM   80     N  N    . ASN A  1 7   ? 8.592   -10.092 -32.025 1.00 0.00 ?  322 ASN A N    1  
ATOM   81     C  CA   . ASN A  1 7   ? 9.461   -9.043  -32.421 1.00 0.00 ?  322 ASN A CA   1  
ATOM   82     C  C    . ASN A  1 7   ? 9.084   -8.399  -33.744 1.00 0.00 ?  322 ASN A C    1  
ATOM   83     O  O    . ASN A  1 7   ? 9.943   -8.015  -34.547 1.00 0.00 ?  322 ASN A O    1  
ATOM   84     C  CB   . ASN A  1 7   ? 10.992  -9.328  -32.308 1.00 0.00 ?  322 ASN A CB   1  
ATOM   85     C  CG   . ASN A  1 7   ? 11.249  -9.543  -30.786 1.00 0.00 ?  322 ASN A CG   1  
ATOM   86     O  OD1  . ASN A  1 7   ? 11.552  -8.567  -30.088 1.00 0.00 ?  322 ASN A OD1  1  
ATOM   87     N  ND2  . ASN A  1 7   ? 11.279  -10.813 -30.309 1.00 0.00 ?  322 ASN A ND2  1  
ATOM   88     H  H    . ASN A  1 7   ? 8.037   -9.883  -31.224 1.00 0.00 ?  322 ASN A H    1  
ATOM   89     H  HA   . ASN A  1 7   ? 9.211   -8.233  -31.751 1.00 0.00 ?  322 ASN A HA   1  
ATOM   90     H  HB2  . ASN A  1 7   ? 11.218  -10.234 -32.911 1.00 0.00 ?  322 ASN A HB2  1  
ATOM   91     H  HB3  . ASN A  1 7   ? 11.416  -8.355  -32.636 1.00 0.00 ?  322 ASN A HB3  1  
ATOM   92     H  HD21 . ASN A  1 7   ? 11.249  -10.898 -29.313 1.00 0.00 ?  322 ASN A HD21 1  
ATOM   93     H  HD22 . ASN A  1 7   ? 11.198  -11.607 -30.912 1.00 0.00 ?  322 ASN A HD22 1  
ATOM   94     N  N    . PHE A  1 8   ? 7.774   -8.471  -34.137 1.00 0.00 ?  323 PHE A N    1  
ATOM   95     C  CA   . PHE A  1 8   ? 7.204   -7.928  -35.345 1.00 0.00 ?  323 PHE A CA   1  
ATOM   96     C  C    . PHE A  1 8   ? 7.424   -6.413  -35.537 1.00 0.00 ?  323 PHE A C    1  
ATOM   97     O  O    . PHE A  1 8   ? 7.327   -5.655  -34.606 1.00 0.00 ?  323 PHE A O    1  
ATOM   98     C  CB   . PHE A  1 8   ? 5.691   -8.099  -35.322 1.00 0.00 ?  323 PHE A CB   1  
ATOM   99     C  CG   . PHE A  1 8   ? 5.270   -9.405  -34.780 1.00 0.00 ?  323 PHE A CG   1  
ATOM   100    C  CD1  . PHE A  1 8   ? 5.701   -10.609 -35.365 1.00 0.00 ?  323 PHE A CD1  1  
ATOM   101    C  CD2  . PHE A  1 8   ? 4.423   -9.498  -33.675 1.00 0.00 ?  323 PHE A CD2  1  
ATOM   102    C  CE1  . PHE A  1 8   ? 5.370   -11.871 -34.761 1.00 0.00 ?  323 PHE A CE1  1  
ATOM   103    C  CE2  . PHE A  1 8   ? 4.029   -10.729 -33.117 1.00 0.00 ?  323 PHE A CE2  1  
ATOM   104    C  CZ   . PHE A  1 8   ? 4.528   -11.885 -33.636 1.00 0.00 ?  323 PHE A CZ   1  
ATOM   105    H  H    . PHE A  1 8   ? 7.148   -8.952  -33.527 1.00 0.00 ?  323 PHE A H    1  
ATOM   106    H  HA   . PHE A  1 8   ? 7.702   -8.426  -36.164 1.00 0.00 ?  323 PHE A HA   1  
ATOM   107    H  HB2  . PHE A  1 8   ? 5.232   -7.337  -34.657 1.00 0.00 ?  323 PHE A HB2  1  
ATOM   108    H  HB3  . PHE A  1 8   ? 5.300   -7.921  -36.347 1.00 0.00 ?  323 PHE A HB3  1  
ATOM   109    H  HD1  . PHE A  1 8   ? 6.452   -10.503 -36.134 1.00 0.00 ?  323 PHE A HD1  1  
ATOM   110    H  HD2  . PHE A  1 8   ? 4.065   -8.645  -33.117 1.00 0.00 ?  323 PHE A HD2  1  
ATOM   111    H  HE1  . PHE A  1 8   ? 5.509   -12.735 -35.394 1.00 0.00 ?  323 PHE A HE1  1  
ATOM   112    H  HE2  . PHE A  1 8   ? 3.310   -10.728 -32.312 1.00 0.00 ?  323 PHE A HE2  1  
ATOM   113    H  HZ   . PHE A  1 8   ? 4.388   -12.841 -33.153 1.00 0.00 ?  323 PHE A HZ   1  
ATOM   114    N  N    . ASP A  1 9   ? 7.685   -6.047  -36.793 1.00 0.00 ?  324 ASP A N    1  
ATOM   115    C  CA   . ASP A  1 9   ? 8.000   -4.659  -37.167 1.00 0.00 ?  324 ASP A CA   1  
ATOM   116    C  C    . ASP A  1 9   ? 6.772   -3.784  -37.205 1.00 0.00 ?  324 ASP A C    1  
ATOM   117    O  O    . ASP A  1 9   ? 6.828   -2.583  -37.014 1.00 0.00 ?  324 ASP A O    1  
ATOM   118    C  CB   . ASP A  1 9   ? 8.663   -4.654  -38.618 1.00 0.00 ?  324 ASP A CB   1  
ATOM   119    C  CG   . ASP A  1 9   ? 10.058  -5.195  -38.439 1.00 0.00 ?  324 ASP A CG   1  
ATOM   120    O  OD1  . ASP A  1 9   ? 10.568  -5.638  -39.482 1.00 0.00 ?  324 ASP A OD1  1  
ATOM   121    O  OD2  . ASP A  1 9   ? 10.582  -5.189  -37.287 1.00 0.00 -1 324 ASP A OD2  1  
ATOM   122    H  H    . ASP A  1 9   ? 7.625   -6.761  -37.487 1.00 0.00 ?  324 ASP A H    1  
ATOM   123    H  HA   . ASP A  1 9   ? 8.670   -4.245  -36.428 1.00 0.00 ?  324 ASP A HA   1  
ATOM   124    H  HB2  . ASP A  1 9   ? 8.142   -5.392  -39.265 1.00 0.00 ?  324 ASP A HB2  1  
ATOM   125    H  HB3  . ASP A  1 9   ? 8.742   -3.643  -39.073 1.00 0.00 ?  324 ASP A HB3  1  
ATOM   126    N  N    . THR A  1 10  ? 5.596   -4.292  -37.673 1.00 0.00 ?  325 THR A N    1  
ATOM   127    C  CA   . THR A  1 10  ? 4.361   -3.469  -37.550 1.00 0.00 ?  325 THR A CA   1  
ATOM   128    C  C    . THR A  1 10  ? 3.233   -4.373  -37.622 1.00 0.00 ?  325 THR A C    1  
ATOM   129    O  O    . THR A  1 10  ? 3.234   -5.415  -38.288 1.00 0.00 ?  325 THR A O    1  
ATOM   130    C  CB   . THR A  1 10  ? 4.294   -2.356  -38.702 1.00 0.00 ?  325 THR A CB   1  
ATOM   131    O  OG1  . THR A  1 10  ? 3.084   -1.609  -38.694 1.00 0.00 ?  325 THR A OG1  1  
ATOM   132    C  CG2  . THR A  1 10  ? 4.543   -3.000  -40.062 1.00 0.00 ?  325 THR A CG2  1  
ATOM   133    H  H    . THR A  1 10  ? 5.510   -5.254  -37.920 1.00 0.00 ?  325 THR A H    1  
ATOM   134    H  HA   . THR A  1 10  ? 4.576   -2.941  -36.633 1.00 0.00 ?  325 THR A HA   1  
ATOM   135    H  HB   . THR A  1 10  ? 5.078   -1.590  -38.523 1.00 0.00 ?  325 THR A HB   1  
ATOM   136    H  HG1  . THR A  1 10  ? 3.206   -0.882  -38.079 1.00 0.00 ?  325 THR A HG1  1  
ATOM   137    H  HG21 . THR A  1 10  ? 4.112   -3.974  -40.378 1.00 0.00 ?  325 THR A HG21 1  
ATOM   138    H  HG22 . THR A  1 10  ? 5.638   -3.167  -40.150 1.00 0.00 ?  325 THR A HG22 1  
ATOM   139    H  HG23 . THR A  1 10  ? 4.329   -2.225  -40.829 1.00 0.00 ?  325 THR A HG23 1  
ATOM   140    N  N    . VAL A  1 11  ? 2.207   -4.076  -36.814 1.00 0.00 ?  326 VAL A N    1  
ATOM   141    C  CA   . VAL A  1 11  ? 0.906   -4.765  -36.833 1.00 0.00 ?  326 VAL A CA   1  
ATOM   142    C  C    . VAL A  1 11  ? -0.260  -3.771  -37.176 1.00 0.00 ?  326 VAL A C    1  
ATOM   143    O  O    . VAL A  1 11  ? -0.499  -2.851  -36.377 1.00 0.00 ?  326 VAL A O    1  
ATOM   144    C  CB   . VAL A  1 11  ? 0.612   -5.409  -35.482 1.00 0.00 ?  326 VAL A CB   1  
ATOM   145    C  CG1  . VAL A  1 11  ? -0.823  -6.106  -35.555 1.00 0.00 ?  326 VAL A CG1  1  
ATOM   146    C  CG2  . VAL A  1 11  ? 1.786   -6.343  -35.079 1.00 0.00 ?  326 VAL A CG2  1  
ATOM   147    H  H    . VAL A  1 11  ? 2.381   -3.326  -36.179 1.00 0.00 ?  326 VAL A H    1  
ATOM   148    H  HA   . VAL A  1 11  ? 1.036   -5.581  -37.529 1.00 0.00 ?  326 VAL A HA   1  
ATOM   149    H  HB   . VAL A  1 11  ? 0.682   -4.537  -34.797 1.00 0.00 ?  326 VAL A HB   1  
ATOM   150    H  HG11 . VAL A  1 11  ? -0.873  -6.787  -36.432 1.00 0.00 ?  326 VAL A HG11 1  
ATOM   151    H  HG12 . VAL A  1 11  ? -1.595  -5.315  -35.673 1.00 0.00 ?  326 VAL A HG12 1  
ATOM   152    H  HG13 . VAL A  1 11  ? -1.162  -6.794  -34.751 1.00 0.00 ?  326 VAL A HG13 1  
ATOM   153    H  HG21 . VAL A  1 11  ? 1.438   -6.775  -34.116 1.00 0.00 ?  326 VAL A HG21 1  
ATOM   154    H  HG22 . VAL A  1 11  ? 2.736   -5.772  -35.000 1.00 0.00 ?  326 VAL A HG22 1  
ATOM   155    H  HG23 . VAL A  1 11  ? 1.937   -7.127  -35.852 1.00 0.00 ?  326 VAL A HG23 1  
ATOM   156    N  N    . ALA A  1 12  ? -1.120  -4.010  -38.207 1.00 0.00 ?  327 ALA A N    1  
ATOM   157    C  CA   . ALA A  1 12  ? -2.188  -3.131  -38.527 1.00 0.00 ?  327 ALA A CA   1  
ATOM   158    C  C    . ALA A  1 12  ? -3.449  -3.872  -38.648 1.00 0.00 ?  327 ALA A C    1  
ATOM   159    O  O    . ALA A  1 12  ? -3.491  -5.049  -38.968 1.00 0.00 ?  327 ALA A O    1  
ATOM   160    C  CB   . ALA A  1 12  ? -1.801  -2.409  -39.822 1.00 0.00 ?  327 ALA A CB   1  
ATOM   161    H  H    . ALA A  1 12  ? -0.957  -4.802  -38.790 1.00 0.00 ?  327 ALA A H    1  
ATOM   162    H  HA   . ALA A  1 12  ? -2.206  -2.403  -37.730 1.00 0.00 ?  327 ALA A HA   1  
ATOM   163    H  HB1  . ALA A  1 12  ? -0.955  -1.748  -39.535 1.00 0.00 ?  327 ALA A HB1  1  
ATOM   164    H  HB2  . ALA A  1 12  ? -2.667  -1.762  -40.076 1.00 0.00 ?  327 ALA A HB2  1  
ATOM   165    H  HB3  . ALA A  1 12  ? -1.541  -3.081  -40.668 1.00 0.00 ?  327 ALA A HB3  1  
ATOM   166    N  N    . MET A  1 13  ? -4.533  -3.115  -38.610 1.00 0.00 ?  328 MET A N    1  
ATOM   167    C  CA   . MET A  1 13  ? -5.877  -3.462  -39.044 1.00 0.00 ?  328 MET A CA   1  
ATOM   168    C  C    . MET A  1 13  ? -6.302  -2.882  -40.383 1.00 0.00 ?  328 MET A C    1  
ATOM   169    O  O    . MET A  1 13  ? -6.442  -1.614  -40.474 1.00 0.00 ?  328 MET A O    1  
ATOM   170    C  CB   . MET A  1 13  ? -6.955  -3.274  -37.953 1.00 0.00 ?  328 MET A CB   1  
ATOM   171    C  CG   . MET A  1 13  ? -6.690  -4.098  -36.765 1.00 0.00 ?  328 MET A CG   1  
ATOM   172    S  SD   . MET A  1 13  ? -7.119  -5.817  -36.980 1.00 0.00 ?  328 MET A SD   1  
ATOM   173    C  CE   . MET A  1 13  ? -7.117  -6.202  -35.160 1.00 0.00 ?  328 MET A CE   1  
ATOM   174    H  H    . MET A  1 13  ? -4.490  -2.151  -38.359 1.00 0.00 ?  328 MET A H    1  
ATOM   175    H  HA   . MET A  1 13  ? -5.826  -4.517  -39.268 1.00 0.00 ?  328 MET A HA   1  
ATOM   176    H  HB2  . MET A  1 13  ? -6.890  -2.199  -37.678 1.00 0.00 ?  328 MET A HB2  1  
ATOM   177    H  HB3  . MET A  1 13  ? -7.955  -3.437  -38.408 1.00 0.00 ?  328 MET A HB3  1  
ATOM   178    H  HG2  . MET A  1 13  ? -5.626  -4.197  -36.460 1.00 0.00 ?  328 MET A HG2  1  
ATOM   179    H  HG3  . MET A  1 13  ? -7.329  -3.705  -35.946 1.00 0.00 ?  328 MET A HG3  1  
ATOM   180    H  HE1  . MET A  1 13  ? -8.048  -5.801  -34.706 1.00 0.00 ?  328 MET A HE1  1  
ATOM   181    H  HE2  . MET A  1 13  ? -6.283  -5.772  -34.565 1.00 0.00 ?  328 MET A HE2  1  
ATOM   182    H  HE3  . MET A  1 13  ? -7.299  -7.292  -35.042 1.00 0.00 ?  328 MET A HE3  1  
ATOM   183    N  N    . LEU A  1 14  ? -6.271  -3.658  -41.455 1.00 0.00 ?  329 LEU A N    1  
ATOM   184    C  CA   . LEU A  1 14  ? -6.508  -3.287  -42.810 1.00 0.00 ?  329 LEU A CA   1  
ATOM   185    C  C    . LEU A  1 14  ? -7.830  -3.926  -43.148 1.00 0.00 ?  329 LEU A C    1  
ATOM   186    O  O    . LEU A  1 14  ? -7.967  -5.152  -43.178 1.00 0.00 ?  329 LEU A O    1  
ATOM   187    C  CB   . LEU A  1 14  ? -5.396  -3.691  -43.804 1.00 0.00 ?  329 LEU A CB   1  
ATOM   188    C  CG   . LEU A  1 14  ? -3.897  -3.163  -43.552 1.00 0.00 ?  329 LEU A CG   1  
ATOM   189    C  CD1  . LEU A  1 14  ? -3.043  -3.592  -44.736 1.00 0.00 ?  329 LEU A CD1  1  
ATOM   190    C  CD2  . LEU A  1 14  ? -3.910  -1.685  -43.240 1.00 0.00 ?  329 LEU A CD2  1  
ATOM   191    H  H    . LEU A  1 14  ? -6.128  -4.641  -41.374 1.00 0.00 ?  329 LEU A H    1  
ATOM   192    H  HA   . LEU A  1 14  ? -6.643  -2.217  -42.862 1.00 0.00 ?  329 LEU A HA   1  
ATOM   193    H  HB2  . LEU A  1 14  ? -5.403  -4.799  -43.875 1.00 0.00 ?  329 LEU A HB2  1  
ATOM   194    H  HB3  . LEU A  1 14  ? -5.764  -3.443  -44.823 1.00 0.00 ?  329 LEU A HB3  1  
ATOM   195    H  HG   . LEU A  1 14  ? -3.534  -3.686  -42.642 1.00 0.00 ?  329 LEU A HG   1  
ATOM   196    H  HD11 . LEU A  1 14  ? -2.081  -3.038  -44.701 1.00 0.00 ?  329 LEU A HD11 1  
ATOM   197    H  HD12 . LEU A  1 14  ? -3.564  -3.357  -45.688 1.00 0.00 ?  329 LEU A HD12 1  
ATOM   198    H  HD13 . LEU A  1 14  ? -2.731  -4.656  -44.803 1.00 0.00 ?  329 LEU A HD13 1  
ATOM   199    H  HD21 . LEU A  1 14  ? -2.880  -1.333  -43.018 1.00 0.00 ?  329 LEU A HD21 1  
ATOM   200    H  HD22 . LEU A  1 14  ? -4.506  -1.681  -42.303 1.00 0.00 ?  329 LEU A HD22 1  
ATOM   201    H  HD23 . LEU A  1 14  ? -4.312  -1.040  -44.050 1.00 0.00 ?  329 LEU A HD23 1  
ATOM   202    N  N    . ARG A  1 15  ? -8.952  -3.209  -43.212 1.00 0.00 ?  330 ARG A N    1  
ATOM   203    C  CA   . ARG A  1 15  ? -10.289 -3.884  -43.446 1.00 0.00 ?  330 ARG A CA   1  
ATOM   204    C  C    . ARG A  1 15  ? -10.816 -4.469  -42.141 1.00 0.00 ?  330 ARG A C    1  
ATOM   205    O  O    . ARG A  1 15  ? -11.662 -5.305  -42.130 1.00 0.00 ?  330 ARG A O    1  
ATOM   206    C  CB   . ARG A  1 15  ? -10.455 -4.772  -44.676 1.00 0.00 ?  330 ARG A CB   1  
ATOM   207    C  CG   . ARG A  1 15  ? -10.239 -3.972  -45.974 1.00 0.00 ?  330 ARG A CG   1  
ATOM   208    C  CD   . ARG A  1 15  ? -10.544 -4.828  -47.252 1.00 0.00 ?  330 ARG A CD   1  
ATOM   209    N  NE   . ARG A  1 15  ? -10.155 -4.090  -48.503 1.00 0.00 ?  330 ARG A NE   1  
ATOM   210    C  CZ   . ARG A  1 15  ? -10.491 -4.472  -49.691 1.00 0.00 ?  330 ARG A CZ   1  
ATOM   211    N  NH1  . ARG A  1 15  ? -10.193 -3.672  -50.713 1.00 0.00 1  330 ARG A NH1  1  
ATOM   212    N  NH2  . ARG A  1 15  ? -10.950 -5.672  -50.022 1.00 0.00 ?  330 ARG A NH2  1  
ATOM   213    H  H    . ARG A  1 15  ? -8.999  -2.224  -43.068 1.00 0.00 ?  330 ARG A H    1  
ATOM   214    H  HA   . ARG A  1 15  ? -10.881 -2.994  -43.600 1.00 0.00 ?  330 ARG A HA   1  
ATOM   215    H  HB2  . ARG A  1 15  ? -9.773  -5.646  -44.599 1.00 0.00 ?  330 ARG A HB2  1  
ATOM   216    H  HB3  . ARG A  1 15  ? -11.454 -5.252  -44.606 1.00 0.00 ?  330 ARG A HB3  1  
ATOM   217    H  HG2  . ARG A  1 15  ? -10.855 -3.055  -46.094 1.00 0.00 ?  330 ARG A HG2  1  
ATOM   218    H  HG3  . ARG A  1 15  ? -9.168  -3.677  -45.961 1.00 0.00 ?  330 ARG A HG3  1  
ATOM   219    H  HD2  . ARG A  1 15  ? -9.869  -5.709  -47.212 1.00 0.00 ?  330 ARG A HD2  1  
ATOM   220    H  HD3  . ARG A  1 15  ? -11.625 -5.081  -47.212 1.00 0.00 ?  330 ARG A HD3  1  
ATOM   221    H  HE   . ARG A  1 15  ? -9.721  -3.192  -48.443 1.00 0.00 ?  330 ARG A HE   1  
ATOM   222    H  HH11 . ARG A  1 15  ? -9.791  -2.777  -50.520 1.00 0.00 ?  330 ARG A HH11 1  
ATOM   223    H  HH12 . ARG A  1 15  ? -10.300 -4.003  -51.650 1.00 0.00 ?  330 ARG A HH12 1  
ATOM   224    H  HH21 . ARG A  1 15  ? -11.415 -6.113  -49.255 1.00 0.00 ?  330 ARG A HH21 1  
ATOM   225    H  HH22 . ARG A  1 15  ? -11.355 -5.901  -50.907 1.00 0.00 ?  330 ARG A HH22 1  
ATOM   226    N  N    . GLY A  1 16  ? -10.249 -4.011  -40.958 1.00 0.00 ?  331 GLY A N    1  
ATOM   227    C  CA   . GLY A  1 16  ? -10.627 -4.657  -39.672 1.00 0.00 ?  331 GLY A CA   1  
ATOM   228    C  C    . GLY A  1 16  ? -10.022 -5.979  -39.419 1.00 0.00 ?  331 GLY A C    1  
ATOM   229    O  O    . GLY A  1 16  ? -10.448 -6.664  -38.495 1.00 0.00 ?  331 GLY A O    1  
ATOM   230    H  H    . GLY A  1 16  ? -9.678  -3.196  -40.903 1.00 0.00 ?  331 GLY A H    1  
ATOM   231    H  HA2  . GLY A  1 16  ? -10.282 -4.003  -38.885 1.00 0.00 ?  331 GLY A HA2  1  
ATOM   232    H  HA3  . GLY A  1 16  ? -11.697 -4.782  -39.746 1.00 0.00 ?  331 GLY A HA3  1  
ATOM   233    N  N    . GLU A  1 17  ? -9.021  -6.420  -40.244 1.00 0.00 ?  332 GLU A N    1  
ATOM   234    C  CA   . GLU A  1 17  ? -8.442  -7.717  -40.281 1.00 0.00 ?  332 GLU A CA   1  
ATOM   235    C  C    . GLU A  1 17  ? -6.949  -7.476  -40.083 1.00 0.00 ?  332 GLU A C    1  
ATOM   236    O  O    . GLU A  1 17  ? -6.339  -6.549  -40.652 1.00 0.00 ?  332 GLU A O    1  
ATOM   237    C  CB   . GLU A  1 17  ? -8.894  -8.521  -41.645 1.00 0.00 ?  332 GLU A CB   1  
ATOM   238    C  CG   . GLU A  1 17  ? -10.420 -8.463  -41.852 1.00 0.00 ?  332 GLU A CG   1  
ATOM   239    C  CD   . GLU A  1 17  ? -10.977 -9.671  -42.642 1.00 0.00 ?  332 GLU A CD   1  
ATOM   240    O  OE1  . GLU A  1 17  ? -10.592 -9.882  -43.790 1.00 0.00 ?  332 GLU A OE1  1  
ATOM   241    O  OE2  . GLU A  1 17  ? -11.811 -10.439 -42.092 1.00 0.00 -1 332 GLU A OE2  1  
ATOM   242    H  H    . GLU A  1 17  ? -8.750  -5.808  -40.983 1.00 0.00 ?  332 GLU A H    1  
ATOM   243    H  HA   . GLU A  1 17  ? -8.869  -8.266  -39.454 1.00 0.00 ?  332 GLU A HA   1  
ATOM   244    H  HB2  . GLU A  1 17  ? -8.488  -8.152  -42.611 1.00 0.00 ?  332 GLU A HB2  1  
ATOM   245    H  HB3  . GLU A  1 17  ? -8.492  -9.535  -41.435 1.00 0.00 ?  332 GLU A HB3  1  
ATOM   246    H  HG2  . GLU A  1 17  ? -10.853 -8.508  -40.830 1.00 0.00 ?  332 GLU A HG2  1  
ATOM   247    H  HG3  . GLU A  1 17  ? -10.744 -7.518  -42.340 1.00 0.00 ?  332 GLU A HG3  1  
ATOM   248    N  N    . MET A  1 18  ? -6.375  -8.274  -39.233 1.00 0.00 ?  333 MET A N    1  
ATOM   249    C  CA   . MET A  1 18  ? -5.014  -8.101  -38.796 1.00 0.00 ?  333 MET A CA   1  
ATOM   250    C  C    . MET A  1 18  ? -3.931  -8.527  -39.681 1.00 0.00 ?  333 MET A C    1  
ATOM   251    O  O    . MET A  1 18  ? -3.869  -9.719  -40.089 1.00 0.00 ?  333 MET A O    1  
ATOM   252    C  CB   . MET A  1 18  ? -4.826  -8.621  -37.356 1.00 0.00 ?  333 MET A CB   1  
ATOM   253    C  CG   . MET A  1 18  ? -3.376  -8.583  -36.784 1.00 0.00 ?  333 MET A CG   1  
ATOM   254    S  SD   . MET A  1 18  ? -3.059  -9.280  -35.198 1.00 0.00 ?  333 MET A SD   1  
ATOM   255    C  CE   . MET A  1 18  ? -3.957  -8.066  -34.154 1.00 0.00 ?  333 MET A CE   1  
ATOM   256    H  H    . MET A  1 18  ? -6.945  -8.974  -38.811 1.00 0.00 ?  333 MET A H    1  
ATOM   257    H  HA   . MET A  1 18  ? -4.841  -7.035  -38.817 1.00 0.00 ?  333 MET A HA   1  
ATOM   258    H  HB2  . MET A  1 18  ? -5.419  -8.061  -36.602 1.00 0.00 ?  333 MET A HB2  1  
ATOM   259    H  HB3  . MET A  1 18  ? -5.112  -9.694  -37.354 1.00 0.00 ?  333 MET A HB3  1  
ATOM   260    H  HG2  . MET A  1 18  ? -2.628  -9.024  -37.478 1.00 0.00 ?  333 MET A HG2  1  
ATOM   261    H  HG3  . MET A  1 18  ? -3.164  -7.494  -36.844 1.00 0.00 ?  333 MET A HG3  1  
ATOM   262    H  HE1  . MET A  1 18  ? -3.828  -8.302  -33.076 1.00 0.00 ?  333 MET A HE1  1  
ATOM   263    H  HE2  . MET A  1 18  ? -5.014  -7.908  -34.459 1.00 0.00 ?  333 MET A HE2  1  
ATOM   264    H  HE3  . MET A  1 18  ? -3.461  -7.080  -34.276 1.00 0.00 ?  333 MET A HE3  1  
ATOM   265    N  N    . PHE A  1 19  ? -3.075  -7.629  -40.093 1.00 0.00 ?  334 PHE A N    1  
ATOM   266    C  CA   . PHE A  1 19  ? -1.876  -7.971  -40.884 1.00 0.00 ?  334 PHE A CA   1  
ATOM   267    C  C    . PHE A  1 19  ? -0.691  -7.853  -39.938 1.00 0.00 ?  334 PHE A C    1  
ATOM   268    O  O    . PHE A  1 19  ? -0.400  -6.727  -39.468 1.00 0.00 ?  334 PHE A O    1  
ATOM   269    C  CB   . PHE A  1 19  ? -1.691  -7.158  -42.169 1.00 0.00 ?  334 PHE A CB   1  
ATOM   270    C  CG   . PHE A  1 19  ? -2.687  -7.481  -43.234 1.00 0.00 ?  334 PHE A CG   1  
ATOM   271    C  CD1  . PHE A  1 19  ? -3.996  -6.987  -43.163 1.00 0.00 ?  334 PHE A CD1  1  
ATOM   272    C  CD2  . PHE A  1 19  ? -2.251  -8.112  -44.434 1.00 0.00 ?  334 PHE A CD2  1  
ATOM   273    C  CE1  . PHE A  1 19  ? -4.882  -7.377  -44.171 1.00 0.00 ?  334 PHE A CE1  1  
ATOM   274    C  CE2  . PHE A  1 19  ? -3.082  -8.359  -45.480 1.00 0.00 ?  334 PHE A CE2  1  
ATOM   275    C  CZ   . PHE A  1 19  ? -4.424  -7.935  -45.357 1.00 0.00 ?  334 PHE A CZ   1  
ATOM   276    H  H    . PHE A  1 19  ? -3.213  -6.654  -39.931 1.00 0.00 ?  334 PHE A H    1  
ATOM   277    H  HA   . PHE A  1 19  ? -1.936  -9.019  -41.141 1.00 0.00 ?  334 PHE A HA   1  
ATOM   278    H  HB2  . PHE A  1 19  ? -1.858  -6.080  -41.958 1.00 0.00 ?  334 PHE A HB2  1  
ATOM   279    H  HB3  . PHE A  1 19  ? -0.639  -7.238  -42.518 1.00 0.00 ?  334 PHE A HB3  1  
ATOM   280    H  HD1  . PHE A  1 19  ? -4.390  -6.401  -42.347 1.00 0.00 ?  334 PHE A HD1  1  
ATOM   281    H  HD2  . PHE A  1 19  ? -1.229  -8.458  -44.497 1.00 0.00 ?  334 PHE A HD2  1  
ATOM   282    H  HE1  . PHE A  1 19  ? -5.903  -7.037  -44.077 1.00 0.00 ?  334 PHE A HE1  1  
ATOM   283    H  HE2  . PHE A  1 19  ? -2.776  -8.808  -46.414 1.00 0.00 ?  334 PHE A HE2  1  
ATOM   284    H  HZ   . PHE A  1 19  ? -5.222  -8.071  -46.073 1.00 0.00 ?  334 PHE A HZ   1  
ATOM   285    N  N    . VAL A  1 20  ? 0.133   -8.894  -39.715 1.00 0.00 ?  335 VAL A N    1  
ATOM   286    C  CA   . VAL A  1 20  ? 1.295   -8.780  -38.888 1.00 0.00 ?  335 VAL A CA   1  
ATOM   287    C  C    . VAL A  1 20  ? 2.495   -8.787  -39.834 1.00 0.00 ?  335 VAL A C    1  
ATOM   288    O  O    . VAL A  1 20  ? 2.519   -9.691  -40.698 1.00 0.00 ?  335 VAL A O    1  
ATOM   289    C  CB   . VAL A  1 20  ? 1.289   -10.004 -37.976 1.00 0.00 ?  335 VAL A CB   1  
ATOM   290    C  CG1  . VAL A  1 20  ? 2.608   -9.948  -37.208 1.00 0.00 ?  335 VAL A CG1  1  
ATOM   291    C  CG2  . VAL A  1 20  ? 0.116   -9.775  -37.025 1.00 0.00 ?  335 VAL A CG2  1  
ATOM   292    H  H    . VAL A  1 20  ? 0.002   -9.843  -39.991 1.00 0.00 ?  335 VAL A H    1  
ATOM   293    H  HA   . VAL A  1 20  ? 1.302   -7.899  -38.263 1.00 0.00 ?  335 VAL A HA   1  
ATOM   294    H  HB   . VAL A  1 20  ? 1.194   -10.886 -38.645 1.00 0.00 ?  335 VAL A HB   1  
ATOM   295    H  HG11 . VAL A  1 20  ? 2.746   -8.999  -36.647 1.00 0.00 ?  335 VAL A HG11 1  
ATOM   296    H  HG12 . VAL A  1 20  ? 3.515   -10.119 -37.827 1.00 0.00 ?  335 VAL A HG12 1  
ATOM   297    H  HG13 . VAL A  1 20  ? 2.683   -10.712 -36.404 1.00 0.00 ?  335 VAL A HG13 1  
ATOM   298    H  HG21 . VAL A  1 20  ? 0.153   -10.557 -36.237 1.00 0.00 ?  335 VAL A HG21 1  
ATOM   299    H  HG22 . VAL A  1 20  ? -0.912  -9.784  -37.447 1.00 0.00 ?  335 VAL A HG22 1  
ATOM   300    H  HG23 . VAL A  1 20  ? 0.140   -8.759  -36.576 1.00 0.00 ?  335 VAL A HG23 1  
ATOM   301    N  N    . PHE A  1 21  ? 3.554   -7.942  -39.749 1.00 0.00 ?  336 PHE A N    1  
ATOM   302    C  CA   . PHE A  1 21  ? 4.716   -7.861  -40.571 1.00 0.00 ?  336 PHE A CA   1  
ATOM   303    C  C    . PHE A  1 21  ? 6.020   -8.059  -39.693 1.00 0.00 ?  336 PHE A C    1  
ATOM   304    O  O    . PHE A  1 21  ? 6.184   -7.574  -38.599 1.00 0.00 ?  336 PHE A O    1  
ATOM   305    C  CB   . PHE A  1 21  ? 4.823   -6.515  -41.382 1.00 0.00 ?  336 PHE A CB   1  
ATOM   306    C  CG   . PHE A  1 21  ? 3.624   -6.266  -42.302 1.00 0.00 ?  336 PHE A CG   1  
ATOM   307    C  CD1  . PHE A  1 21  ? 2.417   -5.719  -41.803 1.00 0.00 ?  336 PHE A CD1  1  
ATOM   308    C  CD2  . PHE A  1 21  ? 3.657   -6.791  -43.592 1.00 0.00 ?  336 PHE A CD2  1  
ATOM   309    C  CE1  . PHE A  1 21  ? 1.342   -5.383  -42.682 1.00 0.00 ?  336 PHE A CE1  1  
ATOM   310    C  CE2  . PHE A  1 21  ? 2.564   -6.626  -44.400 1.00 0.00 ?  336 PHE A CE2  1  
ATOM   311    C  CZ   . PHE A  1 21  ? 1.383   -5.874  -43.998 1.00 0.00 ?  336 PHE A CZ   1  
ATOM   312    H  H    . PHE A  1 21  ? 3.522   -7.166  -39.124 1.00 0.00 ?  336 PHE A H    1  
ATOM   313    H  HA   . PHE A  1 21  ? 4.571   -8.739  -41.184 1.00 0.00 ?  336 PHE A HA   1  
ATOM   314    H  HB2  . PHE A  1 21  ? 4.968   -5.628  -40.729 1.00 0.00 ?  336 PHE A HB2  1  
ATOM   315    H  HB3  . PHE A  1 21  ? 5.724   -6.577  -42.029 1.00 0.00 ?  336 PHE A HB3  1  
ATOM   316    H  HD1  . PHE A  1 21  ? 2.434   -5.393  -40.774 1.00 0.00 ?  336 PHE A HD1  1  
ATOM   317    H  HD2  . PHE A  1 21  ? 4.602   -7.190  -43.931 1.00 0.00 ?  336 PHE A HD2  1  
ATOM   318    H  HE1  . PHE A  1 21  ? 0.452   -4.872  -42.346 1.00 0.00 ?  336 PHE A HE1  1  
ATOM   319    H  HE2  . PHE A  1 21  ? 2.645   -6.966  -45.422 1.00 0.00 ?  336 PHE A HE2  1  
ATOM   320    H  HZ   . PHE A  1 21  ? 0.569   -5.614  -44.659 1.00 0.00 ?  336 PHE A HZ   1  
ATOM   321    N  N    . LYS A  1 22  ? 6.991   -8.898  -40.228 1.00 0.00 ?  337 LYS A N    1  
ATOM   322    C  CA   . LYS A  1 22  ? 8.249   -9.172  -39.570 1.00 0.00 ?  337 LYS A CA   1  
ATOM   323    C  C    . LYS A  1 22  ? 9.200   -9.205  -40.652 1.00 0.00 ?  337 LYS A C    1  
ATOM   324    O  O    . LYS A  1 22  ? 9.091   -10.091 -41.490 1.00 0.00 ?  337 LYS A O    1  
ATOM   325    C  CB   . LYS A  1 22  ? 8.222   -10.460 -38.792 1.00 0.00 ?  337 LYS A CB   1  
ATOM   326    C  CG   . LYS A  1 22  ? 9.543   -10.936 -38.143 1.00 0.00 ?  337 LYS A CG   1  
ATOM   327    C  CD   . LYS A  1 22  ? 10.073  -10.055 -36.993 1.00 0.00 ?  337 LYS A CD   1  
ATOM   328    C  CE   . LYS A  1 22  ? 11.442  -10.507 -36.488 1.00 0.00 ?  337 LYS A CE   1  
ATOM   329    N  NZ   . LYS A  1 22  ? 11.474  -11.933 -36.193 1.00 0.00 1  337 LYS A NZ   1  
ATOM   330    H  H    . LYS A  1 22  ? 6.807   -9.326  -41.109 1.00 0.00 ?  337 LYS A H    1  
ATOM   331    H  HA   . LYS A  1 22  ? 8.456   -8.426  -38.816 1.00 0.00 ?  337 LYS A HA   1  
ATOM   332    H  HB2  . LYS A  1 22  ? 7.423   -10.334 -38.031 1.00 0.00 ?  337 LYS A HB2  1  
ATOM   333    H  HB3  . LYS A  1 22  ? 7.760   -11.325 -39.315 1.00 0.00 ?  337 LYS A HB3  1  
ATOM   334    H  HG2  . LYS A  1 22  ? 9.376   -11.970 -37.772 1.00 0.00 ?  337 LYS A HG2  1  
ATOM   335    H  HG3  . LYS A  1 22  ? 10.266  -10.968 -38.986 1.00 0.00 ?  337 LYS A HG3  1  
ATOM   336    H  HD2  . LYS A  1 22  ? 10.182  -9.030  -37.410 1.00 0.00 ?  337 LYS A HD2  1  
ATOM   337    H  HD3  . LYS A  1 22  ? 9.386   -10.022 -36.121 1.00 0.00 ?  337 LYS A HD3  1  
ATOM   338    H  HE2  . LYS A  1 22  ? 12.212  -10.194 -37.225 1.00 0.00 ?  337 LYS A HE2  1  
ATOM   339    H  HE3  . LYS A  1 22  ? 11.667  -9.925  -35.569 1.00 0.00 ?  337 LYS A HE3  1  
ATOM   340    H  HZ1  . LYS A  1 22  ? 11.943  -12.372 -37.011 1.00 0.00 ?  337 LYS A HZ1  1  
ATOM   341    H  HZ2  . LYS A  1 22  ? 10.533  -12.370 -36.116 1.00 0.00 ?  337 LYS A HZ2  1  
ATOM   342    H  HZ3  . LYS A  1 22  ? 11.977  -12.178 -35.316 1.00 0.00 ?  337 LYS A HZ3  1  
ATOM   343    N  N    . GLU A  1 23  ? 10.251  -8.309  -40.624 1.00 0.00 ?  338 GLU A N    1  
ATOM   344    C  CA   . GLU A  1 23  ? 11.290  -8.391  -41.639 1.00 0.00 ?  338 GLU A CA   1  
ATOM   345    C  C    . GLU A  1 23  ? 10.928  -8.380  -43.192 1.00 0.00 ?  338 GLU A C    1  
ATOM   346    O  O    . GLU A  1 23  ? 10.398  -7.339  -43.638 1.00 0.00 ?  338 GLU A O    1  
ATOM   347    C  CB   . GLU A  1 23  ? 12.329  -9.364  -41.263 1.00 0.00 ?  338 GLU A CB   1  
ATOM   348    C  CG   . GLU A  1 23  ? 13.127  -8.989  -40.010 1.00 0.00 ?  338 GLU A CG   1  
ATOM   349    C  CD   . GLU A  1 23  ? 14.232  -10.072 -39.753 1.00 0.00 ?  338 GLU A CD   1  
ATOM   350    O  OE1  . GLU A  1 23  ? 15.110  -10.324 -40.605 1.00 0.00 ?  338 GLU A OE1  1  
ATOM   351    O  OE2  . GLU A  1 23  ? 14.327  -10.602 -38.583 1.00 0.00 -1 338 GLU A OE2  1  
ATOM   352    H  H    . GLU A  1 23  ? 10.311  -7.576  -39.951 1.00 0.00 ?  338 GLU A H    1  
ATOM   353    H  HA   . GLU A  1 23  ? 11.812  -7.456  -41.495 1.00 0.00 ?  338 GLU A HA   1  
ATOM   354    H  HB2  . GLU A  1 23  ? 11.860  -10.360 -41.118 1.00 0.00 ?  338 GLU A HB2  1  
ATOM   355    H  HB3  . GLU A  1 23  ? 13.051  -9.556  -42.085 1.00 0.00 ?  338 GLU A HB3  1  
ATOM   356    H  HG2  . GLU A  1 23  ? 13.718  -8.049  -39.985 1.00 0.00 ?  338 GLU A HG2  1  
ATOM   357    H  HG3  . GLU A  1 23  ? 12.469  -8.996  -39.114 1.00 0.00 ?  338 GLU A HG3  1  
ATOM   358    N  N    . ARG A  1 24  ? 11.091  -9.474  -43.975 1.00 0.00 ?  339 ARG A N    1  
ATOM   359    C  CA   . ARG A  1 24  ? 10.619  -9.541  -45.350 1.00 0.00 ?  339 ARG A CA   1  
ATOM   360    C  C    . ARG A  1 24  ? 9.333   -10.457 -45.528 1.00 0.00 ?  339 ARG A C    1  
ATOM   361    O  O    . ARG A  1 24  ? 9.011   -10.787 -46.723 1.00 0.00 ?  339 ARG A O    1  
ATOM   362    C  CB   . ARG A  1 24  ? 11.797  -9.949  -46.217 1.00 0.00 ?  339 ARG A CB   1  
ATOM   363    C  CG   . ARG A  1 24  ? 12.372  -11.385 -46.038 1.00 0.00 ?  339 ARG A CG   1  
ATOM   364    C  CD   . ARG A  1 24  ? 13.704  -11.530 -46.809 1.00 0.00 ?  339 ARG A CD   1  
ATOM   365    N  NE   . ARG A  1 24  ? 14.201  -12.918 -46.710 1.00 0.00 ?  339 ARG A NE   1  
ATOM   366    C  CZ   . ARG A  1 24  ? 13.754  -13.934 -47.481 1.00 0.00 ?  339 ARG A CZ   1  
ATOM   367    N  NH1  . ARG A  1 24  ? 12.747  -13.853 -48.315 1.00 0.00 1  339 ARG A NH1  1  
ATOM   368    N  NH2  . ARG A  1 24  ? 14.438  -15.043 -47.379 1.00 0.00 ?  339 ARG A NH2  1  
ATOM   369    H  H    . ARG A  1 24  ? 11.445  -10.291 -43.529 1.00 0.00 ?  339 ARG A H    1  
ATOM   370    H  HA   . ARG A  1 24  ? 10.329  -8.540  -45.631 1.00 0.00 ?  339 ARG A HA   1  
ATOM   371    H  HB2  . ARG A  1 24  ? 11.571  -9.884  -47.303 1.00 0.00 ?  339 ARG A HB2  1  
ATOM   372    H  HB3  . ARG A  1 24  ? 12.585  -9.178  -46.083 1.00 0.00 ?  339 ARG A HB3  1  
ATOM   373    H  HG2  . ARG A  1 24  ? 12.582  -11.624 -44.974 1.00 0.00 ?  339 ARG A HG2  1  
ATOM   374    H  HG3  . ARG A  1 24  ? 11.690  -12.226 -46.285 1.00 0.00 ?  339 ARG A HG3  1  
ATOM   375    H  HD2  . ARG A  1 24  ? 13.603  -11.300 -47.891 1.00 0.00 ?  339 ARG A HD2  1  
ATOM   376    H  HD3  . ARG A  1 24  ? 14.452  -10.795 -46.442 1.00 0.00 ?  339 ARG A HD3  1  
ATOM   377    H  HE   . ARG A  1 24  ? 15.080  -13.128 -46.281 1.00 0.00 ?  339 ARG A HE   1  
ATOM   378    H  HH11 . ARG A  1 24  ? 12.373  -12.941 -48.483 1.00 0.00 ?  339 ARG A HH11 1  
ATOM   379    H  HH12 . ARG A  1 24  ? 12.497  -14.544 -48.993 1.00 0.00 ?  339 ARG A HH12 1  
ATOM   380    H  HH21 . ARG A  1 24  ? 15.271  -14.919 -46.840 1.00 0.00 ?  339 ARG A HH21 1  
ATOM   381    H  HH22 . ARG A  1 24  ? 14.011  -15.847 -47.794 1.00 0.00 ?  339 ARG A HH22 1  
ATOM   382    N  N    . TRP A  1 25  ? 8.720   -10.798 -44.405 1.00 0.00 ?  340 TRP A N    1  
ATOM   383    C  CA   . TRP A  1 25  ? 7.618   -11.741 -44.354 1.00 0.00 ?  340 TRP A CA   1  
ATOM   384    C  C    . TRP A  1 25  ? 6.480   -11.216 -43.392 1.00 0.00 ?  340 TRP A C    1  
ATOM   385    O  O    . TRP A  1 25  ? 6.612   -10.271 -42.613 1.00 0.00 ?  340 TRP A O    1  
ATOM   386    C  CB   . TRP A  1 25  ? 7.885   -13.190 -43.954 1.00 0.00 ?  340 TRP A CB   1  
ATOM   387    C  CG   . TRP A  1 25  ? 9.169   -13.749 -44.439 1.00 0.00 ?  340 TRP A CG   1  
ATOM   388    C  CD1  . TRP A  1 25  ? 9.310   -14.578 -45.511 1.00 0.00 ?  340 TRP A CD1  1  
ATOM   389    C  CD2  . TRP A  1 25  ? 10.505  -13.664 -43.905 1.00 0.00 ?  340 TRP A CD2  1  
ATOM   390    N  NE1  . TRP A  1 25  ? 10.619  -14.921 -45.654 1.00 0.00 ?  340 TRP A NE1  1  
ATOM   391    C  CE2  . TRP A  1 25  ? 11.357  -14.326 -44.738 1.00 0.00 ?  340 TRP A CE2  1  
ATOM   392    C  CE3  . TRP A  1 25  ? 10.952  -13.038 -42.739 1.00 0.00 ?  340 TRP A CE3  1  
ATOM   393    C  CZ2  . TRP A  1 25  ? 12.651  -14.556 -44.382 1.00 0.00 ?  340 TRP A CZ2  1  
ATOM   394    C  CZ3  . TRP A  1 25  ? 12.329  -13.192 -42.401 1.00 0.00 ?  340 TRP A CZ3  1  
ATOM   395    C  CH2  . TRP A  1 25  ? 13.182  -13.894 -43.235 1.00 0.00 ?  340 TRP A CH2  1  
ATOM   396    H  H    . TRP A  1 25  ? 8.995   -10.382 -43.542 1.00 0.00 ?  340 TRP A H    1  
ATOM   397    H  HA   . TRP A  1 25  ? 7.143   -11.718 -45.324 1.00 0.00 ?  340 TRP A HA   1  
ATOM   398    H  HB2  . TRP A  1 25  ? 7.924   -13.318 -42.851 1.00 0.00 ?  340 TRP A HB2  1  
ATOM   399    H  HB3  . TRP A  1 25  ? 7.000   -13.778 -44.280 1.00 0.00 ?  340 TRP A HB3  1  
ATOM   400    H  HD1  . TRP A  1 25  ? 8.488   -14.941 -46.109 1.00 0.00 ?  340 TRP A HD1  1  
ATOM   401    H  HE1  . TRP A  1 25  ? 10.931  -15.654 -46.218 1.00 0.00 ?  340 TRP A HE1  1  
ATOM   402    H  HE3  . TRP A  1 25  ? 10.306  -12.445 -42.109 1.00 0.00 ?  340 TRP A HE3  1  
ATOM   403    H  HZ2  . TRP A  1 25  ? 13.258  -15.264 -44.926 1.00 0.00 ?  340 TRP A HZ2  1  
ATOM   404    H  HZ3  . TRP A  1 25  ? 12.746  -12.720 -41.523 1.00 0.00 ?  340 TRP A HZ3  1  
ATOM   405    H  HH2  . TRP A  1 25  ? 14.206  -14.046 -42.927 1.00 0.00 ?  340 TRP A HH2  1  
ATOM   406    N  N    . PHE A  1 26  ? 5.289   -11.790 -43.581 1.00 0.00 ?  341 PHE A N    1  
ATOM   407    C  CA   . PHE A  1 26  ? 4.164   -11.351 -42.868 1.00 0.00 ?  341 PHE A CA   1  
ATOM   408    C  C    . PHE A  1 26  ? 3.123   -12.403 -42.778 1.00 0.00 ?  341 PHE A C    1  
ATOM   409    O  O    . PHE A  1 26  ? 3.175   -13.325 -43.533 1.00 0.00 ?  341 PHE A O    1  
ATOM   410    C  CB   . PHE A  1 26  ? 3.473   -10.156 -43.628 1.00 0.00 ?  341 PHE A CB   1  
ATOM   411    C  CG   . PHE A  1 26  ? 2.614   -10.436 -44.847 1.00 0.00 ?  341 PHE A CG   1  
ATOM   412    C  CD1  . PHE A  1 26  ? 1.203   -10.258 -44.753 1.00 0.00 ?  341 PHE A CD1  1  
ATOM   413    C  CD2  . PHE A  1 26  ? 3.206   -10.748 -46.091 1.00 0.00 ?  341 PHE A CD2  1  
ATOM   414    C  CE1  . PHE A  1 26  ? 0.388   -10.557 -45.870 1.00 0.00 ?  341 PHE A CE1  1  
ATOM   415    C  CE2  . PHE A  1 26  ? 2.441   -10.853 -47.195 1.00 0.00 ?  341 PHE A CE2  1  
ATOM   416    C  CZ   . PHE A  1 26  ? 1.038   -10.805 -47.123 1.00 0.00 ?  341 PHE A CZ   1  
ATOM   417    H  H    . PHE A  1 26  ? 5.120   -12.229 -44.460 1.00 0.00 ?  341 PHE A H    1  
ATOM   418    H  HA   . PHE A  1 26  ? 4.538   -11.133 -41.879 1.00 0.00 ?  341 PHE A HA   1  
ATOM   419    H  HB2  . PHE A  1 26  ? 2.862   -9.458  -43.016 1.00 0.00 ?  341 PHE A HB2  1  
ATOM   420    H  HB3  . PHE A  1 26  ? 4.350   -9.530  -43.899 1.00 0.00 ?  341 PHE A HB3  1  
ATOM   421    H  HD1  . PHE A  1 26  ? 0.769   -9.768  -43.894 1.00 0.00 ?  341 PHE A HD1  1  
ATOM   422    H  HD2  . PHE A  1 26  ? 4.264   -10.837 -46.293 1.00 0.00 ?  341 PHE A HD2  1  
ATOM   423    H  HE1  . PHE A  1 26  ? -0.685  -10.436 -45.878 1.00 0.00 ?  341 PHE A HE1  1  
ATOM   424    H  HE2  . PHE A  1 26  ? 2.799   -11.122 -48.178 1.00 0.00 ?  341 PHE A HE2  1  
ATOM   425    H  HZ   . PHE A  1 26  ? 0.448   -11.037 -47.998 1.00 0.00 ?  341 PHE A HZ   1  
ATOM   426    N  N    . TRP A  1 27  ? 2.209   -12.222 -41.783 1.00 0.00 ?  342 TRP A N    1  
ATOM   427    C  CA   . TRP A  1 27  ? 1.143   -13.144 -41.607 1.00 0.00 ?  342 TRP A CA   1  
ATOM   428    C  C    . TRP A  1 27  ? -0.194  -12.413 -41.605 1.00 0.00 ?  342 TRP A C    1  
ATOM   429    O  O    . TRP A  1 27  ? -0.383  -11.334 -40.990 1.00 0.00 ?  342 TRP A O    1  
ATOM   430    C  CB   . TRP A  1 27  ? 1.052   -13.888 -40.151 1.00 0.00 ?  342 TRP A CB   1  
ATOM   431    C  CG   . TRP A  1 27  ? 2.350   -14.648 -39.771 1.00 0.00 ?  342 TRP A CG   1  
ATOM   432    C  CD1  . TRP A  1 27  ? 2.414   -16.010 -39.699 1.00 0.00 ?  342 TRP A CD1  1  
ATOM   433    C  CD2  . TRP A  1 27  ? 3.614   -14.131 -39.317 1.00 0.00 ?  342 TRP A CD2  1  
ATOM   434    N  NE1  . TRP A  1 27  ? 3.647   -16.394 -39.250 1.00 0.00 ?  342 TRP A NE1  1  
ATOM   435    C  CE2  . TRP A  1 27  ? 4.411   -15.292 -38.942 1.00 0.00 ?  342 TRP A CE2  1  
ATOM   436    C  CE3  . TRP A  1 27  ? 4.178   -12.887 -39.126 1.00 0.00 ?  342 TRP A CE3  1  
ATOM   437    C  CZ2  . TRP A  1 27  ? 5.729   -15.219 -38.597 1.00 0.00 ?  342 TRP A CZ2  1  
ATOM   438    C  CZ3  . TRP A  1 27  ? 5.488   -12.851 -38.558 1.00 0.00 ?  342 TRP A CZ3  1  
ATOM   439    C  CH2  . TRP A  1 27  ? 6.206   -13.946 -38.338 1.00 0.00 ?  342 TRP A CH2  1  
ATOM   440    H  H    . TRP A  1 27  ? 2.260   -11.536 -41.061 1.00 0.00 ?  342 TRP A H    1  
ATOM   441    H  HA   . TRP A  1 27  ? 1.083   -13.977 -42.291 1.00 0.00 ?  342 TRP A HA   1  
ATOM   442    H  HB2  . TRP A  1 27  ? 0.715   -13.265 -39.295 1.00 0.00 ?  342 TRP A HB2  1  
ATOM   443    H  HB3  . TRP A  1 27  ? 0.212   -14.610 -40.236 1.00 0.00 ?  342 TRP A HB3  1  
ATOM   444    H  HD1  . TRP A  1 27  ? 1.599   -16.667 -39.964 1.00 0.00 ?  342 TRP A HD1  1  
ATOM   445    H  HE1  . TRP A  1 27  ? 3.902   -17.334 -39.193 1.00 0.00 ?  342 TRP A HE1  1  
ATOM   446    H  HE3  . TRP A  1 27  ? 3.636   -12.008 -39.443 1.00 0.00 ?  342 TRP A HE3  1  
ATOM   447    H  HZ2  . TRP A  1 27  ? 6.358   -16.079 -38.422 1.00 0.00 ?  342 TRP A HZ2  1  
ATOM   448    H  HZ3  . TRP A  1 27  ? 5.790   -11.831 -38.372 1.00 0.00 ?  342 TRP A HZ3  1  
ATOM   449    H  HH2  . TRP A  1 27  ? 7.189   -13.951 -37.890 1.00 0.00 ?  342 TRP A HH2  1  
ATOM   450    N  N    . ARG A  1 28  ? -1.215  -12.965 -42.361 1.00 0.00 ?  343 ARG A N    1  
ATOM   451    C  CA   . ARG A  1 28  ? -2.556  -12.472 -42.193 1.00 0.00 ?  343 ARG A CA   1  
ATOM   452    C  C    . ARG A  1 28  ? -3.090  -13.228 -41.040 1.00 0.00 ?  343 ARG A C    1  
ATOM   453    O  O    . ARG A  1 28  ? -3.061  -14.462 -40.962 1.00 0.00 ?  343 ARG A O    1  
ATOM   454    C  CB   . ARG A  1 28  ? -3.566  -12.747 -43.383 1.00 0.00 ?  343 ARG A CB   1  
ATOM   455    C  CG   . ARG A  1 28  ? -3.411  -11.769 -44.542 1.00 0.00 ?  343 ARG A CG   1  
ATOM   456    C  CD   . ARG A  1 28  ? -4.690  -11.671 -45.342 1.00 0.00 ?  343 ARG A CD   1  
ATOM   457    N  NE   . ARG A  1 28  ? -5.826  -11.043 -44.544 1.00 0.00 ?  343 ARG A NE   1  
ATOM   458    C  CZ   . ARG A  1 28  ? -7.118  -11.108 -44.771 1.00 0.00 ?  343 ARG A CZ   1  
ATOM   459    N  NH1  . ARG A  1 28  ? -7.847  -10.379 -43.950 1.00 0.00 1  343 ARG A NH1  1  
ATOM   460    N  NH2  . ARG A  1 28  ? -7.627  -11.783 -45.707 1.00 0.00 ?  343 ARG A NH2  1  
ATOM   461    H  H    . ARG A  1 28  ? -1.196  -13.819 -42.875 1.00 0.00 ?  343 ARG A H    1  
ATOM   462    H  HA   . ARG A  1 28  ? -2.484  -11.428 -41.928 1.00 0.00 ?  343 ARG A HA   1  
ATOM   463    H  HB2  . ARG A  1 28  ? -3.478  -13.804 -43.713 1.00 0.00 ?  343 ARG A HB2  1  
ATOM   464    H  HB3  . ARG A  1 28  ? -4.578  -12.631 -42.940 1.00 0.00 ?  343 ARG A HB3  1  
ATOM   465    H  HG2  . ARG A  1 28  ? -3.008  -10.785 -44.220 1.00 0.00 ?  343 ARG A HG2  1  
ATOM   466    H  HG3  . ARG A  1 28  ? -2.489  -12.139 -45.040 1.00 0.00 ?  343 ARG A HG3  1  
ATOM   467    H  HD2  . ARG A  1 28  ? -4.554  -11.077 -46.272 1.00 0.00 ?  343 ARG A HD2  1  
ATOM   468    H  HD3  . ARG A  1 28  ? -5.078  -12.637 -45.729 1.00 0.00 ?  343 ARG A HD3  1  
ATOM   469    H  HE   . ARG A  1 28  ? -5.574  -10.453 -43.777 1.00 0.00 ?  343 ARG A HE   1  
ATOM   470    H  HH11 . ARG A  1 28  ? -7.406  -10.070 -43.107 1.00 0.00 ?  343 ARG A HH11 1  
ATOM   471    H  HH12 . ARG A  1 28  ? -8.815  -10.266 -44.170 1.00 0.00 ?  343 ARG A HH12 1  
ATOM   472    H  HH21 . ARG A  1 28  ? -7.026  -12.272 -46.339 1.00 0.00 ?  343 ARG A HH21 1  
ATOM   473    H  HH22 . ARG A  1 28  ? -8.586  -11.626 -45.943 1.00 0.00 ?  343 ARG A HH22 1  
ATOM   474    N  N    . VAL A  1 29  ? -3.610  -12.505 -40.048 1.00 0.00 ?  344 VAL A N    1  
ATOM   475    C  CA   . VAL A  1 29  ? -4.179  -12.968 -38.757 1.00 0.00 ?  344 VAL A CA   1  
ATOM   476    C  C    . VAL A  1 29  ? -5.647  -12.637 -38.832 1.00 0.00 ?  344 VAL A C    1  
ATOM   477    O  O    . VAL A  1 29  ? -6.039  -11.553 -39.251 1.00 0.00 ?  344 VAL A O    1  
ATOM   478    C  CB   . VAL A  1 29  ? -3.549  -12.201 -37.582 1.00 0.00 ?  344 VAL A CB   1  
ATOM   479    C  CG1  . VAL A  1 29  ? -4.208  -12.541 -36.199 1.00 0.00 ?  344 VAL A CG1  1  
ATOM   480    C  CG2  . VAL A  1 29  ? -2.054  -12.485 -37.619 1.00 0.00 ?  344 VAL A CG2  1  
ATOM   481    H  H    . VAL A  1 29  ? -3.576  -11.509 -40.022 1.00 0.00 ?  344 VAL A H    1  
ATOM   482    H  HA   . VAL A  1 29  ? -4.020  -14.032 -38.669 1.00 0.00 ?  344 VAL A HA   1  
ATOM   483    H  HB   . VAL A  1 29  ? -3.634  -11.108 -37.764 1.00 0.00 ?  344 VAL A HB   1  
ATOM   484    H  HG11 . VAL A  1 29  ? -5.279  -12.265 -36.098 1.00 0.00 ?  344 VAL A HG11 1  
ATOM   485    H  HG12 . VAL A  1 29  ? -3.592  -12.065 -35.406 1.00 0.00 ?  344 VAL A HG12 1  
ATOM   486    H  HG13 . VAL A  1 29  ? -4.258  -13.634 -36.002 1.00 0.00 ?  344 VAL A HG13 1  
ATOM   487    H  HG21 . VAL A  1 29  ? -1.569  -11.941 -38.458 1.00 0.00 ?  344 VAL A HG21 1  
ATOM   488    H  HG22 . VAL A  1 29  ? -1.794  -13.562 -37.699 1.00 0.00 ?  344 VAL A HG22 1  
ATOM   489    H  HG23 . VAL A  1 29  ? -1.588  -12.152 -36.667 1.00 0.00 ?  344 VAL A HG23 1  
ATOM   490    N  N    . ARG A  1 30  ? -6.499  -13.501 -38.310 1.00 0.00 ?  345 ARG A N    1  
ATOM   491    C  CA   . ARG A  1 30  ? -7.865  -13.183 -38.174 1.00 0.00 ?  345 ARG A CA   1  
ATOM   492    C  C    . ARG A  1 30  ? -8.428  -14.004 -37.011 1.00 0.00 ?  345 ARG A C    1  
ATOM   493    O  O    . ARG A  1 30  ? -8.024  -15.155 -36.808 1.00 0.00 ?  345 ARG A O    1  
ATOM   494    C  CB   . ARG A  1 30  ? -8.565  -13.404 -39.564 1.00 0.00 ?  345 ARG A CB   1  
ATOM   495    C  CG   . ARG A  1 30  ? -10.075 -13.286 -39.619 1.00 0.00 ?  345 ARG A CG   1  
ATOM   496    C  CD   . ARG A  1 30  ? -10.672 -13.558 -41.018 1.00 0.00 ?  345 ARG A CD   1  
ATOM   497    N  NE   . ARG A  1 30  ? -10.436 -15.032 -41.396 1.00 0.00 ?  345 ARG A NE   1  
ATOM   498    C  CZ   . ARG A  1 30  ? -10.848 -15.650 -42.449 1.00 0.00 ?  345 ARG A CZ   1  
ATOM   499    N  NH1  . ARG A  1 30  ? -10.487 -16.856 -42.616 1.00 0.00 1  345 ARG A NH1  1  
ATOM   500    N  NH2  . ARG A  1 30  ? -11.522 -15.072 -43.420 1.00 0.00 ?  345 ARG A NH2  1  
ATOM   501    H  H    . ARG A  1 30  ? -6.187  -14.344 -37.879 1.00 0.00 ?  345 ARG A H    1  
ATOM   502    H  HA   . ARG A  1 30  ? -7.871  -12.147 -37.869 1.00 0.00 ?  345 ARG A HA   1  
ATOM   503    H  HB2  . ARG A  1 30  ? -8.184  -12.612 -40.244 1.00 0.00 ?  345 ARG A HB2  1  
ATOM   504    H  HB3  . ARG A  1 30  ? -8.160  -14.398 -39.851 1.00 0.00 ?  345 ARG A HB3  1  
ATOM   505    H  HG2  . ARG A  1 30  ? -10.620 -14.004 -38.970 1.00 0.00 ?  345 ARG A HG2  1  
ATOM   506    H  HG3  . ARG A  1 30  ? -10.392 -12.359 -39.095 1.00 0.00 ?  345 ARG A HG3  1  
ATOM   507    H  HD2  . ARG A  1 30  ? -11.777 -13.454 -41.069 1.00 0.00 ?  345 ARG A HD2  1  
ATOM   508    H  HD3  . ARG A  1 30  ? -10.092 -12.918 -41.717 1.00 0.00 ?  345 ARG A HD3  1  
ATOM   509    H  HE   . ARG A  1 30  ? -9.983  -15.653 -40.756 1.00 0.00 ?  345 ARG A HE   1  
ATOM   510    H  HH11 . ARG A  1 30  ? -9.890  -17.360 -41.991 1.00 0.00 ?  345 ARG A HH11 1  
ATOM   511    H  HH12 . ARG A  1 30  ? -10.849 -17.253 -43.460 1.00 0.00 ?  345 ARG A HH12 1  
ATOM   512    H  HH21 . ARG A  1 30  ? -11.563 -14.073 -43.397 1.00 0.00 ?  345 ARG A HH21 1  
ATOM   513    H  HH22 . ARG A  1 30  ? -11.820 -15.538 -44.253 1.00 0.00 ?  345 ARG A HH22 1  
ATOM   514    N  N    . ASN A  1 31  ? -9.281  -13.490 -36.136 1.00 0.00 ?  346 ASN A N    1  
ATOM   515    C  CA   . ASN A  1 31  ? -9.877  -14.127 -34.970 1.00 0.00 ?  346 ASN A CA   1  
ATOM   516    C  C    . ASN A  1 31  ? -8.886  -14.619 -33.925 1.00 0.00 ?  346 ASN A C    1  
ATOM   517    O  O    . ASN A  1 31  ? -9.054  -15.737 -33.376 1.00 0.00 ?  346 ASN A O    1  
ATOM   518    C  CB   . ASN A  1 31  ? -10.887 -15.265 -35.286 1.00 0.00 ?  346 ASN A CB   1  
ATOM   519    C  CG   . ASN A  1 31  ? -12.060 -14.598 -35.997 1.00 0.00 ?  346 ASN A CG   1  
ATOM   520    O  OD1  . ASN A  1 31  ? -12.373 -13.392 -36.025 1.00 0.00 ?  346 ASN A OD1  1  
ATOM   521    N  ND2  . ASN A  1 31  ? -12.791 -15.442 -36.700 1.00 0.00 ?  346 ASN A ND2  1  
ATOM   522    H  H    . ASN A  1 31  ? -9.534  -12.526 -36.154 1.00 0.00 ?  346 ASN A H    1  
ATOM   523    H  HA   . ASN A  1 31  ? -10.352 -13.274 -34.508 1.00 0.00 ?  346 ASN A HA   1  
ATOM   524    H  HB2  . ASN A  1 31  ? -10.366 -16.030 -35.901 1.00 0.00 ?  346 ASN A HB2  1  
ATOM   525    H  HB3  . ASN A  1 31  ? -11.250 -15.717 -34.338 1.00 0.00 ?  346 ASN A HB3  1  
ATOM   526    H  HD21 . ASN A  1 31  ? -13.662 -15.175 -37.113 1.00 0.00 ?  346 ASN A HD21 1  
ATOM   527    H  HD22 . ASN A  1 31  ? -12.401 -16.354 -36.826 1.00 0.00 ?  346 ASN A HD22 1  
ATOM   528    N  N    . ASN A  1 32  ? -7.799  -13.801 -33.776 1.00 0.00 ?  347 ASN A N    1  
ATOM   529    C  CA   . ASN A  1 32  ? -6.586  -14.098 -33.053 1.00 0.00 ?  347 ASN A CA   1  
ATOM   530    C  C    . ASN A  1 32  ? -5.778  -15.346 -33.353 1.00 0.00 ?  347 ASN A C    1  
ATOM   531    O  O    . ASN A  1 32  ? -5.003  -15.832 -32.464 1.00 0.00 ?  347 ASN A O    1  
ATOM   532    C  CB   . ASN A  1 32  ? -6.874  -13.902 -31.582 1.00 0.00 ?  347 ASN A CB   1  
ATOM   533    C  CG   . ASN A  1 32  ? -7.383  -12.477 -31.352 1.00 0.00 ?  347 ASN A CG   1  
ATOM   534    O  OD1  . ASN A  1 32  ? -8.579  -12.296 -31.011 1.00 0.00 ?  347 ASN A OD1  1  
ATOM   535    N  ND2  . ASN A  1 32  ? -6.557  -11.430 -31.596 1.00 0.00 ?  347 ASN A ND2  1  
ATOM   536    H  H    . ASN A  1 32  ? -7.848  -12.866 -34.118 1.00 0.00 ?  347 ASN A H    1  
ATOM   537    H  HA   . ASN A  1 32  ? -6.026  -13.252 -33.424 1.00 0.00 ?  347 ASN A HA   1  
ATOM   538    H  HB2  . ASN A  1 32  ? -7.695  -14.581 -31.267 1.00 0.00 ?  347 ASN A HB2  1  
ATOM   539    H  HB3  . ASN A  1 32  ? -5.914  -14.020 -31.036 1.00 0.00 ?  347 ASN A HB3  1  
ATOM   540    H  HD21 . ASN A  1 32  ? -6.934  -10.511 -31.483 1.00 0.00 ?  347 ASN A HD21 1  
ATOM   541    H  HD22 . ASN A  1 32  ? -5.631  -11.566 -31.950 1.00 0.00 ?  347 ASN A HD22 1  
ATOM   542    N  N    . GLN A  1 33  ? -5.830  -15.830 -34.607 1.00 0.00 ?  348 GLN A N    1  
ATOM   543    C  CA   . GLN A  1 33  ? -5.083  -17.095 -34.892 1.00 0.00 ?  348 GLN A CA   1  
ATOM   544    C  C    . GLN A  1 33  ? -4.609  -16.803 -36.335 1.00 0.00 ?  348 GLN A C    1  
ATOM   545    O  O    . GLN A  1 33  ? -5.259  -16.179 -37.083 1.00 0.00 ?  348 GLN A O    1  
ATOM   546    C  CB   . GLN A  1 33  ? -6.153  -18.287 -34.940 1.00 0.00 ?  348 GLN A CB   1  
ATOM   547    C  CG   . GLN A  1 33  ? -5.701  -19.771 -35.057 1.00 0.00 ?  348 GLN A CG   1  
ATOM   548    C  CD   . GLN A  1 33  ? -4.360  -20.095 -34.246 1.00 0.00 ?  348 GLN A CD   1  
ATOM   549    O  OE1  . GLN A  1 33  ? -3.252  -19.593 -34.497 1.00 0.00 ?  348 GLN A OE1  1  
ATOM   550    N  NE2  . GLN A  1 33  ? -4.467  -20.910 -33.182 1.00 0.00 ?  348 GLN A NE2  1  
ATOM   551    H  H    . GLN A  1 33  ? -6.492  -15.489 -35.271 1.00 0.00 ?  348 GLN A H    1  
ATOM   552    H  HA   . GLN A  1 33  ? -4.210  -17.206 -34.266 1.00 0.00 ?  348 GLN A HA   1  
ATOM   553    H  HB2  . GLN A  1 33  ? -6.630  -18.333 -33.937 1.00 0.00 ?  348 GLN A HB2  1  
ATOM   554    H  HB3  . GLN A  1 33  ? -6.942  -18.077 -35.692 1.00 0.00 ?  348 GLN A HB3  1  
ATOM   555    H  HG2  . GLN A  1 33  ? -6.381  -20.535 -34.621 1.00 0.00 ?  348 GLN A HG2  1  
ATOM   556    H  HG3  . GLN A  1 33  ? -5.385  -20.110 -36.066 1.00 0.00 ?  348 GLN A HG3  1  
ATOM   557    H  HE21 . GLN A  1 33  ? -3.654  -21.157 -32.655 1.00 0.00 ?  348 GLN A HE21 1  
ATOM   558    H  HE22 . GLN A  1 33  ? -5.318  -20.810 -32.667 1.00 0.00 ?  348 GLN A HE22 1  
ATOM   559    N  N    . VAL A  1 34  ? -3.382  -17.245 -36.743 1.00 0.00 ?  349 VAL A N    1  
ATOM   560    C  CA   . VAL A  1 34  ? -2.932  -17.124 -38.046 1.00 0.00 ?  349 VAL A CA   1  
ATOM   561    C  C    . VAL A  1 34  ? -3.771  -17.788 -39.132 1.00 0.00 ?  349 VAL A C    1  
ATOM   562    O  O    . VAL A  1 34  ? -4.342  -18.837 -38.965 1.00 0.00 ?  349 VAL A O    1  
ATOM   563    C  CB   . VAL A  1 34  ? -1.378  -17.560 -38.210 1.00 0.00 ?  349 VAL A CB   1  
ATOM   564    C  CG1  . VAL A  1 34  ? -0.450  -16.463 -37.620 1.00 0.00 ?  349 VAL A CG1  1  
ATOM   565    C  CG2  . VAL A  1 34  ? -1.088  -18.855 -37.413 1.00 0.00 ?  349 VAL A CG2  1  
ATOM   566    H  H    . VAL A  1 34  ? -2.792  -17.748 -36.116 1.00 0.00 ?  349 VAL A H    1  
ATOM   567    H  HA   . VAL A  1 34  ? -3.053  -16.095 -38.352 1.00 0.00 ?  349 VAL A HA   1  
ATOM   568    H  HB   . VAL A  1 34  ? -1.190  -17.731 -39.292 1.00 0.00 ?  349 VAL A HB   1  
ATOM   569    H  HG11 . VAL A  1 34  ? 0.600   -16.812 -37.722 1.00 0.00 ?  349 VAL A HG11 1  
ATOM   570    H  HG12 . VAL A  1 34  ? -0.587  -16.217 -36.545 1.00 0.00 ?  349 VAL A HG12 1  
ATOM   571    H  HG13 . VAL A  1 34  ? -0.575  -15.598 -38.306 1.00 0.00 ?  349 VAL A HG13 1  
ATOM   572    H  HG21 . VAL A  1 34  ? -1.349  -18.758 -36.338 1.00 0.00 ?  349 VAL A HG21 1  
ATOM   573    H  HG22 . VAL A  1 34  ? -0.017  -19.119 -37.543 1.00 0.00 ?  349 VAL A HG22 1  
ATOM   574    H  HG23 . VAL A  1 34  ? -1.617  -19.734 -37.841 1.00 0.00 ?  349 VAL A HG23 1  
ATOM   575    N  N    . MET A  1 35  ? -3.959  -17.055 -40.290 1.00 0.00 ?  350 MET A N    1  
ATOM   576    C  CA   . MET A  1 35  ? -4.580  -17.685 -41.387 1.00 0.00 ?  350 MET A CA   1  
ATOM   577    C  C    . MET A  1 35  ? -3.653  -18.709 -42.073 1.00 0.00 ?  350 MET A C    1  
ATOM   578    O  O    . MET A  1 35  ? -2.469  -18.585 -42.013 1.00 0.00 ?  350 MET A O    1  
ATOM   579    C  CB   . MET A  1 35  ? -5.260  -16.674 -42.291 1.00 0.00 ?  350 MET A CB   1  
ATOM   580    C  CG   . MET A  1 35  ? -6.412  -15.735 -41.753 1.00 0.00 ?  350 MET A CG   1  
ATOM   581    S  SD   . MET A  1 35  ? -7.089  -14.594 -42.938 1.00 0.00 ?  350 MET A SD   1  
ATOM   582    C  CE   . MET A  1 35  ? -7.783  -15.592 -44.245 1.00 0.00 ?  350 MET A CE   1  
ATOM   583    H  H    . MET A  1 35  ? -3.595  -16.133 -40.398 1.00 0.00 ?  350 MET A H    1  
ATOM   584    H  HA   . MET A  1 35  ? -5.361  -18.260 -40.913 1.00 0.00 ?  350 MET A HA   1  
ATOM   585    H  HB2  . MET A  1 35  ? -4.469  -16.056 -42.767 1.00 0.00 ?  350 MET A HB2  1  
ATOM   586    H  HB3  . MET A  1 35  ? -5.637  -17.203 -43.192 1.00 0.00 ?  350 MET A HB3  1  
ATOM   587    H  HG2  . MET A  1 35  ? -7.311  -16.292 -41.413 1.00 0.00 ?  350 MET A HG2  1  
ATOM   588    H  HG3  . MET A  1 35  ? -5.914  -15.111 -40.981 1.00 0.00 ?  350 MET A HG3  1  
ATOM   589    H  HE1  . MET A  1 35  ? -7.020  -16.064 -44.901 1.00 0.00 ?  350 MET A HE1  1  
ATOM   590    H  HE2  . MET A  1 35  ? -8.476  -14.985 -44.866 1.00 0.00 ?  350 MET A HE2  1  
ATOM   591    H  HE3  . MET A  1 35  ? -8.454  -16.307 -43.723 1.00 0.00 ?  350 MET A HE3  1  
ATOM   592    N  N    . ASP A  1 36  ? -4.155  -19.709 -42.695 1.00 0.00 ?  351 ASP A N    1  
ATOM   593    C  CA   . ASP A  1 36  ? -3.512  -20.877 -43.320 1.00 0.00 ?  351 ASP A CA   1  
ATOM   594    C  C    . ASP A  1 36  ? -2.629  -20.406 -44.509 1.00 0.00 ?  351 ASP A C    1  
ATOM   595    O  O    . ASP A  1 36  ? -3.009  -19.578 -45.342 1.00 0.00 ?  351 ASP A O    1  
ATOM   596    C  CB   . ASP A  1 36  ? -4.489  -22.082 -43.686 1.00 0.00 ?  351 ASP A CB   1  
ATOM   597    C  CG   . ASP A  1 36  ? -5.278  -22.623 -42.501 1.00 0.00 ?  351 ASP A CG   1  
ATOM   598    O  OD1  . ASP A  1 36  ? -4.969  -22.386 -41.352 1.00 0.00 ?  351 ASP A OD1  1  
ATOM   599    O  OD2  . ASP A  1 36  ? -6.185  -23.430 -42.852 1.00 0.00 -1 351 ASP A OD2  1  
ATOM   600    H  H    . ASP A  1 36  ? -5.145  -19.738 -42.805 1.00 0.00 ?  351 ASP A H    1  
ATOM   601    H  HA   . ASP A  1 36  ? -2.868  -21.298 -42.562 1.00 0.00 ?  351 ASP A HA   1  
ATOM   602    H  HB2  . ASP A  1 36  ? -5.189  -21.761 -44.487 1.00 0.00 ?  351 ASP A HB2  1  
ATOM   603    H  HB3  . ASP A  1 36  ? -3.922  -22.902 -44.177 1.00 0.00 ?  351 ASP A HB3  1  
ATOM   604    N  N    . GLY A  1 37  ? -1.355  -20.912 -44.517 1.00 0.00 ?  352 GLY A N    1  
ATOM   605    C  CA   . GLY A  1 37  ? -0.485  -20.741 -45.726 1.00 0.00 ?  352 GLY A CA   1  
ATOM   606    C  C    . GLY A  1 37  ? 0.506   -19.639 -45.597 1.00 0.00 ?  352 GLY A C    1  
ATOM   607    O  O    . GLY A  1 37  ? 1.204   -19.262 -46.490 1.00 0.00 ?  352 GLY A O    1  
ATOM   608    H  H    . GLY A  1 37  ? -1.095  -21.429 -43.706 1.00 0.00 ?  352 GLY A H    1  
ATOM   609    H  HA2  . GLY A  1 37  ? 0.066   -21.621 -46.020 1.00 0.00 ?  352 GLY A HA2  1  
ATOM   610    H  HA3  . GLY A  1 37  ? -1.195  -20.496 -46.502 1.00 0.00 ?  352 GLY A HA3  1  
ATOM   611    N  N    . TYR A  1 38  ? 0.617   -19.069 -44.394 1.00 0.00 ?  353 TYR A N    1  
ATOM   612    C  CA   . TYR A  1 38  ? 1.448   -17.965 -44.090 1.00 0.00 ?  353 TYR A CA   1  
ATOM   613    C  C    . TYR A  1 38  ? 2.521   -18.586 -43.170 1.00 0.00 ?  353 TYR A C    1  
ATOM   614    O  O    . TYR A  1 38  ? 2.329   -19.659 -42.593 1.00 0.00 ?  353 TYR A O    1  
ATOM   615    C  CB   . TYR A  1 38  ? 0.600   -16.832 -43.367 1.00 0.00 ?  353 TYR A CB   1  
ATOM   616    C  CG   . TYR A  1 38  ? -0.251  -16.081 -44.335 1.00 0.00 ?  353 TYR A CG   1  
ATOM   617    C  CD1  . TYR A  1 38  ? -1.593  -16.466 -44.585 1.00 0.00 ?  353 TYR A CD1  1  
ATOM   618    C  CD2  . TYR A  1 38  ? 0.172   -14.864 -44.970 1.00 0.00 ?  353 TYR A CD2  1  
ATOM   619    C  CE1  . TYR A  1 38  ? -2.401  -15.829 -45.537 1.00 0.00 ?  353 TYR A CE1  1  
ATOM   620    C  CE2  . TYR A  1 38  ? -0.620  -14.233 -45.970 1.00 0.00 ?  353 TYR A CE2  1  
ATOM   621    C  CZ   . TYR A  1 38  ? -1.869  -14.734 -46.291 1.00 0.00 ?  353 TYR A CZ   1  
ATOM   622    O  OH   . TYR A  1 38  ? -2.594  -14.174 -47.411 1.00 0.00 ?  353 TYR A OH   1  
ATOM   623    H  H    . TYR A  1 38  ? 0.038   -19.324 -43.623 1.00 0.00 ?  353 TYR A H    1  
ATOM   624    H  HA   . TYR A  1 38  ? 1.864   -17.570 -45.005 1.00 0.00 ?  353 TYR A HA   1  
ATOM   625    H  HB2  . TYR A  1 38  ? 0.019   -17.409 -42.616 1.00 0.00 ?  353 TYR A HB2  1  
ATOM   626    H  HB3  . TYR A  1 38  ? 1.201   -16.063 -42.836 1.00 0.00 ?  353 TYR A HB3  1  
ATOM   627    H  HD1  . TYR A  1 38  ? -1.939  -17.304 -43.997 1.00 0.00 ?  353 TYR A HD1  1  
ATOM   628    H  HD2  . TYR A  1 38  ? 1.199   -14.553 -44.848 1.00 0.00 ?  353 TYR A HD2  1  
ATOM   629    H  HE1  . TYR A  1 38  ? -3.442  -16.109 -45.585 1.00 0.00 ?  353 TYR A HE1  1  
ATOM   630    H  HE2  . TYR A  1 38  ? -0.287  -13.330 -46.460 1.00 0.00 ?  353 TYR A HE2  1  
ATOM   631    H  HH   . TYR A  1 38  ? -2.200  -13.348 -47.702 1.00 0.00 ?  353 TYR A HH   1  
ATOM   632    N  N    . PRO A  1 39  ? 3.596   -17.885 -42.845 1.00 0.00 ?  354 PRO A N    1  
ATOM   633    C  CA   . PRO A  1 39  ? 4.066   -16.587 -43.249 1.00 0.00 ?  354 PRO A CA   1  
ATOM   634    C  C    . PRO A  1 39  ? 4.294   -16.556 -44.722 1.00 0.00 ?  354 PRO A C    1  
ATOM   635    O  O    . PRO A  1 39  ? 4.728   -17.536 -45.232 1.00 0.00 ?  354 PRO A O    1  
ATOM   636    C  CB   . PRO A  1 39  ? 5.414   -16.315 -42.443 1.00 0.00 ?  354 PRO A CB   1  
ATOM   637    C  CG   . PRO A  1 39  ? 5.795   -17.652 -41.836 1.00 0.00 ?  354 PRO A CG   1  
ATOM   638    C  CD   . PRO A  1 39  ? 4.567   -18.513 -41.931 1.00 0.00 ?  354 PRO A CD   1  
ATOM   639    H  HA   . PRO A  1 39  ? 3.228   -15.960 -42.984 1.00 0.00 ?  354 PRO A HA   1  
ATOM   640    H  HB2  . PRO A  1 39  ? 6.170   -15.766 -43.044 1.00 0.00 ?  354 PRO A HB2  1  
ATOM   641    H  HB3  . PRO A  1 39  ? 5.212   -15.533 -41.681 1.00 0.00 ?  354 PRO A HB3  1  
ATOM   642    H  HG2  . PRO A  1 39  ? 6.547   -18.026 -42.562 1.00 0.00 ?  354 PRO A HG2  1  
ATOM   643    H  HG3  . PRO A  1 39  ? 6.227   -17.571 -40.815 1.00 0.00 ?  354 PRO A HG3  1  
ATOM   644    H  HD2  . PRO A  1 39  ? 4.778   -19.553 -42.259 1.00 0.00 ?  354 PRO A HD2  1  
ATOM   645    H  HD3  . PRO A  1 39  ? 4.053   -18.615 -40.951 1.00 0.00 ?  354 PRO A HD3  1  
ATOM   646    N  N    . MET A  1 40  ? 4.024   -15.467 -45.371 1.00 0.00 ?  355 MET A N    1  
ATOM   647    C  CA   . MET A  1 40  ? 4.171   -15.247 -46.765 1.00 0.00 ?  355 MET A CA   1  
ATOM   648    C  C    . MET A  1 40  ? 5.286   -14.159 -46.761 1.00 0.00 ?  355 MET A C    1  
ATOM   649    O  O    . MET A  1 40  ? 5.214   -13.231 -45.964 1.00 0.00 ?  355 MET A O    1  
ATOM   650    C  CB   . MET A  1 40  ? 2.822   -14.670 -47.399 1.00 0.00 ?  355 MET A CB   1  
ATOM   651    C  CG   . MET A  1 40  ? 2.732   -14.659 -48.952 1.00 0.00 ?  355 MET A CG   1  
ATOM   652    S  SD   . MET A  1 40  ? 1.031   -13.974 -49.559 1.00 0.00 ?  355 MET A SD   1  
ATOM   653    C  CE   . MET A  1 40  ? 1.226   -14.547 -51.283 1.00 0.00 ?  355 MET A CE   1  
ATOM   654    H  H    . MET A  1 40  ? 3.707   -14.676 -44.854 1.00 0.00 ?  355 MET A H    1  
ATOM   655    H  HA   . MET A  1 40  ? 4.522   -16.131 -47.275 1.00 0.00 ?  355 MET A HA   1  
ATOM   656    H  HB2  . MET A  1 40  ? 2.029   -15.388 -47.100 1.00 0.00 ?  355 MET A HB2  1  
ATOM   657    H  HB3  . MET A  1 40  ? 2.663   -13.682 -46.917 1.00 0.00 ?  355 MET A HB3  1  
ATOM   658    H  HG2  . MET A  1 40  ? 3.486   -13.995 -49.426 1.00 0.00 ?  355 MET A HG2  1  
ATOM   659    H  HG3  . MET A  1 40  ? 2.836   -15.705 -49.312 1.00 0.00 ?  355 MET A HG3  1  
ATOM   660    H  HE1  . MET A  1 40  ? 1.558   -13.706 -51.928 1.00 0.00 ?  355 MET A HE1  1  
ATOM   661    H  HE2  . MET A  1 40  ? 0.204   -14.816 -51.627 1.00 0.00 ?  355 MET A HE2  1  
ATOM   662    H  HE3  . MET A  1 40  ? 1.937   -15.400 -51.294 1.00 0.00 ?  355 MET A HE3  1  
ATOM   663    N  N    . PRO A  1 41  ? 6.220   -14.155 -47.713 1.00 0.00 ?  356 PRO A N    1  
ATOM   664    C  CA   . PRO A  1 41  ? 6.966   -13.005 -48.149 1.00 0.00 ?  356 PRO A CA   1  
ATOM   665    C  C    . PRO A  1 41  ? 6.144   -11.824 -48.486 1.00 0.00 ?  356 PRO A C    1  
ATOM   666    O  O    . PRO A  1 41  ? 5.146   -11.965 -49.172 1.00 0.00 ?  356 PRO A O    1  
ATOM   667    C  CB   . PRO A  1 41  ? 7.919   -13.548 -49.308 1.00 0.00 ?  356 PRO A CB   1  
ATOM   668    C  CG   . PRO A  1 41  ? 7.942   -15.049 -49.104 1.00 0.00 ?  356 PRO A CG   1  
ATOM   669    C  CD   . PRO A  1 41  ? 6.563   -15.301 -48.508 1.00 0.00 ?  356 PRO A CD   1  
ATOM   670    H  HA   . PRO A  1 41  ? 7.543   -12.801 -47.260 1.00 0.00 ?  356 PRO A HA   1  
ATOM   671    H  HB2  . PRO A  1 41  ? 7.468   -13.232 -50.273 1.00 0.00 ?  356 PRO A HB2  1  
ATOM   672    H  HB3  . PRO A  1 41  ? 8.937   -13.108 -49.246 1.00 0.00 ?  356 PRO A HB3  1  
ATOM   673    H  HG2  . PRO A  1 41  ? 8.129   -15.584 -50.060 1.00 0.00 ?  356 PRO A HG2  1  
ATOM   674    H  HG3  . PRO A  1 41  ? 8.680   -15.339 -48.327 1.00 0.00 ?  356 PRO A HG3  1  
ATOM   675    H  HD2  . PRO A  1 41  ? 5.808   -15.483 -49.303 1.00 0.00 ?  356 PRO A HD2  1  
ATOM   676    H  HD3  . PRO A  1 41  ? 6.697   -16.203 -47.873 1.00 0.00 ?  356 PRO A HD3  1  
ATOM   677    N  N    . ILE A  1 42  ? 6.586   -10.619 -48.009 1.00 0.00 ?  357 ILE A N    1  
ATOM   678    C  CA   . ILE A  1 42  ? 5.943   -9.318  -48.321 1.00 0.00 ?  357 ILE A CA   1  
ATOM   679    C  C    . ILE A  1 42  ? 5.881   -9.049  -49.864 1.00 0.00 ?  357 ILE A C    1  
ATOM   680    O  O    . ILE A  1 42  ? 4.832   -8.538  -50.300 1.00 0.00 ?  357 ILE A O    1  
ATOM   681    C  CB   . ILE A  1 42  ? 6.526   -8.155  -47.595 1.00 0.00 ?  357 ILE A CB   1  
ATOM   682    C  CG1  . ILE A  1 42  ? 6.360   -8.362  -46.097 1.00 0.00 ?  357 ILE A CG1  1  
ATOM   683    C  CG2  . ILE A  1 42  ? 6.089   -6.764  -47.967 1.00 0.00 ?  357 ILE A CG2  1  
ATOM   684    C  CD1  . ILE A  1 42  ? 7.283   -7.551  -45.127 1.00 0.00 ?  357 ILE A CD1  1  
ATOM   685    H  H    . ILE A  1 42  ? 7.387   -10.603 -47.415 1.00 0.00 ?  357 ILE A H    1  
ATOM   686    H  HA   . ILE A  1 42  ? 4.905   -9.490  -48.075 1.00 0.00 ?  357 ILE A HA   1  
ATOM   687    H  HB   . ILE A  1 42  ? 7.612   -8.270  -47.800 1.00 0.00 ?  357 ILE A HB   1  
ATOM   688    H  HG12 . ILE A  1 42  ? 5.373   -7.921  -45.842 1.00 0.00 ?  357 ILE A HG12 1  
ATOM   689    H  HG13 . ILE A  1 42  ? 6.297   -9.430  -45.800 1.00 0.00 ?  357 ILE A HG13 1  
ATOM   690    H  HG21 . ILE A  1 42  ? 5.110   -6.478  -47.527 1.00 0.00 ?  357 ILE A HG21 1  
ATOM   691    H  HG22 . ILE A  1 42  ? 5.971   -6.704  -49.071 1.00 0.00 ?  357 ILE A HG22 1  
ATOM   692    H  HG23 . ILE A  1 42  ? 6.887   -6.095  -47.580 1.00 0.00 ?  357 ILE A HG23 1  
ATOM   693    H  HD11 . ILE A  1 42  ? 6.949   -6.494  -45.059 1.00 0.00 ?  357 ILE A HD11 1  
ATOM   694    H  HD12 . ILE A  1 42  ? 8.343   -7.705  -45.422 1.00 0.00 ?  357 ILE A HD12 1  
ATOM   695    H  HD13 . ILE A  1 42  ? 7.336   -7.997  -44.111 1.00 0.00 ?  357 ILE A HD13 1  
ATOM   696    N  N    . GLY A  1 43  ? 6.960   -9.304  -50.618 1.00 0.00 ?  358 GLY A N    1  
ATOM   697    C  CA   . GLY A  1 43  ? 7.100   -8.877  -52.016 1.00 0.00 ?  358 GLY A CA   1  
ATOM   698    C  C    . GLY A  1 43  ? 6.292   -9.675  -52.993 1.00 0.00 ?  358 GLY A C    1  
ATOM   699    O  O    . GLY A  1 43  ? 6.032   -9.254  -54.159 1.00 0.00 ?  358 GLY A O    1  
ATOM   700    H  H    . GLY A  1 43  ? 7.774   -9.646  -50.155 1.00 0.00 ?  358 GLY A H    1  
ATOM   701    H  HA2  . GLY A  1 43  ? 6.765   -7.852  -52.082 1.00 0.00 ?  358 GLY A HA2  1  
ATOM   702    H  HA3  . GLY A  1 43  ? 8.150   -8.886  -52.272 1.00 0.00 ?  358 GLY A HA3  1  
ATOM   703    N  N    . GLN A  1 44  ? 5.883   -10.889 -52.612 1.00 0.00 ?  359 GLN A N    1  
ATOM   704    C  CA   . GLN A  1 44  ? 4.911   -11.734 -53.314 1.00 0.00 ?  359 GLN A CA   1  
ATOM   705    C  C    . GLN A  1 44  ? 3.502   -11.076 -53.379 1.00 0.00 ?  359 GLN A C    1  
ATOM   706    O  O    . GLN A  1 44  ? 2.798   -11.155 -54.357 1.00 0.00 ?  359 GLN A O    1  
ATOM   707    C  CB   . GLN A  1 44  ? 4.815   -13.115 -52.670 1.00 0.00 ?  359 GLN A CB   1  
ATOM   708    C  CG   . GLN A  1 44  ? 6.047   -13.956 -53.071 1.00 0.00 ?  359 GLN A CG   1  
ATOM   709    C  CD   . GLN A  1 44  ? 5.938   -14.361 -54.535 1.00 0.00 ?  359 GLN A CD   1  
ATOM   710    O  OE1  . GLN A  1 44  ? 6.306   -13.619 -55.457 1.00 0.00 ?  359 GLN A OE1  1  
ATOM   711    N  NE2  . GLN A  1 44  ? 5.317   -15.521 -54.707 1.00 0.00 ?  359 GLN A NE2  1  
ATOM   712    H  H    . GLN A  1 44  ? 6.393   -11.292 -51.857 1.00 0.00 ?  359 GLN A H    1  
ATOM   713    H  HA   . GLN A  1 44  ? 5.219   -11.803 -54.347 1.00 0.00 ?  359 GLN A HA   1  
ATOM   714    H  HB2  . GLN A  1 44  ? 4.713   -13.073 -51.565 1.00 0.00 ?  359 GLN A HB2  1  
ATOM   715    H  HB3  . GLN A  1 44  ? 3.929   -13.600 -53.132 1.00 0.00 ?  359 GLN A HB3  1  
ATOM   716    H  HG2  . GLN A  1 44  ? 7.005   -13.435 -52.862 1.00 0.00 ?  359 GLN A HG2  1  
ATOM   717    H  HG3  . GLN A  1 44  ? 6.025   -14.872 -52.443 1.00 0.00 ?  359 GLN A HG3  1  
ATOM   718    H  HE21 . GLN A  1 44  ? 4.993   -15.840 -55.598 1.00 0.00 ?  359 GLN A HE21 1  
ATOM   719    H  HE22 . GLN A  1 44  ? 4.968   -16.029 -53.920 1.00 0.00 ?  359 GLN A HE22 1  
ATOM   720    N  N    . PHE A  1 45  ? 3.064   -10.435 -52.259 1.00 0.00 ?  360 PHE A N    1  
ATOM   721    C  CA   . PHE A  1 45  ? 1.690   -9.910  -52.263 1.00 0.00 ?  360 PHE A CA   1  
ATOM   722    C  C    . PHE A  1 45  ? 1.724   -8.396  -52.535 1.00 0.00 ?  360 PHE A C    1  
ATOM   723    O  O    . PHE A  1 45  ? 1.002   -7.814  -53.405 1.00 0.00 ?  360 PHE A O    1  
ATOM   724    C  CB   . PHE A  1 45  ? 0.831   -10.345 -51.016 1.00 0.00 ?  360 PHE A CB   1  
ATOM   725    C  CG   . PHE A  1 45  ? -0.655  -10.070 -51.250 1.00 0.00 ?  360 PHE A CG   1  
ATOM   726    C  CD1  . PHE A  1 45  ? -1.191  -8.810  -50.970 1.00 0.00 ?  360 PHE A CD1  1  
ATOM   727    C  CD2  . PHE A  1 45  ? -1.563  -11.176 -51.547 1.00 0.00 ?  360 PHE A CD2  1  
ATOM   728    C  CE1  . PHE A  1 45  ? -2.588  -8.505  -51.196 1.00 0.00 ?  360 PHE A CE1  1  
ATOM   729    C  CE2  . PHE A  1 45  ? -2.947  -10.953 -51.718 1.00 0.00 ?  360 PHE A CE2  1  
ATOM   730    C  CZ   . PHE A  1 45  ? -3.443  -9.599  -51.513 1.00 0.00 ?  360 PHE A CZ   1  
ATOM   731    H  H    . PHE A  1 45  ? 3.562   -10.302 -51.405 1.00 0.00 ?  360 PHE A H    1  
ATOM   732    H  HA   . PHE A  1 45  ? 1.204   -10.323 -53.135 1.00 0.00 ?  360 PHE A HA   1  
ATOM   733    H  HB2  . PHE A  1 45  ? 1.040   -11.425 -50.862 1.00 0.00 ?  360 PHE A HB2  1  
ATOM   734    H  HB3  . PHE A  1 45  ? 1.206   -9.797  -50.126 1.00 0.00 ?  360 PHE A HB3  1  
ATOM   735    H  HD1  . PHE A  1 45  ? -0.542  -8.013  -50.638 1.00 0.00 ?  360 PHE A HD1  1  
ATOM   736    H  HD2  . PHE A  1 45  ? -1.134  -12.158 -51.685 1.00 0.00 ?  360 PHE A HD2  1  
ATOM   737    H  HE1  . PHE A  1 45  ? -2.992  -7.543  -50.919 1.00 0.00 ?  360 PHE A HE1  1  
ATOM   738    H  HE2  . PHE A  1 45  ? -3.672  -11.743 -51.849 1.00 0.00 ?  360 PHE A HE2  1  
ATOM   739    H  HZ   . PHE A  1 45  ? -4.493  -9.347  -51.528 1.00 0.00 ?  360 PHE A HZ   1  
ATOM   740    N  N    . TRP A  1 46  ? 2.609   -7.639  -51.791 1.00 0.00 ?  361 TRP A N    1  
ATOM   741    C  CA   . TRP A  1 46  ? 2.740   -6.236  -51.906 1.00 0.00 ?  361 TRP A CA   1  
ATOM   742    C  C    . TRP A  1 46  ? 4.029   -5.841  -52.704 1.00 0.00 ?  361 TRP A C    1  
ATOM   743    O  O    . TRP A  1 46  ? 5.051   -5.249  -52.261 1.00 0.00 ?  361 TRP A O    1  
ATOM   744    C  CB   . TRP A  1 46  ? 2.899   -5.713  -50.434 1.00 0.00 ?  361 TRP A CB   1  
ATOM   745    C  CG   . TRP A  1 46  ? 1.928   -6.186  -49.463 1.00 0.00 ?  361 TRP A CG   1  
ATOM   746    C  CD1  . TRP A  1 46  ? 2.115   -6.909  -48.253 1.00 0.00 ?  361 TRP A CD1  1  
ATOM   747    C  CD2  . TRP A  1 46  ? 0.584   -5.654  -49.335 1.00 0.00 ?  361 TRP A CD2  1  
ATOM   748    N  NE1  . TRP A  1 46  ? 0.941   -6.838  -47.486 1.00 0.00 ?  361 TRP A NE1  1  
ATOM   749    C  CE2  . TRP A  1 46  ? 0.034   -6.105  -48.152 1.00 0.00 ?  361 TRP A CE2  1  
ATOM   750    C  CE3  . TRP A  1 46  ? -0.256  -4.947  -50.217 1.00 0.00 ?  361 TRP A CE3  1  
ATOM   751    C  CZ2  . TRP A  1 46  ? -1.224  -5.858  -47.685 1.00 0.00 ?  361 TRP A CZ2  1  
ATOM   752    C  CZ3  . TRP A  1 46  ? -1.618  -4.675  -49.799 1.00 0.00 ?  361 TRP A CZ3  1  
ATOM   753    C  CH2  . TRP A  1 46  ? -2.068  -5.150  -48.544 1.00 0.00 ?  361 TRP A CH2  1  
ATOM   754    H  H    . TRP A  1 46  ? 3.168   -8.088  -51.099 1.00 0.00 ?  361 TRP A H    1  
ATOM   755    H  HA   . TRP A  1 46  ? 1.880   -5.832  -52.419 1.00 0.00 ?  361 TRP A HA   1  
ATOM   756    H  HB2  . TRP A  1 46  ? 3.916   -5.961  -50.061 1.00 0.00 ?  361 TRP A HB2  1  
ATOM   757    H  HB3  . TRP A  1 46  ? 2.929   -4.604  -50.484 1.00 0.00 ?  361 TRP A HB3  1  
ATOM   758    H  HD1  . TRP A  1 46  ? 3.022   -7.481  -48.126 1.00 0.00 ?  361 TRP A HD1  1  
ATOM   759    H  HE1  . TRP A  1 46  ? 0.704   -7.338  -46.682 1.00 0.00 ?  361 TRP A HE1  1  
ATOM   760    H  HE3  . TRP A  1 46  ? 0.214   -4.478  -51.068 1.00 0.00 ?  361 TRP A HE3  1  
ATOM   761    H  HZ2  . TRP A  1 46  ? -1.547  -6.285  -46.747 1.00 0.00 ?  361 TRP A HZ2  1  
ATOM   762    H  HZ3  . TRP A  1 46  ? -2.258  -4.120  -50.469 1.00 0.00 ?  361 TRP A HZ3  1  
ATOM   763    H  HH2  . TRP A  1 46  ? -3.091  -4.967  -48.250 1.00 0.00 ?  361 TRP A HH2  1  
ATOM   764    N  N    . ARG A  1 47  ? 4.040   -6.301  -54.028 1.00 0.00 ?  362 ARG A N    1  
ATOM   765    C  CA   . ARG A  1 47  ? 5.174   -6.135  -54.905 1.00 0.00 ?  362 ARG A CA   1  
ATOM   766    C  C    . ARG A  1 47  ? 5.483   -4.653  -55.008 1.00 0.00 ?  362 ARG A C    1  
ATOM   767    O  O    . ARG A  1 47  ? 4.689   -3.834  -55.429 1.00 0.00 ?  362 ARG A O    1  
ATOM   768    C  CB   . ARG A  1 47  ? 4.963   -6.830  -56.281 1.00 0.00 ?  362 ARG A CB   1  
ATOM   769    C  CG   . ARG A  1 47  ? 6.177   -6.543  -57.360 1.00 0.00 ?  362 ARG A CG   1  
ATOM   770    C  CD   . ARG A  1 47  ? 7.672   -6.735  -56.963 1.00 0.00 ?  362 ARG A CD   1  
ATOM   771    N  NE   . ARG A  1 47  ? 7.909   -8.181  -56.600 1.00 0.00 ?  362 ARG A NE   1  
ATOM   772    C  CZ   . ARG A  1 47  ? 9.072   -8.775  -56.847 1.00 0.00 ?  362 ARG A CZ   1  
ATOM   773    N  NH1  . ARG A  1 47  ? 9.979   -8.273  -57.665 1.00 0.00 1  362 ARG A NH1  1  
ATOM   774    N  NH2  . ARG A  1 47  ? 9.347   -9.975  -56.367 1.00 0.00 ?  362 ARG A NH2  1  
ATOM   775    H  H    . ARG A  1 47  ? 3.271   -6.763  -54.463 1.00 0.00 ?  362 ARG A H    1  
ATOM   776    H  HA   . ARG A  1 47  ? 6.003   -6.689  -54.489 1.00 0.00 ?  362 ARG A HA   1  
ATOM   777    H  HB2  . ARG A  1 47  ? 5.028   -7.891  -55.956 1.00 0.00 ?  362 ARG A HB2  1  
ATOM   778    H  HB3  . ARG A  1 47  ? 3.979   -6.554  -56.718 1.00 0.00 ?  362 ARG A HB3  1  
ATOM   779    H  HG2  . ARG A  1 47  ? 5.953   -7.119  -58.284 1.00 0.00 ?  362 ARG A HG2  1  
ATOM   780    H  HG3  . ARG A  1 47  ? 6.175   -5.486  -57.700 1.00 0.00 ?  362 ARG A HG3  1  
ATOM   781    H  HD2  . ARG A  1 47  ? 8.211   -6.481  -57.901 1.00 0.00 ?  362 ARG A HD2  1  
ATOM   782    H  HD3  . ARG A  1 47  ? 7.934   -6.023  -56.151 1.00 0.00 ?  362 ARG A HD3  1  
ATOM   783    H  HE   . ARG A  1 47  ? 7.183   -8.631  -56.079 1.00 0.00 ?  362 ARG A HE   1  
ATOM   784    H  HH11 . ARG A  1 47  ? 10.036  -7.276  -57.696 1.00 0.00 ?  362 ARG A HH11 1  
ATOM   785    H  HH12 . ARG A  1 47  ? 10.806  -8.808  -57.841 1.00 0.00 ?  362 ARG A HH12 1  
ATOM   786    H  HH21 . ARG A  1 47  ? 8.538   -10.466 -56.042 1.00 0.00 ?  362 ARG A HH21 1  
ATOM   787    H  HH22 . ARG A  1 47  ? 10.022  -10.560 -56.816 1.00 0.00 ?  362 ARG A HH22 1  
ATOM   788    N  N    . GLY A  1 48  ? 6.718   -4.243  -54.607 1.00 0.00 ?  363 GLY A N    1  
ATOM   789    C  CA   . GLY A  1 48  ? 7.259   -2.911  -54.640 1.00 0.00 ?  363 GLY A CA   1  
ATOM   790    C  C    . GLY A  1 48  ? 7.538   -2.276  -53.278 1.00 0.00 ?  363 GLY A C    1  
ATOM   791    O  O    . GLY A  1 48  ? 7.893   -1.136  -53.163 1.00 0.00 ?  363 GLY A O    1  
ATOM   792    H  H    . GLY A  1 48  ? 7.307   -4.964  -54.251 1.00 0.00 ?  363 GLY A H    1  
ATOM   793    H  HA2  . GLY A  1 48  ? 8.229   -2.965  -55.112 1.00 0.00 ?  363 GLY A HA2  1  
ATOM   794    H  HA3  . GLY A  1 48  ? 6.631   -2.246  -55.215 1.00 0.00 ?  363 GLY A HA3  1  
ATOM   795    N  N    . LEU A  1 49  ? 7.242   -3.009  -52.163 1.00 0.00 ?  364 LEU A N    1  
ATOM   796    C  CA   . LEU A  1 49  ? 7.428   -2.508  -50.814 1.00 0.00 ?  364 LEU A CA   1  
ATOM   797    C  C    . LEU A  1 49  ? 8.688   -3.101  -50.156 1.00 0.00 ?  364 LEU A C    1  
ATOM   798    O  O    . LEU A  1 49  ? 8.808   -4.327  -50.262 1.00 0.00 ?  364 LEU A O    1  
ATOM   799    C  CB   . LEU A  1 49  ? 6.192   -2.995  -50.014 1.00 0.00 ?  364 LEU A CB   1  
ATOM   800    C  CG   . LEU A  1 49  ? 6.133   -2.454  -48.564 1.00 0.00 ?  364 LEU A CG   1  
ATOM   801    C  CD1  . LEU A  1 49  ? 5.796   -0.880  -48.527 1.00 0.00 ?  364 LEU A CD1  1  
ATOM   802    C  CD2  . LEU A  1 49  ? 5.055   -3.180  -47.794 1.00 0.00 ?  364 LEU A CD2  1  
ATOM   803    H  H    . LEU A  1 49  ? 6.960   -3.958  -52.280 1.00 0.00 ?  364 LEU A H    1  
ATOM   804    H  HA   . LEU A  1 49  ? 7.511   -1.433  -50.754 1.00 0.00 ?  364 LEU A HA   1  
ATOM   805    H  HB2  . LEU A  1 49  ? 5.325   -2.586  -50.576 1.00 0.00 ?  364 LEU A HB2  1  
ATOM   806    H  HB3  . LEU A  1 49  ? 6.042   -4.096  -50.017 1.00 0.00 ?  364 LEU A HB3  1  
ATOM   807    H  HG   . LEU A  1 49  ? 7.126   -2.605  -48.088 1.00 0.00 ?  364 LEU A HG   1  
ATOM   808    H  HD11 . LEU A  1 49  ? 4.858   -0.657  -49.080 1.00 0.00 ?  364 LEU A HD11 1  
ATOM   809    H  HD12 . LEU A  1 49  ? 6.714   -0.369  -48.889 1.00 0.00 ?  364 LEU A HD12 1  
ATOM   810    H  HD13 . LEU A  1 49  ? 5.756   -0.565  -47.463 1.00 0.00 ?  364 LEU A HD13 1  
ATOM   811    H  HD21 . LEU A  1 49  ? 4.984   -2.699  -46.795 1.00 0.00 ?  364 LEU A HD21 1  
ATOM   812    H  HD22 . LEU A  1 49  ? 5.403   -4.202  -47.531 1.00 0.00 ?  364 LEU A HD22 1  
ATOM   813    H  HD23 . LEU A  1 49  ? 4.067   -3.164  -48.302 1.00 0.00 ?  364 LEU A HD23 1  
ATOM   814    N  N    . PRO A  1 50  ? 9.672   -2.342  -49.609 1.00 0.00 ?  365 PRO A N    1  
ATOM   815    C  CA   . PRO A  1 50  ? 10.829  -2.890  -48.841 1.00 0.00 ?  365 PRO A CA   1  
ATOM   816    C  C    . PRO A  1 50  ? 10.592  -3.942  -47.744 1.00 0.00 ?  365 PRO A C    1  
ATOM   817    O  O    . PRO A  1 50  ? 9.552   -3.931  -47.072 1.00 0.00 ?  365 PRO A O    1  
ATOM   818    C  CB   . PRO A  1 50  ? 11.594  -1.647  -48.283 1.00 0.00 ?  365 PRO A CB   1  
ATOM   819    C  CG   . PRO A  1 50  ? 10.954  -0.478  -49.074 1.00 0.00 ?  365 PRO A CG   1  
ATOM   820    C  CD   . PRO A  1 50  ? 9.593   -0.903  -49.445 1.00 0.00 ?  365 PRO A CD   1  
ATOM   821    H  HA   . PRO A  1 50  ? 11.378  -3.471  -49.567 1.00 0.00 ?  365 PRO A HA   1  
ATOM   822    H  HB2  . PRO A  1 50  ? 11.374  -1.391  -47.225 1.00 0.00 ?  365 PRO A HB2  1  
ATOM   823    H  HB3  . PRO A  1 50  ? 12.697  -1.701  -48.402 1.00 0.00 ?  365 PRO A HB3  1  
ATOM   824    H  HG2  . PRO A  1 50  ? 10.878  0.432   -48.441 1.00 0.00 ?  365 PRO A HG2  1  
ATOM   825    H  HG3  . PRO A  1 50  ? 11.393  -0.308  -50.080 1.00 0.00 ?  365 PRO A HG3  1  
ATOM   826    H  HD2  . PRO A  1 50  ? 8.873   -0.723  -48.618 1.00 0.00 ?  365 PRO A HD2  1  
ATOM   827    H  HD3  . PRO A  1 50  ? 9.329   -0.450  -50.425 1.00 0.00 ?  365 PRO A HD3  1  
ATOM   828    N  N    . ALA A  1 51  ? 11.627  -4.787  -47.452 1.00 0.00 ?  366 ALA A N    1  
ATOM   829    C  CA   . ALA A  1 51  ? 11.642  -5.301  -46.058 1.00 0.00 ?  366 ALA A CA   1  
ATOM   830    C  C    . ALA A  1 51  ? 11.745  -4.264  -44.930 1.00 0.00 ?  366 ALA A C    1  
ATOM   831    O  O    . ALA A  1 51  ? 12.322  -3.165  -45.128 1.00 0.00 ?  366 ALA A O    1  
ATOM   832    C  CB   . ALA A  1 51  ? 12.905  -6.253  -45.892 1.00 0.00 ?  366 ALA A CB   1  
ATOM   833    H  H    . ALA A  1 51  ? 12.418  -4.900  -48.049 1.00 0.00 ?  366 ALA A H    1  
ATOM   834    H  HA   . ALA A  1 51  ? 10.737  -5.851  -45.846 1.00 0.00 ?  366 ALA A HA   1  
ATOM   835    H  HB1  . ALA A  1 51  ? 13.142  -6.409  -44.818 1.00 0.00 ?  366 ALA A HB1  1  
ATOM   836    H  HB2  . ALA A  1 51  ? 13.746  -5.781  -46.444 1.00 0.00 ?  366 ALA A HB2  1  
ATOM   837    H  HB3  . ALA A  1 51  ? 12.564  -7.188  -46.384 1.00 0.00 ?  366 ALA A HB3  1  
ATOM   838    N  N    . SER A  1 52  ? 11.159  -4.600  -43.768 1.00 0.00 ?  367 SER A N    1  
ATOM   839    C  CA   . SER A  1 52  ? 11.098  -3.775  -42.580 1.00 0.00 ?  367 SER A CA   1  
ATOM   840    C  C    . SER A  1 52  ? 10.544  -2.398  -42.669 1.00 0.00 ?  367 SER A C    1  
ATOM   841    O  O    . SER A  1 52  ? 11.189  -1.412  -42.309 1.00 0.00 ?  367 SER A O    1  
ATOM   842    C  CB   . SER A  1 52  ? 12.352  -3.771  -41.543 1.00 0.00 ?  367 SER A CB   1  
ATOM   843    O  OG   . SER A  1 52  ? 12.651  -5.122  -41.162 1.00 0.00 ?  367 SER A OG   1  
ATOM   844    H  H    . SER A  1 52  ? 10.985  -5.572  -43.629 1.00 0.00 ?  367 SER A H    1  
ATOM   845    H  HA   . SER A  1 52  ? 10.290  -4.275  -42.066 1.00 0.00 ?  367 SER A HA   1  
ATOM   846    H  HB2  . SER A  1 52  ? 13.213  -3.206  -41.959 1.00 0.00 ?  367 SER A HB2  1  
ATOM   847    H  HB3  . SER A  1 52  ? 12.129  -3.224  -40.602 1.00 0.00 ?  367 SER A HB3  1  
ATOM   848    H  HG   . SER A  1 52  ? 11.892  -5.415  -40.653 1.00 0.00 ?  367 SER A HG   1  
ATOM   849    N  N    . ILE A  1 53  ? 9.275   -2.342  -43.008 1.00 0.00 ?  368 ILE A N    1  
ATOM   850    C  CA   . ILE A  1 53  ? 8.533   -1.088  -42.907 1.00 0.00 ?  368 ILE A CA   1  
ATOM   851    C  C    . ILE A  1 53  ? 8.169   -0.716  -41.435 1.00 0.00 ?  368 ILE A C    1  
ATOM   852    O  O    . ILE A  1 53  ? 8.025   -1.438  -40.541 1.00 0.00 ?  368 ILE A O    1  
ATOM   853    C  CB   . ILE A  1 53  ? 7.211   -1.220  -43.718 1.00 0.00 ?  368 ILE A CB   1  
ATOM   854    C  CG1  . ILE A  1 53  ? 6.333   -2.427  -43.332 1.00 0.00 ?  368 ILE A CG1  1  
ATOM   855    C  CG2  . ILE A  1 53  ? 7.647   -1.378  -45.159 1.00 0.00 ?  368 ILE A CG2  1  
ATOM   856    C  CD1  . ILE A  1 53  ? 4.876   -2.208  -43.735 1.00 0.00 ?  368 ILE A CD1  1  
ATOM   857    H  H    . ILE A  1 53  ? 8.762   -3.162  -43.251 1.00 0.00 ?  368 ILE A H    1  
ATOM   858    H  HA   . ILE A  1 53  ? 9.161   -0.313  -43.320 1.00 0.00 ?  368 ILE A HA   1  
ATOM   859    H  HB   . ILE A  1 53  ? 6.516   -0.368  -43.557 1.00 0.00 ?  368 ILE A HB   1  
ATOM   860    H  HG12 . ILE A  1 53  ? 6.778   -3.257  -43.920 1.00 0.00 ?  368 ILE A HG12 1  
ATOM   861    H  HG13 . ILE A  1 53  ? 6.369   -2.655  -42.245 1.00 0.00 ?  368 ILE A HG13 1  
ATOM   862    H  HG21 . ILE A  1 53  ? 8.262   -0.590  -45.643 1.00 0.00 ?  368 ILE A HG21 1  
ATOM   863    H  HG22 . ILE A  1 53  ? 6.722   -1.485  -45.766 1.00 0.00 ?  368 ILE A HG22 1  
ATOM   864    H  HG23 . ILE A  1 53  ? 8.116   -2.376  -45.295 1.00 0.00 ?  368 ILE A HG23 1  
ATOM   865    H  HD11 . ILE A  1 53  ? 4.319   -3.117  -43.421 1.00 0.00 ?  368 ILE A HD11 1  
ATOM   866    H  HD12 . ILE A  1 53  ? 4.678   -2.039  -44.815 1.00 0.00 ?  368 ILE A HD12 1  
ATOM   867    H  HD13 . ILE A  1 53  ? 4.498   -1.282  -43.251 1.00 0.00 ?  368 ILE A HD13 1  
ATOM   868    N  N    . ASN A  1 54  ? 8.092   0.620   -41.258 1.00 0.00 ?  369 ASN A N    1  
ATOM   869    C  CA   . ASN A  1 54  ? 7.939   1.240   -39.949 1.00 0.00 ?  369 ASN A CA   1  
ATOM   870    C  C    . ASN A  1 54  ? 6.480   1.174   -39.446 1.00 0.00 ?  369 ASN A C    1  
ATOM   871    O  O    . ASN A  1 54  ? 6.248   1.025   -38.257 1.00 0.00 ?  369 ASN A O    1  
ATOM   872    C  CB   . ASN A  1 54  ? 8.304   2.776   -39.789 1.00 0.00 ?  369 ASN A CB   1  
ATOM   873    C  CG   . ASN A  1 54  ? 9.827   3.010   -40.035 1.00 0.00 ?  369 ASN A CG   1  
ATOM   874    O  OD1  . ASN A  1 54  ? 10.116  3.445   -41.141 1.00 0.00 ?  369 ASN A OD1  1  
ATOM   875    N  ND2  . ASN A  1 54  ? 10.708  2.806   -39.090 1.00 0.00 ?  369 ASN A ND2  1  
ATOM   876    H  H    . ASN A  1 54  ? 8.245   1.263   -42.004 1.00 0.00 ?  369 ASN A H    1  
ATOM   877    H  HA   . ASN A  1 54  ? 8.542   0.720   -39.219 1.00 0.00 ?  369 ASN A HA   1  
ATOM   878    H  HB2  . ASN A  1 54  ? 7.826   3.383   -40.586 1.00 0.00 ?  369 ASN A HB2  1  
ATOM   879    H  HB3  . ASN A  1 54  ? 7.890   3.155   -38.830 1.00 0.00 ?  369 ASN A HB3  1  
ATOM   880    H  HD21 . ASN A  1 54  ? 10.445  2.299   -38.269 1.00 0.00 ?  369 ASN A HD21 1  
ATOM   881    H  HD22 . ASN A  1 54  ? 11.634  3.159   -39.223 1.00 0.00 ?  369 ASN A HD22 1  
ATOM   882    N  N    . THR A  1 55  ? 5.566   1.313   -40.414 1.00 0.00 ?  370 THR A N    1  
ATOM   883    C  CA   . THR A  1 55  ? 4.128   1.385   -40.034 1.00 0.00 ?  370 THR A CA   1  
ATOM   884    C  C    . THR A  1 55  ? 3.273   1.002   -41.224 1.00 0.00 ?  370 THR A C    1  
ATOM   885    O  O    . THR A  1 55  ? 3.714   0.950   -42.341 1.00 0.00 ?  370 THR A O    1  
ATOM   886    C  CB   . THR A  1 55  ? 3.684   2.723   -39.482 1.00 0.00 ?  370 THR A CB   1  
ATOM   887    O  OG1  . THR A  1 55  ? 2.480   2.626   -38.681 1.00 0.00 ?  370 THR A OG1  1  
ATOM   888    C  CG2  . THR A  1 55  ? 3.610   3.916   -40.373 1.00 0.00 ?  370 THR A CG2  1  
ATOM   889    H  H    . THR A  1 55  ? 5.777   1.397   -41.385 1.00 0.00 ?  370 THR A H    1  
ATOM   890    H  HA   . THR A  1 55  ? 3.974   0.621   -39.286 1.00 0.00 ?  370 THR A HA   1  
ATOM   891    H  HB   . THR A  1 55  ? 4.518   2.994   -38.800 1.00 0.00 ?  370 THR A HB   1  
ATOM   892    H  HG1  . THR A  1 55  ? 2.605   1.887   -38.082 1.00 0.00 ?  370 THR A HG1  1  
ATOM   893    H  HG21 . THR A  1 55  ? 3.748   4.892   -39.860 1.00 0.00 ?  370 THR A HG21 1  
ATOM   894    H  HG22 . THR A  1 55  ? 2.668   4.028   -40.952 1.00 0.00 ?  370 THR A HG22 1  
ATOM   895    H  HG23 . THR A  1 55  ? 4.317   3.765   -41.217 1.00 0.00 ?  370 THR A HG23 1  
ATOM   896    N  N    . ALA A  1 56  ? 2.045   0.850   -40.914 1.00 0.00 ?  371 ALA A N    1  
ATOM   897    C  CA   . ALA A  1 56  ? 1.007   0.319   -41.806 1.00 0.00 ?  371 ALA A CA   1  
ATOM   898    C  C    . ALA A  1 56  ? -0.389  0.813   -41.292 1.00 0.00 ?  371 ALA A C    1  
ATOM   899    O  O    . ALA A  1 56  ? -0.684  0.755   -40.089 1.00 0.00 ?  371 ALA A O    1  
ATOM   900    C  CB   . ALA A  1 56  ? 1.043   -1.217  -41.710 1.00 0.00 ?  371 ALA A CB   1  
ATOM   901    H  H    . ALA A  1 56  ? 1.769   0.984   -39.965 1.00 0.00 ?  371 ALA A H    1  
ATOM   902    H  HA   . ALA A  1 56  ? 1.066   0.840   -42.750 1.00 0.00 ?  371 ALA A HA   1  
ATOM   903    H  HB1  . ALA A  1 56  ? 2.019   -1.697  -41.937 1.00 0.00 ?  371 ALA A HB1  1  
ATOM   904    H  HB2  . ALA A  1 56  ? 0.176   -1.618  -42.276 1.00 0.00 ?  371 ALA A HB2  1  
ATOM   905    H  HB3  . ALA A  1 56  ? 0.903   -1.439  -40.630 1.00 0.00 ?  371 ALA A HB3  1  
ATOM   906    N  N    . TYR A  1 57  ? -1.284  1.225   -42.185 1.00 0.00 ?  372 TYR A N    1  
ATOM   907    C  CA   . TYR A  1 57  ? -2.576  1.563   -41.570 1.00 0.00 ?  372 TYR A CA   1  
ATOM   908    C  C    . TYR A  1 57  ? -3.505  1.724   -42.764 1.00 0.00 ?  372 TYR A C    1  
ATOM   909    O  O    . TYR A  1 57  ? -2.952  1.863   -43.862 1.00 0.00 ?  372 TYR A O    1  
ATOM   910    C  CB   . TYR A  1 57  ? -2.649  2.871   -40.692 1.00 0.00 ?  372 TYR A CB   1  
ATOM   911    C  CG   . TYR A  1 57  ? -2.751  4.271   -41.361 1.00 0.00 ?  372 TYR A CG   1  
ATOM   912    C  CD1  . TYR A  1 57  ? -1.686  4.691   -42.222 1.00 0.00 ?  372 TYR A CD1  1  
ATOM   913    C  CD2  . TYR A  1 57  ? -3.836  5.120   -41.150 1.00 0.00 ?  372 TYR A CD2  1  
ATOM   914    C  CE1  . TYR A  1 57  ? -1.728  5.971   -42.783 1.00 0.00 ?  372 TYR A CE1  1  
ATOM   915    C  CE2  . TYR A  1 57  ? -3.861  6.308   -41.799 1.00 0.00 ?  372 TYR A CE2  1  
ATOM   916    C  CZ   . TYR A  1 57  ? -2.803  6.736   -42.622 1.00 0.00 ?  372 TYR A CZ   1  
ATOM   917    O  OH   . TYR A  1 57  ? -2.939  8.007   -43.240 1.00 0.00 ?  372 TYR A OH   1  
ATOM   918    H  H    . TYR A  1 57  ? -1.144  1.446   -43.147 1.00 0.00 ?  372 TYR A H    1  
ATOM   919    H  HA   . TYR A  1 57  ? -2.965  0.752   -40.972 1.00 0.00 ?  372 TYR A HA   1  
ATOM   920    H  HB2  . TYR A  1 57  ? -3.500  2.664   -40.009 1.00 0.00 ?  372 TYR A HB2  1  
ATOM   921    H  HB3  . TYR A  1 57  ? -1.842  2.990   -39.937 1.00 0.00 ?  372 TYR A HB3  1  
ATOM   922    H  HD1  . TYR A  1 57  ? -0.822  4.052   -42.328 1.00 0.00 ?  372 TYR A HD1  1  
ATOM   923    H  HD2  . TYR A  1 57  ? -4.578  4.819   -40.426 1.00 0.00 ?  372 TYR A HD2  1  
ATOM   924    H  HE1  . TYR A  1 57  ? -0.989  6.374   -43.460 1.00 0.00 ?  372 TYR A HE1  1  
ATOM   925    H  HE2  . TYR A  1 57  ? -4.718  6.937   -41.609 1.00 0.00 ?  372 TYR A HE2  1  
ATOM   926    H  HH   . TYR A  1 57  ? -3.488  8.571   -42.689 1.00 0.00 ?  372 TYR A HH   1  
ATOM   927    N  N    . GLU A  1 58  ? -4.756  1.625   -42.546 1.00 0.00 ?  373 GLU A N    1  
ATOM   928    C  CA   . GLU A  1 58  ? -5.758  1.997   -43.638 1.00 0.00 ?  373 GLU A CA   1  
ATOM   929    C  C    . GLU A  1 58  ? -6.278  3.428   -43.544 1.00 0.00 ?  373 GLU A C    1  
ATOM   930    O  O    . GLU A  1 58  ? -6.475  3.972   -42.474 1.00 0.00 ?  373 GLU A O    1  
ATOM   931    C  CB   . GLU A  1 58  ? -6.899  0.942   -43.615 1.00 0.00 ?  373 GLU A CB   1  
ATOM   932    C  CG   . GLU A  1 58  ? -8.369  1.200   -44.245 1.00 0.00 ?  373 GLU A CG   1  
ATOM   933    C  CD   . GLU A  1 58  ? -9.143  -0.076  -44.103 1.00 0.00 ?  373 GLU A CD   1  
ATOM   934    O  OE1  . GLU A  1 58  ? -9.633  -0.660  -45.129 1.00 0.00 ?  373 GLU A OE1  1  
ATOM   935    O  OE2  . GLU A  1 58  ? -9.342  -0.517  -42.965 1.00 0.00 -1 373 GLU A OE2  1  
ATOM   936    H  H    . GLU A  1 58  ? -5.140  1.335   -41.673 1.00 0.00 ?  373 GLU A H    1  
ATOM   937    H  HA   . GLU A  1 58  ? -5.281  2.084   -44.603 1.00 0.00 ?  373 GLU A HA   1  
ATOM   938    H  HB2  . GLU A  1 58  ? -6.409  0.038   -44.036 1.00 0.00 ?  373 GLU A HB2  1  
ATOM   939    H  HB3  . GLU A  1 58  ? -7.064  0.691   -42.545 1.00 0.00 ?  373 GLU A HB3  1  
ATOM   940    H  HG2  . GLU A  1 58  ? -8.870  2.086   -43.800 1.00 0.00 ?  373 GLU A HG2  1  
ATOM   941    H  HG3  . GLU A  1 58  ? -8.175  1.351   -45.329 1.00 0.00 ?  373 GLU A HG3  1  
ATOM   942    N  N    . ARG A  1 59  ? -6.479  4.110   -44.642 1.00 0.00 ?  374 ARG A N    1  
ATOM   943    C  CA   . ARG A  1 59  ? -6.903  5.503   -44.558 1.00 0.00 ?  374 ARG A CA   1  
ATOM   944    C  C    . ARG A  1 59  ? -8.435  5.586   -44.898 1.00 0.00 ?  374 ARG A C    1  
ATOM   945    O  O    . ARG A  1 59  ? -9.015  4.568   -45.245 1.00 0.00 ?  374 ARG A O    1  
ATOM   946    C  CB   . ARG A  1 59  ? -5.938  6.354   -45.433 1.00 0.00 ?  374 ARG A CB   1  
ATOM   947    C  CG   . ARG A  1 59  ? -6.306  6.266   -46.945 1.00 0.00 ?  374 ARG A CG   1  
ATOM   948    C  CD   . ARG A  1 59  ? -5.538  7.404   -47.812 1.00 0.00 ?  374 ARG A CD   1  
ATOM   949    N  NE   . ARG A  1 59  ? -6.263  7.546   -49.077 1.00 0.00 ?  374 ARG A NE   1  
ATOM   950    C  CZ   . ARG A  1 59  ? -5.718  7.603   -50.297 1.00 0.00 ?  374 ARG A CZ   1  
ATOM   951    N  NH1  . ARG A  1 59  ? -6.490  7.400   -51.346 1.00 0.00 1  374 ARG A NH1  1  
ATOM   952    N  NH2  . ARG A  1 59  ? -4.461  7.835   -50.546 1.00 0.00 ?  374 ARG A NH2  1  
ATOM   953    H  H    . ARG A  1 59  ? -6.363  3.764   -45.570 1.00 0.00 ?  374 ARG A H    1  
ATOM   954    H  HA   . ARG A  1 59  ? -6.783  5.876   -43.552 1.00 0.00 ?  374 ARG A HA   1  
ATOM   955    H  HB2  . ARG A  1 59  ? -6.120  7.411   -45.144 1.00 0.00 ?  374 ARG A HB2  1  
ATOM   956    H  HB3  . ARG A  1 59  ? -4.854  6.139   -45.318 1.00 0.00 ?  374 ARG A HB3  1  
ATOM   957    H  HG2  . ARG A  1 59  ? -6.114  5.281   -47.423 1.00 0.00 ?  374 ARG A HG2  1  
ATOM   958    H  HG3  . ARG A  1 59  ? -7.400  6.372   -47.110 1.00 0.00 ?  374 ARG A HG3  1  
ATOM   959    H  HD2  . ARG A  1 59  ? -5.525  8.345   -47.222 1.00 0.00 ?  374 ARG A HD2  1  
ATOM   960    H  HD3  . ARG A  1 59  ? -4.482  7.099   -47.969 1.00 0.00 ?  374 ARG A HD3  1  
ATOM   961    H  HE   . ARG A  1 59  ? -7.171  7.155   -49.226 1.00 0.00 ?  374 ARG A HE   1  
ATOM   962    H  HH11 . ARG A  1 59  ? -7.483  7.430   -51.225 1.00 0.00 ?  374 ARG A HH11 1  
ATOM   963    H  HH12 . ARG A  1 59  ? -6.185  7.668   -52.259 1.00 0.00 ?  374 ARG A HH12 1  
ATOM   964    H  HH21 . ARG A  1 59  ? -3.820  7.974   -49.791 1.00 0.00 ?  374 ARG A HH21 1  
ATOM   965    H  HH22 . ARG A  1 59  ? -4.150  7.934   -51.492 1.00 0.00 ?  374 ARG A HH22 1  
ATOM   966    N  N    . LYS A  1 60  ? -9.034  6.729   -44.883 1.00 0.00 ?  375 LYS A N    1  
ATOM   967    C  CA   . LYS A  1 60  ? -10.387 7.160   -45.267 1.00 0.00 ?  375 LYS A CA   1  
ATOM   968    C  C    . LYS A  1 60  ? -11.172 6.298   -46.224 1.00 0.00 ?  375 LYS A C    1  
ATOM   969    O  O    . LYS A  1 60  ? -12.247 5.821   -45.866 1.00 0.00 ?  375 LYS A O    1  
ATOM   970    C  CB   . LYS A  1 60  ? -10.413 8.663   -45.624 1.00 0.00 ?  375 LYS A CB   1  
ATOM   971    C  CG   . LYS A  1 60  ? -9.205  9.057   -46.502 1.00 0.00 ?  375 LYS A CG   1  
ATOM   972    C  CD   . LYS A  1 60  ? -9.485  10.353  -47.290 1.00 0.00 ?  375 LYS A CD   1  
ATOM   973    C  CE   . LYS A  1 60  ? -10.237 11.515  -46.561 1.00 0.00 ?  375 LYS A CE   1  
ATOM   974    N  NZ   . LYS A  1 60  ? -10.043 12.853  -47.057 1.00 0.00 1  375 LYS A NZ   1  
ATOM   975    H  H    . LYS A  1 60  ? -8.450  7.514   -44.693 1.00 0.00 ?  375 LYS A H    1  
ATOM   976    H  HA   . LYS A  1 60  ? -11.032 7.133   -44.400 1.00 0.00 ?  375 LYS A HA   1  
ATOM   977    H  HB2  . LYS A  1 60  ? -11.256 8.867   -46.318 1.00 0.00 ?  375 LYS A HB2  1  
ATOM   978    H  HB3  . LYS A  1 60  ? -10.478 9.342   -44.747 1.00 0.00 ?  375 LYS A HB3  1  
ATOM   979    H  HG2  . LYS A  1 60  ? -8.260  9.258   -45.953 1.00 0.00 ?  375 LYS A HG2  1  
ATOM   980    H  HG3  . LYS A  1 60  ? -9.084  8.269   -47.276 1.00 0.00 ?  375 LYS A HG3  1  
ATOM   981    H  HD2  . LYS A  1 60  ? -8.487  10.635  -47.687 1.00 0.00 ?  375 LYS A HD2  1  
ATOM   982    H  HD3  . LYS A  1 60  ? -10.096 10.065  -48.172 1.00 0.00 ?  375 LYS A HD3  1  
ATOM   983    H  HE2  . LYS A  1 60  ? -11.310 11.287  -46.381 1.00 0.00 ?  375 LYS A HE2  1  
ATOM   984    H  HE3  . LYS A  1 60  ? -9.874  11.456  -45.512 1.00 0.00 ?  375 LYS A HE3  1  
ATOM   985    H  HZ1  . LYS A  1 60  ? -10.324 12.924  -48.056 1.00 0.00 ?  375 LYS A HZ1  1  
ATOM   986    H  HZ2  . LYS A  1 60  ? -9.067  13.177  -46.899 1.00 0.00 ?  375 LYS A HZ2  1  
ATOM   987    H  HZ3  . LYS A  1 60  ? -10.682 13.467  -46.512 1.00 0.00 ?  375 LYS A HZ3  1  
ATOM   988    N  N    . ASP A  1 61  ? -10.644 6.089   -47.396 1.00 0.00 ?  376 ASP A N    1  
ATOM   989    C  CA   . ASP A  1 61  ? -11.397 5.552   -48.550 1.00 0.00 ?  376 ASP A CA   1  
ATOM   990    C  C    . ASP A  1 61  ? -11.020 4.111   -48.750 1.00 0.00 ?  376 ASP A C    1  
ATOM   991    O  O    . ASP A  1 61  ? -11.443 3.407   -49.631 1.00 0.00 ?  376 ASP A O    1  
ATOM   992    C  CB   . ASP A  1 61  ? -11.071 6.391   -49.887 1.00 0.00 ?  376 ASP A CB   1  
ATOM   993    C  CG   . ASP A  1 61  ? -9.624  6.753   -50.056 1.00 0.00 ?  376 ASP A CG   1  
ATOM   994    O  OD1  . ASP A  1 61  ? -8.728  6.211   -49.373 1.00 0.00 ?  376 ASP A OD1  1  
ATOM   995    O  OD2  . ASP A  1 61  ? -9.354  7.708   -50.863 1.00 0.00 -1 376 ASP A OD2  1  
ATOM   996    H  H    . ASP A  1 61  ? -9.737  6.470   -47.556 1.00 0.00 ?  376 ASP A H    1  
ATOM   997    H  HA   . ASP A  1 61  ? -12.450 5.493   -48.315 1.00 0.00 ?  376 ASP A HA   1  
ATOM   998    H  HB2  . ASP A  1 61  ? -11.517 5.933   -50.796 1.00 0.00 ?  376 ASP A HB2  1  
ATOM   999    H  HB3  . ASP A  1 61  ? -11.585 7.374   -49.820 1.00 0.00 ?  376 ASP A HB3  1  
ATOM   1000   N  N    . GLY A  1 62  ? -10.265 3.588   -47.778 1.00 0.00 ?  377 GLY A N    1  
ATOM   1001   C  CA   . GLY A  1 62  ? -9.931  2.167   -47.731 1.00 0.00 ?  377 GLY A CA   1  
ATOM   1002   C  C    . GLY A  1 62  ? -8.627  1.823   -48.525 1.00 0.00 ?  377 GLY A C    1  
ATOM   1003   O  O    . GLY A  1 62  ? -8.345  0.670   -48.593 1.00 0.00 ?  377 GLY A O    1  
ATOM   1004   H  H    . GLY A  1 62  ? -9.843  4.091   -47.028 1.00 0.00 ?  377 GLY A H    1  
ATOM   1005   H  HA2  . GLY A  1 62  ? -9.767  1.873   -46.705 1.00 0.00 ?  377 GLY A HA2  1  
ATOM   1006   H  HA3  . GLY A  1 62  ? -10.685 1.580   -48.234 1.00 0.00 ?  377 GLY A HA3  1  
ATOM   1007   N  N    . LYS A  1 63  ? -7.800  2.816   -49.037 1.00 0.00 ?  378 LYS A N    1  
ATOM   1008   C  CA   . LYS A  1 63  ? -6.455  2.480   -49.405 1.00 0.00 ?  378 LYS A CA   1  
ATOM   1009   C  C    . LYS A  1 63  ? -5.505  2.294   -48.318 1.00 0.00 ?  378 LYS A C    1  
ATOM   1010   O  O    . LYS A  1 63  ? -5.630  2.967   -47.274 1.00 0.00 ?  378 LYS A O    1  
ATOM   1011   C  CB   . LYS A  1 63  ? -5.853  3.379   -50.533 1.00 0.00 ?  378 LYS A CB   1  
ATOM   1012   C  CG   . LYS A  1 63  ? -6.501  3.249   -51.887 1.00 0.00 ?  378 LYS A CG   1  
ATOM   1013   C  CD   . LYS A  1 63  ? -7.826  3.930   -52.155 1.00 0.00 ?  378 LYS A CD   1  
ATOM   1014   C  CE   . LYS A  1 63  ? -8.479  3.597   -53.496 1.00 0.00 ?  378 LYS A CE   1  
ATOM   1015   N  NZ   . LYS A  1 63  ? -9.089  2.242   -53.382 1.00 0.00 1  378 LYS A NZ   1  
ATOM   1016   H  H    . LYS A  1 63  ? -8.107  3.753   -48.894 1.00 0.00 ?  378 LYS A H    1  
ATOM   1017   H  HA   . LYS A  1 63  ? -6.461  1.488   -49.831 1.00 0.00 ?  378 LYS A HA   1  
ATOM   1018   H  HB2  . LYS A  1 63  ? -5.963  4.443   -50.236 1.00 0.00 ?  378 LYS A HB2  1  
ATOM   1019   H  HB3  . LYS A  1 63  ? -4.764  3.289   -50.734 1.00 0.00 ?  378 LYS A HB3  1  
ATOM   1020   H  HG2  . LYS A  1 63  ? -5.707  3.733   -52.495 1.00 0.00 ?  378 LYS A HG2  1  
ATOM   1021   H  HG3  . LYS A  1 63  ? -6.446  2.165   -52.121 1.00 0.00 ?  378 LYS A HG3  1  
ATOM   1022   H  HD2  . LYS A  1 63  ? -8.487  3.842   -51.266 1.00 0.00 ?  378 LYS A HD2  1  
ATOM   1023   H  HD3  . LYS A  1 63  ? -7.542  5.001   -52.240 1.00 0.00 ?  378 LYS A HD3  1  
ATOM   1024   H  HE2  . LYS A  1 63  ? -9.279  4.333   -53.725 1.00 0.00 ?  378 LYS A HE2  1  
ATOM   1025   H  HE3  . LYS A  1 63  ? -7.855  3.491   -54.409 1.00 0.00 ?  378 LYS A HE3  1  
ATOM   1026   H  HZ1  . LYS A  1 63  ? -9.662  2.031   -54.225 1.00 0.00 ?  378 LYS A HZ1  1  
ATOM   1027   H  HZ2  . LYS A  1 63  ? -9.704  2.126   -52.552 1.00 0.00 ?  378 LYS A HZ2  1  
ATOM   1028   H  HZ3  . LYS A  1 63  ? -8.324  1.543   -53.290 1.00 0.00 ?  378 LYS A HZ3  1  
ATOM   1029   N  N    . PHE A  1 64  ? -4.540  1.419   -48.450 1.00 0.00 ?  379 PHE A N    1  
ATOM   1030   C  CA   . PHE A  1 64  ? -3.505  1.082   -47.489 1.00 0.00 ?  379 PHE A CA   1  
ATOM   1031   C  C    . PHE A  1 64  ? -2.301  1.921   -47.686 1.00 0.00 ?  379 PHE A C    1  
ATOM   1032   O  O    . PHE A  1 64  ? -1.816  2.155   -48.772 1.00 0.00 ?  379 PHE A O    1  
ATOM   1033   C  CB   . PHE A  1 64  ? -2.973  -0.379  -47.720 1.00 0.00 ?  379 PHE A CB   1  
ATOM   1034   C  CG   . PHE A  1 64  ? -4.163  -1.330  -47.798 1.00 0.00 ?  379 PHE A CG   1  
ATOM   1035   C  CD1  . PHE A  1 64  ? -4.280  -2.326  -48.849 1.00 0.00 ?  379 PHE A CD1  1  
ATOM   1036   C  CD2  . PHE A  1 64  ? -5.268  -1.284  -46.836 1.00 0.00 ?  379 PHE A CD2  1  
ATOM   1037   C  CE1  . PHE A  1 64  ? -5.459  -3.049  -49.054 1.00 0.00 ?  379 PHE A CE1  1  
ATOM   1038   C  CE2  . PHE A  1 64  ? -6.419  -2.000  -47.062 1.00 0.00 ?  379 PHE A CE2  1  
ATOM   1039   C  CZ   . PHE A  1 64  ? -6.489  -2.814  -48.190 1.00 0.00 ?  379 PHE A CZ   1  
ATOM   1040   H  H    . PHE A  1 64  ? -4.493  0.796   -49.226 1.00 0.00 ?  379 PHE A H    1  
ATOM   1041   H  HA   . PHE A  1 64  ? -3.867  1.055   -46.472 1.00 0.00 ?  379 PHE A HA   1  
ATOM   1042   H  HB2  . PHE A  1 64  ? -2.415  -0.435  -48.679 1.00 0.00 ?  379 PHE A HB2  1  
ATOM   1043   H  HB3  . PHE A  1 64  ? -2.338  -0.622  -46.842 1.00 0.00 ?  379 PHE A HB3  1  
ATOM   1044   H  HD1  . PHE A  1 64  ? -3.461  -2.284  -49.551 1.00 0.00 ?  379 PHE A HD1  1  
ATOM   1045   H  HD2  . PHE A  1 64  ? -5.264  -0.532  -46.060 1.00 0.00 ?  379 PHE A HD2  1  
ATOM   1046   H  HE1  . PHE A  1 64  ? -5.595  -3.681  -49.919 1.00 0.00 ?  379 PHE A HE1  1  
ATOM   1047   H  HE2  . PHE A  1 64  ? -7.219  -1.884  -46.346 1.00 0.00 ?  379 PHE A HE2  1  
ATOM   1048   H  HZ   . PHE A  1 64  ? -7.458  -3.288  -48.240 1.00 0.00 ?  379 PHE A HZ   1  
ATOM   1049   N  N    . VAL A  1 65  ? -1.745  2.441   -46.517 1.00 0.00 ?  380 VAL A N    1  
ATOM   1050   C  CA   . VAL A  1 65  ? -0.642  3.327   -46.602 1.00 0.00 ?  380 VAL A CA   1  
ATOM   1051   C  C    . VAL A  1 65  ? 0.488   2.553   -45.829 1.00 0.00 ?  380 VAL A C    1  
ATOM   1052   O  O    . VAL A  1 65  ? 0.323   2.054   -44.743 1.00 0.00 ?  380 VAL A O    1  
ATOM   1053   C  CB   . VAL A  1 65  ? -0.920  4.698   -46.123 1.00 0.00 ?  380 VAL A CB   1  
ATOM   1054   C  CG1  . VAL A  1 65  ? 0.242   5.581   -46.547 1.00 0.00 ?  380 VAL A CG1  1  
ATOM   1055   C  CG2  . VAL A  1 65  ? -2.081  5.078   -46.991 1.00 0.00 ?  380 VAL A CG2  1  
ATOM   1056   H  H    . VAL A  1 65  ? -2.088  2.297   -45.593 1.00 0.00 ?  380 VAL A H    1  
ATOM   1057   H  HA   . VAL A  1 65  ? -0.266  3.406   -47.612 1.00 0.00 ?  380 VAL A HA   1  
ATOM   1058   H  HB   . VAL A  1 65  ? -1.118  4.677   -45.030 1.00 0.00 ?  380 VAL A HB   1  
ATOM   1059   H  HG11 . VAL A  1 65  ? 0.379   5.649   -47.648 1.00 0.00 ?  380 VAL A HG11 1  
ATOM   1060   H  HG12 . VAL A  1 65  ? 1.181   5.198   -46.094 1.00 0.00 ?  380 VAL A HG12 1  
ATOM   1061   H  HG13 . VAL A  1 65  ? 0.021   6.538   -46.028 1.00 0.00 ?  380 VAL A HG13 1  
ATOM   1062   H  HG21 . VAL A  1 65  ? -1.891  4.882   -48.068 1.00 0.00 ?  380 VAL A HG21 1  
ATOM   1063   H  HG22 . VAL A  1 65  ? -2.357  6.136   -46.791 1.00 0.00 ?  380 VAL A HG22 1  
ATOM   1064   H  HG23 . VAL A  1 65  ? -3.040  4.547   -46.809 1.00 0.00 ?  380 VAL A HG23 1  
ATOM   1065   N  N    . PHE A  1 66  ? 1.663   2.670   -46.366 1.00 0.00 ?  381 PHE A N    1  
ATOM   1066   C  CA   . PHE A  1 66  ? 2.804   1.995   -45.689 1.00 0.00 ?  381 PHE A CA   1  
ATOM   1067   C  C    . PHE A  1 66  ? 3.955   2.937   -45.726 1.00 0.00 ?  381 PHE A C    1  
ATOM   1068   O  O    . PHE A  1 66  ? 4.206   3.632   -46.717 1.00 0.00 ?  381 PHE A O    1  
ATOM   1069   C  CB   . PHE A  1 66  ? 3.295   0.734   -46.478 1.00 0.00 ?  381 PHE A CB   1  
ATOM   1070   C  CG   . PHE A  1 66  ? 2.265   -0.369  -46.625 1.00 0.00 ?  381 PHE A CG   1  
ATOM   1071   C  CD1  . PHE A  1 66  ? 2.142   -1.060  -47.842 1.00 0.00 ?  381 PHE A CD1  1  
ATOM   1072   C  CD2  . PHE A  1 66  ? 1.379   -0.764  -45.570 1.00 0.00 ?  381 PHE A CD2  1  
ATOM   1073   C  CE1  . PHE A  1 66  ? 1.251   -2.089  -48.021 1.00 0.00 ?  381 PHE A CE1  1  
ATOM   1074   C  CE2  . PHE A  1 66  ? 0.327   -1.601  -45.824 1.00 0.00 ?  381 PHE A CE2  1  
ATOM   1075   C  CZ   . PHE A  1 66  ? 0.330   -2.400  -46.974 1.00 0.00 ?  381 PHE A CZ   1  
ATOM   1076   H  H    . PHE A  1 66  ? 1.783   3.190   -47.208 1.00 0.00 ?  381 PHE A H    1  
ATOM   1077   H  HA   . PHE A  1 66  ? 2.637   1.725   -44.656 1.00 0.00 ?  381 PHE A HA   1  
ATOM   1078   H  HB2  . PHE A  1 66  ? 3.519   1.142   -47.486 1.00 0.00 ?  381 PHE A HB2  1  
ATOM   1079   H  HB3  . PHE A  1 66  ? 4.208   0.322   -45.998 1.00 0.00 ?  381 PHE A HB3  1  
ATOM   1080   H  HD1  . PHE A  1 66  ? 2.884   -0.792  -48.579 1.00 0.00 ?  381 PHE A HD1  1  
ATOM   1081   H  HD2  . PHE A  1 66  ? 1.592   -0.288  -44.625 1.00 0.00 ?  381 PHE A HD2  1  
ATOM   1082   H  HE1  . PHE A  1 66  ? 1.148   -2.583  -48.976 1.00 0.00 ?  381 PHE A HE1  1  
ATOM   1083   H  HE2  . PHE A  1 66  ? -0.439  -1.729  -45.073 1.00 0.00 ?  381 PHE A HE2  1  
ATOM   1084   H  HZ   . PHE A  1 66  ? -0.442  -3.134  -47.155 1.00 0.00 ?  381 PHE A HZ   1  
ATOM   1085   N  N    . PHE A  1 67  ? 4.712   3.075   -44.578 1.00 0.00 ?  382 PHE A N    1  
ATOM   1086   C  CA   . PHE A  1 67  ? 5.849   4.006   -44.473 1.00 0.00 ?  382 PHE A CA   1  
ATOM   1087   C  C    . PHE A  1 67  ? 7.206   3.286   -44.157 1.00 0.00 ?  382 PHE A C    1  
ATOM   1088   O  O    . PHE A  1 67  ? 7.327   2.476   -43.252 1.00 0.00 ?  382 PHE A O    1  
ATOM   1089   C  CB   . PHE A  1 67  ? 5.885   5.215   -43.411 1.00 0.00 ?  382 PHE A CB   1  
ATOM   1090   C  CG   . PHE A  1 67  ? 4.716   6.174   -43.699 1.00 0.00 ?  382 PHE A CG   1  
ATOM   1091   C  CD1  . PHE A  1 67  ? 3.411   5.887   -43.335 1.00 0.00 ?  382 PHE A CD1  1  
ATOM   1092   C  CD2  . PHE A  1 67  ? 5.022   7.498   -44.063 1.00 0.00 ?  382 PHE A CD2  1  
ATOM   1093   C  CE1  . PHE A  1 67  ? 2.373   6.787   -43.371 1.00 0.00 ?  382 PHE A CE1  1  
ATOM   1094   C  CE2  . PHE A  1 67  ? 3.937   8.461   -44.113 1.00 0.00 ?  382 PHE A CE2  1  
ATOM   1095   C  CZ   . PHE A  1 67  ? 2.670   8.092   -43.745 1.00 0.00 ?  382 PHE A CZ   1  
ATOM   1096   H  H    . PHE A  1 67  ? 4.482   2.516   -43.785 1.00 0.00 ?  382 PHE A H    1  
ATOM   1097   H  HA   . PHE A  1 67  ? 6.033   4.452   -45.439 1.00 0.00 ?  382 PHE A HA   1  
ATOM   1098   H  HB2  . PHE A  1 67  ? 5.808   4.788   -42.388 1.00 0.00 ?  382 PHE A HB2  1  
ATOM   1099   H  HB3  . PHE A  1 67  ? 6.855   5.755   -43.458 1.00 0.00 ?  382 PHE A HB3  1  
ATOM   1100   H  HD1  . PHE A  1 67  ? 3.313   4.925   -42.854 1.00 0.00 ?  382 PHE A HD1  1  
ATOM   1101   H  HD2  . PHE A  1 67  ? 6.071   7.754   -44.046 1.00 0.00 ?  382 PHE A HD2  1  
ATOM   1102   H  HE1  . PHE A  1 67  ? 1.375   6.524   -43.055 1.00 0.00 ?  382 PHE A HE1  1  
ATOM   1103   H  HE2  . PHE A  1 67  ? 4.180   9.511   -44.178 1.00 0.00 ?  382 PHE A HE2  1  
ATOM   1104   H  HZ   . PHE A  1 67  ? 1.847   8.775   -43.592 1.00 0.00 ?  382 PHE A HZ   1  
ATOM   1105   N  N    . LYS A  1 68  ? 8.303   3.589   -44.865 1.00 0.00 ?  383 LYS A N    1  
ATOM   1106   C  CA   . LYS A  1 68  ? 9.721   3.373   -44.397 1.00 0.00 ?  383 LYS A CA   1  
ATOM   1107   C  C    . LYS A  1 68  ? 10.499  4.612   -44.780 1.00 0.00 ?  383 LYS A C    1  
ATOM   1108   O  O    . LYS A  1 68  ? 10.354  5.109   -45.895 1.00 0.00 ?  383 LYS A O    1  
ATOM   1109   C  CB   . LYS A  1 68  ? 10.293  2.156   -45.167 1.00 0.00 ?  383 LYS A CB   1  
ATOM   1110   C  CG   . LYS A  1 68  ? 11.634  1.677   -44.394 1.00 0.00 ?  383 LYS A CG   1  
ATOM   1111   C  CD   . LYS A  1 68  ? 12.432  0.579   -45.168 1.00 0.00 ?  383 LYS A CD   1  
ATOM   1112   C  CE   . LYS A  1 68  ? 13.737  0.152   -44.398 1.00 0.00 ?  383 LYS A CE   1  
ATOM   1113   N  NZ   . LYS A  1 68  ? 14.317  -1.016  -45.219 1.00 0.00 1  383 LYS A NZ   1  
ATOM   1114   H  H    . LYS A  1 68  ? 8.207   4.320   -45.536 1.00 0.00 ?  383 LYS A H    1  
ATOM   1115   H  HA   . LYS A  1 68  ? 9.821   3.211   -43.334 1.00 0.00 ?  383 LYS A HA   1  
ATOM   1116   H  HB2  . LYS A  1 68  ? 9.607   1.288   -45.069 1.00 0.00 ?  383 LYS A HB2  1  
ATOM   1117   H  HB3  . LYS A  1 68  ? 10.443  2.371   -46.246 1.00 0.00 ?  383 LYS A HB3  1  
ATOM   1118   H  HG2  . LYS A  1 68  ? 12.294  2.560   -44.253 1.00 0.00 ?  383 LYS A HG2  1  
ATOM   1119   H  HG3  . LYS A  1 68  ? 11.331  1.206   -43.434 1.00 0.00 ?  383 LYS A HG3  1  
ATOM   1120   H  HD2  . LYS A  1 68  ? 11.840  -0.361  -45.203 1.00 0.00 ?  383 LYS A HD2  1  
ATOM   1121   H  HD3  . LYS A  1 68  ? 12.644  1.053   -46.150 1.00 0.00 ?  383 LYS A HD3  1  
ATOM   1122   H  HE2  . LYS A  1 68  ? 14.600  0.835   -44.246 1.00 0.00 ?  383 LYS A HE2  1  
ATOM   1123   H  HE3  . LYS A  1 68  ? 13.474  -0.338  -43.436 1.00 0.00 ?  383 LYS A HE3  1  
ATOM   1124   H  HZ1  . LYS A  1 68  ? 13.534  -1.696  -45.294 1.00 0.00 ?  383 LYS A HZ1  1  
ATOM   1125   H  HZ2  . LYS A  1 68  ? 14.962  -1.586  -44.635 1.00 0.00 ?  383 LYS A HZ2  1  
ATOM   1126   H  HZ3  . LYS A  1 68  ? 14.748  -0.728  -46.120 1.00 0.00 ?  383 LYS A HZ3  1  
ATOM   1127   N  N    . GLY A  1 69  ? 11.325  5.072   -43.824 1.00 0.00 ?  384 GLY A N    1  
ATOM   1128   C  CA   . GLY A  1 69  ? 12.021  6.374   -43.927 1.00 0.00 ?  384 GLY A CA   1  
ATOM   1129   C  C    . GLY A  1 69  ? 11.232  7.524   -44.254 1.00 0.00 ?  384 GLY A C    1  
ATOM   1130   O  O    . GLY A  1 69  ? 10.097  7.685   -43.776 1.00 0.00 ?  384 GLY A O    1  
ATOM   1131   H  H    . GLY A  1 69  ? 11.350  4.591   -42.951 1.00 0.00 ?  384 GLY A H    1  
ATOM   1132   H  HA2  . GLY A  1 69  ? 12.263  6.686   -42.922 1.00 0.00 ?  384 GLY A HA2  1  
ATOM   1133   H  HA3  . GLY A  1 69  ? 12.900  6.270   -44.545 1.00 0.00 ?  384 GLY A HA3  1  
ATOM   1134   N  N    . ASP A  1 70  ? 11.683  8.443   -45.002 1.00 0.00 ?  385 ASP A N    1  
ATOM   1135   C  CA   . ASP A  1 70  ? 11.125  9.674   -45.481 1.00 0.00 ?  385 ASP A CA   1  
ATOM   1136   C  C    . ASP A  1 70  ? 10.195  9.499   -46.724 1.00 0.00 ?  385 ASP A C    1  
ATOM   1137   O  O    . ASP A  1 70  ? 10.013  10.466  -47.504 1.00 0.00 ?  385 ASP A O    1  
ATOM   1138   C  CB   . ASP A  1 70  ? 12.223  10.787  -45.785 1.00 0.00 ?  385 ASP A CB   1  
ATOM   1139   C  CG   . ASP A  1 70  ? 13.056  10.533  -47.010 1.00 0.00 ?  385 ASP A CG   1  
ATOM   1140   O  OD1  . ASP A  1 70  ? 13.511  9.383   -47.247 1.00 0.00 ?  385 ASP A OD1  1  
ATOM   1141   O  OD2  . ASP A  1 70  ? 13.530  11.641  -47.393 1.00 0.00 -1 385 ASP A OD2  1  
ATOM   1142   H  H    . ASP A  1 70  ? 12.597  8.306   -45.375 1.00 0.00 ?  385 ASP A H    1  
ATOM   1143   H  HA   . ASP A  1 70  ? 10.451  10.073  -44.737 1.00 0.00 ?  385 ASP A HA   1  
ATOM   1144   H  HB2  . ASP A  1 70  ? 11.696  11.745  -45.979 1.00 0.00 ?  385 ASP A HB2  1  
ATOM   1145   H  HB3  . ASP A  1 70  ? 12.936  10.910  -44.941 1.00 0.00 ?  385 ASP A HB3  1  
ATOM   1146   N  N    . LYS A  1 71  ? 9.633   8.293   -46.949 1.00 0.00 ?  386 LYS A N    1  
ATOM   1147   C  CA   . LYS A  1 71  ? 8.775   8.092   -48.135 1.00 0.00 ?  386 LYS A CA   1  
ATOM   1148   C  C    . LYS A  1 71  ? 7.588   7.263   -47.536 1.00 0.00 ?  386 LYS A C    1  
ATOM   1149   O  O    . LYS A  1 71  ? 7.632   6.630   -46.476 1.00 0.00 ?  386 LYS A O    1  
ATOM   1150   C  CB   . LYS A  1 71  ? 9.574   7.307   -49.229 1.00 0.00 ?  386 LYS A CB   1  
ATOM   1151   C  CG   . LYS A  1 71  ? 10.907  7.989   -49.635 1.00 0.00 ?  386 LYS A CG   1  
ATOM   1152   C  CD   . LYS A  1 71  ? 11.792  6.961   -50.401 1.00 0.00 ?  386 LYS A CD   1  
ATOM   1153   C  CE   . LYS A  1 71  ? 13.332  7.227   -50.422 1.00 0.00 ?  386 LYS A CE   1  
ATOM   1154   N  NZ   . LYS A  1 71  ? 13.850  7.238   -49.013 1.00 0.00 1  386 LYS A NZ   1  
ATOM   1155   H  H    . LYS A  1 71  ? 9.714   7.539   -46.300 1.00 0.00 ?  386 LYS A H    1  
ATOM   1156   H  HA   . LYS A  1 71  ? 8.303   8.988   -48.508 1.00 0.00 ?  386 LYS A HA   1  
ATOM   1157   H  HB2  . LYS A  1 71  ? 9.934   6.321   -48.866 1.00 0.00 ?  386 LYS A HB2  1  
ATOM   1158   H  HB3  . LYS A  1 71  ? 8.984   7.211   -50.166 1.00 0.00 ?  386 LYS A HB3  1  
ATOM   1159   H  HG2  . LYS A  1 71  ? 10.700  8.932   -50.184 1.00 0.00 ?  386 LYS A HG2  1  
ATOM   1160   H  HG3  . LYS A  1 71  ? 11.439  8.338   -48.724 1.00 0.00 ?  386 LYS A HG3  1  
ATOM   1161   H  HD2  . LYS A  1 71  ? 11.617  5.932   -50.021 1.00 0.00 ?  386 LYS A HD2  1  
ATOM   1162   H  HD3  . LYS A  1 71  ? 11.506  6.932   -51.475 1.00 0.00 ?  386 LYS A HD3  1  
ATOM   1163   H  HE2  . LYS A  1 71  ? 13.939  6.450   -50.935 1.00 0.00 ?  386 LYS A HE2  1  
ATOM   1164   H  HE3  . LYS A  1 71  ? 13.437  8.272   -50.785 1.00 0.00 ?  386 LYS A HE3  1  
ATOM   1165   H  HZ1  . LYS A  1 71  ? 13.547  6.373   -48.522 1.00 0.00 ?  386 LYS A HZ1  1  
ATOM   1166   H  HZ2  . LYS A  1 71  ? 13.592  8.107   -48.503 1.00 0.00 ?  386 LYS A HZ2  1  
ATOM   1167   H  HZ3  . LYS A  1 71  ? 14.882  7.304   -49.120 1.00 0.00 ?  386 LYS A HZ3  1  
ATOM   1168   N  N    . HIS A  1 72  ? 6.509   7.333   -48.348 1.00 0.00 ?  387 HIS A N    1  
ATOM   1169   C  CA   . HIS A  1 72  ? 5.269   6.551   -48.128 1.00 0.00 ?  387 HIS A CA   1  
ATOM   1170   C  C    . HIS A  1 72  ? 4.737   5.899   -49.409 1.00 0.00 ?  387 HIS A C    1  
ATOM   1171   O  O    . HIS A  1 72  ? 4.941   6.506   -50.440 1.00 0.00 ?  387 HIS A O    1  
ATOM   1172   C  CB   . HIS A  1 72  ? 4.159   7.385   -47.513 1.00 0.00 ?  387 HIS A CB   1  
ATOM   1173   C  CG   . HIS A  1 72  ? 3.505   8.454   -48.358 1.00 0.00 ?  387 HIS A CG   1  
ATOM   1174   N  ND1  . HIS A  1 72  ? 4.131   9.709   -48.519 1.00 0.00 ?  387 HIS A ND1  1  
ATOM   1175   C  CD2  . HIS A  1 72  ? 2.264   8.632   -48.850 1.00 0.00 ?  387 HIS A CD2  1  
ATOM   1176   C  CE1  . HIS A  1 72  ? 3.259   10.524  -49.158 1.00 0.00 ?  387 HIS A CE1  1  
ATOM   1177   N  NE2  . HIS A  1 72  ? 2.114   9.866   -49.431 1.00 0.00 ?  387 HIS A NE2  1  
ATOM   1178   H  H    . HIS A  1 72  ? 6.625   7.932   -49.137 1.00 0.00 ?  387 HIS A H    1  
ATOM   1179   H  HA   . HIS A  1 72  ? 5.537   5.703   -47.516 1.00 0.00 ?  387 HIS A HA   1  
ATOM   1180   H  HB2  . HIS A  1 72  ? 3.383   6.775   -47.004 1.00 0.00 ?  387 HIS A HB2  1  
ATOM   1181   H  HB3  . HIS A  1 72  ? 4.784   7.880   -46.740 1.00 0.00 ?  387 HIS A HB3  1  
ATOM   1182   H  HD1  . HIS A  1 72  ? 5.084   9.842   -48.244 1.00 0.00 ?  387 HIS A HD1  1  
ATOM   1183   H  HD2  . HIS A  1 72  ? 1.488   7.879   -48.789 1.00 0.00 ?  387 HIS A HD2  1  
ATOM   1184   H  HE1  . HIS A  1 72  ? 3.541   11.540  -49.433 1.00 0.00 ?  387 HIS A HE1  1  
ATOM   1185   N  N    . TRP A  1 73  ? 4.039   4.762   -49.337 1.00 0.00 ?  388 TRP A N    1  
ATOM   1186   C  CA   . TRP A  1 73  ? 3.608   3.920   -50.467 1.00 0.00 ?  388 TRP A CA   1  
ATOM   1187   C  C    . TRP A  1 73  ? 2.090   3.643   -50.330 1.00 0.00 ?  388 TRP A C    1  
ATOM   1188   O  O    . TRP A  1 73  ? 1.598   3.293   -49.261 1.00 0.00 ?  388 TRP A O    1  
ATOM   1189   C  CB   . TRP A  1 73  ? 4.426   2.536   -50.464 1.00 0.00 ?  388 TRP A CB   1  
ATOM   1190   C  CG   . TRP A  1 73  ? 5.823   2.496   -51.003 1.00 0.00 ?  388 TRP A CG   1  
ATOM   1191   C  CD1  . TRP A  1 73  ? 6.168   1.947   -52.221 1.00 0.00 ?  388 TRP A CD1  1  
ATOM   1192   C  CD2  . TRP A  1 73  ? 7.071   2.742   -50.313 1.00 0.00 ?  388 TRP A CD2  1  
ATOM   1193   N  NE1  . TRP A  1 73  ? 7.569   1.965   -52.345 1.00 0.00 ?  388 TRP A NE1  1  
ATOM   1194   C  CE2  . TRP A  1 73  ? 8.109   2.338   -51.150 1.00 0.00 ?  388 TRP A CE2  1  
ATOM   1195   C  CE3  . TRP A  1 73  ? 7.373   3.283   -49.031 1.00 0.00 ?  388 TRP A CE3  1  
ATOM   1196   C  CZ2  . TRP A  1 73  ? 9.430   2.451   -50.748 1.00 0.00 ?  388 TRP A CZ2  1  
ATOM   1197   C  CZ3  . TRP A  1 73  ? 8.718   3.268   -48.591 1.00 0.00 ?  388 TRP A CZ3  1  
ATOM   1198   C  CH2  . TRP A  1 73  ? 9.693   2.898   -49.460 1.00 0.00 ?  388 TRP A CH2  1  
ATOM   1199   H  H    . TRP A  1 73  ? 3.979   4.377   -48.419 1.00 0.00 ?  388 TRP A H    1  
ATOM   1200   H  HA   . TRP A  1 73  ? 3.745   4.370   -51.439 1.00 0.00 ?  388 TRP A HA   1  
ATOM   1201   H  HB2  . TRP A  1 73  ? 4.449   2.108   -49.439 1.00 0.00 ?  388 TRP A HB2  1  
ATOM   1202   H  HB3  . TRP A  1 73  ? 3.974   1.840   -51.203 1.00 0.00 ?  388 TRP A HB3  1  
ATOM   1203   H  HD1  . TRP A  1 73  ? 5.556   1.621   -53.049 1.00 0.00 ?  388 TRP A HD1  1  
ATOM   1204   H  HE1  . TRP A  1 73  ? 8.135   1.893   -53.137 1.00 0.00 ?  388 TRP A HE1  1  
ATOM   1205   H  HE3  . TRP A  1 73  ? 6.640   3.677   -48.343 1.00 0.00 ?  388 TRP A HE3  1  
ATOM   1206   H  HZ2  . TRP A  1 73  ? 10.275  2.304   -51.403 1.00 0.00 ?  388 TRP A HZ2  1  
ATOM   1207   H  HZ3  . TRP A  1 73  ? 8.965   3.602   -47.594 1.00 0.00 ?  388 TRP A HZ3  1  
ATOM   1208   H  HH2  . TRP A  1 73  ? 10.704  2.740   -49.114 1.00 0.00 ?  388 TRP A HH2  1  
ATOM   1209   N  N    . VAL A  1 74  ? 1.268   4.031   -51.377 1.00 0.00 ?  389 VAL A N    1  
ATOM   1210   C  CA   . VAL A  1 74  ? -0.124  3.659   -51.339 1.00 0.00 ?  389 VAL A CA   1  
ATOM   1211   C  C    . VAL A  1 74  ? -0.405  2.361   -52.132 1.00 0.00 ?  389 VAL A C    1  
ATOM   1212   O  O    . VAL A  1 74  ? -0.254  2.330   -53.365 1.00 0.00 ?  389 VAL A O    1  
ATOM   1213   C  CB   . VAL A  1 74  ? -1.096  4.850   -51.682 1.00 0.00 ?  389 VAL A CB   1  
ATOM   1214   C  CG1  . VAL A  1 74  ? -2.620  4.468   -51.687 1.00 0.00 ?  389 VAL A CG1  1  
ATOM   1215   C  CG2  . VAL A  1 74  ? -0.890  5.967   -50.692 1.00 0.00 ?  389 VAL A CG2  1  
ATOM   1216   H  H    . VAL A  1 74  ? 1.575   4.397   -52.252 1.00 0.00 ?  389 VAL A H    1  
ATOM   1217   H  HA   . VAL A  1 74  ? -0.416  3.502   -50.311 1.00 0.00 ?  389 VAL A HA   1  
ATOM   1218   H  HB   . VAL A  1 74  ? -0.707  5.227   -52.652 1.00 0.00 ?  389 VAL A HB   1  
ATOM   1219   H  HG11 . VAL A  1 74  ? -2.930  4.032   -50.713 1.00 0.00 ?  389 VAL A HG11 1  
ATOM   1220   H  HG12 . VAL A  1 74  ? -2.851  3.786   -52.533 1.00 0.00 ?  389 VAL A HG12 1  
ATOM   1221   H  HG13 . VAL A  1 74  ? -3.190  5.391   -51.925 1.00 0.00 ?  389 VAL A HG13 1  
ATOM   1222   H  HG21 . VAL A  1 74  ? 0.156   6.106   -50.343 1.00 0.00 ?  389 VAL A HG21 1  
ATOM   1223   H  HG22 . VAL A  1 74  ? -1.492  5.990   -49.759 1.00 0.00 ?  389 VAL A HG22 1  
ATOM   1224   H  HG23 . VAL A  1 74  ? -1.053  6.986   -51.104 1.00 0.00 ?  389 VAL A HG23 1  
ATOM   1225   N  N    . PHE A  1 75  ? -0.794  1.282   -51.458 1.00 0.00 ?  390 PHE A N    1  
ATOM   1226   C  CA   . PHE A  1 75  ? -1.400  0.130   -52.091 1.00 0.00 ?  390 PHE A CA   1  
ATOM   1227   C  C    . PHE A  1 75  ? -2.879  0.125   -52.022 1.00 0.00 ?  390 PHE A C    1  
ATOM   1228   O  O    . PHE A  1 75  ? -3.515  0.513   -51.064 1.00 0.00 ?  390 PHE A O    1  
ATOM   1229   C  CB   . PHE A  1 75  ? -0.859  -1.208  -51.510 1.00 0.00 ?  390 PHE A CB   1  
ATOM   1230   C  CG   . PHE A  1 75  ? 0.528   -1.384  -51.932 1.00 0.00 ?  390 PHE A CG   1  
ATOM   1231   C  CD1  . PHE A  1 75  ? 1.600   -0.762  -51.330 1.00 0.00 ?  390 PHE A CD1  1  
ATOM   1232   C  CD2  . PHE A  1 75  ? 0.860   -2.400  -52.836 1.00 0.00 ?  390 PHE A CD2  1  
ATOM   1233   C  CE1  . PHE A  1 75  ? 2.993   -1.192  -51.550 1.00 0.00 ?  390 PHE A CE1  1  
ATOM   1234   C  CE2  . PHE A  1 75  ? 2.165   -2.769  -53.154 1.00 0.00 ?  390 PHE A CE2  1  
ATOM   1235   C  CZ   . PHE A  1 75  ? 3.244   -2.196  -52.462 1.00 0.00 ?  390 PHE A CZ   1  
ATOM   1236   H  H    . PHE A  1 75  ? -0.765  1.365   -50.465 1.00 0.00 ?  390 PHE A H    1  
ATOM   1237   H  HA   . PHE A  1 75  ? -0.939  0.107   -53.067 1.00 0.00 ?  390 PHE A HA   1  
ATOM   1238   H  HB2  . PHE A  1 75  ? -0.822  -1.217  -50.400 1.00 0.00 ?  390 PHE A HB2  1  
ATOM   1239   H  HB3  . PHE A  1 75  ? -1.393  -2.126  -51.838 1.00 0.00 ?  390 PHE A HB3  1  
ATOM   1240   H  HD1  . PHE A  1 75  ? 1.351   0.017   -50.624 1.00 0.00 ?  390 PHE A HD1  1  
ATOM   1241   H  HD2  . PHE A  1 75  ? 0.120   -3.009  -53.333 1.00 0.00 ?  390 PHE A HD2  1  
ATOM   1242   H  HE1  . PHE A  1 75  ? 3.759   -0.720  -50.953 1.00 0.00 ?  390 PHE A HE1  1  
ATOM   1243   H  HE2  . PHE A  1 75  ? 2.301   -3.519  -53.920 1.00 0.00 ?  390 PHE A HE2  1  
ATOM   1244   H  HZ   . PHE A  1 75  ? 4.256   -2.489  -52.702 1.00 0.00 ?  390 PHE A HZ   1  
ATOM   1245   N  N    . ASP A  1 76  ? -3.458  -0.145  -53.239 1.00 0.00 ?  391 ASP A N    1  
ATOM   1246   C  CA   . ASP A  1 76  ? -4.899  -0.396  -53.325 1.00 0.00 ?  391 ASP A CA   1  
ATOM   1247   C  C    . ASP A  1 76  ? -5.042  -1.930  -53.574 1.00 0.00 ?  391 ASP A C    1  
ATOM   1248   O  O    . ASP A  1 76  ? -4.524  -2.352  -54.600 1.00 0.00 ?  391 ASP A O    1  
ATOM   1249   C  CB   . ASP A  1 76  ? -5.555  0.453   -54.434 1.00 0.00 ?  391 ASP A CB   1  
ATOM   1250   C  CG   . ASP A  1 76  ? -7.018  0.341   -54.423 1.00 0.00 ?  391 ASP A CG   1  
ATOM   1251   O  OD1  . ASP A  1 76  ? -7.691  0.603   -55.464 1.00 0.00 ?  391 ASP A OD1  1  
ATOM   1252   O  OD2  . ASP A  1 76  ? -7.542  0.173   -53.269 1.00 0.00 -1 391 ASP A OD2  1  
ATOM   1253   H  H    . ASP A  1 76  ? -2.960  -0.341  -54.081 1.00 0.00 ?  391 ASP A H    1  
ATOM   1254   H  HA   . ASP A  1 76  ? -5.327  -0.133  -52.369 1.00 0.00 ?  391 ASP A HA   1  
ATOM   1255   H  HB2  . ASP A  1 76  ? -5.326  1.483   -54.086 1.00 0.00 ?  391 ASP A HB2  1  
ATOM   1256   H  HB3  . ASP A  1 76  ? -5.109  0.272   -55.435 1.00 0.00 ?  391 ASP A HB3  1  
ATOM   1257   N  N    . GLU A  1 77  ? -5.789  -2.674  -52.690 1.00 0.00 ?  392 GLU A N    1  
ATOM   1258   C  CA   . GLU A  1 77  ? -6.032  -4.100  -52.818 1.00 0.00 ?  392 GLU A CA   1  
ATOM   1259   C  C    . GLU A  1 77  ? -4.775  -5.020  -52.733 1.00 0.00 ?  392 GLU A C    1  
ATOM   1260   O  O    . GLU A  1 77  ? -4.658  -5.788  -51.775 1.00 0.00 ?  392 GLU A O    1  
ATOM   1261   C  CB   . GLU A  1 77  ? -7.075  -4.525  -53.887 1.00 0.00 ?  392 GLU A CB   1  
ATOM   1262   C  CG   . GLU A  1 77  ? -7.150  -5.970  -54.271 1.00 0.00 ?  392 GLU A CG   1  
ATOM   1263   C  CD   . GLU A  1 77  ? -8.364  -6.258  -55.167 1.00 0.00 ?  392 GLU A CD   1  
ATOM   1264   O  OE1  . GLU A  1 77  ? -9.480  -6.397  -54.598 1.00 0.00 ?  392 GLU A OE1  1  
ATOM   1265   O  OE2  . GLU A  1 77  ? -8.229  -6.373  -56.408 1.00 0.00 -1 392 GLU A OE2  1  
ATOM   1266   H  H    . GLU A  1 77  ? -6.278  -2.229  -51.943 1.00 0.00 ?  392 GLU A H    1  
ATOM   1267   H  HA   . GLU A  1 77  ? -6.536  -4.386  -51.907 1.00 0.00 ?  392 GLU A HA   1  
ATOM   1268   H  HB2  . GLU A  1 77  ? -8.007  -4.013  -53.565 1.00 0.00 ?  392 GLU A HB2  1  
ATOM   1269   H  HB3  . GLU A  1 77  ? -6.748  -3.941  -54.773 1.00 0.00 ?  392 GLU A HB3  1  
ATOM   1270   H  HG2  . GLU A  1 77  ? -6.207  -6.194  -54.813 1.00 0.00 ?  392 GLU A HG2  1  
ATOM   1271   H  HG3  . GLU A  1 77  ? -7.412  -6.496  -53.327 1.00 0.00 ?  392 GLU A HG3  1  
ATOM   1272   N  N    . ALA A  1 78  ? -3.812  -4.776  -53.606 1.00 0.00 ?  393 ALA A N    1  
ATOM   1273   C  CA   . ALA A  1 78  ? -2.580  -5.473  -53.634 1.00 0.00 ?  393 ALA A CA   1  
ATOM   1274   C  C    . ALA A  1 78  ? -1.648  -4.715  -54.571 1.00 0.00 ?  393 ALA A C    1  
ATOM   1275   O  O    . ALA A  1 78  ? -0.586  -5.175  -54.891 1.00 0.00 ?  393 ALA A O    1  
ATOM   1276   C  CB   . ALA A  1 78  ? -2.631  -6.912  -54.141 1.00 0.00 ?  393 ALA A CB   1  
ATOM   1277   H  H    . ALA A  1 78  ? -3.983  -4.095  -54.314 1.00 0.00 ?  393 ALA A H    1  
ATOM   1278   H  HA   . ALA A  1 78  ? -2.184  -5.383  -52.633 1.00 0.00 ?  393 ALA A HA   1  
ATOM   1279   H  HB1  . ALA A  1 78  ? -3.291  -7.459  -53.433 1.00 0.00 ?  393 ALA A HB1  1  
ATOM   1280   H  HB2  . ALA A  1 78  ? -1.628  -7.386  -54.085 1.00 0.00 ?  393 ALA A HB2  1  
ATOM   1281   H  HB3  . ALA A  1 78  ? -3.022  -6.991  -55.178 1.00 0.00 ?  393 ALA A HB3  1  
ATOM   1282   N  N    . SER A  1 79  ? -1.964  -3.548  -55.178 1.00 0.00 ?  394 SER A N    1  
ATOM   1283   C  CA   . SER A  1 79  ? -1.173  -2.956  -56.273 1.00 0.00 ?  394 SER A CA   1  
ATOM   1284   C  C    . SER A  1 79  ? -0.905  -1.499  -56.067 1.00 0.00 ?  394 SER A C    1  
ATOM   1285   O  O    . SER A  1 79  ? -1.535  -0.805  -55.244 1.00 0.00 ?  394 SER A O    1  
ATOM   1286   C  CB   . SER A  1 79  ? -1.893  -3.031  -57.679 1.00 0.00 ?  394 SER A CB   1  
ATOM   1287   O  OG   . SER A  1 79  ? -1.324  -2.305  -58.783 1.00 0.00 ?  394 SER A OG   1  
ATOM   1288   H  H    . SER A  1 79  ? -2.677  -2.948  -54.822 1.00 0.00 ?  394 SER A H    1  
ATOM   1289   H  HA   . SER A  1 79  ? -0.222  -3.430  -56.465 1.00 0.00 ?  394 SER A HA   1  
ATOM   1290   H  HB2  . SER A  1 79  ? -1.741  -4.065  -58.055 1.00 0.00 ?  394 SER A HB2  1  
ATOM   1291   H  HB3  . SER A  1 79  ? -2.970  -2.842  -57.481 1.00 0.00 ?  394 SER A HB3  1  
ATOM   1292   H  HG   . SER A  1 79  ? -0.395  -2.547  -58.809 1.00 0.00 ?  394 SER A HG   1  
ATOM   1293   N  N    . LEU A  1 80  ? 0.221   -0.965  -56.671 1.00 0.00 ?  395 LEU A N    1  
ATOM   1294   C  CA   . LEU A  1 80  ? 0.856   0.289   -56.202 1.00 0.00 ?  395 LEU A CA   1  
ATOM   1295   C  C    . LEU A  1 80  ? 0.376   1.604   -56.917 1.00 0.00 ?  395 LEU A C    1  
ATOM   1296   O  O    . LEU A  1 80  ? 0.546   1.730   -58.104 1.00 0.00 ?  395 LEU A O    1  
ATOM   1297   C  CB   . LEU A  1 80  ? 2.372   0.190   -56.375 1.00 0.00 ?  395 LEU A CB   1  
ATOM   1298   C  CG   . LEU A  1 80  ? 3.247   1.409   -56.103 1.00 0.00 ?  395 LEU A CG   1  
ATOM   1299   C  CD1  . LEU A  1 80  ? 3.417   1.760   -54.598 1.00 0.00 ?  395 LEU A CD1  1  
ATOM   1300   C  CD2  . LEU A  1 80  ? 4.681   1.111   -56.619 1.00 0.00 ?  395 LEU A CD2  1  
ATOM   1301   H  H    . LEU A  1 80  ? 0.637   -1.473  -57.421 1.00 0.00 ?  395 LEU A H    1  
ATOM   1302   H  HA   . LEU A  1 80  ? 0.683   0.291   -55.136 1.00 0.00 ?  395 LEU A HA   1  
ATOM   1303   H  HB2  . LEU A  1 80  ? 2.642   -0.698  -55.765 1.00 0.00 ?  395 LEU A HB2  1  
ATOM   1304   H  HB3  . LEU A  1 80  ? 2.575   -0.166  -57.407 1.00 0.00 ?  395 LEU A HB3  1  
ATOM   1305   H  HG   . LEU A  1 80  ? 2.942   2.228   -56.789 1.00 0.00 ?  395 LEU A HG   1  
ATOM   1306   H  HD11 . LEU A  1 80  ? 3.862   2.761   -54.412 1.00 0.00 ?  395 LEU A HD11 1  
ATOM   1307   H  HD12 . LEU A  1 80  ? 4.124   0.985   -54.232 1.00 0.00 ?  395 LEU A HD12 1  
ATOM   1308   H  HD13 . LEU A  1 80  ? 2.425   1.688   -54.102 1.00 0.00 ?  395 LEU A HD13 1  
ATOM   1309   H  HD21 . LEU A  1 80  ? 5.392   1.948   -56.445 1.00 0.00 ?  395 LEU A HD21 1  
ATOM   1310   H  HD22 . LEU A  1 80  ? 4.664   0.958   -57.719 1.00 0.00 ?  395 LEU A HD22 1  
ATOM   1311   H  HD23 . LEU A  1 80  ? 5.103   0.260   -56.043 1.00 0.00 ?  395 LEU A HD23 1  
ATOM   1312   N  N    . GLU A  1 81  ? -0.228  2.546   -56.314 1.00 0.00 ?  396 GLU A N    1  
ATOM   1313   C  CA   . GLU A  1 81  ? -0.830  3.721   -56.966 1.00 0.00 ?  396 GLU A CA   1  
ATOM   1314   C  C    . GLU A  1 81  ? 0.173   4.614   -57.759 1.00 0.00 ?  396 GLU A C    1  
ATOM   1315   O  O    . GLU A  1 81  ? 1.311   4.745   -57.351 1.00 0.00 ?  396 GLU A O    1  
ATOM   1316   C  CB   . GLU A  1 81  ? -1.626  4.514   -55.930 1.00 0.00 ?  396 GLU A CB   1  
ATOM   1317   C  CG   . GLU A  1 81  ? -2.947  3.895   -55.573 1.00 0.00 ?  396 GLU A CG   1  
ATOM   1318   C  CD   . GLU A  1 81  ? -3.894  3.885   -56.719 1.00 0.00 ?  396 GLU A CD   1  
ATOM   1319   O  OE1  . GLU A  1 81  ? -4.368  2.859   -57.318 1.00 0.00 ?  396 GLU A OE1  1  
ATOM   1320   O  OE2  . GLU A  1 81  ? -4.420  5.029   -57.044 1.00 0.00 -1 396 GLU A OE2  1  
ATOM   1321   H  H    . GLU A  1 81  ? -0.365  2.446   -55.332 1.00 0.00 ?  396 GLU A H    1  
ATOM   1322   H  HA   . GLU A  1 81  ? -1.493  3.350   -57.733 1.00 0.00 ?  396 GLU A HA   1  
ATOM   1323   H  HB2  . GLU A  1 81  ? -1.085  4.512   -54.959 1.00 0.00 ?  396 GLU A HB2  1  
ATOM   1324   H  HB3  . GLU A  1 81  ? -1.887  5.548   -56.243 1.00 0.00 ?  396 GLU A HB3  1  
ATOM   1325   H  HG2  . GLU A  1 81  ? -2.724  2.857   -55.245 1.00 0.00 ?  396 GLU A HG2  1  
ATOM   1326   H  HG3  . GLU A  1 81  ? -3.452  4.202   -54.633 1.00 0.00 ?  396 GLU A HG3  1  
ATOM   1327   N  N    . PRO A  1 82  ? -0.186  5.213   -58.881 1.00 0.00 ?  397 PRO A N    1  
ATOM   1328   C  CA   . PRO A  1 82  ? 0.609   6.244   -59.636 1.00 0.00 ?  397 PRO A CA   1  
ATOM   1329   C  C    . PRO A  1 82  ? 1.267   7.240   -58.860 1.00 0.00 ?  397 PRO A C    1  
ATOM   1330   O  O    . PRO A  1 82  ? 0.639   7.781   -57.945 1.00 0.00 ?  397 PRO A O    1  
ATOM   1331   C  CB   . PRO A  1 82  ? -0.457  6.816   -60.633 1.00 0.00 ?  397 PRO A CB   1  
ATOM   1332   C  CG   . PRO A  1 82  ? -1.279  5.586   -60.902 1.00 0.00 ?  397 PRO A CG   1  
ATOM   1333   C  CD   . PRO A  1 82  ? -1.417  4.902   -59.610 1.00 0.00 ?  397 PRO A CD   1  
ATOM   1334   H  HA   . PRO A  1 82  ? 1.415   5.660   -60.054 1.00 0.00 ?  397 PRO A HA   1  
ATOM   1335   H  HB2  . PRO A  1 82  ? -0.964  7.659   -60.117 1.00 0.00 ?  397 PRO A HB2  1  
ATOM   1336   H  HB3  . PRO A  1 82  ? 0.016   6.969   -61.627 1.00 0.00 ?  397 PRO A HB3  1  
ATOM   1337   H  HG2  . PRO A  1 82  ? -2.271  5.659   -61.396 1.00 0.00 ?  397 PRO A HG2  1  
ATOM   1338   H  HG3  . PRO A  1 82  ? -0.717  4.915   -61.587 1.00 0.00 ?  397 PRO A HG3  1  
ATOM   1339   H  HD2  . PRO A  1 82  ? -2.198  5.286   -58.920 1.00 0.00 ?  397 PRO A HD2  1  
ATOM   1340   H  HD3  . PRO A  1 82  ? -1.674  3.830   -59.748 1.00 0.00 ?  397 PRO A HD3  1  
ATOM   1341   N  N    . GLY A  1 83  ? 2.569   7.377   -59.037 1.00 0.00 ?  398 GLY A N    1  
ATOM   1342   C  CA   . GLY A  1 83  ? 3.417   8.507   -58.498 1.00 0.00 ?  398 GLY A CA   1  
ATOM   1343   C  C    . GLY A  1 83  ? 3.920   8.255   -57.073 1.00 0.00 ?  398 GLY A C    1  
ATOM   1344   O  O    . GLY A  1 83  ? 4.613   9.059   -56.461 1.00 0.00 ?  398 GLY A O    1  
ATOM   1345   H  H    . GLY A  1 83  ? 3.114   6.863   -59.694 1.00 0.00 ?  398 GLY A H    1  
ATOM   1346   H  HA2  . GLY A  1 83  ? 4.322   8.663   -59.066 1.00 0.00 ?  398 GLY A HA2  1  
ATOM   1347   H  HA3  . GLY A  1 83  ? 2.772   9.366   -58.387 1.00 0.00 ?  398 GLY A HA3  1  
ATOM   1348   N  N    . TYR A  1 84  ? 3.484   7.074   -56.580 1.00 0.00 ?  399 TYR A N    1  
ATOM   1349   C  CA   . TYR A  1 84  ? 4.036   6.561   -55.338 1.00 0.00 ?  399 TYR A CA   1  
ATOM   1350   C  C    . TYR A  1 84  ? 5.225   5.653   -55.648 1.00 0.00 ?  399 TYR A C    1  
ATOM   1351   O  O    . TYR A  1 84  ? 5.230   4.919   -56.625 1.00 0.00 ?  399 TYR A O    1  
ATOM   1352   C  CB   . TYR A  1 84  ? 2.951   5.713   -54.591 1.00 0.00 ?  399 TYR A CB   1  
ATOM   1353   C  CG   . TYR A  1 84  ? 2.007   6.669   -53.990 1.00 0.00 ?  399 TYR A CG   1  
ATOM   1354   C  CD1  . TYR A  1 84  ? 2.324   7.592   -53.006 1.00 0.00 ?  399 TYR A CD1  1  
ATOM   1355   C  CD2  . TYR A  1 84  ? 0.733   6.673   -54.555 1.00 0.00 ?  399 TYR A CD2  1  
ATOM   1356   C  CE1  . TYR A  1 84  ? 1.315   8.495   -52.581 1.00 0.00 ?  399 TYR A CE1  1  
ATOM   1357   C  CE2  . TYR A  1 84  ? -0.249  7.611   -54.182 1.00 0.00 ?  399 TYR A CE2  1  
ATOM   1358   C  CZ   . TYR A  1 84  ? 0.078   8.508   -53.161 1.00 0.00 ?  399 TYR A CZ   1  
ATOM   1359   O  OH   . TYR A  1 84  ? -0.829  9.505   -52.973 1.00 0.00 ?  399 TYR A OH   1  
ATOM   1360   H  H    . TYR A  1 84  ? 2.688   6.668   -57.022 1.00 0.00 ?  399 TYR A H    1  
ATOM   1361   H  HA   . TYR A  1 84  ? 4.308   7.395   -54.709 1.00 0.00 ?  399 TYR A HA   1  
ATOM   1362   H  HB2  . TYR A  1 84  ? 2.434   5.059   -55.326 1.00 0.00 ?  399 TYR A HB2  1  
ATOM   1363   H  HB3  . TYR A  1 84  ? 3.345   5.171   -53.704 1.00 0.00 ?  399 TYR A HB3  1  
ATOM   1364   H  HD1  . TYR A  1 84  ? 3.268   7.553   -52.483 1.00 0.00 ?  399 TYR A HD1  1  
ATOM   1365   H  HD2  . TYR A  1 84  ? 0.458   5.977   -55.334 1.00 0.00 ?  399 TYR A HD2  1  
ATOM   1366   H  HE1  . TYR A  1 84  ? 1.499   9.229   -51.812 1.00 0.00 ?  399 TYR A HE1  1  
ATOM   1367   H  HE2  . TYR A  1 84  ? -1.174  7.645   -54.739 1.00 0.00 ?  399 TYR A HE2  1  
ATOM   1368   H  HH   . TYR A  1 84  ? -0.463  9.929   -52.193 1.00 0.00 ?  399 TYR A HH   1  
ATOM   1369   N  N    . PRO A  1 85  ? 6.275   5.631   -54.722 1.00 0.00 ?  400 PRO A N    1  
ATOM   1370   C  CA   . PRO A  1 85  ? 6.396   6.302   -53.429 1.00 0.00 ?  400 PRO A CA   1  
ATOM   1371   C  C    . PRO A  1 85  ? 6.491   7.833   -53.477 1.00 0.00 ?  400 PRO A C    1  
ATOM   1372   O  O    . PRO A  1 85  ? 6.899   8.464   -54.398 1.00 0.00 ?  400 PRO A O    1  
ATOM   1373   C  CB   . PRO A  1 85  ? 7.608   5.613   -52.764 1.00 0.00 ?  400 PRO A CB   1  
ATOM   1374   C  CG   . PRO A  1 85  ? 8.374   5.067   -53.950 1.00 0.00 ?  400 PRO A CG   1  
ATOM   1375   C  CD   . PRO A  1 85  ? 7.320   4.662   -54.931 1.00 0.00 ?  400 PRO A CD   1  
ATOM   1376   H  HA   . PRO A  1 85  ? 5.542   6.073   -52.809 1.00 0.00 ?  400 PRO A HA   1  
ATOM   1377   H  HB2  . PRO A  1 85  ? 8.223   6.288   -52.131 1.00 0.00 ?  400 PRO A HB2  1  
ATOM   1378   H  HB3  . PRO A  1 85  ? 7.313   4.740   -52.144 1.00 0.00 ?  400 PRO A HB3  1  
ATOM   1379   H  HG2  . PRO A  1 85  ? 9.081   5.816   -54.366 1.00 0.00 ?  400 PRO A HG2  1  
ATOM   1380   H  HG3  . PRO A  1 85  ? 9.017   4.209   -53.657 1.00 0.00 ?  400 PRO A HG3  1  
ATOM   1381   H  HD2  . PRO A  1 85  ? 7.661   4.677   -55.988 1.00 0.00 ?  400 PRO A HD2  1  
ATOM   1382   H  HD3  . PRO A  1 85  ? 6.840   3.720   -54.588 1.00 0.00 ?  400 PRO A HD3  1  
ATOM   1383   N  N    . LYS A  1 86  ? 5.961   8.482   -52.460 1.00 0.00 ?  401 LYS A N    1  
ATOM   1384   C  CA   . LYS A  1 86  ? 6.005   9.932   -52.411 1.00 0.00 ?  401 LYS A CA   1  
ATOM   1385   C  C    . LYS A  1 86  ? 6.626   10.348  -51.088 1.00 0.00 ?  401 LYS A C    1  
ATOM   1386   O  O    . LYS A  1 86  ? 6.615   9.613   -50.097 1.00 0.00 ?  401 LYS A O    1  
ATOM   1387   C  CB   . LYS A  1 86  ? 4.565   10.600  -52.613 1.00 0.00 ?  401 LYS A CB   1  
ATOM   1388   C  CG   . LYS A  1 86  ? 4.314   12.071  -52.351 1.00 0.00 ?  401 LYS A CG   1  
ATOM   1389   C  CD   . LYS A  1 86  ? 2.913   12.544  -52.454 1.00 0.00 ?  401 LYS A CD   1  
ATOM   1390   C  CE   . LYS A  1 86  ? 2.456   12.611  -53.946 1.00 0.00 ?  401 LYS A CE   1  
ATOM   1391   N  NZ   . LYS A  1 86  ? 3.210   13.550  -54.753 1.00 0.00 1  401 LYS A NZ   1  
ATOM   1392   H  H    . LYS A  1 86  ? 5.546   8.038   -51.669 1.00 0.00 ?  401 LYS A H    1  
ATOM   1393   H  HA   . LYS A  1 86  ? 6.666   10.514  -53.036 1.00 0.00 ?  401 LYS A HA   1  
ATOM   1394   H  HB2  . LYS A  1 86  ? 4.309   10.478  -53.687 1.00 0.00 ?  401 LYS A HB2  1  
ATOM   1395   H  HB3  . LYS A  1 86  ? 3.832   10.085  -51.956 1.00 0.00 ?  401 LYS A HB3  1  
ATOM   1396   H  HG2  . LYS A  1 86  ? 4.559   12.364  -51.308 1.00 0.00 ?  401 LYS A HG2  1  
ATOM   1397   H  HG3  . LYS A  1 86  ? 5.089   12.609  -52.939 1.00 0.00 ?  401 LYS A HG3  1  
ATOM   1398   H  HD2  . LYS A  1 86  ? 2.175   11.878  -51.958 1.00 0.00 ?  401 LYS A HD2  1  
ATOM   1399   H  HD3  . LYS A  1 86  ? 2.722   13.586  -52.120 1.00 0.00 ?  401 LYS A HD3  1  
ATOM   1400   H  HE2  . LYS A  1 86  ? 2.511   11.579  -54.356 1.00 0.00 ?  401 LYS A HE2  1  
ATOM   1401   H  HE3  . LYS A  1 86  ? 1.386   12.901  -54.016 1.00 0.00 ?  401 LYS A HE3  1  
ATOM   1402   H  HZ1  . LYS A  1 86  ? 3.157   13.223  -55.738 1.00 0.00 ?  401 LYS A HZ1  1  
ATOM   1403   H  HZ2  . LYS A  1 86  ? 4.212   13.570  -54.473 1.00 0.00 ?  401 LYS A HZ2  1  
ATOM   1404   H  HZ3  . LYS A  1 86  ? 2.779   14.496  -54.764 1.00 0.00 ?  401 LYS A HZ3  1  
ATOM   1405   N  N    . HIS A  1 87  ? 7.352   11.504  -51.092 1.00 0.00 ?  402 HIS A N    1  
ATOM   1406   C  CA   . HIS A  1 87  ? 7.926   12.157  -49.817 1.00 0.00 ?  402 HIS A CA   1  
ATOM   1407   C  C    . HIS A  1 87  ? 6.930   12.568  -48.769 1.00 0.00 ?  402 HIS A C    1  
ATOM   1408   O  O    . HIS A  1 87  ? 5.840   12.970  -49.022 1.00 0.00 ?  402 HIS A O    1  
ATOM   1409   C  CB   . HIS A  1 87  ? 8.942   13.303  -50.168 1.00 0.00 ?  402 HIS A CB   1  
ATOM   1410   C  CG   . HIS A  1 87  ? 10.179  12.728  -50.868 1.00 0.00 ?  402 HIS A CG   1  
ATOM   1411   N  ND1  . HIS A  1 87  ? 11.226  12.148  -50.257 1.00 0.00 ?  402 HIS A ND1  1  
ATOM   1412   C  CD2  . HIS A  1 87  ? 10.547  13.013  -52.114 1.00 0.00 ?  402 HIS A CD2  1  
ATOM   1413   C  CE1  . HIS A  1 87  ? 12.210  12.070  -51.236 1.00 0.00 ?  402 HIS A CE1  1  
ATOM   1414   N  NE2  . HIS A  1 87  ? 11.815  12.616  -52.363 1.00 0.00 ?  402 HIS A NE2  1  
ATOM   1415   H  H    . HIS A  1 87  ? 7.598   11.989  -51.927 1.00 0.00 ?  402 HIS A H    1  
ATOM   1416   H  HA   . HIS A  1 87  ? 8.565   11.413  -49.365 1.00 0.00 ?  402 HIS A HA   1  
ATOM   1417   H  HB2  . HIS A  1 87  ? 8.563   14.120  -50.819 1.00 0.00 ?  402 HIS A HB2  1  
ATOM   1418   H  HB3  . HIS A  1 87  ? 9.267   13.754  -49.206 1.00 0.00 ?  402 HIS A HB3  1  
ATOM   1419   H  HD1  . HIS A  1 87  ? 11.371  11.738  -49.356 1.00 0.00 ?  402 HIS A HD1  1  
ATOM   1420   H  HD2  . HIS A  1 87  ? 10.165  13.735  -52.825 1.00 0.00 ?  402 HIS A HD2  1  
ATOM   1421   H  HE1  . HIS A  1 87  ? 13.252  11.848  -51.005 1.00 0.00 ?  402 HIS A HE1  1  
ATOM   1422   N  N    . ILE A  1 88  ? 7.308   12.405  -47.473 1.00 0.00 ?  403 ILE A N    1  
ATOM   1423   C  CA   . ILE A  1 88  ? 6.466   12.905  -46.398 1.00 0.00 ?  403 ILE A CA   1  
ATOM   1424   C  C    . ILE A  1 88  ? 6.139   14.395  -46.460 1.00 0.00 ?  403 ILE A C    1  
ATOM   1425   O  O    . ILE A  1 88  ? 4.992   14.770  -46.326 1.00 0.00 ?  403 ILE A O    1  
ATOM   1426   C  CB   . ILE A  1 88  ? 7.126   12.679  -45.029 1.00 0.00 ?  403 ILE A CB   1  
ATOM   1427   C  CG1  . ILE A  1 88  ? 7.425   11.186  -44.808 1.00 0.00 ?  403 ILE A CG1  1  
ATOM   1428   C  CG2  . ILE A  1 88  ? 6.298   13.357  -43.875 1.00 0.00 ?  403 ILE A CG2  1  
ATOM   1429   C  CD1  . ILE A  1 88  ? 8.156   10.884  -43.492 1.00 0.00 ?  403 ILE A CD1  1  
ATOM   1430   H  H    . ILE A  1 88  ? 8.216   12.109  -47.186 1.00 0.00 ?  403 ILE A H    1  
ATOM   1431   H  HA   . ILE A  1 88  ? 5.541   12.347  -46.420 1.00 0.00 ?  403 ILE A HA   1  
ATOM   1432   H  HB   . ILE A  1 88  ? 8.110   13.196  -45.024 1.00 0.00 ?  403 ILE A HB   1  
ATOM   1433   H  HG12 . ILE A  1 88  ? 6.499   10.576  -44.873 1.00 0.00 ?  403 ILE A HG12 1  
ATOM   1434   H  HG13 . ILE A  1 88  ? 8.107   10.791  -45.591 1.00 0.00 ?  403 ILE A HG13 1  
ATOM   1435   H  HG21 . ILE A  1 88  ? 6.504   14.448  -43.914 1.00 0.00 ?  403 ILE A HG21 1  
ATOM   1436   H  HG22 . ILE A  1 88  ? 6.644   13.076  -42.857 1.00 0.00 ?  403 ILE A HG22 1  
ATOM   1437   H  HG23 . ILE A  1 88  ? 5.226   13.099  -44.008 1.00 0.00 ?  403 ILE A HG23 1  
ATOM   1438   H  HD11 . ILE A  1 88  ? 8.464   9.825   -43.355 1.00 0.00 ?  403 ILE A HD11 1  
ATOM   1439   H  HD12 . ILE A  1 88  ? 7.636   11.246  -42.579 1.00 0.00 ?  403 ILE A HD12 1  
ATOM   1440   H  HD13 . ILE A  1 88  ? 9.144   11.392  -43.471 1.00 0.00 ?  403 ILE A HD13 1  
ATOM   1441   N  N    . LYS A  1 89  ? 7.180   15.230  -46.871 1.00 0.00 ?  404 LYS A N    1  
ATOM   1442   C  CA   . LYS A  1 89  ? 7.052   16.665  -46.978 1.00 0.00 ?  404 LYS A CA   1  
ATOM   1443   C  C    . LYS A  1 89  ? 6.133   17.057  -48.159 1.00 0.00 ?  404 LYS A C    1  
ATOM   1444   O  O    . LYS A  1 89  ? 5.392   18.059  -48.117 1.00 0.00 ?  404 LYS A O    1  
ATOM   1445   C  CB   . LYS A  1 89  ? 8.445   17.198  -47.080 1.00 0.00 ?  404 LYS A CB   1  
ATOM   1446   C  CG   . LYS A  1 89  ? 9.234   16.726  -48.315 1.00 0.00 ?  404 LYS A CG   1  
ATOM   1447   C  CD   . LYS A  1 89  ? 10.573  17.493  -48.446 1.00 0.00 ?  404 LYS A CD   1  
ATOM   1448   C  CE   . LYS A  1 89  ? 10.996  17.523  -49.939 1.00 0.00 ?  404 LYS A CE   1  
ATOM   1449   N  NZ   . LYS A  1 89  ? 12.213  18.263  -50.241 1.00 0.00 1  404 LYS A NZ   1  
ATOM   1450   H  H    . LYS A  1 89  ? 8.089   14.820  -46.899 1.00 0.00 ?  404 LYS A H    1  
ATOM   1451   H  HA   . LYS A  1 89  ? 6.545   17.043  -46.102 1.00 0.00 ?  404 LYS A HA   1  
ATOM   1452   H  HB2  . LYS A  1 89  ? 8.422   18.308  -47.044 1.00 0.00 ?  404 LYS A HB2  1  
ATOM   1453   H  HB3  . LYS A  1 89  ? 8.997   16.952  -46.148 1.00 0.00 ?  404 LYS A HB3  1  
ATOM   1454   H  HG2  . LYS A  1 89  ? 9.468   15.653  -48.485 1.00 0.00 ?  404 LYS A HG2  1  
ATOM   1455   H  HG3  . LYS A  1 89  ? 8.625   16.975  -49.210 1.00 0.00 ?  404 LYS A HG3  1  
ATOM   1456   H  HD2  . LYS A  1 89  ? 10.427  18.506  -48.013 1.00 0.00 ?  404 LYS A HD2  1  
ATOM   1457   H  HD3  . LYS A  1 89  ? 11.311  17.129  -47.699 1.00 0.00 ?  404 LYS A HD3  1  
ATOM   1458   H  HE2  . LYS A  1 89  ? 11.173  16.473  -50.255 1.00 0.00 ?  404 LYS A HE2  1  
ATOM   1459   H  HE3  . LYS A  1 89  ? 10.127  17.952  -50.482 1.00 0.00 ?  404 LYS A HE3  1  
ATOM   1460   H  HZ1  . LYS A  1 89  ? 12.320  18.280  -51.276 1.00 0.00 ?  404 LYS A HZ1  1  
ATOM   1461   H  HZ2  . LYS A  1 89  ? 13.097  17.855  -49.875 1.00 0.00 ?  404 LYS A HZ2  1  
ATOM   1462   H  HZ3  . LYS A  1 89  ? 12.124  19.238  -49.891 1.00 0.00 ?  404 LYS A HZ3  1  
ATOM   1463   N  N    . GLU A  1 90  ? 5.994   16.218  -49.223 1.00 0.00 ?  405 GLU A N    1  
ATOM   1464   C  CA   . GLU A  1 90  ? 4.956   16.443  -50.205 1.00 0.00 ?  405 GLU A CA   1  
ATOM   1465   C  C    . GLU A  1 90  ? 3.529   16.243  -49.703 1.00 0.00 ?  405 GLU A C    1  
ATOM   1466   O  O    . GLU A  1 90  ? 2.553   16.948  -50.023 1.00 0.00 ?  405 GLU A O    1  
ATOM   1467   C  CB   . GLU A  1 90  ? 5.129   15.683  -51.601 1.00 0.00 ?  405 GLU A CB   1  
ATOM   1468   C  CG   . GLU A  1 90  ? 6.439   16.108  -52.333 1.00 0.00 ?  405 GLU A CG   1  
ATOM   1469   C  CD   . GLU A  1 90  ? 6.630   15.261  -53.566 1.00 0.00 ?  405 GLU A CD   1  
ATOM   1470   O  OE1  . GLU A  1 90  ? 5.756   14.538  -54.128 1.00 0.00 ?  405 GLU A OE1  1  
ATOM   1471   O  OE2  . GLU A  1 90  ? 7.700   15.400  -54.149 1.00 0.00 -1 405 GLU A OE2  1  
ATOM   1472   H  H    . GLU A  1 90  ? 6.435   15.324  -49.245 1.00 0.00 ?  405 GLU A H    1  
ATOM   1473   H  HA   . GLU A  1 90  ? 5.086   17.466  -50.526 1.00 0.00 ?  405 GLU A HA   1  
ATOM   1474   H  HB2  . GLU A  1 90  ? 4.943   14.616  -51.356 1.00 0.00 ?  405 GLU A HB2  1  
ATOM   1475   H  HB3  . GLU A  1 90  ? 4.290   16.080  -52.212 1.00 0.00 ?  405 GLU A HB3  1  
ATOM   1476   H  HG2  . GLU A  1 90  ? 6.410   17.166  -52.671 1.00 0.00 ?  405 GLU A HG2  1  
ATOM   1477   H  HG3  . GLU A  1 90  ? 7.309   15.998  -51.651 1.00 0.00 ?  405 GLU A HG3  1  
ATOM   1478   N  N    . LEU A  1 91  ? 3.333   15.160  -48.859 1.00 0.00 ?  406 LEU A N    1  
ATOM   1479   C  CA   . LEU A  1 91  ? 1.997   14.896  -48.140 1.00 0.00 ?  406 LEU A CA   1  
ATOM   1480   C  C    . LEU A  1 91  ? 1.584   16.059  -47.186 1.00 0.00 ?  406 LEU A C    1  
ATOM   1481   O  O    . LEU A  1 91  ? 0.501   16.494  -47.062 1.00 0.00 ?  406 LEU A O    1  
ATOM   1482   C  CB   . LEU A  1 91  ? 2.009   13.536  -47.364 1.00 0.00 ?  406 LEU A CB   1  
ATOM   1483   C  CG   . LEU A  1 91  ? 0.808   13.091  -46.513 1.00 0.00 ?  406 LEU A CG   1  
ATOM   1484   C  CD1  . LEU A  1 91  ? -0.442  13.334  -47.310 1.00 0.00 ?  406 LEU A CD1  1  
ATOM   1485   C  CD2  . LEU A  1 91  ? 0.938   11.654  -45.880 1.00 0.00 ?  406 LEU A CD2  1  
ATOM   1486   H  H    . LEU A  1 91  ? 4.049   14.519  -48.595 1.00 0.00 ?  406 LEU A H    1  
ATOM   1487   H  HA   . LEU A  1 91  ? 1.209   14.819  -48.875 1.00 0.00 ?  406 LEU A HA   1  
ATOM   1488   H  HB2  . LEU A  1 91  ? 2.158   12.737  -48.122 1.00 0.00 ?  406 LEU A HB2  1  
ATOM   1489   H  HB3  . LEU A  1 91  ? 3.014   13.467  -46.894 1.00 0.00 ?  406 LEU A HB3  1  
ATOM   1490   H  HG   . LEU A  1 91  ? 0.757   13.710  -45.592 1.00 0.00 ?  406 LEU A HG   1  
ATOM   1491   H  HD11 . LEU A  1 91  ? -1.364  13.146  -46.719 1.00 0.00 ?  406 LEU A HD11 1  
ATOM   1492   H  HD12 . LEU A  1 91  ? -0.422  12.659  -48.193 1.00 0.00 ?  406 LEU A HD12 1  
ATOM   1493   H  HD13 . LEU A  1 91  ? -0.498  14.323  -47.815 1.00 0.00 ?  406 LEU A HD13 1  
ATOM   1494   H  HD21 . LEU A  1 91  ? 0.104   11.347  -45.212 1.00 0.00 ?  406 LEU A HD21 1  
ATOM   1495   H  HD22 . LEU A  1 91  ? 1.871   11.616  -45.278 1.00 0.00 ?  406 LEU A HD22 1  
ATOM   1496   H  HD23 . LEU A  1 91  ? 1.010   10.947  -46.734 1.00 0.00 ?  406 LEU A HD23 1  
ATOM   1497   N  N    . GLY A  1 92  ? 2.558   16.641  -46.514 1.00 0.00 ?  407 GLY A N    1  
ATOM   1498   C  CA   . GLY A  1 92  ? 2.196   17.865  -45.798 1.00 0.00 ?  407 GLY A CA   1  
ATOM   1499   C  C    . GLY A  1 92  ? 3.313   18.635  -45.210 1.00 0.00 ?  407 GLY A C    1  
ATOM   1500   O  O    . GLY A  1 92  ? 4.478   18.190  -45.201 1.00 0.00 ?  407 GLY A O    1  
ATOM   1501   H  H    . GLY A  1 92  ? 3.501   16.342  -46.635 1.00 0.00 ?  407 GLY A H    1  
ATOM   1502   H  HA2  . GLY A  1 92  ? 1.788   18.664  -46.399 1.00 0.00 ?  407 GLY A HA2  1  
ATOM   1503   H  HA3  . GLY A  1 92  ? 1.702   17.573  -44.883 1.00 0.00 ?  407 GLY A HA3  1  
ATOM   1504   N  N    . ARG A  1 93  ? 3.040   19.833  -44.661 1.00 0.00 ?  408 ARG A N    1  
ATOM   1505   C  CA   . ARG A  1 93  ? 4.084   20.614  -44.037 1.00 0.00 ?  408 ARG A CA   1  
ATOM   1506   C  C    . ARG A  1 93  ? 4.095   20.432  -42.468 1.00 0.00 ?  408 ARG A C    1  
ATOM   1507   O  O    . ARG A  1 93  ? 3.104   20.219  -41.763 1.00 0.00 ?  408 ARG A O    1  
ATOM   1508   C  CB   . ARG A  1 93  ? 4.071   22.148  -44.511 1.00 0.00 ?  408 ARG A CB   1  
ATOM   1509   C  CG   . ARG A  1 93  ? 2.679   22.786  -44.320 1.00 0.00 ?  408 ARG A CG   1  
ATOM   1510   C  CD   . ARG A  1 93  ? 2.434   24.212  -45.050 1.00 0.00 ?  408 ARG A CD   1  
ATOM   1511   N  NE   . ARG A  1 93  ? 0.952   24.457  -45.002 1.00 0.00 ?  408 ARG A NE   1  
ATOM   1512   C  CZ   . ARG A  1 93  ? 0.314   24.907  -43.922 1.00 0.00 ?  408 ARG A CZ   1  
ATOM   1513   N  NH1  . ARG A  1 93  ? -0.996  25.025  -43.988 1.00 0.00 1  408 ARG A NH1  1  
ATOM   1514   N  NH2  . ARG A  1 93  ? 0.875   25.395  -42.868 1.00 0.00 ?  408 ARG A NH2  1  
ATOM   1515   H  H    . ARG A  1 93  ? 2.133   20.190  -44.870 1.00 0.00 ?  408 ARG A H    1  
ATOM   1516   H  HA   . ARG A  1 93  ? 5.081   20.273  -44.271 1.00 0.00 ?  408 ARG A HA   1  
ATOM   1517   H  HB2  . ARG A  1 93  ? 5.041   22.577  -44.181 1.00 0.00 ?  408 ARG A HB2  1  
ATOM   1518   H  HB3  . ARG A  1 93  ? 4.149   21.973  -45.605 1.00 0.00 ?  408 ARG A HB3  1  
ATOM   1519   H  HG2  . ARG A  1 93  ? 1.973   22.007  -44.678 1.00 0.00 ?  408 ARG A HG2  1  
ATOM   1520   H  HG3  . ARG A  1 93  ? 2.596   23.032  -43.240 1.00 0.00 ?  408 ARG A HG3  1  
ATOM   1521   H  HD2  . ARG A  1 93  ? 2.927   25.007  -44.451 1.00 0.00 ?  408 ARG A HD2  1  
ATOM   1522   H  HD3  . ARG A  1 93  ? 2.753   24.318  -46.109 1.00 0.00 ?  408 ARG A HD3  1  
ATOM   1523   H  HE   . ARG A  1 93  ? 0.394   24.217  -45.797 1.00 0.00 ?  408 ARG A HE   1  
ATOM   1524   H  HH11 . ARG A  1 93  ? -1.482  24.360  -44.555 1.00 0.00 ?  408 ARG A HH11 1  
ATOM   1525   H  HH12 . ARG A  1 93  ? -1.530  25.423  -43.242 1.00 0.00 ?  408 ARG A HH12 1  
ATOM   1526   H  HH21 . ARG A  1 93  ? 1.868   25.463  -42.777 1.00 0.00 ?  408 ARG A HH21 1  
ATOM   1527   H  HH22 . ARG A  1 93  ? 0.270   25.716  -42.139 1.00 0.00 ?  408 ARG A HH22 1  
ATOM   1528   N  N    . GLY A  1 94  ? 5.280   20.499  -42.007 1.00 0.00 ?  409 GLY A N    1  
ATOM   1529   C  CA   . GLY A  1 94  ? 5.551   20.263  -40.605 1.00 0.00 ?  409 GLY A CA   1  
ATOM   1530   C  C    . GLY A  1 94  ? 5.386   18.916  -39.985 1.00 0.00 ?  409 GLY A C    1  
ATOM   1531   O  O    . GLY A  1 94  ? 5.109   18.750  -38.781 1.00 0.00 ?  409 GLY A O    1  
ATOM   1532   H  H    . GLY A  1 94  ? 6.029   20.750  -42.615 1.00 0.00 ?  409 GLY A H    1  
ATOM   1533   H  HA2  . GLY A  1 94  ? 6.601   20.490  -40.486 1.00 0.00 ?  409 GLY A HA2  1  
ATOM   1534   H  HA3  . GLY A  1 94  ? 5.038   20.969  -39.969 1.00 0.00 ?  409 GLY A HA3  1  
ATOM   1535   N  N    . LEU A  1 95  ? 5.644   17.895  -40.790 1.00 0.00 ?  410 LEU A N    1  
ATOM   1536   C  CA   . LEU A  1 95  ? 5.601   16.465  -40.396 1.00 0.00 ?  410 LEU A CA   1  
ATOM   1537   C  C    . LEU A  1 95  ? 7.070   16.067  -40.193 1.00 0.00 ?  410 LEU A C    1  
ATOM   1538   O  O    . LEU A  1 95  ? 7.950   16.758  -40.643 1.00 0.00 ?  410 LEU A O    1  
ATOM   1539   C  CB   . LEU A  1 95  ? 4.966   15.650  -41.506 1.00 0.00 ?  410 LEU A CB   1  
ATOM   1540   C  CG   . LEU A  1 95  ? 3.485   15.990  -41.907 1.00 0.00 ?  410 LEU A CG   1  
ATOM   1541   C  CD1  . LEU A  1 95  ? 2.783   14.953  -42.809 1.00 0.00 ?  410 LEU A CD1  1  
ATOM   1542   C  CD2  . LEU A  1 95  ? 2.617   16.379  -40.690 1.00 0.00 ?  410 LEU A CD2  1  
ATOM   1543   H  H    . LEU A  1 95  ? 5.779   18.259  -41.709 1.00 0.00 ?  410 LEU A H    1  
ATOM   1544   H  HA   . LEU A  1 95  ? 5.082   16.378  -39.452 1.00 0.00 ?  410 LEU A HA   1  
ATOM   1545   H  HB2  . LEU A  1 95  ? 5.496   15.706  -42.481 1.00 0.00 ?  410 LEU A HB2  1  
ATOM   1546   H  HB3  . LEU A  1 95  ? 4.875   14.559  -41.317 1.00 0.00 ?  410 LEU A HB3  1  
ATOM   1547   H  HG   . LEU A  1 95  ? 3.605   16.918  -42.506 1.00 0.00 ?  410 LEU A HG   1  
ATOM   1548   H  HD11 . LEU A  1 95  ? 3.275   14.923  -43.804 1.00 0.00 ?  410 LEU A HD11 1  
ATOM   1549   H  HD12 . LEU A  1 95  ? 1.703   15.089  -43.034 1.00 0.00 ?  410 LEU A HD12 1  
ATOM   1550   H  HD13 . LEU A  1 95  ? 2.757   13.960  -42.313 1.00 0.00 ?  410 LEU A HD13 1  
ATOM   1551   H  HD21 . LEU A  1 95  ? 2.806   17.359  -40.201 1.00 0.00 ?  410 LEU A HD21 1  
ATOM   1552   H  HD22 . LEU A  1 95  ? 2.644   15.627  -39.874 1.00 0.00 ?  410 LEU A HD22 1  
ATOM   1553   H  HD23 . LEU A  1 95  ? 1.523   16.392  -40.882 1.00 0.00 ?  410 LEU A HD23 1  
ATOM   1554   N  N    . PRO A  1 96  ? 7.360   14.969  -39.461 1.00 0.00 ?  411 PRO A N    1  
ATOM   1555   C  CA   . PRO A  1 96  ? 8.645   14.522  -39.122 1.00 0.00 ?  411 PRO A CA   1  
ATOM   1556   C  C    . PRO A  1 96  ? 9.798   14.698  -40.097 1.00 0.00 ?  411 PRO A C    1  
ATOM   1557   O  O    . PRO A  1 96  ? 9.639   14.510  -41.305 1.00 0.00 ?  411 PRO A O    1  
ATOM   1558   C  CB   . PRO A  1 96  ? 8.511   13.067  -38.622 1.00 0.00 ?  411 PRO A CB   1  
ATOM   1559   C  CG   . PRO A  1 96  ? 7.132   12.999  -37.991 1.00 0.00 ?  411 PRO A CG   1  
ATOM   1560   C  CD   . PRO A  1 96  ? 6.390   14.164  -38.758 1.00 0.00 ?  411 PRO A CD   1  
ATOM   1561   H  HA   . PRO A  1 96  ? 8.988   15.091  -38.270 1.00 0.00 ?  411 PRO A HA   1  
ATOM   1562   H  HB2  . PRO A  1 96  ? 8.597   12.397  -39.505 1.00 0.00 ?  411 PRO A HB2  1  
ATOM   1563   H  HB3  . PRO A  1 96  ? 9.353   12.878  -37.923 1.00 0.00 ?  411 PRO A HB3  1  
ATOM   1564   H  HG2  . PRO A  1 96  ? 6.773   11.954  -38.105 1.00 0.00 ?  411 PRO A HG2  1  
ATOM   1565   H  HG3  . PRO A  1 96  ? 7.186   13.279  -36.917 1.00 0.00 ?  411 PRO A HG3  1  
ATOM   1566   H  HD2  . PRO A  1 96  ? 5.745   13.634  -39.491 1.00 0.00 ?  411 PRO A HD2  1  
ATOM   1567   H  HD3  . PRO A  1 96  ? 5.903   14.817  -38.002 1.00 0.00 ?  411 PRO A HD3  1  
ATOM   1568   N  N    . THR A  1 97  ? 10.919  15.060  -39.624 1.00 0.00 ?  412 THR A N    1  
ATOM   1569   C  CA   . THR A  1 97  ? 12.038  15.501  -40.472 1.00 0.00 ?  412 THR A CA   1  
ATOM   1570   C  C    . THR A  1 97  ? 12.762  14.376  -41.275 1.00 0.00 ?  412 THR A C    1  
ATOM   1571   O  O    . THR A  1 97  ? 13.270  14.564  -42.337 1.00 0.00 ?  412 THR A O    1  
ATOM   1572   C  CB   . THR A  1 97  ? 12.918  16.454  -39.764 1.00 0.00 ?  412 THR A CB   1  
ATOM   1573   O  OG1  . THR A  1 97  ? 13.694  15.906  -38.635 1.00 0.00 ?  412 THR A OG1  1  
ATOM   1574   C  CG2  . THR A  1 97  ? 12.005  17.651  -39.247 1.00 0.00 ?  412 THR A CG2  1  
ATOM   1575   H  H    . THR A  1 97  ? 11.155  14.953  -38.661 1.00 0.00 ?  412 THR A H    1  
ATOM   1576   H  HA   . THR A  1 97  ? 11.615  16.205  -41.173 1.00 0.00 ?  412 THR A HA   1  
ATOM   1577   H  HB   . THR A  1 97  ? 13.628  16.833  -40.530 1.00 0.00 ?  412 THR A HB   1  
ATOM   1578   H  HG1  . THR A  1 97  ? 14.316  16.584  -38.361 1.00 0.00 ?  412 THR A HG1  1  
ATOM   1579   H  HG21 . THR A  1 97  ? 11.405  17.363  -38.358 1.00 0.00 ?  412 THR A HG21 1  
ATOM   1580   H  HG22 . THR A  1 97  ? 11.474  18.012  -40.154 1.00 0.00 ?  412 THR A HG22 1  
ATOM   1581   H  HG23 . THR A  1 97  ? 12.658  18.457  -38.850 1.00 0.00 ?  412 THR A HG23 1  
ATOM   1582   N  N    . ASP A  1 98  ? 12.680  13.101  -40.756 1.00 0.00 ?  413 ASP A N    1  
ATOM   1583   C  CA   . ASP A  1 98  ? 13.453  12.031  -41.237 1.00 0.00 ?  413 ASP A CA   1  
ATOM   1584   C  C    . ASP A  1 98  ? 12.663  10.698  -41.413 1.00 0.00 ?  413 ASP A C    1  
ATOM   1585   O  O    . ASP A  1 98  ? 12.860  10.045  -42.437 1.00 0.00 ?  413 ASP A O    1  
ATOM   1586   C  CB   . ASP A  1 98  ? 14.623  11.833  -40.248 1.00 0.00 ?  413 ASP A CB   1  
ATOM   1587   C  CG   . ASP A  1 98  ? 14.253  11.685  -38.775 1.00 0.00 ?  413 ASP A CG   1  
ATOM   1588   O  OD1  . ASP A  1 98  ? 15.245  11.571  -38.015 1.00 0.00 ?  413 ASP A OD1  1  
ATOM   1589   O  OD2  . ASP A  1 98  ? 13.060  11.641  -38.302 1.00 0.00 -1 413 ASP A OD2  1  
ATOM   1590   H  H    . ASP A  1 98  ? 12.126  12.980  -39.936 1.00 0.00 ?  413 ASP A H    1  
ATOM   1591   H  HA   . ASP A  1 98  ? 13.883  12.307  -42.188 1.00 0.00 ?  413 ASP A HA   1  
ATOM   1592   H  HB2  . ASP A  1 98  ? 15.231  10.962  -40.573 1.00 0.00 ?  413 ASP A HB2  1  
ATOM   1593   H  HB3  . ASP A  1 98  ? 15.311  12.698  -40.362 1.00 0.00 ?  413 ASP A HB3  1  
ATOM   1594   N  N    . LYS A  1 99  ? 11.670  10.363  -40.544 1.00 0.00 ?  414 LYS A N    1  
ATOM   1595   C  CA   . LYS A  1 99  ? 10.874  9.126   -40.766 1.00 0.00 ?  414 LYS A CA   1  
ATOM   1596   C  C    . LYS A  1 99  ? 9.642   9.128   -39.877 1.00 0.00 ?  414 LYS A C    1  
ATOM   1597   O  O    . LYS A  1 99  ? 9.629   9.882   -38.867 1.00 0.00 ?  414 LYS A O    1  
ATOM   1598   C  CB   . LYS A  1 99  ? 11.747  7.805   -40.433 1.00 0.00 ?  414 LYS A CB   1  
ATOM   1599   C  CG   . LYS A  1 99  ? 12.040  7.604   -38.997 1.00 0.00 ?  414 LYS A CG   1  
ATOM   1600   C  CD   . LYS A  1 99  ? 13.278  6.709   -38.833 1.00 0.00 ?  414 LYS A CD   1  
ATOM   1601   C  CE   . LYS A  1 99  ? 13.757  6.624   -37.392 1.00 0.00 ?  414 LYS A CE   1  
ATOM   1602   N  NZ   . LYS A  1 99  ? 12.890  5.627   -36.676 1.00 0.00 1  414 LYS A NZ   1  
ATOM   1603   H  H    . LYS A  1 99  ? 11.618  10.969  -39.754 1.00 0.00 ?  414 LYS A H    1  
ATOM   1604   H  HA   . LYS A  1 99  ? 10.538  8.992   -41.783 1.00 0.00 ?  414 LYS A HA   1  
ATOM   1605   H  HB2  . LYS A  1 99  ? 11.245  6.878   -40.786 1.00 0.00 ?  414 LYS A HB2  1  
ATOM   1606   H  HB3  . LYS A  1 99  ? 12.703  7.871   -40.996 1.00 0.00 ?  414 LYS A HB3  1  
ATOM   1607   H  HG2  . LYS A  1 99  ? 12.214  8.636   -38.625 1.00 0.00 ?  414 LYS A HG2  1  
ATOM   1608   H  HG3  . LYS A  1 99  ? 11.252  7.158   -38.353 1.00 0.00 ?  414 LYS A HG3  1  
ATOM   1609   H  HD2  . LYS A  1 99  ? 13.021  5.694   -39.203 1.00 0.00 ?  414 LYS A HD2  1  
ATOM   1610   H  HD3  . LYS A  1 99  ? 14.090  7.149   -39.451 1.00 0.00 ?  414 LYS A HD3  1  
ATOM   1611   H  HE2  . LYS A  1 99  ? 14.746  6.119   -37.382 1.00 0.00 ?  414 LYS A HE2  1  
ATOM   1612   H  HE3  . LYS A  1 99  ? 13.819  7.594   -36.853 1.00 0.00 ?  414 LYS A HE3  1  
ATOM   1613   H  HZ1  . LYS A  1 99  ? 12.930  4.740   -37.217 1.00 0.00 ?  414 LYS A HZ1  1  
ATOM   1614   H  HZ2  . LYS A  1 99  ? 11.890  5.903   -36.600 1.00 0.00 ?  414 LYS A HZ2  1  
ATOM   1615   H  HZ3  . LYS A  1 99  ? 13.220  5.374   -35.723 1.00 0.00 ?  414 LYS A HZ3  1  
ATOM   1616   N  N    . ILE A  1 100 ? 8.608   8.290   -40.188 1.00 0.00 ?  415 ILE A N    1  
ATOM   1617   C  CA   . ILE A  1 100 ? 7.356   8.174   -39.480 1.00 0.00 ?  415 ILE A CA   1  
ATOM   1618   C  C    . ILE A  1 100 ? 7.266   6.874   -38.834 1.00 0.00 ?  415 ILE A C    1  
ATOM   1619   O  O    . ILE A  1 100 ? 7.136   5.845   -39.529 1.00 0.00 ?  415 ILE A O    1  
ATOM   1620   C  CB   . ILE A  1 100 ? 6.049   8.626   -40.289 1.00 0.00 ?  415 ILE A CB   1  
ATOM   1621   C  CG1  . ILE A  1 100 ? 6.007   10.217  -40.389 1.00 0.00 ?  415 ILE A CG1  1  
ATOM   1622   C  CG2  . ILE A  1 100 ? 4.698   8.111   -39.726 1.00 0.00 ?  415 ILE A CG2  1  
ATOM   1623   C  CD1  . ILE A  1 100 ? 4.883   10.702  -41.384 1.00 0.00 ?  415 ILE A CD1  1  
ATOM   1624   H  H    . ILE A  1 100 ? 8.762   7.832   -41.060 1.00 0.00 ?  415 ILE A H    1  
ATOM   1625   H  HA   . ILE A  1 100 ? 7.424   8.925   -38.707 1.00 0.00 ?  415 ILE A HA   1  
ATOM   1626   H  HB   . ILE A  1 100 ? 6.064   8.276   -41.344 1.00 0.00 ?  415 ILE A HB   1  
ATOM   1627   H  HG12 . ILE A  1 100 ? 5.651   10.490  -39.373 1.00 0.00 ?  415 ILE A HG12 1  
ATOM   1628   H  HG13 . ILE A  1 100 ? 6.958   10.768  -40.552 1.00 0.00 ?  415 ILE A HG13 1  
ATOM   1629   H  HG21 . ILE A  1 100 ? 4.801   7.035   -39.470 1.00 0.00 ?  415 ILE A HG21 1  
ATOM   1630   H  HG22 . ILE A  1 100 ? 3.923   8.143   -40.521 1.00 0.00 ?  415 ILE A HG22 1  
ATOM   1631   H  HG23 . ILE A  1 100 ? 4.351   8.600   -38.791 1.00 0.00 ?  415 ILE A HG23 1  
ATOM   1632   H  HD11 . ILE A  1 100 ? 5.205   10.316  -42.374 1.00 0.00 ?  415 ILE A HD11 1  
ATOM   1633   H  HD12 . ILE A  1 100 ? 4.962   11.810  -41.380 1.00 0.00 ?  415 ILE A HD12 1  
ATOM   1634   H  HD13 . ILE A  1 100 ? 3.833   10.421  -41.154 1.00 0.00 ?  415 ILE A HD13 1  
ATOM   1635   N  N    . ASP A  1 101 ? 7.321   6.825   -37.467 1.00 0.00 ?  416 ASP A N    1  
ATOM   1636   C  CA   . ASP A  1 101 ? 7.407   5.589   -36.776 1.00 0.00 ?  416 ASP A CA   1  
ATOM   1637   C  C    . ASP A  1 101 ? 6.116   4.905   -36.558 1.00 0.00 ?  416 ASP A C    1  
ATOM   1638   O  O    . ASP A  1 101 ? 5.980   3.662   -36.478 1.00 0.00 ?  416 ASP A O    1  
ATOM   1639   C  CB   . ASP A  1 101 ? 7.940   5.873   -35.372 1.00 0.00 ?  416 ASP A CB   1  
ATOM   1640   C  CG   . ASP A  1 101 ? 9.445   6.300   -35.398 1.00 0.00 ?  416 ASP A CG   1  
ATOM   1641   O  OD1  . ASP A  1 101 ? 10.209  6.131   -36.372 1.00 0.00 ?  416 ASP A OD1  1  
ATOM   1642   O  OD2  . ASP A  1 101 ? 9.899   6.846   -34.325 1.00 0.00 -1 416 ASP A OD2  1  
ATOM   1643   H  H    . ASP A  1 101 ? 7.187   7.642   -36.912 1.00 0.00 ?  416 ASP A H    1  
ATOM   1644   H  HA   . ASP A  1 101 ? 8.069   4.894   -37.271 1.00 0.00 ?  416 ASP A HA   1  
ATOM   1645   H  HB2  . ASP A  1 101 ? 7.401   6.744   -34.941 1.00 0.00 ?  416 ASP A HB2  1  
ATOM   1646   H  HB3  . ASP A  1 101 ? 7.819   4.985   -34.716 1.00 0.00 ?  416 ASP A HB3  1  
ATOM   1647   N  N    . ALA A  1 102 ? 4.983   5.653   -36.462 1.00 0.00 ?  417 ALA A N    1  
ATOM   1648   C  CA   . ALA A  1 102 ? 3.698   5.038   -36.574 1.00 0.00 ?  417 ALA A CA   1  
ATOM   1649   C  C    . ALA A  1 102 ? 2.549   5.913   -37.040 1.00 0.00 ?  417 ALA A C    1  
ATOM   1650   O  O    . ALA A  1 102 ? 2.645   7.158   -37.153 1.00 0.00 ?  417 ALA A O    1  
ATOM   1651   C  CB   . ALA A  1 102 ? 3.182   4.453   -35.227 1.00 0.00 ?  417 ALA A CB   1  
ATOM   1652   H  H    . ALA A  1 102 ? 5.160   6.634   -36.463 1.00 0.00 ?  417 ALA A H    1  
ATOM   1653   H  HA   . ALA A  1 102 ? 3.699   4.290   -37.353 1.00 0.00 ?  417 ALA A HA   1  
ATOM   1654   H  HB1  . ALA A  1 102 ? 2.760   5.251   -34.580 1.00 0.00 ?  417 ALA A HB1  1  
ATOM   1655   H  HB2  . ALA A  1 102 ? 4.012   3.981   -34.660 1.00 0.00 ?  417 ALA A HB2  1  
ATOM   1656   H  HB3  . ALA A  1 102 ? 2.329   3.744   -35.289 1.00 0.00 ?  417 ALA A HB3  1  
ATOM   1657   N  N    . ALA A  1 103 ? 1.340   5.390   -37.316 1.00 0.00 ?  418 ALA A N    1  
ATOM   1658   C  CA   . ALA A  1 103 ? 0.221   6.184   -37.779 1.00 0.00 ?  418 ALA A CA   1  
ATOM   1659   C  C    . ALA A  1 103 ? -1.145  5.622   -37.275 1.00 0.00 ?  418 ALA A C    1  
ATOM   1660   O  O    . ALA A  1 103 ? -1.381  4.414   -37.269 1.00 0.00 ?  418 ALA A O    1  
ATOM   1661   C  CB   . ALA A  1 103 ? 0.091   6.323   -39.330 1.00 0.00 ?  418 ALA A CB   1  
ATOM   1662   H  H    . ALA A  1 103 ? 1.122   4.417   -37.303 1.00 0.00 ?  418 ALA A H    1  
ATOM   1663   H  HA   . ALA A  1 103 ? 0.291   7.162   -37.326 1.00 0.00 ?  418 ALA A HA   1  
ATOM   1664   H  HB1  . ALA A  1 103 ? -0.560  7.196   -39.551 1.00 0.00 ?  418 ALA A HB1  1  
ATOM   1665   H  HB2  . ALA A  1 103 ? -0.315  5.447   -39.881 1.00 0.00 ?  418 ALA A HB2  1  
ATOM   1666   H  HB3  . ALA A  1 103 ? 1.095   6.479   -39.778 1.00 0.00 ?  418 ALA A HB3  1  
ATOM   1667   N  N    . LEU A  1 104 ? -2.095  6.494   -36.952 1.00 0.00 ?  419 LEU A N    1  
ATOM   1668   C  CA   . LEU A  1 104 ? -3.372  6.058   -36.523 1.00 0.00 ?  419 LEU A CA   1  
ATOM   1669   C  C    . LEU A  1 104 ? -4.417  6.904   -37.113 1.00 0.00 ?  419 LEU A C    1  
ATOM   1670   O  O    . LEU A  1 104 ? -4.580  8.107   -36.794 1.00 0.00 ?  419 LEU A O    1  
ATOM   1671   C  CB   . LEU A  1 104 ? -3.504  6.189   -34.935 1.00 0.00 ?  419 LEU A CB   1  
ATOM   1672   C  CG   . LEU A  1 104 ? -4.887  5.691   -34.315 1.00 0.00 ?  419 LEU A CG   1  
ATOM   1673   C  CD1  . LEU A  1 104 ? -4.873  4.112   -34.300 1.00 0.00 ?  419 LEU A CD1  1  
ATOM   1674   C  CD2  . LEU A  1 104 ? -5.127  6.321   -32.917 1.00 0.00 ?  419 LEU A CD2  1  
ATOM   1675   H  H    . LEU A  1 104 ? -1.986  7.465   -37.153 1.00 0.00 ?  419 LEU A H    1  
ATOM   1676   H  HA   . LEU A  1 104 ? -3.555  5.050   -36.863 1.00 0.00 ?  419 LEU A HA   1  
ATOM   1677   H  HB2  . LEU A  1 104 ? -2.607  5.672   -34.533 1.00 0.00 ?  419 LEU A HB2  1  
ATOM   1678   H  HB3  . LEU A  1 104 ? -3.368  7.270   -34.717 1.00 0.00 ?  419 LEU A HB3  1  
ATOM   1679   H  HG   . LEU A  1 104 ? -5.660  6.012   -35.045 1.00 0.00 ?  419 LEU A HG   1  
ATOM   1680   H  HD11 . LEU A  1 104 ? -4.745  3.570   -35.262 1.00 0.00 ?  419 LEU A HD11 1  
ATOM   1681   H  HD12 . LEU A  1 104 ? -5.836  3.749   -33.882 1.00 0.00 ?  419 LEU A HD12 1  
ATOM   1682   H  HD13 . LEU A  1 104 ? -4.051  3.784   -33.628 1.00 0.00 ?  419 LEU A HD13 1  
ATOM   1683   H  HD21 . LEU A  1 104 ? -5.331  7.409   -33.013 1.00 0.00 ?  419 LEU A HD21 1  
ATOM   1684   H  HD22 . LEU A  1 104 ? -4.266  6.141   -32.238 1.00 0.00 ?  419 LEU A HD22 1  
ATOM   1685   H  HD23 . LEU A  1 104 ? -6.026  5.854   -32.463 1.00 0.00 ?  419 LEU A HD23 1  
ATOM   1686   N  N    . PHE A  1 105 ? -5.352  6.318   -37.918 1.00 0.00 ?  420 PHE A N    1  
ATOM   1687   C  CA   . PHE A  1 105 ? -6.533  6.976   -38.388 1.00 0.00 ?  420 PHE A CA   1  
ATOM   1688   C  C    . PHE A  1 105 ? -7.609  7.119   -37.279 1.00 0.00 ?  420 PHE A C    1  
ATOM   1689   O  O    . PHE A  1 105 ? -8.114  6.128   -36.715 1.00 0.00 ?  420 PHE A O    1  
ATOM   1690   C  CB   . PHE A  1 105 ? -7.176  6.198   -39.500 1.00 0.00 ?  420 PHE A CB   1  
ATOM   1691   C  CG   . PHE A  1 105 ? -8.172  7.023   -40.219 1.00 0.00 ?  420 PHE A CG   1  
ATOM   1692   C  CD1  . PHE A  1 105 ? -7.832  8.260   -40.818 1.00 0.00 ?  420 PHE A CD1  1  
ATOM   1693   C  CD2  . PHE A  1 105 ? -9.539  6.601   -40.258 1.00 0.00 ?  420 PHE A CD2  1  
ATOM   1694   C  CE1  . PHE A  1 105 ? -8.777  8.943   -41.608 1.00 0.00 ?  420 PHE A CE1  1  
ATOM   1695   C  CE2  . PHE A  1 105 ? -10.488 7.371   -40.900 1.00 0.00 ?  420 PHE A CE2  1  
ATOM   1696   C  CZ   . PHE A  1 105 ? -10.046 8.379   -41.786 1.00 0.00 ?  420 PHE A CZ   1  
ATOM   1697   H  H    . PHE A  1 105 ? -5.268  5.382   -38.249 1.00 0.00 ?  420 PHE A H    1  
ATOM   1698   H  HA   . PHE A  1 105 ? -6.269  7.948   -38.777 1.00 0.00 ?  420 PHE A HA   1  
ATOM   1699   H  HB2  . PHE A  1 105 ? -6.402  5.865   -40.224 1.00 0.00 ?  420 PHE A HB2  1  
ATOM   1700   H  HB3  . PHE A  1 105 ? -7.703  5.272   -39.184 1.00 0.00 ?  420 PHE A HB3  1  
ATOM   1701   H  HD1  . PHE A  1 105 ? -6.836  8.676   -40.790 1.00 0.00 ?  420 PHE A HD1  1  
ATOM   1702   H  HD2  . PHE A  1 105 ? -9.675  5.617   -39.832 1.00 0.00 ?  420 PHE A HD2  1  
ATOM   1703   H  HE1  . PHE A  1 105 ? -8.428  9.813   -42.146 1.00 0.00 ?  420 PHE A HE1  1  
ATOM   1704   H  HE2  . PHE A  1 105 ? -11.450 6.885   -40.969 1.00 0.00 ?  420 PHE A HE2  1  
ATOM   1705   H  HZ   . PHE A  1 105 ? -10.741 8.908   -42.421 1.00 0.00 ?  420 PHE A HZ   1  
ATOM   1706   N  N    . TRP A  1 106 ? -7.984  8.347   -36.896 1.00 0.00 ?  421 TRP A N    1  
ATOM   1707   C  CA   . TRP A  1 106 ? -8.974  8.589   -35.872 1.00 0.00 ?  421 TRP A CA   1  
ATOM   1708   C  C    . TRP A  1 106 ? -10.237 9.022   -36.533 1.00 0.00 ?  421 TRP A C    1  
ATOM   1709   O  O    . TRP A  1 106 ? -10.437 10.198  -36.780 1.00 0.00 ?  421 TRP A O    1  
ATOM   1710   C  CB   . TRP A  1 106 ? -8.361  9.610   -34.857 1.00 0.00 ?  421 TRP A CB   1  
ATOM   1711   C  CG   . TRP A  1 106 ? -9.124  9.906   -33.638 1.00 0.00 ?  421 TRP A CG   1  
ATOM   1712   C  CD1  . TRP A  1 106 ? -9.787  11.114  -33.432 1.00 0.00 ?  421 TRP A CD1  1  
ATOM   1713   C  CD2  . TRP A  1 106 ? -9.223  9.206   -32.426 1.00 0.00 ?  421 TRP A CD2  1  
ATOM   1714   N  NE1  . TRP A  1 106 ? -10.445 11.035  -32.240 1.00 0.00 ?  421 TRP A NE1  1  
ATOM   1715   C  CE2  . TRP A  1 106 ? -10.096 10.016  -31.567 1.00 0.00 ?  421 TRP A CE2  1  
ATOM   1716   C  CE3  . TRP A  1 106 ? -8.731  8.011   -31.855 1.00 0.00 ?  421 TRP A CE3  1  
ATOM   1717   C  CZ2  . TRP A  1 106 ? -10.286 9.760   -30.225 1.00 0.00 ?  421 TRP A CZ2  1  
ATOM   1718   C  CZ3  . TRP A  1 106 ? -9.003  7.714   -30.552 1.00 0.00 ?  421 TRP A CZ3  1  
ATOM   1719   C  CH2  . TRP A  1 106 ? -9.743  8.621   -29.766 1.00 0.00 ?  421 TRP A CH2  1  
ATOM   1720   H  H    . TRP A  1 106 ? -7.595  9.114   -37.401 1.00 0.00 ?  421 TRP A H    1  
ATOM   1721   H  HA   . TRP A  1 106 ? -9.200  7.649   -35.389 1.00 0.00 ?  421 TRP A HA   1  
ATOM   1722   H  HB2  . TRP A  1 106 ? -7.340  9.298   -34.547 1.00 0.00 ?  421 TRP A HB2  1  
ATOM   1723   H  HB3  . TRP A  1 106 ? -8.260  10.523  -35.482 1.00 0.00 ?  421 TRP A HB3  1  
ATOM   1724   H  HD1  . TRP A  1 106 ? -10.019 11.838  -34.199 1.00 0.00 ?  421 TRP A HD1  1  
ATOM   1725   H  HE1  . TRP A  1 106 ? -11.161 11.665  -32.031 1.00 0.00 ?  421 TRP A HE1  1  
ATOM   1726   H  HE3  . TRP A  1 106 ? -8.178  7.373   -32.529 1.00 0.00 ?  421 TRP A HE3  1  
ATOM   1727   H  HZ2  . TRP A  1 106 ? -10.879 10.390  -29.578 1.00 0.00 ?  421 TRP A HZ2  1  
ATOM   1728   H  HZ3  . TRP A  1 106 ? -8.448  6.882   -30.144 1.00 0.00 ?  421 TRP A HZ3  1  
ATOM   1729   H  HH2  . TRP A  1 106 ? -9.854  8.465   -28.703 1.00 0.00 ?  421 TRP A HH2  1  
ATOM   1730   N  N    . MET A  1 107 ? -11.160 8.040   -36.736 1.00 0.00 ?  422 MET A N    1  
ATOM   1731   C  CA   . MET A  1 107 ? -12.427 8.235   -37.259 1.00 0.00 ?  422 MET A CA   1  
ATOM   1732   C  C    . MET A  1 107 ? -13.259 9.473   -37.107 1.00 0.00 ?  422 MET A C    1  
ATOM   1733   O  O    . MET A  1 107 ? -13.602 10.004  -38.117 1.00 0.00 ?  422 MET A O    1  
ATOM   1734   C  CB   . MET A  1 107 ? -13.300 7.057   -36.886 1.00 0.00 ?  422 MET A CB   1  
ATOM   1735   C  CG   . MET A  1 107 ? -13.029 5.932   -37.852 1.00 0.00 ?  422 MET A CG   1  
ATOM   1736   S  SD   . MET A  1 107 ? -11.430 5.088   -37.704 1.00 0.00 ?  422 MET A SD   1  
ATOM   1737   C  CE   . MET A  1 107 ? -12.128 3.810   -38.812 1.00 0.00 ?  422 MET A CE   1  
ATOM   1738   H  H    . MET A  1 107 ? -10.806 7.124   -36.566 1.00 0.00 ?  422 MET A H    1  
ATOM   1739   H  HA   . MET A  1 107 ? -12.374 8.205   -38.337 1.00 0.00 ?  422 MET A HA   1  
ATOM   1740   H  HB2  . MET A  1 107 ? -13.075 6.789   -35.832 1.00 0.00 ?  422 MET A HB2  1  
ATOM   1741   H  HB3  . MET A  1 107 ? -14.399 7.189   -36.980 1.00 0.00 ?  422 MET A HB3  1  
ATOM   1742   H  HG2  . MET A  1 107 ? -13.841 5.217   -37.600 1.00 0.00 ?  422 MET A HG2  1  
ATOM   1743   H  HG3  . MET A  1 107 ? -13.253 6.184   -38.910 1.00 0.00 ?  422 MET A HG3  1  
ATOM   1744   H  HE1  . MET A  1 107 ? -12.500 4.352   -39.708 1.00 0.00 ?  422 MET A HE1  1  
ATOM   1745   H  HE2  . MET A  1 107 ? -12.975 3.281   -38.323 1.00 0.00 ?  422 MET A HE2  1  
ATOM   1746   H  HE3  . MET A  1 107 ? -11.333 3.140   -39.204 1.00 0.00 ?  422 MET A HE3  1  
ATOM   1747   N  N    . PRO A  1 108 ? -13.713 10.122  -36.066 1.00 0.00 ?  423 PRO A N    1  
ATOM   1748   C  CA   . PRO A  1 108 ? -14.805 10.977  -36.091 1.00 0.00 ?  423 PRO A CA   1  
ATOM   1749   C  C    . PRO A  1 108 ? -14.538 12.280  -36.838 1.00 0.00 ?  423 PRO A C    1  
ATOM   1750   O  O    . PRO A  1 108 ? -15.386 12.739  -37.622 1.00 0.00 ?  423 PRO A O    1  
ATOM   1751   C  CB   . PRO A  1 108 ? -15.253 11.097  -34.637 1.00 0.00 ?  423 PRO A CB   1  
ATOM   1752   C  CG   . PRO A  1 108 ? -14.026 10.729  -33.827 1.00 0.00 ?  423 PRO A CG   1  
ATOM   1753   C  CD   . PRO A  1 108 ? -13.367 9.719   -34.746 1.00 0.00 ?  423 PRO A CD   1  
ATOM   1754   H  HA   . PRO A  1 108 ? -15.586 10.566  -36.714 1.00 0.00 ?  423 PRO A HA   1  
ATOM   1755   H  HB2  . PRO A  1 108 ? -15.636 12.103  -34.359 1.00 0.00 ?  423 PRO A HB2  1  
ATOM   1756   H  HB3  . PRO A  1 108 ? -16.055 10.345  -34.476 1.00 0.00 ?  423 PRO A HB3  1  
ATOM   1757   H  HG2  . PRO A  1 108 ? -13.296 11.555  -33.691 1.00 0.00 ?  423 PRO A HG2  1  
ATOM   1758   H  HG3  . PRO A  1 108 ? -14.347 10.277  -32.864 1.00 0.00 ?  423 PRO A HG3  1  
ATOM   1759   H  HD2  . PRO A  1 108 ? -12.265 9.673   -34.605 1.00 0.00 ?  423 PRO A HD2  1  
ATOM   1760   H  HD3  . PRO A  1 108 ? -13.861 8.749   -34.526 1.00 0.00 ?  423 PRO A HD3  1  
ATOM   1761   N  N    . ASN A  1 109 ? -13.386 12.921  -36.618 1.00 0.00 ?  424 ASN A N    1  
ATOM   1762   C  CA   . ASN A  1 109 ? -13.056 14.149  -37.256 1.00 0.00 ?  424 ASN A CA   1  
ATOM   1763   C  C    . ASN A  1 109 ? -12.144 13.838  -38.427 1.00 0.00 ?  424 ASN A C    1  
ATOM   1764   O  O    . ASN A  1 109 ? -11.641 14.711  -39.153 1.00 0.00 ?  424 ASN A O    1  
ATOM   1765   C  CB   . ASN A  1 109 ? -12.244 15.105  -36.248 1.00 0.00 ?  424 ASN A CB   1  
ATOM   1766   C  CG   . ASN A  1 109 ? -11.089 14.455  -35.509 1.00 0.00 ?  424 ASN A CG   1  
ATOM   1767   O  OD1  . ASN A  1 109 ? -10.508 13.414  -35.830 1.00 0.00 ?  424 ASN A OD1  1  
ATOM   1768   N  ND2  . ASN A  1 109 ? -10.590 15.132  -34.451 1.00 0.00 ?  424 ASN A ND2  1  
ATOM   1769   H  H    . ASN A  1 109 ? -12.596 12.575  -36.117 1.00 0.00 ?  424 ASN A H    1  
ATOM   1770   H  HA   . ASN A  1 109 ? -13.945 14.617  -37.652 1.00 0.00 ?  424 ASN A HA   1  
ATOM   1771   H  HB2  . ASN A  1 109 ? -11.844 16.008  -36.756 1.00 0.00 ?  424 ASN A HB2  1  
ATOM   1772   H  HB3  . ASN A  1 109 ? -12.996 15.505  -35.534 1.00 0.00 ?  424 ASN A HB3  1  
ATOM   1773   H  HD21 . ASN A  1 109 ? -9.846  14.671  -33.966 1.00 0.00 ?  424 ASN A HD21 1  
ATOM   1774   H  HD22 . ASN A  1 109 ? -11.198 15.781  -33.994 1.00 0.00 ?  424 ASN A HD22 1  
ATOM   1775   N  N    . GLY A  1 110 ? -11.800 12.555  -38.694 1.00 0.00 ?  425 GLY A N    1  
ATOM   1776   C  CA   . GLY A  1 110 ? -11.042 12.057  -39.804 1.00 0.00 ?  425 GLY A CA   1  
ATOM   1777   C  C    . GLY A  1 110 ? -9.614  12.254  -39.767 1.00 0.00 ?  425 GLY A C    1  
ATOM   1778   O  O    . GLY A  1 110 ? -9.062  12.009  -40.848 1.00 0.00 ?  425 GLY A O    1  
ATOM   1779   H  H    . GLY A  1 110 ? -12.270 11.923  -38.082 1.00 0.00 ?  425 GLY A H    1  
ATOM   1780   H  HA2  . GLY A  1 110 ? -11.281 11.006  -39.872 1.00 0.00 ?  425 GLY A HA2  1  
ATOM   1781   H  HA3  . GLY A  1 110 ? -11.330 12.655  -40.656 1.00 0.00 ?  425 GLY A HA3  1  
ATOM   1782   N  N    . LYS A  1 111 ? -9.032  12.694  -38.626 1.00 0.00 ?  426 LYS A N    1  
ATOM   1783   C  CA   . LYS A  1 111 ? -7.629  13.026  -38.638 1.00 0.00 ?  426 LYS A CA   1  
ATOM   1784   C  C    . LYS A  1 111 ? -6.638  11.909  -38.288 1.00 0.00 ?  426 LYS A C    1  
ATOM   1785   O  O    . LYS A  1 111 ? -6.694  11.084  -37.363 1.00 0.00 ?  426 LYS A O    1  
ATOM   1786   C  CB   . LYS A  1 111 ? -7.500  14.253  -37.749 1.00 0.00 ?  426 LYS A CB   1  
ATOM   1787   C  CG   . LYS A  1 111 ? -8.000  15.615  -38.406 1.00 0.00 ?  426 LYS A CG   1  
ATOM   1788   C  CD   . LYS A  1 111 ? -7.957  16.783  -37.413 1.00 0.00 ?  426 LYS A CD   1  
ATOM   1789   C  CE   . LYS A  1 111 ? -8.478  18.097  -37.929 1.00 0.00 ?  426 LYS A CE   1  
ATOM   1790   N  NZ   . LYS A  1 111 ? -8.294  19.162  -36.873 1.00 0.00 1  426 LYS A NZ   1  
ATOM   1791   H  H    . LYS A  1 111 ? -9.544  12.818  -37.779 1.00 0.00 ?  426 LYS A H    1  
ATOM   1792   H  HA   . LYS A  1 111 ? -7.343  13.253  -39.655 1.00 0.00 ?  426 LYS A HA   1  
ATOM   1793   H  HB2  . LYS A  1 111 ? -8.083  14.026  -36.831 1.00 0.00 ?  426 LYS A HB2  1  
ATOM   1794   H  HB3  . LYS A  1 111 ? -6.426  14.389  -37.498 1.00 0.00 ?  426 LYS A HB3  1  
ATOM   1795   H  HG2  . LYS A  1 111 ? -7.348  15.868  -39.269 1.00 0.00 ?  426 LYS A HG2  1  
ATOM   1796   H  HG3  . LYS A  1 111 ? -9.048  15.402  -38.706 1.00 0.00 ?  426 LYS A HG3  1  
ATOM   1797   H  HD2  . LYS A  1 111 ? -8.566  16.509  -36.526 1.00 0.00 ?  426 LYS A HD2  1  
ATOM   1798   H  HD3  . LYS A  1 111 ? -6.915  16.923  -37.055 1.00 0.00 ?  426 LYS A HD3  1  
ATOM   1799   H  HE2  . LYS A  1 111 ? -7.973  18.347  -38.887 1.00 0.00 ?  426 LYS A HE2  1  
ATOM   1800   H  HE3  . LYS A  1 111 ? -9.558  17.979  -38.161 1.00 0.00 ?  426 LYS A HE3  1  
ATOM   1801   H  HZ1  . LYS A  1 111 ? -7.323  19.409  -36.592 1.00 0.00 ?  426 LYS A HZ1  1  
ATOM   1802   H  HZ2  . LYS A  1 111 ? -8.834  18.957  -36.008 1.00 0.00 ?  426 LYS A HZ2  1  
ATOM   1803   H  HZ3  . LYS A  1 111 ? -8.660  20.101  -37.129 1.00 0.00 ?  426 LYS A HZ3  1  
ATOM   1804   N  N    . THR A  1 112 ? -5.616  11.810  -39.091 1.00 0.00 ?  427 THR A N    1  
ATOM   1805   C  CA   . THR A  1 112 ? -4.475  10.824  -39.005 1.00 0.00 ?  427 THR A CA   1  
ATOM   1806   C  C    . THR A  1 112 ? -3.431  11.368  -38.041 1.00 0.00 ?  427 THR A C    1  
ATOM   1807   O  O    . THR A  1 112 ? -2.870  12.415  -38.195 1.00 0.00 ?  427 THR A O    1  
ATOM   1808   C  CB   . THR A  1 112 ? -3.710  10.543  -40.377 1.00 0.00 ?  427 THR A CB   1  
ATOM   1809   O  OG1  . THR A  1 112 ? -4.621  10.124  -41.424 1.00 0.00 ?  427 THR A OG1  1  
ATOM   1810   C  CG2  . THR A  1 112 ? -2.561  9.523   -40.251 1.00 0.00 ?  427 THR A CG2  1  
ATOM   1811   H  H    . THR A  1 112 ? -5.649  12.528  -39.781 1.00 0.00 ?  427 THR A H    1  
ATOM   1812   H  HA   . THR A  1 112 ? -4.717  9.819   -38.694 1.00 0.00 ?  427 THR A HA   1  
ATOM   1813   H  HB   . THR A  1 112 ? -3.237  11.461  -40.786 1.00 0.00 ?  427 THR A HB   1  
ATOM   1814   H  HG1  . THR A  1 112 ? -5.100  10.862  -41.808 1.00 0.00 ?  427 THR A HG1  1  
ATOM   1815   H  HG21 . THR A  1 112 ? -3.013  8.516   -40.126 1.00 0.00 ?  427 THR A HG21 1  
ATOM   1816   H  HG22 . THR A  1 112 ? -1.945  9.622   -39.332 1.00 0.00 ?  427 THR A HG22 1  
ATOM   1817   H  HG23 . THR A  1 112 ? -1.926  9.479   -41.162 1.00 0.00 ?  427 THR A HG23 1  
ATOM   1818   N  N    . TYR A  1 113 ? -3.140  10.536  -37.028 1.00 0.00 ?  428 TYR A N    1  
ATOM   1819   C  CA   . TYR A  1 113 ? -2.089  10.877  -36.137 1.00 0.00 ?  428 TYR A CA   1  
ATOM   1820   C  C    . TYR A  1 113 ? -0.868  10.291  -36.708 1.00 0.00 ?  428 TYR A C    1  
ATOM   1821   O  O    . TYR A  1 113 ? -0.918  9.123   -37.142 1.00 0.00 ?  428 TYR A O    1  
ATOM   1822   C  CB   . TYR A  1 113 ? -2.228  10.255  -34.689 1.00 0.00 ?  428 TYR A CB   1  
ATOM   1823   C  CG   . TYR A  1 113 ? -3.177  11.086  -33.857 1.00 0.00 ?  428 TYR A CG   1  
ATOM   1824   C  CD1  . TYR A  1 113 ? -4.512  10.637  -33.718 1.00 0.00 ?  428 TYR A CD1  1  
ATOM   1825   C  CD2  . TYR A  1 113 ? -2.695  12.181  -33.191 1.00 0.00 ?  428 TYR A CD2  1  
ATOM   1826   C  CE1  . TYR A  1 113 ? -5.346  11.385  -32.844 1.00 0.00 ?  428 TYR A CE1  1  
ATOM   1827   C  CE2  . TYR A  1 113 ? -3.492  12.882  -32.269 1.00 0.00 ?  428 TYR A CE2  1  
ATOM   1828   C  CZ   . TYR A  1 113 ? -4.822  12.399  -32.050 1.00 0.00 ?  428 TYR A CZ   1  
ATOM   1829   O  OH   . TYR A  1 113 ? -5.572  13.040  -30.992 1.00 0.00 ?  428 TYR A OH   1  
ATOM   1830   H  H    . TYR A  1 113 ? -3.563  9.634   -36.990 1.00 0.00 ?  428 TYR A H    1  
ATOM   1831   H  HA   . TYR A  1 113 ? -1.850  11.930  -36.118 1.00 0.00 ?  428 TYR A HA   1  
ATOM   1832   H  HB2  . TYR A  1 113 ? -2.633  9.222   -34.760 1.00 0.00 ?  428 TYR A HB2  1  
ATOM   1833   H  HB3  . TYR A  1 113 ? -1.247  10.157  -34.178 1.00 0.00 ?  428 TYR A HB3  1  
ATOM   1834   H  HD1  . TYR A  1 113 ? -4.759  9.740   -34.265 1.00 0.00 ?  428 TYR A HD1  1  
ATOM   1835   H  HD2  . TYR A  1 113 ? -1.674  12.509  -33.320 1.00 0.00 ?  428 TYR A HD2  1  
ATOM   1836   H  HE1  . TYR A  1 113 ? -6.355  11.027  -32.703 1.00 0.00 ?  428 TYR A HE1  1  
ATOM   1837   H  HE2  . TYR A  1 113 ? -3.224  13.827  -31.820 1.00 0.00 ?  428 TYR A HE2  1  
ATOM   1838   H  HH   . TYR A  1 113 ? -6.374  12.554  -30.785 1.00 0.00 ?  428 TYR A HH   1  
ATOM   1839   N  N    . PHE A  1 114 ? 0.229   11.009  -36.581 1.00 0.00 ?  429 PHE A N    1  
ATOM   1840   C  CA   . PHE A  1 114 ? 1.541   10.552  -36.963 1.00 0.00 ?  429 PHE A CA   1  
ATOM   1841   C  C    . PHE A  1 114 ? 2.517   10.569  -35.803 1.00 0.00 ?  429 PHE A C    1  
ATOM   1842   O  O    . PHE A  1 114 ? 2.543   11.503  -35.015 1.00 0.00 ?  429 PHE A O    1  
ATOM   1843   C  CB   . PHE A  1 114 ? 2.089   11.524  -38.061 1.00 0.00 ?  429 PHE A CB   1  
ATOM   1844   C  CG   . PHE A  1 114 ? 1.553   11.200  -39.428 1.00 0.00 ?  429 PHE A CG   1  
ATOM   1845   C  CD1  . PHE A  1 114 ? 1.245   12.250  -40.313 1.00 0.00 ?  429 PHE A CD1  1  
ATOM   1846   C  CD2  . PHE A  1 114 ? 1.419   9.895   -39.841 1.00 0.00 ?  429 PHE A CD2  1  
ATOM   1847   C  CE1  . PHE A  1 114 ? 0.829   11.953  -41.653 1.00 0.00 ?  429 PHE A CE1  1  
ATOM   1848   C  CE2  . PHE A  1 114 ? 0.843   9.591   -41.174 1.00 0.00 ?  429 PHE A CE2  1  
ATOM   1849   C  CZ   . PHE A  1 114 ? 0.605   10.652  -42.063 1.00 0.00 ?  429 PHE A CZ   1  
ATOM   1850   H  H    . PHE A  1 114 ? 0.219   11.919  -36.173 1.00 0.00 ?  429 PHE A H    1  
ATOM   1851   H  HA   . PHE A  1 114 ? 1.542   9.488   -37.147 1.00 0.00 ?  429 PHE A HA   1  
ATOM   1852   H  HB2  . PHE A  1 114 ? 1.783   12.558  -37.791 1.00 0.00 ?  429 PHE A HB2  1  
ATOM   1853   H  HB3  . PHE A  1 114 ? 3.156   11.287  -38.258 1.00 0.00 ?  429 PHE A HB3  1  
ATOM   1854   H  HD1  . PHE A  1 114 ? 1.293   13.288  -40.019 1.00 0.00 ?  429 PHE A HD1  1  
ATOM   1855   H  HD2  . PHE A  1 114 ? 1.552   9.056   -39.174 1.00 0.00 ?  429 PHE A HD2  1  
ATOM   1856   H  HE1  . PHE A  1 114 ? 0.634   12.751  -42.354 1.00 0.00 ?  429 PHE A HE1  1  
ATOM   1857   H  HE2  . PHE A  1 114 ? 0.853   8.596   -41.594 1.00 0.00 ?  429 PHE A HE2  1  
ATOM   1858   H  HZ   . PHE A  1 114 ? 0.148   10.430  -43.016 1.00 0.00 ?  429 PHE A HZ   1  
ATOM   1859   N  N    . PHE A  1 115 ? 3.452   9.600   -35.725 1.00 0.00 ?  430 PHE A N    1  
ATOM   1860   C  CA   . PHE A  1 115 ? 4.259   9.410   -34.522 1.00 0.00 ?  430 PHE A CA   1  
ATOM   1861   C  C    . PHE A  1 115 ? 5.706   9.255   -34.975 1.00 0.00 ?  430 PHE A C    1  
ATOM   1862   O  O    . PHE A  1 115 ? 6.029   8.527   -35.819 1.00 0.00 ?  430 PHE A O    1  
ATOM   1863   C  CB   . PHE A  1 115 ? 3.921   8.064   -33.819 1.00 0.00 ?  430 PHE A CB   1  
ATOM   1864   C  CG   . PHE A  1 115 ? 2.573   8.095   -33.139 1.00 0.00 ?  430 PHE A CG   1  
ATOM   1865   C  CD1  . PHE A  1 115 ? 2.566   8.305   -31.761 1.00 0.00 ?  430 PHE A CD1  1  
ATOM   1866   C  CD2  . PHE A  1 115 ? 1.411   7.794   -33.822 1.00 0.00 ?  430 PHE A CD2  1  
ATOM   1867   C  CE1  . PHE A  1 115 ? 1.354   8.197   -31.032 1.00 0.00 ?  430 PHE A CE1  1  
ATOM   1868   C  CE2  . PHE A  1 115 ? 0.201   7.739   -33.093 1.00 0.00 ?  430 PHE A CE2  1  
ATOM   1869   C  CZ   . PHE A  1 115 ? 0.175   7.950   -31.693 1.00 0.00 ?  430 PHE A CZ   1  
ATOM   1870   H  H    . PHE A  1 115 ? 3.392   8.795   -36.309 1.00 0.00 ?  430 PHE A H    1  
ATOM   1871   H  HA   . PHE A  1 115 ? 4.259   10.295  -33.902 1.00 0.00 ?  430 PHE A HA   1  
ATOM   1872   H  HB2  . PHE A  1 115 ? 3.905   7.266   -34.592 1.00 0.00 ?  430 PHE A HB2  1  
ATOM   1873   H  HB3  . PHE A  1 115 ? 4.664   7.780   -33.043 1.00 0.00 ?  430 PHE A HB3  1  
ATOM   1874   H  HD1  . PHE A  1 115 ? 3.462   8.503   -31.192 1.00 0.00 ?  430 PHE A HD1  1  
ATOM   1875   H  HD2  . PHE A  1 115 ? 1.508   7.596   -34.879 1.00 0.00 ?  430 PHE A HD2  1  
ATOM   1876   H  HE1  . PHE A  1 115 ? 1.414   8.400   -29.973 1.00 0.00 ?  430 PHE A HE1  1  
ATOM   1877   H  HE2  . PHE A  1 115 ? -0.745  7.533   -33.571 1.00 0.00 ?  430 PHE A HE2  1  
ATOM   1878   H  HZ   . PHE A  1 115 ? -0.763  7.805   -31.178 1.00 0.00 ?  430 PHE A HZ   1  
ATOM   1879   N  N    . ARG A  1 116 ? 6.566   9.972   -34.201 1.00 0.00 ?  431 ARG A N    1  
ATOM   1880   C  CA   . ARG A  1 116 ? 8.011   9.856   -34.333 1.00 0.00 ?  431 ARG A CA   1  
ATOM   1881   C  C    . ARG A  1 116 ? 8.680   10.014  -33.014 1.00 0.00 ?  431 ARG A C    1  
ATOM   1882   O  O    . ARG A  1 116 ? 8.569   11.108  -32.465 1.00 0.00 ?  431 ARG A O    1  
ATOM   1883   C  CB   . ARG A  1 116 ? 8.634   10.855  -35.471 1.00 0.00 ?  431 ARG A CB   1  
ATOM   1884   C  CG   . ARG A  1 116 ? 10.178  11.110  -35.557 1.00 0.00 ?  431 ARG A CG   1  
ATOM   1885   C  CD   . ARG A  1 116 ? 11.144  9.906   -35.861 1.00 0.00 ?  431 ARG A CD   1  
ATOM   1886   N  NE   . ARG A  1 116 ? 12.549  10.490  -35.964 1.00 0.00 ?  431 ARG A NE   1  
ATOM   1887   C  CZ   . ARG A  1 116 ? 13.497  10.533  -35.068 1.00 0.00 ?  431 ARG A CZ   1  
ATOM   1888   N  NH1  . ARG A  1 116 ? 14.652  11.157  -35.315 1.00 0.00 1  431 ARG A NH1  1  
ATOM   1889   N  NH2  . ARG A  1 116 ? 13.376  10.196  -33.805 1.00 0.00 ?  431 ARG A NH2  1  
ATOM   1890   H  H    . ARG A  1 116 ? 6.260   10.575  -33.468 1.00 0.00 ?  431 ARG A H    1  
ATOM   1891   H  HA   . ARG A  1 116 ? 8.177   8.807   -34.529 1.00 0.00 ?  431 ARG A HA   1  
ATOM   1892   H  HB2  . ARG A  1 116 ? 8.423   10.355  -36.440 1.00 0.00 ?  431 ARG A HB2  1  
ATOM   1893   H  HB3  . ARG A  1 116 ? 8.117   11.835  -35.380 1.00 0.00 ?  431 ARG A HB3  1  
ATOM   1894   H  HG2  . ARG A  1 116 ? 10.492  11.888  -36.285 1.00 0.00 ?  431 ARG A HG2  1  
ATOM   1895   H  HG3  . ARG A  1 116 ? 10.513  11.524  -34.582 1.00 0.00 ?  431 ARG A HG3  1  
ATOM   1896   H  HD2  . ARG A  1 116 ? 11.107  9.173   -35.026 1.00 0.00 ?  431 ARG A HD2  1  
ATOM   1897   H  HD3  . ARG A  1 116 ? 10.929  9.450   -36.851 1.00 0.00 ?  431 ARG A HD3  1  
ATOM   1898   H  HE   . ARG A  1 116 ? 12.772  11.071  -36.747 1.00 0.00 ?  431 ARG A HE   1  
ATOM   1899   H  HH11 . ARG A  1 116 ? 14.900  11.442  -36.241 1.00 0.00 ?  431 ARG A HH11 1  
ATOM   1900   H  HH12 . ARG A  1 116 ? 15.300  11.285  -34.564 1.00 0.00 ?  431 ARG A HH12 1  
ATOM   1901   H  HH21 . ARG A  1 116 ? 12.724  9.488   -33.534 1.00 0.00 ?  431 ARG A HH21 1  
ATOM   1902   H  HH22 . ARG A  1 116 ? 14.185  10.163  -33.218 1.00 0.00 ?  431 ARG A HH22 1  
ATOM   1903   N  N    . GLY A  1 117 ? 9.472   9.073   -32.430 1.00 0.00 ?  432 GLY A N    1  
ATOM   1904   C  CA   . GLY A  1 117 ? 9.919   8.989   -31.102 1.00 0.00 ?  432 GLY A CA   1  
ATOM   1905   C  C    . GLY A  1 117 ? 8.923   9.113   -30.013 1.00 0.00 ?  432 GLY A C    1  
ATOM   1906   O  O    . GLY A  1 117 ? 8.078   8.272   -29.839 1.00 0.00 ?  432 GLY A O    1  
ATOM   1907   H  H    . GLY A  1 117 ? 9.600   8.244   -32.968 1.00 0.00 ?  432 GLY A H    1  
ATOM   1908   H  HA2  . GLY A  1 117 ? 10.426  8.051   -30.929 1.00 0.00 ?  432 GLY A HA2  1  
ATOM   1909   H  HA3  . GLY A  1 117 ? 10.581  9.821   -30.912 1.00 0.00 ?  432 GLY A HA3  1  
ATOM   1910   N  N    . ASN A  1 118 ? 9.195   10.084  -29.179 1.00 0.00 ?  433 ASN A N    1  
ATOM   1911   C  CA   . ASN A  1 118 ? 8.487   10.375  -28.004 1.00 0.00 ?  433 ASN A CA   1  
ATOM   1912   C  C    . ASN A  1 118 ? 7.485   11.548  -28.213 1.00 0.00 ?  433 ASN A C    1  
ATOM   1913   O  O    . ASN A  1 118 ? 6.854   12.109  -27.314 1.00 0.00 ?  433 ASN A O    1  
ATOM   1914   C  CB   . ASN A  1 118 ? 9.459   10.626  -26.799 1.00 0.00 ?  433 ASN A CB   1  
ATOM   1915   C  CG   . ASN A  1 118 ? 10.023  12.019  -26.661 1.00 0.00 ?  433 ASN A CG   1  
ATOM   1916   O  OD1  . ASN A  1 118 ? 10.596  12.511  -27.619 1.00 0.00 ?  433 ASN A OD1  1  
ATOM   1917   N  ND2  . ASN A  1 118 ? 10.045  12.629  -25.479 1.00 0.00 ?  433 ASN A ND2  1  
ATOM   1918   H  H    . ASN A  1 118 ? 10.058  10.566  -29.308 1.00 0.00 ?  433 ASN A H    1  
ATOM   1919   H  HA   . ASN A  1 118 ? 7.884   9.525   -27.722 1.00 0.00 ?  433 ASN A HA   1  
ATOM   1920   H  HB2  . ASN A  1 118 ? 8.775   10.319  -25.979 1.00 0.00 ?  433 ASN A HB2  1  
ATOM   1921   H  HB3  . ASN A  1 118 ? 10.301  9.903   -26.743 1.00 0.00 ?  433 ASN A HB3  1  
ATOM   1922   H  HD21 . ASN A  1 118 ? 9.613   12.183  -24.695 1.00 0.00 ?  433 ASN A HD21 1  
ATOM   1923   H  HD22 . ASN A  1 118 ? 10.705  13.374  -25.381 1.00 0.00 ?  433 ASN A HD22 1  
ATOM   1924   N  N    . LYS A  1 119 ? 7.131   11.831  -29.441 1.00 0.00 ?  434 LYS A N    1  
ATOM   1925   C  CA   . LYS A  1 119 ? 6.135   12.938  -29.730 1.00 0.00 ?  434 LYS A CA   1  
ATOM   1926   C  C    . LYS A  1 119 ? 5.122   12.367  -30.721 1.00 0.00 ?  434 LYS A C    1  
ATOM   1927   O  O    . LYS A  1 119 ? 5.409   11.373  -31.405 1.00 0.00 ?  434 LYS A O    1  
ATOM   1928   C  CB   . LYS A  1 119 ? 6.967   14.150  -30.403 1.00 0.00 ?  434 LYS A CB   1  
ATOM   1929   C  CG   . LYS A  1 119 ? 8.017   14.899  -29.477 1.00 0.00 ?  434 LYS A CG   1  
ATOM   1930   C  CD   . LYS A  1 119 ? 8.226   16.383  -29.841 1.00 0.00 ?  434 LYS A CD   1  
ATOM   1931   C  CE   . LYS A  1 119 ? 8.941   16.583  -31.128 1.00 0.00 ?  434 LYS A CE   1  
ATOM   1932   N  NZ   . LYS A  1 119 ? 10.225  16.065  -30.988 1.00 0.00 1  434 LYS A NZ   1  
ATOM   1933   H  H    . LYS A  1 119 ? 7.499   11.394  -30.258 1.00 0.00 ?  434 LYS A H    1  
ATOM   1934   H  HA   . LYS A  1 119 ? 5.653   13.255  -28.817 1.00 0.00 ?  434 LYS A HA   1  
ATOM   1935   H  HB2  . LYS A  1 119 ? 7.568   13.821  -31.278 1.00 0.00 ?  434 LYS A HB2  1  
ATOM   1936   H  HB3  . LYS A  1 119 ? 6.183   14.884  -30.688 1.00 0.00 ?  434 LYS A HB3  1  
ATOM   1937   H  HG2  . LYS A  1 119 ? 7.483   14.917  -28.503 1.00 0.00 ?  434 LYS A HG2  1  
ATOM   1938   H  HG3  . LYS A  1 119 ? 8.976   14.337  -29.463 1.00 0.00 ?  434 LYS A HG3  1  
ATOM   1939   H  HD2  . LYS A  1 119 ? 7.217   16.825  -29.697 1.00 0.00 ?  434 LYS A HD2  1  
ATOM   1940   H  HD3  . LYS A  1 119 ? 8.887   16.739  -29.021 1.00 0.00 ?  434 LYS A HD3  1  
ATOM   1941   H  HE2  . LYS A  1 119 ? 8.416   15.988  -31.906 1.00 0.00 ?  434 LYS A HE2  1  
ATOM   1942   H  HE3  . LYS A  1 119 ? 8.905   17.629  -31.501 1.00 0.00 ?  434 LYS A HE3  1  
ATOM   1943   H  HZ1  . LYS A  1 119 ? 10.175  15.042  -30.811 1.00 0.00 ?  434 LYS A HZ1  1  
ATOM   1944   H  HZ2  . LYS A  1 119 ? 10.760  16.591  -30.268 1.00 0.00 ?  434 LYS A HZ2  1  
ATOM   1945   H  HZ3  . LYS A  1 119 ? 10.816  16.154  -31.839 1.00 0.00 ?  434 LYS A HZ3  1  
ATOM   1946   N  N    . TYR A  1 120 ? 3.880   12.915  -30.697 1.00 0.00 ?  435 TYR A N    1  
ATOM   1947   C  CA   . TYR A  1 120 ? 2.848   12.404  -31.612 1.00 0.00 ?  435 TYR A CA   1  
ATOM   1948   C  C    . TYR A  1 120 ? 2.379   13.691  -32.312 1.00 0.00 ?  435 TYR A C    1  
ATOM   1949   O  O    . TYR A  1 120 ? 2.113   14.669  -31.630 1.00 0.00 ?  435 TYR A O    1  
ATOM   1950   C  CB   . TYR A  1 120 ? 1.736   11.581  -31.048 1.00 0.00 ?  435 TYR A CB   1  
ATOM   1951   C  CG   . TYR A  1 120 ? 0.822   12.228  -30.038 1.00 0.00 ?  435 TYR A CG   1  
ATOM   1952   C  CD1  . TYR A  1 120 ? 1.305   12.922  -28.916 1.00 0.00 ?  435 TYR A CD1  1  
ATOM   1953   C  CD2  . TYR A  1 120 ? -0.611  11.962  -30.120 1.00 0.00 ?  435 TYR A CD2  1  
ATOM   1954   C  CE1  . TYR A  1 120 ? 0.423   13.387  -27.943 1.00 0.00 ?  435 TYR A CE1  1  
ATOM   1955   C  CE2  . TYR A  1 120 ? -1.452  12.356  -29.095 1.00 0.00 ?  435 TYR A CE2  1  
ATOM   1956   C  CZ   . TYR A  1 120 ? -0.949  13.057  -27.963 1.00 0.00 ?  435 TYR A CZ   1  
ATOM   1957   O  OH   . TYR A  1 120 ? -1.769  13.523  -26.935 1.00 0.00 ?  435 TYR A OH   1  
ATOM   1958   H  H    . TYR A  1 120 ? 3.511   13.623  -30.100 1.00 0.00 ?  435 TYR A H    1  
ATOM   1959   H  HA   . TYR A  1 120 ? 3.339   11.711  -32.278 1.00 0.00 ?  435 TYR A HA   1  
ATOM   1960   H  HB2  . TYR A  1 120 ? 1.225   10.991  -31.839 1.00 0.00 ?  435 TYR A HB2  1  
ATOM   1961   H  HB3  . TYR A  1 120 ? 2.089   10.743  -30.410 1.00 0.00 ?  435 TYR A HB3  1  
ATOM   1962   H  HD1  . TYR A  1 120 ? 2.346   13.029  -28.649 1.00 0.00 ?  435 TYR A HD1  1  
ATOM   1963   H  HD2  . TYR A  1 120 ? -0.929  11.360  -30.960 1.00 0.00 ?  435 TYR A HD2  1  
ATOM   1964   H  HE1  . TYR A  1 120 ? 0.770   13.877  -27.045 1.00 0.00 ?  435 TYR A HE1  1  
ATOM   1965   H  HE2  . TYR A  1 120 ? -2.508  12.224  -29.280 1.00 0.00 ?  435 TYR A HE2  1  
ATOM   1966   H  HH   . TYR A  1 120 ? -2.644  13.243  -27.213 1.00 0.00 ?  435 TYR A HH   1  
ATOM   1967   N  N    . TYR A  1 121 ? 2.283   13.744  -33.652 1.00 0.00 ?  436 TYR A N    1  
ATOM   1968   C  CA   . TYR A  1 121 ? 1.848   14.888  -34.474 1.00 0.00 ?  436 TYR A CA   1  
ATOM   1969   C  C    . TYR A  1 121 ? 0.492   14.506  -34.957 1.00 0.00 ?  436 TYR A C    1  
ATOM   1970   O  O    . TYR A  1 121 ? 0.274   13.359  -35.414 1.00 0.00 ?  436 TYR A O    1  
ATOM   1971   C  CB   . TYR A  1 121 ? 2.795   15.082  -35.682 1.00 0.00 ?  436 TYR A CB   1  
ATOM   1972   C  CG   . TYR A  1 121 ? 4.199   15.450  -35.269 1.00 0.00 ?  436 TYR A CG   1  
ATOM   1973   C  CD1  . TYR A  1 121 ? 4.697   16.739  -35.666 1.00 0.00 ?  436 TYR A CD1  1  
ATOM   1974   C  CD2  . TYR A  1 121 ? 5.064   14.555  -34.565 1.00 0.00 ?  436 TYR A CD2  1  
ATOM   1975   C  CE1  . TYR A  1 121 ? 6.079   17.025  -35.511 1.00 0.00 ?  436 TYR A CE1  1  
ATOM   1976   C  CE2  . TYR A  1 121 ? 6.344   14.994  -34.249 1.00 0.00 ?  436 TYR A CE2  1  
ATOM   1977   C  CZ   . TYR A  1 121 ? 6.879   16.147  -34.762 1.00 0.00 ?  436 TYR A CZ   1  
ATOM   1978   O  OH   . TYR A  1 121 ? 8.261   16.390  -34.560 1.00 0.00 ?  436 TYR A OH   1  
ATOM   1979   H  H    . TYR A  1 121 ? 2.343   12.888  -34.160 1.00 0.00 ?  436 TYR A H    1  
ATOM   1980   H  HA   . TYR A  1 121 ? 1.777   15.775  -33.862 1.00 0.00 ?  436 TYR A HA   1  
ATOM   1981   H  HB2  . TYR A  1 121 ? 2.923   14.138  -36.254 1.00 0.00 ?  436 TYR A HB2  1  
ATOM   1982   H  HB3  . TYR A  1 121 ? 2.460   15.847  -36.416 1.00 0.00 ?  436 TYR A HB3  1  
ATOM   1983   H  HD1  . TYR A  1 121 ? 4.060   17.436  -36.191 1.00 0.00 ?  436 TYR A HD1  1  
ATOM   1984   H  HD2  . TYR A  1 121 ? 4.654   13.629  -34.189 1.00 0.00 ?  436 TYR A HD2  1  
ATOM   1985   H  HE1  . TYR A  1 121 ? 6.539   17.928  -35.887 1.00 0.00 ?  436 TYR A HE1  1  
ATOM   1986   H  HE2  . TYR A  1 121 ? 7.001   14.366  -33.665 1.00 0.00 ?  436 TYR A HE2  1  
ATOM   1987   H  HH   . TYR A  1 121 ? 8.566   17.243  -34.876 1.00 0.00 ?  436 TYR A HH   1  
ATOM   1988   N  N    . ARG A  1 122 ? -0.468  15.452  -34.914 1.00 0.00 ?  437 ARG A N    1  
ATOM   1989   C  CA   . ARG A  1 122 ? -1.744  15.237  -35.654 1.00 0.00 ?  437 ARG A CA   1  
ATOM   1990   C  C    . ARG A  1 122 ? -1.741  15.818  -37.038 1.00 0.00 ?  437 ARG A C    1  
ATOM   1991   O  O    . ARG A  1 122 ? -1.425  16.958  -37.175 1.00 0.00 ?  437 ARG A O    1  
ATOM   1992   C  CB   . ARG A  1 122 ? -3.067  15.627  -34.913 1.00 0.00 ?  437 ARG A CB   1  
ATOM   1993   C  CG   . ARG A  1 122 ? -4.305  15.011  -35.545 1.00 0.00 ?  437 ARG A CG   1  
ATOM   1994   C  CD   . ARG A  1 122 ? -5.489  15.132  -34.475 1.00 0.00 ?  437 ARG A CD   1  
ATOM   1995   N  NE   . ARG A  1 122 ? -5.960  16.567  -34.365 1.00 0.00 ?  437 ARG A NE   1  
ATOM   1996   C  CZ   . ARG A  1 122 ? -6.500  17.061  -33.257 1.00 0.00 ?  437 ARG A CZ   1  
ATOM   1997   N  NH1  . ARG A  1 122 ? -6.785  16.462  -32.190 1.00 0.00 1  437 ARG A NH1  1  
ATOM   1998   N  NH2  . ARG A  1 122 ? -6.652  18.349  -33.133 1.00 0.00 ?  437 ARG A NH2  1  
ATOM   1999   H  H    . ARG A  1 122 ? -0.357  16.268  -34.353 1.00 0.00 ?  437 ARG A H    1  
ATOM   2000   H  HA   . ARG A  1 122 ? -1.851  14.171  -35.793 1.00 0.00 ?  437 ARG A HA   1  
ATOM   2001   H  HB2  . ARG A  1 122 ? -2.971  15.356  -33.840 1.00 0.00 ?  437 ARG A HB2  1  
ATOM   2002   H  HB3  . ARG A  1 122 ? -3.080  16.737  -34.946 1.00 0.00 ?  437 ARG A HB3  1  
ATOM   2003   H  HG2  . ARG A  1 122 ? -4.409  15.381  -36.587 1.00 0.00 ?  437 ARG A HG2  1  
ATOM   2004   H  HG3  . ARG A  1 122 ? -4.020  13.939  -35.596 1.00 0.00 ?  437 ARG A HG3  1  
ATOM   2005   H  HD2  . ARG A  1 122 ? -6.284  14.429  -34.805 1.00 0.00 ?  437 ARG A HD2  1  
ATOM   2006   H  HD3  . ARG A  1 122 ? -5.154  14.699  -33.508 1.00 0.00 ?  437 ARG A HD3  1  
ATOM   2007   H  HE   . ARG A  1 122 ? -5.811  17.260  -35.070 1.00 0.00 ?  437 ARG A HE   1  
ATOM   2008   H  HH11 . ARG A  1 122 ? -6.919  15.477  -32.295 1.00 0.00 ?  437 ARG A HH11 1  
ATOM   2009   H  HH12 . ARG A  1 122 ? -7.505  16.873  -31.630 1.00 0.00 ?  437 ARG A HH12 1  
ATOM   2010   H  HH21 . ARG A  1 122 ? -6.279  18.946  -33.843 1.00 0.00 ?  437 ARG A HH21 1  
ATOM   2011   H  HH22 . ARG A  1 122 ? -6.755  18.770  -32.232 1.00 0.00 ?  437 ARG A HH22 1  
ATOM   2012   N  N    . PHE A  1 123 ? -2.016  15.026  -38.104 1.00 0.00 ?  438 PHE A N    1  
ATOM   2013   C  CA   . PHE A  1 123 ? -2.146  15.586  -39.416 1.00 0.00 ?  438 PHE A CA   1  
ATOM   2014   C  C    . PHE A  1 123 ? -3.508  16.231  -39.597 1.00 0.00 ?  438 PHE A C    1  
ATOM   2015   O  O    . PHE A  1 123 ? -4.482  15.857  -39.017 1.00 0.00 ?  438 PHE A O    1  
ATOM   2016   C  CB   . PHE A  1 123 ? -1.798  14.518  -40.534 1.00 0.00 ?  438 PHE A CB   1  
ATOM   2017   C  CG   . PHE A  1 123 ? -1.889  14.996  -41.961 1.00 0.00 ?  438 PHE A CG   1  
ATOM   2018   C  CD1  . PHE A  1 123 ? -1.121  16.178  -42.354 1.00 0.00 ?  438 PHE A CD1  1  
ATOM   2019   C  CD2  . PHE A  1 123 ? -2.558  14.227  -42.906 1.00 0.00 ?  438 PHE A CD2  1  
ATOM   2020   C  CE1  . PHE A  1 123 ? -1.050  16.471  -43.730 1.00 0.00 ?  438 PHE A CE1  1  
ATOM   2021   C  CE2  . PHE A  1 123 ? -2.461  14.591  -44.260 1.00 0.00 ?  438 PHE A CE2  1  
ATOM   2022   C  CZ   . PHE A  1 123 ? -1.757  15.680  -44.671 1.00 0.00 ?  438 PHE A CZ   1  
ATOM   2023   H  H    . PHE A  1 123 ? -2.312  14.079  -38.012 1.00 0.00 ?  438 PHE A H    1  
ATOM   2024   H  HA   . PHE A  1 123 ? -1.429  16.394  -39.394 1.00 0.00 ?  438 PHE A HA   1  
ATOM   2025   H  HB2  . PHE A  1 123 ? -0.740  14.300  -40.272 1.00 0.00 ?  438 PHE A HB2  1  
ATOM   2026   H  HB3  . PHE A  1 123 ? -2.398  13.590  -40.418 1.00 0.00 ?  438 PHE A HB3  1  
ATOM   2027   H  HD1  . PHE A  1 123 ? -0.636  16.756  -41.580 1.00 0.00 ?  438 PHE A HD1  1  
ATOM   2028   H  HD2  . PHE A  1 123 ? -3.177  13.354  -42.762 1.00 0.00 ?  438 PHE A HD2  1  
ATOM   2029   H  HE1  . PHE A  1 123 ? -0.464  17.312  -44.071 1.00 0.00 ?  438 PHE A HE1  1  
ATOM   2030   H  HE2  . PHE A  1 123 ? -2.975  13.962  -44.972 1.00 0.00 ?  438 PHE A HE2  1  
ATOM   2031   H  HZ   . PHE A  1 123 ? -1.798  15.932  -45.720 1.00 0.00 ?  438 PHE A HZ   1  
ATOM   2032   N  N    . ASN A  1 124 ? -3.650  17.254  -40.468 1.00 0.00 ?  439 ASN A N    1  
ATOM   2033   C  CA   . ASN A  1 124 ? -4.877  17.963  -40.845 1.00 0.00 ?  439 ASN A CA   1  
ATOM   2034   C  C    . ASN A  1 124 ? -4.870  17.973  -42.421 1.00 0.00 ?  439 ASN A C    1  
ATOM   2035   O  O    . ASN A  1 124 ? -4.069  18.688  -43.066 1.00 0.00 ?  439 ASN A O    1  
ATOM   2036   C  CB   . ASN A  1 124 ? -4.868  19.399  -40.213 1.00 0.00 ?  439 ASN A CB   1  
ATOM   2037   C  CG   . ASN A  1 124 ? -6.261  20.020  -40.348 1.00 0.00 ?  439 ASN A CG   1  
ATOM   2038   O  OD1  . ASN A  1 124 ? -7.129  19.534  -41.080 1.00 0.00 ?  439 ASN A OD1  1  
ATOM   2039   N  ND2  . ASN A  1 124 ? -6.583  20.969  -39.439 1.00 0.00 ?  439 ASN A ND2  1  
ATOM   2040   H  H    . ASN A  1 124 ? -2.836  17.620  -40.912 1.00 0.00 ?  439 ASN A H    1  
ATOM   2041   H  HA   . ASN A  1 124 ? -5.761  17.437  -40.517 1.00 0.00 ?  439 ASN A HA   1  
ATOM   2042   H  HB2  . ASN A  1 124 ? -4.515  19.360  -39.160 1.00 0.00 ?  439 ASN A HB2  1  
ATOM   2043   H  HB3  . ASN A  1 124 ? -4.170  20.085  -40.739 1.00 0.00 ?  439 ASN A HB3  1  
ATOM   2044   H  HD21 . ASN A  1 124 ? -7.522  21.312  -39.399 1.00 0.00 ?  439 ASN A HD21 1  
ATOM   2045   H  HD22 . ASN A  1 124 ? -5.950  21.177  -38.694 1.00 0.00 ?  439 ASN A HD22 1  
ATOM   2046   N  N    . GLU A  1 125 ? -5.807  17.276  -43.059 1.00 0.00 ?  440 GLU A N    1  
ATOM   2047   C  CA   . GLU A  1 125 ? -5.985  17.382  -44.485 1.00 0.00 ?  440 GLU A CA   1  
ATOM   2048   C  C    . GLU A  1 125 ? -6.285  18.722  -45.012 1.00 0.00 ?  440 GLU A C    1  
ATOM   2049   O  O    . GLU A  1 125 ? -5.880  19.081  -46.064 1.00 0.00 ?  440 GLU A O    1  
ATOM   2050   C  CB   . GLU A  1 125 ? -6.958  16.357  -45.065 1.00 0.00 ?  440 GLU A CB   1  
ATOM   2051   C  CG   . GLU A  1 125 ? -6.329  14.952  -44.995 1.00 0.00 ?  440 GLU A CG   1  
ATOM   2052   C  CD   . GLU A  1 125 ? -7.201  13.874  -45.588 1.00 0.00 ?  440 GLU A CD   1  
ATOM   2053   O  OE1  . GLU A  1 125 ? -7.643  12.991  -44.869 1.00 0.00 ?  440 GLU A OE1  1  
ATOM   2054   O  OE2  . GLU A  1 125 ? -7.412  13.886  -46.861 1.00 0.00 -1 440 GLU A OE2  1  
ATOM   2055   H  H    . GLU A  1 125 ? -6.345  16.586  -42.580 1.00 0.00 ?  440 GLU A H    1  
ATOM   2056   H  HA   . GLU A  1 125 ? -5.000  17.205  -44.889 1.00 0.00 ?  440 GLU A HA   1  
ATOM   2057   H  HB2  . GLU A  1 125 ? -7.957  16.463  -44.590 1.00 0.00 ?  440 GLU A HB2  1  
ATOM   2058   H  HB3  . GLU A  1 125 ? -7.181  16.673  -46.107 1.00 0.00 ?  440 GLU A HB3  1  
ATOM   2059   H  HG2  . GLU A  1 125 ? -5.338  14.939  -45.497 1.00 0.00 ?  440 GLU A HG2  1  
ATOM   2060   H  HG3  . GLU A  1 125 ? -6.241  14.621  -43.938 1.00 0.00 ?  440 GLU A HG3  1  
ATOM   2061   N  N    . GLU A  1 126 ? -7.107  19.459  -44.283 1.00 0.00 ?  441 GLU A N    1  
ATOM   2062   C  CA   . GLU A  1 126 ? -7.726  20.696  -44.936 1.00 0.00 ?  441 GLU A CA   1  
ATOM   2063   C  C    . GLU A  1 126 ? -6.745  21.845  -45.044 1.00 0.00 ?  441 GLU A C    1  
ATOM   2064   O  O    . GLU A  1 126 ? -6.910  22.771  -45.832 1.00 0.00 ?  441 GLU A O    1  
ATOM   2065   C  CB   . GLU A  1 126 ? -8.823  21.384  -43.995 1.00 0.00 ?  441 GLU A CB   1  
ATOM   2066   C  CG   . GLU A  1 126 ? -9.923  20.361  -43.622 1.00 0.00 ?  441 GLU A CG   1  
ATOM   2067   C  CD   . GLU A  1 126 ? -11.087 20.970  -42.812 1.00 0.00 ?  441 GLU A CD   1  
ATOM   2068   O  OE1  . GLU A  1 126 ? -10.837 21.621  -41.739 1.00 0.00 ?  441 GLU A OE1  1  
ATOM   2069   O  OE2  . GLU A  1 126 ? -12.198 20.881  -43.260 1.00 0.00 -1 441 GLU A OE2  1  
ATOM   2070   H  H    . GLU A  1 126 ? -7.432  19.304  -43.353 1.00 0.00 ?  441 GLU A H    1  
ATOM   2071   H  HA   . GLU A  1 126 ? -8.141  20.517  -45.917 1.00 0.00 ?  441 GLU A HA   1  
ATOM   2072   H  HB2  . GLU A  1 126 ? -8.340  21.671  -43.037 1.00 0.00 ?  441 GLU A HB2  1  
ATOM   2073   H  HB3  . GLU A  1 126 ? -9.228  22.269  -44.530 1.00 0.00 ?  441 GLU A HB3  1  
ATOM   2074   H  HG2  . GLU A  1 126 ? -10.319 19.807  -44.499 1.00 0.00 ?  441 GLU A HG2  1  
ATOM   2075   H  HG3  . GLU A  1 126 ? -9.416  19.605  -42.984 1.00 0.00 ?  441 GLU A HG3  1  
ATOM   2076   N  N    . LEU A  1 127 ? -5.733  21.753  -44.242 1.00 0.00 ?  442 LEU A N    1  
ATOM   2077   C  CA   . LEU A  1 127 ? -4.660  22.674  -44.251 1.00 0.00 ?  442 LEU A CA   1  
ATOM   2078   C  C    . LEU A  1 127 ? -3.354  22.049  -44.802 1.00 0.00 ?  442 LEU A C    1  
ATOM   2079   O  O    . LEU A  1 127 ? -2.371  22.727  -45.129 1.00 0.00 ?  442 LEU A O    1  
ATOM   2080   C  CB   . LEU A  1 127 ? -4.345  23.286  -42.816 1.00 0.00 ?  442 LEU A CB   1  
ATOM   2081   C  CG   . LEU A  1 127 ? -5.474  23.761  -41.883 1.00 0.00 ?  442 LEU A CG   1  
ATOM   2082   C  CD1  . LEU A  1 127 ? -5.033  24.445  -40.515 1.00 0.00 ?  442 LEU A CD1  1  
ATOM   2083   C  CD2  . LEU A  1 127 ? -6.302  24.779  -42.658 1.00 0.00 ?  442 LEU A CD2  1  
ATOM   2084   H  H    . LEU A  1 127 ? -5.694  21.030  -43.557 1.00 0.00 ?  442 LEU A H    1  
ATOM   2085   H  HA   . LEU A  1 127 ? -4.795  23.558  -44.858 1.00 0.00 ?  442 LEU A HA   1  
ATOM   2086   H  HB2  . LEU A  1 127 ? -3.612  22.657  -42.267 1.00 0.00 ?  442 LEU A HB2  1  
ATOM   2087   H  HB3  . LEU A  1 127 ? -3.758  24.195  -43.065 1.00 0.00 ?  442 LEU A HB3  1  
ATOM   2088   H  HG   . LEU A  1 127 ? -6.163  22.983  -41.489 1.00 0.00 ?  442 LEU A HG   1  
ATOM   2089   H  HD11 . LEU A  1 127 ? -5.996  24.638  -39.996 1.00 0.00 ?  442 LEU A HD11 1  
ATOM   2090   H  HD12 . LEU A  1 127 ? -4.495  25.372  -40.809 1.00 0.00 ?  442 LEU A HD12 1  
ATOM   2091   H  HD13 . LEU A  1 127 ? -4.467  23.693  -39.924 1.00 0.00 ?  442 LEU A HD13 1  
ATOM   2092   H  HD21 . LEU A  1 127 ? -5.639  25.572  -43.067 1.00 0.00 ?  442 LEU A HD21 1  
ATOM   2093   H  HD22 . LEU A  1 127 ? -7.057  25.250  -41.992 1.00 0.00 ?  442 LEU A HD22 1  
ATOM   2094   H  HD23 . LEU A  1 127 ? -6.826  24.298  -43.511 1.00 0.00 ?  442 LEU A HD23 1  
ATOM   2095   N  N    . ARG A  1 128 ? -3.327  20.769  -45.097 1.00 0.00 ?  443 ARG A N    1  
ATOM   2096   C  CA   . ARG A  1 128 ? -2.173  19.981  -45.554 1.00 0.00 ?  443 ARG A CA   1  
ATOM   2097   C  C    . ARG A  1 128 ? -0.977  20.079  -44.668 1.00 0.00 ?  443 ARG A C    1  
ATOM   2098   O  O    . ARG A  1 128 ? 0.143   20.215  -45.122 1.00 0.00 ?  443 ARG A O    1  
ATOM   2099   C  CB   . ARG A  1 128 ? -1.926  20.015  -47.058 1.00 0.00 ?  443 ARG A CB   1  
ATOM   2100   C  CG   . ARG A  1 128 ? -3.161  19.533  -47.864 1.00 0.00 ?  443 ARG A CG   1  
ATOM   2101   C  CD   . ARG A  1 128 ? -2.985  19.738  -49.336 1.00 0.00 ?  443 ARG A CD   1  
ATOM   2102   N  NE   . ARG A  1 128 ? -2.690  21.164  -49.666 1.00 0.00 ?  443 ARG A NE   1  
ATOM   2103   C  CZ   . ARG A  1 128 ? -2.038  21.624  -50.735 1.00 0.00 ?  443 ARG A CZ   1  
ATOM   2104   N  NH1  . ARG A  1 128 ? -1.813  22.908  -50.856 1.00 0.00 1  443 ARG A NH1  1  
ATOM   2105   N  NH2  . ARG A  1 128 ? -1.550  20.823  -51.629 1.00 0.00 ?  443 ARG A NH2  1  
ATOM   2106   H  H    . ARG A  1 128 ? -4.219  20.334  -45.184 1.00 0.00 ?  443 ARG A H    1  
ATOM   2107   H  HA   . ARG A  1 128 ? -2.453  18.953  -45.382 1.00 0.00 ?  443 ARG A HA   1  
ATOM   2108   H  HB2  . ARG A  1 128 ? -1.681  21.053  -47.367 1.00 0.00 ?  443 ARG A HB2  1  
ATOM   2109   H  HB3  . ARG A  1 128 ? -1.062  19.328  -47.187 1.00 0.00 ?  443 ARG A HB3  1  
ATOM   2110   H  HG2  . ARG A  1 128 ? -3.299  18.454  -47.639 1.00 0.00 ?  443 ARG A HG2  1  
ATOM   2111   H  HG3  . ARG A  1 128 ? -4.105  20.098  -47.710 1.00 0.00 ?  443 ARG A HG3  1  
ATOM   2112   H  HD2  . ARG A  1 128 ? -2.128  19.129  -49.694 1.00 0.00 ?  443 ARG A HD2  1  
ATOM   2113   H  HD3  . ARG A  1 128 ? -3.851  19.377  -49.932 1.00 0.00 ?  443 ARG A HD3  1  
ATOM   2114   H  HE   . ARG A  1 128 ? -3.097  21.805  -49.016 1.00 0.00 ?  443 ARG A HE   1  
ATOM   2115   H  HH11 . ARG A  1 128 ? -2.360  23.479  -50.244 1.00 0.00 ?  443 ARG A HH11 1  
ATOM   2116   H  HH12 . ARG A  1 128 ? -1.593  23.267  -51.763 1.00 0.00 ?  443 ARG A HH12 1  
ATOM   2117   H  HH21 . ARG A  1 128 ? -1.789  19.852  -51.599 1.00 0.00 ?  443 ARG A HH21 1  
ATOM   2118   H  HH22 . ARG A  1 128 ? -1.203  21.146  -52.509 1.00 0.00 ?  443 ARG A HH22 1  
ATOM   2119   N  N    . ALA A  1 129 ? -1.179  20.012  -43.354 1.00 0.00 ?  444 ALA A N    1  
ATOM   2120   C  CA   . ALA A  1 129 ? -0.147  20.381  -42.391 1.00 0.00 ?  444 ALA A CA   1  
ATOM   2121   C  C    . ALA A  1 129 ? -0.402  19.743  -41.009 1.00 0.00 ?  444 ALA A C    1  
ATOM   2122   O  O    . ALA A  1 129 ? -1.514  19.214  -40.836 1.00 0.00 ?  444 ALA A O    1  
ATOM   2123   C  CB   . ALA A  1 129 ? -0.072  21.885  -42.272 1.00 0.00 ?  444 ALA A CB   1  
ATOM   2124   H  H    . ALA A  1 129 ? -2.022  19.710  -42.916 1.00 0.00 ?  444 ALA A H    1  
ATOM   2125   H  HA   . ALA A  1 129 ? 0.715   19.857  -42.779 1.00 0.00 ?  444 ALA A HA   1  
ATOM   2126   H  HB1  . ALA A  1 129 ? -1.078  22.302  -42.049 1.00 0.00 ?  444 ALA A HB1  1  
ATOM   2127   H  HB2  . ALA A  1 129 ? 0.161   22.341  -43.258 1.00 0.00 ?  444 ALA A HB2  1  
ATOM   2128   H  HB3  . ALA A  1 129 ? 0.625   22.212  -41.471 1.00 0.00 ?  444 ALA A HB3  1  
ATOM   2129   N  N    . VAL A  1 130 ? 0.562   19.794  -40.079 1.00 0.00 ?  445 VAL A N    1  
ATOM   2130   C  CA   . VAL A  1 130 ? 0.479   19.518  -38.667 1.00 0.00 ?  445 VAL A CA   1  
ATOM   2131   C  C    . VAL A  1 130 ? -0.537  20.403  -38.069 1.00 0.00 ?  445 VAL A C    1  
ATOM   2132   O  O    . VAL A  1 130 ? -0.687  21.615  -38.209 1.00 0.00 ?  445 VAL A O    1  
ATOM   2133   C  CB   . VAL A  1 130 ? 1.798   19.563  -37.889 1.00 0.00 ?  445 VAL A CB   1  
ATOM   2134   C  CG1  . VAL A  1 130 ? 2.403   20.955  -37.847 1.00 0.00 ?  445 VAL A CG1  1  
ATOM   2135   C  CG2  . VAL A  1 130 ? 1.585   18.914  -36.538 1.00 0.00 ?  445 VAL A CG2  1  
ATOM   2136   H  H    . VAL A  1 130 ? 1.351   20.369  -40.284 1.00 0.00 ?  445 VAL A H    1  
ATOM   2137   H  HA   . VAL A  1 130 ? -0.010  18.558  -38.593 1.00 0.00 ?  445 VAL A HA   1  
ATOM   2138   H  HB   . VAL A  1 130 ? 2.575   18.986  -38.435 1.00 0.00 ?  445 VAL A HB   1  
ATOM   2139   H  HG11 . VAL A  1 130 ? 2.556   21.317  -38.887 1.00 0.00 ?  445 VAL A HG11 1  
ATOM   2140   H  HG12 . VAL A  1 130 ? 3.406   20.873  -37.378 1.00 0.00 ?  445 VAL A HG12 1  
ATOM   2141   H  HG13 . VAL A  1 130 ? 1.775   21.716  -37.338 1.00 0.00 ?  445 VAL A HG13 1  
ATOM   2142   H  HG21 . VAL A  1 130 ? 1.240   17.869  -36.688 1.00 0.00 ?  445 VAL A HG21 1  
ATOM   2143   H  HG22 . VAL A  1 130 ? 0.864   19.484  -35.914 1.00 0.00 ?  445 VAL A HG22 1  
ATOM   2144   H  HG23 . VAL A  1 130 ? 2.494   18.941  -35.900 1.00 0.00 ?  445 VAL A HG23 1  
ATOM   2145   N  N    . ASP A  1 131 ? -1.353  19.691  -37.294 1.00 0.00 ?  446 ASP A N    1  
ATOM   2146   C  CA   . ASP A  1 131 ? -2.523  20.354  -36.748 1.00 0.00 ?  446 ASP A CA   1  
ATOM   2147   C  C    . ASP A  1 131 ? -2.200  21.307  -35.608 1.00 0.00 ?  446 ASP A C    1  
ATOM   2148   O  O    . ASP A  1 131 ? -1.152  21.174  -34.947 1.00 0.00 ?  446 ASP A O    1  
ATOM   2149   C  CB   . ASP A  1 131 ? -3.503  19.288  -36.300 1.00 0.00 ?  446 ASP A CB   1  
ATOM   2150   C  CG   . ASP A  1 131 ? -4.919  19.833  -36.317 1.00 0.00 ?  446 ASP A CG   1  
ATOM   2151   O  OD1  . ASP A  1 131 ? -5.305  20.920  -36.833 1.00 0.00 ?  446 ASP A OD1  1  
ATOM   2152   O  OD2  . ASP A  1 131 ? -5.794  19.064  -35.892 1.00 0.00 -1 446 ASP A OD2  1  
ATOM   2153   H  H    . ASP A  1 131 ? -1.326  18.728  -37.037 1.00 0.00 ?  446 ASP A H    1  
ATOM   2154   H  HA   . ASP A  1 131 ? -2.955  20.899  -37.575 1.00 0.00 ?  446 ASP A HA   1  
ATOM   2155   H  HB2  . ASP A  1 131 ? -3.636  18.415  -36.973 1.00 0.00 ?  446 ASP A HB2  1  
ATOM   2156   H  HB3  . ASP A  1 131 ? -3.160  19.039  -35.273 1.00 0.00 ?  446 ASP A HB3  1  
ATOM   2157   N  N    . SER A  1 132 ? -3.111  22.284  -35.395 1.00 0.00 ?  447 SER A N    1  
ATOM   2158   C  CA   . SER A  1 132 ? -3.166  23.228  -34.227 1.00 0.00 ?  447 SER A CA   1  
ATOM   2159   C  C    . SER A  1 132 ? -2.720  22.645  -32.852 1.00 0.00 ?  447 SER A C    1  
ATOM   2160   O  O    . SER A  1 132 ? -3.323  21.631  -32.365 1.00 0.00 ?  447 SER A O    1  
ATOM   2161   C  CB   . SER A  1 132 ? -4.482  24.028  -34.130 1.00 0.00 ?  447 SER A CB   1  
ATOM   2162   O  OG   . SER A  1 132 ? -4.422  25.061  -33.214 1.00 0.00 ?  447 SER A OG   1  
ATOM   2163   H  H    . SER A  1 132 ? -3.932  22.261  -35.961 1.00 0.00 ?  447 SER A H    1  
ATOM   2164   H  HA   . SER A  1 132 ? -2.413  23.963  -34.473 1.00 0.00 ?  447 SER A HA   1  
ATOM   2165   H  HB2  . SER A  1 132 ? -4.785  24.365  -35.144 1.00 0.00 ?  447 SER A HB2  1  
ATOM   2166   H  HB3  . SER A  1 132 ? -5.343  23.359  -33.918 1.00 0.00 ?  447 SER A HB3  1  
ATOM   2167   H  HG   . SER A  1 132 ? -5.263  25.516  -33.295 1.00 0.00 ?  447 SER A HG   1  
ATOM   2168   N  N    . GLU A  1 133 ? -1.722  23.340  -32.295 1.00 0.00 ?  448 GLU A N    1  
ATOM   2169   C  CA   . GLU A  1 133 ? -1.017  22.994  -31.060 1.00 0.00 ?  448 GLU A CA   1  
ATOM   2170   C  C    . GLU A  1 133 ? -0.026  21.805  -31.015 1.00 0.00 ?  448 GLU A C    1  
ATOM   2171   O  O    . GLU A  1 133 ? 0.655   21.663  -30.017 1.00 0.00 ?  448 GLU A O    1  
ATOM   2172   C  CB   . GLU A  1 133 ? -1.964  23.085  -29.807 1.00 0.00 ?  448 GLU A CB   1  
ATOM   2173   C  CG   . GLU A  1 133 ? -2.541  24.544  -29.692 1.00 0.00 ?  448 GLU A CG   1  
ATOM   2174   C  CD   . GLU A  1 133 ? -3.528  24.615  -28.507 1.00 0.00 ?  448 GLU A CD   1  
ATOM   2175   O  OE1  . GLU A  1 133 ? -3.147  24.378  -27.337 1.00 0.00 ?  448 GLU A OE1  1  
ATOM   2176   O  OE2  . GLU A  1 133 ? -4.657  24.987  -28.760 1.00 0.00 -1 448 GLU A OE2  1  
ATOM   2177   H  H    . GLU A  1 133 ? -1.719  24.289  -32.598 1.00 0.00 ?  448 GLU A H    1  
ATOM   2178   H  HA   . GLU A  1 133 ? -0.302  23.716  -30.693 1.00 0.00 ?  448 GLU A HA   1  
ATOM   2179   H  HB2  . GLU A  1 133 ? -2.779  22.365  -30.033 1.00 0.00 ?  448 GLU A HB2  1  
ATOM   2180   H  HB3  . GLU A  1 133 ? -1.359  22.781  -28.926 1.00 0.00 ?  448 GLU A HB3  1  
ATOM   2181   H  HG2  . GLU A  1 133 ? -1.725  25.148  -29.238 1.00 0.00 ?  448 GLU A HG2  1  
ATOM   2182   H  HG3  . GLU A  1 133 ? -3.011  25.017  -30.580 1.00 0.00 ?  448 GLU A HG3  1  
ATOM   2183   N  N    . TYR A  1 134 ? 0.001   20.907  -32.061 1.00 0.00 ?  449 TYR A N    1  
ATOM   2184   C  CA   . TYR A  1 134 ? 0.847   19.791  -32.273 1.00 0.00 ?  449 TYR A CA   1  
ATOM   2185   C  C    . TYR A  1 134 ? 2.234   20.206  -32.713 1.00 0.00 ?  449 TYR A C    1  
ATOM   2186   O  O    . TYR A  1 134 ? 2.458   21.364  -33.110 1.00 0.00 ?  449 TYR A O    1  
ATOM   2187   C  CB   . TYR A  1 134 ? 0.237   18.757  -33.253 1.00 0.00 ?  449 TYR A CB   1  
ATOM   2188   C  CG   . TYR A  1 134 ? -0.904  18.103  -32.520 1.00 0.00 ?  449 TYR A CG   1  
ATOM   2189   C  CD1  . TYR A  1 134 ? -0.722  16.821  -31.962 1.00 0.00 ?  449 TYR A CD1  1  
ATOM   2190   C  CD2  . TYR A  1 134 ? -2.195  18.713  -32.405 1.00 0.00 ?  449 TYR A CD2  1  
ATOM   2191   C  CE1  . TYR A  1 134 ? -1.790  16.219  -31.239 1.00 0.00 ?  449 TYR A CE1  1  
ATOM   2192   C  CE2  . TYR A  1 134 ? -3.158  18.114  -31.620 1.00 0.00 ?  449 TYR A CE2  1  
ATOM   2193   C  CZ   . TYR A  1 134 ? -2.950  16.889  -30.982 1.00 0.00 ?  449 TYR A CZ   1  
ATOM   2194   O  OH   . TYR A  1 134 ? -3.879  16.410  -30.028 1.00 0.00 ?  449 TYR A OH   1  
ATOM   2195   H  H    . TYR A  1 134 ? -0.662  21.007  -32.800 1.00 0.00 ?  449 TYR A H    1  
ATOM   2196   H  HA   . TYR A  1 134 ? 1.094   19.327  -31.330 1.00 0.00 ?  449 TYR A HA   1  
ATOM   2197   H  HB2  . TYR A  1 134 ? -0.094  19.194  -34.219 1.00 0.00 ?  449 TYR A HB2  1  
ATOM   2198   H  HB3  . TYR A  1 134 ? 1.031   18.030  -33.529 1.00 0.00 ?  449 TYR A HB3  1  
ATOM   2199   H  HD1  . TYR A  1 134 ? 0.188   16.240  -31.960 1.00 0.00 ?  449 TYR A HD1  1  
ATOM   2200   H  HD2  . TYR A  1 134 ? -2.453  19.654  -32.867 1.00 0.00 ?  449 TYR A HD2  1  
ATOM   2201   H  HE1  . TYR A  1 134 ? -1.535  15.322  -30.694 1.00 0.00 ?  449 TYR A HE1  1  
ATOM   2202   H  HE2  . TYR A  1 134 ? -4.068  18.662  -31.425 1.00 0.00 ?  449 TYR A HE2  1  
ATOM   2203   H  HH   . TYR A  1 134 ? -4.550  17.096  -30.000 1.00 0.00 ?  449 TYR A HH   1  
ATOM   2204   N  N    . PRO A  1 135 ? 3.255   19.300  -32.661 1.00 0.00 ?  450 PRO A N    1  
ATOM   2205   C  CA   . PRO A  1 135 ? 3.391   18.131  -31.765 1.00 0.00 ?  450 PRO A CA   1  
ATOM   2206   C  C    . PRO A  1 135 ? 3.192   18.274  -30.231 1.00 0.00 ?  450 PRO A C    1  
ATOM   2207   O  O    . PRO A  1 135 ? 3.350   19.349  -29.644 1.00 0.00 ?  450 PRO A O    1  
ATOM   2208   C  CB   . PRO A  1 135 ? 4.788   17.593  -32.097 1.00 0.00 ?  450 PRO A CB   1  
ATOM   2209   C  CG   . PRO A  1 135 ? 5.581   18.829  -32.380 1.00 0.00 ?  450 PRO A CG   1  
ATOM   2210   C  CD   . PRO A  1 135 ? 4.573   19.690  -33.059 1.00 0.00 ?  450 PRO A CD   1  
ATOM   2211   H  HA   . PRO A  1 135 ? 2.619   17.491  -32.167 1.00 0.00 ?  450 PRO A HA   1  
ATOM   2212   H  HB2  . PRO A  1 135 ? 5.221   16.887  -31.356 1.00 0.00 ?  450 PRO A HB2  1  
ATOM   2213   H  HB3  . PRO A  1 135 ? 4.728   17.063  -33.072 1.00 0.00 ?  450 PRO A HB3  1  
ATOM   2214   H  HG2  . PRO A  1 135 ? 5.963   19.256  -31.428 1.00 0.00 ?  450 PRO A HG2  1  
ATOM   2215   H  HG3  . PRO A  1 135 ? 6.432   18.738  -33.087 1.00 0.00 ?  450 PRO A HG3  1  
ATOM   2216   H  HD2  . PRO A  1 135 ? 4.839   20.750  -32.858 1.00 0.00 ?  450 PRO A HD2  1  
ATOM   2217   H  HD3  . PRO A  1 135 ? 4.569   19.361  -34.121 1.00 0.00 ?  450 PRO A HD3  1  
ATOM   2218   N  N    . LYS A  1 136 ? 2.818   17.150  -29.657 1.00 0.00 ?  451 LYS A N    1  
ATOM   2219   C  CA   . LYS A  1 136 ? 2.543   17.060  -28.275 1.00 0.00 ?  451 LYS A CA   1  
ATOM   2220   C  C    . LYS A  1 136 ? 3.248   15.855  -27.799 1.00 0.00 ?  451 LYS A C    1  
ATOM   2221   O  O    . LYS A  1 136 ? 3.541   14.965  -28.615 1.00 0.00 ?  451 LYS A O    1  
ATOM   2222   C  CB   . LYS A  1 136 ? 1.035   16.904  -28.071 1.00 0.00 ?  451 LYS A CB   1  
ATOM   2223   C  CG   . LYS A  1 136 ? 0.232   18.218  -28.378 1.00 0.00 ?  451 LYS A CG   1  
ATOM   2224   C  CD   . LYS A  1 136 ? -1.172  18.099  -27.914 1.00 0.00 ?  451 LYS A CD   1  
ATOM   2225   C  CE   . LYS A  1 136 ? -2.010  19.386  -28.119 1.00 0.00 ?  451 LYS A CE   1  
ATOM   2226   N  NZ   . LYS A  1 136 ? -3.316  19.211  -27.382 1.00 0.00 1  451 LYS A NZ   1  
ATOM   2227   H  H    . LYS A  1 136 ? 2.771   16.293  -30.164 1.00 0.00 ?  451 LYS A H    1  
ATOM   2228   H  HA   . LYS A  1 136 ? 2.978   17.828  -27.652 1.00 0.00 ?  451 LYS A HA   1  
ATOM   2229   H  HB2  . LYS A  1 136 ? 0.589   16.082  -28.670 1.00 0.00 ?  451 LYS A HB2  1  
ATOM   2230   H  HB3  . LYS A  1 136 ? 0.872   16.614  -27.010 1.00 0.00 ?  451 LYS A HB3  1  
ATOM   2231   H  HG2  . LYS A  1 136 ? 0.787   19.049  -27.894 1.00 0.00 ?  451 LYS A HG2  1  
ATOM   2232   H  HG3  . LYS A  1 136 ? 0.296   18.402  -29.472 1.00 0.00 ?  451 LYS A HG3  1  
ATOM   2233   H  HD2  . LYS A  1 136 ? -1.570  17.154  -28.341 1.00 0.00 ?  451 LYS A HD2  1  
ATOM   2234   H  HD3  . LYS A  1 136 ? -1.122  17.959  -26.813 1.00 0.00 ?  451 LYS A HD3  1  
ATOM   2235   H  HE2  . LYS A  1 136 ? -1.474  20.292  -27.763 1.00 0.00 ?  451 LYS A HE2  1  
ATOM   2236   H  HE3  . LYS A  1 136 ? -2.220  19.439  -29.209 1.00 0.00 ?  451 LYS A HE3  1  
ATOM   2237   H  HZ1  . LYS A  1 136 ? -3.121  19.042  -26.375 1.00 0.00 ?  451 LYS A HZ1  1  
ATOM   2238   H  HZ2  . LYS A  1 136 ? -3.702  18.328  -27.773 1.00 0.00 ?  451 LYS A HZ2  1  
ATOM   2239   H  HZ3  . LYS A  1 136 ? -3.984  20.000  -27.495 1.00 0.00 ?  451 LYS A HZ3  1  
ATOM   2240   N  N    . ASN A  1 137 ? 3.634   15.800  -26.516 1.00 0.00 ?  452 ASN A N    1  
ATOM   2241   C  CA   . ASN A  1 137 ? 4.526   14.789  -25.923 1.00 0.00 ?  452 ASN A CA   1  
ATOM   2242   C  C    . ASN A  1 137 ? 3.697   13.562  -25.572 1.00 0.00 ?  452 ASN A C    1  
ATOM   2243   O  O    . ASN A  1 137 ? 2.671   13.631  -24.943 1.00 0.00 ?  452 ASN A O    1  
ATOM   2244   C  CB   . ASN A  1 137 ? 5.258   15.261  -24.680 1.00 0.00 ?  452 ASN A CB   1  
ATOM   2245   C  CG   . ASN A  1 137 ? 6.176   14.228  -24.002 1.00 0.00 ?  452 ASN A CG   1  
ATOM   2246   O  OD1  . ASN A  1 137 ? 5.836   13.386  -23.194 1.00 0.00 ?  452 ASN A OD1  1  
ATOM   2247   N  ND2  . ASN A  1 137 ? 7.499   14.320  -24.353 1.00 0.00 ?  452 ASN A ND2  1  
ATOM   2248   H  H    . ASN A  1 137 ? 3.377   16.530  -25.888 1.00 0.00 ?  452 ASN A H    1  
ATOM   2249   H  HA   . ASN A  1 137 ? 5.124   14.328  -26.695 1.00 0.00 ?  452 ASN A HA   1  
ATOM   2250   H  HB2  . ASN A  1 137 ? 5.810   16.187  -24.947 1.00 0.00 ?  452 ASN A HB2  1  
ATOM   2251   H  HB3  . ASN A  1 137 ? 4.583   15.602  -23.866 1.00 0.00 ?  452 ASN A HB3  1  
ATOM   2252   H  HD21 . ASN A  1 137 ? 7.722   14.908  -25.130 1.00 0.00 ?  452 ASN A HD21 1  
ATOM   2253   H  HD22 . ASN A  1 137 ? 8.152   13.674  -23.957 1.00 0.00 ?  452 ASN A HD22 1  
ATOM   2254   N  N    . ILE A  1 138 ? 4.298   12.404  -25.846 1.00 0.00 ?  453 ILE A N    1  
ATOM   2255   C  CA   . ILE A  1 138 ? 3.517   11.161  -25.859 1.00 0.00 ?  453 ILE A CA   1  
ATOM   2256   C  C    . ILE A  1 138 ? 3.015   10.710  -24.509 1.00 0.00 ?  453 ILE A C    1  
ATOM   2257   O  O    . ILE A  1 138 ? 2.204   9.864   -24.386 1.00 0.00 ?  453 ILE A O    1  
ATOM   2258   C  CB   . ILE A  1 138 ? 4.384   10.131  -26.493 1.00 0.00 ?  453 ILE A CB   1  
ATOM   2259   C  CG1  . ILE A  1 138 ? 3.536   8.911   -26.958 1.00 0.00 ?  453 ILE A CG1  1  
ATOM   2260   C  CG2  . ILE A  1 138 ? 5.451   9.565   -25.588 1.00 0.00 ?  453 ILE A CG2  1  
ATOM   2261   C  CD1  . ILE A  1 138 ? 4.098   8.157   -28.130 1.00 0.00 ?  453 ILE A CD1  1  
ATOM   2262   H  H    . ILE A  1 138 ? 5.228   12.312  -26.195 1.00 0.00 ?  453 ILE A H    1  
ATOM   2263   H  HA   . ILE A  1 138 ? 2.647   11.302  -26.483 1.00 0.00 ?  453 ILE A HA   1  
ATOM   2264   H  HB   . ILE A  1 138 ? 4.689   10.647  -27.429 1.00 0.00 ?  453 ILE A HB   1  
ATOM   2265   H  HG12 . ILE A  1 138 ? 3.376   8.254   -26.076 1.00 0.00 ?  453 ILE A HG12 1  
ATOM   2266   H  HG13 . ILE A  1 138 ? 2.594   9.399   -27.289 1.00 0.00 ?  453 ILE A HG13 1  
ATOM   2267   H  HG21 . ILE A  1 138 ? 5.942   8.690   -26.064 1.00 0.00 ?  453 ILE A HG21 1  
ATOM   2268   H  HG22 . ILE A  1 138 ? 5.058   9.221   -24.607 1.00 0.00 ?  453 ILE A HG22 1  
ATOM   2269   H  HG23 . ILE A  1 138 ? 6.190   10.300  -25.202 1.00 0.00 ?  453 ILE A HG23 1  
ATOM   2270   H  HD11 . ILE A  1 138 ? 3.442   7.384   -28.584 1.00 0.00 ?  453 ILE A HD11 1  
ATOM   2271   H  HD12 . ILE A  1 138 ? 5.070   7.678   -27.885 1.00 0.00 ?  453 ILE A HD12 1  
ATOM   2272   H  HD13 . ILE A  1 138 ? 4.327   8.869   -28.952 1.00 0.00 ?  453 ILE A HD13 1  
ATOM   2273   N  N    . LYS A  1 139 ? 3.484   11.295  -23.398 1.00 0.00 ?  454 LYS A N    1  
ATOM   2274   C  CA   . LYS A  1 139 ? 3.118   10.950  -22.115 1.00 0.00 ?  454 LYS A CA   1  
ATOM   2275   C  C    . LYS A  1 139 ? 1.964   11.842  -21.645 1.00 0.00 ?  454 LYS A C    1  
ATOM   2276   O  O    . LYS A  1 139 ? 1.581   11.858  -20.456 1.00 0.00 ?  454 LYS A O    1  
ATOM   2277   C  CB   . LYS A  1 139 ? 4.296   11.149  -21.120 1.00 0.00 ?  454 LYS A CB   1  
ATOM   2278   C  CG   . LYS A  1 139 ? 5.553   10.273  -21.310 1.00 0.00 ?  454 LYS A CG   1  
ATOM   2279   C  CD   . LYS A  1 139 ? 5.198   8.789   -21.332 1.00 0.00 ?  454 LYS A CD   1  
ATOM   2280   C  CE   . LYS A  1 139 ? 6.399   7.839   -21.203 1.00 0.00 ?  454 LYS A CE   1  
ATOM   2281   N  NZ   . LYS A  1 139 ? 5.868   6.498   -21.013 1.00 0.00 1  454 LYS A NZ   1  
ATOM   2282   H  H    . LYS A  1 139 ? 4.222   11.963  -23.449 1.00 0.00 ?  454 LYS A H    1  
ATOM   2283   H  HA   . LYS A  1 139 ? 2.743   9.938   -22.080 1.00 0.00 ?  454 LYS A HA   1  
ATOM   2284   H  HB2  . LYS A  1 139 ? 4.646   12.202  -21.175 1.00 0.00 ?  454 LYS A HB2  1  
ATOM   2285   H  HB3  . LYS A  1 139 ? 3.880   11.089  -20.091 1.00 0.00 ?  454 LYS A HB3  1  
ATOM   2286   H  HG2  . LYS A  1 139 ? 6.039   10.622  -22.246 1.00 0.00 ?  454 LYS A HG2  1  
ATOM   2287   H  HG3  . LYS A  1 139 ? 6.215   10.350  -20.421 1.00 0.00 ?  454 LYS A HG3  1  
ATOM   2288   H  HD2  . LYS A  1 139 ? 4.669   8.708   -20.359 1.00 0.00 ?  454 LYS A HD2  1  
ATOM   2289   H  HD3  . LYS A  1 139 ? 4.520   8.494   -22.161 1.00 0.00 ?  454 LYS A HD3  1  
ATOM   2290   H  HE2  . LYS A  1 139 ? 6.991   7.828   -22.143 1.00 0.00 ?  454 LYS A HE2  1  
ATOM   2291   H  HE3  . LYS A  1 139 ? 7.077   8.079   -20.356 1.00 0.00 ?  454 LYS A HE3  1  
ATOM   2292   H  HZ1  . LYS A  1 139 ? 6.733   5.931   -20.901 1.00 0.00 ?  454 LYS A HZ1  1  
ATOM   2293   H  HZ2  . LYS A  1 139 ? 5.447   6.054   -21.854 1.00 0.00 ?  454 LYS A HZ2  1  
ATOM   2294   H  HZ3  . LYS A  1 139 ? 5.247   6.422   -20.183 1.00 0.00 ?  454 LYS A HZ3  1  
ATOM   2295   N  N    . VAL A  1 140 ? 1.350   12.616  -22.498 1.00 0.00 ?  455 VAL A N    1  
ATOM   2296   C  CA   . VAL A  1 140 ? 0.177   13.419  -22.186 1.00 0.00 ?  455 VAL A CA   1  
ATOM   2297   C  C    . VAL A  1 140 ? -1.001  12.498  -21.947 1.00 0.00 ?  455 VAL A C    1  
ATOM   2298   O  O    . VAL A  1 140 ? -1.807  12.725  -21.100 1.00 0.00 ?  455 VAL A O    1  
ATOM   2299   C  CB   . VAL A  1 140 ? -0.135  14.376  -23.364 1.00 0.00 ?  455 VAL A CB   1  
ATOM   2300   C  CG1  . VAL A  1 140 ? -1.557  15.075  -23.171 1.00 0.00 ?  455 VAL A CG1  1  
ATOM   2301   C  CG2  . VAL A  1 140 ? 0.948   15.487  -23.338 1.00 0.00 ?  455 VAL A CG2  1  
ATOM   2302   H  H    . VAL A  1 140 ? 1.720   12.696  -23.420 1.00 0.00 ?  455 VAL A H    1  
ATOM   2303   H  HA   . VAL A  1 140 ? 0.286   13.897  -21.224 1.00 0.00 ?  455 VAL A HA   1  
ATOM   2304   H  HB   . VAL A  1 140 ? -0.084  13.913  -24.373 1.00 0.00 ?  455 VAL A HB   1  
ATOM   2305   H  HG11 . VAL A  1 140 ? -1.617  15.929  -23.878 1.00 0.00 ?  455 VAL A HG11 1  
ATOM   2306   H  HG12 . VAL A  1 140 ? -1.586  15.390  -22.106 1.00 0.00 ?  455 VAL A HG12 1  
ATOM   2307   H  HG13 . VAL A  1 140 ? -2.474  14.492  -23.401 1.00 0.00 ?  455 VAL A HG13 1  
ATOM   2308   H  HG21 . VAL A  1 140 ? 1.970   15.108  -23.120 1.00 0.00 ?  455 VAL A HG21 1  
ATOM   2309   H  HG22 . VAL A  1 140 ? 0.671   16.405  -22.776 1.00 0.00 ?  455 VAL A HG22 1  
ATOM   2310   H  HG23 . VAL A  1 140 ? 0.959   15.783  -24.409 1.00 0.00 ?  455 VAL A HG23 1  
ATOM   2311   N  N    . TRP A  1 141 ? -1.091  11.368  -22.601 1.00 0.00 ?  456 TRP A N    1  
ATOM   2312   C  CA   . TRP A  1 141 ? -2.080  10.283  -22.186 1.00 0.00 ?  456 TRP A CA   1  
ATOM   2313   C  C    . TRP A  1 141 ? -1.266  9.042   -22.019 1.00 0.00 ?  456 TRP A C    1  
ATOM   2314   O  O    . TRP A  1 141 ? -0.793  8.456   -22.985 1.00 0.00 ?  456 TRP A O    1  
ATOM   2315   C  CB   . TRP A  1 141 ? -3.316  10.190  -23.136 1.00 0.00 ?  456 TRP A CB   1  
ATOM   2316   C  CG   . TRP A  1 141 ? -3.981  11.462  -23.698 1.00 0.00 ?  456 TRP A CG   1  
ATOM   2317   C  CD1  . TRP A  1 141 ? -4.753  12.257  -22.966 1.00 0.00 ?  456 TRP A CD1  1  
ATOM   2318   C  CD2  . TRP A  1 141 ? -4.346  11.639  -25.080 1.00 0.00 ?  456 TRP A CD2  1  
ATOM   2319   N  NE1  . TRP A  1 141 ? -5.564  13.096  -23.792 1.00 0.00 ?  456 TRP A NE1  1  
ATOM   2320   C  CE2  . TRP A  1 141 ? -5.293  12.684  -25.092 1.00 0.00 ?  456 TRP A CE2  1  
ATOM   2321   C  CE3  . TRP A  1 141 ? -3.956  10.965  -26.276 1.00 0.00 ?  456 TRP A CE3  1  
ATOM   2322   C  CZ2  . TRP A  1 141 ? -5.825  13.102  -26.299 1.00 0.00 ?  456 TRP A CZ2  1  
ATOM   2323   C  CZ3  . TRP A  1 141 ? -4.559  11.437  -27.435 1.00 0.00 ?  456 TRP A CZ3  1  
ATOM   2324   C  CH2  . TRP A  1 141 ? -5.369  12.495  -27.467 1.00 0.00 ?  456 TRP A CH2  1  
ATOM   2325   H  H    . TRP A  1 141 ? -0.440  11.133  -23.318 1.00 0.00 ?  456 TRP A H    1  
ATOM   2326   H  HA   . TRP A  1 141 ? -2.488  10.421  -21.195 1.00 0.00 ?  456 TRP A HA   1  
ATOM   2327   H  HB2  . TRP A  1 141 ? -3.030  9.515   -23.971 1.00 0.00 ?  456 TRP A HB2  1  
ATOM   2328   H  HB3  . TRP A  1 141 ? -4.106  9.554   -22.682 1.00 0.00 ?  456 TRP A HB3  1  
ATOM   2329   H  HD1  . TRP A  1 141 ? -4.463  12.431  -21.941 1.00 0.00 ?  456 TRP A HD1  1  
ATOM   2330   H  HE1  . TRP A  1 141 ? -5.923  13.919  -23.410 1.00 0.00 ?  456 TRP A HE1  1  
ATOM   2331   H  HE3  . TRP A  1 141 ? -3.233  10.170  -26.171 1.00 0.00 ?  456 TRP A HE3  1  
ATOM   2332   H  HZ2  . TRP A  1 141 ? -6.414  14.007  -26.285 1.00 0.00 ?  456 TRP A HZ2  1  
ATOM   2333   H  HZ3  . TRP A  1 141 ? -4.380  10.914  -28.363 1.00 0.00 ?  456 TRP A HZ3  1  
ATOM   2334   H  HH2  . TRP A  1 141 ? -5.823  12.826  -28.390 1.00 0.00 ?  456 TRP A HH2  1  
ATOM   2335   N  N    . GLU A  1 142 ? -1.033  8.672   -20.763 1.00 0.00 ?  457 GLU A N    1  
ATOM   2336   C  CA   . GLU A  1 142 ? -0.311  7.479   -20.274 1.00 0.00 ?  457 GLU A CA   1  
ATOM   2337   C  C    . GLU A  1 142 ? -0.911  6.219   -20.857 1.00 0.00 ?  457 GLU A C    1  
ATOM   2338   O  O    . GLU A  1 142 ? -2.132  5.966   -20.713 1.00 0.00 ?  457 GLU A O    1  
ATOM   2339   C  CB   . GLU A  1 142 ? -0.164  7.450   -18.713 1.00 0.00 ?  457 GLU A CB   1  
ATOM   2340   C  CG   . GLU A  1 142 ? 0.845   8.514   -18.100 1.00 0.00 ?  457 GLU A CG   1  
ATOM   2341   C  CD   . GLU A  1 142 ? 0.513   8.974   -16.628 1.00 0.00 ?  457 GLU A CD   1  
ATOM   2342   O  OE1  . GLU A  1 142 ? 1.395   8.704   -15.782 1.00 0.00 ?  457 GLU A OE1  1  
ATOM   2343   O  OE2  . GLU A  1 142 ? -0.627  9.464   -16.345 1.00 0.00 -1 457 GLU A OE2  1  
ATOM   2344   H  H    . GLU A  1 142 ? -1.377  9.301   -20.070 1.00 0.00 ?  457 GLU A H    1  
ATOM   2345   H  HA   . GLU A  1 142 ? 0.695   7.499   -20.667 1.00 0.00 ?  457 GLU A HA   1  
ATOM   2346   H  HB2  . GLU A  1 142 ? -1.189  7.708   -18.371 1.00 0.00 ?  457 GLU A HB2  1  
ATOM   2347   H  HB3  . GLU A  1 142 ? 0.174   6.488   -18.272 1.00 0.00 ?  457 GLU A HB3  1  
ATOM   2348   H  HG2  . GLU A  1 142 ? 1.853   8.046   -18.073 1.00 0.00 ?  457 GLU A HG2  1  
ATOM   2349   H  HG3  . GLU A  1 142 ? 0.912   9.469   -18.664 1.00 0.00 ?  457 GLU A HG3  1  
ATOM   2350   N  N    . GLY A  1 143 ? -0.101  5.336   -21.437 1.00 0.00 ?  458 GLY A N    1  
ATOM   2351   C  CA   . GLY A  1 143 ? -0.533  3.990   -21.980 1.00 0.00 ?  458 GLY A CA   1  
ATOM   2352   C  C    . GLY A  1 143 ? -0.325  3.861   -23.431 1.00 0.00 ?  458 GLY A C    1  
ATOM   2353   O  O    . GLY A  1 143 ? -0.827  2.982   -24.208 1.00 0.00 ?  458 GLY A O    1  
ATOM   2354   H  H    . GLY A  1 143 ? 0.848   5.525   -21.678 1.00 0.00 ?  458 GLY A H    1  
ATOM   2355   H  HA2  . GLY A  1 143 ? 0.142   3.231   -21.611 1.00 0.00 ?  458 GLY A HA2  1  
ATOM   2356   H  HA3  . GLY A  1 143 ? -1.596  3.859   -21.838 1.00 0.00 ?  458 GLY A HA3  1  
ATOM   2357   N  N    . ILE A  1 144 ? 0.522   4.880   -23.985 1.00 0.00 ?  459 ILE A N    1  
ATOM   2358   C  CA   . ILE A  1 144 ? 0.916   4.846   -25.396 1.00 0.00 ?  459 ILE A CA   1  
ATOM   2359   C  C    . ILE A  1 144 ? 2.472   4.673   -25.483 1.00 0.00 ?  459 ILE A C    1  
ATOM   2360   O  O    . ILE A  1 144 ? 3.232   5.586   -25.124 1.00 0.00 ?  459 ILE A O    1  
ATOM   2361   C  CB   . ILE A  1 144 ? 0.465   6.102   -26.126 1.00 0.00 ?  459 ILE A CB   1  
ATOM   2362   C  CG1  . ILE A  1 144 ? -0.934  6.549   -25.813 1.00 0.00 ?  459 ILE A CG1  1  
ATOM   2363   C  CG2  . ILE A  1 144 ? 0.805   5.843   -27.575 1.00 0.00 ?  459 ILE A CG2  1  
ATOM   2364   C  CD1  . ILE A  1 144 ? -1.537  7.678   -26.658 1.00 0.00 ?  459 ILE A CD1  1  
ATOM   2365   H  H    . ILE A  1 144 ? 0.711   5.738   -23.514 1.00 0.00 ?  459 ILE A H    1  
ATOM   2366   H  HA   . ILE A  1 144 ? 0.512   4.004   -25.939 1.00 0.00 ?  459 ILE A HA   1  
ATOM   2367   H  HB   . ILE A  1 144 ? 1.127   6.945   -25.831 1.00 0.00 ?  459 ILE A HB   1  
ATOM   2368   H  HG12 . ILE A  1 144 ? -1.655  5.706   -25.866 1.00 0.00 ?  459 ILE A HG12 1  
ATOM   2369   H  HG13 . ILE A  1 144 ? -0.876  6.882   -24.754 1.00 0.00 ?  459 ILE A HG13 1  
ATOM   2370   H  HG21 . ILE A  1 144 ? 1.906   5.755   -27.697 1.00 0.00 ?  459 ILE A HG21 1  
ATOM   2371   H  HG22 . ILE A  1 144 ? 0.422   6.662   -28.222 1.00 0.00 ?  459 ILE A HG22 1  
ATOM   2372   H  HG23 . ILE A  1 144 ? 0.238   4.961   -27.940 1.00 0.00 ?  459 ILE A HG23 1  
ATOM   2373   H  HD11 . ILE A  1 144 ? -1.061  8.679   -26.574 1.00 0.00 ?  459 ILE A HD11 1  
ATOM   2374   H  HD12 . ILE A  1 144 ? -2.519  7.819   -26.158 1.00 0.00 ?  459 ILE A HD12 1  
ATOM   2375   H  HD13 . ILE A  1 144 ? -1.768  7.401   -27.708 1.00 0.00 ?  459 ILE A HD13 1  
ATOM   2376   N  N    . PRO A  1 145 ? 2.965   3.559   -26.040 1.00 0.00 ?  460 PRO A N    1  
ATOM   2377   C  CA   . PRO A  1 145 ? 4.438   3.414   -26.172 1.00 0.00 ?  460 PRO A CA   1  
ATOM   2378   C  C    . PRO A  1 145 ? 5.181   4.402   -26.973 1.00 0.00 ?  460 PRO A C    1  
ATOM   2379   O  O    . PRO A  1 145 ? 4.687   4.860   -27.986 1.00 0.00 ?  460 PRO A O    1  
ATOM   2380   C  CB   . PRO A  1 145 ? 4.622   2.011   -26.844 1.00 0.00 ?  460 PRO A CB   1  
ATOM   2381   C  CG   . PRO A  1 145 ? 3.292   1.767   -27.566 1.00 0.00 ?  460 PRO A CG   1  
ATOM   2382   C  CD   . PRO A  1 145 ? 2.247   2.529   -26.807 1.00 0.00 ?  460 PRO A CD   1  
ATOM   2383   H  HA   . PRO A  1 145 ? 4.911   3.555   -25.211 1.00 0.00 ?  460 PRO A HA   1  
ATOM   2384   H  HB2  . PRO A  1 145 ? 5.409   2.024   -27.629 1.00 0.00 ?  460 PRO A HB2  1  
ATOM   2385   H  HB3  . PRO A  1 145 ? 4.849   1.279   -26.040 1.00 0.00 ?  460 PRO A HB3  1  
ATOM   2386   H  HG2  . PRO A  1 145 ? 3.348   2.275   -28.552 1.00 0.00 ?  460 PRO A HG2  1  
ATOM   2387   H  HG3  . PRO A  1 145 ? 2.940   0.724   -27.718 1.00 0.00 ?  460 PRO A HG3  1  
ATOM   2388   H  HD2  . PRO A  1 145 ? 1.617   3.061   -27.552 1.00 0.00 ?  460 PRO A HD2  1  
ATOM   2389   H  HD3  . PRO A  1 145 ? 1.594   1.989   -26.089 1.00 0.00 ?  460 PRO A HD3  1  
ATOM   2390   N  N    . GLU A  1 146 ? 6.450   4.724   -26.644 1.00 0.00 ?  461 GLU A N    1  
ATOM   2391   C  CA   . GLU A  1 146 ? 7.347   5.408   -27.504 1.00 0.00 ?  461 GLU A CA   1  
ATOM   2392   C  C    . GLU A  1 146 ? 7.571   4.530   -28.771 1.00 0.00 ?  461 GLU A C    1  
ATOM   2393   O  O    . GLU A  1 146 ? 7.543   3.327   -28.738 1.00 0.00 ?  461 GLU A O    1  
ATOM   2394   C  CB   . GLU A  1 146 ? 8.714   5.646   -26.794 1.00 0.00 ?  461 GLU A CB   1  
ATOM   2395   C  CG   . GLU A  1 146 ? 8.552   6.291   -25.420 1.00 0.00 ?  461 GLU A CG   1  
ATOM   2396   C  CD   . GLU A  1 146 ? 8.544   5.240   -24.297 1.00 0.00 ?  461 GLU A CD   1  
ATOM   2397   O  OE1  . GLU A  1 146 ? 7.563   4.570   -24.024 1.00 0.00 ?  461 GLU A OE1  1  
ATOM   2398   O  OE2  . GLU A  1 146 ? 9.604   5.036   -23.677 1.00 0.00 -1 461 GLU A OE2  1  
ATOM   2399   H  H    . GLU A  1 146 ? 6.797   4.316   -25.803 1.00 0.00 ?  461 GLU A H    1  
ATOM   2400   H  HA   . GLU A  1 146 ? 6.898   6.339   -27.817 1.00 0.00 ?  461 GLU A HA   1  
ATOM   2401   H  HB2  . GLU A  1 146 ? 9.179   4.645   -26.671 1.00 0.00 ?  461 GLU A HB2  1  
ATOM   2402   H  HB3  . GLU A  1 146 ? 9.136   6.379   -27.515 1.00 0.00 ?  461 GLU A HB3  1  
ATOM   2403   H  HG2  . GLU A  1 146 ? 9.337   7.059   -25.253 1.00 0.00 ?  461 GLU A HG2  1  
ATOM   2404   H  HG3  . GLU A  1 146 ? 7.567   6.782   -25.271 1.00 0.00 ?  461 GLU A HG3  1  
ATOM   2405   N  N    . SER A  1 147 ? 7.687   5.242   -29.939 1.00 0.00 ?  462 SER A N    1  
ATOM   2406   C  CA   . SER A  1 147 ? 7.638   4.720   -31.295 1.00 0.00 ?  462 SER A CA   1  
ATOM   2407   C  C    . SER A  1 147 ? 6.860   3.359   -31.601 1.00 0.00 ?  462 SER A C    1  
ATOM   2408   O  O    . SER A  1 147 ? 7.574   2.420   -31.915 1.00 0.00 ?  462 SER A O    1  
ATOM   2409   C  CB   . SER A  1 147 ? 8.977   4.624   -32.015 1.00 0.00 ?  462 SER A CB   1  
ATOM   2410   O  OG   . SER A  1 147 ? 9.647   5.873   -31.912 1.00 0.00 ?  462 SER A OG   1  
ATOM   2411   H  H    . SER A  1 147 ? 7.384   6.188   -29.850 1.00 0.00 ?  462 SER A H    1  
ATOM   2412   H  HA   . SER A  1 147 ? 7.100   5.509   -31.801 1.00 0.00 ?  462 SER A HA   1  
ATOM   2413   H  HB2  . SER A  1 147 ? 9.606   3.811   -31.594 1.00 0.00 ?  462 SER A HB2  1  
ATOM   2414   H  HB3  . SER A  1 147 ? 8.876   4.213   -33.043 1.00 0.00 ?  462 SER A HB3  1  
ATOM   2415   H  HG   . SER A  1 147 ? 9.770   6.239   -32.791 1.00 0.00 ?  462 SER A HG   1  
ATOM   2416   N  N    . PRO A  1 148 ? 5.504   3.235   -31.609 1.00 0.00 ?  463 PRO A N    1  
ATOM   2417   C  CA   . PRO A  1 148 ? 4.712   1.993   -31.723 1.00 0.00 ?  463 PRO A CA   1  
ATOM   2418   C  C    . PRO A  1 148 ? 5.197   1.036   -32.789 1.00 0.00 ?  463 PRO A C    1  
ATOM   2419   O  O    . PRO A  1 148 ? 5.658   1.489   -33.847 1.00 0.00 ?  463 PRO A O    1  
ATOM   2420   C  CB   . PRO A  1 148 ? 3.254   2.361   -31.823 1.00 0.00 ?  463 PRO A CB   1  
ATOM   2421   C  CG   . PRO A  1 148 ? 3.231   3.711   -31.158 1.00 0.00 ?  463 PRO A CG   1  
ATOM   2422   C  CD   . PRO A  1 148 ? 4.590   4.377   -31.545 1.00 0.00 ?  463 PRO A CD   1  
ATOM   2423   H  HA   . PRO A  1 148 ? 4.826   1.516   -30.760 1.00 0.00 ?  463 PRO A HA   1  
ATOM   2424   H  HB2  . PRO A  1 148 ? 2.991   2.702   -32.848 1.00 0.00 ?  463 PRO A HB2  1  
ATOM   2425   H  HB3  . PRO A  1 148 ? 2.572   1.629   -31.342 1.00 0.00 ?  463 PRO A HB3  1  
ATOM   2426   H  HG2  . PRO A  1 148 ? 2.293   4.269   -31.363 1.00 0.00 ?  463 PRO A HG2  1  
ATOM   2427   H  HG3  . PRO A  1 148 ? 3.243   3.581   -30.055 1.00 0.00 ?  463 PRO A HG3  1  
ATOM   2428   H  HD2  . PRO A  1 148 ? 4.496   4.796   -32.569 1.00 0.00 ?  463 PRO A HD2  1  
ATOM   2429   H  HD3  . PRO A  1 148 ? 4.901   5.141   -30.801 1.00 0.00 ?  463 PRO A HD3  1  
ATOM   2430   N  N    . ARG A  1 149 ? 5.070   -0.308  -32.584 1.00 0.00 ?  464 ARG A N    1  
ATOM   2431   C  CA   . ARG A  1 149 ? 5.108   -1.373  -33.576 1.00 0.00 ?  464 ARG A CA   1  
ATOM   2432   C  C    . ARG A  1 149 ? 3.712   -1.984  -33.856 1.00 0.00 ?  464 ARG A C    1  
ATOM   2433   O  O    . ARG A  1 149 ? 3.626   -3.091  -34.480 1.00 0.00 ?  464 ARG A O    1  
ATOM   2434   C  CB   . ARG A  1 149 ? 6.061   -2.577  -33.241 1.00 0.00 ?  464 ARG A CB   1  
ATOM   2435   C  CG   . ARG A  1 149 ? 7.508   -2.239  -32.960 1.00 0.00 ?  464 ARG A CG   1  
ATOM   2436   C  CD   . ARG A  1 149 ? 8.238   -1.434  -34.031 1.00 0.00 ?  464 ARG A CD   1  
ATOM   2437   N  NE   . ARG A  1 149 ? 9.682   -1.182  -33.725 1.00 0.00 ?  464 ARG A NE   1  
ATOM   2438   C  CZ   . ARG A  1 149 ? 10.072  -0.465  -32.710 1.00 0.00 ?  464 ARG A CZ   1  
ATOM   2439   N  NH1  . ARG A  1 149 ? 11.325  -0.624  -32.456 1.00 0.00 1  464 ARG A NH1  1  
ATOM   2440   N  NH2  . ARG A  1 149 ? 9.424   0.466   -32.024 1.00 0.00 ?  464 ARG A NH2  1  
ATOM   2441   H  H    . ARG A  1 149 ? 4.600   -0.531  -31.734 1.00 0.00 ?  464 ARG A H    1  
ATOM   2442   H  HA   . ARG A  1 149 ? 5.415   -1.012  -34.547 1.00 0.00 ?  464 ARG A HA   1  
ATOM   2443   H  HB2  . ARG A  1 149 ? 5.615   -3.103  -32.369 1.00 0.00 ?  464 ARG A HB2  1  
ATOM   2444   H  HB3  . ARG A  1 149 ? 6.145   -3.293  -34.087 1.00 0.00 ?  464 ARG A HB3  1  
ATOM   2445   H  HG2  . ARG A  1 149 ? 7.662   -1.647  -32.033 1.00 0.00 ?  464 ARG A HG2  1  
ATOM   2446   H  HG3  . ARG A  1 149 ? 8.042   -3.170  -32.670 1.00 0.00 ?  464 ARG A HG3  1  
ATOM   2447   H  HD2  . ARG A  1 149 ? 8.225   -2.103  -34.917 1.00 0.00 ?  464 ARG A HD2  1  
ATOM   2448   H  HD3  . ARG A  1 149 ? 7.696   -0.510  -34.325 1.00 0.00 ?  464 ARG A HD3  1  
ATOM   2449   H  HE   . ARG A  1 149 ? 10.389  -1.616  -34.285 1.00 0.00 ?  464 ARG A HE   1  
ATOM   2450   H  HH11 . ARG A  1 149 ? 11.865  -1.316  -32.935 1.00 0.00 ?  464 ARG A HH11 1  
ATOM   2451   H  HH12 . ARG A  1 149 ? 11.646  -0.042  -31.708 1.00 0.00 ?  464 ARG A HH12 1  
ATOM   2452   H  HH21 . ARG A  1 149 ? 9.936   1.051   -31.395 1.00 0.00 ?  464 ARG A HH21 1  
ATOM   2453   H  HH22 . ARG A  1 149 ? 8.756   0.885   -32.638 1.00 0.00 ?  464 ARG A HH22 1  
ATOM   2454   N  N    . GLY A  1 150 ? 2.547   -1.277  -33.497 1.00 0.00 ?  465 GLY A N    1  
ATOM   2455   C  CA   . GLY A  1 150 ? 1.202   -1.524  -34.166 1.00 0.00 ?  465 GLY A CA   1  
ATOM   2456   C  C    . GLY A  1 150 ? 0.142   -0.819  -33.354 1.00 0.00 ?  465 GLY A C    1  
ATOM   2457   O  O    . GLY A  1 150 ? 0.407   -0.606  -32.219 1.00 0.00 ?  465 GLY A O    1  
ATOM   2458   H  H    . GLY A  1 150 ? 2.640   -0.314  -33.255 1.00 0.00 ?  465 GLY A H    1  
ATOM   2459   H  HA2  . GLY A  1 150 ? 1.261   -0.995  -35.106 1.00 0.00 ?  465 GLY A HA2  1  
ATOM   2460   H  HA3  . GLY A  1 150 ? 0.990   -2.573  -34.311 1.00 0.00 ?  465 GLY A HA3  1  
ATOM   2461   N  N    . SER A  1 151 ? -1.067  -0.598  -33.891 1.00 0.00 ?  466 SER A N    1  
ATOM   2462   C  CA   . SER A  1 151 ? -2.124  -0.089  -33.176 1.00 0.00 ?  466 SER A CA   1  
ATOM   2463   C  C    . SER A  1 151 ? -3.430  -0.363  -33.805 1.00 0.00 ?  466 SER A C    1  
ATOM   2464   O  O    . SER A  1 151 ? -3.540  -0.552  -34.978 1.00 0.00 ?  466 SER A O    1  
ATOM   2465   C  CB   . SER A  1 151 ? -2.016  1.466   -33.013 1.00 0.00 ?  466 SER A CB   1  
ATOM   2466   O  OG   . SER A  1 151 ? -1.842  2.308   -34.174 1.00 0.00 ?  466 SER A OG   1  
ATOM   2467   H  H    . SER A  1 151 ? -1.246  -0.626  -34.871 1.00 0.00 ?  466 SER A H    1  
ATOM   2468   H  HA   . SER A  1 151 ? -2.064  -0.524  -32.190 1.00 0.00 ?  466 SER A HA   1  
ATOM   2469   H  HB2  . SER A  1 151 ? -2.926  1.818   -32.480 1.00 0.00 ?  466 SER A HB2  1  
ATOM   2470   H  HB3  . SER A  1 151 ? -1.171  1.656   -32.317 1.00 0.00 ?  466 SER A HB3  1  
ATOM   2471   H  HG   . SER A  1 151 ? -0.940  2.203   -34.484 1.00 0.00 ?  466 SER A HG   1  
ATOM   2472   N  N    . PHE A  1 152 ? -4.592  -0.368  -33.056 1.00 0.00 ?  467 PHE A N    1  
ATOM   2473   C  CA   . PHE A  1 152 ? -5.874  -0.416  -33.684 1.00 0.00 ?  467 PHE A CA   1  
ATOM   2474   C  C    . PHE A  1 152 ? -6.966  0.156   -32.734 1.00 0.00 ?  467 PHE A C    1  
ATOM   2475   O  O    . PHE A  1 152 ? -6.905  0.088   -31.503 1.00 0.00 ?  467 PHE A O    1  
ATOM   2476   C  CB   . PHE A  1 152 ? -6.376  -1.765  -34.257 1.00 0.00 ?  467 PHE A CB   1  
ATOM   2477   C  CG   . PHE A  1 152 ? -6.115  -3.001  -33.396 1.00 0.00 ?  467 PHE A CG   1  
ATOM   2478   C  CD1  . PHE A  1 152 ? -7.098  -3.539  -32.600 1.00 0.00 ?  467 PHE A CD1  1  
ATOM   2479   C  CD2  . PHE A  1 152 ? -4.869  -3.639  -33.471 1.00 0.00 ?  467 PHE A CD2  1  
ATOM   2480   C  CE1  . PHE A  1 152 ? -6.783  -4.616  -31.716 1.00 0.00 ?  467 PHE A CE1  1  
ATOM   2481   C  CE2  . PHE A  1 152 ? -4.552  -4.713  -32.657 1.00 0.00 ?  467 PHE A CE2  1  
ATOM   2482   C  CZ   . PHE A  1 152 ? -5.565  -5.221  -31.740 1.00 0.00 ?  467 PHE A CZ   1  
ATOM   2483   H  H    . PHE A  1 152 ? -4.614  -0.225  -32.070 1.00 0.00 ?  467 PHE A H    1  
ATOM   2484   H  HA   . PHE A  1 152 ? -5.894  0.440   -34.342 1.00 0.00 ?  467 PHE A HA   1  
ATOM   2485   H  HB2  . PHE A  1 152 ? -7.464  -1.692  -34.465 1.00 0.00 ?  467 PHE A HB2  1  
ATOM   2486   H  HB3  . PHE A  1 152 ? -5.926  -1.942  -35.257 1.00 0.00 ?  467 PHE A HB3  1  
ATOM   2487   H  HD1  . PHE A  1 152 ? -8.020  -2.988  -32.490 1.00 0.00 ?  467 PHE A HD1  1  
ATOM   2488   H  HD2  . PHE A  1 152 ? -4.155  -3.223  -34.167 1.00 0.00 ?  467 PHE A HD2  1  
ATOM   2489   H  HE1  . PHE A  1 152 ? -7.517  -5.010  -31.029 1.00 0.00 ?  467 PHE A HE1  1  
ATOM   2490   H  HE2  . PHE A  1 152 ? -3.603  -5.210  -32.519 1.00 0.00 ?  467 PHE A HE2  1  
ATOM   2491   H  HZ   . PHE A  1 152 ? -5.365  -5.990  -31.009 1.00 0.00 ?  467 PHE A HZ   1  
ATOM   2492   N  N    . MET A  1 153 ? -8.068  0.603   -33.316 1.00 0.00 ?  468 MET A N    1  
ATOM   2493   C  CA   . MET A  1 153 ? -9.362  0.881   -32.657 1.00 0.00 ?  468 MET A CA   1  
ATOM   2494   C  C    . MET A  1 153 ? -9.991  -0.415  -32.151 1.00 0.00 ?  468 MET A C    1  
ATOM   2495   O  O    . MET A  1 153 ? -9.888  -1.396  -32.874 1.00 0.00 ?  468 MET A O    1  
ATOM   2496   C  CB   . MET A  1 153 ? -10.382 1.569   -33.504 1.00 0.00 ?  468 MET A CB   1  
ATOM   2497   C  CG   . MET A  1 153 ? -10.040 2.990   -33.876 1.00 0.00 ?  468 MET A CG   1  
ATOM   2498   S  SD   . MET A  1 153 ? -9.791  4.023   -32.337 1.00 0.00 ?  468 MET A SD   1  
ATOM   2499   C  CE   . MET A  1 153 ? -11.318 3.687   -31.420 1.00 0.00 ?  468 MET A CE   1  
ATOM   2500   H  H    . MET A  1 153 ? -8.080  0.613   -34.313 1.00 0.00 ?  468 MET A H    1  
ATOM   2501   H  HA   . MET A  1 153 ? -9.250  1.470   -31.758 1.00 0.00 ?  468 MET A HA   1  
ATOM   2502   H  HB2  . MET A  1 153 ? -10.468 0.925   -34.406 1.00 0.00 ?  468 MET A HB2  1  
ATOM   2503   H  HB3  . MET A  1 153 ? -11.297 1.670   -32.882 1.00 0.00 ?  468 MET A HB3  1  
ATOM   2504   H  HG2  . MET A  1 153 ? -9.173  2.942   -34.568 1.00 0.00 ?  468 MET A HG2  1  
ATOM   2505   H  HG3  . MET A  1 153 ? -10.764 3.474   -34.566 1.00 0.00 ?  468 MET A HG3  1  
ATOM   2506   H  HE1  . MET A  1 153 ? -12.082 3.432   -32.185 1.00 0.00 ?  468 MET A HE1  1  
ATOM   2507   H  HE2  . MET A  1 153 ? -11.679 4.608   -30.915 1.00 0.00 ?  468 MET A HE2  1  
ATOM   2508   H  HE3  . MET A  1 153 ? -11.239 2.822   -30.728 1.00 0.00 ?  468 MET A HE3  1  
ATOM   2509   N  N    . GLY A  1 154 ? -10.518 -0.456  -30.916 1.00 0.00 ?  469 GLY A N    1  
ATOM   2510   C  CA   . GLY A  1 154 ? -11.391 -1.637  -30.560 1.00 0.00 ?  469 GLY A CA   1  
ATOM   2511   C  C    . GLY A  1 154 ? -12.739 -1.465  -31.310 1.00 0.00 ?  469 GLY A C    1  
ATOM   2512   O  O    . GLY A  1 154 ? -12.979 -0.430  -31.992 1.00 0.00 ?  469 GLY A O    1  
ATOM   2513   H  H    . GLY A  1 154 ? -10.414 0.318   -30.296 1.00 0.00 ?  469 GLY A H    1  
ATOM   2514   H  HA2  . GLY A  1 154 ? -10.963 -2.571  -30.892 1.00 0.00 ?  469 GLY A HA2  1  
ATOM   2515   H  HA3  . GLY A  1 154 ? -11.661 -1.556  -29.517 1.00 0.00 ?  469 GLY A HA3  1  
ATOM   2516   N  N    . SER A  1 155 ? -13.642 -2.385  -31.271 1.00 0.00 ?  470 SER A N    1  
ATOM   2517   C  CA   . SER A  1 155 ? -14.917 -2.292  -32.039 1.00 0.00 ?  470 SER A CA   1  
ATOM   2518   C  C    . SER A  1 155 ? -15.879 -1.120  -31.798 1.00 0.00 ?  470 SER A C    1  
ATOM   2519   O  O    . SER A  1 155 ? -16.288 -0.429  -32.742 1.00 0.00 ?  470 SER A O    1  
ATOM   2520   C  CB   . SER A  1 155 ? -15.825 -3.583  -31.944 1.00 0.00 ?  470 SER A CB   1  
ATOM   2521   O  OG   . SER A  1 155 ? -15.651 -4.322  -30.686 1.00 0.00 ?  470 SER A OG   1  
ATOM   2522   H  H    . SER A  1 155 ? -13.458 -3.193  -30.716 1.00 0.00 ?  470 SER A H    1  
ATOM   2523   H  HA   . SER A  1 155 ? -14.697 -2.243  -33.096 1.00 0.00 ?  470 SER A HA   1  
ATOM   2524   H  HB2  . SER A  1 155 ? -16.860 -3.538  -32.345 1.00 0.00 ?  470 SER A HB2  1  
ATOM   2525   H  HB3  . SER A  1 155 ? -15.187 -4.228  -32.585 1.00 0.00 ?  470 SER A HB3  1  
ATOM   2526   H  HG   . SER A  1 155 ? -16.390 -4.924  -30.580 1.00 0.00 ?  470 SER A HG   1  
ATOM   2527   N  N    . ASP A  1 156 ? -16.181 -0.736  -30.502 1.00 0.00 ?  471 ASP A N    1  
ATOM   2528   C  CA   . ASP A  1 156 ? -17.225 0.064   -30.111 1.00 0.00 ?  471 ASP A CA   1  
ATOM   2529   C  C    . ASP A  1 156 ? -16.698 1.397   -29.640 1.00 0.00 ?  471 ASP A C    1  
ATOM   2530   O  O    . ASP A  1 156 ? -17.457 2.305   -29.219 1.00 0.00 ?  471 ASP A O    1  
ATOM   2531   C  CB   . ASP A  1 156 ? -18.031 -0.614  -28.855 1.00 0.00 ?  471 ASP A CB   1  
ATOM   2532   C  CG   . ASP A  1 156 ? -17.296 -0.884  -27.635 1.00 0.00 ?  471 ASP A CG   1  
ATOM   2533   O  OD1  . ASP A  1 156 ? -18.028 -0.925  -26.571 1.00 0.00 ?  471 ASP A OD1  1  
ATOM   2534   O  OD2  . ASP A  1 156 ? -16.117 -1.071  -27.577 1.00 0.00 -1 471 ASP A OD2  1  
ATOM   2535   H  H    . ASP A  1 156 ? -15.624 -1.066  -29.744 1.00 0.00 ?  471 ASP A H    1  
ATOM   2536   H  HA   . ASP A  1 156 ? -17.945 0.155   -30.910 1.00 0.00 ?  471 ASP A HA   1  
ATOM   2537   H  HB2  . ASP A  1 156 ? -18.924 0.038   -28.743 1.00 0.00 ?  471 ASP A HB2  1  
ATOM   2538   H  HB3  . ASP A  1 156 ? -18.340 -1.585  -29.297 1.00 0.00 ?  471 ASP A HB3  1  
ATOM   2539   N  N    . GLU A  1 157 ? -15.337 1.517   -29.906 1.00 0.00 ?  472 GLU A N    1  
ATOM   2540   C  CA   . GLU A  1 157 ? -14.474 2.657   -29.864 1.00 0.00 ?  472 GLU A CA   1  
ATOM   2541   C  C    . GLU A  1 157 ? -14.162 3.173   -28.461 1.00 0.00 ?  472 GLU A C    1  
ATOM   2542   O  O    . GLU A  1 157 ? -13.906 4.335   -28.145 1.00 0.00 ?  472 GLU A O    1  
ATOM   2543   C  CB   . GLU A  1 157 ? -15.015 3.839   -30.696 1.00 0.00 ?  472 GLU A CB   1  
ATOM   2544   C  CG   . GLU A  1 157 ? -15.135 3.596   -32.231 1.00 0.00 ?  472 GLU A CG   1  
ATOM   2545   C  CD   . GLU A  1 157 ? -16.460 4.257   -32.751 1.00 0.00 ?  472 GLU A CD   1  
ATOM   2546   O  OE1  . GLU A  1 157 ? -17.335 3.422   -33.174 1.00 0.00 ?  472 GLU A OE1  1  
ATOM   2547   O  OE2  . GLU A  1 157 ? -16.596 5.471   -32.651 1.00 0.00 -1 472 GLU A OE2  1  
ATOM   2548   H  H    . GLU A  1 157 ? -14.898 0.698   -30.269 1.00 0.00 ?  472 GLU A H    1  
ATOM   2549   H  HA   . GLU A  1 157 ? -13.570 2.270   -30.311 1.00 0.00 ?  472 GLU A HA   1  
ATOM   2550   H  HB2  . GLU A  1 157 ? -16.026 4.121   -30.333 1.00 0.00 ?  472 GLU A HB2  1  
ATOM   2551   H  HB3  . GLU A  1 157 ? -14.309 4.696   -30.659 1.00 0.00 ?  472 GLU A HB3  1  
ATOM   2552   H  HG2  . GLU A  1 157 ? -14.258 3.949   -32.815 1.00 0.00 ?  472 GLU A HG2  1  
ATOM   2553   H  HG3  . GLU A  1 157 ? -15.220 2.544   -32.576 1.00 0.00 ?  472 GLU A HG3  1  
ATOM   2554   N  N    . VAL A  1 158 ? -14.217 2.257   -27.437 1.00 0.00 ?  473 VAL A N    1  
ATOM   2555   C  CA   . VAL A  1 158 ? -13.884 2.539   -26.043 1.00 0.00 ?  473 VAL A CA   1  
ATOM   2556   C  C    . VAL A  1 158 ? -12.299 2.434   -25.845 1.00 0.00 ?  473 VAL A C    1  
ATOM   2557   O  O    . VAL A  1 158 ? -11.672 3.209   -25.137 1.00 0.00 ?  473 VAL A O    1  
ATOM   2558   C  CB   . VAL A  1 158 ? -14.580 1.557   -25.112 1.00 0.00 ?  473 VAL A CB   1  
ATOM   2559   C  CG1  . VAL A  1 158 ? -14.206 1.888   -23.622 1.00 0.00 ?  473 VAL A CG1  1  
ATOM   2560   C  CG2  . VAL A  1 158 ? -16.089 1.596   -25.242 1.00 0.00 ?  473 VAL A CG2  1  
ATOM   2561   H  H    . VAL A  1 158 ? -14.539 1.314   -27.475 1.00 0.00 ?  473 VAL A H    1  
ATOM   2562   H  HA   . VAL A  1 158 ? -14.078 3.592   -25.899 1.00 0.00 ?  473 VAL A HA   1  
ATOM   2563   H  HB   . VAL A  1 158 ? -14.309 0.486   -25.228 1.00 0.00 ?  473 VAL A HB   1  
ATOM   2564   H  HG11 . VAL A  1 158 ? -13.121 1.694   -23.479 1.00 0.00 ?  473 VAL A HG11 1  
ATOM   2565   H  HG12 . VAL A  1 158 ? -14.728 1.208   -22.916 1.00 0.00 ?  473 VAL A HG12 1  
ATOM   2566   H  HG13 . VAL A  1 158 ? -14.417 2.960   -23.421 1.00 0.00 ?  473 VAL A HG13 1  
ATOM   2567   H  HG21 . VAL A  1 158 ? -16.417 1.102   -26.182 1.00 0.00 ?  473 VAL A HG21 1  
ATOM   2568   H  HG22 . VAL A  1 158 ? -16.364 2.671   -25.203 1.00 0.00 ?  473 VAL A HG22 1  
ATOM   2569   H  HG23 . VAL A  1 158 ? -16.527 0.988   -24.421 1.00 0.00 ?  473 VAL A HG23 1  
ATOM   2570   N  N    . PHE A  1 159 ? -11.627 1.575   -26.619 1.00 0.00 ?  474 PHE A N    1  
ATOM   2571   C  CA   . PHE A  1 159 ? -10.250 1.155   -26.352 1.00 0.00 ?  474 PHE A CA   1  
ATOM   2572   C  C    . PHE A  1 159 ? -9.516  1.458   -27.620 1.00 0.00 ?  474 PHE A C    1  
ATOM   2573   O  O    . PHE A  1 159 ? -10.099 1.547   -28.705 1.00 0.00 ?  474 PHE A O    1  
ATOM   2574   C  CB   . PHE A  1 159 ? -9.997  -0.319  -25.795 1.00 0.00 ?  474 PHE A CB   1  
ATOM   2575   C  CG   . PHE A  1 159 ? -10.856 -0.367  -24.488 1.00 0.00 ?  474 PHE A CG   1  
ATOM   2576   C  CD1  . PHE A  1 159 ? -12.108 -1.052  -24.364 1.00 0.00 ?  474 PHE A CD1  1  
ATOM   2577   C  CD2  . PHE A  1 159 ? -10.278 0.119   -23.276 1.00 0.00 ?  474 PHE A CD2  1  
ATOM   2578   C  CE1  . PHE A  1 159 ? -12.605 -1.342  -23.167 1.00 0.00 ?  474 PHE A CE1  1  
ATOM   2579   C  CE2  . PHE A  1 159 ? -10.964 0.048   -22.044 1.00 0.00 ?  474 PHE A CE2  1  
ATOM   2580   C  CZ   . PHE A  1 159 ? -12.132 -0.701  -22.008 1.00 0.00 ?  474 PHE A CZ   1  
ATOM   2581   H  H    . PHE A  1 159 ? -12.075 1.266   -27.454 1.00 0.00 ?  474 PHE A H    1  
ATOM   2582   H  HA   . PHE A  1 159 ? -9.813  1.900   -25.705 1.00 0.00 ?  474 PHE A HA   1  
ATOM   2583   H  HB2  . PHE A  1 159 ? -10.510 -0.939  -26.560 1.00 0.00 ?  474 PHE A HB2  1  
ATOM   2584   H  HB3  . PHE A  1 159 ? -8.943  -0.551  -25.530 1.00 0.00 ?  474 PHE A HB3  1  
ATOM   2585   H  HD1  . PHE A  1 159 ? -12.641 -1.492  -25.194 1.00 0.00 ?  474 PHE A HD1  1  
ATOM   2586   H  HD2  . PHE A  1 159 ? -9.282  0.536   -23.302 1.00 0.00 ?  474 PHE A HD2  1  
ATOM   2587   H  HE1  . PHE A  1 159 ? -13.543 -1.851  -23.000 1.00 0.00 ?  474 PHE A HE1  1  
ATOM   2588   H  HE2  . PHE A  1 159 ? -10.481 0.452   -21.166 1.00 0.00 ?  474 PHE A HE2  1  
ATOM   2589   H  HZ   . PHE A  1 159 ? -12.540 -0.767  -21.010 1.00 0.00 ?  474 PHE A HZ   1  
ATOM   2590   N  N    . THR A  1 160 ? -8.259  1.907   -27.507 1.00 0.00 ?  475 THR A N    1  
ATOM   2591   C  CA   . THR A  1 160 ? -7.199  1.843   -28.556 1.00 0.00 ?  475 THR A CA   1  
ATOM   2592   C  C    . THR A  1 160 ? -6.195  0.810   -28.093 1.00 0.00 ?  475 THR A C    1  
ATOM   2593   O  O    . THR A  1 160 ? -5.856  0.842   -26.889 1.00 0.00 ?  475 THR A O    1  
ATOM   2594   C  CB   . THR A  1 160 ? -6.366  3.106   -28.601 1.00 0.00 ?  475 THR A CB   1  
ATOM   2595   O  OG1  . THR A  1 160 ? -7.285  4.197   -28.723 1.00 0.00 ?  475 THR A OG1  1  
ATOM   2596   C  CG2  . THR A  1 160 ? -5.346  3.039   -29.719 1.00 0.00 ?  475 THR A CG2  1  
ATOM   2597   H  H    . THR A  1 160 ? -7.931  2.042   -26.575 1.00 0.00 ?  475 THR A H    1  
ATOM   2598   H  HA   . THR A  1 160 ? -7.513  1.631   -29.568 1.00 0.00 ?  475 THR A HA   1  
ATOM   2599   H  HB   . THR A  1 160 ? -5.854  3.274   -27.630 1.00 0.00 ?  475 THR A HB   1  
ATOM   2600   H  HG1  . THR A  1 160 ? -8.057  4.024   -28.179 1.00 0.00 ?  475 THR A HG1  1  
ATOM   2601   H  HG21 . THR A  1 160 ? -4.793  3.998   -29.625 1.00 0.00 ?  475 THR A HG21 1  
ATOM   2602   H  HG22 . THR A  1 160 ? -5.908  3.079   -30.676 1.00 0.00 ?  475 THR A HG22 1  
ATOM   2603   H  HG23 . THR A  1 160 ? -4.565  2.258   -29.839 1.00 0.00 ?  475 THR A HG23 1  
ATOM   2604   N  N    . TYR A  1 161 ? -5.688  -0.028  -28.974 1.00 0.00 ?  476 TYR A N    1  
ATOM   2605   C  CA   . TYR A  1 161 ? -4.717  -1.015  -28.734 1.00 0.00 ?  476 TYR A CA   1  
ATOM   2606   C  C    . TYR A  1 161 ? -3.341  -0.644  -29.353 1.00 0.00 ?  476 TYR A C    1  
ATOM   2607   O  O    . TYR A  1 161 ? -3.383  -0.166  -30.465 1.00 0.00 ?  476 TYR A O    1  
ATOM   2608   C  CB   . TYR A  1 161 ? -5.342  -2.296  -29.349 1.00 0.00 ?  476 TYR A CB   1  
ATOM   2609   C  CG   . TYR A  1 161 ? -6.533  -2.761  -28.442 1.00 0.00 ?  476 TYR A CG   1  
ATOM   2610   C  CD1  . TYR A  1 161 ? -6.297  -3.247  -27.115 1.00 0.00 ?  476 TYR A CD1  1  
ATOM   2611   C  CD2  . TYR A  1 161 ? -7.780  -2.637  -28.936 1.00 0.00 ?  476 TYR A CD2  1  
ATOM   2612   C  CE1  . TYR A  1 161 ? -7.396  -3.614  -26.330 1.00 0.00 ?  476 TYR A CE1  1  
ATOM   2613   C  CE2  . TYR A  1 161 ? -8.889  -3.053  -28.239 1.00 0.00 ?  476 TYR A CE2  1  
ATOM   2614   C  CZ   . TYR A  1 161 ? -8.717  -3.534  -26.905 1.00 0.00 ?  476 TYR A CZ   1  
ATOM   2615   O  OH   . TYR A  1 161 ? -9.831  -3.923  -26.205 1.00 0.00 ?  476 TYR A OH   1  
ATOM   2616   H  H    . TYR A  1 161 ? -5.984  -0.119  -29.922 1.00 0.00 ?  476 TYR A H    1  
ATOM   2617   H  HA   . TYR A  1 161 ? -4.616  -1.299  -27.697 1.00 0.00 ?  476 TYR A HA   1  
ATOM   2618   H  HB2  . TYR A  1 161 ? -5.664  -2.126  -30.399 1.00 0.00 ?  476 TYR A HB2  1  
ATOM   2619   H  HB3  . TYR A  1 161 ? -4.534  -3.059  -29.346 1.00 0.00 ?  476 TYR A HB3  1  
ATOM   2620   H  HD1  . TYR A  1 161 ? -5.290  -3.391  -26.752 1.00 0.00 ?  476 TYR A HD1  1  
ATOM   2621   H  HD2  . TYR A  1 161 ? -7.933  -2.170  -29.898 1.00 0.00 ?  476 TYR A HD2  1  
ATOM   2622   H  HE1  . TYR A  1 161 ? -7.219  -4.061  -25.363 1.00 0.00 ?  476 TYR A HE1  1  
ATOM   2623   H  HE2  . TYR A  1 161 ? -9.886  -2.975  -28.647 1.00 0.00 ?  476 TYR A HE2  1  
ATOM   2624   H  HH   . TYR A  1 161 ? -10.279 -4.517  -26.812 1.00 0.00 ?  476 TYR A HH   1  
ATOM   2625   N  N    . PHE A  1 162 ? -2.268  -0.761  -28.588 1.00 0.00 ?  477 PHE A N    1  
ATOM   2626   C  CA   . PHE A  1 162 ? -0.971  -0.371  -29.080 1.00 0.00 ?  477 PHE A CA   1  
ATOM   2627   C  C    . PHE A  1 162 ? -0.012  -1.483  -28.790 1.00 0.00 ?  477 PHE A C    1  
ATOM   2628   O  O    . PHE A  1 162 ? -0.190  -2.211  -27.802 1.00 0.00 ?  477 PHE A O    1  
ATOM   2629   C  CB   . PHE A  1 162 ? -0.379  0.878   -28.378 1.00 0.00 ?  477 PHE A CB   1  
ATOM   2630   C  CG   . PHE A  1 162 ? -1.192  2.080   -28.393 1.00 0.00 ?  477 PHE A CG   1  
ATOM   2631   C  CD1  . PHE A  1 162 ? -1.855  2.598   -27.298 1.00 0.00 ?  477 PHE A CD1  1  
ATOM   2632   C  CD2  . PHE A  1 162 ? -1.230  2.871   -29.571 1.00 0.00 ?  477 PHE A CD2  1  
ATOM   2633   C  CE1  . PHE A  1 162 ? -2.580  3.830   -27.345 1.00 0.00 ?  477 PHE A CE1  1  
ATOM   2634   C  CE2  . PHE A  1 162 ? -1.812  4.067   -29.566 1.00 0.00 ?  477 PHE A CE2  1  
ATOM   2635   C  CZ   . PHE A  1 162 ? -2.606  4.534   -28.549 1.00 0.00 ?  477 PHE A CZ   1  
ATOM   2636   H  H    . PHE A  1 162 ? -2.402  -0.990  -27.627 1.00 0.00 ?  477 PHE A H    1  
ATOM   2637   H  HA   . PHE A  1 162 ? -0.937  -0.324  -30.158 1.00 0.00 ?  477 PHE A HA   1  
ATOM   2638   H  HB2  . PHE A  1 162 ? -0.231  0.632   -27.304 1.00 0.00 ?  477 PHE A HB2  1  
ATOM   2639   H  HB3  . PHE A  1 162 ? 0.633   1.036   -28.809 1.00 0.00 ?  477 PHE A HB3  1  
ATOM   2640   H  HD1  . PHE A  1 162 ? -1.901  2.017   -26.388 1.00 0.00 ?  477 PHE A HD1  1  
ATOM   2641   H  HD2  . PHE A  1 162 ? -0.709  2.524   -30.451 1.00 0.00 ?  477 PHE A HD2  1  
ATOM   2642   H  HE1  . PHE A  1 162 ? -3.010  4.301   -26.473 1.00 0.00 ?  477 PHE A HE1  1  
ATOM   2643   H  HE2  . PHE A  1 162 ? -1.700  4.631   -30.480 1.00 0.00 ?  477 PHE A HE2  1  
ATOM   2644   H  HZ   . PHE A  1 162 ? -3.082  5.502   -28.493 1.00 0.00 ?  477 PHE A HZ   1  
ATOM   2645   N  N    . TYR A  1 163 ? 1.036   -1.748  -29.585 1.00 0.00 ?  478 TYR A N    1  
ATOM   2646   C  CA   . TYR A  1 163 ? 1.927   -2.864  -29.487 1.00 0.00 ?  478 TYR A CA   1  
ATOM   2647   C  C    . TYR A  1 163 ? 3.300   -2.404  -29.755 1.00 0.00 ?  478 TYR A C    1  
ATOM   2648   O  O    . TYR A  1 163 ? 3.555   -1.363  -30.312 1.00 0.00 ?  478 TYR A O    1  
ATOM   2649   C  CB   . TYR A  1 163 ? 1.443   -3.925  -30.554 1.00 0.00 ?  478 TYR A CB   1  
ATOM   2650   C  CG   . TYR A  1 163 ? 2.367   -5.002  -30.792 1.00 0.00 ?  478 TYR A CG   1  
ATOM   2651   C  CD1  . TYR A  1 163 ? 3.220   -5.042  -31.912 1.00 0.00 ?  478 TYR A CD1  1  
ATOM   2652   C  CD2  . TYR A  1 163 ? 2.406   -6.170  -29.951 1.00 0.00 ?  478 TYR A CD2  1  
ATOM   2653   C  CE1  . TYR A  1 163 ? 4.275   -5.927  -32.057 1.00 0.00 ?  478 TYR A CE1  1  
ATOM   2654   C  CE2  . TYR A  1 163 ? 3.569   -6.932  -29.994 1.00 0.00 ?  478 TYR A CE2  1  
ATOM   2655   C  CZ   . TYR A  1 163 ? 4.476   -6.856  -31.043 1.00 0.00 ?  478 TYR A CZ   1  
ATOM   2656   O  OH   . TYR A  1 163 ? 5.630   -7.673  -31.035 1.00 0.00 ?  478 TYR A OH   1  
ATOM   2657   H  H    . TYR A  1 163 ? 1.030   -1.241  -30.443 1.00 0.00 ?  478 TYR A H    1  
ATOM   2658   H  HA   . TYR A  1 163 ? 1.891   -3.293  -28.497 1.00 0.00 ?  478 TYR A HA   1  
ATOM   2659   H  HB2  . TYR A  1 163 ? 0.484   -4.336  -30.173 1.00 0.00 ?  478 TYR A HB2  1  
ATOM   2660   H  HB3  . TYR A  1 163 ? 1.222   -3.479  -31.547 1.00 0.00 ?  478 TYR A HB3  1  
ATOM   2661   H  HD1  . TYR A  1 163 ? 3.065   -4.301  -32.682 1.00 0.00 ?  478 TYR A HD1  1  
ATOM   2662   H  HD2  . TYR A  1 163 ? 1.758   -6.188  -29.086 1.00 0.00 ?  478 TYR A HD2  1  
ATOM   2663   H  HE1  . TYR A  1 163 ? 4.930   -5.880  -32.914 1.00 0.00 ?  478 TYR A HE1  1  
ATOM   2664   H  HE2  . TYR A  1 163 ? 3.730   -7.741  -29.297 1.00 0.00 ?  478 TYR A HE2  1  
ATOM   2665   H  HH   . TYR A  1 163 ? 6.112   -7.297  -31.775 1.00 0.00 ?  478 TYR A HH   1  
ATOM   2666   N  N    . LYS A  1 164 ? 4.258   -3.255  -29.258 1.00 0.00 ?  479 LYS A N    1  
ATOM   2667   C  CA   . LYS A  1 164 ? 5.691   -3.119  -29.297 1.00 0.00 ?  479 LYS A CA   1  
ATOM   2668   C  C    . LYS A  1 164 ? 6.312   -4.247  -28.523 1.00 0.00 ?  479 LYS A C    1  
ATOM   2669   O  O    . LYS A  1 164 ? 6.020   -4.265  -27.342 1.00 0.00 ?  479 LYS A O    1  
ATOM   2670   C  CB   . LYS A  1 164 ? 6.210   -1.887  -28.644 1.00 0.00 ?  479 LYS A CB   1  
ATOM   2671   C  CG   . LYS A  1 164 ? 7.756   -1.615  -28.631 1.00 0.00 ?  479 LYS A CG   1  
ATOM   2672   C  CD   . LYS A  1 164 ? 7.988   -0.108  -28.348 1.00 0.00 ?  479 LYS A CD   1  
ATOM   2673   C  CE   . LYS A  1 164 ? 9.398   0.306   -27.843 1.00 0.00 ?  479 LYS A CE   1  
ATOM   2674   N  NZ   . LYS A  1 164 ? 9.504   1.800   -27.735 1.00 0.00 1  479 LYS A NZ   1  
ATOM   2675   H  H    . LYS A  1 164 ? 3.946   -4.073  -28.781 1.00 0.00 ?  479 LYS A H    1  
ATOM   2676   H  HA   . LYS A  1 164 ? 6.110   -3.243  -30.284 1.00 0.00 ?  479 LYS A HA   1  
ATOM   2677   H  HB2  . LYS A  1 164 ? 5.781   -1.001  -29.158 1.00 0.00 ?  479 LYS A HB2  1  
ATOM   2678   H  HB3  . LYS A  1 164 ? 5.856   -1.814  -27.593 1.00 0.00 ?  479 LYS A HB3  1  
ATOM   2679   H  HG2  . LYS A  1 164 ? 8.156   -2.232  -27.797 1.00 0.00 ?  479 LYS A HG2  1  
ATOM   2680   H  HG3  . LYS A  1 164 ? 8.218   -1.950  -29.584 1.00 0.00 ?  479 LYS A HG3  1  
ATOM   2681   H  HD2  . LYS A  1 164 ? 7.683   0.532   -29.203 1.00 0.00 ?  479 LYS A HD2  1  
ATOM   2682   H  HD3  . LYS A  1 164 ? 7.243   0.065   -27.542 1.00 0.00 ?  479 LYS A HD3  1  
ATOM   2683   H  HE2  . LYS A  1 164 ? 9.652   -0.179  -26.877 1.00 0.00 ?  479 LYS A HE2  1  
ATOM   2684   H  HE3  . LYS A  1 164 ? 10.232  0.051   -28.532 1.00 0.00 ?  479 LYS A HE3  1  
ATOM   2685   H  HZ1  . LYS A  1 164 ? 9.881   1.962   -26.779 1.00 0.00 ?  479 LYS A HZ1  1  
ATOM   2686   H  HZ2  . LYS A  1 164 ? 8.638   2.359   -27.873 1.00 0.00 ?  479 LYS A HZ2  1  
ATOM   2687   H  HZ3  . LYS A  1 164 ? 10.154  2.086   -28.495 1.00 0.00 ?  479 LYS A HZ3  1  
ATOM   2688   N  N    . GLY A  1 165 ? 7.176   -5.120  -29.171 1.00 0.00 ?  480 GLY A N    1  
ATOM   2689   C  CA   . GLY A  1 165 ? 8.078   -6.041  -28.512 1.00 0.00 ?  480 GLY A CA   1  
ATOM   2690   C  C    . GLY A  1 165 ? 7.400   -7.019  -27.634 1.00 0.00 ?  480 GLY A C    1  
ATOM   2691   O  O    . GLY A  1 165 ? 7.690   -7.147  -26.476 1.00 0.00 ?  480 GLY A O    1  
ATOM   2692   H  H    . GLY A  1 165 ? 7.182   -5.098  -30.168 1.00 0.00 ?  480 GLY A H    1  
ATOM   2693   H  HA2  . GLY A  1 165 ? 8.506   -6.602  -29.329 1.00 0.00 ?  480 GLY A HA2  1  
ATOM   2694   H  HA3  . GLY A  1 165 ? 8.765   -5.464  -27.911 1.00 0.00 ?  480 GLY A HA3  1  
ATOM   2695   N  N    . ASN A  1 166 ? 6.442   -7.787  -28.159 1.00 0.00 ?  481 ASN A N    1  
ATOM   2696   C  CA   . ASN A  1 166 ? 5.854   -8.983  -27.568 1.00 0.00 ?  481 ASN A CA   1  
ATOM   2697   C  C    . ASN A  1 166 ? 4.663   -8.653  -26.642 1.00 0.00 ?  481 ASN A C    1  
ATOM   2698   O  O    . ASN A  1 166 ? 3.935   -9.543  -26.279 1.00 0.00 ?  481 ASN A O    1  
ATOM   2699   C  CB   . ASN A  1 166 ? 6.814   -10.127 -27.010 1.00 0.00 ?  481 ASN A CB   1  
ATOM   2700   C  CG   . ASN A  1 166 ? 7.668   -10.686 -28.136 1.00 0.00 ?  481 ASN A CG   1  
ATOM   2701   O  OD1  . ASN A  1 166 ? 7.509   -10.329 -29.268 1.00 0.00 ?  481 ASN A OD1  1  
ATOM   2702   N  ND2  . ASN A  1 166 ? 8.670   -11.480 -27.737 1.00 0.00 ?  481 ASN A ND2  1  
ATOM   2703   H  H    . ASN A  1 166 ? 6.265   -7.690  -29.136 1.00 0.00 ?  481 ASN A H    1  
ATOM   2704   H  HA   . ASN A  1 166 ? 5.319   -9.496  -28.354 1.00 0.00 ?  481 ASN A HA   1  
ATOM   2705   H  HB2  . ASN A  1 166 ? 7.507   -9.737  -26.234 1.00 0.00 ?  481 ASN A HB2  1  
ATOM   2706   H  HB3  . ASN A  1 166 ? 6.282   -10.945 -26.479 1.00 0.00 ?  481 ASN A HB3  1  
ATOM   2707   H  HD21 . ASN A  1 166 ? 9.460   -11.589 -28.340 1.00 0.00 ?  481 ASN A HD21 1  
ATOM   2708   H  HD22 . ASN A  1 166 ? 8.531   -12.087 -26.953 1.00 0.00 ?  481 ASN A HD22 1  
ATOM   2709   N  N    . LYS A  1 167 ? 4.397   -7.399  -26.352 1.00 0.00 ?  482 LYS A N    1  
ATOM   2710   C  CA   . LYS A  1 167 ? 3.374   -6.862  -25.434 1.00 0.00 ?  482 LYS A CA   1  
ATOM   2711   C  C    . LYS A  1 167 ? 2.418   -5.879  -26.019 1.00 0.00 ?  482 LYS A C    1  
ATOM   2712   O  O    . LYS A  1 167 ? 2.637   -5.268  -27.013 1.00 0.00 ?  482 LYS A O    1  
ATOM   2713   C  CB   . LYS A  1 167 ? 4.193   -6.195  -24.317 1.00 0.00 ?  482 LYS A CB   1  
ATOM   2714   C  CG   . LYS A  1 167 ? 5.080   -7.109  -23.448 1.00 0.00 ?  482 LYS A CG   1  
ATOM   2715   C  CD   . LYS A  1 167 ? 4.320   -8.071  -22.612 1.00 0.00 ?  482 LYS A CD   1  
ATOM   2716   C  CE   . LYS A  1 167 ? 5.229   -8.876  -21.665 1.00 0.00 ?  482 LYS A CE   1  
ATOM   2717   N  NZ   . LYS A  1 167 ? 5.612   -8.120  -20.411 1.00 0.00 1  482 LYS A NZ   1  
ATOM   2718   H  H    . LYS A  1 167 ? 5.024   -6.697  -26.681 1.00 0.00 ?  482 LYS A H    1  
ATOM   2719   H  HA   . LYS A  1 167 ? 2.734   -7.644  -25.052 1.00 0.00 ?  482 LYS A HA   1  
ATOM   2720   H  HB2  . LYS A  1 167 ? 4.956   -5.520  -24.762 1.00 0.00 ?  482 LYS A HB2  1  
ATOM   2721   H  HB3  . LYS A  1 167 ? 3.549   -5.545  -23.687 1.00 0.00 ?  482 LYS A HB3  1  
ATOM   2722   H  HG2  . LYS A  1 167 ? 5.910   -7.537  -24.049 1.00 0.00 ?  482 LYS A HG2  1  
ATOM   2723   H  HG3  . LYS A  1 167 ? 5.485   -6.368  -22.726 1.00 0.00 ?  482 LYS A HG3  1  
ATOM   2724   H  HD2  . LYS A  1 167 ? 3.415   -7.631  -22.141 1.00 0.00 ?  482 LYS A HD2  1  
ATOM   2725   H  HD3  . LYS A  1 167 ? 3.784   -8.742  -23.317 1.00 0.00 ?  482 LYS A HD3  1  
ATOM   2726   H  HE2  . LYS A  1 167 ? 4.821   -9.878  -21.410 1.00 0.00 ?  482 LYS A HE2  1  
ATOM   2727   H  HE3  . LYS A  1 167 ? 6.247   -9.048  -22.075 1.00 0.00 ?  482 LYS A HE3  1  
ATOM   2728   H  HZ1  . LYS A  1 167 ? 4.812   -7.922  -19.777 1.00 0.00 ?  482 LYS A HZ1  1  
ATOM   2729   H  HZ2  . LYS A  1 167 ? 5.956   -7.175  -20.678 1.00 0.00 ?  482 LYS A HZ2  1  
ATOM   2730   H  HZ3  . LYS A  1 167 ? 6.298   -8.680  -19.867 1.00 0.00 ?  482 LYS A HZ3  1  
ATOM   2731   N  N    . TYR A  1 168 ? 1.287   -5.719  -25.330 1.00 0.00 ?  483 TYR A N    1  
ATOM   2732   C  CA   . TYR A  1 168 ? 0.286   -4.782  -25.834 1.00 0.00 ?  483 TYR A CA   1  
ATOM   2733   C  C    . TYR A  1 168 ? -0.181  -3.989  -24.690 1.00 0.00 ?  483 TYR A C    1  
ATOM   2734   O  O    . TYR A  1 168 ? -0.196  -4.350  -23.566 1.00 0.00 ?  483 TYR A O    1  
ATOM   2735   C  CB   . TYR A  1 168 ? -0.873  -5.374  -26.684 1.00 0.00 ?  483 TYR A CB   1  
ATOM   2736   C  CG   . TYR A  1 168 ? -1.789  -6.256  -25.905 1.00 0.00 ?  483 TYR A CG   1  
ATOM   2737   C  CD1  . TYR A  1 168 ? -1.484  -7.624  -25.561 1.00 0.00 ?  483 TYR A CD1  1  
ATOM   2738   C  CD2  . TYR A  1 168 ? -3.143  -5.819  -25.647 1.00 0.00 ?  483 TYR A CD2  1  
ATOM   2739   C  CE1  . TYR A  1 168 ? -2.443  -8.485  -24.985 1.00 0.00 ?  483 TYR A CE1  1  
ATOM   2740   C  CE2  . TYR A  1 168 ? -4.053  -6.708  -25.102 1.00 0.00 ?  483 TYR A CE2  1  
ATOM   2741   C  CZ   . TYR A  1 168 ? -3.737  -7.990  -24.740 1.00 0.00 ?  483 TYR A CZ   1  
ATOM   2742   O  OH   . TYR A  1 168 ? -4.776  -8.903  -24.378 1.00 0.00 ?  483 TYR A OH   1  
ATOM   2743   H  H    . TYR A  1 168 ? 1.074   -6.278  -24.532 1.00 0.00 ?  483 TYR A H    1  
ATOM   2744   H  HA   . TYR A  1 168 ? 0.803   -4.093  -26.487 1.00 0.00 ?  483 TYR A HA   1  
ATOM   2745   H  HB2  . TYR A  1 168 ? -1.472  -4.477  -26.952 1.00 0.00 ?  483 TYR A HB2  1  
ATOM   2746   H  HB3  . TYR A  1 168 ? -0.542  -5.884  -27.614 1.00 0.00 ?  483 TYR A HB3  1  
ATOM   2747   H  HD1  . TYR A  1 168 ? -0.499  -8.035  -25.723 1.00 0.00 ?  483 TYR A HD1  1  
ATOM   2748   H  HD2  . TYR A  1 168 ? -3.356  -4.816  -25.988 1.00 0.00 ?  483 TYR A HD2  1  
ATOM   2749   H  HE1  . TYR A  1 168 ? -2.192  -9.533  -24.920 1.00 0.00 ?  483 TYR A HE1  1  
ATOM   2750   H  HE2  . TYR A  1 168 ? -5.094  -6.421  -25.089 1.00 0.00 ?  483 TYR A HE2  1  
ATOM   2751   H  HH   . TYR A  1 168 ? -4.418  -9.791  -24.307 1.00 0.00 ?  483 TYR A HH   1  
ATOM   2752   N  N    . TRP A  1 169 ? -0.691  -2.843  -25.070 1.00 0.00 ?  484 TRP A N    1  
ATOM   2753   C  CA   . TRP A  1 169 ? -1.167  -1.848  -24.172 1.00 0.00 ?  484 TRP A CA   1  
ATOM   2754   C  C    . TRP A  1 169 ? -2.630  -1.607  -24.489 1.00 0.00 ?  484 TRP A C    1  
ATOM   2755   O  O    . TRP A  1 169 ? -3.021  -1.425  -25.679 1.00 0.00 ?  484 TRP A O    1  
ATOM   2756   C  CB   . TRP A  1 169 ? -0.482  -0.440  -24.342 1.00 0.00 ?  484 TRP A CB   1  
ATOM   2757   C  CG   . TRP A  1 169 ? 0.907   -0.334  -23.789 1.00 0.00 ?  484 TRP A CG   1  
ATOM   2758   C  CD1  . TRP A  1 169 ? 1.180   0.314   -22.591 1.00 0.00 ?  484 TRP A CD1  1  
ATOM   2759   C  CD2  . TRP A  1 169 ? 2.148   -0.780  -24.295 1.00 0.00 ?  484 TRP A CD2  1  
ATOM   2760   N  NE1  . TRP A  1 169 ? 2.553   0.309   -22.361 1.00 0.00 ?  484 TRP A NE1  1  
ATOM   2761   C  CE2  . TRP A  1 169 ? 3.162   -0.369  -23.395 1.00 0.00 ?  484 TRP A CE2  1  
ATOM   2762   C  CE3  . TRP A  1 169 ? 2.480   -1.493  -25.491 1.00 0.00 ?  484 TRP A CE3  1  
ATOM   2763   C  CZ2  . TRP A  1 169 ? 4.519   -0.664  -23.658 1.00 0.00 ?  484 TRP A CZ2  1  
ATOM   2764   C  CZ3  . TRP A  1 169 ? 3.784   -1.818  -25.657 1.00 0.00 ?  484 TRP A CZ3  1  
ATOM   2765   C  CH2  . TRP A  1 169 ? 4.809   -1.377  -24.805 1.00 0.00 ?  484 TRP A CH2  1  
ATOM   2766   H  H    . TRP A  1 169 ? -0.798  -2.560  -26.020 1.00 0.00 ?  484 TRP A H    1  
ATOM   2767   H  HA   . TRP A  1 169 ? -0.999  -2.123  -23.141 1.00 0.00 ?  484 TRP A HA   1  
ATOM   2768   H  HB2  . TRP A  1 169 ? -0.466  -0.247  -25.436 1.00 0.00 ?  484 TRP A HB2  1  
ATOM   2769   H  HB3  . TRP A  1 169 ? -1.095  0.332   -23.830 1.00 0.00 ?  484 TRP A HB3  1  
ATOM   2770   H  HD1  . TRP A  1 169 ? 0.469   0.680   -21.865 1.00 0.00 ?  484 TRP A HD1  1  
ATOM   2771   H  HE1  . TRP A  1 169 ? 3.062   0.697   -21.624 1.00 0.00 ?  484 TRP A HE1  1  
ATOM   2772   H  HE3  . TRP A  1 169 ? 1.782   -2.001  -26.141 1.00 0.00 ?  484 TRP A HE3  1  
ATOM   2773   H  HZ2  . TRP A  1 169 ? 5.327   -0.397  -22.992 1.00 0.00 ?  484 TRP A HZ2  1  
ATOM   2774   H  HZ3  . TRP A  1 169 ? 4.079   -2.533  -26.410 1.00 0.00 ?  484 TRP A HZ3  1  
ATOM   2775   H  HH2  . TRP A  1 169 ? 5.785   -1.736  -25.099 1.00 0.00 ?  484 TRP A HH2  1  
ATOM   2776   N  N    . LYS A  1 170 ? -3.498  -1.738  -23.451 1.00 0.00 ?  485 LYS A N    1  
ATOM   2777   C  CA   . LYS A  1 170 ? -4.872  -1.310  -23.581 1.00 0.00 ?  485 LYS A CA   1  
ATOM   2778   C  C    . LYS A  1 170 ? -5.111  0.042   -23.054 1.00 0.00 ?  485 LYS A C    1  
ATOM   2779   O  O    . LYS A  1 170 ? -4.872  0.301   -21.878 1.00 0.00 ?  485 LYS A O    1  
ATOM   2780   C  CB   . LYS A  1 170 ? -5.655  -2.300  -22.774 1.00 0.00 ?  485 LYS A CB   1  
ATOM   2781   C  CG   . LYS A  1 170 ? -7.223  -2.108  -22.776 1.00 0.00 ?  485 LYS A CG   1  
ATOM   2782   C  CD   . LYS A  1 170 ? -7.982  -3.343  -22.195 1.00 0.00 ?  485 LYS A CD   1  
ATOM   2783   C  CE   . LYS A  1 170 ? -9.534  -3.263  -22.578 1.00 0.00 ?  485 LYS A CE   1  
ATOM   2784   N  NZ   . LYS A  1 170 ? -10.258 -4.579  -22.310 1.00 0.00 1  485 LYS A NZ   1  
ATOM   2785   H  H    . LYS A  1 170 ? -3.444  -2.056  -22.508 1.00 0.00 ?  485 LYS A H    1  
ATOM   2786   H  HA   . LYS A  1 170 ? -5.283  -1.374  -24.578 1.00 0.00 ?  485 LYS A HA   1  
ATOM   2787   H  HB2  . LYS A  1 170 ? -5.608  -3.344  -23.151 1.00 0.00 ?  485 LYS A HB2  1  
ATOM   2788   H  HB3  . LYS A  1 170 ? -5.278  -2.320  -21.730 1.00 0.00 ?  485 LYS A HB3  1  
ATOM   2789   H  HG2  . LYS A  1 170 ? -7.448  -1.177  -22.213 1.00 0.00 ?  485 LYS A HG2  1  
ATOM   2790   H  HG3  . LYS A  1 170 ? -7.659  -1.931  -23.782 1.00 0.00 ?  485 LYS A HG3  1  
ATOM   2791   H  HD2  . LYS A  1 170 ? -7.543  -4.211  -22.732 1.00 0.00 ?  485 LYS A HD2  1  
ATOM   2792   H  HD3  . LYS A  1 170 ? -7.700  -3.456  -21.126 1.00 0.00 ?  485 LYS A HD3  1  
ATOM   2793   H  HE2  . LYS A  1 170 ? -9.946  -2.467  -21.922 1.00 0.00 ?  485 LYS A HE2  1  
ATOM   2794   H  HE3  . LYS A  1 170 ? -9.750  -2.995  -23.634 1.00 0.00 ?  485 LYS A HE3  1  
ATOM   2795   H  HZ1  . LYS A  1 170 ? -9.974  -5.203  -23.092 1.00 0.00 ?  485 LYS A HZ1  1  
ATOM   2796   H  HZ2  . LYS A  1 170 ? -11.276 -4.390  -22.410 1.00 0.00 ?  485 LYS A HZ2  1  
ATOM   2797   H  HZ3  . LYS A  1 170 ? -10.009 -4.844  -21.336 1.00 0.00 ?  485 LYS A HZ3  1  
ATOM   2798   N  N    . PHE A  1 171 ? -5.596  0.961   -23.880 1.00 0.00 ?  486 PHE A N    1  
ATOM   2799   C  CA   . PHE A  1 171 ? -5.739  2.309   -23.491 1.00 0.00 ?  486 PHE A CA   1  
ATOM   2800   C  C    . PHE A  1 171 ? -7.190  2.613   -23.546 1.00 0.00 ?  486 PHE A C    1  
ATOM   2801   O  O    . PHE A  1 171 ? -7.927  2.409   -24.554 1.00 0.00 ?  486 PHE A O    1  
ATOM   2802   C  CB   . PHE A  1 171 ? -4.732  3.158   -24.304 1.00 0.00 ?  486 PHE A CB   1  
ATOM   2803   C  CG   . PHE A  1 171 ? -4.997  4.653   -24.189 1.00 0.00 ?  486 PHE A CG   1  
ATOM   2804   C  CD1  . PHE A  1 171 ? -4.197  5.496   -23.375 1.00 0.00 ?  486 PHE A CD1  1  
ATOM   2805   C  CD2  . PHE A  1 171 ? -5.986  5.220   -24.974 1.00 0.00 ?  486 PHE A CD2  1  
ATOM   2806   C  CE1  . PHE A  1 171 ? -4.184  6.848   -23.575 1.00 0.00 ?  486 PHE A CE1  1  
ATOM   2807   C  CE2  . PHE A  1 171 ? -6.123  6.622   -25.053 1.00 0.00 ?  486 PHE A CE2  1  
ATOM   2808   C  CZ   . PHE A  1 171 ? -5.173  7.504   -24.325 1.00 0.00 ?  486 PHE A CZ   1  
ATOM   2809   H  H    . PHE A  1 171 ? -5.753  0.844   -24.857 1.00 0.00 ?  486 PHE A H    1  
ATOM   2810   H  HA   . PHE A  1 171 ? -5.501  2.570   -22.470 1.00 0.00 ?  486 PHE A HA   1  
ATOM   2811   H  HB2  . PHE A  1 171 ? -3.724  2.941   -23.889 1.00 0.00 ?  486 PHE A HB2  1  
ATOM   2812   H  HB3  . PHE A  1 171 ? -4.661  2.862   -25.373 1.00 0.00 ?  486 PHE A HB3  1  
ATOM   2813   H  HD1  . PHE A  1 171 ? -3.678  4.949   -22.601 1.00 0.00 ?  486 PHE A HD1  1  
ATOM   2814   H  HD2  . PHE A  1 171 ? -6.713  4.648   -25.531 1.00 0.00 ?  486 PHE A HD2  1  
ATOM   2815   H  HE1  . PHE A  1 171 ? -3.540  7.455   -22.956 1.00 0.00 ?  486 PHE A HE1  1  
ATOM   2816   H  HE2  . PHE A  1 171 ? -6.982  7.055   -25.545 1.00 0.00 ?  486 PHE A HE2  1  
ATOM   2817   H  HZ   . PHE A  1 171 ? -5.399  8.552   -24.454 1.00 0.00 ?  486 PHE A HZ   1  
ATOM   2818   N  N    . ASN A  1 172 ? -7.737  3.184   -22.468 1.00 0.00 ?  487 ASN A N    1  
ATOM   2819   C  CA   . ASN A  1 172 ? -9.146  3.574   -22.381 1.00 0.00 ?  487 ASN A CA   1  
ATOM   2820   C  C    . ASN A  1 172 ? -9.301  5.001   -23.031 1.00 0.00 ?  487 ASN A C    1  
ATOM   2821   O  O    . ASN A  1 172 ? -8.655  5.971   -22.617 1.00 0.00 ?  487 ASN A O    1  
ATOM   2822   C  CB   . ASN A  1 172 ? -9.601  3.500   -20.921 1.00 0.00 ?  487 ASN A CB   1  
ATOM   2823   C  CG   . ASN A  1 172 ? -11.045 3.879   -20.657 1.00 0.00 ?  487 ASN A CG   1  
ATOM   2824   O  OD1  . ASN A  1 172 ? -11.443 5.086   -20.620 1.00 0.00 ?  487 ASN A OD1  1  
ATOM   2825   N  ND2  . ASN A  1 172 ? -12.011 2.980   -20.545 1.00 0.00 ?  487 ASN A ND2  1  
ATOM   2826   H  H    . ASN A  1 172 ? -7.199  3.332   -21.642 1.00 0.00 ?  487 ASN A H    1  
ATOM   2827   H  HA   . ASN A  1 172 ? -9.750  2.883   -22.951 1.00 0.00 ?  487 ASN A HA   1  
ATOM   2828   H  HB2  . ASN A  1 172 ? -9.567  2.433   -20.615 1.00 0.00 ?  487 ASN A HB2  1  
ATOM   2829   H  HB3  . ASN A  1 172 ? -8.953  4.119   -20.263 1.00 0.00 ?  487 ASN A HB3  1  
ATOM   2830   H  HD21 . ASN A  1 172 ? -12.792 3.260   -19.988 1.00 0.00 ?  487 ASN A HD21 1  
ATOM   2831   H  HD22 . ASN A  1 172 ? -11.863 2.031   -20.823 1.00 0.00 ?  487 ASN A HD22 1  
ATOM   2832   N  N    . ASN A  1 173 ? -10.183 5.235   -24.088 1.00 0.00 ?  488 ASN A N    1  
ATOM   2833   C  CA   . ASN A  1 173 ? -10.336 6.534   -24.778 1.00 0.00 ?  488 ASN A CA   1  
ATOM   2834   C  C    . ASN A  1 173 ? -11.276 7.469   -23.970 1.00 0.00 ?  488 ASN A C    1  
ATOM   2835   O  O    . ASN A  1 173 ? -11.168 8.679   -24.082 1.00 0.00 ?  488 ASN A O    1  
ATOM   2836   C  CB   . ASN A  1 173 ? -11.024 6.460   -26.142 1.00 0.00 ?  488 ASN A CB   1  
ATOM   2837   C  CG   . ASN A  1 173 ? -10.334 5.484   -27.068 1.00 0.00 ?  488 ASN A CG   1  
ATOM   2838   O  OD1  . ASN A  1 173 ? -9.183  5.099   -26.876 1.00 0.00 ?  488 ASN A OD1  1  
ATOM   2839   N  ND2  . ASN A  1 173 ? -11.143 4.806   -27.896 1.00 0.00 ?  488 ASN A ND2  1  
ATOM   2840   H  H    . ASN A  1 173 ? -10.583 4.447   -24.549 1.00 0.00 ?  488 ASN A H    1  
ATOM   2841   H  HA   . ASN A  1 173 ? -9.396  7.060   -24.852 1.00 0.00 ?  488 ASN A HA   1  
ATOM   2842   H  HB2  . ASN A  1 173 ? -12.076 6.141   -25.980 1.00 0.00 ?  488 ASN A HB2  1  
ATOM   2843   H  HB3  . ASN A  1 173 ? -10.947 7.471   -26.597 1.00 0.00 ?  488 ASN A HB3  1  
ATOM   2844   H  HD21 . ASN A  1 173 ? -12.134 4.828   -27.765 1.00 0.00 ?  488 ASN A HD21 1  
ATOM   2845   H  HD22 . ASN A  1 173 ? -10.638 4.087   -28.374 1.00 0.00 ?  488 ASN A HD22 1  
ATOM   2846   N  N    . GLN A  1 174 ? -12.152 6.938   -23.111 1.00 0.00 ?  489 GLN A N    1  
ATOM   2847   C  CA   . GLN A  1 174 ? -13.047 7.688   -22.220 1.00 0.00 ?  489 GLN A CA   1  
ATOM   2848   C  C    . GLN A  1 174 ? -12.396 8.518   -21.207 1.00 0.00 ?  489 GLN A C    1  
ATOM   2849   O  O    . GLN A  1 174 ? -12.700 9.659   -21.115 1.00 0.00 ?  489 GLN A O    1  
ATOM   2850   C  CB   . GLN A  1 174 ? -14.107 6.857   -21.523 1.00 0.00 ?  489 GLN A CB   1  
ATOM   2851   C  CG   . GLN A  1 174 ? -15.432 6.663   -22.280 1.00 0.00 ?  489 GLN A CG   1  
ATOM   2852   C  CD   . GLN A  1 174 ? -15.859 7.778   -23.173 1.00 0.00 ?  489 GLN A CD   1  
ATOM   2853   O  OE1  . GLN A  1 174 ? -15.867 7.743   -24.380 1.00 0.00 ?  489 GLN A OE1  1  
ATOM   2854   N  NE2  . GLN A  1 174 ? -16.277 8.911   -22.599 1.00 0.00 ?  489 GLN A NE2  1  
ATOM   2855   H  H    . GLN A  1 174 ? -12.130 5.954   -22.953 1.00 0.00 ?  489 GLN A H    1  
ATOM   2856   H  HA   . GLN A  1 174 ? -13.496 8.414   -22.881 1.00 0.00 ?  489 GLN A HA   1  
ATOM   2857   H  HB2  . GLN A  1 174 ? -13.780 5.844   -21.204 1.00 0.00 ?  489 GLN A HB2  1  
ATOM   2858   H  HB3  . GLN A  1 174 ? -14.419 7.324   -20.564 1.00 0.00 ?  489 GLN A HB3  1  
ATOM   2859   H  HG2  . GLN A  1 174 ? -15.274 5.730   -22.862 1.00 0.00 ?  489 GLN A HG2  1  
ATOM   2860   H  HG3  . GLN A  1 174 ? -16.350 6.399   -21.711 1.00 0.00 ?  489 GLN A HG3  1  
ATOM   2861   H  HE21 . GLN A  1 174 ? -16.662 9.686   -23.101 1.00 0.00 ?  489 GLN A HE21 1  
ATOM   2862   H  HE22 . GLN A  1 174 ? -16.252 8.872   -21.601 1.00 0.00 ?  489 GLN A HE22 1  
ATOM   2863   N  N    . LYS A  1 175 ? -11.468 7.937   -20.436 1.00 0.00 ?  490 LYS A N    1  
ATOM   2864   C  CA   . LYS A  1 175 ? -10.940 8.513   -19.283 1.00 0.00 ?  490 LYS A CA   1  
ATOM   2865   C  C    . LYS A  1 175 ? -9.474  8.503   -19.458 1.00 0.00 ?  490 LYS A C    1  
ATOM   2866   O  O    . LYS A  1 175 ? -8.803  9.045   -18.621 1.00 0.00 ?  490 LYS A O    1  
ATOM   2867   C  CB   . LYS A  1 175 ? -11.367 7.709   -18.104 1.00 0.00 ?  490 LYS A CB   1  
ATOM   2868   C  CG   . LYS A  1 175 ? -12.831 8.111   -17.730 1.00 0.00 ?  490 LYS A CG   1  
ATOM   2869   C  CD   . LYS A  1 175 ? -13.200 7.746   -16.276 1.00 0.00 ?  490 LYS A CD   1  
ATOM   2870   C  CE   . LYS A  1 175 ? -14.660 8.133   -15.978 1.00 0.00 ?  490 LYS A CE   1  
ATOM   2871   N  NZ   . LYS A  1 175 ? -15.174 7.419   -14.772 1.00 0.00 1  490 LYS A NZ   1  
ATOM   2872   H  H    . LYS A  1 175 ? -11.342 6.951   -20.517 1.00 0.00 ?  490 LYS A H    1  
ATOM   2873   H  HA   . LYS A  1 175 ? -11.241 9.547   -19.196 1.00 0.00 ?  490 LYS A HA   1  
ATOM   2874   H  HB2  . LYS A  1 175 ? -11.345 6.611   -18.274 1.00 0.00 ?  490 LYS A HB2  1  
ATOM   2875   H  HB3  . LYS A  1 175 ? -10.765 7.988   -17.212 1.00 0.00 ?  490 LYS A HB3  1  
ATOM   2876   H  HG2  . LYS A  1 175 ? -12.869 9.222   -17.755 1.00 0.00 ?  490 LYS A HG2  1  
ATOM   2877   H  HG3  . LYS A  1 175 ? -13.541 7.675   -18.466 1.00 0.00 ?  490 LYS A HG3  1  
ATOM   2878   H  HD2  . LYS A  1 175 ? -13.096 6.641   -16.235 1.00 0.00 ?  490 LYS A HD2  1  
ATOM   2879   H  HD3  . LYS A  1 175 ? -12.525 8.262   -15.559 1.00 0.00 ?  490 LYS A HD3  1  
ATOM   2880   H  HE2  . LYS A  1 175 ? -14.909 9.199   -15.794 1.00 0.00 ?  490 LYS A HE2  1  
ATOM   2881   H  HE3  . LYS A  1 175 ? -15.292 7.893   -16.860 1.00 0.00 ?  490 LYS A HE3  1  
ATOM   2882   H  HZ1  . LYS A  1 175 ? -14.723 6.493   -14.630 1.00 0.00 ?  490 LYS A HZ1  1  
ATOM   2883   H  HZ2  . LYS A  1 175 ? -16.189 7.212   -14.865 1.00 0.00 ?  490 LYS A HZ2  1  
ATOM   2884   H  HZ3  . LYS A  1 175 ? -14.953 8.025   -13.956 1.00 0.00 ?  490 LYS A HZ3  1  
ATOM   2885   N  N    . LEU A  1 176 ? -8.900  8.025   -20.563 1.00 0.00 ?  491 LEU A N    1  
ATOM   2886   C  CA   . LEU A  1 176 ? -7.661  8.553   -21.087 1.00 0.00 ?  491 LEU A CA   1  
ATOM   2887   C  C    . LEU A  1 176 ? -6.368  8.043   -20.442 1.00 0.00 ?  491 LEU A C    1  
ATOM   2888   O  O    . LEU A  1 176 ? -5.426  8.845   -20.242 1.00 0.00 ?  491 LEU A O    1  
ATOM   2889   C  CB   . LEU A  1 176 ? -7.774  10.073  -21.280 1.00 0.00 ?  491 LEU A CB   1  
ATOM   2890   C  CG   . LEU A  1 176 ? -8.986  10.539  -22.229 1.00 0.00 ?  491 LEU A CG   1  
ATOM   2891   C  CD1  . LEU A  1 176 ? -9.433  11.930  -21.957 1.00 0.00 ?  491 LEU A CD1  1  
ATOM   2892   C  CD2  . LEU A  1 176 ? -8.715  10.355  -23.769 1.00 0.00 ?  491 LEU A CD2  1  
ATOM   2893   H  H    . LEU A  1 176 ? -9.323  7.487   -21.289 1.00 0.00 ?  491 LEU A H    1  
ATOM   2894   H  HA   . LEU A  1 176 ? -7.656  8.163   -22.095 1.00 0.00 ?  491 LEU A HA   1  
ATOM   2895   H  HB2  . LEU A  1 176 ? -7.808  10.634  -20.322 1.00 0.00 ?  491 LEU A HB2  1  
ATOM   2896   H  HB3  . LEU A  1 176 ? -6.849  10.518  -21.706 1.00 0.00 ?  491 LEU A HB3  1  
ATOM   2897   H  HG   . LEU A  1 176 ? -9.897  9.960   -21.966 1.00 0.00 ?  491 LEU A HG   1  
ATOM   2898   H  HD11 . LEU A  1 176 ? -10.357 12.230  -22.496 1.00 0.00 ?  491 LEU A HD11 1  
ATOM   2899   H  HD12 . LEU A  1 176 ? -8.598  12.604  -22.244 1.00 0.00 ?  491 LEU A HD12 1  
ATOM   2900   H  HD13 . LEU A  1 176 ? -9.549  11.874  -20.853 1.00 0.00 ?  491 LEU A HD13 1  
ATOM   2901   H  HD21 . LEU A  1 176 ? -7.942  11.105  -24.042 1.00 0.00 ?  491 LEU A HD21 1  
ATOM   2902   H  HD22 . LEU A  1 176 ? -9.612  10.502  -24.408 1.00 0.00 ?  491 LEU A HD22 1  
ATOM   2903   H  HD23 . LEU A  1 176 ? -8.382  9.300   -23.865 1.00 0.00 ?  491 LEU A HD23 1  
ATOM   2904   N  N    . LYS A  1 177 ? -6.301  6.775   -20.124 1.00 0.00 ?  492 LYS A N    1  
ATOM   2905   C  CA   . LYS A  1 177 ? -5.078  6.051   -19.689 1.00 0.00 ?  492 LYS A CA   1  
ATOM   2906   C  C    . LYS A  1 177 ? -5.275  4.551   -19.917 1.00 0.00 ?  492 LYS A C    1  
ATOM   2907   O  O    . LYS A  1 177 ? -6.390  4.076   -20.135 1.00 0.00 ?  492 LYS A O    1  
ATOM   2908   C  CB   . LYS A  1 177 ? -4.659  6.421   -18.258 1.00 0.00 ?  492 LYS A CB   1  
ATOM   2909   C  CG   . LYS A  1 177 ? -5.696  6.021   -17.179 1.00 0.00 ?  492 LYS A CG   1  
ATOM   2910   C  CD   . LYS A  1 177 ? -5.018  6.096   -15.773 1.00 0.00 ?  492 LYS A CD   1  
ATOM   2911   C  CE   . LYS A  1 177 ? -5.109  7.462   -15.031 1.00 0.00 ?  492 LYS A CE   1  
ATOM   2912   N  NZ   . LYS A  1 177 ? -4.258  7.539   -13.826 1.00 0.00 1  492 LYS A NZ   1  
ATOM   2913   H  H    . LYS A  1 177 ? -7.069  6.156   -20.268 1.00 0.00 ?  492 LYS A H    1  
ATOM   2914   H  HA   . LYS A  1 177 ? -4.308  6.348   -20.386 1.00 0.00 ?  492 LYS A HA   1  
ATOM   2915   H  HB2  . LYS A  1 177 ? -3.665  5.956   -18.081 1.00 0.00 ?  492 LYS A HB2  1  
ATOM   2916   H  HB3  . LYS A  1 177 ? -4.443  7.511   -18.282 1.00 0.00 ?  492 LYS A HB3  1  
ATOM   2917   H  HG2  . LYS A  1 177 ? -6.583  6.691   -17.195 1.00 0.00 ?  492 LYS A HG2  1  
ATOM   2918   H  HG3  . LYS A  1 177 ? -5.998  4.965   -17.343 1.00 0.00 ?  492 LYS A HG3  1  
ATOM   2919   H  HD2  . LYS A  1 177 ? -5.452  5.327   -15.099 1.00 0.00 ?  492 LYS A HD2  1  
ATOM   2920   H  HD3  . LYS A  1 177 ? -3.932  5.872   -15.850 1.00 0.00 ?  492 LYS A HD3  1  
ATOM   2921   H  HE2  . LYS A  1 177 ? -4.776  8.324   -15.647 1.00 0.00 ?  492 LYS A HE2  1  
ATOM   2922   H  HE3  . LYS A  1 177 ? -6.149  7.712   -14.731 1.00 0.00 ?  492 LYS A HE3  1  
ATOM   2923   H  HZ1  . LYS A  1 177 ? -4.494  6.688   -13.276 1.00 0.00 ?  492 LYS A HZ1  1  
ATOM   2924   H  HZ2  . LYS A  1 177 ? -4.398  8.441   -13.328 1.00 0.00 ?  492 LYS A HZ2  1  
ATOM   2925   H  HZ3  . LYS A  1 177 ? -3.255  7.508   -14.096 1.00 0.00 ?  492 LYS A HZ3  1  
ATOM   2926   N  N    . VAL A  1 178 ? -4.177  3.824   -19.786 1.00 0.00 ?  493 VAL A N    1  
ATOM   2927   C  CA   . VAL A  1 178 ? -3.971  2.368   -19.727 1.00 0.00 ?  493 VAL A CA   1  
ATOM   2928   C  C    . VAL A  1 178 ? -4.672  1.767   -18.514 1.00 0.00 ?  493 VAL A C    1  
ATOM   2929   O  O    . VAL A  1 178 ? -4.683  2.274   -17.368 1.00 0.00 ?  493 VAL A O    1  
ATOM   2930   C  CB   . VAL A  1 178 ? -2.493  1.996   -19.801 1.00 0.00 ?  493 VAL A CB   1  
ATOM   2931   C  CG1  . VAL A  1 178 ? -1.712  2.670   -18.661 1.00 0.00 ?  493 VAL A CG1  1  
ATOM   2932   C  CG2  . VAL A  1 178 ? -2.322  0.486   -19.689 1.00 0.00 ?  493 VAL A CG2  1  
ATOM   2933   H  H    . VAL A  1 178 ? -3.368  4.325   -19.486 1.00 0.00 ?  493 VAL A H    1  
ATOM   2934   H  HA   . VAL A  1 178 ? -4.450  2.067   -20.647 1.00 0.00 ?  493 VAL A HA   1  
ATOM   2935   H  HB   . VAL A  1 178 ? -2.026  2.310   -20.760 1.00 0.00 ?  493 VAL A HB   1  
ATOM   2936   H  HG11 . VAL A  1 178 ? -0.628  2.428   -18.679 1.00 0.00 ?  493 VAL A HG11 1  
ATOM   2937   H  HG12 . VAL A  1 178 ? -2.210  2.425   -17.699 1.00 0.00 ?  493 VAL A HG12 1  
ATOM   2938   H  HG13 . VAL A  1 178 ? -1.858  3.770   -18.730 1.00 0.00 ?  493 VAL A HG13 1  
ATOM   2939   H  HG21 . VAL A  1 178 ? -2.415  0.105   -18.650 1.00 0.00 ?  493 VAL A HG21 1  
ATOM   2940   H  HG22 . VAL A  1 178 ? -1.269  0.331   -20.009 1.00 0.00 ?  493 VAL A HG22 1  
ATOM   2941   H  HG23 . VAL A  1 178 ? -2.894  -0.089  -20.448 1.00 0.00 ?  493 VAL A HG23 1  
ATOM   2942   N  N    . GLU A  1 179 ? -5.348  0.620   -18.706 1.00 0.00 ?  494 GLU A N    1  
ATOM   2943   C  CA   . GLU A  1 179 ? -6.021  -0.261  -17.756 1.00 0.00 ?  494 GLU A CA   1  
ATOM   2944   C  C    . GLU A  1 179 ? -5.139  -0.992  -16.768 1.00 0.00 ?  494 GLU A C    1  
ATOM   2945   O  O    . GLU A  1 179 ? -4.018  -1.263  -17.068 1.00 0.00 ?  494 GLU A O    1  
ATOM   2946   C  CB   . GLU A  1 179 ? -6.959  -1.259  -18.494 1.00 0.00 ?  494 GLU A CB   1  
ATOM   2947   C  CG   . GLU A  1 179 ? -8.099  -0.644  -19.337 1.00 0.00 ?  494 GLU A CG   1  
ATOM   2948   C  CD   . GLU A  1 179 ? -9.226  -0.079  -18.495 1.00 0.00 ?  494 GLU A CD   1  
ATOM   2949   O  OE1  . GLU A  1 179 ? -9.846  -0.960  -17.912 1.00 0.00 ?  494 GLU A OE1  1  
ATOM   2950   O  OE2  . GLU A  1 179 ? -9.425  1.170   -18.399 1.00 0.00 -1 494 GLU A OE2  1  
ATOM   2951   H  H    . GLU A  1 179 ? -5.290  0.318   -19.654 1.00 0.00 ?  494 GLU A H    1  
ATOM   2952   H  HA   . GLU A  1 179 ? -6.530  0.388   -17.059 1.00 0.00 ?  494 GLU A HA   1  
ATOM   2953   H  HB2  . GLU A  1 179 ? -6.389  -1.858  -19.236 1.00 0.00 ?  494 GLU A HB2  1  
ATOM   2954   H  HB3  . GLU A  1 179 ? -7.310  -1.971  -17.716 1.00 0.00 ?  494 GLU A HB3  1  
ATOM   2955   H  HG2  . GLU A  1 179 ? -7.726  0.049   -20.121 1.00 0.00 ?  494 GLU A HG2  1  
ATOM   2956   H  HG3  . GLU A  1 179 ? -8.686  -1.294  -20.021 1.00 0.00 ?  494 GLU A HG3  1  
ATOM   2957   N  N    . PRO A  1 180 ? -5.606  -1.271  -15.540 1.00 0.00 ?  495 PRO A N    1  
ATOM   2958   C  CA   . PRO A  1 180 ? -4.974  -2.204  -14.731 1.00 0.00 ?  495 PRO A CA   1  
ATOM   2959   C  C    . PRO A  1 180 ? -4.530  -3.530  -15.349 1.00 0.00 ?  495 PRO A C    1  
ATOM   2960   O  O    . PRO A  1 180 ? -5.339  -4.055  -16.139 1.00 0.00 ?  495 PRO A O    1  
ATOM   2961   C  CB   . PRO A  1 180 ? -5.974  -2.441  -13.541 1.00 0.00 ?  495 PRO A CB   1  
ATOM   2962   C  CG   . PRO A  1 180 ? -6.744  -1.173  -13.463 1.00 0.00 ?  495 PRO A CG   1  
ATOM   2963   C  CD   . PRO A  1 180 ? -6.839  -0.681  -14.905 1.00 0.00 ?  495 PRO A CD   1  
ATOM   2964   H  HA   . PRO A  1 180 ? -4.079  -1.695  -14.405 1.00 0.00 ?  495 PRO A HA   1  
ATOM   2965   H  HB2  . PRO A  1 180 ? -6.721  -3.207  -13.840 1.00 0.00 ?  495 PRO A HB2  1  
ATOM   2966   H  HB3  . PRO A  1 180 ? -5.402  -2.845  -12.679 1.00 0.00 ?  495 PRO A HB3  1  
ATOM   2967   H  HG2  . PRO A  1 180 ? -7.735  -1.179  -12.960 1.00 0.00 ?  495 PRO A HG2  1  
ATOM   2968   H  HG3  . PRO A  1 180 ? -6.167  -0.443  -12.857 1.00 0.00 ?  495 PRO A HG3  1  
ATOM   2969   H  HD2  . PRO A  1 180 ? -7.773  -1.065  -15.369 1.00 0.00 ?  495 PRO A HD2  1  
ATOM   2970   H  HD3  . PRO A  1 180 ? -6.832  0.429   -14.848 1.00 0.00 ?  495 PRO A HD3  1  
ATOM   2971   N  N    . GLY A  1 181 ? -3.313  -4.043  -15.158 1.00 0.00 ?  496 GLY A N    1  
ATOM   2972   C  CA   . GLY A  1 181 ? -2.715  -5.217  -15.660 1.00 0.00 ?  496 GLY A CA   1  
ATOM   2973   C  C    . GLY A  1 181 ? -2.433  -5.234  -17.085 1.00 0.00 ?  496 GLY A C    1  
ATOM   2974   O  O    . GLY A  1 181 ? -2.558  -6.261  -17.791 1.00 0.00 ?  496 GLY A O    1  
ATOM   2975   H  H    . GLY A  1 181 ? -2.655  -3.369  -14.831 1.00 0.00 ?  496 GLY A H    1  
ATOM   2976   H  HA2  . GLY A  1 181 ? -1.874  -5.425  -15.016 1.00 0.00 ?  496 GLY A HA2  1  
ATOM   2977   H  HA3  . GLY A  1 181 ? -3.483  -5.970  -15.556 1.00 0.00 ?  496 GLY A HA3  1  
ATOM   2978   N  N    . TYR A  1 182 ? -2.045  -4.077  -17.618 1.00 0.00 ?  497 TYR A N    1  
ATOM   2979   C  CA   . TYR A  1 182 ? -1.539  -3.890  -18.965 1.00 0.00 ?  497 TYR A CA   1  
ATOM   2980   C  C    . TYR A  1 182 ? -0.247  -3.126  -18.850 1.00 0.00 ?  497 TYR A C    1  
ATOM   2981   O  O    . TYR A  1 182 ? -0.312  -2.153  -18.079 1.00 0.00 ?  497 TYR A O    1  
ATOM   2982   C  CB   . TYR A  1 182 ? -2.480  -3.110  -19.914 1.00 0.00 ?  497 TYR A CB   1  
ATOM   2983   C  CG   . TYR A  1 182 ? -3.749  -3.932  -20.287 1.00 0.00 ?  497 TYR A CG   1  
ATOM   2984   C  CD1  . TYR A  1 182 ? -4.854  -4.007  -19.442 1.00 0.00 ?  497 TYR A CD1  1  
ATOM   2985   C  CD2  . TYR A  1 182 ? -3.726  -4.665  -21.468 1.00 0.00 ?  497 TYR A CD2  1  
ATOM   2986   C  CE1  . TYR A  1 182 ? -5.931  -4.856  -19.697 1.00 0.00 ?  497 TYR A CE1  1  
ATOM   2987   C  CE2  . TYR A  1 182 ? -4.833  -5.500  -21.780 1.00 0.00 ?  497 TYR A CE2  1  
ATOM   2988   C  CZ   . TYR A  1 182 ? -5.892  -5.670  -20.842 1.00 0.00 ?  497 TYR A CZ   1  
ATOM   2989   O  OH   . TYR A  1 182 ? -7.010  -6.389  -21.073 1.00 0.00 ?  497 TYR A OH   1  
ATOM   2990   H  H    . TYR A  1 182 ? -2.109  -3.196  -17.154 1.00 0.00 ?  497 TYR A H    1  
ATOM   2991   H  HA   . TYR A  1 182 ? -1.335  -4.900  -19.287 1.00 0.00 ?  497 TYR A HA   1  
ATOM   2992   H  HB2  . TYR A  1 182 ? -2.825  -2.192  -19.393 1.00 0.00 ?  497 TYR A HB2  1  
ATOM   2993   H  HB3  . TYR A  1 182 ? -2.003  -2.680  -20.821 1.00 0.00 ?  497 TYR A HB3  1  
ATOM   2994   H  HD1  . TYR A  1 182 ? -4.935  -3.335  -18.601 1.00 0.00 ?  497 TYR A HD1  1  
ATOM   2995   H  HD2  . TYR A  1 182 ? -2.961  -4.552  -22.221 1.00 0.00 ?  497 TYR A HD2  1  
ATOM   2996   H  HE1  . TYR A  1 182 ? -6.808  -4.869  -19.068 1.00 0.00 ?  497 TYR A HE1  1  
ATOM   2997   H  HE2  . TYR A  1 182 ? -4.812  -6.171  -22.625 1.00 0.00 ?  497 TYR A HE2  1  
ATOM   2998   H  HH   . TYR A  1 182 ? -7.464  -6.656  -20.270 1.00 0.00 ?  497 TYR A HH   1  
ATOM   2999   N  N    . PRO A  1 183 ? 0.885   -3.398  -19.469 1.00 0.00 ?  498 PRO A N    1  
ATOM   3000   C  CA   . PRO A  1 183 ? 1.229   -4.332  -20.489 1.00 0.00 ?  498 PRO A CA   1  
ATOM   3001   C  C    . PRO A  1 183 ? 0.765   -5.737  -20.399 1.00 0.00 ?  498 PRO A C    1  
ATOM   3002   O  O    . PRO A  1 183 ? 1.015   -6.297  -19.296 1.00 0.00 ?  498 PRO A O    1  
ATOM   3003   C  CB   . PRO A  1 183 ? 2.792   -4.323  -20.423 1.00 0.00 ?  498 PRO A CB   1  
ATOM   3004   C  CG   . PRO A  1 183 ? 3.124   -2.873  -20.136 1.00 0.00 ?  498 PRO A CG   1  
ATOM   3005   C  CD   . PRO A  1 183 ? 1.994   -2.419  -19.250 1.00 0.00 ?  498 PRO A CD   1  
ATOM   3006   H  HA   . PRO A  1 183 ? 0.855   -3.871  -21.392 1.00 0.00 ?  498 PRO A HA   1  
ATOM   3007   H  HB2  . PRO A  1 183 ? 3.135   -4.871  -19.520 1.00 0.00 ?  498 PRO A HB2  1  
ATOM   3008   H  HB3  . PRO A  1 183 ? 3.364   -4.736  -21.282 1.00 0.00 ?  498 PRO A HB3  1  
ATOM   3009   H  HG2  . PRO A  1 183 ? 4.020   -2.614  -19.533 1.00 0.00 ?  498 PRO A HG2  1  
ATOM   3010   H  HG3  . PRO A  1 183 ? 3.294   -2.353  -21.102 1.00 0.00 ?  498 PRO A HG3  1  
ATOM   3011   H  HD2  . PRO A  1 183 ? 2.293   -2.360  -18.182 1.00 0.00 ?  498 PRO A HD2  1  
ATOM   3012   H  HD3  . PRO A  1 183 ? 1.641   -1.378  -19.413 1.00 0.00 ?  498 PRO A HD3  1  
ATOM   3013   N  N    . LYS A  1 184 ? 0.218   -6.355  -21.437 1.00 0.00 ?  499 LYS A N    1  
ATOM   3014   C  CA   . LYS A  1 184 ? -0.056  -7.819  -21.470 1.00 0.00 ?  499 LYS A CA   1  
ATOM   3015   C  C    . LYS A  1 184 ? 0.702   -8.465  -22.649 1.00 0.00 ?  499 LYS A C    1  
ATOM   3016   O  O    . LYS A  1 184 ? 1.104   -7.812  -23.652 1.00 0.00 ?  499 LYS A O    1  
ATOM   3017   C  CB   . LYS A  1 184 ? -1.534  -8.168  -21.547 1.00 0.00 ?  499 LYS A CB   1  
ATOM   3018   C  CG   . LYS A  1 184 ? -2.469  -8.031  -20.333 1.00 0.00 ?  499 LYS A CG   1  
ATOM   3019   C  CD   . LYS A  1 184 ? -3.840  -8.667  -20.570 1.00 0.00 ?  499 LYS A CD   1  
ATOM   3020   C  CE   . LYS A  1 184 ? -4.725  -8.598  -19.291 1.00 0.00 ?  499 LYS A CE   1  
ATOM   3021   N  NZ   . LYS A  1 184 ? -6.022  -9.263  -19.417 1.00 0.00 1  499 LYS A NZ   1  
ATOM   3022   H  H    . LYS A  1 184 ? 0.103   -5.882  -22.307 1.00 0.00 ?  499 LYS A H    1  
ATOM   3023   H  HA   . LYS A  1 184 ? 0.262   -8.285  -20.549 1.00 0.00 ?  499 LYS A HA   1  
ATOM   3024   H  HB2  . LYS A  1 184 ? -1.934  -7.559  -22.385 1.00 0.00 ?  499 LYS A HB2  1  
ATOM   3025   H  HB3  . LYS A  1 184 ? -1.521  -9.261  -21.746 1.00 0.00 ?  499 LYS A HB3  1  
ATOM   3026   H  HG2  . LYS A  1 184 ? -1.997  -8.502  -19.444 1.00 0.00 ?  499 LYS A HG2  1  
ATOM   3027   H  HG3  . LYS A  1 184 ? -2.523  -6.937  -20.146 1.00 0.00 ?  499 LYS A HG3  1  
ATOM   3028   H  HD2  . LYS A  1 184 ? -4.441  -8.116  -21.324 1.00 0.00 ?  499 LYS A HD2  1  
ATOM   3029   H  HD3  . LYS A  1 184 ? -3.735  -9.732  -20.866 1.00 0.00 ?  499 LYS A HD3  1  
ATOM   3030   H  HE2  . LYS A  1 184 ? -4.175  -9.148  -18.498 1.00 0.00 ?  499 LYS A HE2  1  
ATOM   3031   H  HE3  . LYS A  1 184 ? -4.767  -7.512  -19.059 1.00 0.00 ?  499 LYS A HE3  1  
ATOM   3032   H  HZ1  . LYS A  1 184 ? -6.798  -8.615  -19.174 1.00 0.00 ?  499 LYS A HZ1  1  
ATOM   3033   H  HZ2  . LYS A  1 184 ? -6.163  -10.119 -18.842 1.00 0.00 ?  499 LYS A HZ2  1  
ATOM   3034   H  HZ3  . LYS A  1 184 ? -6.139  -9.653  -20.374 1.00 0.00 ?  499 LYS A HZ3  1  
ATOM   3035   N  N    . SER A  1 185 ? 0.927   -9.776  -22.650 1.00 0.00 ?  500 SER A N    1  
ATOM   3036   C  CA   . SER A  1 185 ? 1.520   -10.573 -23.743 1.00 0.00 ?  500 SER A CA   1  
ATOM   3037   C  C    . SER A  1 185 ? 0.644   -10.674 -24.985 1.00 0.00 ?  500 SER A C    1  
ATOM   3038   O  O    . SER A  1 185 ? -0.268  -11.492 -25.022 1.00 0.00 ?  500 SER A O    1  
ATOM   3039   C  CB   . SER A  1 185 ? 1.833   -12.089 -23.310 1.00 0.00 ?  500 SER A CB   1  
ATOM   3040   O  OG   . SER A  1 185 ? 2.337   -12.954 -24.312 1.00 0.00 ?  500 SER A OG   1  
ATOM   3041   H  H    . SER A  1 185 ? 0.655   -10.236 -21.808 1.00 0.00 ?  500 SER A H    1  
ATOM   3042   H  HA   . SER A  1 185 ? 2.444   -10.161 -24.121 1.00 0.00 ?  500 SER A HA   1  
ATOM   3043   H  HB2  . SER A  1 185 ? 2.626   -11.934 -22.548 1.00 0.00 ?  500 SER A HB2  1  
ATOM   3044   H  HB3  . SER A  1 185 ? 0.890   -12.442 -22.839 1.00 0.00 ?  500 SER A HB3  1  
ATOM   3045   H  HG   . SER A  1 185 ? 2.799   -13.635 -23.817 1.00 0.00 ?  500 SER A HG   1  
ATOM   3046   N  N    . ALA A  1 186 ? 1.078   -10.049 -26.032 1.00 0.00 ?  501 ALA A N    1  
ATOM   3047   C  CA   . ALA A  1 186 ? 0.619   -10.098 -27.389 1.00 0.00 ?  501 ALA A CA   1  
ATOM   3048   C  C    . ALA A  1 186 ? 0.663   -11.524 -27.973 1.00 0.00 ?  501 ALA A C    1  
ATOM   3049   O  O    . ALA A  1 186 ? -0.245  -11.966 -28.680 1.00 0.00 ?  501 ALA A O    1  
ATOM   3050   C  CB   . ALA A  1 186 ? 1.559   -9.162  -28.262 1.00 0.00 ?  501 ALA A CB   1  
ATOM   3051   H  H    . ALA A  1 186 ? 1.881   -9.490  -25.841 1.00 0.00 ?  501 ALA A H    1  
ATOM   3052   H  HA   . ALA A  1 186 ? -0.379  -9.684  -27.373 1.00 0.00 ?  501 ALA A HA   1  
ATOM   3053   H  HB1  . ALA A  1 186 ? 2.551   -9.664  -28.266 1.00 0.00 ?  501 ALA A HB1  1  
ATOM   3054   H  HB2  . ALA A  1 186 ? 1.744   -8.144  -27.856 1.00 0.00 ?  501 ALA A HB2  1  
ATOM   3055   H  HB3  . ALA A  1 186 ? 1.223   -8.988  -29.307 1.00 0.00 ?  501 ALA A HB3  1  
ATOM   3056   N  N    . LEU A  1 187 ? 1.810   -12.197 -27.676 1.00 0.00 ?  502 LEU A N    1  
ATOM   3057   C  CA   . LEU A  1 187 ? 1.887   -13.512 -28.135 1.00 0.00 ?  502 LEU A CA   1  
ATOM   3058   C  C    . LEU A  1 187 ? 0.950   -14.505 -27.553 1.00 0.00 ?  502 LEU A C    1  
ATOM   3059   O  O    . LEU A  1 187 ? 0.449   -15.334 -28.334 1.00 0.00 ?  502 LEU A O    1  
ATOM   3060   C  CB   . LEU A  1 187 ? 3.354   -14.034 -27.927 1.00 0.00 ?  502 LEU A CB   1  
ATOM   3061   C  CG   . LEU A  1 187 ? 4.550   -13.228 -28.572 1.00 0.00 ?  502 LEU A CG   1  
ATOM   3062   C  CD1  . LEU A  1 187 ? 5.882   -13.916 -28.204 1.00 0.00 ?  502 LEU A CD1  1  
ATOM   3063   C  CD2  . LEU A  1 187 ? 4.391   -13.205 -30.108 1.00 0.00 ?  502 LEU A CD2  1  
ATOM   3064   H  H    . LEU A  1 187 ? 2.439   -11.893 -26.965 1.00 0.00 ?  502 LEU A H    1  
ATOM   3065   H  HA   . LEU A  1 187 ? 1.649   -13.702 -29.171 1.00 0.00 ?  502 LEU A HA   1  
ATOM   3066   H  HB2  . LEU A  1 187 ? 3.435   -13.865 -26.831 1.00 0.00 ?  502 LEU A HB2  1  
ATOM   3067   H  HB3  . LEU A  1 187 ? 3.574   -15.095 -28.174 1.00 0.00 ?  502 LEU A HB3  1  
ATOM   3068   H  HG   . LEU A  1 187 ? 4.558   -12.168 -28.241 1.00 0.00 ?  502 LEU A HG   1  
ATOM   3069   H  HD11 . LEU A  1 187 ? 5.924   -14.825 -28.841 1.00 0.00 ?  502 LEU A HD11 1  
ATOM   3070   H  HD12 . LEU A  1 187 ? 6.001   -14.173 -27.129 1.00 0.00 ?  502 LEU A HD12 1  
ATOM   3071   H  HD13 . LEU A  1 187 ? 6.764   -13.326 -28.532 1.00 0.00 ?  502 LEU A HD13 1  
ATOM   3072   H  HD21 . LEU A  1 187 ? 5.323   -12.902 -30.633 1.00 0.00 ?  502 LEU A HD21 1  
ATOM   3073   H  HD22 . LEU A  1 187 ? 3.547   -12.597 -30.496 1.00 0.00 ?  502 LEU A HD22 1  
ATOM   3074   H  HD23 . LEU A  1 187 ? 4.329   -14.230 -30.533 1.00 0.00 ?  502 LEU A HD23 1  
ATOM   3075   N  N    . ARG A  1 188 ? 0.628   -14.410 -26.257 1.00 0.00 ?  503 ARG A N    1  
ATOM   3076   C  CA   . ARG A  1 188 ? -0.426  -15.182 -25.687 1.00 0.00 ?  503 ARG A CA   1  
ATOM   3077   C  C    . ARG A  1 188 ? -1.788  -14.798 -26.128 1.00 0.00 ?  503 ARG A C    1  
ATOM   3078   O  O    . ARG A  1 188 ? -2.598  -15.675 -26.610 1.00 0.00 ?  503 ARG A O    1  
ATOM   3079   C  CB   . ARG A  1 188 ? -0.481  -14.805 -24.209 1.00 0.00 ?  503 ARG A CB   1  
ATOM   3080   C  CG   . ARG A  1 188 ? -1.290  -15.739 -23.323 1.00 0.00 ?  503 ARG A CG   1  
ATOM   3081   C  CD   . ARG A  1 188 ? -1.236  -15.382 -21.823 1.00 0.00 ?  503 ARG A CD   1  
ATOM   3082   N  NE   . ARG A  1 188 ? -1.979  -14.108 -21.632 1.00 0.00 ?  503 ARG A NE   1  
ATOM   3083   C  CZ   . ARG A  1 188 ? -1.609  -13.148 -20.799 1.00 0.00 ?  503 ARG A CZ   1  
ATOM   3084   N  NH1  . ARG A  1 188 ? -1.820  -11.885 -21.160 1.00 0.00 1  503 ARG A NH1  1  
ATOM   3085   N  NH2  . ARG A  1 188 ? -1.074  -13.451 -19.633 1.00 0.00 ?  503 ARG A NH2  1  
ATOM   3086   H  H    . ARG A  1 188 ? 1.133   -13.850 -25.604 1.00 0.00 ?  503 ARG A H    1  
ATOM   3087   H  HA   . ARG A  1 188 ? -0.334  -16.258 -25.715 1.00 0.00 ?  503 ARG A HA   1  
ATOM   3088   H  HB2  . ARG A  1 188 ? 0.590   -14.822 -23.914 1.00 0.00 ?  503 ARG A HB2  1  
ATOM   3089   H  HB3  . ARG A  1 188 ? -0.641  -13.730 -23.976 1.00 0.00 ?  503 ARG A HB3  1  
ATOM   3090   H  HG2  . ARG A  1 188 ? -2.353  -15.610 -23.621 1.00 0.00 ?  503 ARG A HG2  1  
ATOM   3091   H  HG3  . ARG A  1 188 ? -1.054  -16.804 -23.535 1.00 0.00 ?  503 ARG A HG3  1  
ATOM   3092   H  HD2  . ARG A  1 188 ? -1.850  -16.116 -21.260 1.00 0.00 ?  503 ARG A HD2  1  
ATOM   3093   H  HD3  . ARG A  1 188 ? -0.193  -15.263 -21.459 1.00 0.00 ?  503 ARG A HD3  1  
ATOM   3094   H  HE   . ARG A  1 188 ? -2.630  -13.748 -22.300 1.00 0.00 ?  503 ARG A HE   1  
ATOM   3095   H  HH11 . ARG A  1 188 ? -2.249  -11.746 -22.052 1.00 0.00 ?  503 ARG A HH11 1  
ATOM   3096   H  HH12 . ARG A  1 188 ? -1.518  -11.200 -20.497 1.00 0.00 ?  503 ARG A HH12 1  
ATOM   3097   H  HH21 . ARG A  1 188 ? -1.090  -14.439 -19.477 1.00 0.00 ?  503 ARG A HH21 1  
ATOM   3098   H  HH22 . ARG A  1 188 ? -0.734  -12.738 -19.020 1.00 0.00 ?  503 ARG A HH22 1  
ATOM   3099   N  N    . ASP A  1 189 ? -2.195  -13.526 -26.094 1.00 0.00 ?  504 ASP A N    1  
ATOM   3100   C  CA   . ASP A  1 189 ? -3.621  -13.200 -26.284 1.00 0.00 ?  504 ASP A CA   1  
ATOM   3101   C  C    . ASP A  1 189 ? -3.926  -13.043 -27.724 1.00 0.00 ?  504 ASP A C    1  
ATOM   3102   O  O    . ASP A  1 189 ? -4.939  -13.526 -28.261 1.00 0.00 ?  504 ASP A O    1  
ATOM   3103   C  CB   . ASP A  1 189 ? -3.808  -11.838 -25.524 1.00 0.00 ?  504 ASP A CB   1  
ATOM   3104   C  CG   . ASP A  1 189 ? -3.607  -12.067 -24.075 1.00 0.00 ?  504 ASP A CG   1  
ATOM   3105   O  OD1  . ASP A  1 189 ? -3.447  -11.099 -23.287 1.00 0.00 ?  504 ASP A OD1  1  
ATOM   3106   O  OD2  . ASP A  1 189 ? -3.890  -13.194 -23.632 1.00 0.00 -1 504 ASP A OD2  1  
ATOM   3107   H  H    . ASP A  1 189 ? -1.635  -12.774 -25.754 1.00 0.00 ?  504 ASP A H    1  
ATOM   3108   H  HA   . ASP A  1 189 ? -4.250  -13.987 -25.896 1.00 0.00 ?  504 ASP A HA   1  
ATOM   3109   H  HB2  . ASP A  1 189 ? -2.979  -11.167 -25.836 1.00 0.00 ?  504 ASP A HB2  1  
ATOM   3110   H  HB3  . ASP A  1 189 ? -4.773  -11.350 -25.780 1.00 0.00 ?  504 ASP A HB3  1  
ATOM   3111   N  N    . TRP A  1 190 ? -3.031  -12.313 -28.509 1.00 0.00 ?  505 TRP A N    1  
ATOM   3112   C  CA   . TRP A  1 190 ? -3.416  -11.943 -29.851 1.00 0.00 ?  505 TRP A CA   1  
ATOM   3113   C  C    . TRP A  1 190 ? -2.984  -12.929 -30.896 1.00 0.00 ?  505 TRP A C    1  
ATOM   3114   O  O    . TRP A  1 190 ? -3.436  -12.834 -32.076 1.00 0.00 ?  505 TRP A O    1  
ATOM   3115   C  CB   . TRP A  1 190 ? -2.796  -10.518 -30.236 1.00 0.00 ?  505 TRP A CB   1  
ATOM   3116   C  CG   . TRP A  1 190 ? -3.338  -9.263  -29.592 1.00 0.00 ?  505 TRP A CG   1  
ATOM   3117   C  CD1  . TRP A  1 190 ? -4.408  -9.040  -28.767 1.00 0.00 ?  505 TRP A CD1  1  
ATOM   3118   C  CD2  . TRP A  1 190 ? -2.731  -7.947  -29.885 1.00 0.00 ?  505 TRP A CD2  1  
ATOM   3119   N  NE1  . TRP A  1 190 ? -4.599  -7.728  -28.582 1.00 0.00 ?  505 TRP A NE1  1  
ATOM   3120   C  CE2  . TRP A  1 190 ? -3.573  -7.009  -29.151 1.00 0.00 ?  505 TRP A CE2  1  
ATOM   3121   C  CE3  . TRP A  1 190 ? -1.702  -7.562  -30.686 1.00 0.00 ?  505 TRP A CE3  1  
ATOM   3122   C  CZ2  . TRP A  1 190 ? -3.155  -5.711  -29.072 1.00 0.00 ?  505 TRP A CZ2  1  
ATOM   3123   C  CZ3  . TRP A  1 190 ? -1.418  -6.199  -30.727 1.00 0.00 ?  505 TRP A CZ3  1  
ATOM   3124   C  CH2  . TRP A  1 190 ? -2.088  -5.310  -29.921 1.00 0.00 ?  505 TRP A CH2  1  
ATOM   3125   H  H    . TRP A  1 190 ? -2.212  -11.895 -28.126 1.00 0.00 ?  505 TRP A H    1  
ATOM   3126   H  HA   . TRP A  1 190 ? -4.486  -11.859 -29.970 1.00 0.00 ?  505 TRP A HA   1  
ATOM   3127   H  HB2  . TRP A  1 190 ? -1.687  -10.452 -30.241 1.00 0.00 ?  505 TRP A HB2  1  
ATOM   3128   H  HB3  . TRP A  1 190 ? -3.072  -10.413 -31.307 1.00 0.00 ?  505 TRP A HB3  1  
ATOM   3129   H  HD1  . TRP A  1 190 ? -4.970  -9.863  -28.352 1.00 0.00 ?  505 TRP A HD1  1  
ATOM   3130   H  HE1  . TRP A  1 190 ? -5.396  -7.285  -28.232 1.00 0.00 ?  505 TRP A HE1  1  
ATOM   3131   H  HE3  . TRP A  1 190 ? -1.101  -8.278  -31.226 1.00 0.00 ?  505 TRP A HE3  1  
ATOM   3132   H  HZ2  . TRP A  1 190 ? -3.614  -5.021  -28.380 1.00 0.00 ?  505 TRP A HZ2  1  
ATOM   3133   H  HZ3  . TRP A  1 190 ? -0.620  -5.921  -31.399 1.00 0.00 ?  505 TRP A HZ3  1  
ATOM   3134   H  HH2  . TRP A  1 190 ? -1.918  -4.250  -30.040 1.00 0.00 ?  505 TRP A HH2  1  
ATOM   3135   N  N    . MET A  1 191 ? -2.131  -13.885 -30.514 1.00 0.00 ?  506 MET A N    1  
ATOM   3136   C  CA   . MET A  1 191 ? -1.520  -14.737 -31.553 1.00 0.00 ?  506 MET A CA   1  
ATOM   3137   C  C    . MET A  1 191 ? -1.534  -16.225 -31.190 1.00 0.00 ?  506 MET A C    1  
ATOM   3138   O  O    . MET A  1 191 ? -1.050  -16.983 -31.986 1.00 0.00 ?  506 MET A O    1  
ATOM   3139   C  CB   . MET A  1 191 ? -0.075  -14.272 -31.849 1.00 0.00 ?  506 MET A CB   1  
ATOM   3140   C  CG   . MET A  1 191 ? 0.157   -12.781 -32.257 1.00 0.00 ?  506 MET A CG   1  
ATOM   3141   S  SD   . MET A  1 191 ? -0.477  -12.168 -33.815 1.00 0.00 ?  506 MET A SD   1  
ATOM   3142   C  CE   . MET A  1 191 ? -0.029  -10.431 -33.389 1.00 0.00 ?  506 MET A CE   1  
ATOM   3143   H  H    . MET A  1 191 ? -1.787  -13.867 -29.578 1.00 0.00 ?  506 MET A H    1  
ATOM   3144   H  HA   . MET A  1 191 ? -2.035  -14.692 -32.501 1.00 0.00 ?  506 MET A HA   1  
ATOM   3145   H  HB2  . MET A  1 191 ? 0.587   -14.469 -30.979 1.00 0.00 ?  506 MET A HB2  1  
ATOM   3146   H  HB3  . MET A  1 191 ? 0.340   -14.905 -32.663 1.00 0.00 ?  506 MET A HB3  1  
ATOM   3147   H  HG2  . MET A  1 191 ? -0.293  -12.133 -31.475 1.00 0.00 ?  506 MET A HG2  1  
ATOM   3148   H  HG3  . MET A  1 191 ? 1.259   -12.646 -32.217 1.00 0.00 ?  506 MET A HG3  1  
ATOM   3149   H  HE1  . MET A  1 191 ? -0.307  -9.803  -34.263 1.00 0.00 ?  506 MET A HE1  1  
ATOM   3150   H  HE2  . MET A  1 191 ? 1.028   -10.252 -33.096 1.00 0.00 ?  506 MET A HE2  1  
ATOM   3151   H  HE3  . MET A  1 191 ? -0.703  -10.040 -32.598 1.00 0.00 ?  506 MET A HE3  1  
ATOM   3152   N  N    . GLY A  1 192 ? -2.021  -16.584 -30.036 1.00 0.00 ?  507 GLY A N    1  
ATOM   3153   C  CA   . GLY A  1 192 ? -2.120  -17.945 -29.566 1.00 0.00 ?  507 GLY A CA   1  
ATOM   3154   C  C    . GLY A  1 192 ? -0.811  -18.793 -29.501 1.00 0.00 ?  507 GLY A C    1  
ATOM   3155   O  O    . GLY A  1 192 ? -0.831  -19.957 -29.773 1.00 0.00 ?  507 GLY A O    1  
ATOM   3156   H  H    . GLY A  1 192 ? -2.492  -15.832 -29.581 1.00 0.00 ?  507 GLY A H    1  
ATOM   3157   H  HA2  . GLY A  1 192 ? -2.494  -17.919 -28.553 1.00 0.00 ?  507 GLY A HA2  1  
ATOM   3158   H  HA3  . GLY A  1 192 ? -2.850  -18.479 -30.156 1.00 0.00 ?  507 GLY A HA3  1  
ATOM   3159   N  N    . CYS A  1 193 ? 0.334   -18.152 -29.139 1.00 0.00 ?  508 CYS A N    1  
ATOM   3160   C  CA   . CYS A  1 193 ? 1.620   -18.852 -29.225 1.00 0.00 ?  508 CYS A CA   1  
ATOM   3161   C  C    . CYS A  1 193 ? 1.837   -19.718 -28.056 1.00 0.00 ?  508 CYS A C    1  
ATOM   3162   O  O    . CYS A  1 193 ? 1.641   -19.297 -26.956 1.00 0.00 ?  508 CYS A O    1  
ATOM   3163   C  CB   . CYS A  1 193 ? 2.813   -17.882 -29.245 1.00 0.00 ?  508 CYS A CB   1  
ATOM   3164   S  SG   . CYS A  1 193 ? 2.555   -16.554 -30.527 1.00 0.00 ?  508 CYS A SG   1  
ATOM   3165   H  H    . CYS A  1 193 ? 0.272   -17.169 -28.985 1.00 0.00 ?  508 CYS A H    1  
ATOM   3166   H  HA   . CYS A  1 193 ? 1.628   -19.490 -30.097 1.00 0.00 ?  508 CYS A HA   1  
ATOM   3167   H  HB2  . CYS A  1 193 ? 2.807   -17.353 -28.268 1.00 0.00 ?  508 CYS A HB2  1  
ATOM   3168   H  HB3  . CYS A  1 193 ? 3.728   -18.480 -29.443 1.00 0.00 ?  508 CYS A HB3  1  
ATOM   3169   H  HG   . CYS A  1 193 ? 1.705   -15.869 -29.776 1.00 0.00 ?  508 CYS A HG   1  
ATOM   3170   N  N    . PRO A  1 194 ? 2.243   -21.038 -28.101 1.00 0.00 ?  509 PRO A N    1  
ATOM   3171   C  CA   . PRO A  1 194 ? 2.742   -21.668 -26.897 1.00 0.00 ?  509 PRO A CA   1  
ATOM   3172   C  C    . PRO A  1 194 ? 3.976   -20.832 -26.311 1.00 0.00 ?  509 PRO A C    1  
ATOM   3173   O  O    . PRO A  1 194 ? 4.793   -20.289 -27.062 1.00 0.00 ?  509 PRO A O    1  
ATOM   3174   C  CB   . PRO A  1 194 ? 3.194   -23.073 -27.382 1.00 0.00 ?  509 PRO A CB   1  
ATOM   3175   C  CG   . PRO A  1 194 ? 3.224   -23.095 -28.885 1.00 0.00 ?  509 PRO A CG   1  
ATOM   3176   C  CD   . PRO A  1 194 ? 2.174   -21.961 -29.274 1.00 0.00 ?  509 PRO A CD   1  
ATOM   3177   H  HA   . PRO A  1 194 ? 1.968   -21.620 -26.145 1.00 0.00 ?  509 PRO A HA   1  
ATOM   3178   H  HB2  . PRO A  1 194 ? 4.232   -23.325 -27.075 1.00 0.00 ?  509 PRO A HB2  1  
ATOM   3179   H  HB3  . PRO A  1 194 ? 2.459   -23.844 -27.070 1.00 0.00 ?  509 PRO A HB3  1  
ATOM   3180   H  HG2  . PRO A  1 194 ? 4.205   -22.892 -29.365 1.00 0.00 ?  509 PRO A HG2  1  
ATOM   3181   H  HG3  . PRO A  1 194 ? 2.959   -24.119 -29.226 1.00 0.00 ?  509 PRO A HG3  1  
ATOM   3182   H  HD2  . PRO A  1 194 ? 2.459   -21.453 -30.219 1.00 0.00 ?  509 PRO A HD2  1  
ATOM   3183   H  HD3  . PRO A  1 194 ? 1.099   -22.235 -29.211 1.00 0.00 ?  509 PRO A HD3  1  
ATOM   3184   N  N    . SER A  1 195 ? 3.935   -20.892 -24.949 1.00 0.00 ?  510 SER A N    1  
ATOM   3185   C  CA   . SER A  1 195 ? 4.914   -20.219 -24.017 1.00 0.00 ?  510 SER A CA   1  
ATOM   3186   C  C    . SER A  1 195 ? 4.685   -18.711 -24.022 1.00 0.00 ?  510 SER A C    1  
ATOM   3187   O  O    . SER A  1 195 ? 5.575   -17.985 -23.525 1.00 0.00 ?  510 SER A O    1  
ATOM   3188   C  CB   . SER A  1 195 ? 6.370   -20.682 -24.038 1.00 0.00 ?  510 SER A CB   1  
ATOM   3189   O  OG   . SER A  1 195 ? 6.473   -22.073 -23.876 1.00 0.00 ?  510 SER A OG   1  
ATOM   3190   H  H    . SER A  1 195 ? 3.208   -21.484 -24.610 1.00 0.00 ?  510 SER A H    1  
ATOM   3191   H  HA   . SER A  1 195 ? 4.676   -20.534 -23.012 1.00 0.00 ?  510 SER A HA   1  
ATOM   3192   H  HB2  . SER A  1 195 ? 6.864   -20.387 -24.989 1.00 0.00 ?  510 SER A HB2  1  
ATOM   3193   H  HB3  . SER A  1 195 ? 6.846   -20.261 -23.127 1.00 0.00 ?  510 SER A HB3  1  
ATOM   3194   H  HG   . SER A  1 195 ? 6.179   -22.394 -24.732 1.00 0.00 ?  510 SER A HG   1  
ATOM   3195   N  N    . GLY A  1 196 ? 3.523   -18.182 -24.508 1.00 0.00 ?  511 GLY A N    1  
ATOM   3196   C  CA   . GLY A  1 196 ? 3.132   -16.764 -24.513 1.00 0.00 ?  511 GLY A CA   1  
ATOM   3197   C  C    . GLY A  1 196 ? 3.321   -15.860 -23.262 1.00 0.00 ?  511 GLY A C    1  
ATOM   3198   O  O    . GLY A  1 196 ? 4.035   -14.869 -23.453 1.00 0.00 ?  511 GLY A O    1  
ATOM   3199   O  OXT  . GLY A  1 196 ? 2.933   -16.226 -22.110 1.00 0.00 ?  511 GLY A OXT  1  
ATOM   3200   H  H    . GLY A  1 196 ? 3.062   -18.655 -25.255 1.00 0.00 ?  511 GLY A H    1  
ATOM   3201   H  HA2  . GLY A  1 196 ? 3.646   -16.319 -25.352 1.00 0.00 ?  511 GLY A HA2  1  
ATOM   3202   H  HA3  . GLY A  1 196 ? 2.061   -16.754 -24.649 1.00 0.00 ?  511 GLY A HA3  1  
ATOM   3203   N  N    . SER B  2 1   ? 8.258   -50.800 10.373  1.00 0.00 ?  55  SER B N    1  
ATOM   3204   C  CA   . SER B  2 1   ? 7.933   -50.130 9.010   1.00 0.00 ?  55  SER B CA   1  
ATOM   3205   C  C    . SER B  2 1   ? 9.211   -49.651 8.346   1.00 0.00 ?  55  SER B C    1  
ATOM   3206   O  O    . SER B  2 1   ? 10.269  -49.564 9.065   1.00 0.00 ?  55  SER B O    1  
ATOM   3207   C  CB   . SER B  2 1   ? 6.883   -48.965 9.229   1.00 0.00 ?  55  SER B CB   1  
ATOM   3208   O  OG   . SER B  2 1   ? 7.465   -47.803 9.834   1.00 0.00 ?  55  SER B OG   1  
ATOM   3209   H  H1   . SER B  2 1   ? 8.730   -50.097 10.978  1.00 0.00 ?  55  SER B H1   1  
ATOM   3210   H  H2   . SER B  2 1   ? 8.940   -51.585 10.338  1.00 0.00 ?  55  SER B H2   1  
ATOM   3211   H  H3   . SER B  2 1   ? 7.389   -51.234 10.743  1.00 0.00 ?  55  SER B H3   1  
ATOM   3212   H  HA   . SER B  2 1   ? 7.370   -50.834 8.415   1.00 0.00 ?  55  SER B HA   1  
ATOM   3213   H  HB2  . SER B  2 1   ? 6.630   -48.684 8.184   1.00 0.00 ?  55  SER B HB2  1  
ATOM   3214   H  HB3  . SER B  2 1   ? 5.986   -49.312 9.784   1.00 0.00 ?  55  SER B HB3  1  
ATOM   3215   H  HG   . SER B  2 1   ? 7.091   -47.831 10.718  1.00 0.00 ?  55  SER B HG   1  
ATOM   3216   N  N    . THR B  2 2   ? 9.070   -49.286 7.102   1.00 0.00 ?  56  THR B N    1  
ATOM   3217   C  CA   . THR B  2 2   ? 10.257  -48.806 6.372   1.00 0.00 ?  56  THR B CA   1  
ATOM   3218   C  C    . THR B  2 2   ? 10.873  -47.535 7.025   1.00 0.00 ?  56  THR B C    1  
ATOM   3219   O  O    . THR B  2 2   ? 12.115  -47.366 7.089   1.00 0.00 ?  56  THR B O    1  
ATOM   3220   C  CB   . THR B  2 2   ? 10.042  -48.800 4.838   1.00 0.00 ?  56  THR B CB   1  
ATOM   3221   O  OG1  . THR B  2 2   ? 11.177  -48.331 4.104   1.00 0.00 ?  56  THR B OG1  1  
ATOM   3222   C  CG2  . THR B  2 2   ? 8.965   -47.890 4.513   1.00 0.00 ?  56  THR B CG2  1  
ATOM   3223   H  H    . THR B  2 2   ? 8.313   -49.462 6.477   1.00 0.00 ?  56  THR B H    1  
ATOM   3224   H  HA   . THR B  2 2   ? 10.969  -49.602 6.536   1.00 0.00 ?  56  THR B HA   1  
ATOM   3225   H  HB   . THR B  2 2   ? 9.741   -49.805 4.473   1.00 0.00 ?  56  THR B HB   1  
ATOM   3226   H  HG1  . THR B  2 2   ? 11.999  -48.641 4.491   1.00 0.00 ?  56  THR B HG1  1  
ATOM   3227   H  HG21 . THR B  2 2   ? 8.050   -48.238 5.037   1.00 0.00 ?  56  THR B HG21 1  
ATOM   3228   H  HG22 . THR B  2 2   ? 8.845   -47.769 3.415   1.00 0.00 ?  56  THR B HG22 1  
ATOM   3229   H  HG23 . THR B  2 2   ? 9.153   -46.849 4.853   1.00 0.00 ?  56  THR B HG23 1  
ATOM   3230   N  N    . PHE B  2 3   ? 10.011  -46.545 7.380   1.00 0.00 ?  57  PHE B N    1  
ATOM   3231   C  CA   . PHE B  2 3   ? 10.500  -45.301 7.960   1.00 0.00 ?  57  PHE B CA   1  
ATOM   3232   C  C    . PHE B  2 3   ? 11.231  -45.533 9.298   1.00 0.00 ?  57  PHE B C    1  
ATOM   3233   O  O    . PHE B  2 3   ? 12.272  -44.894 9.474   1.00 0.00 ?  57  PHE B O    1  
ATOM   3234   C  CB   . PHE B  2 3   ? 9.373   -44.290 8.279   1.00 0.00 ?  57  PHE B CB   1  
ATOM   3235   C  CG   . PHE B  2 3   ? 8.659   -43.929 7.079   1.00 0.00 ?  57  PHE B CG   1  
ATOM   3236   C  CD1  . PHE B  2 3   ? 7.470   -43.169 7.248   1.00 0.00 ?  57  PHE B CD1  1  
ATOM   3237   C  CD2  . PHE B  2 3   ? 9.067   -44.166 5.773   1.00 0.00 ?  57  PHE B CD2  1  
ATOM   3238   C  CE1  . PHE B  2 3   ? 6.639   -42.766 6.165   1.00 0.00 ?  57  PHE B CE1  1  
ATOM   3239   C  CE2  . PHE B  2 3   ? 8.290   -43.757 4.676   1.00 0.00 ?  57  PHE B CE2  1  
ATOM   3240   C  CZ   . PHE B  2 3   ? 7.052   -43.129 4.841   1.00 0.00 ?  57  PHE B CZ   1  
ATOM   3241   H  H    . PHE B  2 3   ? 9.040   -46.610 7.163   1.00 0.00 ?  57  PHE B H    1  
ATOM   3242   H  HA   . PHE B  2 3   ? 11.259  -44.887 7.312   1.00 0.00 ?  57  PHE B HA   1  
ATOM   3243   H  HB2  . PHE B  2 3   ? 8.702   -44.880 8.939   1.00 0.00 ?  57  PHE B HB2  1  
ATOM   3244   H  HB3  . PHE B  2 3   ? 9.826   -43.364 8.693   1.00 0.00 ?  57  PHE B HB3  1  
ATOM   3245   H  HD1  . PHE B  2 3   ? 7.172   -42.901 8.251   1.00 0.00 ?  57  PHE B HD1  1  
ATOM   3246   H  HD2  . PHE B  2 3   ? 10.047  -44.577 5.581   1.00 0.00 ?  57  PHE B HD2  1  
ATOM   3247   H  HE1  . PHE B  2 3   ? 5.802   -42.106 6.340   1.00 0.00 ?  57  PHE B HE1  1  
ATOM   3248   H  HE2  . PHE B  2 3   ? 8.696   -43.975 3.699   1.00 0.00 ?  57  PHE B HE2  1  
ATOM   3249   H  HZ   . PHE B  2 3   ? 6.514   -42.769 3.977   1.00 0.00 ?  57  PHE B HZ   1  
ATOM   3250   N  N    . SER B  2 4   ? 10.726  -46.464 10.225  1.00 0.00 ?  58  SER B N    1  
ATOM   3251   C  CA   . SER B  2 4   ? 11.365  -46.716 11.512  1.00 0.00 ?  58  SER B CA   1  
ATOM   3252   C  C    . SER B  2 4   ? 12.661  -47.563 11.264  1.00 0.00 ?  58  SER B C    1  
ATOM   3253   O  O    . SER B  2 4   ? 13.744  -47.273 11.778  1.00 0.00 ?  58  SER B O    1  
ATOM   3254   C  CB   . SER B  2 4   ? 10.493  -47.384 12.527  1.00 0.00 ?  58  SER B CB   1  
ATOM   3255   O  OG   . SER B  2 4   ? 10.009  -48.618 12.052  1.00 0.00 ?  58  SER B OG   1  
ATOM   3256   H  H    . SER B  2 4   ? 9.937   -47.044 10.036  1.00 0.00 ?  58  SER B H    1  
ATOM   3257   H  HA   . SER B  2 4   ? 11.636  -45.777 11.970  1.00 0.00 ?  58  SER B HA   1  
ATOM   3258   H  HB2  . SER B  2 4   ? 10.991  -47.562 13.503  1.00 0.00 ?  58  SER B HB2  1  
ATOM   3259   H  HB3  . SER B  2 4   ? 9.616   -46.734 12.736  1.00 0.00 ?  58  SER B HB3  1  
ATOM   3260   H  HG   . SER B  2 4   ? 10.722  -49.210 12.306  1.00 0.00 ?  58  SER B HG   1  
ATOM   3261   N  N    . LYS B  2 5   ? 12.636  -48.482 10.265  1.00 0.00 ?  59  LYS B N    1  
ATOM   3262   C  CA   . LYS B  2 5   ? 13.848  -49.259 9.836   1.00 0.00 ?  59  LYS B CA   1  
ATOM   3263   C  C    . LYS B  2 5   ? 14.997  -48.532 9.198   1.00 0.00 ?  59  LYS B C    1  
ATOM   3264   O  O    . LYS B  2 5   ? 16.154  -48.712 9.546   1.00 0.00 ?  59  LYS B O    1  
ATOM   3265   C  CB   . LYS B  2 5   ? 13.388  -50.373 8.937   1.00 0.00 ?  59  LYS B CB   1  
ATOM   3266   C  CG   . LYS B  2 5   ? 14.455  -51.322 8.498   1.00 0.00 ?  59  LYS B CG   1  
ATOM   3267   C  CD   . LYS B  2 5   ? 15.104  -52.137 9.680   1.00 0.00 ?  59  LYS B CD   1  
ATOM   3268   C  CE   . LYS B  2 5   ? 16.187  -53.110 9.278   1.00 0.00 ?  59  LYS B CE   1  
ATOM   3269   N  NZ   . LYS B  2 5   ? 15.586  -54.341 8.551   1.00 0.00 1  59  LYS B NZ   1  
ATOM   3270   H  H    . LYS B  2 5   ? 11.764  -48.850 9.952   1.00 0.00 ?  59  LYS B H    1  
ATOM   3271   H  HA   . LYS B  2 5   ? 14.223  -49.642 10.774  1.00 0.00 ?  59  LYS B HA   1  
ATOM   3272   H  HB2  . LYS B  2 5   ? 12.567  -50.924 9.445   1.00 0.00 ?  59  LYS B HB2  1  
ATOM   3273   H  HB3  . LYS B  2 5   ? 12.898  -49.979 8.021   1.00 0.00 ?  59  LYS B HB3  1  
ATOM   3274   H  HG2  . LYS B  2 5   ? 14.087  -52.081 7.776   1.00 0.00 ?  59  LYS B HG2  1  
ATOM   3275   H  HG3  . LYS B  2 5   ? 15.169  -50.723 7.892   1.00 0.00 ?  59  LYS B HG3  1  
ATOM   3276   H  HD2  . LYS B  2 5   ? 15.498  -51.422 10.434  1.00 0.00 ?  59  LYS B HD2  1  
ATOM   3277   H  HD3  . LYS B  2 5   ? 14.289  -52.727 10.151  1.00 0.00 ?  59  LYS B HD3  1  
ATOM   3278   H  HE2  . LYS B  2 5   ? 16.910  -52.669 8.558   1.00 0.00 ?  59  LYS B HE2  1  
ATOM   3279   H  HE3  . LYS B  2 5   ? 16.717  -53.554 10.148  1.00 0.00 ?  59  LYS B HE3  1  
ATOM   3280   H  HZ1  . LYS B  2 5   ? 14.860  -54.019 7.879   1.00 0.00 ?  59  LYS B HZ1  1  
ATOM   3281   H  HZ2  . LYS B  2 5   ? 15.146  -54.897 9.312   1.00 0.00 ?  59  LYS B HZ2  1  
ATOM   3282   H  HZ3  . LYS B  2 5   ? 16.172  -54.982 7.980   1.00 0.00 ?  59  LYS B HZ3  1  
ATOM   3283   N  N    . LEU B  2 6   ? 14.709  -47.514 8.344   1.00 0.00 ?  60  LEU B N    1  
ATOM   3284   C  CA   . LEU B  2 6   ? 15.570  -46.443 7.905   1.00 0.00 ?  60  LEU B CA   1  
ATOM   3285   C  C    . LEU B  2 6   ? 16.158  -45.658 9.123   1.00 0.00 ?  60  LEU B C    1  
ATOM   3286   O  O    . LEU B  2 6   ? 17.373  -45.446 9.104   1.00 0.00 ?  60  LEU B O    1  
ATOM   3287   C  CB   . LEU B  2 6   ? 14.831  -45.461 6.960   1.00 0.00 ?  60  LEU B CB   1  
ATOM   3288   C  CG   . LEU B  2 6   ? 15.438  -44.125 6.534   1.00 0.00 ?  60  LEU B CG   1  
ATOM   3289   C  CD1  . LEU B  2 6   ? 16.661  -44.325 5.657   1.00 0.00 ?  60  LEU B CD1  1  
ATOM   3290   C  CD2  . LEU B  2 6   ? 14.402  -43.376 5.697   1.00 0.00 ?  60  LEU B CD2  1  
ATOM   3291   H  H    . LEU B  2 6   ? 13.853  -47.377 7.852   1.00 0.00 ?  60  LEU B H    1  
ATOM   3292   H  HA   . LEU B  2 6   ? 16.386  -46.846 7.323   1.00 0.00 ?  60  LEU B HA   1  
ATOM   3293   H  HB2  . LEU B  2 6   ? 14.409  -46.107 6.161   1.00 0.00 ?  60  LEU B HB2  1  
ATOM   3294   H  HB3  . LEU B  2 6   ? 13.911  -45.171 7.512   1.00 0.00 ?  60  LEU B HB3  1  
ATOM   3295   H  HG   . LEU B  2 6   ? 15.772  -43.608 7.459   1.00 0.00 ?  60  LEU B HG   1  
ATOM   3296   H  HD11 . LEU B  2 6   ? 16.394  -44.997 4.813   1.00 0.00 ?  60  LEU B HD11 1  
ATOM   3297   H  HD12 . LEU B  2 6   ? 17.452  -44.796 6.279   1.00 0.00 ?  60  LEU B HD12 1  
ATOM   3298   H  HD13 . LEU B  2 6   ? 17.031  -43.363 5.243   1.00 0.00 ?  60  LEU B HD13 1  
ATOM   3299   H  HD21 . LEU B  2 6   ? 13.578  -42.913 6.281   1.00 0.00 ?  60  LEU B HD21 1  
ATOM   3300   H  HD22 . LEU B  2 6   ? 13.960  -43.931 4.842   1.00 0.00 ?  60  LEU B HD22 1  
ATOM   3301   H  HD23 . LEU B  2 6   ? 14.876  -42.419 5.393   1.00 0.00 ?  60  LEU B HD23 1  
ATOM   3302   N  N    . ARG B  2 7   ? 15.372  -45.162 10.109  1.00 0.00 ?  61  ARG B N    1  
ATOM   3303   C  CA   . ARG B  2 7   ? 15.976  -44.492 11.285  1.00 0.00 ?  61  ARG B CA   1  
ATOM   3304   C  C    . ARG B  2 7   ? 16.923  -45.368 12.085  1.00 0.00 ?  61  ARG B C    1  
ATOM   3305   O  O    . ARG B  2 7   ? 18.038  -44.933 12.344  1.00 0.00 ?  61  ARG B O    1  
ATOM   3306   C  CB   . ARG B  2 7   ? 14.845  -44.024 12.245  1.00 0.00 ?  61  ARG B CB   1  
ATOM   3307   C  CG   . ARG B  2 7   ? 15.279  -43.172 13.477  1.00 0.00 ?  61  ARG B CG   1  
ATOM   3308   C  CD   . ARG B  2 7   ? 14.204  -43.098 14.495  1.00 0.00 ?  61  ARG B CD   1  
ATOM   3309   N  NE   . ARG B  2 7   ? 14.639  -42.196 15.624  1.00 0.00 ?  61  ARG B NE   1  
ATOM   3310   C  CZ   . ARG B  2 7   ? 13.873  -41.343 16.208  1.00 0.00 ?  61  ARG B CZ   1  
ATOM   3311   N  NH1  . ARG B  2 7   ? 14.309  -40.526 17.121  1.00 0.00 1  61  ARG B NH1  1  
ATOM   3312   N  NH2  . ARG B  2 7   ? 12.601  -41.392 16.043  1.00 0.00 ?  61  ARG B NH2  1  
ATOM   3313   H  H    . ARG B  2 7   ? 14.392  -45.253 9.946   1.00 0.00 ?  61  ARG B H    1  
ATOM   3314   H  HA   . ARG B  2 7   ? 16.409  -43.530 11.052  1.00 0.00 ?  61  ARG B HA   1  
ATOM   3315   H  HB2  . ARG B  2 7   ? 14.174  -43.401 11.617  1.00 0.00 ?  61  ARG B HB2  1  
ATOM   3316   H  HB3  . ARG B  2 7   ? 14.331  -44.935 12.619  1.00 0.00 ?  61  ARG B HB3  1  
ATOM   3317   H  HG2  . ARG B  2 7   ? 16.153  -43.559 14.043  1.00 0.00 ?  61  ARG B HG2  1  
ATOM   3318   H  HG3  . ARG B  2 7   ? 15.673  -42.220 13.061  1.00 0.00 ?  61  ARG B HG3  1  
ATOM   3319   H  HD2  . ARG B  2 7   ? 13.372  -42.575 13.978  1.00 0.00 ?  61  ARG B HD2  1  
ATOM   3320   H  HD3  . ARG B  2 7   ? 13.844  -44.090 14.843  1.00 0.00 ?  61  ARG B HD3  1  
ATOM   3321   H  HE   . ARG B  2 7   ? 15.622  -42.068 15.749  1.00 0.00 ?  61  ARG B HE   1  
ATOM   3322   H  HH11 . ARG B  2 7   ? 15.226  -40.593 17.512  1.00 0.00 ?  61  ARG B HH11 1  
ATOM   3323   H  HH12 . ARG B  2 7   ? 13.525  -40.053 17.524  1.00 0.00 ?  61  ARG B HH12 1  
ATOM   3324   H  HH21 . ARG B  2 7   ? 12.002  -40.764 16.539  1.00 0.00 ?  61  ARG B HH21 1  
ATOM   3325   H  HH22 . ARG B  2 7   ? 12.232  -41.810 15.212  1.00 0.00 ?  61  ARG B HH22 1  
ATOM   3326   N  N    . GLU B  2 8   ? 16.516  -46.628 12.237  1.00 0.00 ?  62  GLU B N    1  
ATOM   3327   C  CA   . GLU B  2 8   ? 17.377  -47.634 12.896  1.00 0.00 ?  62  GLU B CA   1  
ATOM   3328   C  C    . GLU B  2 8   ? 18.715  -47.950 12.112  1.00 0.00 ?  62  GLU B C    1  
ATOM   3329   O  O    . GLU B  2 8   ? 19.800  -47.965 12.622  1.00 0.00 ?  62  GLU B O    1  
ATOM   3330   C  CB   . GLU B  2 8   ? 16.616  -48.947 12.988  1.00 0.00 ?  62  GLU B CB   1  
ATOM   3331   C  CG   . GLU B  2 8   ? 15.480  -48.921 14.080  1.00 0.00 ?  62  GLU B CG   1  
ATOM   3332   C  CD   . GLU B  2 8   ? 14.839  -50.212 14.280  1.00 0.00 ?  62  GLU B CD   1  
ATOM   3333   O  OE1  . GLU B  2 8   ? 13.742  -50.166 15.005  1.00 0.00 ?  62  GLU B OE1  1  
ATOM   3334   O  OE2  . GLU B  2 8   ? 15.216  -51.343 13.824  1.00 0.00 -1 62  GLU B OE2  1  
ATOM   3335   H  H    . GLU B  2 8   ? 15.616  -46.986 12.000  1.00 0.00 ?  62  GLU B H    1  
ATOM   3336   H  HA   . GLU B  2 8   ? 17.547  -47.332 13.919  1.00 0.00 ?  62  GLU B HA   1  
ATOM   3337   H  HB2  . GLU B  2 8   ? 16.207  -49.263 12.004  1.00 0.00 ?  62  GLU B HB2  1  
ATOM   3338   H  HB3  . GLU B  2 8   ? 17.275  -49.793 13.279  1.00 0.00 ?  62  GLU B HB3  1  
ATOM   3339   H  HG2  . GLU B  2 8   ? 15.951  -48.608 15.037  1.00 0.00 ?  62  GLU B HG2  1  
ATOM   3340   H  HG3  . GLU B  2 8   ? 14.689  -48.248 13.685  1.00 0.00 ?  62  GLU B HG3  1  
ATOM   3341   N  N    . GLN B  2 9   ? 18.606  -48.144 10.778  1.00 0.00 ?  63  GLN B N    1  
ATOM   3342   C  CA   . GLN B  2 9   ? 19.732  -48.129 9.931   1.00 0.00 ?  63  GLN B CA   1  
ATOM   3343   C  C    . GLN B  2 9   ? 20.654  -46.913 9.857   1.00 0.00 ?  63  GLN B C    1  
ATOM   3344   O  O    . GLN B  2 9   ? 21.898  -47.099 9.994   1.00 0.00 ?  63  GLN B O    1  
ATOM   3345   C  CB   . GLN B  2 9   ? 19.162  -48.486 8.529   1.00 0.00 ?  63  GLN B CB   1  
ATOM   3346   C  CG   . GLN B  2 9   ? 20.079  -48.266 7.296   1.00 0.00 ?  63  GLN B CG   1  
ATOM   3347   C  CD   . GLN B  2 9   ? 21.204  -49.296 7.224   1.00 0.00 ?  63  GLN B CD   1  
ATOM   3348   O  OE1  . GLN B  2 9   ? 21.029  -50.452 7.645   1.00 0.00 ?  63  GLN B OE1  1  
ATOM   3349   N  NE2  . GLN B  2 9   ? 22.380  -48.944 6.734   1.00 0.00 ?  63  GLN B NE2  1  
ATOM   3350   H  H    . GLN B  2 9   ? 17.677  -48.294 10.449  1.00 0.00 ?  63  GLN B H    1  
ATOM   3351   H  HA   . GLN B  2 9   ? 20.457  -48.907 10.117  1.00 0.00 ?  63  GLN B HA   1  
ATOM   3352   H  HB2  . GLN B  2 9   ? 18.689  -49.490 8.473   1.00 0.00 ?  63  GLN B HB2  1  
ATOM   3353   H  HB3  . GLN B  2 9   ? 18.340  -47.748 8.415   1.00 0.00 ?  63  GLN B HB3  1  
ATOM   3354   H  HG2  . GLN B  2 9   ? 19.481  -48.423 6.373   1.00 0.00 ?  63  GLN B HG2  1  
ATOM   3355   H  HG3  . GLN B  2 9   ? 20.520  -47.246 7.311   1.00 0.00 ?  63  GLN B HG3  1  
ATOM   3356   H  HE21 . GLN B  2 9   ? 23.020  -49.556 6.271   1.00 0.00 ?  63  GLN B HE21 1  
ATOM   3357   H  HE22 . GLN B  2 9   ? 22.427  -47.986 6.450   1.00 0.00 ?  63  GLN B HE22 1  
ATOM   3358   N  N    . LEU B  2 10  ? 20.137  -45.711 9.570   1.00 0.00 ?  64  LEU B N    1  
ATOM   3359   C  CA   . LEU B  2 10  ? 20.945  -44.524 9.345   1.00 0.00 ?  64  LEU B CA   1  
ATOM   3360   C  C    . LEU B  2 10  ? 21.561  -43.897 10.590  1.00 0.00 ?  64  LEU B C    1  
ATOM   3361   O  O    . LEU B  2 10  ? 22.599  -43.260 10.544  1.00 0.00 ?  64  LEU B O    1  
ATOM   3362   C  CB   . LEU B  2 10  ? 20.123  -43.534 8.627   1.00 0.00 ?  64  LEU B CB   1  
ATOM   3363   C  CG   . LEU B  2 10  ? 20.749  -42.231 8.152   1.00 0.00 ?  64  LEU B CG   1  
ATOM   3364   C  CD1  . LEU B  2 10  ? 21.847  -42.425 7.096   1.00 0.00 ?  64  LEU B CD1  1  
ATOM   3365   C  CD2  . LEU B  2 10  ? 19.723  -41.343 7.535   1.00 0.00 ?  64  LEU B CD2  1  
ATOM   3366   H  H    . LEU B  2 10  ? 19.154  -45.567 9.493   1.00 0.00 ?  64  LEU B H    1  
ATOM   3367   H  HA   . LEU B  2 10  ? 21.761  -44.688 8.657   1.00 0.00 ?  64  LEU B HA   1  
ATOM   3368   H  HB2  . LEU B  2 10  ? 19.673  -44.038 7.745   1.00 0.00 ?  64  LEU B HB2  1  
ATOM   3369   H  HB3  . LEU B  2 10  ? 19.288  -43.130 9.239   1.00 0.00 ?  64  LEU B HB3  1  
ATOM   3370   H  HG   . LEU B  2 10  ? 21.120  -41.640 9.016   1.00 0.00 ?  64  LEU B HG   1  
ATOM   3371   H  HD11 . LEU B  2 10  ? 22.625  -43.168 7.374   1.00 0.00 ?  64  LEU B HD11 1  
ATOM   3372   H  HD12 . LEU B  2 10  ? 22.393  -41.476 6.907   1.00 0.00 ?  64  LEU B HD12 1  
ATOM   3373   H  HD13 . LEU B  2 10  ? 21.391  -42.715 6.125   1.00 0.00 ?  64  LEU B HD13 1  
ATOM   3374   H  HD21 . LEU B  2 10  ? 18.967  -41.140 8.324   1.00 0.00 ?  64  LEU B HD21 1  
ATOM   3375   H  HD22 . LEU B  2 10  ? 19.179  -41.873 6.724   1.00 0.00 ?  64  LEU B HD22 1  
ATOM   3376   H  HD23 . LEU B  2 10  ? 20.065  -40.410 7.040   1.00 0.00 ?  64  LEU B HD23 1  
ATOM   3377   N  N    . GLY B  2 11  ? 20.992  -44.101 11.822  1.00 0.00 ?  65  GLY B N    1  
ATOM   3378   C  CA   . GLY B  2 11  ? 21.590  -43.418 13.030  1.00 0.00 ?  65  GLY B CA   1  
ATOM   3379   C  C    . GLY B  2 11  ? 22.956  -43.932 13.362  1.00 0.00 ?  65  GLY B C    1  
ATOM   3380   O  O    . GLY B  2 11  ? 23.951  -43.190 13.264  1.00 0.00 ?  65  GLY B O    1  
ATOM   3381   H  H    . GLY B  2 11  ? 20.133  -44.598 11.920  1.00 0.00 ?  65  GLY B H    1  
ATOM   3382   H  HA2  . GLY B  2 11  ? 21.571  -42.348 12.885  1.00 0.00 ?  65  GLY B HA2  1  
ATOM   3383   H  HA3  . GLY B  2 11  ? 20.949  -43.636 13.872  1.00 0.00 ?  65  GLY B HA3  1  
ATOM   3384   N  N    . PRO B  2 12  ? 23.031  -45.197 13.690  1.00 0.00 ?  66  PRO B N    1  
ATOM   3385   C  CA   . PRO B  2 12  ? 24.334  -45.902 13.864  1.00 0.00 ?  66  PRO B CA   1  
ATOM   3386   C  C    . PRO B  2 12  ? 25.360  -45.743 12.745  1.00 0.00 ?  66  PRO B C    1  
ATOM   3387   O  O    . PRO B  2 12  ? 26.555  -45.446 13.016  1.00 0.00 ?  66  PRO B O    1  
ATOM   3388   C  CB   . PRO B  2 12  ? 23.912  -47.371 14.075  1.00 0.00 ?  66  PRO B CB   1  
ATOM   3389   C  CG   . PRO B  2 12  ? 22.516  -47.234 14.722  1.00 0.00 ?  66  PRO B CG   1  
ATOM   3390   C  CD   . PRO B  2 12  ? 21.908  -46.027 13.978  1.00 0.00 ?  66  PRO B CD   1  
ATOM   3391   H  HA   . PRO B  2 12  ? 24.695  -45.470 14.786  1.00 0.00 ?  66  PRO B HA   1  
ATOM   3392   H  HB2  . PRO B  2 12  ? 23.951  -47.961 13.134  1.00 0.00 ?  66  PRO B HB2  1  
ATOM   3393   H  HB3  . PRO B  2 12  ? 24.554  -47.957 14.768  1.00 0.00 ?  66  PRO B HB3  1  
ATOM   3394   H  HG2  . PRO B  2 12  ? 21.767  -48.040 14.570  1.00 0.00 ?  66  PRO B HG2  1  
ATOM   3395   H  HG3  . PRO B  2 12  ? 22.752  -47.082 15.798  1.00 0.00 ?  66  PRO B HG3  1  
ATOM   3396   H  HD2  . PRO B  2 12  ? 21.590  -46.422 12.990  1.00 0.00 ?  66  PRO B HD2  1  
ATOM   3397   H  HD3  . PRO B  2 12  ? 21.147  -45.465 14.560  1.00 0.00 ?  66  PRO B HD3  1  
ATOM   3398   N  N    . VAL B  2 13  ? 24.981  -45.895 11.497  1.00 0.00 ?  67  VAL B N    1  
ATOM   3399   C  CA   . VAL B  2 13  ? 25.788  -45.675 10.337  1.00 0.00 ?  67  VAL B CA   1  
ATOM   3400   C  C    . VAL B  2 13  ? 26.327  -44.193 10.222  1.00 0.00 ?  67  VAL B C    1  
ATOM   3401   O  O    . VAL B  2 13  ? 27.506  -43.987 9.959   1.00 0.00 ?  67  VAL B O    1  
ATOM   3402   C  CB   . VAL B  2 13  ? 25.014  -46.015 9.056   1.00 0.00 ?  67  VAL B CB   1  
ATOM   3403   C  CG1  . VAL B  2 13  ? 25.439  -45.256 7.700   1.00 0.00 ?  67  VAL B CG1  1  
ATOM   3404   C  CG2  . VAL B  2 13  ? 25.163  -47.538 8.709   1.00 0.00 ?  67  VAL B CG2  1  
ATOM   3405   H  H    . VAL B  2 13  ? 24.019  -46.142 11.411  1.00 0.00 ?  67  VAL B H    1  
ATOM   3406   H  HA   . VAL B  2 13  ? 26.688  -46.263 10.441  1.00 0.00 ?  67  VAL B HA   1  
ATOM   3407   H  HB   . VAL B  2 13  ? 23.958  -45.759 9.286   1.00 0.00 ?  67  VAL B HB   1  
ATOM   3408   H  HG11 . VAL B  2 13  ? 25.404  -44.154 7.833   1.00 0.00 ?  67  VAL B HG11 1  
ATOM   3409   H  HG12 . VAL B  2 13  ? 24.724  -45.370 6.857   1.00 0.00 ?  67  VAL B HG12 1  
ATOM   3410   H  HG13 . VAL B  2 13  ? 26.493  -45.547 7.506   1.00 0.00 ?  67  VAL B HG13 1  
ATOM   3411   H  HG21 . VAL B  2 13  ? 24.713  -48.151 9.520   1.00 0.00 ?  67  VAL B HG21 1  
ATOM   3412   H  HG22 . VAL B  2 13  ? 26.196  -47.876 8.482   1.00 0.00 ?  67  VAL B HG22 1  
ATOM   3413   H  HG23 . VAL B  2 13  ? 24.447  -47.702 7.876   1.00 0.00 ?  67  VAL B HG23 1  
ATOM   3414   N  N    . THR B  2 14  ? 25.480  -43.217 10.458  1.00 0.00 ?  68  THR B N    1  
ATOM   3415   C  CA   . THR B  2 14  ? 25.935  -41.791 10.655  1.00 0.00 ?  68  THR B CA   1  
ATOM   3416   C  C    . THR B  2 14  ? 26.879  -41.515 11.786  1.00 0.00 ?  68  THR B C    1  
ATOM   3417   O  O    . THR B  2 14  ? 27.818  -40.740 11.650  1.00 0.00 ?  68  THR B O    1  
ATOM   3418   C  CB   . THR B  2 14  ? 24.749  -40.816 10.764  1.00 0.00 ?  68  THR B CB   1  
ATOM   3419   O  OG1  . THR B  2 14  ? 23.965  -40.847 9.572   1.00 0.00 ?  68  THR B OG1  1  
ATOM   3420   C  CG2  . THR B  2 14  ? 25.183  -39.328 10.777  1.00 0.00 ?  68  THR B CG2  1  
ATOM   3421   H  H    . THR B  2 14  ? 24.517  -43.473 10.412  1.00 0.00 ?  68  THR B H    1  
ATOM   3422   H  HA   . THR B  2 14  ? 26.434  -41.469 9.753   1.00 0.00 ?  68  THR B HA   1  
ATOM   3423   H  HB   . THR B  2 14  ? 24.058  -41.036 11.606  1.00 0.00 ?  68  THR B HB   1  
ATOM   3424   H  HG1  . THR B  2 14  ? 23.336  -41.552 9.743   1.00 0.00 ?  68  THR B HG1  1  
ATOM   3425   H  HG21 . THR B  2 14  ? 25.688  -39.099 9.814   1.00 0.00 ?  68  THR B HG21 1  
ATOM   3426   H  HG22 . THR B  2 14  ? 25.878  -39.205 11.635  1.00 0.00 ?  68  THR B HG22 1  
ATOM   3427   H  HG23 . THR B  2 14  ? 24.291  -38.676 10.893  1.00 0.00 ?  68  THR B HG23 1  
ATOM   3428   N  N    . GLN B  2 15  ? 26.655  -42.063 13.011  1.00 0.00 ?  69  GLN B N    1  
ATOM   3429   C  CA   . GLN B  2 15  ? 27.557  -41.865 14.121  1.00 0.00 ?  69  GLN B CA   1  
ATOM   3430   C  C    . GLN B  2 15  ? 28.976  -42.297 13.859  1.00 0.00 ?  69  GLN B C    1  
ATOM   3431   O  O    . GLN B  2 15  ? 29.920  -41.505 13.955  1.00 0.00 ?  69  GLN B O    1  
ATOM   3432   C  CB   . GLN B  2 15  ? 26.924  -42.499 15.472  1.00 0.00 ?  69  GLN B CB   1  
ATOM   3433   C  CG   . GLN B  2 15  ? 25.610  -41.730 15.828  1.00 0.00 ?  69  GLN B CG   1  
ATOM   3434   C  CD   . GLN B  2 15  ? 25.009  -42.387 17.137  1.00 0.00 ?  69  GLN B CD   1  
ATOM   3435   O  OE1  . GLN B  2 15  ? 23.951  -42.920 17.053  1.00 0.00 ?  69  GLN B OE1  1  
ATOM   3436   N  NE2  . GLN B  2 15  ? 25.761  -42.255 18.240  1.00 0.00 ?  69  GLN B NE2  1  
ATOM   3437   H  H    . GLN B  2 15  ? 25.911  -42.714 13.135  1.00 0.00 ?  69  GLN B H    1  
ATOM   3438   H  HA   . GLN B  2 15  ? 27.590  -40.803 14.317  1.00 0.00 ?  69  GLN B HA   1  
ATOM   3439   H  HB2  . GLN B  2 15  ? 26.751  -43.590 15.354  1.00 0.00 ?  69  GLN B HB2  1  
ATOM   3440   H  HB3  . GLN B  2 15  ? 27.625  -42.320 16.315  1.00 0.00 ?  69  GLN B HB3  1  
ATOM   3441   H  HG2  . GLN B  2 15  ? 25.777  -40.664 16.094  1.00 0.00 ?  69  GLN B HG2  1  
ATOM   3442   H  HG3  . GLN B  2 15  ? 24.824  -41.949 15.075  1.00 0.00 ?  69  GLN B HG3  1  
ATOM   3443   H  HE21 . GLN B  2 15  ? 25.479  -42.564 19.148  1.00 0.00 ?  69  GLN B HE21 1  
ATOM   3444   H  HE22 . GLN B  2 15  ? 26.573  -41.686 18.109  1.00 0.00 ?  69  GLN B HE22 1  
ATOM   3445   N  N    . GLU B  2 16  ? 29.110  -43.516 13.288  1.00 0.00 ?  70  GLU B N    1  
ATOM   3446   C  CA   . GLU B  2 16  ? 30.392  -44.109 12.918  1.00 0.00 ?  70  GLU B CA   1  
ATOM   3447   C  C    . GLU B  2 16  ? 31.043  -43.214 11.843  1.00 0.00 ?  70  GLU B C    1  
ATOM   3448   O  O    . GLU B  2 16  ? 32.214  -42.834 11.987  1.00 0.00 ?  70  GLU B O    1  
ATOM   3449   C  CB   . GLU B  2 16  ? 30.071  -45.597 12.438  1.00 0.00 ?  70  GLU B CB   1  
ATOM   3450   C  CG   . GLU B  2 16  ? 31.468  -46.340 12.173  1.00 0.00 ?  70  GLU B CG   1  
ATOM   3451   C  CD   . GLU B  2 16  ? 31.331  -47.868 11.901  1.00 0.00 ?  70  GLU B CD   1  
ATOM   3452   O  OE1  . GLU B  2 16  ? 32.427  -48.437 11.764  1.00 0.00 ?  70  GLU B OE1  1  
ATOM   3453   O  OE2  . GLU B  2 16  ? 30.217  -48.470 11.737  1.00 0.00 -1 70  GLU B OE2  1  
ATOM   3454   H  H    . GLU B  2 16  ? 28.274  -43.991 13.026  1.00 0.00 ?  70  GLU B H    1  
ATOM   3455   H  HA   . GLU B  2 16  ? 30.962  -44.320 13.811  1.00 0.00 ?  70  GLU B HA   1  
ATOM   3456   H  HB2  . GLU B  2 16  ? 29.625  -46.140 13.298  1.00 0.00 ?  70  GLU B HB2  1  
ATOM   3457   H  HB3  . GLU B  2 16  ? 29.353  -45.581 11.590  1.00 0.00 ?  70  GLU B HB3  1  
ATOM   3458   H  HG2  . GLU B  2 16  ? 31.986  -45.886 11.302  1.00 0.00 ?  70  GLU B HG2  1  
ATOM   3459   H  HG3  . GLU B  2 16  ? 31.960  -46.106 13.142  1.00 0.00 ?  70  GLU B HG3  1  
ATOM   3460   N  N    . PHE B  2 17  ? 30.261  -42.844 10.833  1.00 0.00 ?  71  PHE B N    1  
ATOM   3461   C  CA   . PHE B  2 17  ? 30.656  -41.896 9.737   1.00 0.00 ?  71  PHE B CA   1  
ATOM   3462   C  C    . PHE B  2 17  ? 31.256  -40.587 10.233  1.00 0.00 ?  71  PHE B C    1  
ATOM   3463   O  O    . PHE B  2 17  ? 32.264  -40.075 9.790   1.00 0.00 ?  71  PHE B O    1  
ATOM   3464   C  CB   . PHE B  2 17  ? 29.392  -41.651 8.785   1.00 0.00 ?  71  PHE B CB   1  
ATOM   3465   C  CG   . PHE B  2 17  ? 29.543  -40.417 7.852   1.00 0.00 ?  71  PHE B CG   1  
ATOM   3466   C  CD1  . PHE B  2 17  ? 28.892  -39.227 8.256   1.00 0.00 ?  71  PHE B CD1  1  
ATOM   3467   C  CD2  . PHE B  2 17  ? 30.189  -40.494 6.640   1.00 0.00 ?  71  PHE B CD2  1  
ATOM   3468   C  CE1  . PHE B  2 17  ? 28.953  -38.139 7.384   1.00 0.00 ?  71  PHE B CE1  1  
ATOM   3469   C  CE2  . PHE B  2 17  ? 30.124  -39.430 5.740   1.00 0.00 ?  71  PHE B CE2  1  
ATOM   3470   C  CZ   . PHE B  2 17  ? 29.446  -38.244 6.067   1.00 0.00 ?  71  PHE B CZ   1  
ATOM   3471   H  H    . PHE B  2 17  ? 29.287  -43.055 10.835  1.00 0.00 ?  71  PHE B H    1  
ATOM   3472   H  HA   . PHE B  2 17  ? 31.386  -42.306 9.054   1.00 0.00 ?  71  PHE B HA   1  
ATOM   3473   H  HB2  . PHE B  2 17  ? 29.165  -42.527 8.140   1.00 0.00 ?  71  PHE B HB2  1  
ATOM   3474   H  HB3  . PHE B  2 17  ? 28.481  -41.468 9.393   1.00 0.00 ?  71  PHE B HB3  1  
ATOM   3475   H  HD1  . PHE B  2 17  ? 28.366  -39.263 9.198   1.00 0.00 ?  71  PHE B HD1  1  
ATOM   3476   H  HD2  . PHE B  2 17  ? 30.741  -41.354 6.288   1.00 0.00 ?  71  PHE B HD2  1  
ATOM   3477   H  HE1  . PHE B  2 17  ? 28.431  -37.263 7.742   1.00 0.00 ?  71  PHE B HE1  1  
ATOM   3478   H  HE2  . PHE B  2 17  ? 30.706  -39.600 4.846   1.00 0.00 ?  71  PHE B HE2  1  
ATOM   3479   H  HZ   . PHE B  2 17  ? 29.435  -37.365 5.440   1.00 0.00 ?  71  PHE B HZ   1  
ATOM   3480   N  N    . TRP B  2 18  ? 30.557  -40.051 11.279  1.00 0.00 ?  72  TRP B N    1  
ATOM   3481   C  CA   . TRP B  2 18  ? 30.748  -38.852 11.938  1.00 0.00 ?  72  TRP B CA   1  
ATOM   3482   C  C    . TRP B  2 18  ? 32.058  -38.791 12.710  1.00 0.00 ?  72  TRP B C    1  
ATOM   3483   O  O    . TRP B  2 18  ? 32.810  -37.799 12.732  1.00 0.00 ?  72  TRP B O    1  
ATOM   3484   C  CB   . TRP B  2 18  ? 29.540  -38.368 12.721  1.00 0.00 ?  72  TRP B CB   1  
ATOM   3485   C  CG   . TRP B  2 18  ? 29.785  -37.090 13.505  1.00 0.00 ?  72  TRP B CG   1  
ATOM   3486   C  CD1  . TRP B  2 18  ? 29.783  -35.857 12.872  1.00 0.00 ?  72  TRP B CD1  1  
ATOM   3487   C  CD2  . TRP B  2 18  ? 30.142  -36.833 14.877  1.00 0.00 ?  72  TRP B CD2  1  
ATOM   3488   N  NE1  . TRP B  2 18  ? 29.906  -34.887 13.829  1.00 0.00 ?  72  TRP B NE1  1  
ATOM   3489   C  CE2  . TRP B  2 18  ? 30.077  -35.449 15.034  1.00 0.00 ?  72  TRP B CE2  1  
ATOM   3490   C  CE3  . TRP B  2 18  ? 30.382  -37.613 15.982  1.00 0.00 ?  72  TRP B CE3  1  
ATOM   3491   C  CZ2  . TRP B  2 18  ? 30.299  -34.793 16.188  1.00 0.00 ?  72  TRP B CZ2  1  
ATOM   3492   C  CZ3  . TRP B  2 18  ? 30.739  -36.963 17.189  1.00 0.00 ?  72  TRP B CZ3  1  
ATOM   3493   C  CH2  . TRP B  2 18  ? 30.638  -35.567 17.313  1.00 0.00 ?  72  TRP B CH2  1  
ATOM   3494   H  H    . TRP B  2 18  ? 29.763  -40.519 11.662  1.00 0.00 ?  72  TRP B H    1  
ATOM   3495   H  HA   . TRP B  2 18  ? 30.890  -38.183 11.102  1.00 0.00 ?  72  TRP B HA   1  
ATOM   3496   H  HB2  . TRP B  2 18  ? 28.724  -38.189 11.988  1.00 0.00 ?  72  TRP B HB2  1  
ATOM   3497   H  HB3  . TRP B  2 18  ? 29.137  -39.122 13.430  1.00 0.00 ?  72  TRP B HB3  1  
ATOM   3498   H  HD1  . TRP B  2 18  ? 29.528  -35.671 11.839  1.00 0.00 ?  72  TRP B HD1  1  
ATOM   3499   H  HE1  . TRP B  2 18  ? 29.812  -33.918 13.753  1.00 0.00 ?  72  TRP B HE1  1  
ATOM   3500   H  HE3  . TRP B  2 18  ? 30.397  -38.693 15.984  1.00 0.00 ?  72  TRP B HE3  1  
ATOM   3501   H  HZ2  . TRP B  2 18  ? 30.275  -33.718 16.296  1.00 0.00 ?  72  TRP B HZ2  1  
ATOM   3502   H  HZ3  . TRP B  2 18  ? 30.922  -37.555 18.073  1.00 0.00 ?  72  TRP B HZ3  1  
ATOM   3503   H  HH2  . TRP B  2 18  ? 30.925  -35.042 18.213  1.00 0.00 ?  72  TRP B HH2  1  
ATOM   3504   N  N    . ASP B  2 19  ? 32.385  -39.883 13.454  1.00 0.00 ?  73  ASP B N    1  
ATOM   3505   C  CA   . ASP B  2 19  ? 33.548  -40.024 14.289  1.00 0.00 ?  73  ASP B CA   1  
ATOM   3506   C  C    . ASP B  2 19  ? 34.811  -40.009 13.437  1.00 0.00 ?  73  ASP B C    1  
ATOM   3507   O  O    . ASP B  2 19  ? 35.776  -39.393 13.842  1.00 0.00 ?  73  ASP B O    1  
ATOM   3508   C  CB   . ASP B  2 19  ? 33.285  -41.393 14.994  1.00 0.00 ?  73  ASP B CB   1  
ATOM   3509   C  CG   . ASP B  2 19  ? 34.129  -41.454 16.301  1.00 0.00 ?  73  ASP B CG   1  
ATOM   3510   O  OD1  . ASP B  2 19  ? 34.314  -42.574 16.875  1.00 0.00 ?  73  ASP B OD1  1  
ATOM   3511   O  OD2  . ASP B  2 19  ? 34.568  -40.480 16.883  1.00 0.00 -1 73  ASP B OD2  1  
ATOM   3512   H  H    . ASP B  2 19  ? 31.648  -40.547 13.556  1.00 0.00 ?  73  ASP B H    1  
ATOM   3513   H  HA   . ASP B  2 19  ? 33.519  -39.228 15.019  1.00 0.00 ?  73  ASP B HA   1  
ATOM   3514   H  HB2  . ASP B  2 19  ? 32.215  -41.447 15.289  1.00 0.00 ?  73  ASP B HB2  1  
ATOM   3515   H  HB3  . ASP B  2 19  ? 33.635  -42.207 14.323  1.00 0.00 ?  73  ASP B HB3  1  
ATOM   3516   N  N    . ASN B  2 20  ? 34.816  -40.663 12.263  1.00 0.00 ?  74  ASN B N    1  
ATOM   3517   C  CA   . ASN B  2 20  ? 35.926  -40.773 11.333  1.00 0.00 ?  74  ASN B CA   1  
ATOM   3518   C  C    . ASN B  2 20  ? 36.338  -39.329 10.743  1.00 0.00 ?  74  ASN B C    1  
ATOM   3519   O  O    . ASN B  2 20  ? 37.492  -38.950 10.659  1.00 0.00 ?  74  ASN B O    1  
ATOM   3520   C  CB   . ASN B  2 20  ? 35.562  -41.691 10.213  1.00 0.00 ?  74  ASN B CB   1  
ATOM   3521   C  CG   . ASN B  2 20  ? 35.505  -43.105 10.731  1.00 0.00 ?  74  ASN B CG   1  
ATOM   3522   O  OD1  . ASN B  2 20  ? 36.067  -43.450 11.746  1.00 0.00 ?  74  ASN B OD1  1  
ATOM   3523   N  ND2  . ASN B  2 20  ? 34.961  -43.997 9.826   1.00 0.00 ?  74  ASN B ND2  1  
ATOM   3524   H  H    . ASN B  2 20  ? 34.022  -41.237 12.075  1.00 0.00 ?  74  ASN B H    1  
ATOM   3525   H  HA   . ASN B  2 20  ? 36.755  -41.129 11.927  1.00 0.00 ?  74  ASN B HA   1  
ATOM   3526   H  HB2  . ASN B  2 20  ? 34.614  -41.382 9.723   1.00 0.00 ?  74  ASN B HB2  1  
ATOM   3527   H  HB3  . ASN B  2 20  ? 36.345  -41.753 9.428   1.00 0.00 ?  74  ASN B HB3  1  
ATOM   3528   H  HD21 . ASN B  2 20  ? 35.039  -44.955 10.102  1.00 0.00 ?  74  ASN B HD21 1  
ATOM   3529   H  HD22 . ASN B  2 20  ? 34.687  -43.704 8.910   1.00 0.00 ?  74  ASN B HD22 1  
ATOM   3530   N  N    . LEU B  2 21  ? 35.344  -38.430 10.434  1.00 0.00 ?  75  LEU B N    1  
ATOM   3531   C  CA   . LEU B  2 21  ? 35.532  -37.076 10.022  1.00 0.00 ?  75  LEU B CA   1  
ATOM   3532   C  C    . LEU B  2 21  ? 36.058  -36.234 11.202  1.00 0.00 ?  75  LEU B C    1  
ATOM   3533   O  O    . LEU B  2 21  ? 37.004  -35.473 11.104  1.00 0.00 ?  75  LEU B O    1  
ATOM   3534   C  CB   . LEU B  2 21  ? 34.240  -36.534 9.370   1.00 0.00 ?  75  LEU B CB   1  
ATOM   3535   C  CG   . LEU B  2 21  ? 33.804  -37.353 8.142   1.00 0.00 ?  75  LEU B CG   1  
ATOM   3536   C  CD1  . LEU B  2 21  ? 32.392  -36.951 7.724   1.00 0.00 ?  75  LEU B CD1  1  
ATOM   3537   C  CD2  . LEU B  2 21  ? 34.749  -37.206 6.896   1.00 0.00 ?  75  LEU B CD2  1  
ATOM   3538   H  H    . LEU B  2 21  ? 34.421  -38.797 10.526  1.00 0.00 ?  75  LEU B H    1  
ATOM   3539   H  HA   . LEU B  2 21  ? 36.360  -37.048 9.328   1.00 0.00 ?  75  LEU B HA   1  
ATOM   3540   H  HB2  . LEU B  2 21  ? 33.409  -36.677 10.093  1.00 0.00 ?  75  LEU B HB2  1  
ATOM   3541   H  HB3  . LEU B  2 21  ? 34.490  -35.551 8.918   1.00 0.00 ?  75  LEU B HB3  1  
ATOM   3542   H  HG   . LEU B  2 21  ? 33.736  -38.442 8.352   1.00 0.00 ?  75  LEU B HG   1  
ATOM   3543   H  HD11 . LEU B  2 21  ? 32.195  -37.399 6.726   1.00 0.00 ?  75  LEU B HD11 1  
ATOM   3544   H  HD12 . LEU B  2 21  ? 32.268  -35.859 7.888   1.00 0.00 ?  75  LEU B HD12 1  
ATOM   3545   H  HD13 . LEU B  2 21  ? 31.750  -37.539 8.414   1.00 0.00 ?  75  LEU B HD13 1  
ATOM   3546   H  HD21 . LEU B  2 21  ? 35.780  -37.606 6.998   1.00 0.00 ?  75  LEU B HD21 1  
ATOM   3547   H  HD22 . LEU B  2 21  ? 34.890  -36.150 6.581   1.00 0.00 ?  75  LEU B HD22 1  
ATOM   3548   H  HD23 . LEU B  2 21  ? 34.331  -37.628 5.957   1.00 0.00 ?  75  LEU B HD23 1  
ATOM   3549   N  N    . GLU B  2 22  ? 35.453  -36.438 12.442  1.00 0.00 ?  76  GLU B N    1  
ATOM   3550   C  CA   . GLU B  2 22  ? 35.996  -35.888 13.650  1.00 0.00 ?  76  GLU B CA   1  
ATOM   3551   C  C    . GLU B  2 22  ? 37.455  -36.290 13.932  1.00 0.00 ?  76  GLU B C    1  
ATOM   3552   O  O    . GLU B  2 22  ? 38.282  -35.441 14.259  1.00 0.00 ?  76  GLU B O    1  
ATOM   3553   C  CB   . GLU B  2 22  ? 35.212  -36.188 14.989  1.00 0.00 ?  76  GLU B CB   1  
ATOM   3554   C  CG   . GLU B  2 22  ? 33.766  -35.597 14.833  1.00 0.00 ?  76  GLU B CG   1  
ATOM   3555   C  CD   . GLU B  2 22  ? 33.753  -34.168 15.162  1.00 0.00 ?  76  GLU B CD   1  
ATOM   3556   O  OE1  . GLU B  2 22  ? 33.726  -33.355 14.225  1.00 0.00 ?  76  GLU B OE1  1  
ATOM   3557   O  OE2  . GLU B  2 22  ? 33.805  -33.829 16.395  1.00 0.00 -1 76  GLU B OE2  1  
ATOM   3558   H  H    . GLU B  2 22  ? 34.658  -37.026 12.573  1.00 0.00 ?  76  GLU B H    1  
ATOM   3559   H  HA   . GLU B  2 22  ? 35.979  -34.818 13.509  1.00 0.00 ?  76  GLU B HA   1  
ATOM   3560   H  HB2  . GLU B  2 22  ? 35.116  -37.291 15.089  1.00 0.00 ?  76  GLU B HB2  1  
ATOM   3561   H  HB3  . GLU B  2 22  ? 35.647  -35.725 15.900  1.00 0.00 ?  76  GLU B HB3  1  
ATOM   3562   H  HG2  . GLU B  2 22  ? 33.253  -35.745 13.858  1.00 0.00 ?  76  GLU B HG2  1  
ATOM   3563   H  HG3  . GLU B  2 22  ? 32.976  -36.063 15.459  1.00 0.00 ?  76  GLU B HG3  1  
ATOM   3564   N  N    . LYS B  2 23  ? 37.766  -37.593 13.724  1.00 0.00 ?  77  LYS B N    1  
ATOM   3565   C  CA   . LYS B  2 23  ? 39.161  -38.169 13.791  1.00 0.00 ?  77  LYS B CA   1  
ATOM   3566   C  C    . LYS B  2 23  ? 40.131  -37.450 12.823  1.00 0.00 ?  77  LYS B C    1  
ATOM   3567   O  O    . LYS B  2 23  ? 41.227  -37.072 13.182  1.00 0.00 ?  77  LYS B O    1  
ATOM   3568   C  CB   . LYS B  2 23  ? 39.112  -39.681 13.524  1.00 0.00 ?  77  LYS B CB   1  
ATOM   3569   C  CG   . LYS B  2 23  ? 40.434  -40.462 13.636  1.00 0.00 ?  77  LYS B CG   1  
ATOM   3570   C  CD   . LYS B  2 23  ? 41.009  -40.376 15.007  1.00 0.00 ?  77  LYS B CD   1  
ATOM   3571   C  CE   . LYS B  2 23  ? 42.138  -41.386 15.288  1.00 0.00 ?  77  LYS B CE   1  
ATOM   3572   N  NZ   . LYS B  2 23  ? 43.337  -40.943 14.567  1.00 0.00 1  77  LYS B NZ   1  
ATOM   3573   H  H    . LYS B  2 23  ? 37.060  -38.270 13.528  1.00 0.00 ?  77  LYS B H    1  
ATOM   3574   H  HA   . LYS B  2 23  ? 39.539  -38.048 14.796  1.00 0.00 ?  77  LYS B HA   1  
ATOM   3575   H  HB2  . LYS B  2 23  ? 38.369  -40.135 14.214  1.00 0.00 ?  77  LYS B HB2  1  
ATOM   3576   H  HB3  . LYS B  2 23  ? 38.752  -39.893 12.495  1.00 0.00 ?  77  LYS B HB3  1  
ATOM   3577   H  HG2  . LYS B  2 23  ? 40.279  -41.547 13.449  1.00 0.00 ?  77  LYS B HG2  1  
ATOM   3578   H  HG3  . LYS B  2 23  ? 41.170  -40.148 12.866  1.00 0.00 ?  77  LYS B HG3  1  
ATOM   3579   H  HD2  . LYS B  2 23  ? 41.390  -39.356 15.228  1.00 0.00 ?  77  LYS B HD2  1  
ATOM   3580   H  HD3  . LYS B  2 23  ? 40.183  -40.478 15.743  1.00 0.00 ?  77  LYS B HD3  1  
ATOM   3581   H  HE2  . LYS B  2 23  ? 42.354  -41.562 16.363  1.00 0.00 ?  77  LYS B HE2  1  
ATOM   3582   H  HE3  . LYS B  2 23  ? 41.899  -42.415 14.944  1.00 0.00 ?  77  LYS B HE3  1  
ATOM   3583   H  HZ1  . LYS B  2 23  ? 43.508  -39.980 14.921  1.00 0.00 ?  77  LYS B HZ1  1  
ATOM   3584   H  HZ2  . LYS B  2 23  ? 43.277  -41.006 13.531  1.00 0.00 ?  77  LYS B HZ2  1  
ATOM   3585   H  HZ3  . LYS B  2 23  ? 44.276  -41.321 14.804  1.00 0.00 ?  77  LYS B HZ3  1  
ATOM   3586   N  N    . GLU B  2 24  ? 39.708  -37.303 11.582  1.00 0.00 ?  78  GLU B N    1  
ATOM   3587   C  CA   . GLU B  2 24  ? 40.511  -36.609 10.522  1.00 0.00 ?  78  GLU B CA   1  
ATOM   3588   C  C    . GLU B  2 24  ? 40.778  -35.166 10.882  1.00 0.00 ?  78  GLU B C    1  
ATOM   3589   O  O    . GLU B  2 24  ? 41.969  -34.774 10.922  1.00 0.00 ?  78  GLU B O    1  
ATOM   3590   C  CB   . GLU B  2 24  ? 39.813  -36.744 9.073   1.00 0.00 ?  78  GLU B CB   1  
ATOM   3591   C  CG   . GLU B  2 24  ? 39.645  -38.277 8.693   1.00 0.00 ?  78  GLU B CG   1  
ATOM   3592   C  CD   . GLU B  2 24  ? 40.668  -38.670 7.630   1.00 0.00 ?  78  GLU B CD   1  
ATOM   3593   O  OE1  . GLU B  2 24  ? 41.695  -39.299 8.012   1.00 0.00 ?  78  GLU B OE1  1  
ATOM   3594   O  OE2  . GLU B  2 24  ? 40.572  -38.235 6.449   1.00 0.00 -1 78  GLU B OE2  1  
ATOM   3595   H  H    . GLU B  2 24  ? 38.783  -37.599 11.360  1.00 0.00 ?  78  GLU B H    1  
ATOM   3596   H  HA   . GLU B  2 24  ? 41.484  -37.076 10.501  1.00 0.00 ?  78  GLU B HA   1  
ATOM   3597   H  HB2  . GLU B  2 24  ? 38.816  -36.267 9.179   1.00 0.00 ?  78  GLU B HB2  1  
ATOM   3598   H  HB3  . GLU B  2 24  ? 40.424  -36.213 8.312   1.00 0.00 ?  78  GLU B HB3  1  
ATOM   3599   H  HG2  . GLU B  2 24  ? 39.616  -38.978 9.554   1.00 0.00 ?  78  GLU B HG2  1  
ATOM   3600   H  HG3  . GLU B  2 24  ? 38.690  -38.453 8.152   1.00 0.00 ?  78  GLU B HG3  1  
ATOM   3601   N  N    . THR B  2 25  ? 39.850  -34.395 11.378  1.00 0.00 ?  79  THR B N    1  
ATOM   3602   C  CA   . THR B  2 25  ? 40.064  -32.983 11.707  1.00 0.00 ?  79  THR B CA   1  
ATOM   3603   C  C    . THR B  2 25  ? 41.230  -32.758 12.685  1.00 0.00 ?  79  THR B C    1  
ATOM   3604   O  O    . THR B  2 25  ? 41.940  -31.733 12.584  1.00 0.00 ?  79  THR B O    1  
ATOM   3605   C  CB   . THR B  2 25  ? 38.808  -32.568 12.469  1.00 0.00 ?  79  THR B CB   1  
ATOM   3606   O  OG1  . THR B  2 25  ? 37.657  -32.688 11.637  1.00 0.00 ?  79  THR B OG1  1  
ATOM   3607   C  CG2  . THR B  2 25  ? 38.875  -31.118 12.919  1.00 0.00 ?  79  THR B CG2  1  
ATOM   3608   H  H    . THR B  2 25  ? 38.892  -34.670 11.392  1.00 0.00 ?  79  THR B H    1  
ATOM   3609   H  HA   . THR B  2 25  ? 40.206  -32.446 10.780  1.00 0.00 ?  79  THR B HA   1  
ATOM   3610   H  HB   . THR B  2 25  ? 38.597  -33.179 13.373  1.00 0.00 ?  79  THR B HB   1  
ATOM   3611   H  HG1  . THR B  2 25  ? 36.896  -32.585 12.213  1.00 0.00 ?  79  THR B HG1  1  
ATOM   3612   H  HG21 . THR B  2 25  ? 37.898  -30.843 13.371  1.00 0.00 ?  79  THR B HG21 1  
ATOM   3613   H  HG22 . THR B  2 25  ? 39.318  -30.420 12.177  1.00 0.00 ?  79  THR B HG22 1  
ATOM   3614   H  HG23 . THR B  2 25  ? 39.618  -30.950 13.727  1.00 0.00 ?  79  THR B HG23 1  
ATOM   3615   N  N    . GLU B  2 26  ? 41.347  -33.632 13.717  1.00 0.00 ?  80  GLU B N    1  
ATOM   3616   C  CA   . GLU B  2 26  ? 42.397  -33.625 14.713  1.00 0.00 ?  80  GLU B CA   1  
ATOM   3617   C  C    . GLU B  2 26  ? 43.705  -33.940 14.128  1.00 0.00 ?  80  GLU B C    1  
ATOM   3618   O  O    . GLU B  2 26  ? 44.648  -33.214 14.432  1.00 0.00 ?  80  GLU B O    1  
ATOM   3619   C  CB   . GLU B  2 26  ? 41.994  -34.566 15.891  1.00 0.00 ?  80  GLU B CB   1  
ATOM   3620   C  CG   . GLU B  2 26  ? 43.109  -34.894 16.856  1.00 0.00 ?  80  GLU B CG   1  
ATOM   3621   C  CD   . GLU B  2 26  ? 42.811  -35.747 18.080  1.00 0.00 ?  80  GLU B CD   1  
ATOM   3622   O  OE1  . GLU B  2 26  ? 43.333  -36.937 18.144  1.00 0.00 ?  80  GLU B OE1  1  
ATOM   3623   O  OE2  . GLU B  2 26  ? 42.309  -35.169 19.097  1.00 0.00 -1 80  GLU B OE2  1  
ATOM   3624   H  H    . GLU B  2 26  ? 40.784  -34.454 13.756  1.00 0.00 ?  80  GLU B H    1  
ATOM   3625   H  HA   . GLU B  2 26  ? 42.634  -32.622 15.033  1.00 0.00 ?  80  GLU B HA   1  
ATOM   3626   H  HB2  . GLU B  2 26  ? 41.074  -34.182 16.382  1.00 0.00 ?  80  GLU B HB2  1  
ATOM   3627   H  HB3  . GLU B  2 26  ? 41.575  -35.543 15.570  1.00 0.00 ?  80  GLU B HB3  1  
ATOM   3628   H  HG2  . GLU B  2 26  ? 43.975  -35.449 16.436  1.00 0.00 ?  80  GLU B HG2  1  
ATOM   3629   H  HG3  . GLU B  2 26  ? 43.596  -33.951 17.185  1.00 0.00 ?  80  GLU B HG3  1  
ATOM   3630   N  N    . GLY B  2 27  ? 43.928  -34.950 13.240  1.00 0.00 ?  81  GLY B N    1  
ATOM   3631   C  CA   . GLY B  2 27  ? 45.297  -35.263 12.871  1.00 0.00 ?  81  GLY B CA   1  
ATOM   3632   C  C    . GLY B  2 27  ? 45.815  -34.303 11.847  1.00 0.00 ?  81  GLY B C    1  
ATOM   3633   O  O    . GLY B  2 27  ? 47.032  -34.083 11.722  1.00 0.00 ?  81  GLY B O    1  
ATOM   3634   H  H    . GLY B  2 27  ? 43.272  -35.474 12.703  1.00 0.00 ?  81  GLY B H    1  
ATOM   3635   H  HA2  . GLY B  2 27  ? 45.995  -35.245 13.695  1.00 0.00 ?  81  GLY B HA2  1  
ATOM   3636   H  HA3  . GLY B  2 27  ? 45.248  -36.188 12.315  1.00 0.00 ?  81  GLY B HA3  1  
ATOM   3637   N  N    . LEU B  2 28  ? 44.949  -33.724 11.045  1.00 0.00 ?  82  LEU B N    1  
ATOM   3638   C  CA   . LEU B  2 28  ? 45.104  -32.500 10.335  1.00 0.00 ?  82  LEU B CA   1  
ATOM   3639   C  C    . LEU B  2 28  ? 45.556  -31.228 11.233  1.00 0.00 ?  82  LEU B C    1  
ATOM   3640   O  O    . LEU B  2 28  ? 46.517  -30.453 11.036  1.00 0.00 ?  82  LEU B O    1  
ATOM   3641   C  CB   . LEU B  2 28  ? 43.891  -32.206 9.435   1.00 0.00 ?  82  LEU B CB   1  
ATOM   3642   C  CG   . LEU B  2 28  ? 43.338  -33.353 8.540   1.00 0.00 ?  82  LEU B CG   1  
ATOM   3643   C  CD1  . LEU B  2 28  ? 41.791  -33.073 8.174   1.00 0.00 ?  82  LEU B CD1  1  
ATOM   3644   C  CD2  . LEU B  2 28  ? 44.196  -33.453 7.269   1.00 0.00 ?  82  LEU B CD2  1  
ATOM   3645   H  H    . LEU B  2 28  ? 44.064  -34.184 11.037  1.00 0.00 ?  82  LEU B H    1  
ATOM   3646   H  HA   . LEU B  2 28  ? 45.931  -32.680 9.664   1.00 0.00 ?  82  LEU B HA   1  
ATOM   3647   H  HB2  . LEU B  2 28  ? 43.027  -31.927 10.076  1.00 0.00 ?  82  LEU B HB2  1  
ATOM   3648   H  HB3  . LEU B  2 28  ? 44.239  -31.380 8.780   1.00 0.00 ?  82  LEU B HB3  1  
ATOM   3649   H  HG   . LEU B  2 28  ? 43.408  -34.363 8.997   1.00 0.00 ?  82  LEU B HG   1  
ATOM   3650   H  HD11 . LEU B  2 28  ? 41.305  -33.755 7.445   1.00 0.00 ?  82  LEU B HD11 1  
ATOM   3651   H  HD12 . LEU B  2 28  ? 41.658  -32.015 7.862   1.00 0.00 ?  82  LEU B HD12 1  
ATOM   3652   H  HD13 . LEU B  2 28  ? 41.279  -33.171 9.155   1.00 0.00 ?  82  LEU B HD13 1  
ATOM   3653   H  HD21 . LEU B  2 28  ? 44.102  -32.492 6.719   1.00 0.00 ?  82  LEU B HD21 1  
ATOM   3654   H  HD22 . LEU B  2 28  ? 43.849  -34.355 6.721   1.00 0.00 ?  82  LEU B HD22 1  
ATOM   3655   H  HD23 . LEU B  2 28  ? 45.292  -33.433 7.449   1.00 0.00 ?  82  LEU B HD23 1  
ATOM   3656   N  N    . ARG B  2 29  ? 44.844  -31.170 12.438  1.00 0.00 ?  83  ARG B N    1  
ATOM   3657   C  CA   . ARG B  2 29  ? 45.260  -30.117 13.354  1.00 0.00 ?  83  ARG B CA   1  
ATOM   3658   C  C    . ARG B  2 29  ? 46.626  -30.168 13.884  1.00 0.00 ?  83  ARG B C    1  
ATOM   3659   O  O    . ARG B  2 29  ? 47.330  -29.199 14.043  1.00 0.00 ?  83  ARG B O    1  
ATOM   3660   C  CB   . ARG B  2 29  ? 44.278  -30.121 14.576  1.00 0.00 ?  83  ARG B CB   1  
ATOM   3661   C  CG   . ARG B  2 29  ? 43.129  -29.229 14.210  1.00 0.00 ?  83  ARG B CG   1  
ATOM   3662   C  CD   . ARG B  2 29  ? 41.872  -29.242 15.063  1.00 0.00 ?  83  ARG B CD   1  
ATOM   3663   N  NE   . ARG B  2 29  ? 40.924  -28.142 14.613  1.00 0.00 ?  83  ARG B NE   1  
ATOM   3664   C  CZ   . ARG B  2 29  ? 39.658  -27.923 15.020  1.00 0.00 ?  83  ARG B CZ   1  
ATOM   3665   N  NH1  . ARG B  2 29  ? 39.132  -26.799 14.710  1.00 0.00 1  83  ARG B NH1  1  
ATOM   3666   N  NH2  . ARG B  2 29  ? 38.958  -28.797 15.742  1.00 0.00 ?  83  ARG B NH2  1  
ATOM   3667   H  H    . ARG B  2 29  ? 44.109  -31.810 12.647  1.00 0.00 ?  83  ARG B H    1  
ATOM   3668   H  HA   . ARG B  2 29  ? 45.037  -29.163 12.900  1.00 0.00 ?  83  ARG B HA   1  
ATOM   3669   H  HB2  . ARG B  2 29  ? 43.883  -31.117 14.870  1.00 0.00 ?  83  ARG B HB2  1  
ATOM   3670   H  HB3  . ARG B  2 29  ? 44.640  -29.581 15.477  1.00 0.00 ?  83  ARG B HB3  1  
ATOM   3671   H  HG2  . ARG B  2 29  ? 43.447  -28.165 14.212  1.00 0.00 ?  83  ARG B HG2  1  
ATOM   3672   H  HG3  . ARG B  2 29  ? 42.687  -29.337 13.197  1.00 0.00 ?  83  ARG B HG3  1  
ATOM   3673   H  HD2  . ARG B  2 29  ? 41.394  -30.231 14.892  1.00 0.00 ?  83  ARG B HD2  1  
ATOM   3674   H  HD3  . ARG B  2 29  ? 42.128  -29.138 16.139  1.00 0.00 ?  83  ARG B HD3  1  
ATOM   3675   H  HE   . ARG B  2 29  ? 41.275  -27.422 14.014  1.00 0.00 ?  83  ARG B HE   1  
ATOM   3676   H  HH11 . ARG B  2 29  ? 39.655  -26.061 14.283  1.00 0.00 ?  83  ARG B HH11 1  
ATOM   3677   H  HH12 . ARG B  2 29  ? 38.236  -26.649 15.128  1.00 0.00 ?  83  ARG B HH12 1  
ATOM   3678   H  HH21 . ARG B  2 29  ? 39.508  -29.604 15.956  1.00 0.00 ?  83  ARG B HH21 1  
ATOM   3679   H  HH22 . ARG B  2 29  ? 37.969  -28.738 15.872  1.00 0.00 ?  83  ARG B HH22 1  
ATOM   3680   N  N    . GLN B  2 30  ? 47.065  -31.412 14.083  1.00 0.00 ?  84  GLN B N    1  
ATOM   3681   C  CA   . GLN B  2 30  ? 48.402  -31.767 14.549  1.00 0.00 ?  84  GLN B CA   1  
ATOM   3682   C  C    . GLN B  2 30  ? 49.578  -31.584 13.537  1.00 0.00 ?  84  GLN B C    1  
ATOM   3683   O  O    . GLN B  2 30  ? 50.644  -31.114 13.905  1.00 0.00 ?  84  GLN B O    1  
ATOM   3684   C  CB   . GLN B  2 30  ? 48.329  -33.337 14.904  1.00 0.00 ?  84  GLN B CB   1  
ATOM   3685   C  CG   . GLN B  2 30  ? 47.495  -33.643 16.164  1.00 0.00 ?  84  GLN B CG   1  
ATOM   3686   C  CD   . GLN B  2 30  ? 47.980  -32.832 17.387  1.00 0.00 ?  84  GLN B CD   1  
ATOM   3687   O  OE1  . GLN B  2 30  ? 47.505  -31.711 17.714  1.00 0.00 ?  84  GLN B OE1  1  
ATOM   3688   N  NE2  . GLN B  2 30  ? 48.917  -33.430 18.139  1.00 0.00 ?  84  GLN B NE2  1  
ATOM   3689   H  H    . GLN B  2 30  ? 46.462  -32.205 14.094  1.00 0.00 ?  84  GLN B H    1  
ATOM   3690   H  HA   . GLN B  2 30  ? 48.635  -31.164 15.414  1.00 0.00 ?  84  GLN B HA   1  
ATOM   3691   H  HB2  . GLN B  2 30  ? 47.843  -33.892 14.073  1.00 0.00 ?  84  GLN B HB2  1  
ATOM   3692   H  HB3  . GLN B  2 30  ? 49.386  -33.641 15.058  1.00 0.00 ?  84  GLN B HB3  1  
ATOM   3693   H  HG2  . GLN B  2 30  ? 46.439  -33.414 15.907  1.00 0.00 ?  84  GLN B HG2  1  
ATOM   3694   H  HG3  . GLN B  2 30  ? 47.474  -34.718 16.441  1.00 0.00 ?  84  GLN B HG3  1  
ATOM   3695   H  HE21 . GLN B  2 30  ? 49.265  -32.919 18.925  1.00 0.00 ?  84  GLN B HE21 1  
ATOM   3696   H  HE22 . GLN B  2 30  ? 49.308  -34.287 17.803  1.00 0.00 ?  84  GLN B HE22 1  
ATOM   3697   N  N    . GLU B  2 31  ? 49.370  -31.787 12.233  1.00 0.00 ?  85  GLU B N    1  
ATOM   3698   C  CA   . GLU B  2 31  ? 50.169  -31.313 11.176  1.00 0.00 ?  85  GLU B CA   1  
ATOM   3699   C  C    . GLU B  2 31  ? 50.303  -29.846 10.982  1.00 0.00 ?  85  GLU B C    1  
ATOM   3700   O  O    . GLU B  2 31  ? 51.437  -29.275 10.911  1.00 0.00 ?  85  GLU B O    1  
ATOM   3701   C  CB   . GLU B  2 31  ? 49.789  -31.908 9.787   1.00 0.00 ?  85  GLU B CB   1  
ATOM   3702   C  CG   . GLU B  2 31  ? 49.887  -33.465 9.626   1.00 0.00 ?  85  GLU B CG   1  
ATOM   3703   C  CD   . GLU B  2 31  ? 50.290  -33.990 8.301   1.00 0.00 ?  85  GLU B CD   1  
ATOM   3704   O  OE1  . GLU B  2 31  ? 51.336  -34.542 8.140   1.00 0.00 ?  85  GLU B OE1  1  
ATOM   3705   O  OE2  . GLU B  2 31  ? 49.464  -33.850 7.333   1.00 0.00 -1 85  GLU B OE2  1  
ATOM   3706   H  H    . GLU B  2 31  ? 48.458  -32.100 11.976  1.00 0.00 ?  85  GLU B H    1  
ATOM   3707   H  HA   . GLU B  2 31  ? 51.149  -31.704 11.406  1.00 0.00 ?  85  GLU B HA   1  
ATOM   3708   H  HB2  . GLU B  2 31  ? 48.787  -31.474 9.585   1.00 0.00 ?  85  GLU B HB2  1  
ATOM   3709   H  HB3  . GLU B  2 31  ? 50.433  -31.475 8.991   1.00 0.00 ?  85  GLU B HB3  1  
ATOM   3710   H  HG2  . GLU B  2 31  ? 50.624  -33.770 10.399  1.00 0.00 ?  85  GLU B HG2  1  
ATOM   3711   H  HG3  . GLU B  2 31  ? 48.927  -33.918 9.954   1.00 0.00 ?  85  GLU B HG3  1  
ATOM   3712   N  N    . MET B  2 32  ? 49.202  -29.107 10.997  1.00 0.00 ?  86  MET B N    1  
ATOM   3713   C  CA   . MET B  2 32  ? 49.331  -27.723 10.676  1.00 0.00 ?  86  MET B CA   1  
ATOM   3714   C  C    . MET B  2 32  ? 49.747  -26.714 11.678  1.00 0.00 ?  86  MET B C    1  
ATOM   3715   O  O    . MET B  2 32  ? 50.025  -25.582 11.412  1.00 0.00 ?  86  MET B O    1  
ATOM   3716   C  CB   . MET B  2 32  ? 48.029  -27.242 9.968   1.00 0.00 ?  86  MET B CB   1  
ATOM   3717   C  CG   . MET B  2 32  ? 46.747  -27.082 10.786  1.00 0.00 ?  86  MET B CG   1  
ATOM   3718   S  SD   . MET B  2 32  ? 46.706  -25.386 11.442  1.00 0.00 ?  86  MET B SD   1  
ATOM   3719   C  CE   . MET B  2 32  ? 45.526  -25.613 12.745  1.00 0.00 ?  86  MET B CE   1  
ATOM   3720   H  H    . MET B  2 32  ? 48.326  -29.577 11.073  1.00 0.00 ?  86  MET B H    1  
ATOM   3721   H  HA   . MET B  2 32  ? 49.969  -27.536 9.825   1.00 0.00 ?  86  MET B HA   1  
ATOM   3722   H  HB2  . MET B  2 32  ? 48.221  -26.250 9.506   1.00 0.00 ?  86  MET B HB2  1  
ATOM   3723   H  HB3  . MET B  2 32  ? 47.730  -27.867 9.100   1.00 0.00 ?  86  MET B HB3  1  
ATOM   3724   H  HG2  . MET B  2 32  ? 45.833  -27.129 10.156  1.00 0.00 ?  86  MET B HG2  1  
ATOM   3725   H  HG3  . MET B  2 32  ? 46.562  -27.857 11.561  1.00 0.00 ?  86  MET B HG3  1  
ATOM   3726   H  HE1  . MET B  2 32  ? 45.850  -26.403 13.456  1.00 0.00 ?  86  MET B HE1  1  
ATOM   3727   H  HE2  . MET B  2 32  ? 44.519  -25.674 12.281  1.00 0.00 ?  86  MET B HE2  1  
ATOM   3728   H  HE3  . MET B  2 32  ? 45.442  -24.692 13.361  1.00 0.00 ?  86  MET B HE3  1  
ATOM   3729   N  N    . SER B  2 33  ? 49.862  -27.150 12.952  1.00 0.00 ?  87  SER B N    1  
ATOM   3730   C  CA   . SER B  2 33  ? 50.133  -26.356 14.161  1.00 0.00 ?  87  SER B CA   1  
ATOM   3731   C  C    . SER B  2 33  ? 51.444  -25.572 14.116  1.00 0.00 ?  87  SER B C    1  
ATOM   3732   O  O    . SER B  2 33  ? 51.460  -24.375 14.225  1.00 0.00 ?  87  SER B O    1  
ATOM   3733   C  CB   . SER B  2 33  ? 49.990  -27.221 15.472  1.00 0.00 ?  87  SER B CB   1  
ATOM   3734   O  OG   . SER B  2 33  ? 50.358  -26.506 16.694  1.00 0.00 ?  87  SER B OG   1  
ATOM   3735   H  H    . SER B  2 33  ? 49.504  -28.057 13.163  1.00 0.00 ?  87  SER B H    1  
ATOM   3736   H  HA   . SER B  2 33  ? 49.314  -25.652 14.174  1.00 0.00 ?  87  SER B HA   1  
ATOM   3737   H  HB2  . SER B  2 33  ? 48.915  -27.502 15.452  1.00 0.00 ?  87  SER B HB2  1  
ATOM   3738   H  HB3  . SER B  2 33  ? 50.582  -28.150 15.325  1.00 0.00 ?  87  SER B HB3  1  
ATOM   3739   H  HG   . SER B  2 33  ? 51.292  -26.286 16.679  1.00 0.00 ?  87  SER B HG   1  
ATOM   3740   N  N    . LYS B  2 34  ? 52.613  -26.187 13.813  1.00 0.00 ?  88  LYS B N    1  
ATOM   3741   C  CA   . LYS B  2 34  ? 53.774  -25.397 13.489  1.00 0.00 ?  88  LYS B CA   1  
ATOM   3742   C  C    . LYS B  2 34  ? 53.676  -24.478 12.244  1.00 0.00 ?  88  LYS B C    1  
ATOM   3743   O  O    . LYS B  2 34  ? 54.200  -23.387 12.343  1.00 0.00 ?  88  LYS B O    1  
ATOM   3744   C  CB   . LYS B  2 34  ? 55.102  -26.202 13.198  1.00 0.00 ?  88  LYS B CB   1  
ATOM   3745   C  CG   . LYS B  2 34  ? 55.660  -26.957 14.428  1.00 0.00 ?  88  LYS B CG   1  
ATOM   3746   C  CD   . LYS B  2 34  ? 56.157  -26.132 15.576  1.00 0.00 ?  88  LYS B CD   1  
ATOM   3747   C  CE   . LYS B  2 34  ? 56.612  -26.954 16.807  1.00 0.00 ?  88  LYS B CE   1  
ATOM   3748   N  NZ   . LYS B  2 34  ? 57.262  -26.113 17.787  1.00 0.00 1  88  LYS B NZ   1  
ATOM   3749   H  H    . LYS B  2 34  ? 52.722  -27.177 13.771  1.00 0.00 ?  88  LYS B H    1  
ATOM   3750   H  HA   . LYS B  2 34  ? 53.939  -24.736 14.327  1.00 0.00 ?  88  LYS B HA   1  
ATOM   3751   H  HB2  . LYS B  2 34  ? 54.956  -26.872 12.323  1.00 0.00 ?  88  LYS B HB2  1  
ATOM   3752   H  HB3  . LYS B  2 34  ? 55.899  -25.508 12.856  1.00 0.00 ?  88  LYS B HB3  1  
ATOM   3753   H  HG2  . LYS B  2 34  ? 54.918  -27.653 14.876  1.00 0.00 ?  88  LYS B HG2  1  
ATOM   3754   H  HG3  . LYS B  2 34  ? 56.534  -27.557 14.095  1.00 0.00 ?  88  LYS B HG3  1  
ATOM   3755   H  HD2  . LYS B  2 34  ? 57.036  -25.573 15.190  1.00 0.00 ?  88  LYS B HD2  1  
ATOM   3756   H  HD3  . LYS B  2 34  ? 55.380  -25.440 15.968  1.00 0.00 ?  88  LYS B HD3  1  
ATOM   3757   H  HE2  . LYS B  2 34  ? 55.689  -27.290 17.328  1.00 0.00 ?  88  LYS B HE2  1  
ATOM   3758   H  HE3  . LYS B  2 34  ? 57.192  -27.888 16.648  1.00 0.00 ?  88  LYS B HE3  1  
ATOM   3759   H  HZ1  . LYS B  2 34  ? 58.105  -25.638 17.406  1.00 0.00 ?  88  LYS B HZ1  1  
ATOM   3760   H  HZ2  . LYS B  2 34  ? 57.659  -26.621 18.603  1.00 0.00 ?  88  LYS B HZ2  1  
ATOM   3761   H  HZ3  . LYS B  2 34  ? 56.614  -25.506 18.328  1.00 0.00 ?  88  LYS B HZ3  1  
ATOM   3762   N  N    . ASP B  2 35  ? 53.156  -24.888 11.086  1.00 0.00 ?  89  ASP B N    1  
ATOM   3763   C  CA   . ASP B  2 35  ? 53.033  -24.100 9.848   1.00 0.00 ?  89  ASP B CA   1  
ATOM   3764   C  C    . ASP B  2 35  ? 52.174  -22.867 10.064  1.00 0.00 ?  89  ASP B C    1  
ATOM   3765   O  O    . ASP B  2 35  ? 52.557  -21.763 9.584   1.00 0.00 ?  89  ASP B O    1  
ATOM   3766   C  CB   . ASP B  2 35  ? 52.489  -25.049 8.797   1.00 0.00 ?  89  ASP B CB   1  
ATOM   3767   C  CG   . ASP B  2 35  ? 53.625  -25.954 8.356   1.00 0.00 ?  89  ASP B CG   1  
ATOM   3768   O  OD1  . ASP B  2 35  ? 54.740  -25.475 8.060   1.00 0.00 ?  89  ASP B OD1  1  
ATOM   3769   O  OD2  . ASP B  2 35  ? 53.420  -27.234 8.302   1.00 0.00 -1 89  ASP B OD2  1  
ATOM   3770   H  H    . ASP B  2 35  ? 52.768  -25.804 11.016  1.00 0.00 ?  89  ASP B H    1  
ATOM   3771   H  HA   . ASP B  2 35  ? 54.052  -23.778 9.692   1.00 0.00 ?  89  ASP B HA   1  
ATOM   3772   H  HB2  . ASP B  2 35  ? 51.741  -25.694 9.306   1.00 0.00 ?  89  ASP B HB2  1  
ATOM   3773   H  HB3  . ASP B  2 35  ? 52.136  -24.570 7.859   1.00 0.00 ?  89  ASP B HB3  1  
ATOM   3774   N  N    . LEU B  2 36  ? 51.003  -22.957 10.756  1.00 0.00 ?  90  LEU B N    1  
ATOM   3775   C  CA   . LEU B  2 36  ? 50.259  -21.759 11.207  1.00 0.00 ?  90  LEU B CA   1  
ATOM   3776   C  C    . LEU B  2 36  ? 51.119  -20.744 12.102  1.00 0.00 ?  90  LEU B C    1  
ATOM   3777   O  O    . LEU B  2 36  ? 51.059  -19.577 11.696  1.00 0.00 ?  90  LEU B O    1  
ATOM   3778   C  CB   . LEU B  2 36  ? 48.975  -22.152 12.026  1.00 0.00 ?  90  LEU B CB   1  
ATOM   3779   C  CG   . LEU B  2 36  ? 48.116  -20.936 12.495  1.00 0.00 ?  90  LEU B CG   1  
ATOM   3780   C  CD1  . LEU B  2 36  ? 47.704  -20.143 11.251  1.00 0.00 ?  90  LEU B CD1  1  
ATOM   3781   C  CD2  . LEU B  2 36  ? 46.969  -21.387 13.329  1.00 0.00 ?  90  LEU B CD2  1  
ATOM   3782   H  H    . LEU B  2 36  ? 50.635  -23.852 10.997  1.00 0.00 ?  90  LEU B H    1  
ATOM   3783   H  HA   . LEU B  2 36  ? 49.981  -21.262 10.289  1.00 0.00 ?  90  LEU B HA   1  
ATOM   3784   H  HB2  . LEU B  2 36  ? 48.330  -22.768 11.364  1.00 0.00 ?  90  LEU B HB2  1  
ATOM   3785   H  HB3  . LEU B  2 36  ? 49.332  -22.808 12.849  1.00 0.00 ?  90  LEU B HB3  1  
ATOM   3786   H  HG   . LEU B  2 36  ? 48.692  -20.279 13.181  1.00 0.00 ?  90  LEU B HG   1  
ATOM   3787   H  HD11 . LEU B  2 36  ? 48.660  -19.878 10.752  1.00 0.00 ?  90  LEU B HD11 1  
ATOM   3788   H  HD12 . LEU B  2 36  ? 47.006  -19.293 11.411  1.00 0.00 ?  90  LEU B HD12 1  
ATOM   3789   H  HD13 . LEU B  2 36  ? 47.221  -20.927 10.629  1.00 0.00 ?  90  LEU B HD13 1  
ATOM   3790   H  HD21 . LEU B  2 36  ? 46.209  -22.001 12.800  1.00 0.00 ?  90  LEU B HD21 1  
ATOM   3791   H  HD22 . LEU B  2 36  ? 46.442  -20.495 13.728  1.00 0.00 ?  90  LEU B HD22 1  
ATOM   3792   H  HD23 . LEU B  2 36  ? 47.381  -21.893 14.229  1.00 0.00 ?  90  LEU B HD23 1  
ATOM   3793   N  N    . GLU B  2 37  ? 51.972  -21.144 13.071  1.00 0.00 ?  91  GLU B N    1  
ATOM   3794   C  CA   . GLU B  2 37  ? 53.071  -20.252 13.619  1.00 0.00 ?  91  GLU B CA   1  
ATOM   3795   C  C    . GLU B  2 37  ? 54.165  -19.723 12.627  1.00 0.00 ?  91  GLU B C    1  
ATOM   3796   O  O    . GLU B  2 37  ? 54.650  -18.592 12.728  1.00 0.00 ?  91  GLU B O    1  
ATOM   3797   C  CB   . GLU B  2 37  ? 53.787  -20.912 14.860  1.00 0.00 ?  91  GLU B CB   1  
ATOM   3798   C  CG   . GLU B  2 37  ? 52.870  -21.477 15.956  1.00 0.00 ?  91  GLU B CG   1  
ATOM   3799   C  CD   . GLU B  2 37  ? 53.622  -22.150 17.112  1.00 0.00 ?  91  GLU B CD   1  
ATOM   3800   O  OE1  . GLU B  2 37  ? 54.598  -21.474 17.672  1.00 0.00 ?  91  GLU B OE1  1  
ATOM   3801   O  OE2  . GLU B  2 37  ? 53.315  -23.306 17.431  1.00 0.00 -1 91  GLU B OE2  1  
ATOM   3802   H  H    . GLU B  2 37  ? 52.023  -22.079 13.412  1.00 0.00 ?  91  GLU B H    1  
ATOM   3803   H  HA   . GLU B  2 37  ? 52.657  -19.437 14.194  1.00 0.00 ?  91  GLU B HA   1  
ATOM   3804   H  HB2  . GLU B  2 37  ? 54.409  -21.758 14.496  1.00 0.00 ?  91  GLU B HB2  1  
ATOM   3805   H  HB3  . GLU B  2 37  ? 54.496  -20.143 15.234  1.00 0.00 ?  91  GLU B HB3  1  
ATOM   3806   H  HG2  . GLU B  2 37  ? 52.152  -20.751 16.393  1.00 0.00 ?  91  GLU B HG2  1  
ATOM   3807   H  HG3  . GLU B  2 37  ? 52.270  -22.314 15.539  1.00 0.00 ?  91  GLU B HG3  1  
ATOM   3808   N  N    . GLU B  2 38  ? 54.517  -20.513 11.649  1.00 0.00 ?  92  GLU B N    1  
ATOM   3809   C  CA   . GLU B  2 38  ? 55.235  -20.060 10.423  1.00 0.00 ?  92  GLU B CA   1  
ATOM   3810   C  C    . GLU B  2 38  ? 54.529  -18.988 9.562   1.00 0.00 ?  92  GLU B C    1  
ATOM   3811   O  O    . GLU B  2 38  ? 55.014  -17.914 9.346   1.00 0.00 ?  92  GLU B O    1  
ATOM   3812   C  CB   . GLU B  2 38  ? 55.931  -21.206 9.661   1.00 0.00 ?  92  GLU B CB   1  
ATOM   3813   C  CG   . GLU B  2 38  ? 57.418  -21.632 9.973   1.00 0.00 ?  92  GLU B CG   1  
ATOM   3814   C  CD   . GLU B  2 38  ? 57.750  -22.748 9.091   1.00 0.00 ?  92  GLU B CD   1  
ATOM   3815   O  OE1  . GLU B  2 38  ? 58.269  -23.797 9.532   1.00 0.00 ?  92  GLU B OE1  1  
ATOM   3816   O  OE2  . GLU B  2 38  ? 57.740  -22.600 7.848   1.00 0.00 -1 92  GLU B OE2  1  
ATOM   3817   H  H    . GLU B  2 38  ? 54.293  -21.465 11.841  1.00 0.00 ?  92  GLU B H    1  
ATOM   3818   H  HA   . GLU B  2 38  ? 56.066  -19.430 10.703  1.00 0.00 ?  92  GLU B HA   1  
ATOM   3819   H  HB2  . GLU B  2 38  ? 55.204  -22.033 9.518   1.00 0.00 ?  92  GLU B HB2  1  
ATOM   3820   H  HB3  . GLU B  2 38  ? 55.962  -20.790 8.631   1.00 0.00 ?  92  GLU B HB3  1  
ATOM   3821   H  HG2  . GLU B  2 38  ? 58.171  -20.840 9.771   1.00 0.00 ?  92  GLU B HG2  1  
ATOM   3822   H  HG3  . GLU B  2 38  ? 57.497  -21.966 11.030  1.00 0.00 ?  92  GLU B HG3  1  
ATOM   3823   N  N    . VAL B  2 39  ? 53.291  -19.203 9.172   1.00 0.00 ?  93  VAL B N    1  
ATOM   3824   C  CA   . VAL B  2 39  ? 52.571  -18.136 8.404   1.00 0.00 ?  93  VAL B CA   1  
ATOM   3825   C  C    . VAL B  2 39  ? 52.320  -16.881 9.183   1.00 0.00 ?  93  VAL B C    1  
ATOM   3826   O  O    . VAL B  2 39  ? 52.537  -15.819 8.628   1.00 0.00 ?  93  VAL B O    1  
ATOM   3827   C  CB   . VAL B  2 39  ? 51.373  -18.630 7.579   1.00 0.00 ?  93  VAL B CB   1  
ATOM   3828   C  CG1  . VAL B  2 39  ? 50.123  -18.725 8.414   1.00 0.00 ?  93  VAL B CG1  1  
ATOM   3829   C  CG2  . VAL B  2 39  ? 51.083  -17.732 6.373   1.00 0.00 ?  93  VAL B CG2  1  
ATOM   3830   H  H    . VAL B  2 39  ? 52.882  -20.099 9.326   1.00 0.00 ?  93  VAL B H    1  
ATOM   3831   H  HA   . VAL B  2 39  ? 53.201  -17.767 7.608   1.00 0.00 ?  93  VAL B HA   1  
ATOM   3832   H  HB   . VAL B  2 39  ? 51.643  -19.571 7.055   1.00 0.00 ?  93  VAL B HB   1  
ATOM   3833   H  HG11 . VAL B  2 39  ? 49.438  -19.234 7.702   1.00 0.00 ?  93  VAL B HG11 1  
ATOM   3834   H  HG12 . VAL B  2 39  ? 49.789  -17.750 8.829   1.00 0.00 ?  93  VAL B HG12 1  
ATOM   3835   H  HG13 . VAL B  2 39  ? 50.380  -19.510 9.157   1.00 0.00 ?  93  VAL B HG13 1  
ATOM   3836   H  HG21 . VAL B  2 39  ? 51.854  -17.800 5.575   1.00 0.00 ?  93  VAL B HG21 1  
ATOM   3837   H  HG22 . VAL B  2 39  ? 50.934  -16.681 6.701   1.00 0.00 ?  93  VAL B HG22 1  
ATOM   3838   H  HG23 . VAL B  2 39  ? 50.213  -18.067 5.769   1.00 0.00 ?  93  VAL B HG23 1  
ATOM   3839   N  N    . LYS B  2 40  ? 51.936  -16.945 10.510  1.00 0.00 ?  94  LYS B N    1  
ATOM   3840   C  CA   . LYS B  2 40  ? 51.898  -15.714 11.449  1.00 0.00 ?  94  LYS B CA   1  
ATOM   3841   C  C    . LYS B  2 40  ? 53.097  -14.760 11.366  1.00 0.00 ?  94  LYS B C    1  
ATOM   3842   O  O    . LYS B  2 40  ? 53.026  -13.712 10.772  1.00 0.00 ?  94  LYS B O    1  
ATOM   3843   C  CB   . LYS B  2 40  ? 51.652  -16.154 12.916  1.00 0.00 ?  94  LYS B CB   1  
ATOM   3844   C  CG   . LYS B  2 40  ? 50.314  -16.915 13.191  1.00 0.00 ?  94  LYS B CG   1  
ATOM   3845   C  CD   . LYS B  2 40  ? 49.031  -16.126 12.891  1.00 0.00 ?  94  LYS B CD   1  
ATOM   3846   C  CE   . LYS B  2 40  ? 47.709  -16.924 12.944  1.00 0.00 ?  94  LYS B CE   1  
ATOM   3847   N  NZ   . LYS B  2 40  ? 46.552  -16.027 12.792  1.00 0.00 1  94  LYS B NZ   1  
ATOM   3848   H  H    . LYS B  2 40  ? 51.812  -17.829 10.953  1.00 0.00 ?  94  LYS B H    1  
ATOM   3849   H  HA   . LYS B  2 40  ? 51.076  -15.052 11.220  1.00 0.00 ?  94  LYS B HA   1  
ATOM   3850   H  HB2  . LYS B  2 40  ? 52.476  -16.794 13.298  1.00 0.00 ?  94  LYS B HB2  1  
ATOM   3851   H  HB3  . LYS B  2 40  ? 51.477  -15.269 13.564  1.00 0.00 ?  94  LYS B HB3  1  
ATOM   3852   H  HG2  . LYS B  2 40  ? 50.335  -17.728 12.435  1.00 0.00 ?  94  LYS B HG2  1  
ATOM   3853   H  HG3  . LYS B  2 40  ? 50.341  -17.296 14.235  1.00 0.00 ?  94  LYS B HG3  1  
ATOM   3854   H  HD2  . LYS B  2 40  ? 48.978  -15.166 13.448  1.00 0.00 ?  94  LYS B HD2  1  
ATOM   3855   H  HD3  . LYS B  2 40  ? 49.040  -15.862 11.811  1.00 0.00 ?  94  LYS B HD3  1  
ATOM   3856   H  HE2  . LYS B  2 40  ? 47.849  -17.643 12.109  1.00 0.00 ?  94  LYS B HE2  1  
ATOM   3857   H  HE3  . LYS B  2 40  ? 47.645  -17.456 13.918  1.00 0.00 ?  94  LYS B HE3  1  
ATOM   3858   H  HZ1  . LYS B  2 40  ? 46.555  -15.388 13.613  1.00 0.00 ?  94  LYS B HZ1  1  
ATOM   3859   H  HZ2  . LYS B  2 40  ? 45.682  -16.590 12.699  1.00 0.00 ?  94  LYS B HZ2  1  
ATOM   3860   H  HZ3  . LYS B  2 40  ? 46.778  -15.477 11.939  1.00 0.00 ?  94  LYS B HZ3  1  
ATOM   3861   N  N    . ALA B  2 41  ? 54.238  -15.161 11.800  1.00 0.00 ?  95  ALA B N    1  
ATOM   3862   C  CA   . ALA B  2 41  ? 55.550  -14.461 11.757  1.00 0.00 ?  95  ALA B CA   1  
ATOM   3863   C  C    . ALA B  2 41  ? 55.946  -14.071 10.381  1.00 0.00 ?  95  ALA B C    1  
ATOM   3864   O  O    . ALA B  2 41  ? 56.720  -13.096 10.230  1.00 0.00 ?  95  ALA B O    1  
ATOM   3865   C  CB   . ALA B  2 41  ? 56.755  -15.339 12.237  1.00 0.00 ?  95  ALA B CB   1  
ATOM   3866   H  H    . ALA B  2 41  ? 54.345  -16.109 12.090  1.00 0.00 ?  95  ALA B H    1  
ATOM   3867   H  HA   . ALA B  2 41  ? 55.567  -13.562 12.356  1.00 0.00 ?  95  ALA B HA   1  
ATOM   3868   H  HB1  . ALA B  2 41  ? 57.768  -14.973 11.962  1.00 0.00 ?  95  ALA B HB1  1  
ATOM   3869   H  HB2  . ALA B  2 41  ? 56.664  -16.404 11.936  1.00 0.00 ?  95  ALA B HB2  1  
ATOM   3870   H  HB3  . ALA B  2 41  ? 56.654  -15.281 13.342  1.00 0.00 ?  95  ALA B HB3  1  
ATOM   3871   N  N    . LYS B  2 42  ? 55.544  -14.763 9.302   1.00 0.00 ?  96  LYS B N    1  
ATOM   3872   C  CA   . LYS B  2 42  ? 55.642  -14.271 7.901   1.00 0.00 ?  96  LYS B CA   1  
ATOM   3873   C  C    . LYS B  2 42  ? 54.941  -12.959 7.606   1.00 0.00 ?  96  LYS B C    1  
ATOM   3874   O  O    . LYS B  2 42  ? 55.441  -12.064 6.957   1.00 0.00 ?  96  LYS B O    1  
ATOM   3875   C  CB   . LYS B  2 42  ? 55.396  -15.366 6.900   1.00 0.00 ?  96  LYS B CB   1  
ATOM   3876   C  CG   . LYS B  2 42  ? 55.624  -15.012 5.500   1.00 0.00 ?  96  LYS B CG   1  
ATOM   3877   C  CD   . LYS B  2 42  ? 57.133  -14.593 5.099   1.00 0.00 ?  96  LYS B CD   1  
ATOM   3878   C  CE   . LYS B  2 42  ? 58.198  -15.615 5.447   1.00 0.00 ?  96  LYS B CE   1  
ATOM   3879   N  NZ   . LYS B  2 42  ? 59.402  -15.027 4.875   1.00 0.00 1  96  LYS B NZ   1  
ATOM   3880   H  H    . LYS B  2 42  ? 54.942  -15.556 9.351   1.00 0.00 ?  96  LYS B H    1  
ATOM   3881   H  HA   . LYS B  2 42  ? 56.695  -14.071 7.777   1.00 0.00 ?  96  LYS B HA   1  
ATOM   3882   H  HB2  . LYS B  2 42  ? 56.138  -16.124 7.229   1.00 0.00 ?  96  LYS B HB2  1  
ATOM   3883   H  HB3  . LYS B  2 42  ? 54.411  -15.854 7.064   1.00 0.00 ?  96  LYS B HB3  1  
ATOM   3884   H  HG2  . LYS B  2 42  ? 55.376  -15.881 4.855   1.00 0.00 ?  96  LYS B HG2  1  
ATOM   3885   H  HG3  . LYS B  2 42  ? 54.989  -14.170 5.149   1.00 0.00 ?  96  LYS B HG3  1  
ATOM   3886   H  HD2  . LYS B  2 42  ? 57.169  -14.234 4.049   1.00 0.00 ?  96  LYS B HD2  1  
ATOM   3887   H  HD3  . LYS B  2 42  ? 57.267  -13.644 5.662   1.00 0.00 ?  96  LYS B HD3  1  
ATOM   3888   H  HE2  . LYS B  2 42  ? 58.365  -15.779 6.533   1.00 0.00 ?  96  LYS B HE2  1  
ATOM   3889   H  HE3  . LYS B  2 42  ? 57.982  -16.573 4.929   1.00 0.00 ?  96  LYS B HE3  1  
ATOM   3890   H  HZ1  . LYS B  2 42  ? 59.304  -14.875 3.851   1.00 0.00 ?  96  LYS B HZ1  1  
ATOM   3891   H  HZ2  . LYS B  2 42  ? 60.320  -15.454 5.111   1.00 0.00 ?  96  LYS B HZ2  1  
ATOM   3892   H  HZ3  . LYS B  2 42  ? 59.410  -14.114 5.373   1.00 0.00 ?  96  LYS B HZ3  1  
ATOM   3893   N  N    . VAL B  2 43  ? 53.686  -12.749 8.099   1.00 0.00 ?  97  VAL B N    1  
ATOM   3894   C  CA   . VAL B  2 43  ? 52.881  -11.570 7.760   1.00 0.00 ?  97  VAL B CA   1  
ATOM   3895   C  C    . VAL B  2 43  ? 52.942  -10.509 8.915   1.00 0.00 ?  97  VAL B C    1  
ATOM   3896   O  O    . VAL B  2 43  ? 52.948  -9.340  8.597   1.00 0.00 ?  97  VAL B O    1  
ATOM   3897   C  CB   . VAL B  2 43  ? 51.416  -11.969 7.616   1.00 0.00 ?  97  VAL B CB   1  
ATOM   3898   C  CG1  . VAL B  2 43  ? 50.558  -10.707 7.322   1.00 0.00 ?  97  VAL B CG1  1  
ATOM   3899   C  CG2  . VAL B  2 43  ? 51.194  -12.980 6.483   1.00 0.00 ?  97  VAL B CG2  1  
ATOM   3900   H  H    . VAL B  2 43  ? 53.280  -13.323 8.806   1.00 0.00 ?  97  VAL B H    1  
ATOM   3901   H  HA   . VAL B  2 43  ? 53.187  -11.206 6.790   1.00 0.00 ?  97  VAL B HA   1  
ATOM   3902   H  HB   . VAL B  2 43  ? 51.061  -12.380 8.586   1.00 0.00 ?  97  VAL B HB   1  
ATOM   3903   H  HG11 . VAL B  2 43  ? 50.290  -10.125 8.230   1.00 0.00 ?  97  VAL B HG11 1  
ATOM   3904   H  HG12 . VAL B  2 43  ? 49.538  -10.930 6.941   1.00 0.00 ?  97  VAL B HG12 1  
ATOM   3905   H  HG13 . VAL B  2 43  ? 51.174  -10.092 6.633   1.00 0.00 ?  97  VAL B HG13 1  
ATOM   3906   H  HG21 . VAL B  2 43  ? 50.162  -13.386 6.405   1.00 0.00 ?  97  VAL B HG21 1  
ATOM   3907   H  HG22 . VAL B  2 43  ? 51.847  -13.870 6.603   1.00 0.00 ?  97  VAL B HG22 1  
ATOM   3908   H  HG23 . VAL B  2 43  ? 51.480  -12.636 5.466   1.00 0.00 ?  97  VAL B HG23 1  
ATOM   3909   N  N    . GLN B  2 44  ? 53.068  -10.920 10.177  1.00 0.00 ?  98  GLN B N    1  
ATOM   3910   C  CA   . GLN B  2 44  ? 53.010  -10.040 11.339  1.00 0.00 ?  98  GLN B CA   1  
ATOM   3911   C  C    . GLN B  2 44  ? 54.059  -8.961  11.325  1.00 0.00 ?  98  GLN B C    1  
ATOM   3912   O  O    . GLN B  2 44  ? 53.744  -7.827  11.708  1.00 0.00 ?  98  GLN B O    1  
ATOM   3913   C  CB   . GLN B  2 44  ? 52.952  -10.903 12.587  1.00 0.00 ?  98  GLN B CB   1  
ATOM   3914   C  CG   . GLN B  2 44  ? 52.610  -10.253 13.965  1.00 0.00 ?  98  GLN B CG   1  
ATOM   3915   C  CD   . GLN B  2 44  ? 51.343  -9.403  13.928  1.00 0.00 ?  98  GLN B CD   1  
ATOM   3916   O  OE1  . GLN B  2 44  ? 50.208  -9.842  13.841  1.00 0.00 ?  98  GLN B OE1  1  
ATOM   3917   N  NE2  . GLN B  2 44  ? 51.591  -8.068  13.880  1.00 0.00 ?  98  GLN B NE2  1  
ATOM   3918   H  H    . GLN B  2 44  ? 52.982  -11.904 10.317  1.00 0.00 ?  98  GLN B H    1  
ATOM   3919   H  HA   . GLN B  2 44  ? 52.071  -9.528  11.187  1.00 0.00 ?  98  GLN B HA   1  
ATOM   3920   H  HB2  . GLN B  2 44  ? 52.105  -11.584 12.359  1.00 0.00 ?  98  GLN B HB2  1  
ATOM   3921   H  HB3  . GLN B  2 44  ? 53.927  -11.417 12.728  1.00 0.00 ?  98  GLN B HB3  1  
ATOM   3922   H  HG2  . GLN B  2 44  ? 52.458  -11.158 14.590  1.00 0.00 ?  98  GLN B HG2  1  
ATOM   3923   H  HG3  . GLN B  2 44  ? 53.513  -9.732  14.349  1.00 0.00 ?  98  GLN B HG3  1  
ATOM   3924   H  HE21 . GLN B  2 44  ? 50.900  -7.452  13.504  1.00 0.00 ?  98  GLN B HE21 1  
ATOM   3925   H  HE22 . GLN B  2 44  ? 52.544  -7.765  13.899  1.00 0.00 ?  98  GLN B HE22 1  
ATOM   3926   N  N    . PRO B  2 45  ? 55.297  -9.106  10.864  1.00 0.00 ?  99  PRO B N    1  
ATOM   3927   C  CA   . PRO B  2 45  ? 56.273  -7.988  10.919  1.00 0.00 ?  99  PRO B CA   1  
ATOM   3928   C  C    . PRO B  2 45  ? 55.940  -6.928  9.957   1.00 0.00 ?  99  PRO B C    1  
ATOM   3929   O  O    . PRO B  2 45  ? 56.064  -5.805  10.377  1.00 0.00 ?  99  PRO B O    1  
ATOM   3930   C  CB   . PRO B  2 45  ? 57.626  -8.621  10.764  1.00 0.00 ?  99  PRO B CB   1  
ATOM   3931   C  CG   . PRO B  2 45  ? 57.385  -9.999  11.434  1.00 0.00 ?  99  PRO B CG   1  
ATOM   3932   C  CD   . PRO B  2 45  ? 56.006  -10.340 10.900  1.00 0.00 ?  99  PRO B CD   1  
ATOM   3933   H  HA   . PRO B  2 45  ? 56.178  -7.638  11.936  1.00 0.00 ?  99  PRO B HA   1  
ATOM   3934   H  HB2  . PRO B  2 45  ? 57.774  -8.804  9.678   1.00 0.00 ?  99  PRO B HB2  1  
ATOM   3935   H  HB3  . PRO B  2 45  ? 58.432  -8.007  11.218  1.00 0.00 ?  99  PRO B HB3  1  
ATOM   3936   H  HG2  . PRO B  2 45  ? 58.123  -10.793 11.190  1.00 0.00 ?  99  PRO B HG2  1  
ATOM   3937   H  HG3  . PRO B  2 45  ? 57.358  -9.921  12.542  1.00 0.00 ?  99  PRO B HG3  1  
ATOM   3938   H  HD2  . PRO B  2 45  ? 55.930  -10.699 9.851   1.00 0.00 ?  99  PRO B HD2  1  
ATOM   3939   H  HD3  . PRO B  2 45  ? 55.457  -11.009 11.596  1.00 0.00 ?  99  PRO B HD3  1  
ATOM   3940   N  N    . TYR B  2 46  ? 55.382  -7.289  8.798   1.00 0.00 ?  100 TYR B N    1  
ATOM   3941   C  CA   . TYR B  2 46  ? 54.859  -6.368  7.787   1.00 0.00 ?  100 TYR B CA   1  
ATOM   3942   C  C    . TYR B  2 46  ? 53.767  -5.514  8.308   1.00 0.00 ?  100 TYR B C    1  
ATOM   3943   O  O    . TYR B  2 46  ? 53.759  -4.332  8.021   1.00 0.00 ?  100 TYR B O    1  
ATOM   3944   C  CB   . TYR B  2 46  ? 54.342  -7.122  6.500   1.00 0.00 ?  100 TYR B CB   1  
ATOM   3945   C  CG   . TYR B  2 46  ? 55.499  -7.865  5.818   1.00 0.00 ?  100 TYR B CG   1  
ATOM   3946   C  CD1  . TYR B  2 46  ? 56.626  -7.176  5.187   1.00 0.00 ?  100 TYR B CD1  1  
ATOM   3947   C  CD2  . TYR B  2 46  ? 55.409  -9.224  5.721   1.00 0.00 ?  100 TYR B CD2  1  
ATOM   3948   C  CE1  . TYR B  2 46  ? 57.411  -7.880  4.283   1.00 0.00 ?  100 TYR B CE1  1  
ATOM   3949   C  CE2  . TYR B  2 46  ? 56.346  -9.912  4.965   1.00 0.00 ?  100 TYR B CE2  1  
ATOM   3950   C  CZ   . TYR B  2 46  ? 57.346  -9.224  4.237   1.00 0.00 ?  100 TYR B CZ   1  
ATOM   3951   O  OH   . TYR B  2 46  ? 58.162  -10.033 3.399   1.00 0.00 ?  100 TYR B OH   1  
ATOM   3952   H  H    . TYR B  2 46  ? 55.325  -8.267  8.613   1.00 0.00 ?  100 TYR B H    1  
ATOM   3953   H  HA   . TYR B  2 46  ? 55.598  -5.659  7.444   1.00 0.00 ?  100 TYR B HA   1  
ATOM   3954   H  HB2  . TYR B  2 46  ? 53.546  -7.835  6.802   1.00 0.00 ?  100 TYR B HB2  1  
ATOM   3955   H  HB3  . TYR B  2 46  ? 53.984  -6.290  5.856   1.00 0.00 ?  100 TYR B HB3  1  
ATOM   3956   H  HD1  . TYR B  2 46  ? 56.628  -6.099  5.269   1.00 0.00 ?  100 TYR B HD1  1  
ATOM   3957   H  HD2  . TYR B  2 46  ? 54.554  -9.653  6.221   1.00 0.00 ?  100 TYR B HD2  1  
ATOM   3958   H  HE1  . TYR B  2 46  ? 58.285  -7.415  3.852   1.00 0.00 ?  100 TYR B HE1  1  
ATOM   3959   H  HE2  . TYR B  2 46  ? 56.386  -10.980 4.813   1.00 0.00 ?  100 TYR B HE2  1  
ATOM   3960   H  HH   . TYR B  2 46  ? 58.878  -9.521  3.017   1.00 0.00 ?  100 TYR B HH   1  
ATOM   3961   N  N    . LEU B  2 47  ? 52.781  -6.147  8.986   1.00 0.00 ?  101 LEU B N    1  
ATOM   3962   C  CA   . LEU B  2 47  ? 51.785  -5.377  9.658   1.00 0.00 ?  101 LEU B CA   1  
ATOM   3963   C  C    . LEU B  2 47  ? 52.258  -4.351  10.794  1.00 0.00 ?  101 LEU B C    1  
ATOM   3964   O  O    . LEU B  2 47  ? 51.856  -3.205  10.764  1.00 0.00 ?  101 LEU B O    1  
ATOM   3965   C  CB   . LEU B  2 47  ? 50.648  -6.173  10.370  1.00 0.00 ?  101 LEU B CB   1  
ATOM   3966   C  CG   . LEU B  2 47  ? 49.955  -7.256  9.551   1.00 0.00 ?  101 LEU B CG   1  
ATOM   3967   C  CD1  . LEU B  2 47  ? 48.859  -7.919  10.353  1.00 0.00 ?  101 LEU B CD1  1  
ATOM   3968   C  CD2  . LEU B  2 47  ? 49.313  -6.596  8.266   1.00 0.00 ?  101 LEU B CD2  1  
ATOM   3969   H  H    . LEU B  2 47  ? 52.743  -7.136  9.106   1.00 0.00 ?  101 LEU B H    1  
ATOM   3970   H  HA   . LEU B  2 47  ? 51.362  -4.751  8.887   1.00 0.00 ?  101 LEU B HA   1  
ATOM   3971   H  HB2  . LEU B  2 47  ? 51.052  -6.612  11.307  1.00 0.00 ?  101 LEU B HB2  1  
ATOM   3972   H  HB3  . LEU B  2 47  ? 49.868  -5.412  10.585  1.00 0.00 ?  101 LEU B HB3  1  
ATOM   3973   H  HG   . LEU B  2 47  ? 50.716  -8.030  9.311   1.00 0.00 ?  101 LEU B HG   1  
ATOM   3974   H  HD11 . LEU B  2 47  ? 48.351  -8.747  9.815   1.00 0.00 ?  101 LEU B HD11 1  
ATOM   3975   H  HD12 . LEU B  2 47  ? 48.106  -7.142  10.604  1.00 0.00 ?  101 LEU B HD12 1  
ATOM   3976   H  HD13 . LEU B  2 47  ? 49.237  -8.283  11.333  1.00 0.00 ?  101 LEU B HD13 1  
ATOM   3977   H  HD21 . LEU B  2 47  ? 48.686  -7.283  7.660   1.00 0.00 ?  101 LEU B HD21 1  
ATOM   3978   H  HD22 . LEU B  2 47  ? 50.228  -6.255  7.735   1.00 0.00 ?  101 LEU B HD22 1  
ATOM   3979   H  HD23 . LEU B  2 47  ? 48.688  -5.747  8.616   1.00 0.00 ?  101 LEU B HD23 1  
ATOM   3980   N  N    . ASP B  2 48  ? 53.191  -4.815  11.648  1.00 0.00 ?  102 ASP B N    1  
ATOM   3981   C  CA   . ASP B  2 48  ? 53.812  -3.985  12.623  1.00 0.00 ?  102 ASP B CA   1  
ATOM   3982   C  C    . ASP B  2 48  ? 54.595  -2.786  12.034  1.00 0.00 ?  102 ASP B C    1  
ATOM   3983   O  O    . ASP B  2 48  ? 54.452  -1.719  12.587  1.00 0.00 ?  102 ASP B O    1  
ATOM   3984   C  CB   . ASP B  2 48  ? 54.801  -4.770  13.553  1.00 0.00 ?  102 ASP B CB   1  
ATOM   3985   C  CG   . ASP B  2 48  ? 54.004  -5.580  14.528  1.00 0.00 ?  102 ASP B CG   1  
ATOM   3986   O  OD1  . ASP B  2 48  ? 52.852  -5.195  14.849  1.00 0.00 ?  102 ASP B OD1  1  
ATOM   3987   O  OD2  . ASP B  2 48  ? 54.463  -6.651  15.059  1.00 0.00 -1 102 ASP B OD2  1  
ATOM   3988   H  H    . ASP B  2 48  ? 53.533  -5.752  11.657  1.00 0.00 ?  102 ASP B H    1  
ATOM   3989   H  HA   . ASP B  2 48  ? 53.029  -3.632  13.278  1.00 0.00 ?  102 ASP B HA   1  
ATOM   3990   H  HB2  . ASP B  2 48  ? 55.416  -5.423  12.898  1.00 0.00 ?  102 ASP B HB2  1  
ATOM   3991   H  HB3  . ASP B  2 48  ? 55.490  -4.131  14.146  1.00 0.00 ?  102 ASP B HB3  1  
ATOM   3992   N  N    . ASP B  2 49  ? 55.427  -2.970  10.998  1.00 0.00 ?  103 ASP B N    1  
ATOM   3993   C  CA   . ASP B  2 49  ? 56.150  -1.872  10.314  1.00 0.00 ?  103 ASP B CA   1  
ATOM   3994   C  C    . ASP B  2 49  ? 55.166  -0.945  9.555   1.00 0.00 ?  103 ASP B C    1  
ATOM   3995   O  O    . ASP B  2 49  ? 55.371  0.257   9.590   1.00 0.00 ?  103 ASP B O    1  
ATOM   3996   C  CB   . ASP B  2 49  ? 57.117  -2.562  9.296   1.00 0.00 ?  103 ASP B CB   1  
ATOM   3997   C  CG   . ASP B  2 49  ? 58.053  -1.581  8.745   1.00 0.00 ?  103 ASP B CG   1  
ATOM   3998   O  OD1  . ASP B  2 49  ? 58.619  -1.945  7.671   1.00 0.00 ?  103 ASP B OD1  1  
ATOM   3999   O  OD2  . ASP B  2 49  ? 58.419  -0.577  9.407   1.00 0.00 -1 103 ASP B OD2  1  
ATOM   4000   H  H    . ASP B  2 49  ? 55.598  -3.898  10.677  1.00 0.00 ?  103 ASP B H    1  
ATOM   4001   H  HA   . ASP B  2 49  ? 56.644  -1.267  11.060  1.00 0.00 ?  103 ASP B HA   1  
ATOM   4002   H  HB2  . ASP B  2 49  ? 57.658  -3.320  9.901   1.00 0.00 ?  103 ASP B HB2  1  
ATOM   4003   H  HB3  . ASP B  2 49  ? 56.529  -3.087  8.513   1.00 0.00 ?  103 ASP B HB3  1  
ATOM   4004   N  N    . PHE B  2 50  ? 54.044  -1.519  8.970   1.00 0.00 ?  104 PHE B N    1  
ATOM   4005   C  CA   . PHE B  2 50  ? 52.920  -0.743  8.510   1.00 0.00 ?  104 PHE B CA   1  
ATOM   4006   C  C    . PHE B  2 50  ? 52.097  0.023   9.570   1.00 0.00 ?  104 PHE B C    1  
ATOM   4007   O  O    . PHE B  2 50  ? 51.529  1.128   9.274   1.00 0.00 ?  104 PHE B O    1  
ATOM   4008   C  CB   . PHE B  2 50  ? 51.899  -1.672  7.617   1.00 0.00 ?  104 PHE B CB   1  
ATOM   4009   C  CG   . PHE B  2 50  ? 50.545  -1.111  7.268   1.00 0.00 ?  104 PHE B CG   1  
ATOM   4010   C  CD1  . PHE B  2 50  ? 49.485  -1.534  8.075   1.00 0.00 ?  104 PHE B CD1  1  
ATOM   4011   C  CD2  . PHE B  2 50  ? 50.306  -0.196  6.235   1.00 0.00 ?  104 PHE B CD2  1  
ATOM   4012   C  CE1  . PHE B  2 50  ? 48.222  -1.032  7.898   1.00 0.00 ?  104 PHE B CE1  1  
ATOM   4013   C  CE2  . PHE B  2 50  ? 49.040  0.213   5.974   1.00 0.00 ?  104 PHE B CE2  1  
ATOM   4014   C  CZ   . PHE B  2 50  ? 47.935  -0.238  6.805   1.00 0.00 ?  104 PHE B CZ   1  
ATOM   4015   H  H    . PHE B  2 50  ? 53.868  -2.500  8.928   1.00 0.00 ?  104 PHE B H    1  
ATOM   4016   H  HA   . PHE B  2 50  ? 53.350  0.009   7.865   1.00 0.00 ?  104 PHE B HA   1  
ATOM   4017   H  HB2  . PHE B  2 50  ? 52.441  -1.940  6.685   1.00 0.00 ?  104 PHE B HB2  1  
ATOM   4018   H  HB3  . PHE B  2 50  ? 51.858  -2.660  8.123   1.00 0.00 ?  104 PHE B HB3  1  
ATOM   4019   H  HD1  . PHE B  2 50  ? 49.732  -2.031  9.001   1.00 0.00 ?  104 PHE B HD1  1  
ATOM   4020   H  HD2  . PHE B  2 50  ? 51.100  0.073   5.554   1.00 0.00 ?  104 PHE B HD2  1  
ATOM   4021   H  HE1  . PHE B  2 50  ? 47.456  -1.385  8.572   1.00 0.00 ?  104 PHE B HE1  1  
ATOM   4022   H  HE2  . PHE B  2 50  ? 48.973  0.937   5.176   1.00 0.00 ?  104 PHE B HE2  1  
ATOM   4023   H  HZ   . PHE B  2 50  ? 47.018  0.264   6.535   1.00 0.00 ?  104 PHE B HZ   1  
ATOM   4024   N  N    . GLN B  2 51  ? 52.106  -0.387  10.874  1.00 0.00 ?  105 GLN B N    1  
ATOM   4025   C  CA   . GLN B  2 51  ? 51.531  0.259   12.034  1.00 0.00 ?  105 GLN B CA   1  
ATOM   4026   C  C    . GLN B  2 51  ? 52.463  1.494   12.393  1.00 0.00 ?  105 GLN B C    1  
ATOM   4027   O  O    . GLN B  2 51  ? 52.032  2.605   12.693  1.00 0.00 ?  105 GLN B O    1  
ATOM   4028   C  CB   . GLN B  2 51  ? 51.295  -0.654  13.290  1.00 0.00 ?  105 GLN B CB   1  
ATOM   4029   C  CG   . GLN B  2 51  ? 49.978  -1.450  13.218  1.00 0.00 ?  105 GLN B CG   1  
ATOM   4030   C  CD   . GLN B  2 51  ? 48.728  -0.530  13.145  1.00 0.00 ?  105 GLN B CD   1  
ATOM   4031   O  OE1  . GLN B  2 51  ? 48.652  0.633   13.418  1.00 0.00 ?  105 GLN B OE1  1  
ATOM   4032   N  NE2  . GLN B  2 51  ? 47.617  -1.249  12.786  1.00 0.00 ?  105 GLN B NE2  1  
ATOM   4033   H  H    . GLN B  2 51  ? 52.532  -1.282  10.975  1.00 0.00 ?  105 GLN B H    1  
ATOM   4034   H  HA   . GLN B  2 51  ? 50.550  0.646   11.801  1.00 0.00 ?  105 GLN B HA   1  
ATOM   4035   H  HB2  . GLN B  2 51  ? 52.114  -1.392  13.432  1.00 0.00 ?  105 GLN B HB2  1  
ATOM   4036   H  HB3  . GLN B  2 51  ? 51.278  -0.134  14.272  1.00 0.00 ?  105 GLN B HB3  1  
ATOM   4037   H  HG2  . GLN B  2 51  ? 49.989  -2.144  12.350  1.00 0.00 ?  105 GLN B HG2  1  
ATOM   4038   H  HG3  . GLN B  2 51  ? 50.023  -2.061  14.145  1.00 0.00 ?  105 GLN B HG3  1  
ATOM   4039   H  HE21 . GLN B  2 51  ? 47.647  -2.224  12.566  1.00 0.00 ?  105 GLN B HE21 1  
ATOM   4040   H  HE22 . GLN B  2 51  ? 46.830  -0.669  12.578  1.00 0.00 ?  105 GLN B HE22 1  
ATOM   4041   N  N    . LYS B  2 52  ? 53.757  1.332   12.422  1.00 0.00 ?  106 LYS B N    1  
ATOM   4042   C  CA   . LYS B  2 52  ? 54.707  2.383   12.750  1.00 0.00 ?  106 LYS B CA   1  
ATOM   4043   C  C    . LYS B  2 52  ? 54.712  3.517   11.736  1.00 0.00 ?  106 LYS B C    1  
ATOM   4044   O  O    . LYS B  2 52  ? 54.734  4.676   12.035  1.00 0.00 ?  106 LYS B O    1  
ATOM   4045   C  CB   . LYS B  2 52  ? 56.108  1.754   12.664  1.00 0.00 ?  106 LYS B CB   1  
ATOM   4046   C  CG   . LYS B  2 52  ? 57.329  2.614   13.140  1.00 0.00 ?  106 LYS B CG   1  
ATOM   4047   C  CD   . LYS B  2 52  ? 58.027  3.522   12.049  1.00 0.00 ?  106 LYS B CD   1  
ATOM   4048   C  CE   . LYS B  2 52  ? 58.217  2.854   10.644  1.00 0.00 ?  106 LYS B CE   1  
ATOM   4049   N  NZ   . LYS B  2 52  ? 58.958  1.586   10.791  1.00 0.00 1  106 LYS B NZ   1  
ATOM   4050   H  H    . LYS B  2 52  ? 54.040  0.403   12.199  1.00 0.00 ?  106 LYS B H    1  
ATOM   4051   H  HA   . LYS B  2 52  ? 54.518  2.723   13.757  1.00 0.00 ?  106 LYS B HA   1  
ATOM   4052   H  HB2  . LYS B  2 52  ? 55.987  0.898   13.362  1.00 0.00 ?  106 LYS B HB2  1  
ATOM   4053   H  HB3  . LYS B  2 52  ? 56.303  1.204   11.719  1.00 0.00 ?  106 LYS B HB3  1  
ATOM   4054   H  HG2  . LYS B  2 52  ? 57.026  3.190   14.040  1.00 0.00 ?  106 LYS B HG2  1  
ATOM   4055   H  HG3  . LYS B  2 52  ? 58.172  2.008   13.535  1.00 0.00 ?  106 LYS B HG3  1  
ATOM   4056   H  HD2  . LYS B  2 52  ? 57.417  4.434   11.871  1.00 0.00 ?  106 LYS B HD2  1  
ATOM   4057   H  HD3  . LYS B  2 52  ? 59.034  3.782   12.441  1.00 0.00 ?  106 LYS B HD3  1  
ATOM   4058   H  HE2  . LYS B  2 52  ? 57.280  2.678   10.073  1.00 0.00 ?  106 LYS B HE2  1  
ATOM   4059   H  HE3  . LYS B  2 52  ? 58.862  3.531   10.043  1.00 0.00 ?  106 LYS B HE3  1  
ATOM   4060   H  HZ1  . LYS B  2 52  ? 59.983  1.757   10.747  1.00 0.00 ?  106 LYS B HZ1  1  
ATOM   4061   H  HZ2  . LYS B  2 52  ? 58.640  0.885   10.091  1.00 0.00 ?  106 LYS B HZ2  1  
ATOM   4062   H  HZ3  . LYS B  2 52  ? 58.951  1.120   11.721  1.00 0.00 ?  106 LYS B HZ3  1  
ATOM   4063   N  N    . LYS B  2 53  ? 54.735  3.087   10.476  1.00 0.00 ?  107 LYS B N    1  
ATOM   4064   C  CA   . LYS B  2 53  ? 54.537  3.951   9.333   1.00 0.00 ?  107 LYS B CA   1  
ATOM   4065   C  C    . LYS B  2 53  ? 53.168  4.648   9.355   1.00 0.00 ?  107 LYS B C    1  
ATOM   4066   O  O    . LYS B  2 53  ? 53.218  5.863   9.528   1.00 0.00 ?  107 LYS B O    1  
ATOM   4067   C  CB   . LYS B  2 53  ? 54.767  3.138   8.084   1.00 0.00 ?  107 LYS B CB   1  
ATOM   4068   C  CG   . LYS B  2 53  ? 54.822  3.793   6.690   1.00 0.00 ?  107 LYS B CG   1  
ATOM   4069   C  CD   . LYS B  2 53  ? 54.860  2.821   5.561   1.00 0.00 ?  107 LYS B CD   1  
ATOM   4070   C  CE   . LYS B  2 53  ? 54.887  3.560   4.223   1.00 0.00 ?  107 LYS B CE   1  
ATOM   4071   N  NZ   . LYS B  2 53  ? 55.484  2.834   3.051   1.00 0.00 1  107 LYS B NZ   1  
ATOM   4072   H  H    . LYS B  2 53  ? 54.834  2.127   10.225  1.00 0.00 ?  107 LYS B H    1  
ATOM   4073   H  HA   . LYS B  2 53  ? 55.307  4.709   9.335   1.00 0.00 ?  107 LYS B HA   1  
ATOM   4074   H  HB2  . LYS B  2 53  ? 55.687  2.540   8.258   1.00 0.00 ?  107 LYS B HB2  1  
ATOM   4075   H  HB3  . LYS B  2 53  ? 53.958  2.395   7.917   1.00 0.00 ?  107 LYS B HB3  1  
ATOM   4076   H  HG2  . LYS B  2 53  ? 54.003  4.528   6.530   1.00 0.00 ?  107 LYS B HG2  1  
ATOM   4077   H  HG3  . LYS B  2 53  ? 55.756  4.393   6.697   1.00 0.00 ?  107 LYS B HG3  1  
ATOM   4078   H  HD2  . LYS B  2 53  ? 55.823  2.266   5.575   1.00 0.00 ?  107 LYS B HD2  1  
ATOM   4079   H  HD3  . LYS B  2 53  ? 54.071  2.049   5.684   1.00 0.00 ?  107 LYS B HD3  1  
ATOM   4080   H  HE2  . LYS B  2 53  ? 53.821  3.746   3.971   1.00 0.00 ?  107 LYS B HE2  1  
ATOM   4081   H  HE3  . LYS B  2 53  ? 55.573  4.422   4.362   1.00 0.00 ?  107 LYS B HE3  1  
ATOM   4082   H  HZ1  . LYS B  2 53  ? 56.515  2.765   3.171   1.00 0.00 ?  107 LYS B HZ1  1  
ATOM   4083   H  HZ2  . LYS B  2 53  ? 55.221  3.309   2.164   1.00 0.00 ?  107 LYS B HZ2  1  
ATOM   4084   H  HZ3  . LYS B  2 53  ? 55.152  1.856   2.927   1.00 0.00 ?  107 LYS B HZ3  1  
ATOM   4085   N  N    . TRP B  2 54  ? 51.952  3.985   9.527   1.00 0.00 ?  108 TRP B N    1  
ATOM   4086   C  CA   . TRP B  2 54  ? 50.695  4.684   9.713   1.00 0.00 ?  108 TRP B CA   1  
ATOM   4087   C  C    . TRP B  2 54  ? 50.558  5.766   10.788  1.00 0.00 ?  108 TRP B C    1  
ATOM   4088   O  O    . TRP B  2 54  ? 50.053  6.856   10.597  1.00 0.00 ?  108 TRP B O    1  
ATOM   4089   C  CB   . TRP B  2 54  ? 49.638  3.566   9.786   1.00 0.00 ?  108 TRP B CB   1  
ATOM   4090   C  CG   . TRP B  2 54  ? 48.236  3.962   10.259  1.00 0.00 ?  108 TRP B CG   1  
ATOM   4091   C  CD1  . TRP B  2 54  ? 47.652  3.808   11.513  1.00 0.00 ?  108 TRP B CD1  1  
ATOM   4092   C  CD2  . TRP B  2 54  ? 47.228  4.710   9.451   1.00 0.00 ?  108 TRP B CD2  1  
ATOM   4093   N  NE1  . TRP B  2 54  ? 46.492  4.562   11.595  1.00 0.00 ?  108 TRP B NE1  1  
ATOM   4094   C  CE2  . TRP B  2 54  ? 46.180  5.088   10.355  1.00 0.00 ?  108 TRP B CE2  1  
ATOM   4095   C  CE3  . TRP B  2 54  ? 47.195  5.065   8.137   1.00 0.00 ?  108 TRP B CE3  1  
ATOM   4096   C  CZ2  . TRP B  2 54  ? 45.003  5.741   9.905   1.00 0.00 ?  108 TRP B CZ2  1  
ATOM   4097   C  CZ3  . TRP B  2 54  ? 45.981  5.635   7.681   1.00 0.00 ?  108 TRP B CZ3  1  
ATOM   4098   C  CH2  . TRP B  2 54  ? 44.928  5.878   8.553   1.00 0.00 ?  108 TRP B CH2  1  
ATOM   4099   H  H    . TRP B  2 54  ? 51.937  2.997   9.395   1.00 0.00 ?  108 TRP B H    1  
ATOM   4100   H  HA   . TRP B  2 54  ? 50.397  5.179   8.801   1.00 0.00 ?  108 TRP B HA   1  
ATOM   4101   H  HB2  . TRP B  2 54  ? 49.613  2.970   8.848   1.00 0.00 ?  108 TRP B HB2  1  
ATOM   4102   H  HB3  . TRP B  2 54  ? 50.074  2.838   10.504  1.00 0.00 ?  108 TRP B HB3  1  
ATOM   4103   H  HD1  . TRP B  2 54  ? 48.136  3.275   12.319  1.00 0.00 ?  108 TRP B HD1  1  
ATOM   4104   H  HE1  . TRP B  2 54  ? 45.980  4.777   12.397  1.00 0.00 ?  108 TRP B HE1  1  
ATOM   4105   H  HE3  . TRP B  2 54  ? 48.032  5.009   7.456   1.00 0.00 ?  108 TRP B HE3  1  
ATOM   4106   H  HZ2  . TRP B  2 54  ? 44.178  5.984   10.558  1.00 0.00 ?  108 TRP B HZ2  1  
ATOM   4107   H  HZ3  . TRP B  2 54  ? 45.825  5.927   6.653   1.00 0.00 ?  108 TRP B HZ3  1  
ATOM   4108   H  HH2  . TRP B  2 54  ? 44.034  6.326   8.144   1.00 0.00 ?  108 TRP B HH2  1  
ATOM   4109   N  N    . GLN B  2 55  ? 51.036  5.393   12.011  1.00 0.00 ?  109 GLN B N    1  
ATOM   4110   C  CA   . GLN B  2 55  ? 51.111  6.256   13.188  1.00 0.00 ?  109 GLN B CA   1  
ATOM   4111   C  C    . GLN B  2 55  ? 51.910  7.581   12.944  1.00 0.00 ?  109 GLN B C    1  
ATOM   4112   O  O    . GLN B  2 55  ? 51.502  8.655   13.351  1.00 0.00 ?  109 GLN B O    1  
ATOM   4113   C  CB   . GLN B  2 55  ? 51.572  5.507   14.553  1.00 0.00 ?  109 GLN B CB   1  
ATOM   4114   C  CG   . GLN B  2 55  ? 51.308  6.260   15.875  1.00 0.00 ?  109 GLN B CG   1  
ATOM   4115   C  CD   . GLN B  2 55  ? 50.048  7.213   15.968  1.00 0.00 ?  109 GLN B CD   1  
ATOM   4116   O  OE1  . GLN B  2 55  ? 48.922  6.894   15.520  1.00 0.00 ?  109 GLN B OE1  1  
ATOM   4117   N  NE2  . GLN B  2 55  ? 50.186  8.420   16.508  1.00 0.00 ?  109 GLN B NE2  1  
ATOM   4118   H  H    . GLN B  2 55  ? 51.617  4.584   12.058  1.00 0.00 ?  109 GLN B H    1  
ATOM   4119   H  HA   . GLN B  2 55  ? 50.079  6.520   13.365  1.00 0.00 ?  109 GLN B HA   1  
ATOM   4120   H  HB2  . GLN B  2 55  ? 51.010  4.556   14.671  1.00 0.00 ?  109 GLN B HB2  1  
ATOM   4121   H  HB3  . GLN B  2 55  ? 52.673  5.364   14.509  1.00 0.00 ?  109 GLN B HB3  1  
ATOM   4122   H  HG2  . GLN B  2 55  ? 51.235  5.687   16.824  1.00 0.00 ?  109 GLN B HG2  1  
ATOM   4123   H  HG3  . GLN B  2 55  ? 52.123  7.006   15.991  1.00 0.00 ?  109 GLN B HG3  1  
ATOM   4124   H  HE21 . GLN B  2 55  ? 51.071  8.884   16.564  1.00 0.00 ?  109 GLN B HE21 1  
ATOM   4125   H  HE22 . GLN B  2 55  ? 49.384  9.011   16.590  1.00 0.00 ?  109 GLN B HE22 1  
ATOM   4126   N  N    . GLU B  2 56  ? 53.080  7.489   12.309  1.00 0.00 ?  110 GLU B N    1  
ATOM   4127   C  CA   . GLU B  2 56  ? 53.952  8.565   12.054  1.00 0.00 ?  110 GLU B CA   1  
ATOM   4128   C  C    . GLU B  2 56  ? 53.274  9.517   11.163  1.00 0.00 ?  110 GLU B C    1  
ATOM   4129   O  O    . GLU B  2 56  ? 53.363  10.717  11.504  1.00 0.00 ?  110 GLU B O    1  
ATOM   4130   C  CB   . GLU B  2 56  ? 55.435  8.186   11.672  1.00 0.00 ?  110 GLU B CB   1  
ATOM   4131   C  CG   . GLU B  2 56  ? 56.259  9.327   11.016  1.00 0.00 ?  110 GLU B CG   1  
ATOM   4132   C  CD   . GLU B  2 56  ? 57.576  8.874   10.396  1.00 0.00 ?  110 GLU B CD   1  
ATOM   4133   O  OE1  . GLU B  2 56  ? 58.659  9.452   10.751  1.00 0.00 ?  110 GLU B OE1  1  
ATOM   4134   O  OE2  . GLU B  2 56  ? 57.533  7.870   9.595   1.00 0.00 -1 110 GLU B OE2  1  
ATOM   4135   H  H    . GLU B  2 56  ? 53.460  6.594   12.088  1.00 0.00 ?  110 GLU B H    1  
ATOM   4136   H  HA   . GLU B  2 56  ? 53.903  9.063   13.011  1.00 0.00 ?  110 GLU B HA   1  
ATOM   4137   H  HB2  . GLU B  2 56  ? 55.939  7.650   12.505  1.00 0.00 ?  110 GLU B HB2  1  
ATOM   4138   H  HB3  . GLU B  2 56  ? 55.221  7.499   10.826  1.00 0.00 ?  110 GLU B HB3  1  
ATOM   4139   H  HG2  . GLU B  2 56  ? 55.653  9.872   10.262  1.00 0.00 ?  110 GLU B HG2  1  
ATOM   4140   H  HG3  . GLU B  2 56  ? 56.585  10.099  11.745  1.00 0.00 ?  110 GLU B HG3  1  
ATOM   4141   N  N    . GLU B  2 57  ? 52.641  8.975   10.111  1.00 0.00 ?  111 GLU B N    1  
ATOM   4142   C  CA   . GLU B  2 57  ? 51.913  9.869   9.178   1.00 0.00 ?  111 GLU B CA   1  
ATOM   4143   C  C    . GLU B  2 57  ? 50.681  10.593  9.795   1.00 0.00 ?  111 GLU B C    1  
ATOM   4144   O  O    . GLU B  2 57  ? 50.340  11.671  9.397   1.00 0.00 ?  111 GLU B O    1  
ATOM   4145   C  CB   . GLU B  2 57  ? 51.623  9.089   7.841   1.00 0.00 ?  111 GLU B CB   1  
ATOM   4146   C  CG   . GLU B  2 57  ? 51.191  9.863   6.625   1.00 0.00 ?  111 GLU B CG   1  
ATOM   4147   C  CD   . GLU B  2 57  ? 52.472  10.347  5.931   1.00 0.00 ?  111 GLU B CD   1  
ATOM   4148   O  OE1  . GLU B  2 57  ? 53.362  9.491   5.566   1.00 0.00 ?  111 GLU B OE1  1  
ATOM   4149   O  OE2  . GLU B  2 57  ? 52.580  11.562  5.846   1.00 0.00 -1 111 GLU B OE2  1  
ATOM   4150   H  H    . GLU B  2 57  ? 52.751  7.986   10.053  1.00 0.00 ?  111 GLU B H    1  
ATOM   4151   H  HA   . GLU B  2 57  ? 52.551  10.698  8.908   1.00 0.00 ?  111 GLU B HA   1  
ATOM   4152   H  HB2  . GLU B  2 57  ? 52.521  8.446   7.722   1.00 0.00 ?  111 GLU B HB2  1  
ATOM   4153   H  HB3  . GLU B  2 57  ? 50.956  8.238   8.096   1.00 0.00 ?  111 GLU B HB3  1  
ATOM   4154   H  HG2  . GLU B  2 57  ? 50.573  9.152   6.037   1.00 0.00 ?  111 GLU B HG2  1  
ATOM   4155   H  HG3  . GLU B  2 57  ? 50.561  10.696  7.005   1.00 0.00 ?  111 GLU B HG3  1  
ATOM   4156   N  N    . MET B  2 58  ? 50.043  9.907   10.824  1.00 0.00 ?  112 MET B N    1  
ATOM   4157   C  CA   . MET B  2 58  ? 48.848  10.355  11.532  1.00 0.00 ?  112 MET B CA   1  
ATOM   4158   C  C    . MET B  2 58  ? 49.137  11.648  12.313  1.00 0.00 ?  112 MET B C    1  
ATOM   4159   O  O    . MET B  2 58  ? 48.337  12.596  12.260  1.00 0.00 ?  112 MET B O    1  
ATOM   4160   C  CB   . MET B  2 58  ? 48.061  9.261   12.403  1.00 0.00 ?  112 MET B CB   1  
ATOM   4161   C  CG   . MET B  2 58  ? 47.092  8.400   11.684  1.00 0.00 ?  112 MET B CG   1  
ATOM   4162   S  SD   . MET B  2 58  ? 45.746  9.394   10.810  1.00 0.00 ?  112 MET B SD   1  
ATOM   4163   C  CE   . MET B  2 58  ? 44.839  9.814   12.256  1.00 0.00 ?  112 MET B CE   1  
ATOM   4164   H  H    . MET B  2 58  ? 50.441  9.015   11.027  1.00 0.00 ?  112 MET B H    1  
ATOM   4165   H  HA   . MET B  2 58  ? 48.162  10.639  10.748  1.00 0.00 ?  112 MET B HA   1  
ATOM   4166   H  HB2  . MET B  2 58  ? 48.840  8.584   12.814  1.00 0.00 ?  112 MET B HB2  1  
ATOM   4167   H  HB3  . MET B  2 58  ? 47.625  9.787   13.279  1.00 0.00 ?  112 MET B HB3  1  
ATOM   4168   H  HG2  . MET B  2 58  ? 47.736  7.860   10.957  1.00 0.00 ?  112 MET B HG2  1  
ATOM   4169   H  HG3  . MET B  2 58  ? 46.640  7.756   12.468  1.00 0.00 ?  112 MET B HG3  1  
ATOM   4170   H  HE1  . MET B  2 58  ? 44.357  8.893   12.648  1.00 0.00 ?  112 MET B HE1  1  
ATOM   4171   H  HE2  . MET B  2 58  ? 44.153  10.644  11.979  1.00 0.00 ?  112 MET B HE2  1  
ATOM   4172   H  HE3  . MET B  2 58  ? 45.513  10.265  13.015  1.00 0.00 ?  112 MET B HE3  1  
ATOM   4173   N  N    . GLU B  2 59  ? 50.367  11.658  12.954  1.00 0.00 ?  113 GLU B N    1  
ATOM   4174   C  CA   . GLU B  2 59  ? 50.910  12.838  13.743  1.00 0.00 ?  113 GLU B CA   1  
ATOM   4175   C  C    . GLU B  2 59  ? 51.186  14.029  12.854  1.00 0.00 ?  113 GLU B C    1  
ATOM   4176   O  O    . GLU B  2 59  ? 50.686  15.125  13.079  1.00 0.00 ?  113 GLU B O    1  
ATOM   4177   C  CB   . GLU B  2 59  ? 52.230  12.360  14.415  1.00 0.00 ?  113 GLU B CB   1  
ATOM   4178   C  CG   . GLU B  2 59  ? 51.980  11.334  15.506  1.00 0.00 ?  113 GLU B CG   1  
ATOM   4179   C  CD   . GLU B  2 59  ? 53.176  10.719  16.242  1.00 0.00 ?  113 GLU B CD   1  
ATOM   4180   O  OE1  . GLU B  2 59  ? 54.318  11.305  16.319  1.00 0.00 ?  113 GLU B OE1  1  
ATOM   4181   O  OE2  . GLU B  2 59  ? 53.039  9.616   16.796  1.00 0.00 -1 113 GLU B OE2  1  
ATOM   4182   H  H    . GLU B  2 59  ? 50.836  10.779  12.996  1.00 0.00 ?  113 GLU B H    1  
ATOM   4183   H  HA   . GLU B  2 59  ? 50.115  13.226  14.363  1.00 0.00 ?  113 GLU B HA   1  
ATOM   4184   H  HB2  . GLU B  2 59  ? 52.956  11.869  13.732  1.00 0.00 ?  113 GLU B HB2  1  
ATOM   4185   H  HB3  . GLU B  2 59  ? 52.674  13.349  14.660  1.00 0.00 ?  113 GLU B HB3  1  
ATOM   4186   H  HG2  . GLU B  2 59  ? 51.473  11.795  16.380  1.00 0.00 ?  113 GLU B HG2  1  
ATOM   4187   H  HG3  . GLU B  2 59  ? 51.253  10.543  15.222  1.00 0.00 ?  113 GLU B HG3  1  
ATOM   4188   N  N    . LEU B  2 60  ? 51.972  13.807  11.766  1.00 0.00 ?  114 LEU B N    1  
ATOM   4189   C  CA   . LEU B  2 60  ? 52.156  14.707  10.658  1.00 0.00 ?  114 LEU B CA   1  
ATOM   4190   C  C    . LEU B  2 60  ? 50.814  15.260  10.062  1.00 0.00 ?  114 LEU B C    1  
ATOM   4191   O  O    . LEU B  2 60  ? 50.744  16.448  9.782   1.00 0.00 ?  114 LEU B O    1  
ATOM   4192   C  CB   . LEU B  2 60  ? 53.085  14.042  9.644   1.00 0.00 ?  114 LEU B CB   1  
ATOM   4193   C  CG   . LEU B  2 60  ? 54.600  14.228  10.030  1.00 0.00 ?  114 LEU B CG   1  
ATOM   4194   C  CD1  . LEU B  2 60  ? 55.457  13.246  9.282   1.00 0.00 ?  114 LEU B CD1  1  
ATOM   4195   C  CD2  . LEU B  2 60  ? 54.906  15.759  9.873   1.00 0.00 ?  114 LEU B CD2  1  
ATOM   4196   H  H    . LEU B  2 60  ? 52.265  12.875  11.570  1.00 0.00 ?  114 LEU B H    1  
ATOM   4197   H  HA   . LEU B  2 60  ? 52.538  15.601  11.127  1.00 0.00 ?  114 LEU B HA   1  
ATOM   4198   H  HB2  . LEU B  2 60  ? 52.873  12.964  9.479   1.00 0.00 ?  114 LEU B HB2  1  
ATOM   4199   H  HB3  . LEU B  2 60  ? 52.984  14.573  8.673   1.00 0.00 ?  114 LEU B HB3  1  
ATOM   4200   H  HG   . LEU B  2 60  ? 54.739  14.008  11.110  1.00 0.00 ?  114 LEU B HG   1  
ATOM   4201   H  HD11 . LEU B  2 60  ? 55.378  13.443  8.192   1.00 0.00 ?  114 LEU B HD11 1  
ATOM   4202   H  HD12 . LEU B  2 60  ? 55.277  12.187  9.565   1.00 0.00 ?  114 LEU B HD12 1  
ATOM   4203   H  HD13 . LEU B  2 60  ? 56.543  13.438  9.416   1.00 0.00 ?  114 LEU B HD13 1  
ATOM   4204   H  HD21 . LEU B  2 60  ? 54.284  16.385  10.548  1.00 0.00 ?  114 LEU B HD21 1  
ATOM   4205   H  HD22 . LEU B  2 60  ? 54.561  16.148  8.891   1.00 0.00 ?  114 LEU B HD22 1  
ATOM   4206   H  HD23 . LEU B  2 60  ? 55.961  15.954  10.160  1.00 0.00 ?  114 LEU B HD23 1  
ATOM   4207   N  N    . TYR B  2 61  ? 49.730  14.421  9.908   1.00 0.00 ?  115 TYR B N    1  
ATOM   4208   C  CA   . TYR B  2 61  ? 48.510  14.818  9.245   1.00 0.00 ?  115 TYR B CA   1  
ATOM   4209   C  C    . TYR B  2 61  ? 47.881  15.986  9.998   1.00 0.00 ?  115 TYR B C    1  
ATOM   4210   O  O    . TYR B  2 61  ? 47.512  17.030  9.430   1.00 0.00 ?  115 TYR B O    1  
ATOM   4211   C  CB   . TYR B  2 61  ? 47.621  13.593  9.028   1.00 0.00 ?  115 TYR B CB   1  
ATOM   4212   C  CG   . TYR B  2 61  ? 46.260  13.918  8.506   1.00 0.00 ?  115 TYR B CG   1  
ATOM   4213   C  CD1  . TYR B  2 61  ? 45.185  14.255  9.325   1.00 0.00 ?  115 TYR B CD1  1  
ATOM   4214   C  CD2  . TYR B  2 61  ? 46.074  14.034  7.094   1.00 0.00 ?  115 TYR B CD2  1  
ATOM   4215   C  CE1  . TYR B  2 61  ? 43.940  14.552  8.771   1.00 0.00 ?  115 TYR B CE1  1  
ATOM   4216   C  CE2  . TYR B  2 61  ? 44.818  14.207  6.541   1.00 0.00 ?  115 TYR B CE2  1  
ATOM   4217   C  CZ   . TYR B  2 61  ? 43.761  14.526  7.381   1.00 0.00 ?  115 TYR B CZ   1  
ATOM   4218   O  OH   . TYR B  2 61  ? 42.493  14.738  6.825   1.00 0.00 ?  115 TYR B OH   1  
ATOM   4219   H  H    . TYR B  2 61  ? 49.826  13.433  9.999   1.00 0.00 ?  115 TYR B H    1  
ATOM   4220   H  HA   . TYR B  2 61  ? 48.691  15.210  8.255   1.00 0.00 ?  115 TYR B HA   1  
ATOM   4221   H  HB2  . TYR B  2 61  ? 48.107  12.885  8.322   1.00 0.00 ?  115 TYR B HB2  1  
ATOM   4222   H  HB3  . TYR B  2 61  ? 47.409  13.055  9.976   1.00 0.00 ?  115 TYR B HB3  1  
ATOM   4223   H  HD1  . TYR B  2 61  ? 45.298  14.073  10.384  1.00 0.00 ?  115 TYR B HD1  1  
ATOM   4224   H  HD2  . TYR B  2 61  ? 46.773  13.650  6.366   1.00 0.00 ?  115 TYR B HD2  1  
ATOM   4225   H  HE1  . TYR B  2 61  ? 43.182  14.781  9.506   1.00 0.00 ?  115 TYR B HE1  1  
ATOM   4226   H  HE2  . TYR B  2 61  ? 44.597  14.311  5.489   1.00 0.00 ?  115 TYR B HE2  1  
ATOM   4227   H  HH   . TYR B  2 61  ? 41.920  15.063  7.524   1.00 0.00 ?  115 TYR B HH   1  
ATOM   4228   N  N    . ARG B  2 62  ? 47.839  15.776  11.353  1.00 0.00 ?  116 ARG B N    1  
ATOM   4229   C  CA   . ARG B  2 62  ? 47.192  16.615  12.317  1.00 0.00 ?  116 ARG B CA   1  
ATOM   4230   C  C    . ARG B  2 62  ? 47.963  17.924  12.470  1.00 0.00 ?  116 ARG B C    1  
ATOM   4231   O  O    . ARG B  2 62  ? 47.519  19.043  12.336  1.00 0.00 ?  116 ARG B O    1  
ATOM   4232   C  CB   . ARG B  2 62  ? 47.206  15.909  13.689  1.00 0.00 ?  116 ARG B CB   1  
ATOM   4233   C  CG   . ARG B  2 62  ? 46.139  14.713  13.943  1.00 0.00 ?  116 ARG B CG   1  
ATOM   4234   C  CD   . ARG B  2 62  ? 46.501  13.885  15.114  1.00 0.00 ?  116 ARG B CD   1  
ATOM   4235   N  NE   . ARG B  2 62  ? 45.434  12.813  15.097  1.00 0.00 ?  116 ARG B NE   1  
ATOM   4236   C  CZ   . ARG B  2 62  ? 45.537  11.529  15.528  1.00 0.00 ?  116 ARG B CZ   1  
ATOM   4237   N  NH1  . ARG B  2 62  ? 44.449  10.821  15.476  1.00 0.00 1  116 ARG B NH1  1  
ATOM   4238   N  NH2  . ARG B  2 62  ? 46.536  11.074  16.170  1.00 0.00 ?  116 ARG B NH2  1  
ATOM   4239   H  H    . ARG B  2 62  ? 48.173  14.924  11.749  1.00 0.00 ?  116 ARG B H    1  
ATOM   4240   H  HA   . ARG B  2 62  ? 46.188  16.929  12.072  1.00 0.00 ?  116 ARG B HA   1  
ATOM   4241   H  HB2  . ARG B  2 62  ? 48.229  15.509  13.858  1.00 0.00 ?  116 ARG B HB2  1  
ATOM   4242   H  HB3  . ARG B  2 62  ? 47.064  16.666  14.490  1.00 0.00 ?  116 ARG B HB3  1  
ATOM   4243   H  HG2  . ARG B  2 62  ? 45.123  15.137  14.091  1.00 0.00 ?  116 ARG B HG2  1  
ATOM   4244   H  HG3  . ARG B  2 62  ? 46.132  14.020  13.074  1.00 0.00 ?  116 ARG B HG3  1  
ATOM   4245   H  HD2  . ARG B  2 62  ? 47.515  13.439  15.033  1.00 0.00 ?  116 ARG B HD2  1  
ATOM   4246   H  HD3  . ARG B  2 62  ? 46.388  14.548  15.998  1.00 0.00 ?  116 ARG B HD3  1  
ATOM   4247   H  HE   . ARG B  2 62  ? 44.519  13.176  14.926  1.00 0.00 ?  116 ARG B HE   1  
ATOM   4248   H  HH11 . ARG B  2 62  ? 43.826  11.124  14.755  1.00 0.00 ?  116 ARG B HH11 1  
ATOM   4249   H  HH12 . ARG B  2 62  ? 44.459  9.882   15.819  1.00 0.00 ?  116 ARG B HH12 1  
ATOM   4250   H  HH21 . ARG B  2 62  ? 47.328  11.686  16.160  1.00 0.00 ?  116 ARG B HH21 1  
ATOM   4251   H  HH22 . ARG B  2 62  ? 46.568  10.100  16.393  1.00 0.00 ?  116 ARG B HH22 1  
ATOM   4252   N  N    . GLN B  2 63  ? 49.275  17.735  12.602  1.00 0.00 ?  117 GLN B N    1  
ATOM   4253   C  CA   . GLN B  2 63  ? 50.264  18.780  12.591  1.00 0.00 ?  117 GLN B CA   1  
ATOM   4254   C  C    . GLN B  2 63  ? 50.290  19.728  11.373  1.00 0.00 ?  117 GLN B C    1  
ATOM   4255   O  O    . GLN B  2 63  ? 50.258  20.912  11.496  1.00 0.00 ?  117 GLN B O    1  
ATOM   4256   C  CB   . GLN B  2 63  ? 51.638  18.195  12.776  1.00 0.00 ?  117 GLN B CB   1  
ATOM   4257   C  CG   . GLN B  2 63  ? 52.897  19.055  12.611  1.00 0.00 ?  117 GLN B CG   1  
ATOM   4258   C  CD   . GLN B  2 63  ? 52.950  20.299  13.421  1.00 0.00 ?  117 GLN B CD   1  
ATOM   4259   O  OE1  . GLN B  2 63  ? 52.916  21.437  12.926  1.00 0.00 ?  117 GLN B OE1  1  
ATOM   4260   N  NE2  . GLN B  2 63  ? 52.978  20.161  14.766  1.00 0.00 ?  117 GLN B NE2  1  
ATOM   4261   H  H    . GLN B  2 63  ? 49.578  16.786  12.651  1.00 0.00 ?  117 GLN B H    1  
ATOM   4262   H  HA   . GLN B  2 63  ? 50.140  19.355  13.497  1.00 0.00 ?  117 GLN B HA   1  
ATOM   4263   H  HB2  . GLN B  2 63  ? 51.815  17.646  13.725  1.00 0.00 ?  117 GLN B HB2  1  
ATOM   4264   H  HB3  . GLN B  2 63  ? 51.728  17.314  12.106  1.00 0.00 ?  117 GLN B HB3  1  
ATOM   4265   H  HG2  . GLN B  2 63  ? 53.758  18.489  13.026  1.00 0.00 ?  117 GLN B HG2  1  
ATOM   4266   H  HG3  . GLN B  2 63  ? 53.028  19.285  11.532  1.00 0.00 ?  117 GLN B HG3  1  
ATOM   4267   H  HE21 . GLN B  2 63  ? 53.135  21.039  15.217  1.00 0.00 ?  117 GLN B HE21 1  
ATOM   4268   H  HE22 . GLN B  2 63  ? 53.327  19.294  15.121  1.00 0.00 ?  117 GLN B HE22 1  
ATOM   4269   N  N    . LYS B  2 64  ? 50.320  19.150  10.158  1.00 0.00 ?  118 LYS B N    1  
ATOM   4270   C  CA   . LYS B  2 64  ? 50.313  19.930  8.955   1.00 0.00 ?  118 LYS B CA   1  
ATOM   4271   C  C    . LYS B  2 64  ? 49.028  20.722  8.750   1.00 0.00 ?  118 LYS B C    1  
ATOM   4272   O  O    . LYS B  2 64  ? 49.125  21.861  8.330   1.00 0.00 ?  118 LYS B O    1  
ATOM   4273   C  CB   . LYS B  2 64  ? 50.514  19.067  7.727   1.00 0.00 ?  118 LYS B CB   1  
ATOM   4274   C  CG   . LYS B  2 64  ? 51.934  18.553  7.575   1.00 0.00 ?  118 LYS B CG   1  
ATOM   4275   C  CD   . LYS B  2 64  ? 52.160  17.887  6.174   1.00 0.00 ?  118 LYS B CD   1  
ATOM   4276   C  CE   . LYS B  2 64  ? 53.502  17.285  6.173   1.00 0.00 ?  118 LYS B CE   1  
ATOM   4277   N  NZ   . LYS B  2 64  ? 53.897  16.911  4.781   1.00 0.00 1  118 LYS B NZ   1  
ATOM   4278   H  H    . LYS B  2 64  ? 50.377  18.187  9.906   1.00 0.00 ?  118 LYS B H    1  
ATOM   4279   H  HA   . LYS B  2 64  ? 51.141  20.615  9.058   1.00 0.00 ?  118 LYS B HA   1  
ATOM   4280   H  HB2  . LYS B  2 64  ? 49.793  18.235  7.882   1.00 0.00 ?  118 LYS B HB2  1  
ATOM   4281   H  HB3  . LYS B  2 64  ? 50.151  19.541  6.790   1.00 0.00 ?  118 LYS B HB3  1  
ATOM   4282   H  HG2  . LYS B  2 64  ? 52.587  19.447  7.672   1.00 0.00 ?  118 LYS B HG2  1  
ATOM   4283   H  HG3  . LYS B  2 64  ? 52.022  17.801  8.388   1.00 0.00 ?  118 LYS B HG3  1  
ATOM   4284   H  HD2  . LYS B  2 64  ? 51.326  17.197  5.928   1.00 0.00 ?  118 LYS B HD2  1  
ATOM   4285   H  HD3  . LYS B  2 64  ? 52.083  18.648  5.368   1.00 0.00 ?  118 LYS B HD3  1  
ATOM   4286   H  HE2  . LYS B  2 64  ? 54.120  18.081  6.641   1.00 0.00 ?  118 LYS B HE2  1  
ATOM   4287   H  HE3  . LYS B  2 64  ? 53.390  16.336  6.739   1.00 0.00 ?  118 LYS B HE3  1  
ATOM   4288   H  HZ1  . LYS B  2 64  ? 53.065  16.837  4.161   1.00 0.00 ?  118 LYS B HZ1  1  
ATOM   4289   H  HZ2  . LYS B  2 64  ? 54.414  16.013  4.694   1.00 0.00 ?  118 LYS B HZ2  1  
ATOM   4290   H  HZ3  . LYS B  2 64  ? 54.527  17.646  4.400   1.00 0.00 ?  118 LYS B HZ3  1  
ATOM   4291   N  N    . VAL B  2 65  ? 47.943  20.001  8.948   1.00 0.00 ?  119 VAL B N    1  
ATOM   4292   C  CA   . VAL B  2 65  ? 46.645  20.649  8.637   1.00 0.00 ?  119 VAL B CA   1  
ATOM   4293   C  C    . VAL B  2 65  ? 46.058  21.593  9.707   1.00 0.00 ?  119 VAL B C    1  
ATOM   4294   O  O    . VAL B  2 65  ? 45.418  22.553  9.246   1.00 0.00 ?  119 VAL B O    1  
ATOM   4295   C  CB   . VAL B  2 65  ? 45.627  19.551  8.192   1.00 0.00 ?  119 VAL B CB   1  
ATOM   4296   C  CG1  . VAL B  2 65  ? 44.785  18.934  9.329   1.00 0.00 ?  119 VAL B CG1  1  
ATOM   4297   C  CG2  . VAL B  2 65  ? 44.596  20.171  7.187   1.00 0.00 ?  119 VAL B CG2  1  
ATOM   4298   H  H    . VAL B  2 65  ? 47.844  19.120  9.404   1.00 0.00 ?  119 VAL B H    1  
ATOM   4299   H  HA   . VAL B  2 65  ? 46.876  21.266  7.781   1.00 0.00 ?  119 VAL B HA   1  
ATOM   4300   H  HB   . VAL B  2 65  ? 46.111  18.677  7.707   1.00 0.00 ?  119 VAL B HB   1  
ATOM   4301   H  HG11 . VAL B  2 65  ? 44.283  18.037  8.906   1.00 0.00 ?  119 VAL B HG11 1  
ATOM   4302   H  HG12 . VAL B  2 65  ? 44.071  19.701  9.697   1.00 0.00 ?  119 VAL B HG12 1  
ATOM   4303   H  HG13 . VAL B  2 65  ? 45.342  18.718  10.266  1.00 0.00 ?  119 VAL B HG13 1  
ATOM   4304   H  HG21 . VAL B  2 65  ? 43.792  19.483  6.848   1.00 0.00 ?  119 VAL B HG21 1  
ATOM   4305   H  HG22 . VAL B  2 65  ? 45.091  20.680  6.332   1.00 0.00 ?  119 VAL B HG22 1  
ATOM   4306   H  HG23 . VAL B  2 65  ? 43.951  20.882  7.745   1.00 0.00 ?  119 VAL B HG23 1  
ATOM   4307   N  N    . GLU B  2 66  ? 46.390  21.514  10.961  1.00 0.00 ?  120 GLU B N    1  
ATOM   4308   C  CA   . GLU B  2 66  ? 45.815  22.305  11.944  1.00 0.00 ?  120 GLU B CA   1  
ATOM   4309   C  C    . GLU B  2 66  ? 45.896  23.810  11.921  1.00 0.00 ?  120 GLU B C    1  
ATOM   4310   O  O    . GLU B  2 66  ? 44.903  24.555  12.115  1.00 0.00 ?  120 GLU B O    1  
ATOM   4311   C  CB   . GLU B  2 66  ? 46.220  21.858  13.332  1.00 0.00 ?  120 GLU B CB   1  
ATOM   4312   C  CG   . GLU B  2 66  ? 45.581  22.702  14.528  1.00 0.00 ?  120 GLU B CG   1  
ATOM   4313   C  CD   . GLU B  2 66  ? 46.037  22.222  15.933  1.00 0.00 ?  120 GLU B CD   1  
ATOM   4314   O  OE1  . GLU B  2 66  ? 45.316  21.456  16.618  1.00 0.00 ?  120 GLU B OE1  1  
ATOM   4315   O  OE2  . GLU B  2 66  ? 47.184  22.548  16.206  1.00 0.00 -1 120 GLU B OE2  1  
ATOM   4316   H  H    . GLU B  2 66  ? 46.928  20.745  11.294  1.00 0.00 ?  120 GLU B H    1  
ATOM   4317   H  HA   . GLU B  2 66  ? 44.777  22.090  11.734  1.00 0.00 ?  120 GLU B HA   1  
ATOM   4318   H  HB2  . GLU B  2 66  ? 45.851  20.819  13.468  1.00 0.00 ?  120 GLU B HB2  1  
ATOM   4319   H  HB3  . GLU B  2 66  ? 47.316  21.968  13.483  1.00 0.00 ?  120 GLU B HB3  1  
ATOM   4320   H  HG2  . GLU B  2 66  ? 45.770  23.796  14.472  1.00 0.00 ?  120 GLU B HG2  1  
ATOM   4321   H  HG3  . GLU B  2 66  ? 44.475  22.607  14.483  1.00 0.00 ?  120 GLU B HG3  1  
ATOM   4322   N  N    . PRO B  2 67  ? 47.029  24.486  11.707  1.00 0.00 ?  121 PRO B N    1  
ATOM   4323   C  CA   . PRO B  2 67  ? 47.131  25.856  11.985  1.00 0.00 ?  121 PRO B CA   1  
ATOM   4324   C  C    . PRO B  2 67  ? 46.594  26.611  10.765  1.00 0.00 ?  121 PRO B C    1  
ATOM   4325   O  O    . PRO B  2 67  ? 46.252  27.796  10.945  1.00 0.00 ?  121 PRO B O    1  
ATOM   4326   C  CB   . PRO B  2 67  ? 48.626  26.168  12.061  1.00 0.00 ?  121 PRO B CB   1  
ATOM   4327   C  CG   . PRO B  2 67  ? 49.220  25.143  11.111  1.00 0.00 ?  121 PRO B CG   1  
ATOM   4328   C  CD   . PRO B  2 67  ? 48.254  23.891  11.295  1.00 0.00 ?  121 PRO B CD   1  
ATOM   4329   H  HA   . PRO B  2 67  ? 46.508  26.114  12.829  1.00 0.00 ?  121 PRO B HA   1  
ATOM   4330   H  HB2  . PRO B  2 67  ? 48.878  27.208  11.763  1.00 0.00 ?  121 PRO B HB2  1  
ATOM   4331   H  HB3  . PRO B  2 67  ? 49.033  26.160  13.095  1.00 0.00 ?  121 PRO B HB3  1  
ATOM   4332   H  HG2  . PRO B  2 67  ? 49.194  25.543  10.075  1.00 0.00 ?  121 PRO B HG2  1  
ATOM   4333   H  HG3  . PRO B  2 67  ? 50.266  24.812  11.288  1.00 0.00 ?  121 PRO B HG3  1  
ATOM   4334   H  HD2  . PRO B  2 67  ? 48.112  23.425  10.296  1.00 0.00 ?  121 PRO B HD2  1  
ATOM   4335   H  HD3  . PRO B  2 67  ? 48.490  23.232  12.158  1.00 0.00 ?  121 PRO B HD3  1  
ATOM   4336   N  N    . TYR B  2 68  ? 46.574  26.099  9.528   1.00 0.00 ?  122 TYR B N    1  
ATOM   4337   C  CA   . TYR B  2 68  ? 46.156  26.868  8.465   1.00 0.00 ?  122 TYR B CA   1  
ATOM   4338   C  C    . TYR B  2 68  ? 44.688  27.093  8.630   1.00 0.00 ?  122 TYR B C    1  
ATOM   4339   O  O    . TYR B  2 68  ? 44.193  28.189  8.444   1.00 0.00 ?  122 TYR B O    1  
ATOM   4340   C  CB   . TYR B  2 68  ? 46.370  26.263  7.047   1.00 0.00 ?  122 TYR B CB   1  
ATOM   4341   C  CG   . TYR B  2 68  ? 47.782  26.418  6.613   1.00 0.00 ?  122 TYR B CG   1  
ATOM   4342   C  CD1  . TYR B  2 68  ? 48.848  25.613  7.138   1.00 0.00 ?  122 TYR B CD1  1  
ATOM   4343   C  CD2  . TYR B  2 68  ? 48.116  27.215  5.536   1.00 0.00 ?  122 TYR B CD2  1  
ATOM   4344   C  CE1  . TYR B  2 68  ? 50.177  25.624  6.679   1.00 0.00 ?  122 TYR B CE1  1  
ATOM   4345   C  CE2  . TYR B  2 68  ? 49.459  27.238  5.050   1.00 0.00 ?  122 TYR B CE2  1  
ATOM   4346   C  CZ   . TYR B  2 68  ? 50.467  26.445  5.623   1.00 0.00 ?  122 TYR B CZ   1  
ATOM   4347   O  OH   . TYR B  2 68  ? 51.820  26.401  5.017   1.00 0.00 ?  122 TYR B OH   1  
ATOM   4348   H  H    . TYR B  2 68  ? 46.822  25.137  9.438   1.00 0.00 ?  122 TYR B H    1  
ATOM   4349   H  HA   . TYR B  2 68  ? 46.651  27.823  8.558   1.00 0.00 ?  122 TYR B HA   1  
ATOM   4350   H  HB2  . TYR B  2 68  ? 46.314  25.154  7.030   1.00 0.00 ?  122 TYR B HB2  1  
ATOM   4351   H  HB3  . TYR B  2 68  ? 45.702  26.830  6.364   1.00 0.00 ?  122 TYR B HB3  1  
ATOM   4352   H  HD1  . TYR B  2 68  ? 48.688  24.921  7.950   1.00 0.00 ?  122 TYR B HD1  1  
ATOM   4353   H  HD2  . TYR B  2 68  ? 47.314  27.824  5.145   1.00 0.00 ?  122 TYR B HD2  1  
ATOM   4354   H  HE1  . TYR B  2 68  ? 50.859  24.848  6.994   1.00 0.00 ?  122 TYR B HE1  1  
ATOM   4355   H  HE2  . TYR B  2 68  ? 49.525  27.784  4.121   1.00 0.00 ?  122 TYR B HE2  1  
ATOM   4356   H  HH   . TYR B  2 68  ? 51.712  27.071  4.338   1.00 0.00 ?  122 TYR B HH   1  
ATOM   4357   N  N    . LEU B  2 69  ? 43.961  26.035  8.942   1.00 0.00 ?  123 LEU B N    1  
ATOM   4358   C  CA   . LEU B  2 69  ? 42.520  26.106  9.000   1.00 0.00 ?  123 LEU B CA   1  
ATOM   4359   C  C    . LEU B  2 69  ? 41.953  26.837  10.212  1.00 0.00 ?  123 LEU B C    1  
ATOM   4360   O  O    . LEU B  2 69  ? 40.845  27.409  10.141  1.00 0.00 ?  123 LEU B O    1  
ATOM   4361   C  CB   . LEU B  2 69  ? 41.741  24.687  8.801   1.00 0.00 ?  123 LEU B CB   1  
ATOM   4362   C  CG   . LEU B  2 69  ? 41.834  23.955  7.436   1.00 0.00 ?  123 LEU B CG   1  
ATOM   4363   C  CD1  . LEU B  2 69  ? 41.875  22.466  7.611   1.00 0.00 ?  123 LEU B CD1  1  
ATOM   4364   C  CD2  . LEU B  2 69  ? 40.694  24.360  6.471   1.00 0.00 ?  123 LEU B CD2  1  
ATOM   4365   H  H    . LEU B  2 69  ? 44.302  25.101  9.013   1.00 0.00 ?  123 LEU B H    1  
ATOM   4366   H  HA   . LEU B  2 69  ? 42.209  26.692  8.148   1.00 0.00 ?  123 LEU B HA   1  
ATOM   4367   H  HB2  . LEU B  2 69  ? 42.148  24.047  9.613   1.00 0.00 ?  123 LEU B HB2  1  
ATOM   4368   H  HB3  . LEU B  2 69  ? 40.658  24.734  9.045   1.00 0.00 ?  123 LEU B HB3  1  
ATOM   4369   H  HG   . LEU B  2 69  ? 42.779  24.207  6.909   1.00 0.00 ?  123 LEU B HG   1  
ATOM   4370   H  HD11 . LEU B  2 69  ? 42.518  22.225  8.484   1.00 0.00 ?  123 LEU B HD11 1  
ATOM   4371   H  HD12 . LEU B  2 69  ? 42.339  21.998  6.716   1.00 0.00 ?  123 LEU B HD12 1  
ATOM   4372   H  HD13 . LEU B  2 69  ? 40.838  22.075  7.682   1.00 0.00 ?  123 LEU B HD13 1  
ATOM   4373   H  HD21 . LEU B  2 69  ? 40.650  25.457  6.302   1.00 0.00 ?  123 LEU B HD21 1  
ATOM   4374   H  HD22 . LEU B  2 69  ? 39.727  24.002  6.886   1.00 0.00 ?  123 LEU B HD22 1  
ATOM   4375   H  HD23 . LEU B  2 69  ? 40.837  23.937  5.454   1.00 0.00 ?  123 LEU B HD23 1  
ATOM   4376   N  N    . ASP B  2 70  ? 42.701  26.895  11.322  1.00 0.00 ?  124 ASP B N    1  
ATOM   4377   C  CA   . ASP B  2 70  ? 42.467  27.779  12.429  1.00 0.00 ?  124 ASP B CA   1  
ATOM   4378   C  C    . ASP B  2 70  ? 42.628  29.213  12.024  1.00 0.00 ?  124 ASP B C    1  
ATOM   4379   O  O    . ASP B  2 70  ? 41.729  29.985  12.352  1.00 0.00 ?  124 ASP B O    1  
ATOM   4380   C  CB   . ASP B  2 70  ? 43.407  27.378  13.494  1.00 0.00 ?  124 ASP B CB   1  
ATOM   4381   C  CG   . ASP B  2 70  ? 43.059  27.975  14.895  1.00 0.00 ?  124 ASP B CG   1  
ATOM   4382   O  OD1  . ASP B  2 70  ? 43.856  27.909  15.840  1.00 0.00 ?  124 ASP B OD1  1  
ATOM   4383   O  OD2  . ASP B  2 70  ? 41.959  28.505  15.058  1.00 0.00 -1 124 ASP B OD2  1  
ATOM   4384   H  H    . ASP B  2 70  ? 43.543  26.371  11.424  1.00 0.00 ?  124 ASP B H    1  
ATOM   4385   H  HA   . ASP B  2 70  ? 41.451  27.623  12.761  1.00 0.00 ?  124 ASP B HA   1  
ATOM   4386   H  HB2  . ASP B  2 70  ? 43.283  26.300  13.729  1.00 0.00 ?  124 ASP B HB2  1  
ATOM   4387   H  HB3  . ASP B  2 70  ? 44.453  27.692  13.290  1.00 0.00 ?  124 ASP B HB3  1  
ATOM   4388   N  N    . ASP B  2 71  ? 43.603  29.627  11.207  1.00 0.00 ?  125 ASP B N    1  
ATOM   4389   C  CA   . ASP B  2 71  ? 43.775  31.029  10.737  1.00 0.00 ?  125 ASP B CA   1  
ATOM   4390   C  C    . ASP B  2 71  ? 42.779  31.459  9.789   1.00 0.00 ?  125 ASP B C    1  
ATOM   4391   O  O    . ASP B  2 71  ? 42.351  32.590  9.823   1.00 0.00 ?  125 ASP B O    1  
ATOM   4392   C  CB   . ASP B  2 71  ? 45.245  31.195  10.387  1.00 0.00 ?  125 ASP B CB   1  
ATOM   4393   C  CG   . ASP B  2 71  ? 46.164  31.353  11.577  1.00 0.00 ?  125 ASP B CG   1  
ATOM   4394   O  OD1  . ASP B  2 71  ? 47.385  31.487  11.322  1.00 0.00 ?  125 ASP B OD1  1  
ATOM   4395   O  OD2  . ASP B  2 71  ? 45.763  31.428  12.725  1.00 0.00 -1 125 ASP B OD2  1  
ATOM   4396   H  H    . ASP B  2 71  ? 44.243  28.927  10.901  1.00 0.00 ?  125 ASP B H    1  
ATOM   4397   H  HA   . ASP B  2 71  ? 43.458  31.638  11.570  1.00 0.00 ?  125 ASP B HA   1  
ATOM   4398   H  HB2  . ASP B  2 71  ? 45.612  30.274  9.886   1.00 0.00 ?  125 ASP B HB2  1  
ATOM   4399   H  HB3  . ASP B  2 71  ? 45.295  32.092  9.733   1.00 0.00 ?  125 ASP B HB3  1  
ATOM   4400   N  N    . PHE B  2 72  ? 42.299  30.592  8.934   1.00 0.00 ?  126 PHE B N    1  
ATOM   4401   C  CA   . PHE B  2 72  ? 41.242  30.934  8.020   1.00 0.00 ?  126 PHE B CA   1  
ATOM   4402   C  C    . PHE B  2 72  ? 39.838  31.120  8.595   1.00 0.00 ?  126 PHE B C    1  
ATOM   4403   O  O    . PHE B  2 72  ? 39.080  32.051  8.281   1.00 0.00 ?  126 PHE B O    1  
ATOM   4404   C  CB   . PHE B  2 72  ? 41.432  30.020  6.866   1.00 0.00 ?  126 PHE B CB   1  
ATOM   4405   C  CG   . PHE B  2 72  ? 40.621  30.433  5.613   1.00 0.00 ?  126 PHE B CG   1  
ATOM   4406   C  CD1  . PHE B  2 72  ? 39.237  30.080  5.483   1.00 0.00 ?  126 PHE B CD1  1  
ATOM   4407   C  CD2  . PHE B  2 72  ? 41.267  31.066  4.559   1.00 0.00 ?  126 PHE B CD2  1  
ATOM   4408   C  CE1  . PHE B  2 72  ? 38.526  30.371  4.359   1.00 0.00 ?  126 PHE B CE1  1  
ATOM   4409   C  CE2  . PHE B  2 72  ? 40.616  31.336  3.304   1.00 0.00 ?  126 PHE B CE2  1  
ATOM   4410   C  CZ   . PHE B  2 72  ? 39.242  30.981  3.264   1.00 0.00 ?  126 PHE B CZ   1  
ATOM   4411   H  H    . PHE B  2 72  ? 42.636  29.658  9.027   1.00 0.00 ?  126 PHE B H    1  
ATOM   4412   H  HA   . PHE B  2 72  ? 41.489  31.860  7.522   1.00 0.00 ?  126 PHE B HA   1  
ATOM   4413   H  HB2  . PHE B  2 72  ? 42.474  30.074  6.486   1.00 0.00 ?  126 PHE B HB2  1  
ATOM   4414   H  HB3  . PHE B  2 72  ? 41.158  28.995  7.199   1.00 0.00 ?  126 PHE B HB3  1  
ATOM   4415   H  HD1  . PHE B  2 72  ? 38.743  29.689  6.360   1.00 0.00 ?  126 PHE B HD1  1  
ATOM   4416   H  HD2  . PHE B  2 72  ? 42.326  31.247  4.445   1.00 0.00 ?  126 PHE B HD2  1  
ATOM   4417   H  HE1  . PHE B  2 72  ? 37.450  30.286  4.397   1.00 0.00 ?  126 PHE B HE1  1  
ATOM   4418   H  HE2  . PHE B  2 72  ? 41.159  31.838  2.517   1.00 0.00 ?  126 PHE B HE2  1  
ATOM   4419   H  HZ   . PHE B  2 72  ? 38.636  31.354  2.452   1.00 0.00 ?  126 PHE B HZ   1  
ATOM   4420   N  N    . GLN B  2 73  ? 39.459  30.366  9.612   1.00 0.00 ?  127 GLN B N    1  
ATOM   4421   C  CA   . GLN B  2 73  ? 38.305  30.445  10.451  1.00 0.00 ?  127 GLN B CA   1  
ATOM   4422   C  C    . GLN B  2 73  ? 38.445  31.583  11.458  1.00 0.00 ?  127 GLN B C    1  
ATOM   4423   O  O    . GLN B  2 73  ? 37.532  32.355  11.519  1.00 0.00 ?  127 GLN B O    1  
ATOM   4424   C  CB   . GLN B  2 73  ? 38.083  29.107  11.161  1.00 0.00 ?  127 GLN B CB   1  
ATOM   4425   C  CG   . GLN B  2 73  ? 37.522  27.845  10.355  1.00 0.00 ?  127 GLN B CG   1  
ATOM   4426   C  CD   . GLN B  2 73  ? 37.778  27.931  8.877   1.00 0.00 ?  127 GLN B CD   1  
ATOM   4427   O  OE1  . GLN B  2 73  ? 37.145  28.745  8.248   1.00 0.00 ?  127 GLN B OE1  1  
ATOM   4428   N  NE2  . GLN B  2 73  ? 38.711  27.049  8.370   1.00 0.00 ?  127 GLN B NE2  1  
ATOM   4429   H  H    . GLN B  2 73  ? 40.024  29.619  9.952   1.00 0.00 ?  127 GLN B H    1  
ATOM   4430   H  HA   . GLN B  2 73  ? 37.386  30.702  9.946   1.00 0.00 ?  127 GLN B HA   1  
ATOM   4431   H  HB2  . GLN B  2 73  ? 39.051  28.766  11.585  1.00 0.00 ?  127 GLN B HB2  1  
ATOM   4432   H  HB3  . GLN B  2 73  ? 37.342  29.160  11.987  1.00 0.00 ?  127 GLN B HB3  1  
ATOM   4433   H  HG2  . GLN B  2 73  ? 37.996  26.964  10.838  1.00 0.00 ?  127 GLN B HG2  1  
ATOM   4434   H  HG3  . GLN B  2 73  ? 36.425  27.912  10.518  1.00 0.00 ?  127 GLN B HG3  1  
ATOM   4435   H  HE21 . GLN B  2 73  ? 39.016  27.194  7.429   1.00 0.00 ?  127 GLN B HE21 1  
ATOM   4436   H  HE22 . GLN B  2 73  ? 39.387  26.702  9.020   1.00 0.00 ?  127 GLN B HE22 1  
ATOM   4437   N  N    . LYS B  2 74  ? 39.531  31.789  12.132  1.00 0.00 ?  128 LYS B N    1  
ATOM   4438   C  CA   . LYS B  2 74  ? 39.774  33.040  12.922  1.00 0.00 ?  128 LYS B CA   1  
ATOM   4439   C  C    . LYS B  2 74  ? 39.621  34.297  12.050  1.00 0.00 ?  128 LYS B C    1  
ATOM   4440   O  O    . LYS B  2 74  ? 39.014  35.271  12.439  1.00 0.00 ?  128 LYS B O    1  
ATOM   4441   C  CB   . LYS B  2 74  ? 41.206  33.066  13.633  1.00 0.00 ?  128 LYS B CB   1  
ATOM   4442   C  CG   . LYS B  2 74  ? 41.325  34.261  14.631  1.00 0.00 ?  128 LYS B CG   1  
ATOM   4443   C  CD   . LYS B  2 74  ? 40.431  34.326  15.876  1.00 0.00 ?  128 LYS B CD   1  
ATOM   4444   C  CE   . LYS B  2 74  ? 39.567  35.626  16.057  1.00 0.00 ?  128 LYS B CE   1  
ATOM   4445   N  NZ   . LYS B  2 74  ? 40.509  36.749  16.145  1.00 0.00 1  128 LYS B NZ   1  
ATOM   4446   H  H    . LYS B  2 74  ? 40.340  31.216  12.033  1.00 0.00 ?  128 LYS B H    1  
ATOM   4447   H  HA   . LYS B  2 74  ? 38.955  33.192  13.608  1.00 0.00 ?  128 LYS B HA   1  
ATOM   4448   H  HB2  . LYS B  2 74  ? 41.348  32.112  14.184  1.00 0.00 ?  128 LYS B HB2  1  
ATOM   4449   H  HB3  . LYS B  2 74  ? 42.008  33.060  12.864  1.00 0.00 ?  128 LYS B HB3  1  
ATOM   4450   H  HG2  . LYS B  2 74  ? 42.353  34.314  15.050  1.00 0.00 ?  128 LYS B HG2  1  
ATOM   4451   H  HG3  . LYS B  2 74  ? 41.101  35.166  14.027  1.00 0.00 ?  128 LYS B HG3  1  
ATOM   4452   H  HD2  . LYS B  2 74  ? 39.794  33.416  15.869  1.00 0.00 ?  128 LYS B HD2  1  
ATOM   4453   H  HD3  . LYS B  2 74  ? 41.145  34.192  16.716  1.00 0.00 ?  128 LYS B HD3  1  
ATOM   4454   H  HE2  . LYS B  2 74  ? 38.775  35.791  15.295  1.00 0.00 ?  128 LYS B HE2  1  
ATOM   4455   H  HE3  . LYS B  2 74  ? 39.006  35.508  17.009  1.00 0.00 ?  128 LYS B HE3  1  
ATOM   4456   H  HZ1  . LYS B  2 74  ? 40.953  36.997  15.238  1.00 0.00 ?  128 LYS B HZ1  1  
ATOM   4457   H  HZ2  . LYS B  2 74  ? 41.243  36.554  16.856  1.00 0.00 ?  128 LYS B HZ2  1  
ATOM   4458   H  HZ3  . LYS B  2 74  ? 40.006  37.585  16.504  1.00 0.00 ?  128 LYS B HZ3  1  
ATOM   4459   N  N    . LYS B  2 75  ? 40.199  34.296  10.764  1.00 0.00 ?  129 LYS B N    1  
ATOM   4460   C  CA   . LYS B  2 75  ? 40.352  35.446  10.066  1.00 0.00 ?  129 LYS B CA   1  
ATOM   4461   C  C    . LYS B  2 75  ? 38.988  35.824  9.387   1.00 0.00 ?  129 LYS B C    1  
ATOM   4462   O  O    . LYS B  2 75  ? 38.633  36.984  9.346   1.00 0.00 ?  129 LYS B O    1  
ATOM   4463   C  CB   . LYS B  2 75  ? 41.389  35.326  8.981   1.00 0.00 ?  129 LYS B CB   1  
ATOM   4464   C  CG   . LYS B  2 75  ? 41.583  36.610  8.128   1.00 0.00 ?  129 LYS B CG   1  
ATOM   4465   C  CD   . LYS B  2 75  ? 41.863  37.888  8.985   1.00 0.00 ?  129 LYS B CD   1  
ATOM   4466   C  CE   . LYS B  2 75  ? 43.019  37.992  9.929   1.00 0.00 ?  129 LYS B CE   1  
ATOM   4467   N  NZ   . LYS B  2 75  ? 43.039  39.359  10.556  1.00 0.00 1  129 LYS B NZ   1  
ATOM   4468   H  H    . LYS B  2 75  ? 40.758  33.564  10.382  1.00 0.00 ?  129 LYS B H    1  
ATOM   4469   H  HA   . LYS B  2 75  ? 40.693  36.215  10.742  1.00 0.00 ?  129 LYS B HA   1  
ATOM   4470   H  HB2  . LYS B  2 75  ? 42.367  35.196  9.492   1.00 0.00 ?  129 LYS B HB2  1  
ATOM   4471   H  HB3  . LYS B  2 75  ? 41.250  34.525  8.224   1.00 0.00 ?  129 LYS B HB3  1  
ATOM   4472   H  HG2  . LYS B  2 75  ? 42.513  36.446  7.543   1.00 0.00 ?  129 LYS B HG2  1  
ATOM   4473   H  HG3  . LYS B  2 75  ? 40.738  36.761  7.424   1.00 0.00 ?  129 LYS B HG3  1  
ATOM   4474   H  HD2  . LYS B  2 75  ? 42.041  38.612  8.162   1.00 0.00 ?  129 LYS B HD2  1  
ATOM   4475   H  HD3  . LYS B  2 75  ? 40.857  38.190  9.349   1.00 0.00 ?  129 LYS B HD3  1  
ATOM   4476   H  HE2  . LYS B  2 75  ? 43.096  37.188  10.691  1.00 0.00 ?  129 LYS B HE2  1  
ATOM   4477   H  HE3  . LYS B  2 75  ? 43.946  37.909  9.323   1.00 0.00 ?  129 LYS B HE3  1  
ATOM   4478   H  HZ1  . LYS B  2 75  ? 42.407  39.457  11.376  1.00 0.00 ?  129 LYS B HZ1  1  
ATOM   4479   H  HZ2  . LYS B  2 75  ? 42.725  40.017  9.814   1.00 0.00 ?  129 LYS B HZ2  1  
ATOM   4480   H  HZ3  . LYS B  2 75  ? 43.987  39.710  10.801  1.00 0.00 ?  129 LYS B HZ3  1  
ATOM   4481   N  N    . TRP B  2 76  ? 38.251  34.768  9.041   1.00 0.00 ?  130 TRP B N    1  
ATOM   4482   C  CA   . TRP B  2 76  ? 36.768  34.854  8.723   1.00 0.00 ?  130 TRP B CA   1  
ATOM   4483   C  C    . TRP B  2 76  ? 35.920  35.468  9.849   1.00 0.00 ?  130 TRP B C    1  
ATOM   4484   O  O    . TRP B  2 76  ? 35.101  36.389  9.598   1.00 0.00 ?  130 TRP B O    1  
ATOM   4485   C  CB   . TRP B  2 76  ? 36.155  33.384  8.575   1.00 0.00 ?  130 TRP B CB   1  
ATOM   4486   C  CG   . TRP B  2 76  ? 34.819  33.150  7.895   1.00 0.00 ?  130 TRP B CG   1  
ATOM   4487   C  CD1  . TRP B  2 76  ? 34.578  32.616  6.683   1.00 0.00 ?  130 TRP B CD1  1  
ATOM   4488   C  CD2  . TRP B  2 76  ? 33.465  33.363  8.566   1.00 0.00 ?  130 TRP B CD2  1  
ATOM   4489   N  NE1  . TRP B  2 76  ? 33.215  32.420  6.463   1.00 0.00 ?  130 TRP B NE1  1  
ATOM   4490   C  CE2  . TRP B  2 76  ? 32.529  32.852  7.606   1.00 0.00 ?  130 TRP B CE2  1  
ATOM   4491   C  CE3  . TRP B  2 76  ? 33.014  33.850  9.815   1.00 0.00 ?  130 TRP B CE3  1  
ATOM   4492   C  CZ2  . TRP B  2 76  ? 31.189  32.852  7.914   1.00 0.00 ?  130 TRP B CZ2  1  
ATOM   4493   C  CZ3  . TRP B  2 76  ? 31.683  33.687  10.101  1.00 0.00 ?  130 TRP B CZ3  1  
ATOM   4494   C  CH2  . TRP B  2 76  ? 30.748  33.281  9.169   1.00 0.00 ?  130 TRP B CH2  1  
ATOM   4495   H  H    . TRP B  2 76  ? 38.571  33.825  9.090   1.00 0.00 ?  130 TRP B H    1  
ATOM   4496   H  HA   . TRP B  2 76  ? 36.709  35.438  7.816   1.00 0.00 ?  130 TRP B HA   1  
ATOM   4497   H  HB2  . TRP B  2 76  ? 36.925  33.023  7.860   1.00 0.00 ?  130 TRP B HB2  1  
ATOM   4498   H  HB3  . TRP B  2 76  ? 36.331  32.712  9.442   1.00 0.00 ?  130 TRP B HB3  1  
ATOM   4499   H  HD1  . TRP B  2 76  ? 35.268  32.040  6.083   1.00 0.00 ?  130 TRP B HD1  1  
ATOM   4500   H  HE1  . TRP B  2 76  ? 32.880  31.824  5.766   1.00 0.00 ?  130 TRP B HE1  1  
ATOM   4501   H  HE3  . TRP B  2 76  ? 33.810  34.073  10.511  1.00 0.00 ?  130 TRP B HE3  1  
ATOM   4502   H  HZ2  . TRP B  2 76  ? 30.545  32.440  7.150   1.00 0.00 ?  130 TRP B HZ2  1  
ATOM   4503   H  HZ3  . TRP B  2 76  ? 31.366  34.080  11.055  1.00 0.00 ?  130 TRP B HZ3  1  
ATOM   4504   H  HH2  . TRP B  2 76  ? 29.686  33.234  9.357   1.00 0.00 ?  130 TRP B HH2  1  
ATOM   4505   N  N    . GLN B  2 77  ? 36.037  35.096  11.125  1.00 0.00 ?  131 GLN B N    1  
ATOM   4506   C  CA   . GLN B  2 77  ? 35.435  35.818  12.216  1.00 0.00 ?  131 GLN B CA   1  
ATOM   4507   C  C    . GLN B  2 77  ? 35.703  37.303  12.279  1.00 0.00 ?  131 GLN B C    1  
ATOM   4508   O  O    . GLN B  2 77  ? 34.840  38.135  12.489  1.00 0.00 ?  131 GLN B O    1  
ATOM   4509   C  CB   . GLN B  2 77  ? 35.791  35.295  13.604  1.00 0.00 ?  131 GLN B CB   1  
ATOM   4510   C  CG   . GLN B  2 77  ? 35.243  36.080  14.890  1.00 0.00 ?  131 GLN B CG   1  
ATOM   4511   C  CD   . GLN B  2 77  ? 33.789  35.834  15.074  1.00 0.00 ?  131 GLN B CD   1  
ATOM   4512   O  OE1  . GLN B  2 77  ? 33.293  34.748  15.405  1.00 0.00 ?  131 GLN B OE1  1  
ATOM   4513   N  NE2  . GLN B  2 77  ? 32.968  36.934  14.867  1.00 0.00 ?  131 GLN B NE2  1  
ATOM   4514   H  H    . GLN B  2 77  ? 36.612  34.327  11.393  1.00 0.00 ?  131 GLN B H    1  
ATOM   4515   H  HA   . GLN B  2 77  ? 34.376  35.680  12.052  1.00 0.00 ?  131 GLN B HA   1  
ATOM   4516   H  HB2  . GLN B  2 77  ? 35.530  34.240  13.836  1.00 0.00 ?  131 GLN B HB2  1  
ATOM   4517   H  HB3  . GLN B  2 77  ? 36.899  35.234  13.650  1.00 0.00 ?  131 GLN B HB3  1  
ATOM   4518   H  HG2  . GLN B  2 77  ? 35.644  35.592  15.804  1.00 0.00 ?  131 GLN B HG2  1  
ATOM   4519   H  HG3  . GLN B  2 77  ? 35.484  37.164  14.900  1.00 0.00 ?  131 GLN B HG3  1  
ATOM   4520   H  HE21 . GLN B  2 77  ? 33.329  37.812  14.552  1.00 0.00 ?  131 GLN B HE21 1  
ATOM   4521   H  HE22 . GLN B  2 77  ? 32.041  36.876  15.237  1.00 0.00 ?  131 GLN B HE22 1  
ATOM   4522   N  N    . GLU B  2 78  ? 36.949  37.724  12.200  1.00 0.00 ?  132 GLU B N    1  
ATOM   4523   C  CA   . GLU B  2 78  ? 37.410  39.147  12.119  1.00 0.00 ?  132 GLU B CA   1  
ATOM   4524   C  C    . GLU B  2 78  ? 36.863  39.924  10.957  1.00 0.00 ?  132 GLU B C    1  
ATOM   4525   O  O    . GLU B  2 78  ? 36.536  41.106  11.207  1.00 0.00 ?  132 GLU B O    1  
ATOM   4526   C  CB   . GLU B  2 78  ? 38.955  39.283  12.093  1.00 0.00 ?  132 GLU B CB   1  
ATOM   4527   C  CG   . GLU B  2 78  ? 39.549  38.690  13.393  1.00 0.00 ?  132 GLU B CG   1  
ATOM   4528   C  CD   . GLU B  2 78  ? 41.085  38.705  13.428  1.00 0.00 ?  132 GLU B CD   1  
ATOM   4529   O  OE1  . GLU B  2 78  ? 41.609  37.749  14.058  1.00 0.00 ?  132 GLU B OE1  1  
ATOM   4530   O  OE2  . GLU B  2 78  ? 41.781  39.615  12.867  1.00 0.00 -1 132 GLU B OE2  1  
ATOM   4531   H  H    . GLU B  2 78  ? 37.697  37.078  12.071  1.00 0.00 ?  132 GLU B H    1  
ATOM   4532   H  HA   . GLU B  2 78  ? 37.067  39.653  13.009  1.00 0.00 ?  132 GLU B HA   1  
ATOM   4533   H  HB2  . GLU B  2 78  ? 39.337  38.805  11.166  1.00 0.00 ?  132 GLU B HB2  1  
ATOM   4534   H  HB3  . GLU B  2 78  ? 39.275  40.347  12.069  1.00 0.00 ?  132 GLU B HB3  1  
ATOM   4535   H  HG2  . GLU B  2 78  ? 39.257  39.117  14.376  1.00 0.00 ?  132 GLU B HG2  1  
ATOM   4536   H  HG3  . GLU B  2 78  ? 39.281  37.614  13.469  1.00 0.00 ?  132 GLU B HG3  1  
ATOM   4537   N  N    . GLU B  2 79  ? 36.851  39.393  9.799   1.00 0.00 ?  133 GLU B N    1  
ATOM   4538   C  CA   . GLU B  2 79  ? 36.138  39.942  8.637   1.00 0.00 ?  133 GLU B CA   1  
ATOM   4539   C  C    . GLU B  2 79  ? 34.560  40.147  8.748   1.00 0.00 ?  133 GLU B C    1  
ATOM   4540   O  O    . GLU B  2 79  ? 34.036  41.215  8.420   1.00 0.00 ?  133 GLU B O    1  
ATOM   4541   C  CB   . GLU B  2 79  ? 36.571  39.074  7.412   1.00 0.00 ?  133 GLU B CB   1  
ATOM   4542   C  CG   . GLU B  2 79  ? 38.003  39.373  6.870   1.00 0.00 ?  133 GLU B CG   1  
ATOM   4543   C  CD   . GLU B  2 79  ? 38.156  40.659  5.979   1.00 0.00 ?  133 GLU B CD   1  
ATOM   4544   O  OE1  . GLU B  2 79  ? 37.977  41.688  6.593   1.00 0.00 ?  133 GLU B OE1  1  
ATOM   4545   O  OE2  . GLU B  2 79  ? 38.580  40.515  4.789   1.00 0.00 -1 133 GLU B OE2  1  
ATOM   4546   H  H    . GLU B  2 79  ? 37.245  38.486  9.671   1.00 0.00 ?  133 GLU B H    1  
ATOM   4547   H  HA   . GLU B  2 79  ? 36.495  40.954  8.523   1.00 0.00 ?  133 GLU B HA   1  
ATOM   4548   H  HB2  . GLU B  2 79  ? 36.491  38.047  7.828   1.00 0.00 ?  133 GLU B HB2  1  
ATOM   4549   H  HB3  . GLU B  2 79  ? 35.844  39.060  6.572   1.00 0.00 ?  133 GLU B HB3  1  
ATOM   4550   H  HG2  . GLU B  2 79  ? 38.665  39.416  7.761   1.00 0.00 ?  133 GLU B HG2  1  
ATOM   4551   H  HG3  . GLU B  2 79  ? 38.140  38.568  6.116   1.00 0.00 ?  133 GLU B HG3  1  
ATOM   4552   N  N    . MET B  2 80  ? 33.929  39.128  9.394   1.00 0.00 ?  134 MET B N    1  
ATOM   4553   C  CA   . MET B  2 80  ? 32.440  39.109  9.588   1.00 0.00 ?  134 MET B CA   1  
ATOM   4554   C  C    . MET B  2 80  ? 32.005  40.291  10.455  1.00 0.00 ?  134 MET B C    1  
ATOM   4555   O  O    . MET B  2 80  ? 31.145  41.082  10.124  1.00 0.00 ?  134 MET B O    1  
ATOM   4556   C  CB   . MET B  2 80  ? 32.094  37.754  10.244  1.00 0.00 ?  134 MET B CB   1  
ATOM   4557   C  CG   . MET B  2 80  ? 30.561  37.474  10.307  1.00 0.00 ?  134 MET B CG   1  
ATOM   4558   S  SD   . MET B  2 80  ? 29.567  37.460  8.734   1.00 0.00 ?  134 MET B SD   1  
ATOM   4559   C  CE   . MET B  2 80  ? 27.939  36.959  9.304   1.00 0.00 ?  134 MET B CE   1  
ATOM   4560   H  H    . MET B  2 80  ? 34.451  38.363  9.764   1.00 0.00 ?  134 MET B H    1  
ATOM   4561   H  HA   . MET B  2 80  ? 31.893  38.998  8.664   1.00 0.00 ?  134 MET B HA   1  
ATOM   4562   H  HB2  . MET B  2 80  ? 32.587  36.871  9.784   1.00 0.00 ?  134 MET B HB2  1  
ATOM   4563   H  HB3  . MET B  2 80  ? 32.498  37.647  11.273  1.00 0.00 ?  134 MET B HB3  1  
ATOM   4564   H  HG2  . MET B  2 80  ? 30.404  36.577  10.944  1.00 0.00 ?  134 MET B HG2  1  
ATOM   4565   H  HG3  . MET B  2 80  ? 30.128  38.370  10.802  1.00 0.00 ?  134 MET B HG3  1  
ATOM   4566   H  HE1  . MET B  2 80  ? 27.617  37.751  10.013  1.00 0.00 ?  134 MET B HE1  1  
ATOM   4567   H  HE2  . MET B  2 80  ? 27.890  35.913  9.676   1.00 0.00 ?  134 MET B HE2  1  
ATOM   4568   H  HE3  . MET B  2 80  ? 27.212  36.983  8.464   1.00 0.00 ?  134 MET B HE3  1  
ATOM   4569   N  N    . GLU B  2 81  ? 32.686  40.415  11.687  1.00 0.00 ?  135 GLU B N    1  
ATOM   4570   C  CA   . GLU B  2 81  ? 32.598  41.537  12.578  1.00 0.00 ?  135 GLU B CA   1  
ATOM   4571   C  C    . GLU B  2 81  ? 32.880  42.899  11.978  1.00 0.00 ?  135 GLU B C    1  
ATOM   4572   O  O    . GLU B  2 81  ? 32.078  43.843  12.032  1.00 0.00 ?  135 GLU B O    1  
ATOM   4573   C  CB   . GLU B  2 81  ? 33.434  41.407  13.956  1.00 0.00 ?  135 GLU B CB   1  
ATOM   4574   C  CG   . GLU B  2 81  ? 33.276  42.557  14.872  1.00 0.00 ?  135 GLU B CG   1  
ATOM   4575   C  CD   . GLU B  2 81  ? 33.721  42.286  16.295  1.00 0.00 ?  135 GLU B CD   1  
ATOM   4576   O  OE1  . GLU B  2 81  ? 34.799  42.854  16.681  1.00 0.00 ?  135 GLU B OE1  1  
ATOM   4577   O  OE2  . GLU B  2 81  ? 33.079  41.407  16.941  1.00 0.00 -1 135 GLU B OE2  1  
ATOM   4578   H  H    . GLU B  2 81  ? 33.444  39.807  11.911  1.00 0.00 ?  135 GLU B H    1  
ATOM   4579   H  HA   . GLU B  2 81  ? 31.576  41.561  12.926  1.00 0.00 ?  135 GLU B HA   1  
ATOM   4580   H  HB2  . GLU B  2 81  ? 33.086  40.485  14.469  1.00 0.00 ?  135 GLU B HB2  1  
ATOM   4581   H  HB3  . GLU B  2 81  ? 34.506  41.317  13.681  1.00 0.00 ?  135 GLU B HB3  1  
ATOM   4582   H  HG2  . GLU B  2 81  ? 33.824  43.434  14.468  1.00 0.00 ?  135 GLU B HG2  1  
ATOM   4583   H  HG3  . GLU B  2 81  ? 32.216  42.854  15.023  1.00 0.00 ?  135 GLU B HG3  1  
ATOM   4584   N  N    . LEU B  2 82  ? 33.983  43.066  11.246  1.00 0.00 ?  136 LEU B N    1  
ATOM   4585   C  CA   . LEU B  2 82  ? 34.192  44.283  10.455  1.00 0.00 ?  136 LEU B CA   1  
ATOM   4586   C  C    . LEU B  2 82  ? 33.032  44.629  9.513   1.00 0.00 ?  136 LEU B C    1  
ATOM   4587   O  O    . LEU B  2 82  ? 32.558  45.757  9.290   1.00 0.00 ?  136 LEU B O    1  
ATOM   4588   C  CB   . LEU B  2 82  ? 35.498  44.160  9.702   1.00 0.00 ?  136 LEU B CB   1  
ATOM   4589   C  CG   . LEU B  2 82  ? 35.912  45.260  8.652   1.00 0.00 ?  136 LEU B CG   1  
ATOM   4590   C  CD1  . LEU B  2 82  ? 35.767  46.643  9.155   1.00 0.00 ?  136 LEU B CD1  1  
ATOM   4591   C  CD2  . LEU B  2 82  ? 37.325  44.902  8.145   1.00 0.00 ?  136 LEU B CD2  1  
ATOM   4592   H  H    . LEU B  2 82  ? 34.771  42.467  11.367  1.00 0.00 ?  136 LEU B H    1  
ATOM   4593   H  HA   . LEU B  2 82  ? 34.148  45.068  11.197  1.00 0.00 ?  136 LEU B HA   1  
ATOM   4594   H  HB2  . LEU B  2 82  ? 36.385  44.156  10.371  1.00 0.00 ?  136 LEU B HB2  1  
ATOM   4595   H  HB3  . LEU B  2 82  ? 35.501  43.153  9.233   1.00 0.00 ?  136 LEU B HB3  1  
ATOM   4596   H  HG   . LEU B  2 82  ? 35.173  45.198  7.825   1.00 0.00 ?  136 LEU B HG   1  
ATOM   4597   H  HD11 . LEU B  2 82  ? 36.410  46.713  10.059  1.00 0.00 ?  136 LEU B HD11 1  
ATOM   4598   H  HD12 . LEU B  2 82  ? 34.736  46.937  9.446   1.00 0.00 ?  136 LEU B HD12 1  
ATOM   4599   H  HD13 . LEU B  2 82  ? 36.095  47.354  8.367   1.00 0.00 ?  136 LEU B HD13 1  
ATOM   4600   H  HD21 . LEU B  2 82  ? 37.198  44.017  7.484   1.00 0.00 ?  136 LEU B HD21 1  
ATOM   4601   H  HD22 . LEU B  2 82  ? 38.060  44.807  8.972   1.00 0.00 ?  136 LEU B HD22 1  
ATOM   4602   H  HD23 . LEU B  2 82  ? 37.667  45.720  7.476   1.00 0.00 ?  136 LEU B HD23 1  
ATOM   4603   N  N    . TYR B  2 83  ? 32.462  43.596  8.840   1.00 0.00 ?  137 TYR B N    1  
ATOM   4604   C  CA   . TYR B  2 83  ? 31.435  43.806  7.842   1.00 0.00 ?  137 TYR B CA   1  
ATOM   4605   C  C    . TYR B  2 83  ? 30.105  44.170  8.368   1.00 0.00 ?  137 TYR B C    1  
ATOM   4606   O  O    . TYR B  2 83  ? 29.375  44.908  7.743   1.00 0.00 ?  137 TYR B O    1  
ATOM   4607   C  CB   . TYR B  2 83  ? 31.387  42.497  6.933   1.00 0.00 ?  137 TYR B CB   1  
ATOM   4608   C  CG   . TYR B  2 83  ? 30.577  42.777  5.722   1.00 0.00 ?  137 TYR B CG   1  
ATOM   4609   C  CD1  . TYR B  2 83  ? 31.006  43.556  4.607   1.00 0.00 ?  137 TYR B CD1  1  
ATOM   4610   C  CD2  . TYR B  2 83  ? 29.227  42.389  5.717   1.00 0.00 ?  137 TYR B CD2  1  
ATOM   4611   C  CE1  . TYR B  2 83  ? 30.219  43.838  3.509   1.00 0.00 ?  137 TYR B CE1  1  
ATOM   4612   C  CE2  . TYR B  2 83  ? 28.364  42.783  4.653   1.00 0.00 ?  137 TYR B CE2  1  
ATOM   4613   C  CZ   . TYR B  2 83  ? 28.867  43.413  3.526   1.00 0.00 ?  137 TYR B CZ   1  
ATOM   4614   O  OH   . TYR B  2 83  ? 28.125  43.373  2.325   1.00 0.00 ?  137 TYR B OH   1  
ATOM   4615   H  H    . TYR B  2 83  ? 32.547  42.697  9.263   1.00 0.00 ?  137 TYR B H    1  
ATOM   4616   H  HA   . TYR B  2 83  ? 31.813  44.644  7.274   1.00 0.00 ?  137 TYR B HA   1  
ATOM   4617   H  HB2  . TYR B  2 83  ? 32.461  42.313  6.717   1.00 0.00 ?  137 TYR B HB2  1  
ATOM   4618   H  HB3  . TYR B  2 83  ? 30.890  41.638  7.431   1.00 0.00 ?  137 TYR B HB3  1  
ATOM   4619   H  HD1  . TYR B  2 83  ? 32.018  43.932  4.622   1.00 0.00 ?  137 TYR B HD1  1  
ATOM   4620   H  HD2  . TYR B  2 83  ? 28.849  42.031  6.663   1.00 0.00 ?  137 TYR B HD2  1  
ATOM   4621   H  HE1  . TYR B  2 83  ? 30.681  44.362  2.685   1.00 0.00 ?  137 TYR B HE1  1  
ATOM   4622   H  HE2  . TYR B  2 83  ? 27.325  42.486  4.662   1.00 0.00 ?  137 TYR B HE2  1  
ATOM   4623   H  HH   . TYR B  2 83  ? 28.632  43.557  1.530   1.00 0.00 ?  137 TYR B HH   1  
ATOM   4624   N  N    . ARG B  2 84  ? 29.720  43.838  9.647   1.00 0.00 ?  138 ARG B N    1  
ATOM   4625   C  CA   . ARG B  2 84  ? 28.573  44.343  10.366  1.00 0.00 ?  138 ARG B CA   1  
ATOM   4626   C  C    . ARG B  2 84  ? 28.496  45.849  10.521  1.00 0.00 ?  138 ARG B C    1  
ATOM   4627   O  O    . ARG B  2 84  ? 27.441  46.490  10.430  1.00 0.00 ?  138 ARG B O    1  
ATOM   4628   C  CB   . ARG B  2 84  ? 28.558  43.801  11.780  1.00 0.00 ?  138 ARG B CB   1  
ATOM   4629   C  CG   . ARG B  2 84  ? 28.179  42.336  12.085  1.00 0.00 ?  138 ARG B CG   1  
ATOM   4630   C  CD   . ARG B  2 84  ? 28.251  41.977  13.539  1.00 0.00 ?  138 ARG B CD   1  
ATOM   4631   N  NE   . ARG B  2 84  ? 27.703  40.568  13.685  1.00 0.00 ?  138 ARG B NE   1  
ATOM   4632   C  CZ   . ARG B  2 84  ? 28.451  39.486  13.775  1.00 0.00 ?  138 ARG B CZ   1  
ATOM   4633   N  NH1  . ARG B  2 84  ? 28.095  38.367  13.199  1.00 0.00 1  138 ARG B NH1  1  
ATOM   4634   N  NH2  . ARG B  2 84  ? 29.549  39.482  14.521  1.00 0.00 ?  138 ARG B NH2  1  
ATOM   4635   H  H    . ARG B  2 84  ? 30.361  43.373  10.252  1.00 0.00 ?  138 ARG B H    1  
ATOM   4636   H  HA   . ARG B  2 84  ? 27.716  44.009  9.800   1.00 0.00 ?  138 ARG B HA   1  
ATOM   4637   H  HB2  . ARG B  2 84  ? 29.532  44.074  12.241  1.00 0.00 ?  138 ARG B HB2  1  
ATOM   4638   H  HB3  . ARG B  2 84  ? 27.840  44.378  12.400  1.00 0.00 ?  138 ARG B HB3  1  
ATOM   4639   H  HG2  . ARG B  2 84  ? 27.154  42.133  11.709  1.00 0.00 ?  138 ARG B HG2  1  
ATOM   4640   H  HG3  . ARG B  2 84  ? 28.869  41.732  11.457  1.00 0.00 ?  138 ARG B HG3  1  
ATOM   4641   H  HD2  . ARG B  2 84  ? 29.316  42.100  13.829  1.00 0.00 ?  138 ARG B HD2  1  
ATOM   4642   H  HD3  . ARG B  2 84  ? 27.650  42.712  14.117  1.00 0.00 ?  138 ARG B HD3  1  
ATOM   4643   H  HE   . ARG B  2 84  ? 26.894  40.343  13.142  1.00 0.00 ?  138 ARG B HE   1  
ATOM   4644   H  HH11 . ARG B  2 84  ? 27.205  38.379  12.743  1.00 0.00 ?  138 ARG B HH11 1  
ATOM   4645   H  HH12 . ARG B  2 84  ? 28.600  37.504  13.234  1.00 0.00 ?  138 ARG B HH12 1  
ATOM   4646   H  HH21 . ARG B  2 84  ? 29.563  40.296  15.102  1.00 0.00 ?  138 ARG B HH21 1  
ATOM   4647   H  HH22 . ARG B  2 84  ? 29.951  38.619  14.826  1.00 0.00 ?  138 ARG B HH22 1  
ATOM   4648   N  N    . GLN B  2 85  ? 29.647  46.430  10.800  1.00 0.00 ?  139 GLN B N    1  
ATOM   4649   C  CA   . GLN B  2 85  ? 29.815  47.854  10.766  1.00 0.00 ?  139 GLN B CA   1  
ATOM   4650   C  C    . GLN B  2 85  ? 29.419  48.617  9.499   1.00 0.00 ?  139 GLN B C    1  
ATOM   4651   O  O    . GLN B  2 85  ? 28.872  49.686  9.615   1.00 0.00 ?  139 GLN B O    1  
ATOM   4652   C  CB   . GLN B  2 85  ? 31.276  48.293  11.150  1.00 0.00 ?  139 GLN B CB   1  
ATOM   4653   C  CG   . GLN B  2 85  ? 31.867  47.530  12.447  1.00 0.00 ?  139 GLN B CG   1  
ATOM   4654   C  CD   . GLN B  2 85  ? 31.207  48.043  13.750  1.00 0.00 ?  139 GLN B CD   1  
ATOM   4655   O  OE1  . GLN B  2 85  ? 31.157  49.260  13.998  1.00 0.00 ?  139 GLN B OE1  1  
ATOM   4656   N  NE2  . GLN B  2 85  ? 30.738  47.093  14.596  1.00 0.00 ?  139 GLN B NE2  1  
ATOM   4657   H  H    . GLN B  2 85  ? 30.416  45.891  11.136  1.00 0.00 ?  139 GLN B H    1  
ATOM   4658   H  HA   . GLN B  2 85  ? 29.158  48.123  11.580  1.00 0.00 ?  139 GLN B HA   1  
ATOM   4659   H  HB2  . GLN B  2 85  ? 32.032  48.180  10.343  1.00 0.00 ?  139 GLN B HB2  1  
ATOM   4660   H  HB3  . GLN B  2 85  ? 31.359  49.390  11.304  1.00 0.00 ?  139 GLN B HB3  1  
ATOM   4661   H  HG2  . GLN B  2 85  ? 31.836  46.426  12.324  1.00 0.00 ?  139 GLN B HG2  1  
ATOM   4662   H  HG3  . GLN B  2 85  ? 32.940  47.744  12.640  1.00 0.00 ?  139 GLN B HG3  1  
ATOM   4663   H  HE21 . GLN B  2 85  ? 30.308  47.367  15.457  1.00 0.00 ?  139 GLN B HE21 1  
ATOM   4664   H  HE22 . GLN B  2 85  ? 30.737  46.111  14.409  1.00 0.00 ?  139 GLN B HE22 1  
ATOM   4665   N  N    . LYS B  2 86  ? 29.754  48.069  8.305   1.00 0.00 ?  140 LYS B N    1  
ATOM   4666   C  CA   . LYS B  2 86  ? 29.267  48.652  7.024   1.00 0.00 ?  140 LYS B CA   1  
ATOM   4667   C  C    . LYS B  2 86  ? 27.741  48.528  6.883   1.00 0.00 ?  140 LYS B C    1  
ATOM   4668   O  O    . LYS B  2 86  ? 27.120  49.565  6.560   1.00 0.00 ?  140 LYS B O    1  
ATOM   4669   C  CB   . LYS B  2 86  ? 29.887  47.859  5.793   1.00 0.00 ?  140 LYS B CB   1  
ATOM   4670   C  CG   . LYS B  2 86  ? 31.398  47.582  5.875   1.00 0.00 ?  140 LYS B CG   1  
ATOM   4671   C  CD   . LYS B  2 86  ? 32.269  48.808  6.212   1.00 0.00 ?  140 LYS B CD   1  
ATOM   4672   C  CE   . LYS B  2 86  ? 33.761  48.704  5.792   1.00 0.00 ?  140 LYS B CE   1  
ATOM   4673   N  NZ   . LYS B  2 86  ? 34.508  49.797  6.455   1.00 0.00 1  140 LYS B NZ   1  
ATOM   4674   H  H    . LYS B  2 86  ? 30.209  47.182  8.339   1.00 0.00 ?  140 LYS B H    1  
ATOM   4675   H  HA   . LYS B  2 86  ? 29.580  49.686  7.022   1.00 0.00 ?  140 LYS B HA   1  
ATOM   4676   H  HB2  . LYS B  2 86  ? 29.395  46.905  5.508   1.00 0.00 ?  140 LYS B HB2  1  
ATOM   4677   H  HB3  . LYS B  2 86  ? 29.668  48.360  4.825   1.00 0.00 ?  140 LYS B HB3  1  
ATOM   4678   H  HG2  . LYS B  2 86  ? 31.611  46.839  6.673   1.00 0.00 ?  140 LYS B HG2  1  
ATOM   4679   H  HG3  . LYS B  2 86  ? 31.670  47.025  4.953   1.00 0.00 ?  140 LYS B HG3  1  
ATOM   4680   H  HD2  . LYS B  2 86  ? 31.923  49.792  5.828   1.00 0.00 ?  140 LYS B HD2  1  
ATOM   4681   H  HD3  . LYS B  2 86  ? 32.288  48.799  7.323   1.00 0.00 ?  140 LYS B HD3  1  
ATOM   4682   H  HE2  . LYS B  2 86  ? 34.225  47.768  6.168   1.00 0.00 ?  140 LYS B HE2  1  
ATOM   4683   H  HE3  . LYS B  2 86  ? 33.957  48.880  4.712   1.00 0.00 ?  140 LYS B HE3  1  
ATOM   4684   H  HZ1  . LYS B  2 86  ? 34.376  49.748  7.486   1.00 0.00 ?  140 LYS B HZ1  1  
ATOM   4685   H  HZ2  . LYS B  2 86  ? 34.066  50.684  6.140   1.00 0.00 ?  140 LYS B HZ2  1  
ATOM   4686   H  HZ3  . LYS B  2 86  ? 35.507  49.873  6.179   1.00 0.00 ?  140 LYS B HZ3  1  
ATOM   4687   N  N    . VAL B  2 87  ? 27.148  47.279  7.145   1.00 0.00 ?  141 VAL B N    1  
ATOM   4688   C  CA   . VAL B  2 87  ? 25.718  47.052  7.166   1.00 0.00 ?  141 VAL B CA   1  
ATOM   4689   C  C    . VAL B  2 87  ? 25.048  47.984  8.148   1.00 0.00 ?  141 VAL B C    1  
ATOM   4690   O  O    . VAL B  2 87  ? 23.948  48.396  7.821   1.00 0.00 ?  141 VAL B O    1  
ATOM   4691   C  CB   . VAL B  2 87  ? 25.617  45.583  7.535   1.00 0.00 ?  141 VAL B CB   1  
ATOM   4692   C  CG1  . VAL B  2 87  ? 24.128  45.303  7.904   1.00 0.00 ?  141 VAL B CG1  1  
ATOM   4693   C  CG2  . VAL B  2 87  ? 26.021  44.691  6.321   1.00 0.00 ?  141 VAL B CG2  1  
ATOM   4694   H  H    . VAL B  2 87  ? 27.734  46.476  7.220   1.00 0.00 ?  141 VAL B H    1  
ATOM   4695   H  HA   . VAL B  2 87  ? 25.340  47.280  6.181   1.00 0.00 ?  141 VAL B HA   1  
ATOM   4696   H  HB   . VAL B  2 87  ? 26.269  45.227  8.361   1.00 0.00 ?  141 VAL B HB   1  
ATOM   4697   H  HG11 . VAL B  2 87  ? 23.960  45.584  8.965   1.00 0.00 ?  141 VAL B HG11 1  
ATOM   4698   H  HG12 . VAL B  2 87  ? 23.945  44.229  7.685   1.00 0.00 ?  141 VAL B HG12 1  
ATOM   4699   H  HG13 . VAL B  2 87  ? 23.467  45.818  7.174   1.00 0.00 ?  141 VAL B HG13 1  
ATOM   4700   H  HG21 . VAL B  2 87  ? 26.326  43.668  6.629   1.00 0.00 ?  141 VAL B HG21 1  
ATOM   4701   H  HG22 . VAL B  2 87  ? 26.920  45.010  5.751   1.00 0.00 ?  141 VAL B HG22 1  
ATOM   4702   H  HG23 . VAL B  2 87  ? 25.188  44.673  5.587   1.00 0.00 ?  141 VAL B HG23 1  
ATOM   4703   N  N    . GLU B  2 88  ? 25.605  48.337  9.326   1.00 0.00 ?  142 GLU B N    1  
ATOM   4704   C  CA   . GLU B  2 88  ? 24.786  49.210  10.246  1.00 0.00 ?  142 GLU B CA   1  
ATOM   4705   C  C    . GLU B  2 88  ? 24.192  50.586  9.792   1.00 0.00 ?  142 GLU B C    1  
ATOM   4706   O  O    . GLU B  2 88  ? 22.961  50.822  9.912   1.00 0.00 ?  142 GLU B O    1  
ATOM   4707   C  CB   . GLU B  2 88  ? 25.498  49.433  11.616  1.00 0.00 ?  142 GLU B CB   1  
ATOM   4708   C  CG   . GLU B  2 88  ? 24.723  50.249  12.671  1.00 0.00 ?  142 GLU B CG   1  
ATOM   4709   C  CD   . GLU B  2 88  ? 25.669  50.242  13.912  1.00 0.00 ?  142 GLU B CD   1  
ATOM   4710   O  OE1  . GLU B  2 88  ? 26.422  51.180  14.223  1.00 0.00 ?  142 GLU B OE1  1  
ATOM   4711   O  OE2  . GLU B  2 88  ? 25.619  49.218  14.680  1.00 0.00 -1 142 GLU B OE2  1  
ATOM   4712   H  H    . GLU B  2 88  ? 26.444  47.918  9.665   1.00 0.00 ?  142 GLU B H    1  
ATOM   4713   H  HA   . GLU B  2 88  ? 23.929  48.566  10.374  1.00 0.00 ?  142 GLU B HA   1  
ATOM   4714   H  HB2  . GLU B  2 88  ? 25.870  48.462  12.009  1.00 0.00 ?  142 GLU B HB2  1  
ATOM   4715   H  HB3  . GLU B  2 88  ? 26.335  50.136  11.419  1.00 0.00 ?  142 GLU B HB3  1  
ATOM   4716   H  HG2  . GLU B  2 88  ? 24.472  51.298  12.405  1.00 0.00 ?  142 GLU B HG2  1  
ATOM   4717   H  HG3  . GLU B  2 88  ? 23.867  49.594  12.940  1.00 0.00 ?  142 GLU B HG3  1  
ATOM   4718   N  N    . PRO B  2 89  ? 24.891  51.532  9.241   1.00 0.00 ?  143 PRO B N    1  
ATOM   4719   C  CA   . PRO B  2 89  ? 24.298  52.781  8.705   1.00 0.00 ?  143 PRO B CA   1  
ATOM   4720   C  C    . PRO B  2 89  ? 23.725  52.599  7.373   1.00 0.00 ?  143 PRO B C    1  
ATOM   4721   O  O    . PRO B  2 89  ? 22.645  53.142  7.160   1.00 0.00 ?  143 PRO B O    1  
ATOM   4722   C  CB   . PRO B  2 89  ? 25.492  53.737  8.658   1.00 0.00 ?  143 PRO B CB   1  
ATOM   4723   C  CG   . PRO B  2 89  ? 26.664  52.888  8.334   1.00 0.00 ?  143 PRO B CG   1  
ATOM   4724   C  CD   . PRO B  2 89  ? 26.364  51.589  9.153   1.00 0.00 ?  143 PRO B CD   1  
ATOM   4725   H  HA   . PRO B  2 89  ? 23.463  53.100  9.311   1.00 0.00 ?  143 PRO B HA   1  
ATOM   4726   H  HB2  . PRO B  2 89  ? 25.279  54.590  7.978   1.00 0.00 ?  143 PRO B HB2  1  
ATOM   4727   H  HB3  . PRO B  2 89  ? 25.620  54.160  9.677   1.00 0.00 ?  143 PRO B HB3  1  
ATOM   4728   H  HG2  . PRO B  2 89  ? 26.698  52.564  7.272   1.00 0.00 ?  143 PRO B HG2  1  
ATOM   4729   H  HG3  . PRO B  2 89  ? 27.584  53.379  8.717   1.00 0.00 ?  143 PRO B HG3  1  
ATOM   4730   H  HD2  . PRO B  2 89  ? 26.773  50.687  8.649   1.00 0.00 ?  143 PRO B HD2  1  
ATOM   4731   H  HD3  . PRO B  2 89  ? 26.732  51.767  10.186  1.00 0.00 ?  143 PRO B HD3  1  
ATOM   4732   N  N    . LEU B  2 90  ? 24.254  51.731  6.463   1.00 0.00 ?  144 LEU B N    1  
ATOM   4733   C  CA   . LEU B  2 90  ? 23.789  51.549  5.125   1.00 0.00 ?  144 LEU B CA   1  
ATOM   4734   C  C    . LEU B  2 90  ? 22.443  50.800  4.938   1.00 0.00 ?  144 LEU B C    1  
ATOM   4735   O  O    . LEU B  2 90  ? 21.722  51.089  3.986   1.00 0.00 ?  144 LEU B O    1  
ATOM   4736   C  CB   . LEU B  2 90  ? 24.838  50.767  4.245   1.00 0.00 ?  144 LEU B CB   1  
ATOM   4737   C  CG   . LEU B  2 90  ? 24.597  50.666  2.715   1.00 0.00 ?  144 LEU B CG   1  
ATOM   4738   C  CD1  . LEU B  2 90  ? 24.476  52.099  2.174   1.00 0.00 ?  144 LEU B CD1  1  
ATOM   4739   C  CD2  . LEU B  2 90  ? 25.845  50.008  2.041   1.00 0.00 ?  144 LEU B CD2  1  
ATOM   4740   H  H    . LEU B  2 90  ? 25.180  51.402  6.629   1.00 0.00 ?  144 LEU B H    1  
ATOM   4741   H  HA   . LEU B  2 90  ? 23.639  52.523  4.683   1.00 0.00 ?  144 LEU B HA   1  
ATOM   4742   H  HB2  . LEU B  2 90  ? 25.891  51.116  4.297   1.00 0.00 ?  144 LEU B HB2  1  
ATOM   4743   H  HB3  . LEU B  2 90  ? 24.839  49.731  4.646   1.00 0.00 ?  144 LEU B HB3  1  
ATOM   4744   H  HG   . LEU B  2 90  ? 23.705  50.069  2.427   1.00 0.00 ?  144 LEU B HG   1  
ATOM   4745   H  HD11 . LEU B  2 90  ? 24.611  52.038  1.073   1.00 0.00 ?  144 LEU B HD11 1  
ATOM   4746   H  HD12 . LEU B  2 90  ? 25.265  52.757  2.597   1.00 0.00 ?  144 LEU B HD12 1  
ATOM   4747   H  HD13 . LEU B  2 90  ? 23.458  52.457  2.436   1.00 0.00 ?  144 LEU B HD13 1  
ATOM   4748   H  HD21 . LEU B  2 90  ? 25.847  50.058  0.932   1.00 0.00 ?  144 LEU B HD21 1  
ATOM   4749   H  HD22 . LEU B  2 90  ? 25.944  48.953  2.375   1.00 0.00 ?  144 LEU B HD22 1  
ATOM   4750   H  HD23 . LEU B  2 90  ? 26.729  50.586  2.388   1.00 0.00 ?  144 LEU B HD23 1  
ATOM   4751   N  N    . ARG B  2 91  ? 22.053  49.889  5.887   1.00 0.00 ?  145 ARG B N    1  
ATOM   4752   C  CA   . ARG B  2 91  ? 20.767  49.288  5.745   1.00 0.00 ?  145 ARG B CA   1  
ATOM   4753   C  C    . ARG B  2 91  ? 19.639  49.872  6.624   1.00 0.00 ?  145 ARG B C    1  
ATOM   4754   O  O    . ARG B  2 91  ? 18.482  49.394  6.713   1.00 0.00 ?  145 ARG B O    1  
ATOM   4755   C  CB   . ARG B  2 91  ? 20.890  47.819  6.000   1.00 0.00 ?  145 ARG B CB   1  
ATOM   4756   C  CG   . ARG B  2 91  ? 21.704  47.173  4.806   1.00 0.00 ?  145 ARG B CG   1  
ATOM   4757   C  CD   . ARG B  2 91  ? 20.976  46.984  3.501   1.00 0.00 ?  145 ARG B CD   1  
ATOM   4758   N  NE   . ARG B  2 91  ? 20.869  48.148  2.568   1.00 0.00 ?  145 ARG B NE   1  
ATOM   4759   C  CZ   . ARG B  2 91  ? 21.696  48.354  1.570   1.00 0.00 ?  145 ARG B CZ   1  
ATOM   4760   N  NH1  . ARG B  2 91  ? 21.506  49.196  0.583   1.00 0.00 1  145 ARG B NH1  1  
ATOM   4761   N  NH2  . ARG B  2 91  ? 22.734  47.595  1.477   1.00 0.00 ?  145 ARG B NH2  1  
ATOM   4762   H  H    . ARG B  2 91  ? 22.583  49.633  6.692   1.00 0.00 ?  145 ARG B H    1  
ATOM   4763   H  HA   . ARG B  2 91  ? 20.335  49.523  4.783   1.00 0.00 ?  145 ARG B HA   1  
ATOM   4764   H  HB2  . ARG B  2 91  ? 21.480  47.680  6.931   1.00 0.00 ?  145 ARG B HB2  1  
ATOM   4765   H  HB3  . ARG B  2 91  ? 19.860  47.414  6.093   1.00 0.00 ?  145 ARG B HB3  1  
ATOM   4766   H  HG2  . ARG B  2 91  ? 22.636  47.753  4.633   1.00 0.00 ?  145 ARG B HG2  1  
ATOM   4767   H  HG3  . ARG B  2 91  ? 22.030  46.167  5.147   1.00 0.00 ?  145 ARG B HG3  1  
ATOM   4768   H  HD2  . ARG B  2 91  ? 21.255  46.054  2.961   1.00 0.00 ?  145 ARG B HD2  1  
ATOM   4769   H  HD3  . ARG B  2 91  ? 19.996  46.541  3.783   1.00 0.00 ?  145 ARG B HD3  1  
ATOM   4770   H  HE   . ARG B  2 91  ? 20.077  48.758  2.605   1.00 0.00 ?  145 ARG B HE   1  
ATOM   4771   H  HH11 . ARG B  2 91  ? 22.316  49.249  -0.001  1.00 0.00 ?  145 ARG B HH11 1  
ATOM   4772   H  HH12 . ARG B  2 91  ? 20.710  49.802  0.587   1.00 0.00 ?  145 ARG B HH12 1  
ATOM   4773   H  HH21 . ARG B  2 91  ? 22.886  46.890  2.170   1.00 0.00 ?  145 ARG B HH21 1  
ATOM   4774   H  HH22 . ARG B  2 91  ? 23.331  47.726  0.685   1.00 0.00 ?  145 ARG B HH22 1  
ATOM   4775   N  N    . ALA B  2 92  ? 19.991  51.013  7.299   1.00 0.00 ?  146 ALA B N    1  
ATOM   4776   C  CA   . ALA B  2 92  ? 19.045  51.891  8.043   1.00 0.00 ?  146 ALA B CA   1  
ATOM   4777   C  C    . ALA B  2 92  ? 17.906  52.376  7.063   1.00 0.00 ?  146 ALA B C    1  
ATOM   4778   O  O    . ALA B  2 92  ? 16.698  52.217  7.394   1.00 0.00 ?  146 ALA B O    1  
ATOM   4779   C  CB   . ALA B  2 92  ? 19.837  53.068  8.692   1.00 0.00 ?  146 ALA B CB   1  
ATOM   4780   H  H    . ALA B  2 92  ? 20.925  51.360  7.314   1.00 0.00 ?  146 ALA B H    1  
ATOM   4781   H  HA   . ALA B  2 92  ? 18.677  51.265  8.843   1.00 0.00 ?  146 ALA B HA   1  
ATOM   4782   H  HB1  . ALA B  2 92  ? 19.300  53.402  9.605   1.00 0.00 ?  146 ALA B HB1  1  
ATOM   4783   H  HB2  . ALA B  2 92  ? 20.216  53.852  8.003   1.00 0.00 ?  146 ALA B HB2  1  
ATOM   4784   H  HB3  . ALA B  2 92  ? 20.741  52.767  9.264   1.00 0.00 ?  146 ALA B HB3  1  
ATOM   4785   N  N    . GLU B  2 93  ? 18.239  52.925  5.855   1.00 0.00 ?  147 GLU B N    1  
ATOM   4786   C  CA   . GLU B  2 93  ? 17.155  53.458  4.986   1.00 0.00 ?  147 GLU B CA   1  
ATOM   4787   C  C    . GLU B  2 93  ? 16.114  52.385  4.512   1.00 0.00 ?  147 GLU B C    1  
ATOM   4788   O  O    . GLU B  2 93  ? 14.916  52.598  4.572   1.00 0.00 ?  147 GLU B O    1  
ATOM   4789   C  CB   . GLU B  2 93  ? 17.798  54.317  3.805   1.00 0.00 ?  147 GLU B CB   1  
ATOM   4790   C  CG   . GLU B  2 93  ? 16.981  54.559  2.519   1.00 0.00 ?  147 GLU B CG   1  
ATOM   4791   C  CD   . GLU B  2 93  ? 17.679  55.646  1.638   1.00 0.00 ?  147 GLU B CD   1  
ATOM   4792   O  OE1  . GLU B  2 93  ? 17.849  55.405  0.385   1.00 0.00 ?  147 GLU B OE1  1  
ATOM   4793   O  OE2  . GLU B  2 93  ? 17.842  56.796  2.076   1.00 0.00 -1 147 GLU B OE2  1  
ATOM   4794   H  H    . GLU B  2 93  ? 19.176  53.027  5.531   1.00 0.00 ?  147 GLU B H    1  
ATOM   4795   H  HA   . GLU B  2 93  ? 16.640  54.148  5.638   1.00 0.00 ?  147 GLU B HA   1  
ATOM   4796   H  HB2  . GLU B  2 93  ? 18.136  55.275  4.254   1.00 0.00 ?  147 GLU B HB2  1  
ATOM   4797   H  HB3  . GLU B  2 93  ? 18.758  53.837  3.518   1.00 0.00 ?  147 GLU B HB3  1  
ATOM   4798   H  HG2  . GLU B  2 93  ? 16.834  53.669  1.871   1.00 0.00 ?  147 GLU B HG2  1  
ATOM   4799   H  HG3  . GLU B  2 93  ? 15.946  54.897  2.741   1.00 0.00 ?  147 GLU B HG3  1  
ATOM   4800   N  N    . LEU B  2 94  ? 16.524  51.172  4.001   1.00 0.00 ?  148 LEU B N    1  
ATOM   4801   C  CA   . LEU B  2 94  ? 15.630  50.119  3.727   1.00 0.00 ?  148 LEU B CA   1  
ATOM   4802   C  C    . LEU B  2 94  ? 14.955  49.487  4.922   1.00 0.00 ?  148 LEU B C    1  
ATOM   4803   O  O    . LEU B  2 94  ? 13.751  49.161  4.897   1.00 0.00 ?  148 LEU B O    1  
ATOM   4804   C  CB   . LEU B  2 94  ? 16.460  49.073  2.899   1.00 0.00 ?  148 LEU B CB   1  
ATOM   4805   C  CG   . LEU B  2 94  ? 15.630  47.918  2.348   1.00 0.00 ?  148 LEU B CG   1  
ATOM   4806   C  CD1  . LEU B  2 94  ? 14.310  48.381  1.717   1.00 0.00 ?  148 LEU B CD1  1  
ATOM   4807   C  CD2  . LEU B  2 94  ? 16.475  47.217  1.329   1.00 0.00 ?  148 LEU B CD2  1  
ATOM   4808   H  H    . LEU B  2 94  ? 17.472  51.026  3.728   1.00 0.00 ?  148 LEU B H    1  
ATOM   4809   H  HA   . LEU B  2 94  ? 14.848  50.487  3.080   1.00 0.00 ?  148 LEU B HA   1  
ATOM   4810   H  HB2  . LEU B  2 94  ? 16.837  49.730  2.086   1.00 0.00 ?  148 LEU B HB2  1  
ATOM   4811   H  HB3  . LEU B  2 94  ? 17.311  48.602  3.436   1.00 0.00 ?  148 LEU B HB3  1  
ATOM   4812   H  HG   . LEU B  2 94  ? 15.378  47.155  3.115   1.00 0.00 ?  148 LEU B HG   1  
ATOM   4813   H  HD11 . LEU B  2 94  ? 14.571  49.205  1.019   1.00 0.00 ?  148 LEU B HD11 1  
ATOM   4814   H  HD12 . LEU B  2 94  ? 13.567  48.683  2.486   1.00 0.00 ?  148 LEU B HD12 1  
ATOM   4815   H  HD13 . LEU B  2 94  ? 13.831  47.574  1.123   1.00 0.00 ?  148 LEU B HD13 1  
ATOM   4816   H  HD21 . LEU B  2 94  ? 17.548  47.152  1.612   1.00 0.00 ?  148 LEU B HD21 1  
ATOM   4817   H  HD22 . LEU B  2 94  ? 16.486  47.708  0.332   1.00 0.00 ?  148 LEU B HD22 1  
ATOM   4818   H  HD23 . LEU B  2 94  ? 16.001  46.249  1.058   1.00 0.00 ?  148 LEU B HD23 1  
ATOM   4819   N  N    . GLN B  2 95  ? 15.602  49.412  6.146   1.00 0.00 ?  149 GLN B N    1  
ATOM   4820   C  CA   . GLN B  2 95  ? 14.905  48.854  7.336   1.00 0.00 ?  149 GLN B CA   1  
ATOM   4821   C  C    . GLN B  2 95  ? 13.764  49.715  7.832   1.00 0.00 ?  149 GLN B C    1  
ATOM   4822   O  O    . GLN B  2 95  ? 12.683  49.269  8.202   1.00 0.00 ?  149 GLN B O    1  
ATOM   4823   C  CB   . GLN B  2 95  ? 15.981  48.506  8.388   1.00 0.00 ?  149 GLN B CB   1  
ATOM   4824   C  CG   . GLN B  2 95  ? 15.304  48.291  9.742   1.00 0.00 ?  149 GLN B CG   1  
ATOM   4825   C  CD   . GLN B  2 95  ? 16.339  47.503  10.657  1.00 0.00 ?  149 GLN B CD   1  
ATOM   4826   O  OE1  . GLN B  2 95  ? 16.639  46.322  10.495  1.00 0.00 ?  149 GLN B OE1  1  
ATOM   4827   N  NE2  . GLN B  2 95  ? 16.916  48.292  11.593  1.00 0.00 ?  149 GLN B NE2  1  
ATOM   4828   H  H    . GLN B  2 95  ? 16.517  49.778  6.301   1.00 0.00 ?  149 GLN B H    1  
ATOM   4829   H  HA   . GLN B  2 95  ? 14.358  47.984  7.005   1.00 0.00 ?  149 GLN B HA   1  
ATOM   4830   H  HB2  . GLN B  2 95  ? 16.587  47.637  8.053   1.00 0.00 ?  149 GLN B HB2  1  
ATOM   4831   H  HB3  . GLN B  2 95  ? 16.769  49.288  8.423   1.00 0.00 ?  149 GLN B HB3  1  
ATOM   4832   H  HG2  . GLN B  2 95  ? 15.195  49.334  10.111  1.00 0.00 ?  149 GLN B HG2  1  
ATOM   4833   H  HG3  . GLN B  2 95  ? 14.349  47.737  9.613   1.00 0.00 ?  149 GLN B HG3  1  
ATOM   4834   H  HE21 . GLN B  2 95  ? 16.546  49.185  11.851  1.00 0.00 ?  149 GLN B HE21 1  
ATOM   4835   H  HE22 . GLN B  2 95  ? 17.626  47.921  12.191  1.00 0.00 ?  149 GLN B HE22 1  
ATOM   4836   N  N    . GLU B  2 96  ? 14.024  51.040  7.780   1.00 0.00 ?  150 GLU B N    1  
ATOM   4837   C  CA   . GLU B  2 96  ? 13.038  52.018  8.010   1.00 0.00 ?  150 GLU B CA   1  
ATOM   4838   C  C    . GLU B  2 96  ? 11.878  51.916  6.967   1.00 0.00 ?  150 GLU B C    1  
ATOM   4839   O  O    . GLU B  2 96  ? 10.683  51.890  7.249   1.00 0.00 ?  150 GLU B O    1  
ATOM   4840   C  CB   . GLU B  2 96  ? 13.633  53.378  8.186   1.00 0.00 ?  150 GLU B CB   1  
ATOM   4841   C  CG   . GLU B  2 96  ? 12.535  54.501  8.263   1.00 0.00 ?  150 GLU B CG   1  
ATOM   4842   C  CD   . GLU B  2 96  ? 13.085  55.877  8.809   1.00 0.00 ?  150 GLU B CD   1  
ATOM   4843   O  OE1  . GLU B  2 96  ? 13.027  56.897  8.052   1.00 0.00 ?  150 GLU B OE1  1  
ATOM   4844   O  OE2  . GLU B  2 96  ? 13.431  55.911  10.070  1.00 0.00 -1 150 GLU B OE2  1  
ATOM   4845   H  H    . GLU B  2 96  ? 14.946  51.322  7.527   1.00 0.00 ?  150 GLU B H    1  
ATOM   4846   H  HA   . GLU B  2 96  ? 12.642  51.854  9.001   1.00 0.00 ?  150 GLU B HA   1  
ATOM   4847   H  HB2  . GLU B  2 96  ? 14.274  53.415  9.093   1.00 0.00 ?  150 GLU B HB2  1  
ATOM   4848   H  HB3  . GLU B  2 96  ? 14.348  53.678  7.391   1.00 0.00 ?  150 GLU B HB3  1  
ATOM   4849   H  HG2  . GLU B  2 96  ? 12.051  54.705  7.284   1.00 0.00 ?  150 GLU B HG2  1  
ATOM   4850   H  HG3  . GLU B  2 96  ? 11.720  54.225  8.966   1.00 0.00 ?  150 GLU B HG3  1  
ATOM   4851   N  N    . GLY B  2 97  ? 12.244  51.944  5.668   1.00 0.00 ?  151 GLY B N    1  
ATOM   4852   C  CA   . GLY B  2 97  ? 11.197  52.079  4.602   1.00 0.00 ?  151 GLY B CA   1  
ATOM   4853   C  C    . GLY B  2 97  ? 10.479  50.858  4.527   1.00 0.00 ?  151 GLY B C    1  
ATOM   4854   O  O    . GLY B  2 97  ? 9.340   50.900  4.075   1.00 0.00 ?  151 GLY B O    1  
ATOM   4855   H  H    . GLY B  2 97  ? 13.204  52.038  5.417   1.00 0.00 ?  151 GLY B H    1  
ATOM   4856   H  HA2  . GLY B  2 97  ? 10.546  52.864  4.957   1.00 0.00 ?  151 GLY B HA2  1  
ATOM   4857   H  HA3  . GLY B  2 97  ? 11.757  52.238  3.692   1.00 0.00 ?  151 GLY B HA3  1  
ATOM   4858   N  N    . ALA B  2 98  ? 11.037  49.652  4.813   1.00 0.00 ?  152 ALA B N    1  
ATOM   4859   C  CA   . ALA B  2 98  ? 10.311  48.416  4.790   1.00 0.00 ?  152 ALA B CA   1  
ATOM   4860   C  C    . ALA B  2 98  ? 9.143   48.307  5.788   1.00 0.00 ?  152 ALA B C    1  
ATOM   4861   O  O    . ALA B  2 98  ? 8.067   47.822  5.407   1.00 0.00 ?  152 ALA B O    1  
ATOM   4862   C  CB   . ALA B  2 98  ? 11.208  47.174  5.092   1.00 0.00 ?  152 ALA B CB   1  
ATOM   4863   H  H    . ALA B  2 98  ? 11.993  49.627  5.094   1.00 0.00 ?  152 ALA B H    1  
ATOM   4864   H  HA   . ALA B  2 98  ? 9.912   48.335  3.790   1.00 0.00 ?  152 ALA B HA   1  
ATOM   4865   H  HB1  . ALA B  2 98  ? 11.612  47.161  6.127   1.00 0.00 ?  152 ALA B HB1  1  
ATOM   4866   H  HB2  . ALA B  2 98  ? 12.109  47.365  4.471   1.00 0.00 ?  152 ALA B HB2  1  
ATOM   4867   H  HB3  . ALA B  2 98  ? 10.686  46.203  4.952   1.00 0.00 ?  152 ALA B HB3  1  
ATOM   4868   N  N    . ARG B  2 99  ? 9.401   48.663  7.059   1.00 0.00 ?  153 ARG B N    1  
ATOM   4869   C  CA   . ARG B  2 99  ? 8.505   48.561  8.155   1.00 0.00 ?  153 ARG B CA   1  
ATOM   4870   C  C    . ARG B  2 99  ? 7.510   49.704  8.024   1.00 0.00 ?  153 ARG B C    1  
ATOM   4871   O  O    . ARG B  2 99  ? 6.249   49.550  8.095   1.00 0.00 ?  153 ARG B O    1  
ATOM   4872   C  CB   . ARG B  2 99  ? 9.168   48.668  9.530   1.00 0.00 ?  153 ARG B CB   1  
ATOM   4873   C  CG   . ARG B  2 99  ? 9.587   50.100  10.042  1.00 0.00 ?  153 ARG B CG   1  
ATOM   4874   C  CD   . ARG B  2 99  ? 10.386  50.039  11.353  1.00 0.00 ?  153 ARG B CD   1  
ATOM   4875   N  NE   . ARG B  2 99  ? 10.238  51.406  11.920  1.00 0.00 ?  153 ARG B NE   1  
ATOM   4876   C  CZ   . ARG B  2 99  ? 11.184  52.345  11.885  1.00 0.00 ?  153 ARG B CZ   1  
ATOM   4877   N  NH1  . ARG B  2 99  ? 10.717  53.587  11.819  1.00 0.00 1  153 ARG B NH1  1  
ATOM   4878   N  NH2  . ARG B  2 99  ? 12.480  52.101  12.002  1.00 0.00 ?  153 ARG B NH2  1  
ATOM   4879   H  H    . ARG B  2 99  ? 10.314  48.942  7.347   1.00 0.00 ?  153 ARG B H    1  
ATOM   4880   H  HA   . ARG B  2 99  ? 8.014   47.601  8.216   1.00 0.00 ?  153 ARG B HA   1  
ATOM   4881   H  HB2  . ARG B  2 99  ? 8.424   48.360  10.295  1.00 0.00 ?  153 ARG B HB2  1  
ATOM   4882   H  HB3  . ARG B  2 99  ? 10.035  47.975  9.580   1.00 0.00 ?  153 ARG B HB3  1  
ATOM   4883   H  HG2  . ARG B  2 99  ? 10.221  50.621  9.293   1.00 0.00 ?  153 ARG B HG2  1  
ATOM   4884   H  HG3  . ARG B  2 99  ? 8.665   50.718  10.088  1.00 0.00 ?  153 ARG B HG3  1  
ATOM   4885   H  HD2  . ARG B  2 99  ? 9.923   49.299  12.040  1.00 0.00 ?  153 ARG B HD2  1  
ATOM   4886   H  HD3  . ARG B  2 99  ? 11.412  49.687  11.112  1.00 0.00 ?  153 ARG B HD3  1  
ATOM   4887   H  HE   . ARG B  2 99  ? 9.320   51.751  12.116  1.00 0.00 ?  153 ARG B HE   1  
ATOM   4888   H  HH11 . ARG B  2 99  ? 11.406  54.283  12.019  1.00 0.00 ?  153 ARG B HH11 1  
ATOM   4889   H  HH12 . ARG B  2 99  ? 9.728   53.736  11.849  1.00 0.00 ?  153 ARG B HH12 1  
ATOM   4890   H  HH21 . ARG B  2 99  ? 12.775  51.207  12.339  1.00 0.00 ?  153 ARG B HH21 1  
ATOM   4891   H  HH22 . ARG B  2 99  ? 13.118  52.869  11.935  1.00 0.00 ?  153 ARG B HH22 1  
ATOM   4892   N  N    . GLN B  2 100 ? 7.978   50.977  7.663   1.00 0.00 ?  154 GLN B N    1  
ATOM   4893   C  CA   . GLN B  2 100 ? 7.089   52.075  7.231   1.00 0.00 ?  154 GLN B CA   1  
ATOM   4894   C  C    . GLN B  2 100 ? 6.138   51.732  6.133   1.00 0.00 ?  154 GLN B C    1  
ATOM   4895   O  O    . GLN B  2 100 ? 4.961   51.997  6.212   1.00 0.00 ?  154 GLN B O    1  
ATOM   4896   C  CB   . GLN B  2 100 ? 7.950   53.289  6.790   1.00 0.00 ?  154 GLN B CB   1  
ATOM   4897   C  CG   . GLN B  2 100 ? 7.119   54.663  6.518   1.00 0.00 ?  154 GLN B CG   1  
ATOM   4898   C  CD   . GLN B  2 100 ? 6.133   55.117  7.576   1.00 0.00 ?  154 GLN B CD   1  
ATOM   4899   O  OE1  . GLN B  2 100 ? 6.373   55.199  8.791   1.00 0.00 ?  154 GLN B OE1  1  
ATOM   4900   N  NE2  . GLN B  2 100 ? 4.931   55.424  7.113   1.00 0.00 ?  154 GLN B NE2  1  
ATOM   4901   H  H    . GLN B  2 100 ? 8.911   51.162  7.362   1.00 0.00 ?  154 GLN B H    1  
ATOM   4902   H  HA   . GLN B  2 100 ? 6.430   52.332  8.048   1.00 0.00 ?  154 GLN B HA   1  
ATOM   4903   H  HB2  . GLN B  2 100 ? 8.596   53.499  7.669   1.00 0.00 ?  154 GLN B HB2  1  
ATOM   4904   H  HB3  . GLN B  2 100 ? 8.639   53.155  5.930   1.00 0.00 ?  154 GLN B HB3  1  
ATOM   4905   H  HG2  . GLN B  2 100 ? 7.932   55.413  6.414   1.00 0.00 ?  154 GLN B HG2  1  
ATOM   4906   H  HG3  . GLN B  2 100 ? 6.618   54.592  5.528   1.00 0.00 ?  154 GLN B HG3  1  
ATOM   4907   H  HE21 . GLN B  2 100 ? 4.251   55.779  7.755   1.00 0.00 ?  154 GLN B HE21 1  
ATOM   4908   H  HE22 . GLN B  2 100 ? 4.702   55.233  6.159   1.00 0.00 ?  154 GLN B HE22 1  
ATOM   4909   N  N    . LYS B  2 101 ? 6.622   51.230  4.964   1.00 0.00 ?  155 LYS B N    1  
ATOM   4910   C  CA   . LYS B  2 101 ? 5.749   50.793  3.956   1.00 0.00 ?  155 LYS B CA   1  
ATOM   4911   C  C    . LYS B  2 101 ? 4.900   49.521  4.250   1.00 0.00 ?  155 LYS B C    1  
ATOM   4912   O  O    . LYS B  2 101 ? 3.757   49.527  3.917   1.00 0.00 ?  155 LYS B O    1  
ATOM   4913   C  CB   . LYS B  2 101 ? 6.406   50.568  2.540   1.00 0.00 ?  155 LYS B CB   1  
ATOM   4914   C  CG   . LYS B  2 101 ? 7.121   51.885  2.092   1.00 0.00 ?  155 LYS B CG   1  
ATOM   4915   C  CD   . LYS B  2 101 ? 6.044   53.006  1.750   1.00 0.00 ?  155 LYS B CD   1  
ATOM   4916   C  CE   . LYS B  2 101 ? 6.511   54.229  0.894   1.00 0.00 ?  155 LYS B CE   1  
ATOM   4917   N  NZ   . LYS B  2 101 ? 5.412   55.009  0.332   1.00 0.00 1  155 LYS B NZ   1  
ATOM   4918   H  H    . LYS B  2 101 ? 7.602   51.162  4.797   1.00 0.00 ?  155 LYS B H    1  
ATOM   4919   H  HA   . LYS B  2 101 ? 5.040   51.603  3.862   1.00 0.00 ?  155 LYS B HA   1  
ATOM   4920   H  HB2  . LYS B  2 101 ? 7.296   49.912  2.652   1.00 0.00 ?  155 LYS B HB2  1  
ATOM   4921   H  HB3  . LYS B  2 101 ? 5.864   50.163  1.659   1.00 0.00 ?  155 LYS B HB3  1  
ATOM   4922   H  HG2  . LYS B  2 101 ? 7.707   52.243  2.966   1.00 0.00 ?  155 LYS B HG2  1  
ATOM   4923   H  HG3  . LYS B  2 101 ? 7.825   51.716  1.249   1.00 0.00 ?  155 LYS B HG3  1  
ATOM   4924   H  HD2  . LYS B  2 101 ? 5.326   52.409  1.148   1.00 0.00 ?  155 LYS B HD2  1  
ATOM   4925   H  HD3  . LYS B  2 101 ? 5.472   53.464  2.585   1.00 0.00 ?  155 LYS B HD3  1  
ATOM   4926   H  HE2  . LYS B  2 101 ? 7.111   54.983  1.448   1.00 0.00 ?  155 LYS B HE2  1  
ATOM   4927   H  HE3  . LYS B  2 101 ? 7.052   53.795  0.026   1.00 0.00 ?  155 LYS B HE3  1  
ATOM   4928   H  HZ1  . LYS B  2 101 ? 4.618   55.045  1.002   1.00 0.00 ?  155 LYS B HZ1  1  
ATOM   4929   H  HZ2  . LYS B  2 101 ? 5.156   54.626  -0.601  1.00 0.00 ?  155 LYS B HZ2  1  
ATOM   4930   H  HZ3  . LYS B  2 101 ? 5.817   55.950  0.153   1.00 0.00 ?  155 LYS B HZ3  1  
ATOM   4931   N  N    . LEU B  2 102 ? 5.360   48.606  5.238   1.00 0.00 ?  156 LEU B N    1  
ATOM   4932   C  CA   . LEU B  2 102 ? 4.354   47.728  5.880   1.00 0.00 ?  156 LEU B CA   1  
ATOM   4933   C  C    . LEU B  2 102 ? 3.259   48.437  6.611   1.00 0.00 ?  156 LEU B C    1  
ATOM   4934   O  O    . LEU B  2 102 ? 2.092   48.027  6.396   1.00 0.00 ?  156 LEU B O    1  
ATOM   4935   C  CB   . LEU B  2 102 ? 5.169   46.749  6.689   1.00 0.00 ?  156 LEU B CB   1  
ATOM   4936   C  CG   . LEU B  2 102 ? 4.400   45.714  7.532   1.00 0.00 ?  156 LEU B CG   1  
ATOM   4937   C  CD1  . LEU B  2 102 ? 3.469   44.741  6.850   1.00 0.00 ?  156 LEU B CD1  1  
ATOM   4938   C  CD2  . LEU B  2 102 ? 5.433   44.988  8.464   1.00 0.00 ?  156 LEU B CD2  1  
ATOM   4939   H  H    . LEU B  2 102 ? 6.311   48.454  5.496   1.00 0.00 ?  156 LEU B H    1  
ATOM   4940   H  HA   . LEU B  2 102 ? 3.849   47.088  5.172   1.00 0.00 ?  156 LEU B HA   1  
ATOM   4941   H  HB2  . LEU B  2 102 ? 5.767   46.114  6.001   1.00 0.00 ?  156 LEU B HB2  1  
ATOM   4942   H  HB3  . LEU B  2 102 ? 5.932   47.255  7.318   1.00 0.00 ?  156 LEU B HB3  1  
ATOM   4943   H  HG   . LEU B  2 102 ? 3.882   46.205  8.384   1.00 0.00 ?  156 LEU B HG   1  
ATOM   4944   H  HD11 . LEU B  2 102 ? 4.034   44.001  6.243   1.00 0.00 ?  156 LEU B HD11 1  
ATOM   4945   H  HD12 . LEU B  2 102 ? 2.565   45.234  6.434   1.00 0.00 ?  156 LEU B HD12 1  
ATOM   4946   H  HD13 . LEU B  2 102 ? 3.076   44.252  7.767   1.00 0.00 ?  156 LEU B HD13 1  
ATOM   4947   H  HD21 . LEU B  2 102 ? 6.315   44.706  7.850   1.00 0.00 ?  156 LEU B HD21 1  
ATOM   4948   H  HD22 . LEU B  2 102 ? 5.076   44.006  8.843   1.00 0.00 ?  156 LEU B HD22 1  
ATOM   4949   H  HD23 . LEU B  2 102 ? 5.775   45.652  9.287   1.00 0.00 ?  156 LEU B HD23 1  
ATOM   4950   N  N    . HIS B  2 103 ? 3.468   49.553  7.376   1.00 0.00 ?  157 HIS B N    1  
ATOM   4951   C  CA   . HIS B  2 103 ? 2.430   50.367  7.875   1.00 0.00 ?  157 HIS B CA   1  
ATOM   4952   C  C    . HIS B  2 103 ? 1.435   51.039  6.963   1.00 0.00 ?  157 HIS B C    1  
ATOM   4953   O  O    . HIS B  2 103 ? 0.200   50.853  7.050   1.00 0.00 ?  157 HIS B O    1  
ATOM   4954   C  CB   . HIS B  2 103 ? 3.040   51.318  8.966   1.00 0.00 ?  157 HIS B CB   1  
ATOM   4955   C  CG   . HIS B  2 103 ? 3.453   50.524  10.177  1.00 0.00 ?  157 HIS B CG   1  
ATOM   4956   N  ND1  . HIS B  2 103 ? 2.556   50.204  11.169  1.00 0.00 ?  157 HIS B ND1  1  
ATOM   4957   C  CD2  . HIS B  2 103 ? 4.673   50.450  10.699  1.00 0.00 ?  157 HIS B CD2  1  
ATOM   4958   C  CE1  . HIS B  2 103 ? 3.308   49.784  12.238  1.00 0.00 ?  157 HIS B CE1  1  
ATOM   4959   N  NE2  . HIS B  2 103 ? 4.603   49.935  12.016  1.00 0.00 ?  157 HIS B NE2  1  
ATOM   4960   H  H    . HIS B  2 103 ? 4.365   49.903  7.632   1.00 0.00 ?  157 HIS B H    1  
ATOM   4961   H  HA   . HIS B  2 103 ? 1.784   49.707  8.435   1.00 0.00 ?  157 HIS B HA   1  
ATOM   4962   H  HB2  . HIS B  2 103 ? 4.000   51.738  8.598   1.00 0.00 ?  157 HIS B HB2  1  
ATOM   4963   H  HB3  . HIS B  2 103 ? 2.446   52.226  9.210   1.00 0.00 ?  157 HIS B HB3  1  
ATOM   4964   H  HD1  . HIS B  2 103 ? 1.566   50.237  11.036  1.00 0.00 ?  157 HIS B HD1  1  
ATOM   4965   H  HD2  . HIS B  2 103 ? 5.672   50.688  10.356  1.00 0.00 ?  157 HIS B HD2  1  
ATOM   4966   H  HE1  . HIS B  2 103 ? 2.872   49.424  13.170  1.00 0.00 ?  157 HIS B HE1  1  
ATOM   4967   N  N    . GLU B  2 104 ? 1.978   51.653  5.821   1.00 0.00 ?  158 GLU B N    1  
ATOM   4968   C  CA   . GLU B  2 104 ? 1.257   52.262  4.694   1.00 0.00 ?  158 GLU B CA   1  
ATOM   4969   C  C    . GLU B  2 104 ? 0.415   51.274  3.984   1.00 0.00 ?  158 GLU B C    1  
ATOM   4970   O  O    . GLU B  2 104 ? -0.602  51.668  3.350   1.00 0.00 ?  158 GLU B O    1  
ATOM   4971   C  CB   . GLU B  2 104 ? 2.254   52.988  3.720   1.00 0.00 ?  158 GLU B CB   1  
ATOM   4972   C  CG   . GLU B  2 104 ? 2.666   54.384  4.262   1.00 0.00 ?  158 GLU B CG   1  
ATOM   4973   C  CD   . GLU B  2 104 ? 3.631   55.124  3.407   1.00 0.00 ?  158 GLU B CD   1  
ATOM   4974   O  OE1  . GLU B  2 104 ? 4.572   55.673  4.036   1.00 0.00 ?  158 GLU B OE1  1  
ATOM   4975   O  OE2  . GLU B  2 104 ? 3.478   55.195  2.172   1.00 0.00 -1 158 GLU B OE2  1  
ATOM   4976   H  H    . GLU B  2 104 ? 2.974   51.695  5.833   1.00 0.00 ?  158 GLU B H    1  
ATOM   4977   H  HA   . GLU B  2 104 ? 0.566   52.953  5.154   1.00 0.00 ?  158 GLU B HA   1  
ATOM   4978   H  HB2  . GLU B  2 104 ? 3.135   52.321  3.597   1.00 0.00 ?  158 GLU B HB2  1  
ATOM   4979   H  HB3  . GLU B  2 104 ? 1.736   53.043  2.740   1.00 0.00 ?  158 GLU B HB3  1  
ATOM   4980   H  HG2  . GLU B  2 104 ? 1.769   55.040  4.286   1.00 0.00 ?  158 GLU B HG2  1  
ATOM   4981   H  HG3  . GLU B  2 104 ? 3.098   54.203  5.270   1.00 0.00 ?  158 GLU B HG3  1  
ATOM   4982   N  N    . LEU B  2 105 ? 0.773   50.043  3.832   1.00 0.00 ?  159 LEU B N    1  
ATOM   4983   C  CA   . LEU B  2 105 ? -0.126  49.078  3.206   1.00 0.00 ?  159 LEU B CA   1  
ATOM   4984   C  C    . LEU B  2 105 ? -1.337  48.660  4.033   1.00 0.00 ?  159 LEU B C    1  
ATOM   4985   O  O    . LEU B  2 105 ? -2.418  48.686  3.563   1.00 0.00 ?  159 LEU B O    1  
ATOM   4986   C  CB   . LEU B  2 105 ? 0.739   47.864  2.800   1.00 0.00 ?  159 LEU B CB   1  
ATOM   4987   C  CG   . LEU B  2 105 ? 0.033   46.740  2.033   1.00 0.00 ?  159 LEU B CG   1  
ATOM   4988   C  CD1  . LEU B  2 105 ? -0.925  47.288  0.830   1.00 0.00 ?  159 LEU B CD1  1  
ATOM   4989   C  CD2  . LEU B  2 105 ? 0.980   45.656  1.421   1.00 0.00 ?  159 LEU B CD2  1  
ATOM   4990   H  H    . LEU B  2 105 ? 1.666   49.711  4.125   1.00 0.00 ?  159 LEU B H    1  
ATOM   4991   H  HA   . LEU B  2 105 ? -0.533  49.605  2.356   1.00 0.00 ?  159 LEU B HA   1  
ATOM   4992   H  HB2  . LEU B  2 105 ? 1.619   48.275  2.260   1.00 0.00 ?  159 LEU B HB2  1  
ATOM   4993   H  HB3  . LEU B  2 105 ? 1.244   47.448  3.698   1.00 0.00 ?  159 LEU B HB3  1  
ATOM   4994   H  HG   . LEU B  2 105 ? -0.559  46.255  2.839   1.00 0.00 ?  159 LEU B HG   1  
ATOM   4995   H  HD11 . LEU B  2 105 ? -1.228  46.532  0.074   1.00 0.00 ?  159 LEU B HD11 1  
ATOM   4996   H  HD12 . LEU B  2 105 ? -0.514  48.153  0.269   1.00 0.00 ?  159 LEU B HD12 1  
ATOM   4997   H  HD13 . LEU B  2 105 ? -1.781  47.705  1.404   1.00 0.00 ?  159 LEU B HD13 1  
ATOM   4998   H  HD21 . LEU B  2 105 ? 1.562   45.340  2.313   1.00 0.00 ?  159 LEU B HD21 1  
ATOM   4999   H  HD22 . LEU B  2 105 ? 1.718   46.015  0.673   1.00 0.00 ?  159 LEU B HD22 1  
ATOM   5000   H  HD23 . LEU B  2 105 ? 0.376   44.807  1.034   1.00 0.00 ?  159 LEU B HD23 1  
ATOM   5001   N  N    . GLN B  2 106 ? -1.095  48.397  5.382   1.00 0.00 ?  160 GLN B N    1  
ATOM   5002   C  CA   . GLN B  2 106 ? -2.179  48.157  6.351   1.00 0.00 ?  160 GLN B CA   1  
ATOM   5003   C  C    . GLN B  2 106 ? -3.237  49.310  6.361   1.00 0.00 ?  160 GLN B C    1  
ATOM   5004   O  O    . GLN B  2 106 ? -4.471  49.076  6.293   1.00 0.00 ?  160 GLN B O    1  
ATOM   5005   C  CB   . GLN B  2 106 ? -1.540  47.966  7.698   1.00 0.00 ?  160 GLN B CB   1  
ATOM   5006   C  CG   . GLN B  2 106 ? -0.876  46.586  7.875   1.00 0.00 ?  160 GLN B CG   1  
ATOM   5007   C  CD   . GLN B  2 106 ? 0.030   46.438  9.144   1.00 0.00 ?  160 GLN B CD   1  
ATOM   5008   O  OE1  . GLN B  2 106 ? -0.259  45.711  10.047  1.00 0.00 ?  160 GLN B OE1  1  
ATOM   5009   N  NE2  . GLN B  2 106 ? 1.109   47.250  9.217   1.00 0.00 ?  160 GLN B NE2  1  
ATOM   5010   H  H    . GLN B  2 106 ? -0.167  48.306  5.733   1.00 0.00 ?  160 GLN B H    1  
ATOM   5011   H  HA   . GLN B  2 106 ? -2.622  47.209  6.084   1.00 0.00 ?  160 GLN B HA   1  
ATOM   5012   H  HB2  . GLN B  2 106 ? -0.936  48.861  7.962   1.00 0.00 ?  160 GLN B HB2  1  
ATOM   5013   H  HB3  . GLN B  2 106 ? -2.402  48.053  8.394   1.00 0.00 ?  160 GLN B HB3  1  
ATOM   5014   H  HG2  . GLN B  2 106 ? -1.754  45.915  7.989   1.00 0.00 ?  160 GLN B HG2  1  
ATOM   5015   H  HG3  . GLN B  2 106 ? -0.232  46.224  7.045   1.00 0.00 ?  160 GLN B HG3  1  
ATOM   5016   H  HE21 . GLN B  2 106 ? 1.733   47.108  9.986   1.00 0.00 ?  160 GLN B HE21 1  
ATOM   5017   H  HE22 . GLN B  2 106 ? 1.328   47.683  8.343   1.00 0.00 ?  160 GLN B HE22 1  
ATOM   5018   N  N    . GLU B  2 107 ? -2.768  50.579  6.299   1.00 0.00 ?  161 GLU B N    1  
ATOM   5019   C  CA   . GLU B  2 107 ? -3.565  51.815  6.181   1.00 0.00 ?  161 GLU B CA   1  
ATOM   5020   C  C    . GLU B  2 107 ? -4.404  51.825  4.936   1.00 0.00 ?  161 GLU B C    1  
ATOM   5021   O  O    . GLU B  2 107 ? -5.631  52.015  5.012   1.00 0.00 ?  161 GLU B O    1  
ATOM   5022   C  CB   . GLU B  2 107 ? -2.591  53.048  6.073   1.00 0.00 ?  161 GLU B CB   1  
ATOM   5023   C  CG   . GLU B  2 107 ? -3.321  54.439  6.046   1.00 0.00 ?  161 GLU B CG   1  
ATOM   5024   C  CD   . GLU B  2 107 ? -3.904  54.831  7.424   1.00 0.00 ?  161 GLU B CD   1  
ATOM   5025   O  OE1  . GLU B  2 107 ? -5.061  54.472  7.556   1.00 0.00 ?  161 GLU B OE1  1  
ATOM   5026   O  OE2  . GLU B  2 107 ? -3.222  55.476  8.256   1.00 0.00 -1 161 GLU B OE2  1  
ATOM   5027   H  H    . GLU B  2 107 ? -1.801  50.751  6.126   1.00 0.00 ?  161 GLU B H    1  
ATOM   5028   H  HA   . GLU B  2 107 ? -4.225  51.922  7.029   1.00 0.00 ?  161 GLU B HA   1  
ATOM   5029   H  HB2  . GLU B  2 107 ? -1.835  53.104  6.885   1.00 0.00 ?  161 GLU B HB2  1  
ATOM   5030   H  HB3  . GLU B  2 107 ? -1.937  52.919  5.184   1.00 0.00 ?  161 GLU B HB3  1  
ATOM   5031   H  HG2  . GLU B  2 107 ? -2.504  55.123  5.730   1.00 0.00 ?  161 GLU B HG2  1  
ATOM   5032   H  HG3  . GLU B  2 107 ? -4.117  54.492  5.273   1.00 0.00 ?  161 GLU B HG3  1  
ATOM   5033   N  N    . LYS B  2 108 ? -3.785  51.562  3.761   1.00 0.00 ?  162 LYS B N    1  
ATOM   5034   C  CA   . LYS B  2 108 ? -4.440  51.389  2.419   1.00 0.00 ?  162 LYS B CA   1  
ATOM   5035   C  C    . LYS B  2 108 ? -5.536  50.316  2.458   1.00 0.00 ?  162 LYS B C    1  
ATOM   5036   O  O    . LYS B  2 108 ? -6.651  50.464  1.910   1.00 0.00 ?  162 LYS B O    1  
ATOM   5037   C  CB   . LYS B  2 108 ? -3.405  51.180  1.260   1.00 0.00 ?  162 LYS B CB   1  
ATOM   5038   C  CG   . LYS B  2 108 ? -2.723  52.406  0.860   1.00 0.00 ?  162 LYS B CG   1  
ATOM   5039   C  CD   . LYS B  2 108 ? -1.868  52.195  -0.417  1.00 0.00 ?  162 LYS B CD   1  
ATOM   5040   C  CE   . LYS B  2 108 ? -1.265  53.391  -1.134  1.00 0.00 ?  162 LYS B CE   1  
ATOM   5041   N  NZ   . LYS B  2 108 ? -2.432  53.866  -1.929  1.00 0.00 1  162 LYS B NZ   1  
ATOM   5042   H  H    . LYS B  2 108 ? -2.805  51.680  3.624   1.00 0.00 ?  162 LYS B H    1  
ATOM   5043   H  HA   . LYS B  2 108 ? -5.043  52.275  2.287   1.00 0.00 ?  162 LYS B HA   1  
ATOM   5044   H  HB2  . LYS B  2 108 ? -2.649  50.472  1.663   1.00 0.00 ?  162 LYS B HB2  1  
ATOM   5045   H  HB3  . LYS B  2 108 ? -3.833  50.762  0.324   1.00 0.00 ?  162 LYS B HB3  1  
ATOM   5046   H  HG2  . LYS B  2 108 ? -3.467  53.170  0.548   1.00 0.00 ?  162 LYS B HG2  1  
ATOM   5047   H  HG3  . LYS B  2 108 ? -2.179  53.025  1.604   1.00 0.00 ?  162 LYS B HG3  1  
ATOM   5048   H  HD2  . LYS B  2 108 ? -0.964  51.615  -0.133  1.00 0.00 ?  162 LYS B HD2  1  
ATOM   5049   H  HD3  . LYS B  2 108 ? -2.443  51.509  -1.075  1.00 0.00 ?  162 LYS B HD3  1  
ATOM   5050   H  HE2  . LYS B  2 108 ? -0.915  54.135  -0.386  1.00 0.00 ?  162 LYS B HE2  1  
ATOM   5051   H  HE3  . LYS B  2 108 ? -0.322  53.202  -1.691  1.00 0.00 ?  162 LYS B HE3  1  
ATOM   5052   H  HZ1  . LYS B  2 108 ? -3.149  54.319  -1.327  1.00 0.00 ?  162 LYS B HZ1  1  
ATOM   5053   H  HZ2  . LYS B  2 108 ? -2.757  53.054  -2.491  1.00 0.00 ?  162 LYS B HZ2  1  
ATOM   5054   H  HZ3  . LYS B  2 108 ? -2.043  54.538  -2.621  1.00 0.00 ?  162 LYS B HZ3  1  
ATOM   5055   N  N    . LEU B  2 109 ? -5.231  49.113  3.082   1.00 0.00 ?  163 LEU B N    1  
ATOM   5056   C  CA   . LEU B  2 109 ? -6.166  48.048  3.061   1.00 0.00 ?  163 LEU B CA   1  
ATOM   5057   C  C    . LEU B  2 109 ? -7.365  48.245  3.980   1.00 0.00 ?  163 LEU B C    1  
ATOM   5058   O  O    . LEU B  2 109 ? -8.523  47.848  3.692   1.00 0.00 ?  163 LEU B O    1  
ATOM   5059   C  CB   . LEU B  2 109 ? -5.535  46.696  3.369   1.00 0.00 ?  163 LEU B CB   1  
ATOM   5060   C  CG   . LEU B  2 109 ? -4.779  46.006  2.302   1.00 0.00 ?  163 LEU B CG   1  
ATOM   5061   C  CD1  . LEU B  2 109 ? -3.498  45.332  2.900   1.00 0.00 ?  163 LEU B CD1  1  
ATOM   5062   C  CD2  . LEU B  2 109 ? -5.622  44.958  1.562   1.00 0.00 ?  163 LEU B CD2  1  
ATOM   5063   H  H    . LEU B  2 109 ? -4.379  48.998  3.586   1.00 0.00 ?  163 LEU B H    1  
ATOM   5064   H  HA   . LEU B  2 109 ? -6.577  47.953  2.066   1.00 0.00 ?  163 LEU B HA   1  
ATOM   5065   H  HB2  . LEU B  2 109 ? -4.860  46.823  4.243   1.00 0.00 ?  163 LEU B HB2  1  
ATOM   5066   H  HB3  . LEU B  2 109 ? -6.226  45.860  3.609   1.00 0.00 ?  163 LEU B HB3  1  
ATOM   5067   H  HG   . LEU B  2 109 ? -4.481  46.699  1.486   1.00 0.00 ?  163 LEU B HG   1  
ATOM   5068   H  HD11 . LEU B  2 109 ? -2.866  44.946  2.072   1.00 0.00 ?  163 LEU B HD11 1  
ATOM   5069   H  HD12 . LEU B  2 109 ? -3.751  44.446  3.521   1.00 0.00 ?  163 LEU B HD12 1  
ATOM   5070   H  HD13 . LEU B  2 109 ? -2.886  46.103  3.415   1.00 0.00 ?  163 LEU B HD13 1  
ATOM   5071   H  HD21 . LEU B  2 109 ? -6.638  45.367  1.379   1.00 0.00 ?  163 LEU B HD21 1  
ATOM   5072   H  HD22 . LEU B  2 109 ? -5.904  44.041  2.123   1.00 0.00 ?  163 LEU B HD22 1  
ATOM   5073   H  HD23 . LEU B  2 109 ? -5.145  44.670  0.601   1.00 0.00 ?  163 LEU B HD23 1  
ATOM   5074   N  N    . SER B  2 110 ? -7.129  48.887  5.113   1.00 0.00 ?  164 SER B N    1  
ATOM   5075   C  CA   . SER B  2 110 ? -8.140  49.023  6.245   1.00 0.00 ?  164 SER B CA   1  
ATOM   5076   C  C    . SER B  2 110 ? -9.528  49.547  6.000   1.00 0.00 ?  164 SER B C    1  
ATOM   5077   O  O    . SER B  2 110 ? -10.441 49.073  6.722   1.00 0.00 ?  164 SER B O    1  
ATOM   5078   C  CB   . SER B  2 110 ? -7.579  49.762  7.525   1.00 0.00 ?  164 SER B CB   1  
ATOM   5079   O  OG   . SER B  2 110 ? -6.625  48.999  8.191   1.00 0.00 ?  164 SER B OG   1  
ATOM   5080   H  H    . SER B  2 110 ? -6.193  49.131  5.356   1.00 0.00 ?  164 SER B H    1  
ATOM   5081   H  HA   . SER B  2 110 ? -8.295  47.977  6.468   1.00 0.00 ?  164 SER B HA   1  
ATOM   5082   H  HB2  . SER B  2 110 ? -7.084  50.679  7.139   1.00 0.00 ?  164 SER B HB2  1  
ATOM   5083   H  HB3  . SER B  2 110 ? -8.357  50.039  8.267   1.00 0.00 ?  164 SER B HB3  1  
ATOM   5084   H  HG   . SER B  2 110 ? -5.851  48.898  7.631   1.00 0.00 ?  164 SER B HG   1  
ATOM   5085   N  N    . PRO B  2 111 ? -9.842  50.458  5.117   1.00 0.00 ?  165 PRO B N    1  
ATOM   5086   C  CA   . PRO B  2 111 ? -11.137 51.096  5.010   1.00 0.00 ?  165 PRO B CA   1  
ATOM   5087   C  C    . PRO B  2 111 ? -12.191 50.241  4.478   1.00 0.00 ?  165 PRO B C    1  
ATOM   5088   O  O    . PRO B  2 111 ? -13.225 50.097  5.126   1.00 0.00 ?  165 PRO B O    1  
ATOM   5089   C  CB   . PRO B  2 111 ? -11.037 52.405  4.281   1.00 0.00 ?  165 PRO B CB   1  
ATOM   5090   C  CG   . PRO B  2 111 ? -9.590  52.781  4.450   1.00 0.00 ?  165 PRO B CG   1  
ATOM   5091   C  CD   . PRO B  2 111 ? -8.851  51.389  4.598   1.00 0.00 ?  165 PRO B CD   1  
ATOM   5092   H  HA   . PRO B  2 111 ? -11.395 51.327  6.033   1.00 0.00 ?  165 PRO B HA   1  
ATOM   5093   H  HB2  . PRO B  2 111 ? -11.312 52.198  3.224   1.00 0.00 ?  165 PRO B HB2  1  
ATOM   5094   H  HB3  . PRO B  2 111 ? -11.775 53.109  4.721   1.00 0.00 ?  165 PRO B HB3  1  
ATOM   5095   H  HG2  . PRO B  2 111 ? -9.066  53.402  3.692   1.00 0.00 ?  165 PRO B HG2  1  
ATOM   5096   H  HG3  . PRO B  2 111 ? -9.559  53.246  5.458   1.00 0.00 ?  165 PRO B HG3  1  
ATOM   5097   H  HD2  . PRO B  2 111 ? -8.381  50.983  3.677   1.00 0.00 ?  165 PRO B HD2  1  
ATOM   5098   H  HD3  . PRO B  2 111 ? -7.992  51.591  5.273   1.00 0.00 ?  165 PRO B HD3  1  
ATOM   5099   N  N    . LEU B  2 112 ? -11.888 49.580  3.398   1.00 0.00 ?  166 LEU B N    1  
ATOM   5100   C  CA   . LEU B  2 112 ? -12.680 48.508  2.851   1.00 0.00 ?  166 LEU B CA   1  
ATOM   5101   C  C    . LEU B  2 112 ? -12.937 47.325  3.808   1.00 0.00 ?  166 LEU B C    1  
ATOM   5102   O  O    . LEU B  2 112 ? -14.046 46.894  4.086   1.00 0.00 ?  166 LEU B O    1  
ATOM   5103   C  CB   . LEU B  2 112 ? -12.209 48.075  1.435   1.00 0.00 ?  166 LEU B CB   1  
ATOM   5104   C  CG   . LEU B  2 112 ? -13.020 47.048  0.580   1.00 0.00 ?  166 LEU B CG   1  
ATOM   5105   C  CD1  . LEU B  2 112 ? -14.215 47.568  -0.164  1.00 0.00 ?  166 LEU B CD1  1  
ATOM   5106   C  CD2  . LEU B  2 112 ? -12.176 46.301  -0.434  1.00 0.00 ?  166 LEU B CD2  1  
ATOM   5107   H  H    . LEU B  2 112 ? -11.023 49.660  2.908   1.00 0.00 ?  166 LEU B H    1  
ATOM   5108   H  HA   . LEU B  2 112 ? -13.712 48.826  2.836   1.00 0.00 ?  166 LEU B HA   1  
ATOM   5109   H  HB2  . LEU B  2 112 ? -12.037 48.941  0.761   1.00 0.00 ?  166 LEU B HB2  1  
ATOM   5110   H  HB3  . LEU B  2 112 ? -11.188 47.727  1.701   1.00 0.00 ?  166 LEU B HB3  1  
ATOM   5111   H  HG   . LEU B  2 112 ? -13.406 46.255  1.256   1.00 0.00 ?  166 LEU B HG   1  
ATOM   5112   H  HD11 . LEU B  2 112 ? -14.883 48.010  0.605   1.00 0.00 ?  166 LEU B HD11 1  
ATOM   5113   H  HD12 . LEU B  2 112 ? -14.699 46.763  -0.757  1.00 0.00 ?  166 LEU B HD12 1  
ATOM   5114   H  HD13 . LEU B  2 112 ? -13.851 48.402  -0.802  1.00 0.00 ?  166 LEU B HD13 1  
ATOM   5115   H  HD21 . LEU B  2 112 ? -12.019 47.018  -1.268  1.00 0.00 ?  166 LEU B HD21 1  
ATOM   5116   H  HD22 . LEU B  2 112 ? -12.771 45.439  -0.805  1.00 0.00 ?  166 LEU B HD22 1  
ATOM   5117   H  HD23 . LEU B  2 112 ? -11.246 45.856  -0.021  1.00 0.00 ?  166 LEU B HD23 1  
ATOM   5118   N  N    . GLY B  2 113 ? -11.862 46.919  4.465   1.00 0.00 ?  167 GLY B N    1  
ATOM   5119   C  CA   . GLY B  2 113 ? -11.883 45.888  5.495   1.00 0.00 ?  167 GLY B CA   1  
ATOM   5120   C  C    . GLY B  2 113 ? -12.911 46.206  6.522   1.00 0.00 ?  167 GLY B C    1  
ATOM   5121   O  O    . GLY B  2 113 ? -13.803 45.428  6.889   1.00 0.00 ?  167 GLY B O    1  
ATOM   5122   H  H    . GLY B  2 113 ? -10.994 47.381  4.300   1.00 0.00 ?  167 GLY B H    1  
ATOM   5123   H  HA2  . GLY B  2 113 ? -12.026 44.960  4.962   1.00 0.00 ?  167 GLY B HA2  1  
ATOM   5124   H  HA3  . GLY B  2 113 ? -10.918 45.970  5.974   1.00 0.00 ?  167 GLY B HA3  1  
ATOM   5125   N  N    . GLU B  2 114 ? -12.839 47.378  7.146   1.00 0.00 ?  168 GLU B N    1  
ATOM   5126   C  CA   . GLU B  2 114 ? -13.712 47.778  8.219   1.00 0.00 ?  168 GLU B CA   1  
ATOM   5127   C  C    . GLU B  2 114 ? -15.184 47.946  7.787   1.00 0.00 ?  168 GLU B C    1  
ATOM   5128   O  O    . GLU B  2 114 ? -16.132 47.668  8.516   1.00 0.00 ?  168 GLU B O    1  
ATOM   5129   C  CB   . GLU B  2 114 ? -13.181 49.159  8.877   1.00 0.00 ?  168 GLU B CB   1  
ATOM   5130   C  CG   . GLU B  2 114 ? -14.200 49.825  9.765   1.00 0.00 ?  168 GLU B CG   1  
ATOM   5131   C  CD   . GLU B  2 114 ? -13.553 50.525  10.980  1.00 0.00 ?  168 GLU B CD   1  
ATOM   5132   O  OE1  . GLU B  2 114 ? -12.330 50.931  10.922  1.00 0.00 ?  168 GLU B OE1  1  
ATOM   5133   O  OE2  . GLU B  2 114 ? -14.298 50.604  11.948  1.00 0.00 -1 168 GLU B OE2  1  
ATOM   5134   H  H    . GLU B  2 114 ? -12.142 48.056  6.928   1.00 0.00 ?  168 GLU B H    1  
ATOM   5135   H  HA   . GLU B  2 114 ? -13.647 47.007  8.973   1.00 0.00 ?  168 GLU B HA   1  
ATOM   5136   H  HB2  . GLU B  2 114 ? -12.292 48.850  9.467   1.00 0.00 ?  168 GLU B HB2  1  
ATOM   5137   H  HB3  . GLU B  2 114 ? -13.032 49.916  8.078   1.00 0.00 ?  168 GLU B HB3  1  
ATOM   5138   H  HG2  . GLU B  2 114 ? -14.799 50.618  9.268   1.00 0.00 ?  168 GLU B HG2  1  
ATOM   5139   H  HG3  . GLU B  2 114 ? -14.914 49.079  10.176  1.00 0.00 ?  168 GLU B HG3  1  
ATOM   5140   N  N    . GLU B  2 115 ? -15.434 48.511  6.566   1.00 0.00 ?  169 GLU B N    1  
ATOM   5141   C  CA   . GLU B  2 115 ? -16.798 48.588  6.025   1.00 0.00 ?  169 GLU B CA   1  
ATOM   5142   C  C    . GLU B  2 115 ? -17.487 47.290  5.745   1.00 0.00 ?  169 GLU B C    1  
ATOM   5143   O  O    . GLU B  2 115 ? -18.618 47.101  6.209   1.00 0.00 ?  169 GLU B O    1  
ATOM   5144   C  CB   . GLU B  2 115 ? -16.854 49.487  4.662   1.00 0.00 ?  169 GLU B CB   1  
ATOM   5145   C  CG   . GLU B  2 115 ? -18.305 49.565  3.904   1.00 0.00 ?  169 GLU B CG   1  
ATOM   5146   C  CD   . GLU B  2 115 ? -18.234 50.461  2.692   1.00 0.00 ?  169 GLU B CD   1  
ATOM   5147   O  OE1  . GLU B  2 115 ? -17.489 50.141  1.737   1.00 0.00 ?  169 GLU B OE1  1  
ATOM   5148   O  OE2  . GLU B  2 115 ? -18.908 51.551  2.650   1.00 0.00 -1 169 GLU B OE2  1  
ATOM   5149   H  H    . GLU B  2 115 ? -14.697 48.709  5.925   1.00 0.00 ?  169 GLU B H    1  
ATOM   5150   H  HA   . GLU B  2 115 ? -17.454 48.992  6.782   1.00 0.00 ?  169 GLU B HA   1  
ATOM   5151   H  HB2  . GLU B  2 115 ? -16.351 50.462  4.836   1.00 0.00 ?  169 GLU B HB2  1  
ATOM   5152   H  HB3  . GLU B  2 115 ? -16.289 48.859  3.941   1.00 0.00 ?  169 GLU B HB3  1  
ATOM   5153   H  HG2  . GLU B  2 115 ? -18.680 48.604  3.491   1.00 0.00 ?  169 GLU B HG2  1  
ATOM   5154   H  HG3  . GLU B  2 115 ? -19.021 50.056  4.598   1.00 0.00 ?  169 GLU B HG3  1  
ATOM   5155   N  N    . MET B  2 116 ? -16.687 46.387  5.141   1.00 0.00 ?  170 MET B N    1  
ATOM   5156   C  CA   . MET B  2 116 ? -17.200 45.056  4.875   1.00 0.00 ?  170 MET B CA   1  
ATOM   5157   C  C    . MET B  2 116 ? -17.338 44.143  6.153   1.00 0.00 ?  170 MET B C    1  
ATOM   5158   O  O    . MET B  2 116 ? -18.300 43.285  6.095   1.00 0.00 ?  170 MET B O    1  
ATOM   5159   C  CB   . MET B  2 116 ? -16.253 44.385  3.847   1.00 0.00 ?  170 MET B CB   1  
ATOM   5160   C  CG   . MET B  2 116 ? -16.864 43.169  3.169   1.00 0.00 ?  170 MET B CG   1  
ATOM   5161   S  SD   . MET B  2 116 ? -18.348 43.515  2.152   1.00 0.00 ?  170 MET B SD   1  
ATOM   5162   C  CE   . MET B  2 116 ? -18.753 41.756  1.886   1.00 0.00 ?  170 MET B CE   1  
ATOM   5163   H  H    . MET B  2 116 ? -15.725 46.558  4.942   1.00 0.00 ?  170 MET B H    1  
ATOM   5164   H  HA   . MET B  2 116 ? -18.192 45.094  4.449   1.00 0.00 ?  170 MET B HA   1  
ATOM   5165   H  HB2  . MET B  2 116 ? -15.943 45.156  3.109   1.00 0.00 ?  170 MET B HB2  1  
ATOM   5166   H  HB3  . MET B  2 116 ? -15.310 44.086  4.352   1.00 0.00 ?  170 MET B HB3  1  
ATOM   5167   H  HG2  . MET B  2 116 ? -16.131 42.644  2.519   1.00 0.00 ?  170 MET B HG2  1  
ATOM   5168   H  HG3  . MET B  2 116 ? -17.138 42.454  3.974   1.00 0.00 ?  170 MET B HG3  1  
ATOM   5169   H  HE1  . MET B  2 116 ? -19.600 41.632  1.179   1.00 0.00 ?  170 MET B HE1  1  
ATOM   5170   H  HE2  . MET B  2 116 ? -19.034 41.316  2.867   1.00 0.00 ?  170 MET B HE2  1  
ATOM   5171   H  HE3  . MET B  2 116 ? -17.906 41.092  1.610   1.00 0.00 ?  170 MET B HE3  1  
ATOM   5172   N  N    . ARG B  2 117 ? -16.619 44.307  7.227   1.00 0.00 ?  171 ARG B N    1  
ATOM   5173   C  CA   . ARG B  2 117 ? -16.895 43.847  8.561   1.00 0.00 ?  171 ARG B CA   1  
ATOM   5174   C  C    . ARG B  2 117 ? -18.133 44.288  9.307   1.00 0.00 ?  171 ARG B C    1  
ATOM   5175   O  O    . ARG B  2 117 ? -18.863 43.498  9.883   1.00 0.00 ?  171 ARG B O    1  
ATOM   5176   C  CB   . ARG B  2 117 ? -15.782 44.059  9.599   1.00 0.00 ?  171 ARG B CB   1  
ATOM   5177   C  CG   . ARG B  2 117 ? -14.440 43.311  9.359   1.00 0.00 ?  171 ARG B CG   1  
ATOM   5178   C  CD   . ARG B  2 117 ? -13.481 43.338  10.609  1.00 0.00 ?  171 ARG B CD   1  
ATOM   5179   N  NE   . ARG B  2 117 ? -12.586 44.553  10.525  1.00 0.00 ?  171 ARG B NE   1  
ATOM   5180   C  CZ   . ARG B  2 117 ? -12.722 45.588  11.292  1.00 0.00 ?  171 ARG B CZ   1  
ATOM   5181   N  NH1  . ARG B  2 117 ? -11.845 46.591  11.256  1.00 0.00 1  171 ARG B NH1  1  
ATOM   5182   N  NH2  . ARG B  2 117 ? -13.676 45.761  12.165  1.00 0.00 ?  171 ARG B NH2  1  
ATOM   5183   H  H    . ARG B  2 117 ? -15.836 44.890  7.027   1.00 0.00 ?  171 ARG B H    1  
ATOM   5184   H  HA   . ARG B  2 117 ? -16.953 42.775  8.450   1.00 0.00 ?  171 ARG B HA   1  
ATOM   5185   H  HB2  . ARG B  2 117 ? -15.600 45.147  9.732   1.00 0.00 ?  171 ARG B HB2  1  
ATOM   5186   H  HB3  . ARG B  2 117 ? -16.105 43.839  10.639  1.00 0.00 ?  171 ARG B HB3  1  
ATOM   5187   H  HG2  . ARG B  2 117 ? -14.801 42.295  9.094   1.00 0.00 ?  171 ARG B HG2  1  
ATOM   5188   H  HG3  . ARG B  2 117 ? -13.880 43.708  8.485   1.00 0.00 ?  171 ARG B HG3  1  
ATOM   5189   H  HD2  . ARG B  2 117 ? -14.060 43.415  11.554  1.00 0.00 ?  171 ARG B HD2  1  
ATOM   5190   H  HD3  . ARG B  2 117 ? -12.783 42.477  10.681  1.00 0.00 ?  171 ARG B HD3  1  
ATOM   5191   H  HE   . ARG B  2 117 ? -11.847 44.559  9.851   1.00 0.00 ?  171 ARG B HE   1  
ATOM   5192   H  HH11 . ARG B  2 117 ? -11.177 46.593  10.513  1.00 0.00 ?  171 ARG B HH11 1  
ATOM   5193   H  HH12 . ARG B  2 117 ? -11.760 46.990  12.169  1.00 0.00 ?  171 ARG B HH12 1  
ATOM   5194   H  HH21 . ARG B  2 117 ? -14.268 44.977  12.352  1.00 0.00 ?  171 ARG B HH21 1  
ATOM   5195   H  HH22 . ARG B  2 117 ? -13.689 46.614  12.688  1.00 0.00 ?  171 ARG B HH22 1  
ATOM   5196   N  N    . ASP B  2 118 ? -18.478 45.623  9.165   1.00 0.00 ?  172 ASP B N    1  
ATOM   5197   C  CA   . ASP B  2 118 ? -19.828 46.172  9.495   1.00 0.00 ?  172 ASP B CA   1  
ATOM   5198   C  C    . ASP B  2 118 ? -20.988 45.636  8.687   1.00 0.00 ?  172 ASP B C    1  
ATOM   5199   O  O    . ASP B  2 118 ? -22.045 45.299  9.165   1.00 0.00 ?  172 ASP B O    1  
ATOM   5200   C  CB   . ASP B  2 118 ? -19.739 47.738  9.380   1.00 0.00 ?  172 ASP B CB   1  
ATOM   5201   C  CG   . ASP B  2 118 ? -19.043 48.371  10.607  1.00 0.00 ?  172 ASP B CG   1  
ATOM   5202   O  OD1  . ASP B  2 118 ? -18.679 49.570  10.493  1.00 0.00 ?  172 ASP B OD1  1  
ATOM   5203   O  OD2  . ASP B  2 118 ? -18.873 47.803  11.712  1.00 0.00 -1 172 ASP B OD2  1  
ATOM   5204   H  H    . ASP B  2 118 ? -17.886 46.178  8.586   1.00 0.00 ?  172 ASP B H    1  
ATOM   5205   H  HA   . ASP B  2 118 ? -20.011 45.961  10.538  1.00 0.00 ?  172 ASP B HA   1  
ATOM   5206   H  HB2  . ASP B  2 118 ? -19.316 48.036  8.397   1.00 0.00 ?  172 ASP B HB2  1  
ATOM   5207   H  HB3  . ASP B  2 118 ? -20.766 48.153  9.465   1.00 0.00 ?  172 ASP B HB3  1  
ATOM   5208   N  N    . ARG B  2 119 ? -20.847 45.431  7.385   1.00 0.00 ?  173 ARG B N    1  
ATOM   5209   C  CA   . ARG B  2 119 ? -21.736 44.799  6.509   1.00 0.00 ?  173 ARG B CA   1  
ATOM   5210   C  C    . ARG B  2 119 ? -22.093 43.383  6.699   1.00 0.00 ?  173 ARG B C    1  
ATOM   5211   O  O    . ARG B  2 119 ? -23.292 43.062  6.723   1.00 0.00 ?  173 ARG B O    1  
ATOM   5212   C  CB   . ARG B  2 119 ? -21.272 44.958  5.018   1.00 0.00 ?  173 ARG B CB   1  
ATOM   5213   C  CG   . ARG B  2 119 ? -21.221 46.428  4.406   1.00 0.00 ?  173 ARG B CG   1  
ATOM   5214   C  CD   . ARG B  2 119 ? -22.246 47.398  4.980   1.00 0.00 ?  173 ARG B CD   1  
ATOM   5215   N  NE   . ARG B  2 119 ? -22.181 48.555  4.085   1.00 0.00 ?  173 ARG B NE   1  
ATOM   5216   C  CZ   . ARG B  2 119 ? -22.677 49.761  4.229   1.00 0.00 ?  173 ARG B CZ   1  
ATOM   5217   N  NH1  . ARG B  2 119 ? -22.429 50.710  3.399   1.00 0.00 1  173 ARG B NH1  1  
ATOM   5218   N  NH2  . ARG B  2 119 ? -23.576 49.997  5.144   1.00 0.00 ?  173 ARG B NH2  1  
ATOM   5219   H  H    . ARG B  2 119 ? -19.930 45.667  7.071   1.00 0.00 ?  173 ARG B H    1  
ATOM   5220   H  HA   . ARG B  2 119 ? -22.651 45.361  6.626   1.00 0.00 ?  173 ARG B HA   1  
ATOM   5221   H  HB2  . ARG B  2 119 ? -20.211 44.664  4.868   1.00 0.00 ?  173 ARG B HB2  1  
ATOM   5222   H  HB3  . ARG B  2 119 ? -21.934 44.359  4.357   1.00 0.00 ?  173 ARG B HB3  1  
ATOM   5223   H  HG2  . ARG B  2 119 ? -20.173 46.788  4.325   1.00 0.00 ?  173 ARG B HG2  1  
ATOM   5224   H  HG3  . ARG B  2 119 ? -21.604 46.244  3.380   1.00 0.00 ?  173 ARG B HG3  1  
ATOM   5225   H  HD2  . ARG B  2 119 ? -23.168 46.865  4.664   1.00 0.00 ?  173 ARG B HD2  1  
ATOM   5226   H  HD3  . ARG B  2 119 ? -22.062 47.713  6.029   1.00 0.00 ?  173 ARG B HD3  1  
ATOM   5227   H  HE   . ARG B  2 119 ? -21.960 48.423  3.119   1.00 0.00 ?  173 ARG B HE   1  
ATOM   5228   H  HH11 . ARG B  2 119 ? -21.772 50.510  2.673   1.00 0.00 ?  173 ARG B HH11 1  
ATOM   5229   H  HH12 . ARG B  2 119 ? -22.670 51.634  3.697   1.00 0.00 ?  173 ARG B HH12 1  
ATOM   5230   H  HH21 . ARG B  2 119 ? -23.922 50.922  5.300   1.00 0.00 ?  173 ARG B HH21 1  
ATOM   5231   H  HH22 . ARG B  2 119 ? -23.827 49.150  5.611   1.00 0.00 ?  173 ARG B HH22 1  
ATOM   5232   N  N    . ALA B  2 120 ? -21.095 42.504  6.878   1.00 0.00 ?  174 ALA B N    1  
ATOM   5233   C  CA   . ALA B  2 120 ? -21.222 41.021  6.998   1.00 0.00 ?  174 ALA B CA   1  
ATOM   5234   C  C    . ALA B  2 120 ? -22.172 40.579  8.186   1.00 0.00 ?  174 ALA B C    1  
ATOM   5235   O  O    . ALA B  2 120 ? -23.062 39.780  8.017   1.00 0.00 ?  174 ALA B O    1  
ATOM   5236   C  CB   . ALA B  2 120 ? -19.892 40.358  7.089   1.00 0.00 ?  174 ALA B CB   1  
ATOM   5237   H  H    . ALA B  2 120 ? -20.163 42.832  6.744   1.00 0.00 ?  174 ALA B H    1  
ATOM   5238   H  HA   . ALA B  2 120 ? -21.738 40.737  6.092   1.00 0.00 ?  174 ALA B HA   1  
ATOM   5239   H  HB1  . ALA B  2 120 ? -20.030 39.255  7.093   1.00 0.00 ?  174 ALA B HB1  1  
ATOM   5240   H  HB2  . ALA B  2 120 ? -19.349 40.731  7.984   1.00 0.00 ?  174 ALA B HB2  1  
ATOM   5241   H  HB3  . ALA B  2 120 ? -19.274 40.606  6.200   1.00 0.00 ?  174 ALA B HB3  1  
ATOM   5242   N  N    . ARG B  2 121 ? -21.989 41.126  9.397   1.00 0.00 ?  175 ARG B N    1  
ATOM   5243   C  CA   . ARG B  2 121 ? -22.944 40.835  10.441  1.00 0.00 ?  175 ARG B CA   1  
ATOM   5244   C  C    . ARG B  2 121 ? -24.421 41.394  10.175  1.00 0.00 ?  175 ARG B C    1  
ATOM   5245   O  O    . ARG B  2 121 ? -25.429 40.733  10.484  1.00 0.00 ?  175 ARG B O    1  
ATOM   5246   C  CB   . ARG B  2 121 ? -22.472 41.470  11.737  1.00 0.00 ?  175 ARG B CB   1  
ATOM   5247   C  CG   . ARG B  2 121 ? -21.676 42.826  11.559  1.00 0.00 ?  175 ARG B CG   1  
ATOM   5248   C  CD   . ARG B  2 121 ? -21.417 43.570  12.988  1.00 0.00 ?  175 ARG B CD   1  
ATOM   5249   N  NE   . ARG B  2 121 ? -20.331 44.584  12.924  1.00 0.00 ?  175 ARG B NE   1  
ATOM   5250   C  CZ   . ARG B  2 121 ? -19.012 44.258  12.880  1.00 0.00 ?  175 ARG B CZ   1  
ATOM   5251   N  NH1  . ARG B  2 121 ? -18.140 45.234  12.640  1.00 0.00 1  175 ARG B NH1  1  
ATOM   5252   N  NH2  . ARG B  2 121 ? -18.524 43.002  12.901  1.00 0.00 ?  175 ARG B NH2  1  
ATOM   5253   H  H    . ARG B  2 121 ? -21.145 41.613  9.609   1.00 0.00 ?  175 ARG B H    1  
ATOM   5254   H  HA   . ARG B  2 121 ? -23.118 39.785  10.622  1.00 0.00 ?  175 ARG B HA   1  
ATOM   5255   H  HB2  . ARG B  2 121 ? -23.239 41.832  12.455  1.00 0.00 ?  175 ARG B HB2  1  
ATOM   5256   H  HB3  . ARG B  2 121 ? -21.812 40.740  12.253  1.00 0.00 ?  175 ARG B HB3  1  
ATOM   5257   H  HG2  . ARG B  2 121 ? -20.663 42.608  11.160  1.00 0.00 ?  175 ARG B HG2  1  
ATOM   5258   H  HG3  . ARG B  2 121 ? -22.199 43.577  10.928  1.00 0.00 ?  175 ARG B HG3  1  
ATOM   5259   H  HD2  . ARG B  2 121 ? -22.361 44.038  13.339  1.00 0.00 ?  175 ARG B HD2  1  
ATOM   5260   H  HD3  . ARG B  2 121 ? -21.279 42.872  13.841  1.00 0.00 ?  175 ARG B HD3  1  
ATOM   5261   H  HE   . ARG B  2 121 ? -20.537 45.562  12.877  1.00 0.00 ?  175 ARG B HE   1  
ATOM   5262   H  HH11 . ARG B  2 121 ? -18.481 46.154  12.446  1.00 0.00 ?  175 ARG B HH11 1  
ATOM   5263   H  HH12 . ARG B  2 121 ? -17.154 45.075  12.680  1.00 0.00 ?  175 ARG B HH12 1  
ATOM   5264   H  HH21 . ARG B  2 121 ? -17.573 42.930  13.200  1.00 0.00 ?  175 ARG B HH21 1  
ATOM   5265   H  HH22 . ARG B  2 121 ? -19.180 42.263  13.052  1.00 0.00 ?  175 ARG B HH22 1  
ATOM   5266   N  N    . ALA B  2 122 ? -24.561 42.602  9.532   1.00 0.00 ?  176 ALA B N    1  
ATOM   5267   C  CA   . ALA B  2 122 ? -25.885 43.065  9.190   1.00 0.00 ?  176 ALA B CA   1  
ATOM   5268   C  C    . ALA B  2 122 ? -26.662 42.112  8.207   1.00 0.00 ?  176 ALA B C    1  
ATOM   5269   O  O    . ALA B  2 122 ? -27.847 41.801  8.381   1.00 0.00 ?  176 ALA B O    1  
ATOM   5270   C  CB   . ALA B  2 122 ? -25.794 44.441  8.585   1.00 0.00 ?  176 ALA B CB   1  
ATOM   5271   H  H    . ALA B  2 122 ? -23.774 43.102  9.179   1.00 0.00 ?  176 ALA B H    1  
ATOM   5272   H  HA   . ALA B  2 122 ? -26.304 42.983  10.182  1.00 0.00 ?  176 ALA B HA   1  
ATOM   5273   H  HB1  . ALA B  2 122 ? -25.228 44.374  7.632   1.00 0.00 ?  176 ALA B HB1  1  
ATOM   5274   H  HB2  . ALA B  2 122 ? -25.287 45.155  9.269   1.00 0.00 ?  176 ALA B HB2  1  
ATOM   5275   H  HB3  . ALA B  2 122 ? -26.820 44.857  8.486   1.00 0.00 ?  176 ALA B HB3  1  
ATOM   5276   N  N    . HIS B  2 123 ? -25.990 41.547  7.158   1.00 0.00 ?  177 HIS B N    1  
ATOM   5277   C  CA   . HIS B  2 123 ? -26.531 40.532  6.410   1.00 0.00 ?  177 HIS B CA   1  
ATOM   5278   C  C    . HIS B  2 123 ? -26.909 39.191  7.119   1.00 0.00 ?  177 HIS B C    1  
ATOM   5279   O  O    . HIS B  2 123 ? -28.015 38.702  6.837   1.00 0.00 ?  177 HIS B O    1  
ATOM   5280   C  CB   . HIS B  2 123 ? -25.708 40.400  5.143   1.00 0.00 ?  177 HIS B CB   1  
ATOM   5281   C  CG   . HIS B  2 123 ? -25.648 41.645  4.279   1.00 0.00 ?  177 HIS B CG   1  
ATOM   5282   N  ND1  . HIS B  2 123 ? -26.752 42.130  3.621   1.00 0.00 ?  177 HIS B ND1  1  
ATOM   5283   C  CD2  . HIS B  2 123 ? -24.588 42.426  3.783   1.00 0.00 ?  177 HIS B CD2  1  
ATOM   5284   C  CE1  . HIS B  2 123 ? -26.348 43.200  2.939   1.00 0.00 ?  177 HIS B CE1  1  
ATOM   5285   N  NE2  . HIS B  2 123 ? -25.091 43.437  3.062   1.00 0.00 ?  177 HIS B NE2  1  
ATOM   5286   H  H    . HIS B  2 123 ? -25.074 41.868  6.927   1.00 0.00 ?  177 HIS B H    1  
ATOM   5287   H  HA   . HIS B  2 123 ? -27.497 40.936  6.146   1.00 0.00 ?  177 HIS B HA   1  
ATOM   5288   H  HB2  . HIS B  2 123 ? -24.635 40.153  5.290   1.00 0.00 ?  177 HIS B HB2  1  
ATOM   5289   H  HB3  . HIS B  2 123 ? -26.238 39.599  4.583   1.00 0.00 ?  177 HIS B HB3  1  
ATOM   5290   H  HD1  . HIS B  2 123 ? -27.668 41.760  3.465   1.00 0.00 ?  177 HIS B HD1  1  
ATOM   5291   H  HD2  . HIS B  2 123 ? -23.536 42.460  4.038   1.00 0.00 ?  177 HIS B HD2  1  
ATOM   5292   H  HE1  . HIS B  2 123 ? -26.942 43.577  2.107   1.00 0.00 ?  177 HIS B HE1  1  
ATOM   5293   N  N    . VAL B  2 124 ? -26.108 38.709  8.067   1.00 0.00 ?  178 VAL B N    1  
ATOM   5294   C  CA   . VAL B  2 124 ? -26.405 37.673  8.992   1.00 0.00 ?  178 VAL B CA   1  
ATOM   5295   C  C    . VAL B  2 124 ? -27.688 37.877  9.877   1.00 0.00 ?  178 VAL B C    1  
ATOM   5296   O  O    . VAL B  2 124 ? -28.415 36.907  10.148  1.00 0.00 ?  178 VAL B O    1  
ATOM   5297   C  CB   . VAL B  2 124 ? -25.231 37.256  9.812   1.00 0.00 ?  178 VAL B CB   1  
ATOM   5298   C  CG1  . VAL B  2 124 ? -25.629 36.284  10.980  1.00 0.00 ?  178 VAL B CG1  1  
ATOM   5299   C  CG2  . VAL B  2 124 ? -24.186 36.561  8.844   1.00 0.00 ?  178 VAL B CG2  1  
ATOM   5300   H  H    . VAL B  2 124 ? -25.206 39.114  8.194   1.00 0.00 ?  178 VAL B H    1  
ATOM   5301   H  HA   . VAL B  2 124 ? -26.716 36.812  8.420   1.00 0.00 ?  178 VAL B HA   1  
ATOM   5302   H  HB   . VAL B  2 124 ? -24.749 38.134  10.295  1.00 0.00 ?  178 VAL B HB   1  
ATOM   5303   H  HG11 . VAL B  2 124 ? -26.434 35.547  10.771  1.00 0.00 ?  178 VAL B HG11 1  
ATOM   5304   H  HG12 . VAL B  2 124 ? -25.987 36.879  11.847  1.00 0.00 ?  178 VAL B HG12 1  
ATOM   5305   H  HG13 . VAL B  2 124 ? -24.743 35.751  11.386  1.00 0.00 ?  178 VAL B HG13 1  
ATOM   5306   H  HG21 . VAL B  2 124 ? -24.821 35.755  8.418   1.00 0.00 ?  178 VAL B HG21 1  
ATOM   5307   H  HG22 . VAL B  2 124 ? -23.341 36.165  9.447   1.00 0.00 ?  178 VAL B HG22 1  
ATOM   5308   H  HG23 . VAL B  2 124 ? -23.818 37.284  8.085   1.00 0.00 ?  178 VAL B HG23 1  
ATOM   5309   N  N    . ASP B  2 125 ? -27.770 39.028  10.422  1.00 0.00 ?  179 ASP B N    1  
ATOM   5310   C  CA   . ASP B  2 125 ? -28.801 39.741  11.133  1.00 0.00 ?  179 ASP B CA   1  
ATOM   5311   C  C    . ASP B  2 125 ? -30.101 39.845  10.322  1.00 0.00 ?  179 ASP B C    1  
ATOM   5312   O  O    . ASP B  2 125 ? -31.194 39.387  10.765  1.00 0.00 ?  179 ASP B O    1  
ATOM   5313   C  CB   . ASP B  2 125 ? -28.240 41.036  11.794  1.00 0.00 ?  179 ASP B CB   1  
ATOM   5314   C  CG   . ASP B  2 125 ? -29.193 41.955  12.590  1.00 0.00 ?  179 ASP B CG   1  
ATOM   5315   O  OD1  . ASP B  2 125 ? -29.207 43.185  12.360  1.00 0.00 ?  179 ASP B OD1  1  
ATOM   5316   O  OD2  . ASP B  2 125 ? -29.969 41.462  13.464  1.00 0.00 -1 179 ASP B OD2  1  
ATOM   5317   H  H    . ASP B  2 125 ? -26.950 39.595  10.425  1.00 0.00 ?  179 ASP B H    1  
ATOM   5318   H  HA   . ASP B  2 125 ? -29.161 39.309  12.055  1.00 0.00 ?  179 ASP B HA   1  
ATOM   5319   H  HB2  . ASP B  2 125 ? -27.427 40.709  12.477  1.00 0.00 ?  179 ASP B HB2  1  
ATOM   5320   H  HB3  . ASP B  2 125 ? -27.612 41.679  11.141  1.00 0.00 ?  179 ASP B HB3  1  
ATOM   5321   N  N    . ALA B  2 126 ? -30.027 40.303  9.091   1.00 0.00 ?  180 ALA B N    1  
ATOM   5322   C  CA   . ALA B  2 126 ? -31.085 40.303  8.166   1.00 0.00 ?  180 ALA B CA   1  
ATOM   5323   C  C    . ALA B  2 126 ? -31.600 38.809  8.094   1.00 0.00 ?  180 ALA B C    1  
ATOM   5324   O  O    . ALA B  2 126 ? -32.770 38.540  8.323   1.00 0.00 ?  180 ALA B O    1  
ATOM   5325   C  CB   . ALA B  2 126 ? -30.670 40.946  6.787   1.00 0.00 ?  180 ALA B CB   1  
ATOM   5326   H  H    . ALA B  2 126 ? -29.249 40.826  8.754   1.00 0.00 ?  180 ALA B H    1  
ATOM   5327   H  HA   . ALA B  2 126 ? -31.936 40.801  8.607   1.00 0.00 ?  180 ALA B HA   1  
ATOM   5328   H  HB1  . ALA B  2 126 ? -29.762 40.382  6.482   1.00 0.00 ?  180 ALA B HB1  1  
ATOM   5329   H  HB2  . ALA B  2 126 ? -30.443 42.032  6.847   1.00 0.00 ?  180 ALA B HB2  1  
ATOM   5330   H  HB3  . ALA B  2 126 ? -31.604 40.901  6.187   1.00 0.00 ?  180 ALA B HB3  1  
ATOM   5331   N  N    . LEU B  2 127 ? -30.622 37.883  7.910   1.00 0.00 ?  181 LEU B N    1  
ATOM   5332   C  CA   . LEU B  2 127 ? -30.887 36.490  7.787   1.00 0.00 ?  181 LEU B CA   1  
ATOM   5333   C  C    . LEU B  2 127 ? -31.557 35.912  8.994   1.00 0.00 ?  181 LEU B C    1  
ATOM   5334   O  O    . LEU B  2 127 ? -32.615 35.331  8.921   1.00 0.00 ?  181 LEU B O    1  
ATOM   5335   C  CB   . LEU B  2 127 ? -29.633 35.610  7.469   1.00 0.00 ?  181 LEU B CB   1  
ATOM   5336   C  CG   . LEU B  2 127 ? -29.772 34.096  7.392   1.00 0.00 ?  181 LEU B CG   1  
ATOM   5337   C  CD1  . LEU B  2 127 ? -30.604 33.766  6.133   1.00 0.00 ?  181 LEU B CD1  1  
ATOM   5338   C  CD2  . LEU B  2 127 ? -28.408 33.337  7.333   1.00 0.00 ?  181 LEU B CD2  1  
ATOM   5339   H  H    . LEU B  2 127 ? -29.662 38.134  7.813   1.00 0.00 ?  181 LEU B H    1  
ATOM   5340   H  HA   . LEU B  2 127 ? -31.598 36.355  6.986   1.00 0.00 ?  181 LEU B HA   1  
ATOM   5341   H  HB2  . LEU B  2 127 ? -29.320 35.988  6.473   1.00 0.00 ?  181 LEU B HB2  1  
ATOM   5342   H  HB3  . LEU B  2 127 ? -28.730 35.940  8.026   1.00 0.00 ?  181 LEU B HB3  1  
ATOM   5343   H  HG   . LEU B  2 127 ? -30.327 33.700  8.269   1.00 0.00 ?  181 LEU B HG   1  
ATOM   5344   H  HD11 . LEU B  2 127 ? -30.563 32.668  5.965   1.00 0.00 ?  181 LEU B HD11 1  
ATOM   5345   H  HD12 . LEU B  2 127 ? -30.262 34.301  5.222   1.00 0.00 ?  181 LEU B HD12 1  
ATOM   5346   H  HD13 . LEU B  2 127 ? -31.661 34.085  6.258   1.00 0.00 ?  181 LEU B HD13 1  
ATOM   5347   H  HD21 . LEU B  2 127 ? -28.007 33.384  6.298   1.00 0.00 ?  181 LEU B HD21 1  
ATOM   5348   H  HD22 . LEU B  2 127 ? -28.456 32.272  7.647   1.00 0.00 ?  181 LEU B HD22 1  
ATOM   5349   H  HD23 . LEU B  2 127 ? -27.626 33.874  7.911   1.00 0.00 ?  181 LEU B HD23 1  
ATOM   5350   N  N    . ARG B  2 128 ? -30.993 36.122  10.153  1.00 0.00 ?  182 ARG B N    1  
ATOM   5351   C  CA   . ARG B  2 128 ? -31.611 35.736  11.417  1.00 0.00 ?  182 ARG B CA   1  
ATOM   5352   C  C    . ARG B  2 128 ? -33.023 36.336  11.639  1.00 0.00 ?  182 ARG B C    1  
ATOM   5353   O  O    . ARG B  2 128 ? -33.926 35.625  12.104  1.00 0.00 ?  182 ARG B O    1  
ATOM   5354   C  CB   . ARG B  2 128 ? -30.557 35.987  12.564  1.00 0.00 ?  182 ARG B CB   1  
ATOM   5355   C  CG   . ARG B  2 128 ? -31.194 35.681  13.974  1.00 0.00 ?  182 ARG B CG   1  
ATOM   5356   C  CD   . ARG B  2 128 ? -30.317 36.115  15.276  1.00 0.00 ?  182 ARG B CD   1  
ATOM   5357   N  NE   . ARG B  2 128 ? -29.818 37.519  15.130  1.00 0.00 ?  182 ARG B NE   1  
ATOM   5358   C  CZ   . ARG B  2 128 ? -28.542 37.881  14.992  1.00 0.00 ?  182 ARG B CZ   1  
ATOM   5359   N  NH1  . ARG B  2 128 ? -28.283 39.142  14.828  1.00 0.00 1  182 ARG B NH1  1  
ATOM   5360   N  NH2  . ARG B  2 128 ? -27.525 37.064  14.951  1.00 0.00 ?  182 ARG B NH2  1  
ATOM   5361   H  H    . ARG B  2 128 ? -30.170 36.684  10.179  1.00 0.00 ?  182 ARG B H    1  
ATOM   5362   H  HA   . ARG B  2 128 ? -31.664 34.663  11.303  1.00 0.00 ?  182 ARG B HA   1  
ATOM   5363   H  HB2  . ARG B  2 128 ? -29.667 35.358  12.348  1.00 0.00 ?  182 ARG B HB2  1  
ATOM   5364   H  HB3  . ARG B  2 128 ? -30.238 37.049  12.505  1.00 0.00 ?  182 ARG B HB3  1  
ATOM   5365   H  HG2  . ARG B  2 128 ? -31.953 36.490  14.027  1.00 0.00 ?  182 ARG B HG2  1  
ATOM   5366   H  HG3  . ARG B  2 128 ? -31.645 34.680  14.147  1.00 0.00 ?  182 ARG B HG3  1  
ATOM   5367   H  HD2  . ARG B  2 128 ? -31.024 36.128  16.133  1.00 0.00 ?  182 ARG B HD2  1  
ATOM   5368   H  HD3  . ARG B  2 128 ? -29.506 35.373  15.435  1.00 0.00 ?  182 ARG B HD3  1  
ATOM   5369   H  HE   . ARG B  2 128 ? -30.531 38.219  15.106  1.00 0.00 ?  182 ARG B HE   1  
ATOM   5370   H  HH11 . ARG B  2 128 ? -29.022 39.805  14.942  1.00 0.00 ?  182 ARG B HH11 1  
ATOM   5371   H  HH12 . ARG B  2 128 ? -27.339 39.433  14.672  1.00 0.00 ?  182 ARG B HH12 1  
ATOM   5372   H  HH21 . ARG B  2 128 ? -26.618 37.377  15.233  1.00 0.00 ?  182 ARG B HH21 1  
ATOM   5373   H  HH22 . ARG B  2 128 ? -27.784 36.193  15.368  1.00 0.00 ?  182 ARG B HH22 1  
ATOM   5374   N  N    . THR B  2 129 ? -33.274 37.629  11.266  1.00 0.00 ?  183 THR B N    1  
ATOM   5375   C  CA   . THR B  2 129 ? -34.590 38.237  11.252  1.00 0.00 ?  183 THR B CA   1  
ATOM   5376   C  C    . THR B  2 129 ? -35.479 37.472  10.295  1.00 0.00 ?  183 THR B C    1  
ATOM   5377   O  O    . THR B  2 129 ? -36.659 37.198  10.673  1.00 0.00 ?  183 THR B O    1  
ATOM   5378   C  CB   . THR B  2 129 ? -34.528 39.733  10.848  1.00 0.00 ?  183 THR B CB   1  
ATOM   5379   O  OG1  . THR B  2 129 ? -33.792 40.436  11.783  1.00 0.00 ?  183 THR B OG1  1  
ATOM   5380   C  CG2  . THR B  2 129 ? -35.847 40.462  10.656  1.00 0.00 ?  183 THR B CG2  1  
ATOM   5381   H  H    . THR B  2 129 ? -32.569 38.285  11.007  1.00 0.00 ?  183 THR B H    1  
ATOM   5382   H  HA   . THR B  2 129 ? -35.126 38.163  12.187  1.00 0.00 ?  183 THR B HA   1  
ATOM   5383   H  HB   . THR B  2 129 ? -33.914 39.878  9.933   1.00 0.00 ?  183 THR B HB   1  
ATOM   5384   H  HG1  . THR B  2 129 ? -32.853 40.250  11.721  1.00 0.00 ?  183 THR B HG1  1  
ATOM   5385   H  HG21 . THR B  2 129 ? -36.297 40.030  9.737   1.00 0.00 ?  183 THR B HG21 1  
ATOM   5386   H  HG22 . THR B  2 129 ? -35.804 41.562  10.507  1.00 0.00 ?  183 THR B HG22 1  
ATOM   5387   H  HG23 . THR B  2 129 ? -36.611 40.332  11.452  1.00 0.00 ?  183 THR B HG23 1  
ATOM   5388   N  N    . HIS B  2 130 ? -34.970 37.109  9.115   1.00 0.00 ?  184 HIS B N    1  
ATOM   5389   C  CA   . HIS B  2 130 ? -35.597 36.311  8.090   1.00 0.00 ?  184 HIS B CA   1  
ATOM   5390   C  C    . HIS B  2 130 ? -35.864 34.808  8.502   1.00 0.00 ?  184 HIS B C    1  
ATOM   5391   O  O    . HIS B  2 130 ? -36.819 34.142  8.043   1.00 0.00 ?  184 HIS B O    1  
ATOM   5392   C  CB   . HIS B  2 130 ? -34.856 36.465  6.760   1.00 0.00 ?  184 HIS B CB   1  
ATOM   5393   C  CG   . HIS B  2 130 ? -35.392 35.724  5.487   1.00 0.00 ?  184 HIS B CG   1  
ATOM   5394   N  ND1  . HIS B  2 130 ? -35.903 36.284  4.335   1.00 0.00 ?  184 HIS B ND1  1  
ATOM   5395   C  CD2  . HIS B  2 130 ? -35.610 34.350  5.337   1.00 0.00 ?  184 HIS B CD2  1  
ATOM   5396   C  CE1  . HIS B  2 130 ? -36.484 35.323  3.602   1.00 0.00 ?  184 HIS B CE1  1  
ATOM   5397   N  NE2  . HIS B  2 130 ? -36.357 34.126  4.179   1.00 0.00 ?  184 HIS B NE2  1  
ATOM   5398   H  H    . HIS B  2 130 ? -34.065 37.441  8.860   1.00 0.00 ?  184 HIS B H    1  
ATOM   5399   H  HA   . HIS B  2 130 ? -36.594 36.714  7.994   1.00 0.00 ?  184 HIS B HA   1  
ATOM   5400   H  HB2  . HIS B  2 130 ? -34.823 37.562  6.588   1.00 0.00 ?  184 HIS B HB2  1  
ATOM   5401   H  HB3  . HIS B  2 130 ? -33.842 36.101  7.032   1.00 0.00 ?  184 HIS B HB3  1  
ATOM   5402   H  HD1  . HIS B  2 130 ? -36.227 37.229  4.388   1.00 0.00 ?  184 HIS B HD1  1  
ATOM   5403   H  HD2  . HIS B  2 130 ? -35.390 33.484  5.948   1.00 0.00 ?  184 HIS B HD2  1  
ATOM   5404   H  HE1  . HIS B  2 130 ? -37.148 35.436  2.745   1.00 0.00 ?  184 HIS B HE1  1  
ATOM   5405   N  N    . LEU B  2 131 ? -34.977 34.293  9.403   1.00 0.00 ?  185 LEU B N    1  
ATOM   5406   C  CA   . LEU B  2 131 ? -34.764 32.840  9.625   1.00 0.00 ?  185 LEU B CA   1  
ATOM   5407   C  C    . LEU B  2 131 ? -35.368 32.229  10.858  1.00 0.00 ?  185 LEU B C    1  
ATOM   5408   O  O    . LEU B  2 131 ? -35.898 31.121  10.801  1.00 0.00 ?  185 LEU B O    1  
ATOM   5409   C  CB   . LEU B  2 131 ? -33.240 32.500  9.574   1.00 0.00 ?  185 LEU B CB   1  
ATOM   5410   C  CG   . LEU B  2 131 ? -32.853 30.972  9.673   1.00 0.00 ?  185 LEU B CG   1  
ATOM   5411   C  CD1  . LEU B  2 131 ? -33.481 30.223  8.502   1.00 0.00 ?  185 LEU B CD1  1  
ATOM   5412   C  CD2  . LEU B  2 131 ? -31.316 30.984  9.539   1.00 0.00 ?  185 LEU B CD2  1  
ATOM   5413   H  H    . LEU B  2 131 ? -34.255 34.945  9.623   1.00 0.00 ?  185 LEU B H    1  
ATOM   5414   H  HA   . LEU B  2 131 ? -35.197 32.381  8.748   1.00 0.00 ?  185 LEU B HA   1  
ATOM   5415   H  HB2  . LEU B  2 131 ? -32.921 32.845  8.568   1.00 0.00 ?  185 LEU B HB2  1  
ATOM   5416   H  HB3  . LEU B  2 131 ? -32.674 33.034  10.367  1.00 0.00 ?  185 LEU B HB3  1  
ATOM   5417   H  HG   . LEU B  2 131 ? -33.154 30.514  10.640  1.00 0.00 ?  185 LEU B HG   1  
ATOM   5418   H  HD11 . LEU B  2 131 ? -34.564 30.147  8.742   1.00 0.00 ?  185 LEU B HD11 1  
ATOM   5419   H  HD12 . LEU B  2 131 ? -33.012 29.219  8.432   1.00 0.00 ?  185 LEU B HD12 1  
ATOM   5420   H  HD13 . LEU B  2 131 ? -33.345 30.743  7.530   1.00 0.00 ?  185 LEU B HD13 1  
ATOM   5421   H  HD21 . LEU B  2 131 ? -30.969 31.223  8.511   1.00 0.00 ?  185 LEU B HD21 1  
ATOM   5422   H  HD22 . LEU B  2 131 ? -30.993 31.724  10.302  1.00 0.00 ?  185 LEU B HD22 1  
ATOM   5423   H  HD23 . LEU B  2 131 ? -30.845 30.061  9.939   1.00 0.00 ?  185 LEU B HD23 1  
ATOM   5424   N  N    . ALA B  2 132 ? -35.350 32.911  11.973  1.00 0.00 ?  186 ALA B N    1  
ATOM   5425   C  CA   . ALA B  2 132 ? -36.123 32.495  13.101  1.00 0.00 ?  186 ALA B CA   1  
ATOM   5426   C  C    . ALA B  2 132 ? -37.631 32.204  12.846  1.00 0.00 ?  186 ALA B C    1  
ATOM   5427   O  O    . ALA B  2 132 ? -38.038 31.181  13.379  1.00 0.00 ?  186 ALA B O    1  
ATOM   5428   C  CB   . ALA B  2 132 ? -35.804 33.470  14.267  1.00 0.00 ?  186 ALA B CB   1  
ATOM   5429   H  H    . ALA B  2 132 ? -34.894 33.797  12.001  1.00 0.00 ?  186 ALA B H    1  
ATOM   5430   H  HA   . ALA B  2 132 ? -35.720 31.540  13.405  1.00 0.00 ?  186 ALA B HA   1  
ATOM   5431   H  HB1  . ALA B  2 132 ? -36.359 34.419  14.107  1.00 0.00 ?  186 ALA B HB1  1  
ATOM   5432   H  HB2  . ALA B  2 132 ? -34.720 33.623  14.457  1.00 0.00 ?  186 ALA B HB2  1  
ATOM   5433   H  HB3  . ALA B  2 132 ? -36.081 32.834  15.135  1.00 0.00 ?  186 ALA B HB3  1  
ATOM   5434   N  N    . PRO B  2 133 ? -38.538 33.017  12.179  1.00 0.00 ?  187 PRO B N    1  
ATOM   5435   C  CA   . PRO B  2 133 ? -39.840 32.468  11.865  1.00 0.00 ?  187 PRO B CA   1  
ATOM   5436   C  C    . PRO B  2 133 ? -39.885 31.361  10.846  1.00 0.00 ?  187 PRO B C    1  
ATOM   5437   O  O    . PRO B  2 133 ? -40.717 30.457  11.027  1.00 0.00 ?  187 PRO B O    1  
ATOM   5438   C  CB   . PRO B  2 133 ? -40.472 33.640  11.193  1.00 0.00 ?  187 PRO B CB   1  
ATOM   5439   C  CG   . PRO B  2 133 ? -39.819 34.852  11.816  1.00 0.00 ?  187 PRO B CG   1  
ATOM   5440   C  CD   . PRO B  2 133 ? -38.365 34.359  11.850  1.00 0.00 ?  187 PRO B CD   1  
ATOM   5441   H  HA   . PRO B  2 133 ? -40.242 32.029  12.766  1.00 0.00 ?  187 PRO B HA   1  
ATOM   5442   H  HB2  . PRO B  2 133 ? -40.305 33.790  10.105  1.00 0.00 ?  187 PRO B HB2  1  
ATOM   5443   H  HB3  . PRO B  2 133 ? -41.564 33.605  11.394  1.00 0.00 ?  187 PRO B HB3  1  
ATOM   5444   H  HG2  . PRO B  2 133 ? -39.924 35.711  11.119  1.00 0.00 ?  187 PRO B HG2  1  
ATOM   5445   H  HG3  . PRO B  2 133 ? -40.156 35.040  12.858  1.00 0.00 ?  187 PRO B HG3  1  
ATOM   5446   H  HD2  . PRO B  2 133 ? -38.003 34.423  10.802  1.00 0.00 ?  187 PRO B HD2  1  
ATOM   5447   H  HD3  . PRO B  2 133 ? -37.686 34.930  12.518  1.00 0.00 ?  187 PRO B HD3  1  
ATOM   5448   N  N    . TYR B  2 134 ? -39.074 31.454  9.754   1.00 0.00 ?  188 TYR B N    1  
ATOM   5449   C  CA   . TYR B  2 134 ? -38.943 30.337  8.786   1.00 0.00 ?  188 TYR B CA   1  
ATOM   5450   C  C    . TYR B  2 134 ? -38.592 28.935  9.442   1.00 0.00 ?  188 TYR B C    1  
ATOM   5451   O  O    . TYR B  2 134 ? -39.144 27.912  9.074   1.00 0.00 ?  188 TYR B O    1  
ATOM   5452   C  CB   . TYR B  2 134 ? -37.852 30.760  7.733   1.00 0.00 ?  188 TYR B CB   1  
ATOM   5453   C  CG   . TYR B  2 134 ? -37.743 29.749  6.646   1.00 0.00 ?  188 TYR B CG   1  
ATOM   5454   C  CD1  . TYR B  2 134 ? -37.000 28.587  6.736   1.00 0.00 ?  188 TYR B CD1  1  
ATOM   5455   C  CD2  . TYR B  2 134 ? -38.518 30.045  5.534   1.00 0.00 ?  188 TYR B CD2  1  
ATOM   5456   C  CE1  . TYR B  2 134 ? -37.020 27.722  5.598   1.00 0.00 ?  188 TYR B CE1  1  
ATOM   5457   C  CE2  . TYR B  2 134 ? -38.517 29.217  4.404   1.00 0.00 ?  188 TYR B CE2  1  
ATOM   5458   C  CZ   . TYR B  2 134 ? -37.764 28.035  4.485   1.00 0.00 ?  188 TYR B CZ   1  
ATOM   5459   O  OH   . TYR B  2 134 ? -38.005 27.157  3.462   1.00 0.00 ?  188 TYR B OH   1  
ATOM   5460   H  H    . TYR B  2 134 ? -38.501 32.246  9.560   1.00 0.00 ?  188 TYR B H    1  
ATOM   5461   H  HA   . TYR B  2 134 ? -39.905 30.209  8.312   1.00 0.00 ?  188 TYR B HA   1  
ATOM   5462   H  HB2  . TYR B  2 134 ? -38.146 31.755  7.335   1.00 0.00 ?  188 TYR B HB2  1  
ATOM   5463   H  HB3  . TYR B  2 134 ? -36.913 30.759  8.327   1.00 0.00 ?  188 TYR B HB3  1  
ATOM   5464   H  HD1  . TYR B  2 134 ? -36.489 28.292  7.641   1.00 0.00 ?  188 TYR B HD1  1  
ATOM   5465   H  HD2  . TYR B  2 134 ? -39.149 30.918  5.449   1.00 0.00 ?  188 TYR B HD2  1  
ATOM   5466   H  HE1  . TYR B  2 134 ? -36.457 26.801  5.569   1.00 0.00 ?  188 TYR B HE1  1  
ATOM   5467   H  HE2  . TYR B  2 134 ? -39.205 29.450  3.605   1.00 0.00 ?  188 TYR B HE2  1  
ATOM   5468   H  HH   . TYR B  2 134 ? -37.315 26.491  3.423   1.00 0.00 ?  188 TYR B HH   1  
ATOM   5469   N  N    . SER B  2 135 ? -37.771 29.002  10.525  1.00 0.00 ?  189 SER B N    1  
ATOM   5470   C  CA   . SER B  2 135 ? -37.309 27.989  11.477  1.00 0.00 ?  189 SER B CA   1  
ATOM   5471   C  C    . SER B  2 135 ? -38.383 27.288  12.204  1.00 0.00 ?  189 SER B C    1  
ATOM   5472   O  O    . SER B  2 135 ? -38.513 26.050  12.123  1.00 0.00 ?  189 SER B O    1  
ATOM   5473   C  CB   . SER B  2 135 ? -36.173 28.441  12.427  1.00 0.00 ?  189 SER B CB   1  
ATOM   5474   O  OG   . SER B  2 135 ? -35.795 27.626  13.556  1.00 0.00 ?  189 SER B OG   1  
ATOM   5475   H  H    . SER B  2 135 ? -37.315 29.885  10.608  1.00 0.00 ?  189 SER B H    1  
ATOM   5476   H  HA   . SER B  2 135 ? -37.023 27.171  10.833  1.00 0.00 ?  189 SER B HA   1  
ATOM   5477   H  HB2  . SER B  2 135 ? -35.241 28.556  11.833  1.00 0.00 ?  189 SER B HB2  1  
ATOM   5478   H  HB3  . SER B  2 135 ? -36.418 29.463  12.789  1.00 0.00 ?  189 SER B HB3  1  
ATOM   5479   H  HG   . SER B  2 135 ? -36.571 27.427  14.085  1.00 0.00 ?  189 SER B HG   1  
ATOM   5480   N  N    . ASP B  2 136 ? -39.208 28.086  12.848  1.00 0.00 ?  190 ASP B N    1  
ATOM   5481   C  CA   . ASP B  2 136 ? -40.312 27.675  13.669  1.00 0.00 ?  190 ASP B CA   1  
ATOM   5482   C  C    . ASP B  2 136 ? -41.404 27.099  12.805  1.00 0.00 ?  190 ASP B C    1  
ATOM   5483   O  O    . ASP B  2 136 ? -41.827 25.970  12.984  1.00 0.00 ?  190 ASP B O    1  
ATOM   5484   C  CB   . ASP B  2 136 ? -40.819 28.773  14.625  1.00 0.00 ?  190 ASP B CB   1  
ATOM   5485   C  CG   . ASP B  2 136 ? -39.913 29.001  15.772  1.00 0.00 ?  190 ASP B CG   1  
ATOM   5486   O  OD1  . ASP B  2 136 ? -38.812 28.431  15.927  1.00 0.00 ?  190 ASP B OD1  1  
ATOM   5487   O  OD2  . ASP B  2 136 ? -40.317 29.772  16.700  1.00 0.00 -1 190 ASP B OD2  1  
ATOM   5488   H  H    . ASP B  2 136 ? -39.102 29.076  12.787  1.00 0.00 ?  190 ASP B H    1  
ATOM   5489   H  HA   . ASP B  2 136 ? -40.049 26.820  14.276  1.00 0.00 ?  190 ASP B HA   1  
ATOM   5490   H  HB2  . ASP B  2 136 ? -41.134 29.753  14.207  1.00 0.00 ?  190 ASP B HB2  1  
ATOM   5491   H  HB3  . ASP B  2 136 ? -41.767 28.364  15.036  1.00 0.00 ?  190 ASP B HB3  1  
ATOM   5492   N  N    . GLU B  2 137 ? -41.872 27.739  11.716  1.00 0.00 ?  191 GLU B N    1  
ATOM   5493   C  CA   . GLU B  2 137 ? -43.001 27.370  10.896  1.00 0.00 ?  191 GLU B CA   1  
ATOM   5494   C  C    . GLU B  2 137 ? -42.741 26.104  10.123  1.00 0.00 ?  191 GLU B C    1  
ATOM   5495   O  O    . GLU B  2 137 ? -43.474 25.117  10.081  1.00 0.00 ?  191 GLU B O    1  
ATOM   5496   C  CB   . GLU B  2 137 ? -43.479 28.551  9.956   1.00 0.00 ?  191 GLU B CB   1  
ATOM   5497   C  CG   . GLU B  2 137 ? -44.003 29.828  10.709  1.00 0.00 ?  191 GLU B CG   1  
ATOM   5498   C  CD   . GLU B  2 137 ? -45.550 29.957  10.795  1.00 0.00 ?  191 GLU B CD   1  
ATOM   5499   O  OE1  . GLU B  2 137 ? -46.108 30.279  9.696   1.00 0.00 ?  191 GLU B OE1  1  
ATOM   5500   O  OE2  . GLU B  2 137 ? -46.158 29.689  11.869  1.00 0.00 -1 191 GLU B OE2  1  
ATOM   5501   H  H    . GLU B  2 137 ? -41.548 28.668  11.553  1.00 0.00 ?  191 GLU B H    1  
ATOM   5502   H  HA   . GLU B  2 137 ? -43.822 27.214  11.580  1.00 0.00 ?  191 GLU B HA   1  
ATOM   5503   H  HB2  . GLU B  2 137 ? -42.617 28.965  9.391   1.00 0.00 ?  191 GLU B HB2  1  
ATOM   5504   H  HB3  . GLU B  2 137 ? -44.278 28.297  9.227   1.00 0.00 ?  191 GLU B HB3  1  
ATOM   5505   H  HG2  . GLU B  2 137 ? -43.488 29.990  11.680  1.00 0.00 ?  191 GLU B HG2  1  
ATOM   5506   H  HG3  . GLU B  2 137 ? -43.737 30.706  10.082  1.00 0.00 ?  191 GLU B HG3  1  
ATOM   5507   N  N    . LEU B  2 138 ? -41.524 26.026  9.642   1.00 0.00 ?  192 LEU B N    1  
ATOM   5508   C  CA   . LEU B  2 138 ? -40.929 24.789  9.111   1.00 0.00 ?  192 LEU B CA   1  
ATOM   5509   C  C    . LEU B  2 138 ? -40.899 23.608  10.073  1.00 0.00 ?  192 LEU B C    1  
ATOM   5510   O  O    . LEU B  2 138 ? -41.293 22.472  9.708   1.00 0.00 ?  192 LEU B O    1  
ATOM   5511   C  CB   . LEU B  2 138 ? -39.528 24.994  8.458   1.00 0.00 ?  192 LEU B CB   1  
ATOM   5512   C  CG   . LEU B  2 138 ? -38.779 23.792  7.895   1.00 0.00 ?  192 LEU B CG   1  
ATOM   5513   C  CD1  . LEU B  2 138 ? -39.655 23.301  6.748   1.00 0.00 ?  192 LEU B CD1  1  
ATOM   5514   C  CD2  . LEU B  2 138 ? -37.366 24.151  7.440   1.00 0.00 ?  192 LEU B CD2  1  
ATOM   5515   H  H    . LEU B  2 138 ? -40.886 26.792  9.645   1.00 0.00 ?  192 LEU B H    1  
ATOM   5516   H  HA   . LEU B  2 138 ? -41.645 24.433  8.384   1.00 0.00 ?  192 LEU B HA   1  
ATOM   5517   H  HB2  . LEU B  2 138 ? -39.605 25.832  7.732   1.00 0.00 ?  192 LEU B HB2  1  
ATOM   5518   H  HB3  . LEU B  2 138 ? -38.917 25.461  9.260   1.00 0.00 ?  192 LEU B HB3  1  
ATOM   5519   H  HG   . LEU B  2 138 ? -38.628 23.012  8.672   1.00 0.00 ?  192 LEU B HG   1  
ATOM   5520   H  HD11 . LEU B  2 138 ? -39.182 22.327  6.498   1.00 0.00 ?  192 LEU B HD11 1  
ATOM   5521   H  HD12 . LEU B  2 138 ? -39.666 24.018  5.900   1.00 0.00 ?  192 LEU B HD12 1  
ATOM   5522   H  HD13 . LEU B  2 138 ? -40.719 23.152  7.034   1.00 0.00 ?  192 LEU B HD13 1  
ATOM   5523   H  HD21 . LEU B  2 138 ? -36.844 24.611  8.307   1.00 0.00 ?  192 LEU B HD21 1  
ATOM   5524   H  HD22 . LEU B  2 138 ? -37.344 24.886  6.607   1.00 0.00 ?  192 LEU B HD22 1  
ATOM   5525   H  HD23 . LEU B  2 138 ? -36.737 23.281  7.153   1.00 0.00 ?  192 LEU B HD23 1  
ATOM   5526   N  N    . ARG B  2 139 ? -40.414 23.797  11.394  1.00 0.00 ?  193 ARG B N    1  
ATOM   5527   C  CA   . ARG B  2 139 ? -40.352 22.663  12.211  1.00 0.00 ?  193 ARG B CA   1  
ATOM   5528   C  C    . ARG B  2 139 ? -41.780 22.044  12.512  1.00 0.00 ?  193 ARG B C    1  
ATOM   5529   O  O    . ARG B  2 139 ? -42.058 20.858  12.446  1.00 0.00 ?  193 ARG B O    1  
ATOM   5530   C  CB   . ARG B  2 139 ? -39.540 23.015  13.548  1.00 0.00 ?  193 ARG B CB   1  
ATOM   5531   C  CG   . ARG B  2 139 ? -39.705 22.150  14.786  1.00 0.00 ?  193 ARG B CG   1  
ATOM   5532   C  CD   . ARG B  2 139 ? -38.521 22.052  15.785  1.00 0.00 ?  193 ARG B CD   1  
ATOM   5533   N  NE   . ARG B  2 139 ? -38.785 21.094  16.904  1.00 0.00 ?  193 ARG B NE   1  
ATOM   5534   C  CZ   . ARG B  2 139 ? -37.926 20.862  17.885  1.00 0.00 ?  193 ARG B CZ   1  
ATOM   5535   N  NH1  . ARG B  2 139 ? -38.509 20.392  19.000  1.00 0.00 1  193 ARG B NH1  1  
ATOM   5536   N  NH2  . ARG B  2 139 ? -36.666 21.069  17.783  1.00 0.00 ?  193 ARG B NH2  1  
ATOM   5537   H  H    . ARG B  2 139 ? -40.140 24.678  11.773  1.00 0.00 ?  193 ARG B H    1  
ATOM   5538   H  HA   . ARG B  2 139 ? -39.845 21.835  11.737  1.00 0.00 ?  193 ARG B HA   1  
ATOM   5539   H  HB2  . ARG B  2 139 ? -38.484 23.068  13.208  1.00 0.00 ?  193 ARG B HB2  1  
ATOM   5540   H  HB3  . ARG B  2 139 ? -39.754 24.069  13.824  1.00 0.00 ?  193 ARG B HB3  1  
ATOM   5541   H  HG2  . ARG B  2 139 ? -40.573 22.548  15.354  1.00 0.00 ?  193 ARG B HG2  1  
ATOM   5542   H  HG3  . ARG B  2 139 ? -39.827 21.082  14.506  1.00 0.00 ?  193 ARG B HG3  1  
ATOM   5543   H  HD2  . ARG B  2 139 ? -37.671 21.591  15.238  1.00 0.00 ?  193 ARG B HD2  1  
ATOM   5544   H  HD3  . ARG B  2 139 ? -38.218 22.963  16.344  1.00 0.00 ?  193 ARG B HD3  1  
ATOM   5545   H  HE   . ARG B  2 139 ? -39.723 21.007  17.238  1.00 0.00 ?  193 ARG B HE   1  
ATOM   5546   H  HH11 . ARG B  2 139 ? -39.497 20.456  19.135  1.00 0.00 ?  193 ARG B HH11 1  
ATOM   5547   H  HH12 . ARG B  2 139 ? -37.931 19.943  19.683  1.00 0.00 ?  193 ARG B HH12 1  
ATOM   5548   H  HH21 . ARG B  2 139 ? -36.227 21.338  16.926  1.00 0.00 ?  193 ARG B HH21 1  
ATOM   5549   H  HH22 . ARG B  2 139 ? -36.050 20.973  18.565  1.00 0.00 ?  193 ARG B HH22 1  
ATOM   5550   N  N    . GLN B  2 140 ? -42.770 22.907  12.876  1.00 0.00 ?  194 GLN B N    1  
ATOM   5551   C  CA   . GLN B  2 140 ? -44.153 22.593  13.145  1.00 0.00 ?  194 GLN B CA   1  
ATOM   5552   C  C    . GLN B  2 140 ? -44.854 21.956  11.980  1.00 0.00 ?  194 GLN B C    1  
ATOM   5553   O  O    . GLN B  2 140 ? -45.397 20.849  12.141  1.00 0.00 ?  194 GLN B O    1  
ATOM   5554   C  CB   . GLN B  2 140 ? -44.978 23.864  13.531  1.00 0.00 ?  194 GLN B CB   1  
ATOM   5555   C  CG   . GLN B  2 140 ? -44.561 24.547  14.905  1.00 0.00 ?  194 GLN B CG   1  
ATOM   5556   C  CD   . GLN B  2 140 ? -44.816 23.520  15.999  1.00 0.00 ?  194 GLN B CD   1  
ATOM   5557   O  OE1  . GLN B  2 140 ? -43.941 22.866  16.527  1.00 0.00 ?  194 GLN B OE1  1  
ATOM   5558   N  NE2  . GLN B  2 140 ? -46.111 23.412  16.321  1.00 0.00 ?  194 GLN B NE2  1  
ATOM   5559   H  H    . GLN B  2 140 ? -42.462 23.853  12.811  1.00 0.00 ?  194 GLN B H    1  
ATOM   5560   H  HA   . GLN B  2 140 ? -44.272 21.830  13.900  1.00 0.00 ?  194 GLN B HA   1  
ATOM   5561   H  HB2  . GLN B  2 140 ? -44.929 24.589  12.690  1.00 0.00 ?  194 GLN B HB2  1  
ATOM   5562   H  HB3  . GLN B  2 140 ? -46.028 23.503  13.589  1.00 0.00 ?  194 GLN B HB3  1  
ATOM   5563   H  HG2  . GLN B  2 140 ? -43.464 24.655  14.768  1.00 0.00 ?  194 GLN B HG2  1  
ATOM   5564   H  HG3  . GLN B  2 140 ? -45.058 25.525  15.078  1.00 0.00 ?  194 GLN B HG3  1  
ATOM   5565   H  HE21 . GLN B  2 140 ? -46.331 22.460  16.537  1.00 0.00 ?  194 GLN B HE21 1  
ATOM   5566   H  HE22 . GLN B  2 140 ? -46.854 23.935  15.904  1.00 0.00 ?  194 GLN B HE22 1  
ATOM   5567   N  N    . ARG B  2 141 ? -44.736 22.509  10.830  1.00 0.00 ?  195 ARG B N    1  
ATOM   5568   C  CA   . ARG B  2 141 ? -45.254 21.954  9.543   1.00 0.00 ?  195 ARG B CA   1  
ATOM   5569   C  C    . ARG B  2 141 ? -44.864 20.554  9.150   1.00 0.00 ?  195 ARG B C    1  
ATOM   5570   O  O    . ARG B  2 141 ? -45.672 19.653  8.846   1.00 0.00 ?  195 ARG B O    1  
ATOM   5571   C  CB   . ARG B  2 141 ? -44.850 22.882  8.353   1.00 0.00 ?  195 ARG B CB   1  
ATOM   5572   C  CG   . ARG B  2 141 ? -45.747 24.163  8.303   1.00 0.00 ?  195 ARG B CG   1  
ATOM   5573   C  CD   . ARG B  2 141 ? -45.527 25.143  7.157   1.00 0.00 ?  195 ARG B CD   1  
ATOM   5574   N  NE   . ARG B  2 141 ? -45.974 24.550  5.843   1.00 0.00 ?  195 ARG B NE   1  
ATOM   5575   C  CZ   . ARG B  2 141 ? -47.137 24.874  5.317   1.00 0.00 ?  195 ARG B CZ   1  
ATOM   5576   N  NH1  . ARG B  2 141 ? -47.432 24.269  4.177   1.00 0.00 1  195 ARG B NH1  1  
ATOM   5577   N  NH2  . ARG B  2 141 ? -47.976 25.647  5.885   1.00 0.00 ?  195 ARG B NH2  1  
ATOM   5578   H  H    . ARG B  2 141 ? -44.199 23.309  10.576  1.00 0.00 ?  195 ARG B H    1  
ATOM   5579   H  HA   . ARG B  2 141 ? -46.328 22.063  9.546   1.00 0.00 ?  195 ARG B HA   1  
ATOM   5580   H  HB2  . ARG B  2 141 ? -43.808 23.269  8.337   1.00 0.00 ?  195 ARG B HB2  1  
ATOM   5581   H  HB3  . ARG B  2 141 ? -44.896 22.274  7.425   1.00 0.00 ?  195 ARG B HB3  1  
ATOM   5582   H  HG2  . ARG B  2 141 ? -46.837 23.955  8.261   1.00 0.00 ?  195 ARG B HG2  1  
ATOM   5583   H  HG3  . ARG B  2 141 ? -45.638 24.747  9.242   1.00 0.00 ?  195 ARG B HG3  1  
ATOM   5584   H  HD2  . ARG B  2 141 ? -45.987 26.148  7.269   1.00 0.00 ?  195 ARG B HD2  1  
ATOM   5585   H  HD3  . ARG B  2 141 ? -44.440 25.335  7.030   1.00 0.00 ?  195 ARG B HD3  1  
ATOM   5586   H  HE   . ARG B  2 141 ? -45.503 23.713  5.564   1.00 0.00 ?  195 ARG B HE   1  
ATOM   5587   H  HH11 . ARG B  2 141 ? -46.625 23.981  3.662   1.00 0.00 ?  195 ARG B HH11 1  
ATOM   5588   H  HH12 . ARG B  2 141 ? -48.228 24.679  3.732   1.00 0.00 ?  195 ARG B HH12 1  
ATOM   5589   H  HH21 . ARG B  2 141 ? -47.612 26.091  6.703   1.00 0.00 ?  195 ARG B HH21 1  
ATOM   5590   H  HH22 . ARG B  2 141 ? -48.937 25.572  5.619   1.00 0.00 ?  195 ARG B HH22 1  
ATOM   5591   N  N    . LEU B  2 142 ? -43.539 20.334  9.247   1.00 0.00 ?  196 LEU B N    1  
ATOM   5592   C  CA   . LEU B  2 142 ? -42.811 19.115  9.027   1.00 0.00 ?  196 LEU B CA   1  
ATOM   5593   C  C    . LEU B  2 142 ? -43.119 18.147  10.152  1.00 0.00 ?  196 LEU B C    1  
ATOM   5594   O  O    . LEU B  2 142 ? -43.316 16.965  9.950   1.00 0.00 ?  196 LEU B O    1  
ATOM   5595   C  CB   . LEU B  2 142 ? -41.287 19.219  8.763   1.00 0.00 ?  196 LEU B CB   1  
ATOM   5596   C  CG   . LEU B  2 142 ? -40.512 17.934  8.411   1.00 0.00 ?  196 LEU B CG   1  
ATOM   5597   C  CD1  . LEU B  2 142 ? -41.028 17.250  7.150   1.00 0.00 ?  196 LEU B CD1  1  
ATOM   5598   C  CD2  . LEU B  2 142 ? -38.988 18.294  8.302   1.00 0.00 ?  196 LEU B CD2  1  
ATOM   5599   H  H    . LEU B  2 142 ? -43.025 21.142  9.523   1.00 0.00 ?  196 LEU B H    1  
ATOM   5600   H  HA   . LEU B  2 142 ? -43.344 18.677  8.197   1.00 0.00 ?  196 LEU B HA   1  
ATOM   5601   H  HB2  . LEU B  2 142 ? -41.012 19.918  7.945   1.00 0.00 ?  196 LEU B HB2  1  
ATOM   5602   H  HB3  . LEU B  2 142 ? -40.766 19.626  9.657   1.00 0.00 ?  196 LEU B HB3  1  
ATOM   5603   H  HG   . LEU B  2 142 ? -40.641 17.217  9.250   1.00 0.00 ?  196 LEU B HG   1  
ATOM   5604   H  HD11 . LEU B  2 142 ? -40.861 17.972  6.323   1.00 0.00 ?  196 LEU B HD11 1  
ATOM   5605   H  HD12 . LEU B  2 142 ? -42.048 16.867  7.367   1.00 0.00 ?  196 LEU B HD12 1  
ATOM   5606   H  HD13 . LEU B  2 142 ? -40.451 16.329  6.917   1.00 0.00 ?  196 LEU B HD13 1  
ATOM   5607   H  HD21 . LEU B  2 142 ? -38.561 18.836  9.172   1.00 0.00 ?  196 LEU B HD21 1  
ATOM   5608   H  HD22 . LEU B  2 142 ? -38.793 18.872  7.374   1.00 0.00 ?  196 LEU B HD22 1  
ATOM   5609   H  HD23 . LEU B  2 142 ? -38.376 17.399  8.058   1.00 0.00 ?  196 LEU B HD23 1  
ATOM   5610   N  N    . ALA B  2 143 ? -43.198 18.559  11.466  1.00 0.00 ?  197 ALA B N    1  
ATOM   5611   C  CA   . ALA B  2 143 ? -43.598 17.636  12.549  1.00 0.00 ?  197 ALA B CA   1  
ATOM   5612   C  C    . ALA B  2 143 ? -44.938 17.114  12.407  1.00 0.00 ?  197 ALA B C    1  
ATOM   5613   O  O    . ALA B  2 143 ? -45.233 15.965  12.519  1.00 0.00 ?  197 ALA B O    1  
ATOM   5614   C  CB   . ALA B  2 143 ? -43.632 18.417  13.834  1.00 0.00 ?  197 ALA B CB   1  
ATOM   5615   H  H    . ALA B  2 143 ? -43.217 19.539  11.648  1.00 0.00 ?  197 ALA B H    1  
ATOM   5616   H  HA   . ALA B  2 143 ? -42.872 16.836  12.553  1.00 0.00 ?  197 ALA B HA   1  
ATOM   5617   H  HB1  . ALA B  2 143 ? -42.583 18.763  13.956  1.00 0.00 ?  197 ALA B HB1  1  
ATOM   5618   H  HB2  . ALA B  2 143 ? -44.098 17.964  14.735  1.00 0.00 ?  197 ALA B HB2  1  
ATOM   5619   H  HB3  . ALA B  2 143 ? -44.309 19.291  13.726  1.00 0.00 ?  197 ALA B HB3  1  
ATOM   5620   N  N    . ALA B  2 144 ? -45.907 17.994  11.997  1.00 0.00 ?  198 ALA B N    1  
ATOM   5621   C  CA   . ALA B  2 144 ? -47.255 17.571  11.657  1.00 0.00 ?  198 ALA B CA   1  
ATOM   5622   C  C    . ALA B  2 144 ? -47.337 16.575  10.534  1.00 0.00 ?  198 ALA B C    1  
ATOM   5623   O  O    . ALA B  2 144 ? -48.166 15.662  10.481  1.00 0.00 ?  198 ALA B O    1  
ATOM   5624   C  CB   . ALA B  2 144 ? -48.100 18.795  11.422  1.00 0.00 ?  198 ALA B CB   1  
ATOM   5625   H  H    . ALA B  2 144 ? -45.747 18.977  11.958  1.00 0.00 ?  198 ALA B H    1  
ATOM   5626   H  HA   . ALA B  2 144 ? -47.691 17.143  12.548  1.00 0.00 ?  198 ALA B HA   1  
ATOM   5627   H  HB1  . ALA B  2 144 ? -49.176 18.517  11.427  1.00 0.00 ?  198 ALA B HB1  1  
ATOM   5628   H  HB2  . ALA B  2 144 ? -47.801 19.401  10.540  1.00 0.00 ?  198 ALA B HB2  1  
ATOM   5629   H  HB3  . ALA B  2 144 ? -48.068 19.380  12.367  1.00 0.00 ?  198 ALA B HB3  1  
ATOM   5630   N  N    . ARG B  2 145 ? -46.491 16.822  9.526   1.00 0.00 ?  199 ARG B N    1  
ATOM   5631   C  CA   . ARG B  2 145 ? -46.472 15.922  8.436   1.00 0.00 ?  199 ARG B CA   1  
ATOM   5632   C  C    . ARG B  2 145 ? -45.941 14.533  8.862   1.00 0.00 ?  199 ARG B C    1  
ATOM   5633   O  O    . ARG B  2 145 ? -46.434 13.463  8.446   1.00 0.00 ?  199 ARG B O    1  
ATOM   5634   C  CB   . ARG B  2 145 ? -45.493 16.518  7.326   1.00 0.00 ?  199 ARG B CB   1  
ATOM   5635   C  CG   . ARG B  2 145 ? -45.525 15.859  5.914   1.00 0.00 ?  199 ARG B CG   1  
ATOM   5636   C  CD   . ARG B  2 145 ? -46.892 15.238  5.433   1.00 0.00 ?  199 ARG B CD   1  
ATOM   5637   N  NE   . ARG B  2 145 ? -47.854 16.435  5.305   1.00 0.00 ?  199 ARG B NE   1  
ATOM   5638   C  CZ   . ARG B  2 145 ? -49.095 16.375  4.909   1.00 0.00 ?  199 ARG B CZ   1  
ATOM   5639   N  NH1  . ARG B  2 145 ? -49.799 17.501  4.745   1.00 0.00 1  199 ARG B NH1  1  
ATOM   5640   N  NH2  . ARG B  2 145 ? -49.711 15.235  4.763   1.00 0.00 ?  199 ARG B NH2  1  
ATOM   5641   H  H    . ARG B  2 145 ? -45.826 17.559  9.618   1.00 0.00 ?  199 ARG B H    1  
ATOM   5642   H  HA   . ARG B  2 145 ? -47.430 15.744  7.971   1.00 0.00 ?  199 ARG B HA   1  
ATOM   5643   H  HB2  . ARG B  2 145 ? -45.812 17.565  7.133   1.00 0.00 ?  199 ARG B HB2  1  
ATOM   5644   H  HB3  . ARG B  2 145 ? -44.453 16.538  7.716   1.00 0.00 ?  199 ARG B HB3  1  
ATOM   5645   H  HG2  . ARG B  2 145 ? -45.131 16.566  5.153   1.00 0.00 ?  199 ARG B HG2  1  
ATOM   5646   H  HG3  . ARG B  2 145 ? -44.776 15.040  5.857   1.00 0.00 ?  199 ARG B HG3  1  
ATOM   5647   H  HD2  . ARG B  2 145 ? -46.932 14.626  4.507   1.00 0.00 ?  199 ARG B HD2  1  
ATOM   5648   H  HD3  . ARG B  2 145 ? -47.181 14.581  6.281   1.00 0.00 ?  199 ARG B HD3  1  
ATOM   5649   H  HE   . ARG B  2 145 ? -47.443 17.342  5.213   1.00 0.00 ?  199 ARG B HE   1  
ATOM   5650   H  HH11 . ARG B  2 145 ? -49.428 18.346  5.131   1.00 0.00 ?  199 ARG B HH11 1  
ATOM   5651   H  HH12 . ARG B  2 145 ? -50.794 17.437  4.816   1.00 0.00 ?  199 ARG B HH12 1  
ATOM   5652   H  HH21 . ARG B  2 145 ? -49.196 14.406  4.544   1.00 0.00 ?  199 ARG B HH21 1  
ATOM   5653   H  HH22 . ARG B  2 145 ? -50.616 15.282  4.342   1.00 0.00 ?  199 ARG B HH22 1  
ATOM   5654   N  N    . LEU B  2 146 ? -44.797 14.490  9.681   1.00 0.00 ?  200 LEU B N    1  
ATOM   5655   C  CA   . LEU B  2 146 ? -44.237 13.211  10.100  1.00 0.00 ?  200 LEU B CA   1  
ATOM   5656   C  C    . LEU B  2 146 ? -45.156 12.406  11.059  1.00 0.00 ?  200 LEU B C    1  
ATOM   5657   O  O    . LEU B  2 146 ? -45.323 11.221  10.821  1.00 0.00 ?  200 LEU B O    1  
ATOM   5658   C  CB   . LEU B  2 146 ? -42.821 13.452  10.743  1.00 0.00 ?  200 LEU B CB   1  
ATOM   5659   C  CG   . LEU B  2 146 ? -41.724 13.886  9.695   1.00 0.00 ?  200 LEU B CG   1  
ATOM   5660   C  CD1  . LEU B  2 146 ? -40.465 14.197  10.455  1.00 0.00 ?  200 LEU B CD1  1  
ATOM   5661   C  CD2  . LEU B  2 146 ? -41.630 12.959  8.497   1.00 0.00 ?  200 LEU B CD2  1  
ATOM   5662   H  H    . LEU B  2 146 ? -44.327 15.312  9.993   1.00 0.00 ?  200 LEU B H    1  
ATOM   5663   H  HA   . LEU B  2 146 ? -44.189 12.582  9.224   1.00 0.00 ?  200 LEU B HA   1  
ATOM   5664   H  HB2  . LEU B  2 146 ? -42.979 14.374  11.342  1.00 0.00 ?  200 LEU B HB2  1  
ATOM   5665   H  HB3  . LEU B  2 146 ? -42.467 12.607  11.373  1.00 0.00 ?  200 LEU B HB3  1  
ATOM   5666   H  HG   . LEU B  2 146 ? -42.070 14.869  9.310   1.00 0.00 ?  200 LEU B HG   1  
ATOM   5667   H  HD11 . LEU B  2 146 ? -39.728 14.745  9.831   1.00 0.00 ?  200 LEU B HD11 1  
ATOM   5668   H  HD12 . LEU B  2 146 ? -39.911 13.285  10.765  1.00 0.00 ?  200 LEU B HD12 1  
ATOM   5669   H  HD13 . LEU B  2 146 ? -40.642 14.879  11.314  1.00 0.00 ?  200 LEU B HD13 1  
ATOM   5670   H  HD21 . LEU B  2 146 ? -40.661 12.946  7.954   1.00 0.00 ?  200 LEU B HD21 1  
ATOM   5671   H  HD22 . LEU B  2 146 ? -42.240 13.219  7.605   1.00 0.00 ?  200 LEU B HD22 1  
ATOM   5672   H  HD23 . LEU B  2 146 ? -41.961 11.933  8.766   1.00 0.00 ?  200 LEU B HD23 1  
ATOM   5673   N  N    . GLU B  2 147 ? -45.912 13.018  12.019  1.00 0.00 ?  201 GLU B N    1  
ATOM   5674   C  CA   . GLU B  2 147 ? -47.097 12.421  12.579  1.00 0.00 ?  201 GLU B CA   1  
ATOM   5675   C  C    . GLU B  2 147 ? -48.177 12.013  11.683  1.00 0.00 ?  201 GLU B C    1  
ATOM   5676   O  O    . GLU B  2 147 ? -48.687 10.900  11.826  1.00 0.00 ?  201 GLU B O    1  
ATOM   5677   C  CB   . GLU B  2 147 ? -47.798 13.438  13.513  1.00 0.00 ?  201 GLU B CB   1  
ATOM   5678   C  CG   . GLU B  2 147 ? -47.005 13.942  14.759  1.00 0.00 ?  201 GLU B CG   1  
ATOM   5679   C  CD   . GLU B  2 147 ? -47.763 14.876  15.688  1.00 0.00 ?  201 GLU B CD   1  
ATOM   5680   O  OE1  . GLU B  2 147 ? -47.086 15.390  16.614  1.00 0.00 ?  201 GLU B OE1  1  
ATOM   5681   O  OE2  . GLU B  2 147 ? -48.872 15.251  15.335  1.00 0.00 -1 201 GLU B OE2  1  
ATOM   5682   H  H    . GLU B  2 147 ? -45.717 13.967  12.255  1.00 0.00 ?  201 GLU B H    1  
ATOM   5683   H  HA   . GLU B  2 147 ? -46.798 11.561  13.159  1.00 0.00 ?  201 GLU B HA   1  
ATOM   5684   H  HB2  . GLU B  2 147 ? -48.066 14.350  12.939  1.00 0.00 ?  201 GLU B HB2  1  
ATOM   5685   H  HB3  . GLU B  2 147 ? -48.806 13.084  13.818  1.00 0.00 ?  201 GLU B HB3  1  
ATOM   5686   H  HG2  . GLU B  2 147 ? -46.607 13.165  15.446  1.00 0.00 ?  201 GLU B HG2  1  
ATOM   5687   H  HG3  . GLU B  2 147 ? -46.079 14.453  14.418  1.00 0.00 ?  201 GLU B HG3  1  
ATOM   5688   N  N    . ALA B  2 148 ? -48.516 12.778  10.618  1.00 0.00 ?  202 ALA B N    1  
ATOM   5689   C  CA   . ALA B  2 148 ? -49.510 12.324  9.628   1.00 0.00 ?  202 ALA B CA   1  
ATOM   5690   C  C    . ALA B  2 148 ? -49.014 11.083  8.886   1.00 0.00 ?  202 ALA B C    1  
ATOM   5691   O  O    . ALA B  2 148 ? -49.666 10.066  8.823   1.00 0.00 ?  202 ALA B O    1  
ATOM   5692   C  CB   . ALA B  2 148 ? -50.050 13.371  8.618   1.00 0.00 ?  202 ALA B CB   1  
ATOM   5693   H  H    . ALA B  2 148 ? -48.136 13.692  10.500  1.00 0.00 ?  202 ALA B H    1  
ATOM   5694   H  HA   . ALA B  2 148 ? -50.469 12.005  10.007  1.00 0.00 ?  202 ALA B HA   1  
ATOM   5695   H  HB1  . ALA B  2 148 ? -50.780 12.865  7.951   1.00 0.00 ?  202 ALA B HB1  1  
ATOM   5696   H  HB2  . ALA B  2 148 ? -49.127 13.788  8.162   1.00 0.00 ?  202 ALA B HB2  1  
ATOM   5697   H  HB3  . ALA B  2 148 ? -50.482 14.195  9.225   1.00 0.00 ?  202 ALA B HB3  1  
ATOM   5698   N  N    . LEU B  2 149 ? -47.766 11.070  8.357   1.00 0.00 ?  203 LEU B N    1  
ATOM   5699   C  CA   . LEU B  2 149 ? -47.183 9.974   7.646   1.00 0.00 ?  203 LEU B CA   1  
ATOM   5700   C  C    . LEU B  2 149 ? -47.072 8.707   8.452   1.00 0.00 ?  203 LEU B C    1  
ATOM   5701   O  O    . LEU B  2 149 ? -47.185 7.616   7.910   1.00 0.00 ?  203 LEU B O    1  
ATOM   5702   C  CB   . LEU B  2 149 ? -45.704 10.341  7.359   1.00 0.00 ?  203 LEU B CB   1  
ATOM   5703   C  CG   . LEU B  2 149 ? -44.803 9.511   6.475   1.00 0.00 ?  203 LEU B CG   1  
ATOM   5704   C  CD1  . LEU B  2 149 ? -45.335 9.249   5.064   1.00 0.00 ?  203 LEU B CD1  1  
ATOM   5705   C  CD2  . LEU B  2 149 ? -43.382 10.066  6.409   1.00 0.00 ?  203 LEU B CD2  1  
ATOM   5706   H  H    . LEU B  2 149 ? -47.167 11.829  8.598   1.00 0.00 ?  203 LEU B H    1  
ATOM   5707   H  HA   . LEU B  2 149 ? -47.847 9.765   6.820   1.00 0.00 ?  203 LEU B HA   1  
ATOM   5708   H  HB2  . LEU B  2 149 ? -45.734 11.346  6.886   1.00 0.00 ?  203 LEU B HB2  1  
ATOM   5709   H  HB3  . LEU B  2 149 ? -45.080 10.359  8.278   1.00 0.00 ?  203 LEU B HB3  1  
ATOM   5710   H  HG   . LEU B  2 149 ? -44.819 8.502   6.940   1.00 0.00 ?  203 LEU B HG   1  
ATOM   5711   H  HD11 . LEU B  2 149 ? -46.368 8.845   5.141   1.00 0.00 ?  203 LEU B HD11 1  
ATOM   5712   H  HD12 . LEU B  2 149 ? -44.732 8.452   4.579   1.00 0.00 ?  203 LEU B HD12 1  
ATOM   5713   H  HD13 . LEU B  2 149 ? -45.283 10.166  4.439   1.00 0.00 ?  203 LEU B HD13 1  
ATOM   5714   H  HD21 . LEU B  2 149 ? -43.351 11.104  6.012   1.00 0.00 ?  203 LEU B HD21 1  
ATOM   5715   H  HD22 . LEU B  2 149 ? -42.834 9.353   5.757   1.00 0.00 ?  203 LEU B HD22 1  
ATOM   5716   H  HD23 . LEU B  2 149 ? -42.784 10.067  7.345   1.00 0.00 ?  203 LEU B HD23 1  
ATOM   5717   N  N    . LYS B  2 150 ? -46.779 8.907   9.791   1.00 0.00 ?  204 LYS B N    1  
ATOM   5718   C  CA   . LYS B  2 150 ? -46.477 7.803   10.685  1.00 0.00 ?  204 LYS B CA   1  
ATOM   5719   C  C    . LYS B  2 150 ? -47.784 7.040   11.057  1.00 0.00 ?  204 LYS B C    1  
ATOM   5720   O  O    . LYS B  2 150 ? -47.844 5.813   11.170  1.00 0.00 ?  204 LYS B O    1  
ATOM   5721   C  CB   . LYS B  2 150 ? -45.771 8.316   11.936  1.00 0.00 ?  204 LYS B CB   1  
ATOM   5722   C  CG   . LYS B  2 150 ? -45.269 7.121   12.771  1.00 0.00 ?  204 LYS B CG   1  
ATOM   5723   C  CD   . LYS B  2 150 ? -44.397 7.667   13.916  1.00 0.00 ?  204 LYS B CD   1  
ATOM   5724   C  CE   . LYS B  2 150 ? -44.019 6.551   14.924  1.00 0.00 ?  204 LYS B CE   1  
ATOM   5725   N  NZ   . LYS B  2 150 ? -43.339 6.899   16.190  1.00 0.00 1  204 LYS B NZ   1  
ATOM   5726   H  H    . LYS B  2 150 ? -46.686 9.840   10.129  1.00 0.00 ?  204 LYS B H    1  
ATOM   5727   H  HA   . LYS B  2 150 ? -45.831 7.110   10.166  1.00 0.00 ?  204 LYS B HA   1  
ATOM   5728   H  HB2  . LYS B  2 150 ? -44.874 8.908   11.653  1.00 0.00 ?  204 LYS B HB2  1  
ATOM   5729   H  HB3  . LYS B  2 150 ? -46.362 8.963   12.619  1.00 0.00 ?  204 LYS B HB3  1  
ATOM   5730   H  HG2  . LYS B  2 150 ? -46.085 6.584   13.301  1.00 0.00 ?  204 LYS B HG2  1  
ATOM   5731   H  HG3  . LYS B  2 150 ? -44.786 6.343   12.142  1.00 0.00 ?  204 LYS B HG3  1  
ATOM   5732   H  HD2  . LYS B  2 150 ? -43.490 8.129   13.471  1.00 0.00 ?  204 LYS B HD2  1  
ATOM   5733   H  HD3  . LYS B  2 150 ? -45.034 8.441   14.396  1.00 0.00 ?  204 LYS B HD3  1  
ATOM   5734   H  HE2  . LYS B  2 150 ? -44.866 5.887   15.199  1.00 0.00 ?  204 LYS B HE2  1  
ATOM   5735   H  HE3  . LYS B  2 150 ? -43.300 5.910   14.371  1.00 0.00 ?  204 LYS B HE3  1  
ATOM   5736   H  HZ1  . LYS B  2 150 ? -43.812 7.611   16.784  1.00 0.00 ?  204 LYS B HZ1  1  
ATOM   5737   H  HZ2  . LYS B  2 150 ? -42.434 7.366   15.980  1.00 0.00 ?  204 LYS B HZ2  1  
ATOM   5738   H  HZ3  . LYS B  2 150 ? -43.179 6.085   16.817  1.00 0.00 ?  204 LYS B HZ3  1  
ATOM   5739   N  N    . GLU B  2 151 ? -48.885 7.815   11.217  1.00 0.00 ?  205 GLU B N    1  
ATOM   5740   C  CA   . GLU B  2 151 ? -50.212 7.316   11.562  1.00 0.00 ?  205 GLU B CA   1  
ATOM   5741   C  C    . GLU B  2 151 ? -50.802 6.369   10.533  1.00 0.00 ?  205 GLU B C    1  
ATOM   5742   O  O    . GLU B  2 151 ? -51.227 5.244   10.773  1.00 0.00 ?  205 GLU B O    1  
ATOM   5743   C  CB   . GLU B  2 151 ? -51.054 8.536   11.861  1.00 0.00 ?  205 GLU B CB   1  
ATOM   5744   C  CG   . GLU B  2 151 ? -52.637 8.330   11.756  1.00 0.00 ?  205 GLU B CG   1  
ATOM   5745   C  CD   . GLU B  2 151 ? -53.364 9.642   12.002  1.00 0.00 ?  205 GLU B CD   1  
ATOM   5746   O  OE1  . GLU B  2 151 ? -53.086 10.469  12.936  1.00 0.00 ?  205 GLU B OE1  1  
ATOM   5747   O  OE2  . GLU B  2 151 ? -54.300 9.938   11.152  1.00 0.00 -1 205 GLU B OE2  1  
ATOM   5748   H  H    . GLU B  2 151 ? -48.859 8.798   11.051  1.00 0.00 ?  205 GLU B H    1  
ATOM   5749   H  HA   . GLU B  2 151 ? -50.161 6.756   12.484  1.00 0.00 ?  205 GLU B HA   1  
ATOM   5750   H  HB2  . GLU B  2 151 ? -50.768 8.859   12.885  1.00 0.00 ?  205 GLU B HB2  1  
ATOM   5751   H  HB3  . GLU B  2 151 ? -50.696 9.330   11.172  1.00 0.00 ?  205 GLU B HB3  1  
ATOM   5752   H  HG2  . GLU B  2 151 ? -52.778 8.009   10.701  1.00 0.00 ?  205 GLU B HG2  1  
ATOM   5753   H  HG3  . GLU B  2 151 ? -53.014 7.540   12.439  1.00 0.00 ?  205 GLU B HG3  1  
ATOM   5754   N  N    . ASN B  2 152 ? -50.741 6.818   9.279   1.00 0.00 ?  206 ASN B N    1  
ATOM   5755   C  CA   . ASN B  2 152 ? -50.991 6.003   8.136   1.00 0.00 ?  206 ASN B CA   1  
ATOM   5756   C  C    . ASN B  2 152 ? -49.891 4.882   7.992   1.00 0.00 ?  206 ASN B C    1  
ATOM   5757   O  O    . ASN B  2 152 ? -50.239 3.656   7.995   1.00 0.00 ?  206 ASN B O    1  
ATOM   5758   C  CB   . ASN B  2 152 ? -51.073 6.883   6.924   1.00 0.00 ?  206 ASN B CB   1  
ATOM   5759   C  CG   . ASN B  2 152 ? -52.379 7.603   6.876   1.00 0.00 ?  206 ASN B CG   1  
ATOM   5760   O  OD1  . ASN B  2 152 ? -52.302 8.865   6.868   1.00 0.00 ?  206 ASN B OD1  1  
ATOM   5761   N  ND2  . ASN B  2 152 ? -53.579 7.005   6.763   1.00 0.00 ?  206 ASN B ND2  1  
ATOM   5762   H  H    . ASN B  2 152 ? -50.660 7.797   9.110   1.00 0.00 ?  206 ASN B H    1  
ATOM   5763   H  HA   . ASN B  2 152 ? -51.902 5.433   8.239   1.00 0.00 ?  206 ASN B HA   1  
ATOM   5764   H  HB2  . ASN B  2 152 ? -50.281 7.662   6.961   1.00 0.00 ?  206 ASN B HB2  1  
ATOM   5765   H  HB3  . ASN B  2 152 ? -50.909 6.287   6.001   1.00 0.00 ?  206 ASN B HB3  1  
ATOM   5766   H  HD21 . ASN B  2 152 ? -54.335 7.647   6.635   1.00 0.00 ?  206 ASN B HD21 1  
ATOM   5767   H  HD22 . ASN B  2 152 ? -53.580 6.006   6.811   1.00 0.00 ?  206 ASN B HD22 1  
ATOM   5768   N  N    . GLY B  2 153 ? -48.529 5.190   8.002   1.00 0.00 ?  207 GLY B N    1  
ATOM   5769   C  CA   . GLY B  2 153 ? -47.585 4.090   7.796   1.00 0.00 ?  207 GLY B CA   1  
ATOM   5770   C  C    . GLY B  2 153 ? -47.421 2.941   8.793   1.00 0.00 ?  207 GLY B C    1  
ATOM   5771   O  O    . GLY B  2 153 ? -47.282 1.819   8.384   1.00 0.00 ?  207 GLY B O    1  
ATOM   5772   H  H    . GLY B  2 153 ? -48.252 6.143   7.907   1.00 0.00 ?  207 GLY B H    1  
ATOM   5773   H  HA2  . GLY B  2 153 ? -47.834 3.511   6.918   1.00 0.00 ?  207 GLY B HA2  1  
ATOM   5774   H  HA3  . GLY B  2 153 ? -46.593 4.492   7.652   1.00 0.00 ?  207 GLY B HA3  1  
ATOM   5775   N  N    . GLY B  2 154 ? -47.656 3.186   10.143  1.00 0.00 ?  208 GLY B N    1  
ATOM   5776   C  CA   . GLY B  2 154 ? -47.809 2.141   11.153  1.00 0.00 ?  208 GLY B CA   1  
ATOM   5777   C  C    . GLY B  2 154 ? -49.043 1.235   11.035  1.00 0.00 ?  208 GLY B C    1  
ATOM   5778   O  O    . GLY B  2 154 ? -48.962 0.063   11.274  1.00 0.00 ?  208 GLY B O    1  
ATOM   5779   H  H    . GLY B  2 154 ? -47.753 4.122   10.473  1.00 0.00 ?  208 GLY B H    1  
ATOM   5780   H  HA2  . GLY B  2 154 ? -46.866 1.616   11.144  1.00 0.00 ?  208 GLY B HA2  1  
ATOM   5781   H  HA3  . GLY B  2 154 ? -47.783 2.675   12.091  1.00 0.00 ?  208 GLY B HA3  1  
ATOM   5782   N  N    . ALA B  2 155 ? -50.175 1.780   10.645  1.00 0.00 ?  209 ALA B N    1  
ATOM   5783   C  CA   . ALA B  2 155 ? -51.332 0.974   10.342  1.00 0.00 ?  209 ALA B CA   1  
ATOM   5784   C  C    . ALA B  2 155 ? -51.130 0.059   9.196   1.00 0.00 ?  209 ALA B C    1  
ATOM   5785   O  O    . ALA B  2 155 ? -51.660 -1.057  9.212   1.00 0.00 ?  209 ALA B O    1  
ATOM   5786   C  CB   . ALA B  2 155 ? -52.438 1.959   9.931   1.00 0.00 ?  209 ALA B CB   1  
ATOM   5787   H  H    . ALA B  2 155 ? -50.071 2.718   10.326  1.00 0.00 ?  209 ALA B H    1  
ATOM   5788   H  HA   . ALA B  2 155 ? -51.600 0.519   11.284  1.00 0.00 ?  209 ALA B HA   1  
ATOM   5789   H  HB1  . ALA B  2 155 ? -52.142 2.403   8.956   1.00 0.00 ?  209 ALA B HB1  1  
ATOM   5790   H  HB2  . ALA B  2 155 ? -52.413 2.868   10.569  1.00 0.00 ?  209 ALA B HB2  1  
ATOM   5791   H  HB3  . ALA B  2 155 ? -53.462 1.533   10.000  1.00 0.00 ?  209 ALA B HB3  1  
ATOM   5792   N  N    . ARG B  2 156 ? -50.480 0.517   8.039   1.00 0.00 ?  210 ARG B N    1  
ATOM   5793   C  CA   . ARG B  2 156 ? -50.077 -0.363  7.014   1.00 0.00 ?  210 ARG B CA   1  
ATOM   5794   C  C    . ARG B  2 156 ? -49.011 -1.365  7.432   1.00 0.00 ?  210 ARG B C    1  
ATOM   5795   O  O    . ARG B  2 156 ? -48.986 -2.457  6.901   1.00 0.00 ?  210 ARG B O    1  
ATOM   5796   C  CB   . ARG B  2 156 ? -49.657 0.445   5.727   1.00 0.00 ?  210 ARG B CB   1  
ATOM   5797   C  CG   . ARG B  2 156 ? -50.817 0.664   4.779   1.00 0.00 ?  210 ARG B CG   1  
ATOM   5798   C  CD   . ARG B  2 156 ? -51.998 1.615   5.144   1.00 0.00 ?  210 ARG B CD   1  
ATOM   5799   N  NE   . ARG B  2 156 ? -52.935 0.877   5.996   1.00 0.00 ?  210 ARG B NE   1  
ATOM   5800   C  CZ   . ARG B  2 156 ? -54.098 1.287   6.593   1.00 0.00 ?  210 ARG B CZ   1  
ATOM   5801   N  NH1  . ARG B  2 156 ? -54.630 0.433   7.357   1.00 0.00 1  210 ARG B NH1  1  
ATOM   5802   N  NH2  . ARG B  2 156 ? -54.409 2.620   6.694   1.00 0.00 ?  210 ARG B NH2  1  
ATOM   5803   H  H    . ARG B  2 156 ? -50.271 1.484   7.914   1.00 0.00 ?  210 ARG B H    1  
ATOM   5804   H  HA   . ARG B  2 156 ? -50.895 -0.960  6.640   1.00 0.00 ?  210 ARG B HA   1  
ATOM   5805   H  HB2  . ARG B  2 156 ? -49.039 1.311   6.046   1.00 0.00 ?  210 ARG B HB2  1  
ATOM   5806   H  HB3  . ARG B  2 156 ? -48.833 -0.136  5.259   1.00 0.00 ?  210 ARG B HB3  1  
ATOM   5807   H  HG2  . ARG B  2 156 ? -50.242 1.043   3.908   1.00 0.00 ?  210 ARG B HG2  1  
ATOM   5808   H  HG3  . ARG B  2 156 ? -51.200 -0.250  4.277   1.00 0.00 ?  210 ARG B HG3  1  
ATOM   5809   H  HD2  . ARG B  2 156 ? -51.777 2.592   5.624   1.00 0.00 ?  210 ARG B HD2  1  
ATOM   5810   H  HD3  . ARG B  2 156 ? -52.405 1.945   4.164   1.00 0.00 ?  210 ARG B HD3  1  
ATOM   5811   H  HE   . ARG B  2 156 ? -52.698 -0.070  6.213   1.00 0.00 ?  210 ARG B HE   1  
ATOM   5812   H  HH11 . ARG B  2 156 ? -54.343 -0.501  7.145   1.00 0.00 ?  210 ARG B HH11 1  
ATOM   5813   H  HH12 . ARG B  2 156 ? -55.533 0.670   7.715   1.00 0.00 ?  210 ARG B HH12 1  
ATOM   5814   H  HH21 . ARG B  2 156 ? -53.871 3.298   6.193   1.00 0.00 ?  210 ARG B HH21 1  
ATOM   5815   H  HH22 . ARG B  2 156 ? -55.217 2.824   7.247   1.00 0.00 ?  210 ARG B HH22 1  
ATOM   5816   N  N    . LEU B  2 157 ? -48.016 -0.974  8.289   1.00 0.00 ?  211 LEU B N    1  
ATOM   5817   C  CA   . LEU B  2 157 ? -46.997 -1.878  8.686   1.00 0.00 ?  211 LEU B CA   1  
ATOM   5818   C  C    . LEU B  2 157 ? -47.479 -3.046  9.396   1.00 0.00 ?  211 LEU B C    1  
ATOM   5819   O  O    . LEU B  2 157 ? -47.033 -4.167  9.195   1.00 0.00 ?  211 LEU B O    1  
ATOM   5820   C  CB   . LEU B  2 157 ? -45.906 -1.130  9.465   1.00 0.00 ?  211 LEU B CB   1  
ATOM   5821   C  CG   . LEU B  2 157 ? -44.679 -1.941  9.844   1.00 0.00 ?  211 LEU B CG   1  
ATOM   5822   C  CD1  . LEU B  2 157 ? -44.053 -2.769  8.655   1.00 0.00 ?  211 LEU B CD1  1  
ATOM   5823   C  CD2  . LEU B  2 157 ? -43.634 -0.984  10.420  1.00 0.00 ?  211 LEU B CD2  1  
ATOM   5824   H  H    . LEU B  2 157 ? -48.011 -0.068  8.706   1.00 0.00 ?  211 LEU B H    1  
ATOM   5825   H  HA   . LEU B  2 157 ? -46.473 -2.248  7.817   1.00 0.00 ?  211 LEU B HA   1  
ATOM   5826   H  HB2  . LEU B  2 157 ? -45.600 -0.270  8.832   1.00 0.00 ?  211 LEU B HB2  1  
ATOM   5827   H  HB3  . LEU B  2 157 ? -46.362 -0.750  10.404  1.00 0.00 ?  211 LEU B HB3  1  
ATOM   5828   H  HG   . LEU B  2 157 ? -45.029 -2.684  10.592  1.00 0.00 ?  211 LEU B HG   1  
ATOM   5829   H  HD11 . LEU B  2 157 ? -44.741 -3.330  7.987   1.00 0.00 ?  211 LEU B HD11 1  
ATOM   5830   H  HD12 . LEU B  2 157 ? -43.402 -3.567  9.073   1.00 0.00 ?  211 LEU B HD12 1  
ATOM   5831   H  HD13 . LEU B  2 157 ? -43.400 -2.111  8.043   1.00 0.00 ?  211 LEU B HD13 1  
ATOM   5832   H  HD21 . LEU B  2 157 ? -44.061 -0.372  11.243  1.00 0.00 ?  211 LEU B HD21 1  
ATOM   5833   H  HD22 . LEU B  2 157 ? -43.174 -0.293  9.682   1.00 0.00 ?  211 LEU B HD22 1  
ATOM   5834   H  HD23 . LEU B  2 157 ? -42.743 -1.535  10.789  1.00 0.00 ?  211 LEU B HD23 1  
ATOM   5835   N  N    . ALA B  2 158 ? -48.463 -2.859  10.337  1.00 0.00 ?  212 ALA B N    1  
ATOM   5836   C  CA   . ALA B  2 158 ? -48.995 -4.016  11.018  1.00 0.00 ?  212 ALA B CA   1  
ATOM   5837   C  C    . ALA B  2 158 ? -49.601 -4.998  9.992   1.00 0.00 ?  212 ALA B C    1  
ATOM   5838   O  O    . ALA B  2 158 ? -49.316 -6.195  10.158  1.00 0.00 ?  212 ALA B O    1  
ATOM   5839   C  CB   . ALA B  2 158 ? -50.013 -3.374  11.996  1.00 0.00 ?  212 ALA B CB   1  
ATOM   5840   H  H    . ALA B  2 158 ? -48.726 -1.936  10.607  1.00 0.00 ?  212 ALA B H    1  
ATOM   5841   H  HA   . ALA B  2 158 ? -48.257 -4.667  11.463  1.00 0.00 ?  212 ALA B HA   1  
ATOM   5842   H  HB1  . ALA B  2 158 ? -50.761 -2.736  11.478  1.00 0.00 ?  212 ALA B HB1  1  
ATOM   5843   H  HB2  . ALA B  2 158 ? -49.629 -2.802  12.867  1.00 0.00 ?  212 ALA B HB2  1  
ATOM   5844   H  HB3  . ALA B  2 158 ? -50.485 -4.161  12.623  1.00 0.00 ?  212 ALA B HB3  1  
ATOM   5845   N  N    . GLU B  2 159 ? -50.306 -4.574  8.945   1.00 0.00 ?  213 GLU B N    1  
ATOM   5846   C  CA   . GLU B  2 159 ? -50.929 -5.403  7.896   1.00 0.00 ?  213 GLU B CA   1  
ATOM   5847   C  C    . GLU B  2 159 ? -49.904 -6.108  6.984   1.00 0.00 ?  213 GLU B C    1  
ATOM   5848   O  O    . GLU B  2 159 ? -50.056 -7.187  6.509   1.00 0.00 ?  213 GLU B O    1  
ATOM   5849   C  CB   . GLU B  2 159 ? -51.890 -4.489  7.094   1.00 0.00 ?  213 GLU B CB   1  
ATOM   5850   C  CG   . GLU B  2 159 ? -52.989 -3.779  7.953   1.00 0.00 ?  213 GLU B CG   1  
ATOM   5851   C  CD   . GLU B  2 159 ? -53.899 -2.829  7.166   1.00 0.00 ?  213 GLU B CD   1  
ATOM   5852   O  OE1  . GLU B  2 159 ? -53.374 -2.065  6.406   1.00 0.00 ?  213 GLU B OE1  1  
ATOM   5853   O  OE2  . GLU B  2 159 ? -55.059 -2.713  7.579   1.00 0.00 -1 213 GLU B OE2  1  
ATOM   5854   H  H    . GLU B  2 159 ? -50.467 -3.594  8.864   1.00 0.00 ?  213 GLU B H    1  
ATOM   5855   H  HA   . GLU B  2 159 ? -51.463 -6.182  8.420   1.00 0.00 ?  213 GLU B HA   1  
ATOM   5856   H  HB2  . GLU B  2 159 ? -51.242 -3.704  6.650   1.00 0.00 ?  213 GLU B HB2  1  
ATOM   5857   H  HB3  . GLU B  2 159 ? -52.370 -5.071  6.278   1.00 0.00 ?  213 GLU B HB3  1  
ATOM   5858   H  HG2  . GLU B  2 159 ? -53.535 -4.536  8.555   1.00 0.00 ?  213 GLU B HG2  1  
ATOM   5859   H  HG3  . GLU B  2 159 ? -52.599 -3.242  8.844   1.00 0.00 ?  213 GLU B HG3  1  
ATOM   5860   N  N    . TYR B  2 160 ? -48.823 -5.434  6.712   1.00 0.00 ?  214 TYR B N    1  
ATOM   5861   C  CA   . TYR B  2 160 ? -47.713 -5.968  6.114   1.00 0.00 ?  214 TYR B CA   1  
ATOM   5862   C  C    . TYR B  2 160 ? -47.009 -7.020  6.947   1.00 0.00 ?  214 TYR B C    1  
ATOM   5863   O  O    . TYR B  2 160 ? -46.636 -8.078  6.447   1.00 0.00 ?  214 TYR B O    1  
ATOM   5864   C  CB   . TYR B  2 160 ? -46.708 -4.809  5.813   1.00 0.00 ?  214 TYR B CB   1  
ATOM   5865   C  CG   . TYR B  2 160 ? -47.147 -3.946  4.615   1.00 0.00 ?  214 TYR B CG   1  
ATOM   5866   C  CD1  . TYR B  2 160 ? -48.073 -4.274  3.578   1.00 0.00 ?  214 TYR B CD1  1  
ATOM   5867   C  CD2  . TYR B  2 160 ? -46.684 -2.590  4.505   1.00 0.00 ?  214 TYR B CD2  1  
ATOM   5868   C  CE1  . TYR B  2 160 ? -48.663 -3.328  2.686   1.00 0.00 ?  214 TYR B CE1  1  
ATOM   5869   C  CE2  . TYR B  2 160 ? -47.278 -1.626  3.687   1.00 0.00 ?  214 TYR B CE2  1  
ATOM   5870   C  CZ   . TYR B  2 160 ? -48.260 -2.031  2.761   1.00 0.00 ?  214 TYR B CZ   1  
ATOM   5871   O  OH   . TYR B  2 160 ? -48.822 -1.020  1.952   1.00 0.00 ?  214 TYR B OH   1  
ATOM   5872   H  H    . TYR B  2 160 ? -48.798 -4.472  6.971   1.00 0.00 ?  214 TYR B H    1  
ATOM   5873   H  HA   . TYR B  2 160 ? -48.012 -6.426  5.182   1.00 0.00 ?  214 TYR B HA   1  
ATOM   5874   H  HB2  . TYR B  2 160 ? -46.414 -4.196  6.692   1.00 0.00 ?  214 TYR B HB2  1  
ATOM   5875   H  HB3  . TYR B  2 160 ? -45.766 -5.287  5.469   1.00 0.00 ?  214 TYR B HB3  1  
ATOM   5876   H  HD1  . TYR B  2 160 ? -48.659 -5.176  3.681   1.00 0.00 ?  214 TYR B HD1  1  
ATOM   5877   H  HD2  . TYR B  2 160 ? -45.975 -2.163  5.198   1.00 0.00 ?  214 TYR B HD2  1  
ATOM   5878   H  HE1  . TYR B  2 160 ? -49.536 -3.482  2.069   1.00 0.00 ?  214 TYR B HE1  1  
ATOM   5879   H  HE2  . TYR B  2 160 ? -46.937 -0.602  3.653   1.00 0.00 ?  214 TYR B HE2  1  
ATOM   5880   H  HH   . TYR B  2 160 ? -49.696 -1.330  1.704   1.00 0.00 ?  214 TYR B HH   1  
ATOM   5881   N  N    . HIS B  2 161 ? -46.834 -6.775  8.271   1.00 0.00 ?  215 HIS B N    1  
ATOM   5882   C  CA   . HIS B  2 161 ? -46.231 -7.692  9.232   1.00 0.00 ?  215 HIS B CA   1  
ATOM   5883   C  C    . HIS B  2 161 ? -47.013 -9.006  9.483   1.00 0.00 ?  215 HIS B C    1  
ATOM   5884   O  O    . HIS B  2 161 ? -46.473 -10.104 9.643   1.00 0.00 ?  215 HIS B O    1  
ATOM   5885   C  CB   . HIS B  2 161 ? -45.968 -6.953  10.579  1.00 0.00 ?  215 HIS B CB   1  
ATOM   5886   C  CG   . HIS B  2 161 ? -45.182 -7.766  11.629  1.00 0.00 ?  215 HIS B CG   1  
ATOM   5887   N  ND1  . HIS B  2 161 ? -45.747 -8.582  12.576  1.00 0.00 ?  215 HIS B ND1  1  
ATOM   5888   C  CD2  . HIS B  2 161 ? -43.824 -7.797  11.910  1.00 0.00 ?  215 HIS B CD2  1  
ATOM   5889   C  CE1  . HIS B  2 161 ? -44.805 -9.181  13.272  1.00 0.00 ?  215 HIS B CE1  1  
ATOM   5890   N  NE2  . HIS B  2 161 ? -43.588 -8.736  12.889  1.00 0.00 ?  215 HIS B NE2  1  
ATOM   5891   H  H    . HIS B  2 161 ? -46.969 -5.869  8.665   1.00 0.00 ?  215 HIS B H    1  
ATOM   5892   H  HA   . HIS B  2 161 ? -45.170 -7.824  9.080   1.00 0.00 ?  215 HIS B HA   1  
ATOM   5893   H  HB2  . HIS B  2 161 ? -45.393 -6.032  10.345  1.00 0.00 ?  215 HIS B HB2  1  
ATOM   5894   H  HB3  . HIS B  2 161 ? -46.984 -6.710  10.956  1.00 0.00 ?  215 HIS B HB3  1  
ATOM   5895   H  HD1  . HIS B  2 161 ? -46.729 -8.739  12.681  1.00 0.00 ?  215 HIS B HD1  1  
ATOM   5896   H  HD2  . HIS B  2 161 ? -43.015 -7.371  11.330  1.00 0.00 ?  215 HIS B HD2  1  
ATOM   5897   H  HE1  . HIS B  2 161 ? -45.136 -9.825  14.086  1.00 0.00 ?  215 HIS B HE1  1  
ATOM   5898   N  N    . ALA B  2 162 ? -48.384 -8.838  9.542   1.00 0.00 ?  216 ALA B N    1  
ATOM   5899   C  CA   . ALA B  2 162 ? -49.367 -9.879  9.584   1.00 0.00 ?  216 ALA B CA   1  
ATOM   5900   C  C    . ALA B  2 162 ? -49.224 -10.983 8.402   1.00 0.00 ?  216 ALA B C    1  
ATOM   5901   O  O    . ALA B  2 162 ? -49.114 -12.167 8.624   1.00 0.00 ?  216 ALA B O    1  
ATOM   5902   C  CB   . ALA B  2 162 ? -50.753 -9.241  9.390   1.00 0.00 ?  216 ALA B CB   1  
ATOM   5903   H  H    . ALA B  2 162 ? -48.663 -7.881  9.525   1.00 0.00 ?  216 ALA B H    1  
ATOM   5904   H  HA   . ALA B  2 162 ? -49.245 -10.331 10.557  1.00 0.00 ?  216 ALA B HA   1  
ATOM   5905   H  HB1  . ALA B  2 162 ? -50.923 -8.486  10.187  1.00 0.00 ?  216 ALA B HB1  1  
ATOM   5906   H  HB2  . ALA B  2 162 ? -51.689 -9.837  9.443   1.00 0.00 ?  216 ALA B HB2  1  
ATOM   5907   H  HB3  . ALA B  2 162 ? -50.866 -8.781  8.385   1.00 0.00 ?  216 ALA B HB3  1  
ATOM   5908   N  N    . LYS B  2 163 ? -49.170 -10.545 7.120   1.00 0.00 ?  217 LYS B N    1  
ATOM   5909   C  CA   . LYS B  2 163 ? -48.809 -11.375 5.966   1.00 0.00 ?  217 LYS B CA   1  
ATOM   5910   C  C    . LYS B  2 163 ? -47.394 -11.912 6.093   1.00 0.00 ?  217 LYS B C    1  
ATOM   5911   O  O    . LYS B  2 163 ? -47.239 -13.107 5.805   1.00 0.00 ?  217 LYS B O    1  
ATOM   5912   C  CB   . LYS B  2 163 ? -49.023 -10.508 4.692   1.00 0.00 ?  217 LYS B CB   1  
ATOM   5913   C  CG   . LYS B  2 163 ? -50.488 -10.466 4.327   1.00 0.00 ?  217 LYS B CG   1  
ATOM   5914   C  CD   . LYS B  2 163 ? -51.262 -11.893 4.133   1.00 0.00 ?  217 LYS B CD   1  
ATOM   5915   C  CE   . LYS B  2 163 ? -50.512 -12.945 3.308   1.00 0.00 ?  217 LYS B CE   1  
ATOM   5916   N  NZ   . LYS B  2 163 ? -51.374 -14.193 3.238   1.00 0.00 1  217 LYS B NZ   1  
ATOM   5917   H  H    . LYS B  2 163 ? -49.105 -9.554  7.035   1.00 0.00 ?  217 LYS B H    1  
ATOM   5918   H  HA   . LYS B  2 163 ? -49.401 -12.278 5.968   1.00 0.00 ?  217 LYS B HA   1  
ATOM   5919   H  HB2  . LYS B  2 163 ? -48.538 -9.509  4.741   1.00 0.00 ?  217 LYS B HB2  1  
ATOM   5920   H  HB3  . LYS B  2 163 ? -48.488 -11.009 3.857   1.00 0.00 ?  217 LYS B HB3  1  
ATOM   5921   H  HG2  . LYS B  2 163 ? -50.899 -9.852  5.156   1.00 0.00 ?  217 LYS B HG2  1  
ATOM   5922   H  HG3  . LYS B  2 163 ? -50.543 -9.965  3.337   1.00 0.00 ?  217 LYS B HG3  1  
ATOM   5923   H  HD2  . LYS B  2 163 ? -51.439 -12.213 5.182   1.00 0.00 ?  217 LYS B HD2  1  
ATOM   5924   H  HD3  . LYS B  2 163 ? -52.278 -11.752 3.706   1.00 0.00 ?  217 LYS B HD3  1  
ATOM   5925   H  HE2  . LYS B  2 163 ? -50.315 -12.665 2.251   1.00 0.00 ?  217 LYS B HE2  1  
ATOM   5926   H  HE3  . LYS B  2 163 ? -49.558 -13.202 3.817   1.00 0.00 ?  217 LYS B HE3  1  
ATOM   5927   H  HZ1  . LYS B  2 163 ? -51.310 -14.635 4.177   1.00 0.00 ?  217 LYS B HZ1  1  
ATOM   5928   H  HZ2  . LYS B  2 163 ? -51.113 -14.943 2.566   1.00 0.00 ?  217 LYS B HZ2  1  
ATOM   5929   H  HZ3  . LYS B  2 163 ? -52.366 -13.985 3.005   1.00 0.00 ?  217 LYS B HZ3  1  
ATOM   5930   N  N    . ALA B  2 164 ? -46.348 -11.127 6.428   1.00 0.00 ?  218 ALA B N    1  
ATOM   5931   C  CA   . ALA B  2 164 ? -44.966 -11.662 6.730   1.00 0.00 ?  218 ALA B CA   1  
ATOM   5932   C  C    . ALA B  2 164 ? -44.955 -12.752 7.815   1.00 0.00 ?  218 ALA B C    1  
ATOM   5933   O  O    . ALA B  2 164 ? -44.325 -13.762 7.705   1.00 0.00 ?  218 ALA B O    1  
ATOM   5934   C  CB   . ALA B  2 164 ? -44.121 -10.481 7.107   1.00 0.00 ?  218 ALA B CB   1  
ATOM   5935   H  H    . ALA B  2 164 ? -46.533 -10.159 6.579   1.00 0.00 ?  218 ALA B H    1  
ATOM   5936   H  HA   . ALA B  2 164 ? -44.577 -12.086 5.815   1.00 0.00 ?  218 ALA B HA   1  
ATOM   5937   H  HB1  . ALA B  2 164 ? -43.108 -10.936 7.151   1.00 0.00 ?  218 ALA B HB1  1  
ATOM   5938   H  HB2  . ALA B  2 164 ? -44.426 -9.926  8.020   1.00 0.00 ?  218 ALA B HB2  1  
ATOM   5939   H  HB3  . ALA B  2 164 ? -44.102 -9.778  6.247   1.00 0.00 ?  218 ALA B HB3  1  
ATOM   5940   N  N    . THR B  2 165 ? -45.626 -12.551 8.941   1.00 0.00 ?  219 THR B N    1  
ATOM   5941   C  CA   . THR B  2 165 ? -45.675 -13.466 10.058  1.00 0.00 ?  219 THR B CA   1  
ATOM   5942   C  C    . THR B  2 165 ? -46.220 -14.786 9.617   1.00 0.00 ?  219 THR B C    1  
ATOM   5943   O  O    . THR B  2 165 ? -45.624 -15.838 9.846   1.00 0.00 ?  219 THR B O    1  
ATOM   5944   C  CB   . THR B  2 165 ? -46.501 -12.972 11.262  1.00 0.00 ?  219 THR B CB   1  
ATOM   5945   O  OG1  . THR B  2 165 ? -45.892 -11.800 11.766  1.00 0.00 ?  219 THR B OG1  1  
ATOM   5946   C  CG2  . THR B  2 165 ? -46.671 -13.885 12.484  1.00 0.00 ?  219 THR B CG2  1  
ATOM   5947   H  H    . THR B  2 165 ? -46.039 -11.653 9.072   1.00 0.00 ?  219 THR B H    1  
ATOM   5948   H  HA   . THR B  2 165 ? -44.652 -13.501 10.403  1.00 0.00 ?  219 THR B HA   1  
ATOM   5949   H  HB   . THR B  2 165 ? -47.561 -12.795 10.979  1.00 0.00 ?  219 THR B HB   1  
ATOM   5950   H  HG1  . THR B  2 165 ? -45.804 -11.156 11.059  1.00 0.00 ?  219 THR B HG1  1  
ATOM   5951   H  HG21 . THR B  2 165 ? -47.217 -13.431 13.339  1.00 0.00 ?  219 THR B HG21 1  
ATOM   5952   H  HG22 . THR B  2 165 ? -45.653 -14.234 12.759  1.00 0.00 ?  219 THR B HG22 1  
ATOM   5953   H  HG23 . THR B  2 165 ? -47.314 -14.773 12.302  1.00 0.00 ?  219 THR B HG23 1  
ATOM   5954   N  N    . GLU B  2 166 ? -47.281 -14.784 8.824   1.00 0.00 ?  220 GLU B N    1  
ATOM   5955   C  CA   . GLU B  2 166 ? -47.642 -16.002 8.112   1.00 0.00 ?  220 GLU B CA   1  
ATOM   5956   C  C    . GLU B  2 166 ? -46.606 -16.532 7.122   1.00 0.00 ?  220 GLU B C    1  
ATOM   5957   O  O    . GLU B  2 166 ? -46.322 -17.713 7.169   1.00 0.00 ?  220 GLU B O    1  
ATOM   5958   C  CB   . GLU B  2 166 ? -49.040 -15.685 7.401   1.00 0.00 ?  220 GLU B CB   1  
ATOM   5959   C  CG   . GLU B  2 166 ? -49.699 -16.824 6.553   1.00 0.00 ?  220 GLU B CG   1  
ATOM   5960   C  CD   . GLU B  2 166 ? -50.914 -16.247 5.903   1.00 0.00 ?  220 GLU B CD   1  
ATOM   5961   O  OE1  . GLU B  2 166 ? -51.176 -15.042 5.968   1.00 0.00 ?  220 GLU B OE1  1  
ATOM   5962   O  OE2  . GLU B  2 166 ? -51.697 -17.055 5.283   1.00 0.00 -1 220 GLU B OE2  1  
ATOM   5963   H  H    . GLU B  2 166 ? -47.897 -14.020 8.649   1.00 0.00 ?  220 GLU B H    1  
ATOM   5964   H  HA   . GLU B  2 166 ? -47.886 -16.797 8.801   1.00 0.00 ?  220 GLU B HA   1  
ATOM   5965   H  HB2  . GLU B  2 166 ? -49.727 -15.231 8.147   1.00 0.00 ?  220 GLU B HB2  1  
ATOM   5966   H  HB3  . GLU B  2 166 ? -48.923 -14.870 6.656   1.00 0.00 ?  220 GLU B HB3  1  
ATOM   5967   H  HG2  . GLU B  2 166 ? -49.113 -17.234 5.704   1.00 0.00 ?  220 GLU B HG2  1  
ATOM   5968   H  HG3  . GLU B  2 166 ? -49.877 -17.729 7.172   1.00 0.00 ?  220 GLU B HG3  1  
ATOM   5969   N  N    . HIS B  2 167 ? -45.910 -15.727 6.230   1.00 0.00 ?  221 HIS B N    1  
ATOM   5970   C  CA   . HIS B  2 167 ? -44.929 -16.302 5.364   1.00 0.00 ?  221 HIS B CA   1  
ATOM   5971   C  C    . HIS B  2 167 ? -43.682 -16.849 6.103   1.00 0.00 ?  221 HIS B C    1  
ATOM   5972   O  O    . HIS B  2 167 ? -43.117 -17.809 5.684   1.00 0.00 ?  221 HIS B O    1  
ATOM   5973   C  CB   . HIS B  2 167 ? -44.548 -15.378 4.207   1.00 0.00 ?  221 HIS B CB   1  
ATOM   5974   C  CG   . HIS B  2 167 ? -45.618 -14.936 3.310   1.00 0.00 ?  221 HIS B CG   1  
ATOM   5975   N  ND1  . HIS B  2 167 ? -46.749 -15.722 2.982   1.00 0.00 ?  221 HIS B ND1  1  
ATOM   5976   C  CD2  . HIS B  2 167 ? -45.832 -13.741 2.738   1.00 0.00 ?  221 HIS B CD2  1  
ATOM   5977   C  CE1  . HIS B  2 167 ? -47.540 -14.959 2.199   1.00 0.00 ?  221 HIS B CE1  1  
ATOM   5978   N  NE2  . HIS B  2 167 ? -47.047 -13.749 2.031   1.00 0.00 ?  221 HIS B NE2  1  
ATOM   5979   H  H    . HIS B  2 167 ? -46.105 -14.764 6.058   1.00 0.00 ?  221 HIS B H    1  
ATOM   5980   H  HA   . HIS B  2 167 ? -45.363 -17.144 4.846   1.00 0.00 ?  221 HIS B HA   1  
ATOM   5981   H  HB2  . HIS B  2 167 ? -44.274 -14.392 4.641   1.00 0.00 ?  221 HIS B HB2  1  
ATOM   5982   H  HB3  . HIS B  2 167 ? -43.660 -15.762 3.660   1.00 0.00 ?  221 HIS B HB3  1  
ATOM   5983   H  HD1  . HIS B  2 167 ? -46.991 -16.626 3.336   1.00 0.00 ?  221 HIS B HD1  1  
ATOM   5984   H  HD2  . HIS B  2 167 ? -45.170 -12.891 2.854   1.00 0.00 ?  221 HIS B HD2  1  
ATOM   5985   H  HE1  . HIS B  2 167 ? -48.391 -15.385 1.667   1.00 0.00 ?  221 HIS B HE1  1  
ATOM   5986   N  N    . LEU B  2 168 ? -43.187 -16.152 7.169   1.00 0.00 ?  222 LEU B N    1  
ATOM   5987   C  CA   . LEU B  2 168 ? -42.164 -16.613 8.109   1.00 0.00 ?  222 LEU B CA   1  
ATOM   5988   C  C    . LEU B  2 168 ? -42.498 -17.873 8.815   1.00 0.00 ?  222 LEU B C    1  
ATOM   5989   O  O    . LEU B  2 168 ? -41.722 -18.773 8.917   1.00 0.00 ?  222 LEU B O    1  
ATOM   5990   C  CB   . LEU B  2 168 ? -42.026 -15.485 9.196   1.00 0.00 ?  222 LEU B CB   1  
ATOM   5991   C  CG   . LEU B  2 168 ? -41.164 -15.823 10.470  1.00 0.00 ?  222 LEU B CG   1  
ATOM   5992   C  CD1  . LEU B  2 168 ? -39.717 -16.008 10.154  1.00 0.00 ?  222 LEU B CD1  1  
ATOM   5993   C  CD2  . LEU B  2 168 ? -41.311 -14.698 11.476  1.00 0.00 ?  222 LEU B CD2  1  
ATOM   5994   H  H    . LEU B  2 168 ? -43.687 -15.338 7.457   1.00 0.00 ?  222 LEU B H    1  
ATOM   5995   H  HA   . LEU B  2 168 ? -41.238 -16.744 7.569   1.00 0.00 ?  222 LEU B HA   1  
ATOM   5996   H  HB2  . LEU B  2 168 ? -41.586 -14.592 8.703   1.00 0.00 ?  222 LEU B HB2  1  
ATOM   5997   H  HB3  . LEU B  2 168 ? -43.050 -15.213 9.531   1.00 0.00 ?  222 LEU B HB3  1  
ATOM   5998   H  HG   . LEU B  2 168 ? -41.500 -16.798 10.883  1.00 0.00 ?  222 LEU B HG   1  
ATOM   5999   H  HD11 . LEU B  2 168 ? -39.364 -15.035 9.750   1.00 0.00 ?  222 LEU B HD11 1  
ATOM   6000   H  HD12 . LEU B  2 168 ? -39.582 -16.747 9.335   1.00 0.00 ?  222 LEU B HD12 1  
ATOM   6001   H  HD13 . LEU B  2 168 ? -39.180 -16.326 11.073  1.00 0.00 ?  222 LEU B HD13 1  
ATOM   6002   H  HD21 . LEU B  2 168 ? -40.794 -14.683 12.459  1.00 0.00 ?  222 LEU B HD21 1  
ATOM   6003   H  HD22 . LEU B  2 168 ? -42.404 -14.615 11.657  1.00 0.00 ?  222 LEU B HD22 1  
ATOM   6004   H  HD23 . LEU B  2 168 ? -40.996 -13.765 10.962  1.00 0.00 ?  222 LEU B HD23 1  
ATOM   6005   N  N    . SER B  2 169 ? -43.753 -17.993 9.273   1.00 0.00 ?  223 SER B N    1  
ATOM   6006   C  CA   . SER B  2 169 ? -44.307 -19.168 9.888   1.00 0.00 ?  223 SER B CA   1  
ATOM   6007   C  C    . SER B  2 169 ? -44.304 -20.404 8.984   1.00 0.00 ?  223 SER B C    1  
ATOM   6008   O  O    . SER B  2 169 ? -43.896 -21.487 9.335   1.00 0.00 ?  223 SER B O    1  
ATOM   6009   C  CB   . SER B  2 169 ? -45.788 -19.113 10.238  1.00 0.00 ?  223 SER B CB   1  
ATOM   6010   O  OG   . SER B  2 169 ? -45.929 -18.242 11.363  1.00 0.00 ?  223 SER B OG   1  
ATOM   6011   H  H    . SER B  2 169 ? -44.336 -17.188 9.192   1.00 0.00 ?  223 SER B H    1  
ATOM   6012   H  HA   . SER B  2 169 ? -43.785 -19.396 10.806  1.00 0.00 ?  223 SER B HA   1  
ATOM   6013   H  HB2  . SER B  2 169 ? -46.432 -18.655 9.456   1.00 0.00 ?  223 SER B HB2  1  
ATOM   6014   H  HB3  . SER B  2 169 ? -46.199 -20.083 10.590  1.00 0.00 ?  223 SER B HB3  1  
ATOM   6015   H  HG   . SER B  2 169 ? -45.509 -17.408 11.140  1.00 0.00 ?  223 SER B HG   1  
ATOM   6016   N  N    . THR B  2 170 ? -44.654 -20.202 7.742   1.00 0.00 ?  224 THR B N    1  
ATOM   6017   C  CA   . THR B  2 170 ? -44.720 -21.149 6.655   1.00 0.00 ?  224 THR B CA   1  
ATOM   6018   C  C    . THR B  2 170 ? -43.328 -21.665 6.356   1.00 0.00 ?  224 THR B C    1  
ATOM   6019   O  O    . THR B  2 170 ? -43.051 -22.862 6.126   1.00 0.00 ?  224 THR B O    1  
ATOM   6020   C  CB   . THR B  2 170 ? -45.279 -20.536 5.374   1.00 0.00 ?  224 THR B CB   1  
ATOM   6021   O  OG1  . THR B  2 170 ? -46.646 -20.200 5.621   1.00 0.00 ?  224 THR B OG1  1  
ATOM   6022   C  CG2  . THR B  2 170 ? -45.347 -21.708 4.285   1.00 0.00 ?  224 THR B CG2  1  
ATOM   6023   H  H    . THR B  2 170 ? -44.983 -19.271 7.603   1.00 0.00 ?  224 THR B H    1  
ATOM   6024   H  HA   . THR B  2 170 ? -45.311 -21.989 6.986   1.00 0.00 ?  224 THR B HA   1  
ATOM   6025   H  HB   . THR B  2 170 ? -44.818 -19.557 5.123   1.00 0.00 ?  224 THR B HB   1  
ATOM   6026   H  HG1  . THR B  2 170 ? -46.689 -19.588 6.360   1.00 0.00 ?  224 THR B HG1  1  
ATOM   6027   H  HG21 . THR B  2 170 ? -44.380 -21.889 3.767   1.00 0.00 ?  224 THR B HG21 1  
ATOM   6028   H  HG22 . THR B  2 170 ? -46.082 -21.436 3.497   1.00 0.00 ?  224 THR B HG22 1  
ATOM   6029   H  HG23 . THR B  2 170 ? -45.632 -22.642 4.813   1.00 0.00 ?  224 THR B HG23 1  
ATOM   6030   N  N    . LEU B  2 171 ? -42.301 -20.807 6.391   1.00 0.00 ?  225 LEU B N    1  
ATOM   6031   C  CA   . LEU B  2 171 ? -40.933 -21.331 6.187   1.00 0.00 ?  225 LEU B CA   1  
ATOM   6032   C  C    . LEU B  2 171 ? -40.428 -22.100 7.427   1.00 0.00 ?  225 LEU B C    1  
ATOM   6033   O  O    . LEU B  2 171 ? -39.850 -23.176 7.290   1.00 0.00 ?  225 LEU B O    1  
ATOM   6034   C  CB   . LEU B  2 171 ? -39.904 -20.243 5.828   1.00 0.00 ?  225 LEU B CB   1  
ATOM   6035   C  CG   . LEU B  2 171 ? -40.165 -19.684 4.447   1.00 0.00 ?  225 LEU B CG   1  
ATOM   6036   C  CD1  . LEU B  2 171 ? -39.624 -18.281 4.453   1.00 0.00 ?  225 LEU B CD1  1  
ATOM   6037   C  CD2  . LEU B  2 171 ? -39.660 -20.448 3.230   1.00 0.00 ?  225 LEU B CD2  1  
ATOM   6038   H  H    . LEU B  2 171 ? -42.306 -19.908 6.821   1.00 0.00 ?  225 LEU B H    1  
ATOM   6039   H  HA   . LEU B  2 171 ? -41.033 -22.087 5.422   1.00 0.00 ?  225 LEU B HA   1  
ATOM   6040   H  HB2  . LEU B  2 171 ? -40.047 -19.486 6.629   1.00 0.00 ?  225 LEU B HB2  1  
ATOM   6041   H  HB3  . LEU B  2 171 ? -38.868 -20.643 5.843   1.00 0.00 ?  225 LEU B HB3  1  
ATOM   6042   H  HG   . LEU B  2 171 ? -41.264 -19.587 4.314   1.00 0.00 ?  225 LEU B HG   1  
ATOM   6043   H  HD11 . LEU B  2 171 ? -40.075 -17.660 5.257   1.00 0.00 ?  225 LEU B HD11 1  
ATOM   6044   H  HD12 . LEU B  2 171 ? -39.645 -17.938 3.397   1.00 0.00 ?  225 LEU B HD12 1  
ATOM   6045   H  HD13 . LEU B  2 171 ? -38.559 -18.408 4.742   1.00 0.00 ?  225 LEU B HD13 1  
ATOM   6046   H  HD21 . LEU B  2 171 ? -40.075 -20.036 2.285   1.00 0.00 ?  225 LEU B HD21 1  
ATOM   6047   H  HD22 . LEU B  2 171 ? -40.038 -21.493 3.259   1.00 0.00 ?  225 LEU B HD22 1  
ATOM   6048   H  HD23 . LEU B  2 171 ? -38.550 -20.408 3.217   1.00 0.00 ?  225 LEU B HD23 1  
ATOM   6049   N  N    . SER B  2 172 ? -40.746 -21.603 8.638   1.00 0.00 ?  226 SER B N    1  
ATOM   6050   C  CA   . SER B  2 172 ? -40.438 -22.316 9.918   1.00 0.00 ?  226 SER B CA   1  
ATOM   6051   C  C    . SER B  2 172 ? -41.057 -23.672 9.970   1.00 0.00 ?  226 SER B C    1  
ATOM   6052   O  O    . SER B  2 172 ? -40.377 -24.684 10.248  1.00 0.00 ?  226 SER B O    1  
ATOM   6053   C  CB   . SER B  2 172 ? -40.872 -21.526 11.163  1.00 0.00 ?  226 SER B CB   1  
ATOM   6054   O  OG   . SER B  2 172 ? -40.472 -22.276 12.346  1.00 0.00 ?  226 SER B OG   1  
ATOM   6055   H  H    . SER B  2 172 ? -41.209 -20.756 8.885   1.00 0.00 ?  226 SER B H    1  
ATOM   6056   H  HA   . SER B  2 172 ? -39.388 -22.558 9.847   1.00 0.00 ?  226 SER B HA   1  
ATOM   6057   H  HB2  . SER B  2 172 ? -40.294 -20.587 11.305  1.00 0.00 ?  226 SER B HB2  1  
ATOM   6058   H  HB3  . SER B  2 172 ? -41.951 -21.264 11.175  1.00 0.00 ?  226 SER B HB3  1  
ATOM   6059   H  HG   . SER B  2 172 ? -41.174 -22.314 13.000  1.00 0.00 ?  226 SER B HG   1  
ATOM   6060   N  N    . GLU B  2 173 ? -42.291 -23.804 9.466   1.00 0.00 ?  227 GLU B N    1  
ATOM   6061   C  CA   . GLU B  2 173 ? -42.881 -25.147 9.294   1.00 0.00 ?  227 GLU B CA   1  
ATOM   6062   C  C    . GLU B  2 173 ? -42.408 -26.034 8.176   1.00 0.00 ?  227 GLU B C    1  
ATOM   6063   O  O    . GLU B  2 173 ? -42.543 -27.250 8.177   1.00 0.00 ?  227 GLU B O    1  
ATOM   6064   C  CB   . GLU B  2 173 ? -44.497 -25.081 9.253   1.00 0.00 ?  227 GLU B CB   1  
ATOM   6065   C  CG   . GLU B  2 173 ? -44.998 -24.623 10.655  1.00 0.00 ?  227 GLU B CG   1  
ATOM   6066   C  CD   . GLU B  2 173 ? -46.475 -24.832 10.745  1.00 0.00 ?  227 GLU B CD   1  
ATOM   6067   O  OE1  . GLU B  2 173 ? -47.005 -25.754 10.067  1.00 0.00 ?  227 GLU B OE1  1  
ATOM   6068   O  OE2  . GLU B  2 173 ? -47.201 -24.044 11.438  1.00 0.00 -1 227 GLU B OE2  1  
ATOM   6069   H  H    . GLU B  2 173 ? -42.867 -23.005 9.307   1.00 0.00 ?  227 GLU B H    1  
ATOM   6070   H  HA   . GLU B  2 173 ? -42.744 -25.732 10.191  1.00 0.00 ?  227 GLU B HA   1  
ATOM   6071   H  HB2  . GLU B  2 173 ? -44.816 -24.500 8.361   1.00 0.00 ?  227 GLU B HB2  1  
ATOM   6072   H  HB3  . GLU B  2 173 ? -44.869 -26.113 9.075   1.00 0.00 ?  227 GLU B HB3  1  
ATOM   6073   H  HG2  . GLU B  2 173 ? -44.423 -25.029 11.515  1.00 0.00 ?  227 GLU B HG2  1  
ATOM   6074   H  HG3  . GLU B  2 173 ? -44.698 -23.555 10.720  1.00 0.00 ?  227 GLU B HG3  1  
ATOM   6075   N  N    . LYS B  2 174 ? -41.927 -25.450 7.078   1.00 0.00 ?  228 LYS B N    1  
ATOM   6076   C  CA   . LYS B  2 174 ? -41.485 -26.226 5.941   1.00 0.00 ?  228 LYS B CA   1  
ATOM   6077   C  C    . LYS B  2 174 ? -40.085 -26.841 6.220   1.00 0.00 ?  228 LYS B C    1  
ATOM   6078   O  O    . LYS B  2 174 ? -39.743 -27.933 5.726   1.00 0.00 ?  228 LYS B O    1  
ATOM   6079   C  CB   . LYS B  2 174 ? -41.490 -25.388 4.647   1.00 0.00 ?  228 LYS B CB   1  
ATOM   6080   C  CG   . LYS B  2 174 ? -41.090 -26.018 3.289   1.00 0.00 ?  228 LYS B CG   1  
ATOM   6081   C  CD   . LYS B  2 174 ? -40.847 -25.070 2.100   1.00 0.00 ?  228 LYS B CD   1  
ATOM   6082   C  CE   . LYS B  2 174 ? -40.392 -25.734 0.741   1.00 0.00 ?  228 LYS B CE   1  
ATOM   6083   N  NZ   . LYS B  2 174 ? -41.467 -26.538 0.160   1.00 0.00 1  228 LYS B NZ   1  
ATOM   6084   H  H    . LYS B  2 174 ? -42.041 -24.465 6.967   1.00 0.00 ?  228 LYS B H    1  
ATOM   6085   H  HA   . LYS B  2 174 ? -42.216 -26.989 5.717   1.00 0.00 ?  228 LYS B HA   1  
ATOM   6086   H  HB2  . LYS B  2 174 ? -42.490 -24.947 4.448   1.00 0.00 ?  228 LYS B HB2  1  
ATOM   6087   H  HB3  . LYS B  2 174 ? -40.857 -24.487 4.794   1.00 0.00 ?  228 LYS B HB3  1  
ATOM   6088   H  HG2  . LYS B  2 174 ? -40.082 -26.423 3.523   1.00 0.00 ?  228 LYS B HG2  1  
ATOM   6089   H  HG3  . LYS B  2 174 ? -41.900 -26.733 3.029   1.00 0.00 ?  228 LYS B HG3  1  
ATOM   6090   H  HD2  . LYS B  2 174 ? -41.800 -24.500 2.074   1.00 0.00 ?  228 LYS B HD2  1  
ATOM   6091   H  HD3  . LYS B  2 174 ? -40.125 -24.311 2.472   1.00 0.00 ?  228 LYS B HD3  1  
ATOM   6092   H  HE2  . LYS B  2 174 ? -40.011 -25.005 -0.006  1.00 0.00 ?  228 LYS B HE2  1  
ATOM   6093   H  HE3  . LYS B  2 174 ? -39.519 -26.352 1.041   1.00 0.00 ?  228 LYS B HE3  1  
ATOM   6094   H  HZ1  . LYS B  2 174 ? -41.734 -27.466 0.545   1.00 0.00 ?  228 LYS B HZ1  1  
ATOM   6095   H  HZ2  . LYS B  2 174 ? -41.307 -26.776 -0.839  1.00 0.00 ?  228 LYS B HZ2  1  
ATOM   6096   H  HZ3  . LYS B  2 174 ? -42.335 -25.966 0.194   1.00 0.00 ?  228 LYS B HZ3  1  
ATOM   6097   N  N    . ALA B  2 175 ? -39.191 -26.068 6.837   1.00 0.00 ?  229 ALA B N    1  
ATOM   6098   C  CA   . ALA B  2 175 ? -37.844 -26.493 7.179   1.00 0.00 ?  229 ALA B CA   1  
ATOM   6099   C  C    . ALA B  2 175 ? -37.812 -27.712 8.120   1.00 0.00 ?  229 ALA B C    1  
ATOM   6100   O  O    . ALA B  2 175 ? -37.034 -28.664 7.894   1.00 0.00 ?  229 ALA B O    1  
ATOM   6101   C  CB   . ALA B  2 175 ? -37.216 -25.246 7.946   1.00 0.00 ?  229 ALA B CB   1  
ATOM   6102   H  H    . ALA B  2 175 ? -39.520 -25.152 7.055   1.00 0.00 ?  229 ALA B H    1  
ATOM   6103   H  HA   . ALA B  2 175 ? -37.363 -26.727 6.241   1.00 0.00 ?  229 ALA B HA   1  
ATOM   6104   H  HB1  . ALA B  2 175 ? -36.510 -25.667 8.693   1.00 0.00 ?  229 ALA B HB1  1  
ATOM   6105   H  HB2  . ALA B  2 175 ? -37.939 -24.675 8.566   1.00 0.00 ?  229 ALA B HB2  1  
ATOM   6106   H  HB3  . ALA B  2 175 ? -36.770 -24.540 7.213   1.00 0.00 ?  229 ALA B HB3  1  
ATOM   6107   N  N    . LYS B  2 176 ? -38.540 -27.643 9.185   1.00 0.00 ?  230 LYS B N    1  
ATOM   6108   C  CA   . LYS B  2 176 ? -38.553 -28.732 10.197  1.00 0.00 ?  230 LYS B CA   1  
ATOM   6109   C  C    . LYS B  2 176 ? -38.820 -30.234 9.748   1.00 0.00 ?  230 LYS B C    1  
ATOM   6110   O  O    . LYS B  2 176 ? -37.947 -31.100 9.978   1.00 0.00 ?  230 LYS B O    1  
ATOM   6111   C  CB   . LYS B  2 176 ? -39.356 -28.292 11.428  1.00 0.00 ?  230 LYS B CB   1  
ATOM   6112   C  CG   . LYS B  2 176 ? -39.958 -29.431 12.382  1.00 0.00 ?  230 LYS B CG   1  
ATOM   6113   C  CD   . LYS B  2 176 ? -40.710 -28.885 13.609  1.00 0.00 ?  230 LYS B CD   1  
ATOM   6114   C  CE   . LYS B  2 176 ? -41.161 -29.958 14.590  1.00 0.00 ?  230 LYS B CE   1  
ATOM   6115   N  NZ   . LYS B  2 176 ? -42.152 -30.899 13.999  1.00 0.00 1  230 LYS B NZ   1  
ATOM   6116   H  H    . LYS B  2 176 ? -39.025 -26.824 9.483   1.00 0.00 ?  230 LYS B H    1  
ATOM   6117   H  HA   . LYS B  2 176 ? -37.513 -28.825 10.472  1.00 0.00 ?  230 LYS B HA   1  
ATOM   6118   H  HB2  . LYS B  2 176 ? -38.835 -27.448 11.930  1.00 0.00 ?  230 LYS B HB2  1  
ATOM   6119   H  HB3  . LYS B  2 176 ? -40.315 -27.846 11.089  1.00 0.00 ?  230 LYS B HB3  1  
ATOM   6120   H  HG2  . LYS B  2 176 ? -40.556 -30.147 11.779  1.00 0.00 ?  230 LYS B HG2  1  
ATOM   6121   H  HG3  . LYS B  2 176 ? -39.113 -30.044 12.762  1.00 0.00 ?  230 LYS B HG3  1  
ATOM   6122   H  HD2  . LYS B  2 176 ? -39.993 -28.277 14.203  1.00 0.00 ?  230 LYS B HD2  1  
ATOM   6123   H  HD3  . LYS B  2 176 ? -41.585 -28.351 13.181  1.00 0.00 ?  230 LYS B HD3  1  
ATOM   6124   H  HE2  . LYS B  2 176 ? -40.296 -30.568 14.928  1.00 0.00 ?  230 LYS B HE2  1  
ATOM   6125   H  HE3  . LYS B  2 176 ? -41.533 -29.319 15.418  1.00 0.00 ?  230 LYS B HE3  1  
ATOM   6126   H  HZ1  . LYS B  2 176 ? -42.969 -30.337 13.684  1.00 0.00 ?  230 LYS B HZ1  1  
ATOM   6127   H  HZ2  . LYS B  2 176 ? -42.414 -31.538 14.777  1.00 0.00 ?  230 LYS B HZ2  1  
ATOM   6128   H  HZ3  . LYS B  2 176 ? -41.620 -31.458 13.302  1.00 0.00 ?  230 LYS B HZ3  1  
ATOM   6129   N  N    . PRO B  2 177 ? -39.862 -30.574 8.986   1.00 0.00 ?  231 PRO B N    1  
ATOM   6130   C  CA   . PRO B  2 177 ? -39.984 -31.990 8.647   1.00 0.00 ?  231 PRO B CA   1  
ATOM   6131   C  C    . PRO B  2 177 ? -39.004 -32.483 7.684   1.00 0.00 ?  231 PRO B C    1  
ATOM   6132   O  O    . PRO B  2 177 ? -38.573 -33.601 7.835   1.00 0.00 ?  231 PRO B O    1  
ATOM   6133   C  CB   . PRO B  2 177 ? -41.448 -32.152 8.156   1.00 0.00 ?  231 PRO B CB   1  
ATOM   6134   C  CG   . PRO B  2 177 ? -42.000 -30.746 7.942   1.00 0.00 ?  231 PRO B CG   1  
ATOM   6135   C  CD   . PRO B  2 177 ? -41.095 -29.797 8.798   1.00 0.00 ?  231 PRO B CD   1  
ATOM   6136   H  HA   . PRO B  2 177 ? -39.776 -32.511 9.569   1.00 0.00 ?  231 PRO B HA   1  
ATOM   6137   H  HB2  . PRO B  2 177 ? -41.624 -32.733 7.225   1.00 0.00 ?  231 PRO B HB2  1  
ATOM   6138   H  HB3  . PRO B  2 177 ? -42.010 -32.651 8.974   1.00 0.00 ?  231 PRO B HB3  1  
ATOM   6139   H  HG2  . PRO B  2 177 ? -42.019 -30.537 6.851   1.00 0.00 ?  231 PRO B HG2  1  
ATOM   6140   H  HG3  . PRO B  2 177 ? -43.053 -30.662 8.285   1.00 0.00 ?  231 PRO B HG3  1  
ATOM   6141   H  HD2  . PRO B  2 177 ? -40.960 -28.885 8.178   1.00 0.00 ?  231 PRO B HD2  1  
ATOM   6142   H  HD3  . PRO B  2 177 ? -41.544 -29.579 9.791   1.00 0.00 ?  231 PRO B HD3  1  
ATOM   6143   N  N    . ALA B  2 178 ? -38.668 -31.692 6.707   1.00 0.00 ?  232 ALA B N    1  
ATOM   6144   C  CA   . ALA B  2 178 ? -37.764 -32.050 5.699   1.00 0.00 ?  232 ALA B CA   1  
ATOM   6145   C  C    . ALA B  2 178 ? -36.348 -32.151 6.146   1.00 0.00 ?  232 ALA B C    1  
ATOM   6146   O  O    . ALA B  2 178 ? -35.629 -33.080 5.653   1.00 0.00 ?  232 ALA B O    1  
ATOM   6147   C  CB   . ALA B  2 178 ? -37.743 -30.987 4.589   1.00 0.00 ?  232 ALA B CB   1  
ATOM   6148   H  H    . ALA B  2 178 ? -38.985 -30.747 6.751   1.00 0.00 ?  232 ALA B H    1  
ATOM   6149   H  HA   . ALA B  2 178 ? -38.119 -32.973 5.264   1.00 0.00 ?  232 ALA B HA   1  
ATOM   6150   H  HB1  . ALA B  2 178 ? -37.793 -29.931 4.932   1.00 0.00 ?  232 ALA B HB1  1  
ATOM   6151   H  HB2  . ALA B  2 178 ? -38.629 -31.027 3.920   1.00 0.00 ?  232 ALA B HB2  1  
ATOM   6152   H  HB3  . ALA B  2 178 ? -36.944 -31.098 3.825   1.00 0.00 ?  232 ALA B HB3  1  
ATOM   6153   N  N    . LEU B  2 179 ? -35.901 -31.343 7.100   1.00 0.00 ?  233 LEU B N    1  
ATOM   6154   C  CA   . LEU B  2 179 ? -34.615 -31.496 7.733   1.00 0.00 ?  233 LEU B CA   1  
ATOM   6155   C  C    . LEU B  2 179 ? -34.564 -32.885 8.419   1.00 0.00 ?  233 LEU B C    1  
ATOM   6156   O  O    . LEU B  2 179 ? -33.467 -33.533 8.319   1.00 0.00 ?  233 LEU B O    1  
ATOM   6157   C  CB   . LEU B  2 179 ? -34.321 -30.425 8.867   1.00 0.00 ?  233 LEU B CB   1  
ATOM   6158   C  CG   . LEU B  2 179 ? -33.010 -30.486 9.643   1.00 0.00 ?  233 LEU B CG   1  
ATOM   6159   C  CD1  . LEU B  2 179 ? -31.803 -30.305 8.647   1.00 0.00 ?  233 LEU B CD1  1  
ATOM   6160   C  CD2  . LEU B  2 179 ? -33.118 -29.487 10.823  1.00 0.00 ?  233 LEU B CD2  1  
ATOM   6161   H  H    . LEU B  2 179 ? -36.387 -30.515 7.369   1.00 0.00 ?  233 LEU B H    1  
ATOM   6162   H  HA   . LEU B  2 179 ? -33.925 -31.556 6.905   1.00 0.00 ?  233 LEU B HA   1  
ATOM   6163   H  HB2  . LEU B  2 179 ? -34.451 -29.388 8.491   1.00 0.00 ?  233 LEU B HB2  1  
ATOM   6164   H  HB3  . LEU B  2 179 ? -35.115 -30.563 9.631   1.00 0.00 ?  233 LEU B HB3  1  
ATOM   6165   H  HG   . LEU B  2 179 ? -32.948 -31.470 10.154  1.00 0.00 ?  233 LEU B HG   1  
ATOM   6166   H  HD11 . LEU B  2 179 ? -31.821 -31.016 7.794   1.00 0.00 ?  233 LEU B HD11 1  
ATOM   6167   H  HD12 . LEU B  2 179 ? -30.833 -30.411 9.180   1.00 0.00 ?  233 LEU B HD12 1  
ATOM   6168   H  HD13 . LEU B  2 179 ? -31.796 -29.375 8.040   1.00 0.00 ?  233 LEU B HD13 1  
ATOM   6169   H  HD21 . LEU B  2 179 ? -32.143 -29.384 11.345  1.00 0.00 ?  233 LEU B HD21 1  
ATOM   6170   H  HD22 . LEU B  2 179 ? -33.859 -29.734 11.614  1.00 0.00 ?  233 LEU B HD22 1  
ATOM   6171   H  HD23 . LEU B  2 179 ? -33.285 -28.452 10.457  1.00 0.00 ?  233 LEU B HD23 1  
ATOM   6172   N  N    . GLU B  2 180 ? -35.593 -33.357 9.222   1.00 0.00 ?  234 GLU B N    1  
ATOM   6173   C  CA   . GLU B  2 180 ? -35.455 -34.600 9.883   1.00 0.00 ?  234 GLU B CA   1  
ATOM   6174   C  C    . GLU B  2 180 ? -35.097 -35.772 8.955   1.00 0.00 ?  234 GLU B C    1  
ATOM   6175   O  O    . GLU B  2 180 ? -34.146 -36.551 9.176   1.00 0.00 ?  234 GLU B O    1  
ATOM   6176   C  CB   . GLU B  2 180 ? -36.787 -34.996 10.727  1.00 0.00 ?  234 GLU B CB   1  
ATOM   6177   C  CG   . GLU B  2 180 ? -37.332 -34.049 11.828  1.00 0.00 ?  234 GLU B CG   1  
ATOM   6178   C  CD   . GLU B  2 180 ? -38.625 -34.599 12.492  1.00 0.00 ?  234 GLU B CD   1  
ATOM   6179   O  OE1  . GLU B  2 180 ? -39.572 -35.028 11.769  1.00 0.00 ?  234 GLU B OE1  1  
ATOM   6180   O  OE2  . GLU B  2 180 ? -38.704 -34.632 13.768  1.00 0.00 -1 234 GLU B OE2  1  
ATOM   6181   H  H    . GLU B  2 180 ? -36.499 -32.953 9.120   1.00 0.00 ?  234 GLU B H    1  
ATOM   6182   H  HA   . GLU B  2 180 ? -34.633 -34.402 10.554  1.00 0.00 ?  234 GLU B HA   1  
ATOM   6183   H  HB2  . GLU B  2 180 ? -37.479 -35.239 9.892   1.00 0.00 ?  234 GLU B HB2  1  
ATOM   6184   H  HB3  . GLU B  2 180 ? -36.473 -35.962 11.176  1.00 0.00 ?  234 GLU B HB3  1  
ATOM   6185   H  HG2  . GLU B  2 180 ? -36.535 -33.922 12.591  1.00 0.00 ?  234 GLU B HG2  1  
ATOM   6186   H  HG3  . GLU B  2 180 ? -37.572 -33.082 11.336  1.00 0.00 ?  234 GLU B HG3  1  
ATOM   6187   N  N    . ASP B  2 181 ? -35.764 -35.771 7.785   1.00 0.00 ?  235 ASP B N    1  
ATOM   6188   C  CA   . ASP B  2 181 ? -35.452 -36.724 6.674   1.00 0.00 ?  235 ASP B CA   1  
ATOM   6189   C  C    . ASP B  2 181 ? -34.015 -36.596 6.232   1.00 0.00 ?  235 ASP B C    1  
ATOM   6190   O  O    . ASP B  2 181 ? -33.356 -37.603 5.984   1.00 0.00 ?  235 ASP B O    1  
ATOM   6191   C  CB   . ASP B  2 181 ? -36.508 -36.379 5.616   1.00 0.00 ?  235 ASP B CB   1  
ATOM   6192   C  CG   . ASP B  2 181 ? -37.853 -37.001 6.024   1.00 0.00 ?  235 ASP B CG   1  
ATOM   6193   O  OD1  . ASP B  2 181 ? -37.886 -38.166 6.559   1.00 0.00 ?  235 ASP B OD1  1  
ATOM   6194   O  OD2  . ASP B  2 181 ? -38.909 -36.419 5.785   1.00 0.00 -1 235 ASP B OD2  1  
ATOM   6195   H  H    . ASP B  2 181 ? -36.596 -35.228 7.707   1.00 0.00 ?  235 ASP B H    1  
ATOM   6196   H  HA   . ASP B  2 181 ? -35.598 -37.683 7.148   1.00 0.00 ?  235 ASP B HA   1  
ATOM   6197   H  HB2  . ASP B  2 181 ? -36.711 -35.325 5.330   1.00 0.00 ?  235 ASP B HB2  1  
ATOM   6198   H  HB3  . ASP B  2 181 ? -36.268 -36.912 4.672   1.00 0.00 ?  235 ASP B HB3  1  
ATOM   6199   N  N    . LEU B  2 182 ? -33.481 -35.400 6.005   1.00 0.00 ?  236 LEU B N    1  
ATOM   6200   C  CA   . LEU B  2 182 ? -32.191 -35.069 5.552   1.00 0.00 ?  236 LEU B CA   1  
ATOM   6201   C  C    . LEU B  2 182 ? -31.070 -35.607 6.532   1.00 0.00 ?  236 LEU B C    1  
ATOM   6202   O  O    . LEU B  2 182 ? -30.072 -36.301 6.178   1.00 0.00 ?  236 LEU B O    1  
ATOM   6203   C  CB   . LEU B  2 182 ? -32.218 -33.488 5.285   1.00 0.00 ?  236 LEU B CB   1  
ATOM   6204   C  CG   . LEU B  2 182 ? -31.127 -33.009 4.312   1.00 0.00 ?  236 LEU B CG   1  
ATOM   6205   C  CD1  . LEU B  2 182 ? -31.454 -33.548 2.927   1.00 0.00 ?  236 LEU B CD1  1  
ATOM   6206   C  CD2  . LEU B  2 182 ? -31.007 -31.484 4.285   1.00 0.00 ?  236 LEU B CD2  1  
ATOM   6207   H  H    . LEU B  2 182 ? -34.169 -34.678 6.009   1.00 0.00 ?  236 LEU B H    1  
ATOM   6208   H  HA   . LEU B  2 182 ? -32.006 -35.465 4.565   1.00 0.00 ?  236 LEU B HA   1  
ATOM   6209   H  HB2  . LEU B  2 182 ? -33.251 -33.280 4.934   1.00 0.00 ?  236 LEU B HB2  1  
ATOM   6210   H  HB3  . LEU B  2 182 ? -32.030 -32.933 6.229   1.00 0.00 ?  236 LEU B HB3  1  
ATOM   6211   H  HG   . LEU B  2 182 ? -30.120 -33.360 4.623   1.00 0.00 ?  236 LEU B HG   1  
ATOM   6212   H  HD11 . LEU B  2 182 ? -30.964 -32.954 2.126   1.00 0.00 ?  236 LEU B HD11 1  
ATOM   6213   H  HD12 . LEU B  2 182 ? -32.554 -33.581 2.771   1.00 0.00 ?  236 LEU B HD12 1  
ATOM   6214   H  HD13 . LEU B  2 182 ? -31.117 -34.591 2.750   1.00 0.00 ?  236 LEU B HD13 1  
ATOM   6215   H  HD21 . LEU B  2 182 ? -30.699 -31.079 5.272   1.00 0.00 ?  236 LEU B HD21 1  
ATOM   6216   H  HD22 . LEU B  2 182 ? -31.918 -30.934 3.963   1.00 0.00 ?  236 LEU B HD22 1  
ATOM   6217   H  HD23 . LEU B  2 182 ? -30.184 -31.237 3.581   1.00 0.00 ?  236 LEU B HD23 1  
ATOM   6218   N  N    . ARG B  2 183 ? -31.230 -35.408 7.886   1.00 0.00 ?  237 ARG B N    1  
ATOM   6219   C  CA   . ARG B  2 183 ? -30.418 -36.131 8.896   1.00 0.00 ?  237 ARG B CA   1  
ATOM   6220   C  C    . ARG B  2 183 ? -30.576 -37.603 8.993   1.00 0.00 ?  237 ARG B C    1  
ATOM   6221   O  O    . ARG B  2 183 ? -29.602 -38.376 9.140   1.00 0.00 ?  237 ARG B O    1  
ATOM   6222   C  CB   . ARG B  2 183 ? -30.332 -35.276 10.318  1.00 0.00 ?  237 ARG B CB   1  
ATOM   6223   C  CG   . ARG B  2 183 ? -31.709 -34.954 11.108  1.00 0.00 ?  237 ARG B CG   1  
ATOM   6224   C  CD   . ARG B  2 183 ? -32.144 -36.028 12.035  1.00 0.00 ?  237 ARG B CD   1  
ATOM   6225   N  NE   . ARG B  2 183 ? -33.049 -35.505 13.152  1.00 0.00 ?  237 ARG B NE   1  
ATOM   6226   C  CZ   . ARG B  2 183 ? -34.269 -36.045 13.399  1.00 0.00 ?  237 ARG B CZ   1  
ATOM   6227   N  NH1  . ARG B  2 183 ? -35.126 -35.313 14.090  1.00 0.00 1  237 ARG B NH1  1  
ATOM   6228   N  NH2  . ARG B  2 183 ? -34.653 -37.239 13.033  1.00 0.00 ?  237 ARG B NH2  1  
ATOM   6229   H  H    . ARG B  2 183 ? -31.911 -34.737 8.169   1.00 0.00 ?  237 ARG B H    1  
ATOM   6230   H  HA   . ARG B  2 183 ? -29.394 -36.101 8.557   1.00 0.00 ?  237 ARG B HA   1  
ATOM   6231   H  HB2  . ARG B  2 183 ? -29.619 -35.782 11.003  1.00 0.00 ?  237 ARG B HB2  1  
ATOM   6232   H  HB3  . ARG B  2 183 ? -30.059 -34.254 9.979   1.00 0.00 ?  237 ARG B HB3  1  
ATOM   6233   H  HG2  . ARG B  2 183 ? -31.467 -34.127 11.809  1.00 0.00 ?  237 ARG B HG2  1  
ATOM   6234   H  HG3  . ARG B  2 183 ? -32.521 -34.592 10.442  1.00 0.00 ?  237 ARG B HG3  1  
ATOM   6235   H  HD2  . ARG B  2 183 ? -32.576 -36.867 11.449  1.00 0.00 ?  237 ARG B HD2  1  
ATOM   6236   H  HD3  . ARG B  2 183 ? -31.222 -36.457 12.481  1.00 0.00 ?  237 ARG B HD3  1  
ATOM   6237   H  HE   . ARG B  2 183 ? -32.892 -34.537 13.348  1.00 0.00 ?  237 ARG B HE   1  
ATOM   6238   H  HH11 . ARG B  2 183 ? -34.962 -34.335 14.216  1.00 0.00 ?  237 ARG B HH11 1  
ATOM   6239   H  HH12 . ARG B  2 183 ? -35.998 -35.734 14.339  1.00 0.00 ?  237 ARG B HH12 1  
ATOM   6240   H  HH21 . ARG B  2 183 ? -34.033 -37.814 12.499  1.00 0.00 ?  237 ARG B HH21 1  
ATOM   6241   H  HH22 . ARG B  2 183 ? -35.323 -37.766 13.557  1.00 0.00 ?  237 ARG B HH22 1  
ATOM   6242   N  N    . GLN B  2 184 ? -31.832 -38.076 8.838   1.00 0.00 ?  238 GLN B N    1  
ATOM   6243   C  CA   . GLN B  2 184 ? -32.072 -39.535 8.645   1.00 0.00 ?  238 GLN B CA   1  
ATOM   6244   C  C    . GLN B  2 184 ? -31.395 -40.105 7.384   1.00 0.00 ?  238 GLN B C    1  
ATOM   6245   O  O    . GLN B  2 184 ? -30.880 -41.234 7.345   1.00 0.00 ?  238 GLN B O    1  
ATOM   6246   C  CB   . GLN B  2 184 ? -33.626 -39.895 8.696   1.00 0.00 ?  238 GLN B CB   1  
ATOM   6247   C  CG   . GLN B  2 184 ? -34.384 -39.706 10.025  1.00 0.00 ?  238 GLN B CG   1  
ATOM   6248   C  CD   . GLN B  2 184 ? -33.710 -40.143 11.375  1.00 0.00 ?  238 GLN B CD   1  
ATOM   6249   O  OE1  . GLN B  2 184 ? -33.042 -39.313 12.033  1.00 0.00 ?  238 GLN B OE1  1  
ATOM   6250   N  NE2  . GLN B  2 184 ? -33.906 -41.374 11.773  1.00 0.00 ?  238 GLN B NE2  1  
ATOM   6251   H  H    . GLN B  2 184 ? -32.617 -37.477 8.700   1.00 0.00 ?  238 GLN B H    1  
ATOM   6252   H  HA   . GLN B  2 184 ? -31.499 -39.969 9.451   1.00 0.00 ?  238 GLN B HA   1  
ATOM   6253   H  HB2  . GLN B  2 184 ? -34.013 -39.255 7.875   1.00 0.00 ?  238 GLN B HB2  1  
ATOM   6254   H  HB3  . GLN B  2 184 ? -33.710 -40.946 8.344   1.00 0.00 ?  238 GLN B HB3  1  
ATOM   6255   H  HG2  . GLN B  2 184 ? -34.691 -38.648 10.167  1.00 0.00 ?  238 GLN B HG2  1  
ATOM   6256   H  HG3  . GLN B  2 184 ? -35.250 -40.398 9.952   1.00 0.00 ?  238 GLN B HG3  1  
ATOM   6257   H  HE21 . GLN B  2 184 ? -33.556 -41.649 12.669  1.00 0.00 ?  238 GLN B HE21 1  
ATOM   6258   H  HE22 . GLN B  2 184 ? -34.528 -41.919 11.212  1.00 0.00 ?  238 GLN B HE22 1  
ATOM   6259   N  N    . GLY B  2 185 ? -31.244 -39.301 6.391   1.00 0.00 ?  239 GLY B N    1  
ATOM   6260   C  CA   . GLY B  2 185 ? -30.476 -39.674 5.236   1.00 0.00 ?  239 GLY B CA   1  
ATOM   6261   C  C    . GLY B  2 185 ? -29.001 -39.653 5.490   1.00 0.00 ?  239 GLY B C    1  
ATOM   6262   O  O    . GLY B  2 185 ? -28.277 -40.369 4.778   1.00 0.00 ?  239 GLY B O    1  
ATOM   6263   H  H    . GLY B  2 185 ? -31.759 -38.449 6.446   1.00 0.00 ?  239 GLY B H    1  
ATOM   6264   H  HA2  . GLY B  2 185 ? -30.708 -40.667 4.881   1.00 0.00 ?  239 GLY B HA2  1  
ATOM   6265   H  HA3  . GLY B  2 185 ? -30.653 -39.059 4.365   1.00 0.00 ?  239 GLY B HA3  1  
ATOM   6266   N  N    . LEU B  2 186 ? -28.467 -38.849 6.406   1.00 0.00 ?  240 LEU B N    1  
ATOM   6267   C  CA   . LEU B  2 186 ? -27.067 -38.582 6.505   1.00 0.00 ?  240 LEU B CA   1  
ATOM   6268   C  C    . LEU B  2 186 ? -26.348 -39.568 7.381   1.00 0.00 ?  240 LEU B C    1  
ATOM   6269   O  O    . LEU B  2 186 ? -25.167 -39.795 7.269   1.00 0.00 ?  240 LEU B O    1  
ATOM   6270   C  CB   . LEU B  2 186 ? -26.881 -37.164 7.185   1.00 0.00 ?  240 LEU B CB   1  
ATOM   6271   C  CG   . LEU B  2 186 ? -25.452 -36.619 7.320   1.00 0.00 ?  240 LEU B CG   1  
ATOM   6272   C  CD1  . LEU B  2 186 ? -24.834 -36.444 5.944   1.00 0.00 ?  240 LEU B CD1  1  
ATOM   6273   C  CD2  . LEU B  2 186 ? -25.268 -35.414 8.293   1.00 0.00 ?  240 LEU B CD2  1  
ATOM   6274   H  H    . LEU B  2 186 ? -29.073 -38.221 6.888   1.00 0.00 ?  240 LEU B H    1  
ATOM   6275   H  HA   . LEU B  2 186 ? -26.598 -38.680 5.537   1.00 0.00 ?  240 LEU B HA   1  
ATOM   6276   H  HB2  . LEU B  2 186 ? -27.496 -36.521 6.520   1.00 0.00 ?  240 LEU B HB2  1  
ATOM   6277   H  HB3  . LEU B  2 186 ? -27.255 -37.272 8.226   1.00 0.00 ?  240 LEU B HB3  1  
ATOM   6278   H  HG   . LEU B  2 186 ? -24.858 -37.393 7.852   1.00 0.00 ?  240 LEU B HG   1  
ATOM   6279   H  HD11 . LEU B  2 186 ? -24.889 -37.371 5.333   1.00 0.00 ?  240 LEU B HD11 1  
ATOM   6280   H  HD12 . LEU B  2 186 ? -23.810 -36.032 6.070   1.00 0.00 ?  240 LEU B HD12 1  
ATOM   6281   H  HD13 . LEU B  2 186 ? -25.384 -35.606 5.465   1.00 0.00 ?  240 LEU B HD13 1  
ATOM   6282   H  HD21 . LEU B  2 186 ? -25.905 -35.448 9.203   1.00 0.00 ?  240 LEU B HD21 1  
ATOM   6283   H  HD22 . LEU B  2 186 ? -25.420 -34.489 7.697   1.00 0.00 ?  240 LEU B HD22 1  
ATOM   6284   H  HD23 . LEU B  2 186 ? -24.251 -35.549 8.720   1.00 0.00 ?  240 LEU B HD23 1  
ATOM   6285   N  N    . LEU B  2 187 ? -27.072 -40.146 8.353   1.00 0.00 ?  241 LEU B N    1  
ATOM   6286   C  CA   . LEU B  2 187 ? -26.600 -41.251 9.236   1.00 0.00 ?  241 LEU B CA   1  
ATOM   6287   C  C    . LEU B  2 187 ? -26.036 -42.542 8.754   1.00 0.00 ?  241 LEU B C    1  
ATOM   6288   O  O    . LEU B  2 187 ? -25.082 -43.036 9.340   1.00 0.00 ?  241 LEU B O    1  
ATOM   6289   C  CB   . LEU B  2 187 ? -27.703 -41.537 10.334  1.00 0.00 ?  241 LEU B CB   1  
ATOM   6290   C  CG   . LEU B  2 187 ? -27.830 -40.432 11.387  1.00 0.00 ?  241 LEU B CG   1  
ATOM   6291   C  CD1  . LEU B  2 187 ? -29.233 -40.275 11.853  1.00 0.00 ?  241 LEU B CD1  1  
ATOM   6292   C  CD2  . LEU B  2 187 ? -26.949 -40.861 12.566  1.00 0.00 ?  241 LEU B CD2  1  
ATOM   6293   H  H    . LEU B  2 187 ? -28.060 -40.012 8.371   1.00 0.00 ?  241 LEU B H    1  
ATOM   6294   H  HA   . LEU B  2 187 ? -25.805 -40.798 9.811   1.00 0.00 ?  241 LEU B HA   1  
ATOM   6295   H  HB2  . LEU B  2 187 ? -28.646 -41.530 9.746   1.00 0.00 ?  241 LEU B HB2  1  
ATOM   6296   H  HB3  . LEU B  2 187 ? -27.617 -42.507 10.869  1.00 0.00 ?  241 LEU B HB3  1  
ATOM   6297   H  HG   . LEU B  2 187 ? -27.459 -39.500 10.910  1.00 0.00 ?  241 LEU B HG   1  
ATOM   6298   H  HD11 . LEU B  2 187 ? -29.222 -39.499 12.648  1.00 0.00 ?  241 LEU B HD11 1  
ATOM   6299   H  HD12 . LEU B  2 187 ? -29.688 -41.214 12.233  1.00 0.00 ?  241 LEU B HD12 1  
ATOM   6300   H  HD13 . LEU B  2 187 ? -29.959 -39.904 11.099  1.00 0.00 ?  241 LEU B HD13 1  
ATOM   6301   H  HD21 . LEU B  2 187 ? -25.859 -40.905 12.358  1.00 0.00 ?  241 LEU B HD21 1  
ATOM   6302   H  HD22 . LEU B  2 187 ? -27.236 -41.824 13.041  1.00 0.00 ?  241 LEU B HD22 1  
ATOM   6303   H  HD23 . LEU B  2 187 ? -27.044 -40.076 13.346  1.00 0.00 ?  241 LEU B HD23 1  
ATOM   6304   N  N    . PRO B  2 188 ? -26.616 -43.096 7.700   1.00 0.00 ?  242 PRO B N    1  
ATOM   6305   C  CA   . PRO B  2 188 ? -25.995 -44.221 6.904   1.00 0.00 ?  242 PRO B CA   1  
ATOM   6306   C  C    . PRO B  2 188 ? -24.643 -43.840 6.261   1.00 0.00 ?  242 PRO B C    1  
ATOM   6307   O  O    . PRO B  2 188 ? -23.722 -44.644 6.070   1.00 0.00 ?  242 PRO B O    1  
ATOM   6308   C  CB   . PRO B  2 188 ? -27.099 -44.560 5.830   1.00 0.00 ?  242 PRO B CB   1  
ATOM   6309   C  CG   . PRO B  2 188 ? -28.348 -44.396 6.631   1.00 0.00 ?  242 PRO B CG   1  
ATOM   6310   C  CD   . PRO B  2 188 ? -27.992 -42.996 7.316   1.00 0.00 ?  242 PRO B CD   1  
ATOM   6311   H  HA   . PRO B  2 188 ? -25.688 -44.977 7.612   1.00 0.00 ?  242 PRO B HA   1  
ATOM   6312   H  HB2  . PRO B  2 188 ? -27.052 -43.793 5.028   1.00 0.00 ?  242 PRO B HB2  1  
ATOM   6313   H  HB3  . PRO B  2 188 ? -26.933 -45.543 5.340   1.00 0.00 ?  242 PRO B HB3  1  
ATOM   6314   H  HG2  . PRO B  2 188 ? -29.295 -44.328 6.054   1.00 0.00 ?  242 PRO B HG2  1  
ATOM   6315   H  HG3  . PRO B  2 188 ? -28.376 -45.141 7.455   1.00 0.00 ?  242 PRO B HG3  1  
ATOM   6316   H  HD2  . PRO B  2 188 ? -28.093 -42.194 6.554   1.00 0.00 ?  242 PRO B HD2  1  
ATOM   6317   H  HD3  . PRO B  2 188 ? -28.703 -42.842 8.156   1.00 0.00 ?  242 PRO B HD3  1  
ATOM   6318   N  N    . VAL B  2 189 ? -24.501 -42.544 5.864   1.00 0.00 ?  243 VAL B N    1  
ATOM   6319   C  CA   . VAL B  2 189 ? -23.267 -41.985 5.336   1.00 0.00 ?  243 VAL B CA   1  
ATOM   6320   C  C    . VAL B  2 189 ? -22.139 -42.068 6.331   1.00 0.00 ?  243 VAL B C    1  
ATOM   6321   O  O    . VAL B  2 189 ? -21.047 -42.559 5.997   1.00 0.00 ?  243 VAL B O    1  
ATOM   6322   C  CB   . VAL B  2 189 ? -23.324 -40.535 4.879   1.00 0.00 ?  243 VAL B CB   1  
ATOM   6323   C  CG1  . VAL B  2 189 ? -21.892 -40.016 4.527   1.00 0.00 ?  243 VAL B CG1  1  
ATOM   6324   C  CG2  . VAL B  2 189 ? -24.245 -40.440 3.719   1.00 0.00 ?  243 VAL B CG2  1  
ATOM   6325   H  H    . VAL B  2 189 ? -25.202 -41.837 5.923   1.00 0.00 ?  243 VAL B H    1  
ATOM   6326   H  HA   . VAL B  2 189 ? -22.993 -42.610 4.499   1.00 0.00 ?  243 VAL B HA   1  
ATOM   6327   H  HB   . VAL B  2 189 ? -23.589 -39.764 5.633   1.00 0.00 ?  243 VAL B HB   1  
ATOM   6328   H  HG11 . VAL B  2 189 ? -21.413 -40.625 3.730   1.00 0.00 ?  243 VAL B HG11 1  
ATOM   6329   H  HG12 . VAL B  2 189 ? -21.131 -40.080 5.334   1.00 0.00 ?  243 VAL B HG12 1  
ATOM   6330   H  HG13 . VAL B  2 189 ? -22.000 -38.965 4.183   1.00 0.00 ?  243 VAL B HG13 1  
ATOM   6331   H  HG21 . VAL B  2 189 ? -25.203 -40.990 3.833   1.00 0.00 ?  243 VAL B HG21 1  
ATOM   6332   H  HG22 . VAL B  2 189 ? -23.742 -40.922 2.853   1.00 0.00 ?  243 VAL B HG22 1  
ATOM   6333   H  HG23 . VAL B  2 189 ? -24.424 -39.403 3.361   1.00 0.00 ?  243 VAL B HG23 1  
ATOM   6334   N  N    . LEU B  2 190 ? -22.389 -41.596 7.562   1.00 0.00 ?  244 LEU B N    1  
ATOM   6335   C  CA   . LEU B  2 190 ? -21.430 -41.589 8.663   1.00 0.00 ?  244 LEU B CA   1  
ATOM   6336   C  C    . LEU B  2 190 ? -20.946 -43.008 8.981   1.00 0.00 ?  244 LEU B C    1  
ATOM   6337   O  O    . LEU B  2 190 ? -19.750 -43.205 9.124   1.00 0.00 ?  244 LEU B O    1  
ATOM   6338   C  CB   . LEU B  2 190 ? -22.062 -40.957 9.923   1.00 0.00 ?  244 LEU B CB   1  
ATOM   6339   C  CG   . LEU B  2 190 ? -22.634 -39.534 9.717   1.00 0.00 ?  244 LEU B CG   1  
ATOM   6340   C  CD1  . LEU B  2 190 ? -23.588 -39.066 10.868  1.00 0.00 ?  244 LEU B CD1  1  
ATOM   6341   C  CD2  . LEU B  2 190 ? -21.585 -38.511 9.536   1.00 0.00 ?  244 LEU B CD2  1  
ATOM   6342   H  H    . LEU B  2 190 ? -23.273 -41.151 7.682   1.00 0.00 ?  244 LEU B H    1  
ATOM   6343   H  HA   . LEU B  2 190 ? -20.552 -41.013 8.409   1.00 0.00 ?  244 LEU B HA   1  
ATOM   6344   H  HB2  . LEU B  2 190 ? -22.953 -41.531 10.257  1.00 0.00 ?  244 LEU B HB2  1  
ATOM   6345   H  HB3  . LEU B  2 190 ? -21.280 -40.903 10.710  1.00 0.00 ?  244 LEU B HB3  1  
ATOM   6346   H  HG   . LEU B  2 190 ? -23.228 -39.477 8.780   1.00 0.00 ?  244 LEU B HG   1  
ATOM   6347   H  HD11 . LEU B  2 190 ? -24.475 -39.735 10.869  1.00 0.00 ?  244 LEU B HD11 1  
ATOM   6348   H  HD12 . LEU B  2 190 ? -23.822 -37.982 10.788  1.00 0.00 ?  244 LEU B HD12 1  
ATOM   6349   H  HD13 . LEU B  2 190 ? -23.082 -39.301 11.829  1.00 0.00 ?  244 LEU B HD13 1  
ATOM   6350   H  HD21 . LEU B  2 190 ? -21.561 -38.060 8.521   1.00 0.00 ?  244 LEU B HD21 1  
ATOM   6351   H  HD22 . LEU B  2 190 ? -20.561 -38.873 9.769   1.00 0.00 ?  244 LEU B HD22 1  
ATOM   6352   H  HD23 . LEU B  2 190 ? -21.761 -37.707 10.281  1.00 0.00 ?  244 LEU B HD23 1  
ATOM   6353   N  N    . GLU B  2 191 ? -21.983 -43.888 9.019   1.00 0.00 ?  245 GLU B N    1  
ATOM   6354   C  CA   . GLU B  2 191 ? -21.723 -45.331 9.099   1.00 0.00 ?  245 GLU B CA   1  
ATOM   6355   C  C    . GLU B  2 191 ? -20.853 -45.973 8.041   1.00 0.00 ?  245 GLU B C    1  
ATOM   6356   O  O    . GLU B  2 191 ? -19.963 -46.832 8.262   1.00 0.00 ?  245 GLU B O    1  
ATOM   6357   C  CB   . GLU B  2 191 ? -22.991 -46.126 9.406   1.00 0.00 ?  245 GLU B CB   1  
ATOM   6358   C  CG   . GLU B  2 191 ? -23.576 -45.919 10.805  1.00 0.00 ?  245 GLU B CG   1  
ATOM   6359   C  CD   . GLU B  2 191 ? -22.849 -46.395 12.031  1.00 0.00 ?  245 GLU B CD   1  
ATOM   6360   O  OE1  . GLU B  2 191 ? -22.024 -45.571 12.552  1.00 0.00 ?  245 GLU B OE1  1  
ATOM   6361   O  OE2  . GLU B  2 191 ? -23.110 -47.501 12.446  1.00 0.00 -1 245 GLU B OE2  1  
ATOM   6362   H  H    . GLU B  2 191 ? -22.913 -43.575 8.845   1.00 0.00 ?  245 GLU B H    1  
ATOM   6363   H  HA   . GLU B  2 191 ? -21.198 -45.343 10.042  1.00 0.00 ?  245 GLU B HA   1  
ATOM   6364   H  HB2  . GLU B  2 191 ? -23.802 -45.816 8.714   1.00 0.00 ?  245 GLU B HB2  1  
ATOM   6365   H  HB3  . GLU B  2 191 ? -22.871 -47.224 9.284   1.00 0.00 ?  245 GLU B HB3  1  
ATOM   6366   H  HG2  . GLU B  2 191 ? -23.928 -44.866 10.855  1.00 0.00 ?  245 GLU B HG2  1  
ATOM   6367   H  HG3  . GLU B  2 191 ? -24.556 -46.444 10.796  1.00 0.00 ?  245 GLU B HG3  1  
ATOM   6368   N  N    . SER B  2 192 ? -21.198 -45.671 6.795   1.00 0.00 ?  246 SER B N    1  
ATOM   6369   C  CA   . SER B  2 192 ? -20.612 -46.333 5.662   1.00 0.00 ?  246 SER B CA   1  
ATOM   6370   C  C    . SER B  2 192 ? -19.116 -46.110 5.557   1.00 0.00 ?  246 SER B C    1  
ATOM   6371   O  O    . SER B  2 192 ? -18.248 -46.951 5.368   1.00 0.00 ?  246 SER B O    1  
ATOM   6372   C  CB   . SER B  2 192 ? -21.286 -45.807 4.367   1.00 0.00 ?  246 SER B CB   1  
ATOM   6373   O  OG   . SER B  2 192 ? -20.845 -46.440 3.159   1.00 0.00 ?  246 SER B OG   1  
ATOM   6374   H  H    . SER B  2 192 ? -22.098 -45.260 6.672   1.00 0.00 ?  246 SER B H    1  
ATOM   6375   H  HA   . SER B  2 192 ? -20.675 -47.386 5.894   1.00 0.00 ?  246 SER B HA   1  
ATOM   6376   H  HB2  . SER B  2 192 ? -22.395 -45.882 4.344   1.00 0.00 ?  246 SER B HB2  1  
ATOM   6377   H  HB3  . SER B  2 192 ? -20.974 -44.746 4.266   1.00 0.00 ?  246 SER B HB3  1  
ATOM   6378   H  HG   . SER B  2 192 ? -21.674 -46.810 2.845   1.00 0.00 ?  246 SER B HG   1  
ATOM   6379   N  N    . PHE B  2 193 ? -18.792 -44.858 5.822   1.00 0.00 ?  247 PHE B N    1  
ATOM   6380   C  CA   . PHE B  2 193 ? -17.438 -44.388 5.879   1.00 0.00 ?  247 PHE B CA   1  
ATOM   6381   C  C    . PHE B  2 193 ? -16.633 -45.158 6.910   1.00 0.00 ?  247 PHE B C    1  
ATOM   6382   O  O    . PHE B  2 193 ? -15.532 -45.681 6.621   1.00 0.00 ?  247 PHE B O    1  
ATOM   6383   C  CB   . PHE B  2 193 ? -17.415 -42.867 5.983   1.00 0.00 ?  247 PHE B CB   1  
ATOM   6384   C  CG   . PHE B  2 193 ? -16.151 -42.294 6.526   1.00 0.00 ?  247 PHE B CG   1  
ATOM   6385   C  CD1  . PHE B  2 193 ? -14.901 -42.793 6.070   1.00 0.00 ?  247 PHE B CD1  1  
ATOM   6386   C  CD2  . PHE B  2 193 ? -16.161 -41.317 7.564   1.00 0.00 ?  247 PHE B CD2  1  
ATOM   6387   C  CE1  . PHE B  2 193 ? -13.685 -42.299 6.534   1.00 0.00 ?  247 PHE B CE1  1  
ATOM   6388   C  CE2  . PHE B  2 193 ? -14.935 -40.930 8.116   1.00 0.00 ?  247 PHE B CE2  1  
ATOM   6389   C  CZ   . PHE B  2 193 ? -13.715 -41.339 7.582   1.00 0.00 ?  247 PHE B CZ   1  
ATOM   6390   H  H    . PHE B  2 193 ? -19.496 -44.209 6.100   1.00 0.00 ?  247 PHE B H    1  
ATOM   6391   H  HA   . PHE B  2 193 ? -17.009 -44.659 4.926   1.00 0.00 ?  247 PHE B HA   1  
ATOM   6392   H  HB2  . PHE B  2 193 ? -17.659 -42.378 5.016   1.00 0.00 ?  247 PHE B HB2  1  
ATOM   6393   H  HB3  . PHE B  2 193 ? -18.215 -42.585 6.700   1.00 0.00 ?  247 PHE B HB3  1  
ATOM   6394   H  HD1  . PHE B  2 193 ? -14.990 -43.432 5.204   1.00 0.00 ?  247 PHE B HD1  1  
ATOM   6395   H  HD2  . PHE B  2 193 ? -17.114 -41.215 8.061   1.00 0.00 ?  247 PHE B HD2  1  
ATOM   6396   H  HE1  . PHE B  2 193 ? -12.742 -42.560 6.078   1.00 0.00 ?  247 PHE B HE1  1  
ATOM   6397   H  HE2  . PHE B  2 193 ? -14.955 -40.244 8.950   1.00 0.00 ?  247 PHE B HE2  1  
ATOM   6398   H  HZ   . PHE B  2 193 ? -12.800 -40.938 7.991   1.00 0.00 ?  247 PHE B HZ   1  
ATOM   6399   N  N    . LYS B  2 194 ? -17.166 -45.217 8.157   1.00 0.00 ?  248 LYS B N    1  
ATOM   6400   C  CA   . LYS B  2 194 ? -16.537 -45.971 9.166   1.00 0.00 ?  248 LYS B CA   1  
ATOM   6401   C  C    . LYS B  2 194 ? -16.386 -47.477 8.783   1.00 0.00 ?  248 LYS B C    1  
ATOM   6402   O  O    . LYS B  2 194 ? -15.352 -48.156 9.087   1.00 0.00 ?  248 LYS B O    1  
ATOM   6403   C  CB   . LYS B  2 194 ? -17.211 -45.883 10.555  1.00 0.00 ?  248 LYS B CB   1  
ATOM   6404   C  CG   . LYS B  2 194 ? -17.007 -44.519 11.311  1.00 0.00 ?  248 LYS B CG   1  
ATOM   6405   C  CD   . LYS B  2 194 ? -15.655 -44.222 11.894  1.00 0.00 ?  248 LYS B CD   1  
ATOM   6406   C  CE   . LYS B  2 194 ? -15.467 -43.683 13.362  1.00 0.00 ?  248 LYS B CE   1  
ATOM   6407   N  NZ   . LYS B  2 194 ? -15.924 -44.622 14.292  1.00 0.00 1  248 LYS B NZ   1  
ATOM   6408   H  H    . LYS B  2 194 ? -18.093 -44.868 8.269   1.00 0.00 ?  248 LYS B H    1  
ATOM   6409   H  HA   . LYS B  2 194 ? -15.562 -45.572 9.402   1.00 0.00 ?  248 LYS B HA   1  
ATOM   6410   H  HB2  . LYS B  2 194 ? -18.306 -45.932 10.375  1.00 0.00 ?  248 LYS B HB2  1  
ATOM   6411   H  HB3  . LYS B  2 194 ? -16.916 -46.719 11.224  1.00 0.00 ?  248 LYS B HB3  1  
ATOM   6412   H  HG2  . LYS B  2 194 ? -17.343 -43.741 10.593  1.00 0.00 ?  248 LYS B HG2  1  
ATOM   6413   H  HG3  . LYS B  2 194 ? -17.654 -44.709 12.194  1.00 0.00 ?  248 LYS B HG3  1  
ATOM   6414   H  HD2  . LYS B  2 194 ? -14.981 -45.081 11.691  1.00 0.00 ?  248 LYS B HD2  1  
ATOM   6415   H  HD3  . LYS B  2 194 ? -15.426 -43.277 11.357  1.00 0.00 ?  248 LYS B HD3  1  
ATOM   6416   H  HE2  . LYS B  2 194 ? -14.392 -43.414 13.447  1.00 0.00 ?  248 LYS B HE2  1  
ATOM   6417   H  HE3  . LYS B  2 194 ? -16.100 -42.771 13.340  1.00 0.00 ?  248 LYS B HE3  1  
ATOM   6418   H  HZ1  . LYS B  2 194 ? -15.257 -45.416 14.209  1.00 0.00 ?  248 LYS B HZ1  1  
ATOM   6419   H  HZ2  . LYS B  2 194 ? -16.878 -45.018 14.176  1.00 0.00 ?  248 LYS B HZ2  1  
ATOM   6420   H  HZ3  . LYS B  2 194 ? -15.838 -44.304 15.278  1.00 0.00 ?  248 LYS B HZ3  1  
ATOM   6421   N  N    . VAL B  2 195 ? -17.350 -48.203 8.067   1.00 0.00 ?  249 VAL B N    1  
ATOM   6422   C  CA   . VAL B  2 195 ? -17.110 -49.608 7.611   1.00 0.00 ?  249 VAL B CA   1  
ATOM   6423   C  C    . VAL B  2 195 ? -16.168 -49.706 6.391   1.00 0.00 ?  249 VAL B C    1  
ATOM   6424   O  O    . VAL B  2 195 ? -15.298 -50.557 6.361   1.00 0.00 ?  249 VAL B O    1  
ATOM   6425   C  CB   . VAL B  2 195 ? -18.356 -50.398 7.399   1.00 0.00 ?  249 VAL B CB   1  
ATOM   6426   C  CG1  . VAL B  2 195 ? -18.101 -51.821 6.879   1.00 0.00 ?  249 VAL B CG1  1  
ATOM   6427   C  CG2  . VAL B  2 195 ? -19.018 -50.461 8.776   1.00 0.00 ?  249 VAL B CG2  1  
ATOM   6428   H  H    . VAL B  2 195 ? -18.179 -47.722 7.791   1.00 0.00 ?  249 VAL B H    1  
ATOM   6429   H  HA   . VAL B  2 195 ? -16.517 -49.986 8.430   1.00 0.00 ?  249 VAL B HA   1  
ATOM   6430   H  HB   . VAL B  2 195 ? -19.014 -49.809 6.725   1.00 0.00 ?  249 VAL B HB   1  
ATOM   6431   H  HG11 . VAL B  2 195 ? -17.192 -52.262 7.340   1.00 0.00 ?  249 VAL B HG11 1  
ATOM   6432   H  HG12 . VAL B  2 195 ? -17.904 -51.856 5.786   1.00 0.00 ?  249 VAL B HG12 1  
ATOM   6433   H  HG13 . VAL B  2 195 ? -18.929 -52.521 7.125   1.00 0.00 ?  249 VAL B HG13 1  
ATOM   6434   H  HG21 . VAL B  2 195 ? -19.917 -51.113 8.746   1.00 0.00 ?  249 VAL B HG21 1  
ATOM   6435   H  HG22 . VAL B  2 195 ? -19.315 -49.503 9.255   1.00 0.00 ?  249 VAL B HG22 1  
ATOM   6436   H  HG23 . VAL B  2 195 ? -18.293 -50.905 9.490   1.00 0.00 ?  249 VAL B HG23 1  
ATOM   6437   N  N    . SER B  2 196 ? -16.210 -48.782 5.429   1.00 0.00 ?  250 SER B N    1  
ATOM   6438   C  CA   . SER B  2 196 ? -15.216 -48.805 4.324   1.00 0.00 ?  250 SER B CA   1  
ATOM   6439   C  C    . SER B  2 196 ? -13.903 -48.563 4.919   1.00 0.00 ?  250 SER B C    1  
ATOM   6440   O  O    . SER B  2 196 ? -12.972 -49.357 4.638   1.00 0.00 ?  250 SER B O    1  
ATOM   6441   C  CB   . SER B  2 196 ? -15.703 -48.011 3.183   1.00 0.00 ?  250 SER B CB   1  
ATOM   6442   O  OG   . SER B  2 196 ? -14.783 -48.050 1.999   1.00 0.00 ?  250 SER B OG   1  
ATOM   6443   H  H    . SER B  2 196 ? -16.849 -48.056 5.671   1.00 0.00 ?  250 SER B H    1  
ATOM   6444   H  HA   . SER B  2 196 ? -15.113 -49.751 3.813   1.00 0.00 ?  250 SER B HA   1  
ATOM   6445   H  HB2  . SER B  2 196 ? -16.655 -48.482 2.858   1.00 0.00 ?  250 SER B HB2  1  
ATOM   6446   H  HB3  . SER B  2 196 ? -15.812 -46.919 3.352   1.00 0.00 ?  250 SER B HB3  1  
ATOM   6447   H  HG   . SER B  2 196 ? -14.531 -48.972 2.086   1.00 0.00 ?  250 SER B HG   1  
ATOM   6448   N  N    . PHE B  2 197 ? -13.655 -47.506 5.720   1.00 0.00 ?  251 PHE B N    1  
ATOM   6449   C  CA   . PHE B  2 197 ? -12.373 -47.236 6.300   1.00 0.00 ?  251 PHE B CA   1  
ATOM   6450   C  C    . PHE B  2 197 ? -11.714 -48.366 7.080   1.00 0.00 ?  251 PHE B C    1  
ATOM   6451   O  O    . PHE B  2 197 ? -10.560 -48.636 6.837   1.00 0.00 ?  251 PHE B O    1  
ATOM   6452   C  CB   . PHE B  2 197 ? -12.531 -45.906 7.158   1.00 0.00 ?  251 PHE B CB   1  
ATOM   6453   C  CG   . PHE B  2 197 ? -11.318 -45.392 7.948   1.00 0.00 ?  251 PHE B CG   1  
ATOM   6454   C  CD1  . PHE B  2 197 ? -10.085 -45.470 7.237   1.00 0.00 ?  251 PHE B CD1  1  
ATOM   6455   C  CD2  . PHE B  2 197 ? -11.379 -44.848 9.235   1.00 0.00 ?  251 PHE B CD2  1  
ATOM   6456   C  CE1  . PHE B  2 197 ? -8.914  -45.039 7.829   1.00 0.00 ?  251 PHE B CE1  1  
ATOM   6457   C  CE2  . PHE B  2 197 ? -10.133 -44.411 9.796   1.00 0.00 ?  251 PHE B CE2  1  
ATOM   6458   C  CZ   . PHE B  2 197 ? -8.956  -44.481 9.061   1.00 0.00 ?  251 PHE B CZ   1  
ATOM   6459   H  H    . PHE B  2 197 ? -14.431 -46.954 6.014   1.00 0.00 ?  251 PHE B H    1  
ATOM   6460   H  HA   . PHE B  2 197 ? -11.798 -47.029 5.409   1.00 0.00 ?  251 PHE B HA   1  
ATOM   6461   H  HB2  . PHE B  2 197 ? -12.918 -45.100 6.498   1.00 0.00 ?  251 PHE B HB2  1  
ATOM   6462   H  HB3  . PHE B  2 197 ? -13.317 -46.031 7.933   1.00 0.00 ?  251 PHE B HB3  1  
ATOM   6463   H  HD1  . PHE B  2 197 ? -10.060 -45.835 6.221   1.00 0.00 ?  251 PHE B HD1  1  
ATOM   6464   H  HD2  . PHE B  2 197 ? -12.347 -44.825 9.713   1.00 0.00 ?  251 PHE B HD2  1  
ATOM   6465   H  HE1  . PHE B  2 197 ? -7.978  -45.051 7.290   1.00 0.00 ?  251 PHE B HE1  1  
ATOM   6466   H  HE2  . PHE B  2 197 ? -10.103 -43.938 10.767  1.00 0.00 ?  251 PHE B HE2  1  
ATOM   6467   H  HZ   . PHE B  2 197 ? -8.029  -44.062 9.423   1.00 0.00 ?  251 PHE B HZ   1  
ATOM   6468   N  N    . LEU B  2 198 ? -12.472 -49.020 7.904   1.00 0.00 ?  252 LEU B N    1  
ATOM   6469   C  CA   . LEU B  2 198 ? -12.131 -50.188 8.670   1.00 0.00 ?  252 LEU B CA   1  
ATOM   6470   C  C    . LEU B  2 198 ? -11.678 -51.315 7.772   1.00 0.00 ?  252 LEU B C    1  
ATOM   6471   O  O    . LEU B  2 198 ? -10.608 -51.915 7.984   1.00 0.00 ?  252 LEU B O    1  
ATOM   6472   C  CB   . LEU B  2 198 ? -13.322 -50.705 9.491   1.00 0.00 ?  252 LEU B CB   1  
ATOM   6473   C  CG   . LEU B  2 198 ? -12.886 -51.703 10.534  1.00 0.00 ?  252 LEU B CG   1  
ATOM   6474   C  CD1  . LEU B  2 198 ? -11.758 -51.172 11.436  1.00 0.00 ?  252 LEU B CD1  1  
ATOM   6475   C  CD2  . LEU B  2 198 ? -14.041 -52.033 11.471  1.00 0.00 ?  252 LEU B CD2  1  
ATOM   6476   H  H    . LEU B  2 198 ? -13.394 -48.653 8.005   1.00 0.00 ?  252 LEU B H    1  
ATOM   6477   H  HA   . LEU B  2 198 ? -11.337 -49.853 9.321   1.00 0.00 ?  252 LEU B HA   1  
ATOM   6478   H  HB2  . LEU B  2 198 ? -13.881 -49.887 9.992   1.00 0.00 ?  252 LEU B HB2  1  
ATOM   6479   H  HB3  . LEU B  2 198 ? -14.096 -51.152 8.831   1.00 0.00 ?  252 LEU B HB3  1  
ATOM   6480   H  HG   . LEU B  2 198 ? -12.495 -52.670 10.153  1.00 0.00 ?  252 LEU B HG   1  
ATOM   6481   H  HD11 . LEU B  2 198 ? -10.787 -51.214 10.897  1.00 0.00 ?  252 LEU B HD11 1  
ATOM   6482   H  HD12 . LEU B  2 198 ? -11.708 -51.793 12.355  1.00 0.00 ?  252 LEU B HD12 1  
ATOM   6483   H  HD13 . LEU B  2 198 ? -11.984 -50.112 11.681  1.00 0.00 ?  252 LEU B HD13 1  
ATOM   6484   H  HD21 . LEU B  2 198 ? -14.935 -52.430 10.943  1.00 0.00 ?  252 LEU B HD21 1  
ATOM   6485   H  HD22 . LEU B  2 198 ? -14.420 -51.159 12.043  1.00 0.00 ?  252 LEU B HD22 1  
ATOM   6486   H  HD23 . LEU B  2 198 ? -13.701 -52.709 12.284  1.00 0.00 ?  252 LEU B HD23 1  
ATOM   6487   N  N    . SER B  2 199 ? -12.410 -51.625 6.692   1.00 0.00 ?  253 SER B N    1  
ATOM   6488   C  CA   . SER B  2 199 ? -11.949 -52.666 5.685   1.00 0.00 ?  253 SER B CA   1  
ATOM   6489   C  C    . SER B  2 199 ? -10.689 -52.253 4.879   1.00 0.00 ?  253 SER B C    1  
ATOM   6490   O  O    . SER B  2 199 ? -9.725  -52.956 4.771   1.00 0.00 ?  253 SER B O    1  
ATOM   6491   C  CB   . SER B  2 199 ? -13.047 -53.110 4.667   1.00 0.00 ?  253 SER B CB   1  
ATOM   6492   O  OG   . SER B  2 199 ? -12.656 -53.996 3.570   1.00 0.00 ?  253 SER B OG   1  
ATOM   6493   H  H    . SER B  2 199 ? -13.102 -51.002 6.335   1.00 0.00 ?  253 SER B H    1  
ATOM   6494   H  HA   . SER B  2 199 ? -11.713 -53.575 6.218   1.00 0.00 ?  253 SER B HA   1  
ATOM   6495   H  HB2  . SER B  2 199 ? -13.903 -53.523 5.244   1.00 0.00 ?  253 SER B HB2  1  
ATOM   6496   H  HB3  . SER B  2 199 ? -13.479 -52.193 4.213   1.00 0.00 ?  253 SER B HB3  1  
ATOM   6497   H  HG   . SER B  2 199 ? -12.072 -54.689 3.889   1.00 0.00 ?  253 SER B HG   1  
ATOM   6498   N  N    . ALA B  2 200 ? -10.588 -50.939 4.518   1.00 0.00 ?  254 ALA B N    1  
ATOM   6499   C  CA   . ALA B  2 200 ? -9.381  -50.420 3.884   1.00 0.00 ?  254 ALA B CA   1  
ATOM   6500   C  C    . ALA B  2 200 ? -8.142  -50.497 4.781   1.00 0.00 ?  254 ALA B C    1  
ATOM   6501   O  O    . ALA B  2 200 ? -7.074  -51.046 4.480   1.00 0.00 ?  254 ALA B O    1  
ATOM   6502   C  CB   . ALA B  2 200 ? -9.603  -48.978 3.460   1.00 0.00 ?  254 ALA B CB   1  
ATOM   6503   H  H    . ALA B  2 200 ? -11.337 -50.303 4.686   1.00 0.00 ?  254 ALA B H    1  
ATOM   6504   H  HA   . ALA B  2 200 ? -9.183  -50.940 2.959   1.00 0.00 ?  254 ALA B HA   1  
ATOM   6505   H  HB1  . ALA B  2 200 ? -10.155 -48.307 4.152   1.00 0.00 ?  254 ALA B HB1  1  
ATOM   6506   H  HB2  . ALA B  2 200 ? -10.274 -48.952 2.575   1.00 0.00 ?  254 ALA B HB2  1  
ATOM   6507   H  HB3  . ALA B  2 200 ? -8.710  -48.488 3.015   1.00 0.00 ?  254 ALA B HB3  1  
ATOM   6508   N  N    . LEU B  2 201 ? -8.387  -50.069 6.043   1.00 0.00 ?  255 LEU B N    1  
ATOM   6509   C  CA   . LEU B  2 201 ? -7.443  -50.044 7.156   1.00 0.00 ?  255 LEU B CA   1  
ATOM   6510   C  C    . LEU B  2 201 ? -7.025  -51.431 7.521   1.00 0.00 ?  255 LEU B C    1  
ATOM   6511   O  O    . LEU B  2 201 ? -5.858  -51.692 7.798   1.00 0.00 ?  255 LEU B O    1  
ATOM   6512   C  CB   . LEU B  2 201 ? -7.965  -49.241 8.354   1.00 0.00 ?  255 LEU B CB   1  
ATOM   6513   C  CG   . LEU B  2 201 ? -7.111  -49.175 9.619   1.00 0.00 ?  255 LEU B CG   1  
ATOM   6514   C  CD1  . LEU B  2 201 ? -5.761  -48.450 9.314   1.00 0.00 ?  255 LEU B CD1  1  
ATOM   6515   C  CD2  . LEU B  2 201 ? -7.887  -48.483 10.808  1.00 0.00 ?  255 LEU B CD2  1  
ATOM   6516   H  H    . LEU B  2 201 ? -9.316  -49.789 6.272   1.00 0.00 ?  255 LEU B H    1  
ATOM   6517   H  HA   . LEU B  2 201 ? -6.513  -49.677 6.747   1.00 0.00 ?  255 LEU B HA   1  
ATOM   6518   H  HB2  . LEU B  2 201 ? -8.241  -48.190 8.122   1.00 0.00 ?  255 LEU B HB2  1  
ATOM   6519   H  HB3  . LEU B  2 201 ? -8.930  -49.720 8.624   1.00 0.00 ?  255 LEU B HB3  1  
ATOM   6520   H  HG   . LEU B  2 201 ? -6.918  -50.193 10.019  1.00 0.00 ?  255 LEU B HG   1  
ATOM   6521   H  HD11 . LEU B  2 201 ? -5.157  -48.233 10.221  1.00 0.00 ?  255 LEU B HD11 1  
ATOM   6522   H  HD12 . LEU B  2 201 ? -6.031  -47.494 8.815   1.00 0.00 ?  255 LEU B HD12 1  
ATOM   6523   H  HD13 . LEU B  2 201 ? -5.143  -49.003 8.575   1.00 0.00 ?  255 LEU B HD13 1  
ATOM   6524   H  HD21 . LEU B  2 201 ? -8.472  -49.316 11.251  1.00 0.00 ?  255 LEU B HD21 1  
ATOM   6525   H  HD22 . LEU B  2 201 ? -8.451  -47.603 10.431  1.00 0.00 ?  255 LEU B HD22 1  
ATOM   6526   H  HD23 . LEU B  2 201 ? -7.217  -48.155 11.631  1.00 0.00 ?  255 LEU B HD23 1  
ATOM   6527   N  N    . GLU B  2 202 ? -7.933  -52.503 7.477   1.00 0.00 ?  256 GLU B N    1  
ATOM   6528   C  CA   . GLU B  2 202 ? -7.398  -53.833 7.673   1.00 0.00 ?  256 GLU B CA   1  
ATOM   6529   C  C    . GLU B  2 202 ? -6.476  -54.422 6.571   1.00 0.00 ?  256 GLU B C    1  
ATOM   6530   O  O    . GLU B  2 202 ? -5.357  -55.004 6.805   1.00 0.00 ?  256 GLU B O    1  
ATOM   6531   C  CB   . GLU B  2 202 ? -8.646  -54.758 7.900   1.00 0.00 ?  256 GLU B CB   1  
ATOM   6532   C  CG   . GLU B  2 202 ? -9.351  -54.533 9.310   1.00 0.00 ?  256 GLU B CG   1  
ATOM   6533   C  CD   . GLU B  2 202 ? -8.679  -55.118 10.579  1.00 0.00 ?  256 GLU B CD   1  
ATOM   6534   O  OE1  . GLU B  2 202 ? -9.196  -56.149 11.089  1.00 0.00 ?  256 GLU B OE1  1  
ATOM   6535   O  OE2  . GLU B  2 202 ? -7.613  -54.582 11.005  1.00 0.00 -1 256 GLU B OE2  1  
ATOM   6536   H  H    . GLU B  2 202 ? -8.905  -52.315 7.359   1.00 0.00 ?  256 GLU B H    1  
ATOM   6537   H  HA   . GLU B  2 202 ? -6.807  -53.892 8.575   1.00 0.00 ?  256 GLU B HA   1  
ATOM   6538   H  HB2  . GLU B  2 202 ? -9.335  -54.807 7.030   1.00 0.00 ?  256 GLU B HB2  1  
ATOM   6539   H  HB3  . GLU B  2 202 ? -8.371  -55.823 8.052   1.00 0.00 ?  256 GLU B HB3  1  
ATOM   6540   H  HG2  . GLU B  2 202 ? -9.581  -53.478 9.571   1.00 0.00 ?  256 GLU B HG2  1  
ATOM   6541   H  HG3  . GLU B  2 202 ? -10.350 -54.994 9.159   1.00 0.00 ?  256 GLU B HG3  1  
ATOM   6542   N  N    . GLU B  2 203 ? -6.833  -54.131 5.321   1.00 0.00 ?  257 GLU B N    1  
ATOM   6543   C  CA   . GLU B  2 203 ? -5.892  -54.295 4.201   1.00 0.00 ?  257 GLU B CA   1  
ATOM   6544   C  C    . GLU B  2 203 ? -4.634  -53.527 4.217   1.00 0.00 ?  257 GLU B C    1  
ATOM   6545   O  O    . GLU B  2 203 ? -3.613  -54.021 3.722   1.00 0.00 ?  257 GLU B O    1  
ATOM   6546   C  CB   . GLU B  2 203 ? -6.800  -54.080 2.931   1.00 0.00 ?  257 GLU B CB   1  
ATOM   6547   C  CG   . GLU B  2 203 ? -7.987  -55.072 2.683   1.00 0.00 ?  257 GLU B CG   1  
ATOM   6548   C  CD   . GLU B  2 203 ? -7.642  -56.505 2.515   1.00 0.00 ?  257 GLU B CD   1  
ATOM   6549   O  OE1  . GLU B  2 203 ? -6.742  -56.961 1.798   1.00 0.00 ?  257 GLU B OE1  1  
ATOM   6550   O  OE2  . GLU B  2 203 ? -8.392  -57.192 3.278   1.00 0.00 -1 257 GLU B OE2  1  
ATOM   6551   H  H    . GLU B  2 203 ? -7.739  -53.754 5.146   1.00 0.00 ?  257 GLU B H    1  
ATOM   6552   H  HA   . GLU B  2 203 ? -5.597  -55.334 4.176   1.00 0.00 ?  257 GLU B HA   1  
ATOM   6553   H  HB2  . GLU B  2 203 ? -7.340  -53.110 2.893   1.00 0.00 ?  257 GLU B HB2  1  
ATOM   6554   H  HB3  . GLU B  2 203 ? -6.211  -54.287 2.012   1.00 0.00 ?  257 GLU B HB3  1  
ATOM   6555   H  HG2  . GLU B  2 203 ? -8.602  -54.941 3.599   1.00 0.00 ?  257 GLU B HG2  1  
ATOM   6556   H  HG3  . GLU B  2 203 ? -8.586  -54.818 1.782   1.00 0.00 ?  257 GLU B HG3  1  
ATOM   6557   N  N    . TYR B  2 204 ? -4.681  -52.259 4.704   1.00 0.00 ?  258 TYR B N    1  
ATOM   6558   C  CA   . TYR B  2 204 ? -3.464  -51.493 4.926   1.00 0.00 ?  258 TYR B CA   1  
ATOM   6559   C  C    . TYR B  2 204 ? -2.544  -52.127 6.000   1.00 0.00 ?  258 TYR B C    1  
ATOM   6560   O  O    . TYR B  2 204 ? -1.309  -52.243 5.818   1.00 0.00 ?  258 TYR B O    1  
ATOM   6561   C  CB   . TYR B  2 204 ? -3.819  -50.069 5.407   1.00 0.00 ?  258 TYR B CB   1  
ATOM   6562   C  CG   . TYR B  2 204 ? -2.667  -49.171 6.031   1.00 0.00 ?  258 TYR B CG   1  
ATOM   6563   C  CD1  . TYR B  2 204 ? -2.510  -49.112 7.400   1.00 0.00 ?  258 TYR B CD1  1  
ATOM   6564   C  CD2  . TYR B  2 204 ? -1.774  -48.418 5.157   1.00 0.00 ?  258 TYR B CD2  1  
ATOM   6565   C  CE1  . TYR B  2 204 ? -1.509  -48.252 7.995   1.00 0.00 ?  258 TYR B CE1  1  
ATOM   6566   C  CE2  . TYR B  2 204 ? -0.821  -47.610 5.669   1.00 0.00 ?  258 TYR B CE2  1  
ATOM   6567   C  CZ   . TYR B  2 204 ? -0.673  -47.529 7.107   1.00 0.00 ?  258 TYR B CZ   1  
ATOM   6568   O  OH   . TYR B  2 204 ? 0.374   -46.716 7.631   1.00 0.00 ?  258 TYR B OH   1  
ATOM   6569   H  H    . TYR B  2 204 ? -5.528  -51.771 4.904   1.00 0.00 ?  258 TYR B H    1  
ATOM   6570   H  HA   . TYR B  2 204 ? -2.973  -51.413 3.967   1.00 0.00 ?  258 TYR B HA   1  
ATOM   6571   H  HB2  . TYR B  2 204 ? -4.253  -49.523 4.542   1.00 0.00 ?  258 TYR B HB2  1  
ATOM   6572   H  HB3  . TYR B  2 204 ? -4.668  -50.164 6.118   1.00 0.00 ?  258 TYR B HB3  1  
ATOM   6573   H  HD1  . TYR B  2 204 ? -3.114  -49.774 8.004   1.00 0.00 ?  258 TYR B HD1  1  
ATOM   6574   H  HD2  . TYR B  2 204 ? -1.862  -48.503 4.084   1.00 0.00 ?  258 TYR B HD2  1  
ATOM   6575   H  HE1  . TYR B  2 204 ? -1.202  -48.265 9.031   1.00 0.00 ?  258 TYR B HE1  1  
ATOM   6576   H  HE2  . TYR B  2 204 ? -0.169  -46.960 5.104   1.00 0.00 ?  258 TYR B HE2  1  
ATOM   6577   H  HH   . TYR B  2 204 ? 0.219   -46.701 8.579   1.00 0.00 ?  258 TYR B HH   1  
ATOM   6578   N  N    . THR B  2 205 ? -3.165  -52.638 7.096   1.00 0.00 ?  259 THR B N    1  
ATOM   6579   C  CA   . THR B  2 205 ? -2.490  -53.276 8.227   1.00 0.00 ?  259 THR B CA   1  
ATOM   6580   C  C    . THR B  2 205 ? -1.704  -54.518 7.919   1.00 0.00 ?  259 THR B C    1  
ATOM   6581   O  O    . THR B  2 205 ? -0.553  -54.652 8.254   1.00 0.00 ?  259 THR B O    1  
ATOM   6582   C  CB   . THR B  2 205 ? -3.322  -53.478 9.443   1.00 0.00 ?  259 THR B CB   1  
ATOM   6583   O  OG1  . THR B  2 205 ? -3.891  -52.227 9.733   1.00 0.00 ?  259 THR B OG1  1  
ATOM   6584   C  CG2  . THR B  2 205 ? -2.456  -53.930 10.655  1.00 0.00 ?  259 THR B CG2  1  
ATOM   6585   H  H    . THR B  2 205 ? -4.157  -52.685 7.011   1.00 0.00 ?  259 THR B H    1  
ATOM   6586   H  HA   . THR B  2 205 ? -1.721  -52.570 8.503   1.00 0.00 ?  259 THR B HA   1  
ATOM   6587   H  HB   . THR B  2 205 ? -4.092  -54.254 9.246   1.00 0.00 ?  259 THR B HB   1  
ATOM   6588   H  HG1  . THR B  2 205 ? -4.397  -51.951 8.965   1.00 0.00 ?  259 THR B HG1  1  
ATOM   6589   H  HG21 . THR B  2 205 ? -1.775  -53.154 11.064  1.00 0.00 ?  259 THR B HG21 1  
ATOM   6590   H  HG22 . THR B  2 205 ? -1.754  -54.736 10.351  1.00 0.00 ?  259 THR B HG22 1  
ATOM   6591   H  HG23 . THR B  2 205 ? -3.087  -54.186 11.533  1.00 0.00 ?  259 THR B HG23 1  
ATOM   6592   N  N    . LYS B  2 206 ? -2.283  -55.479 7.194   1.00 0.00 ?  260 LYS B N    1  
ATOM   6593   C  CA   . LYS B  2 206 ? -1.743  -56.627 6.762   1.00 0.00 ?  260 LYS B CA   1  
ATOM   6594   C  C    . LYS B  2 206 ? -0.580  -56.435 5.882   1.00 0.00 ?  260 LYS B C    1  
ATOM   6595   O  O    . LYS B  2 206 ? 0.442   -57.121 6.040   1.00 0.00 ?  260 LYS B O    1  
ATOM   6596   C  CB   . LYS B  2 206 ? -2.732  -57.665 6.191   1.00 0.00 ?  260 LYS B CB   1  
ATOM   6597   C  CG   . LYS B  2 206 ? -3.395  -57.124 4.958   1.00 0.00 ?  260 LYS B CG   1  
ATOM   6598   C  CD   . LYS B  2 206 ? -4.533  -58.001 4.372   1.00 0.00 ?  260 LYS B CD   1  
ATOM   6599   C  CE   . LYS B  2 206 ? -5.704  -58.396 5.299   1.00 0.00 ?  260 LYS B CE   1  
ATOM   6600   N  NZ   . LYS B  2 206 ? -6.623  -59.114 4.410   1.00 0.00 1  260 LYS B NZ   1  
ATOM   6601   H  H    . LYS B  2 206 ? -3.240  -55.424 6.921   1.00 0.00 ?  260 LYS B H    1  
ATOM   6602   H  HA   . LYS B  2 206 ? -1.257  -57.061 7.624   1.00 0.00 ?  260 LYS B HA   1  
ATOM   6603   H  HB2  . LYS B  2 206 ? -2.062  -58.508 5.918   1.00 0.00 ?  260 LYS B HB2  1  
ATOM   6604   H  HB3  . LYS B  2 206 ? -3.498  -57.999 6.923   1.00 0.00 ?  260 LYS B HB3  1  
ATOM   6605   H  HG2  . LYS B  2 206 ? -3.835  -56.118 5.122   1.00 0.00 ?  260 LYS B HG2  1  
ATOM   6606   H  HG3  . LYS B  2 206 ? -2.670  -57.027 4.122   1.00 0.00 ?  260 LYS B HG3  1  
ATOM   6607   H  HD2  . LYS B  2 206 ? -5.102  -57.427 3.610   1.00 0.00 ?  260 LYS B HD2  1  
ATOM   6608   H  HD3  . LYS B  2 206 ? -4.013  -58.880 3.935   1.00 0.00 ?  260 LYS B HD3  1  
ATOM   6609   H  HE2  . LYS B  2 206 ? -5.433  -59.172 6.046   1.00 0.00 ?  260 LYS B HE2  1  
ATOM   6610   H  HE3  . LYS B  2 206 ? -6.216  -57.484 5.673   1.00 0.00 ?  260 LYS B HE3  1  
ATOM   6611   H  HZ1  . LYS B  2 206 ? -7.090  -58.372 3.851   1.00 0.00 ?  260 LYS B HZ1  1  
ATOM   6612   H  HZ2  . LYS B  2 206 ? -7.223  -59.703 5.023   1.00 0.00 ?  260 LYS B HZ2  1  
ATOM   6613   H  HZ3  . LYS B  2 206 ? -6.234  -59.829 3.762   1.00 0.00 ?  260 LYS B HZ3  1  
ATOM   6614   N  N    . LYS B  2 207 ? -0.588  -55.498 4.921   1.00 0.00 ?  261 LYS B N    1  
ATOM   6615   C  CA   . LYS B  2 207 ? 0.563   -55.099 4.246   1.00 0.00 ?  261 LYS B CA   1  
ATOM   6616   C  C    . LYS B  2 207 ? 1.680   -54.419 5.034   1.00 0.00 ?  261 LYS B C    1  
ATOM   6617   O  O    . LYS B  2 207 ? 2.879   -54.625 4.865   1.00 0.00 ?  261 LYS B O    1  
ATOM   6618   C  CB   . LYS B  2 207 ? 0.186   -54.211 3.038   1.00 0.00 ?  261 LYS B CB   1  
ATOM   6619   C  CG   . LYS B  2 207 ? -0.680  -55.027 2.072   1.00 0.00 ?  261 LYS B CG   1  
ATOM   6620   C  CD   . LYS B  2 207 ? -0.897  -54.413 0.672   1.00 0.00 ?  261 LYS B CD   1  
ATOM   6621   C  CE   . LYS B  2 207 ? -1.667  -53.037 0.862   1.00 0.00 ?  261 LYS B CE   1  
ATOM   6622   N  NZ   . LYS B  2 207 ? -3.075  -53.269 1.176   1.00 0.00 1  261 LYS B NZ   1  
ATOM   6623   H  H    . LYS B  2 207 ? -1.370  -54.901 4.757   1.00 0.00 ?  261 LYS B H    1  
ATOM   6624   H  HA   . LYS B  2 207 ? 1.011   -56.007 3.869   1.00 0.00 ?  261 LYS B HA   1  
ATOM   6625   H  HB2  . LYS B  2 207 ? -0.284  -53.308 3.483   1.00 0.00 ?  261 LYS B HB2  1  
ATOM   6626   H  HB3  . LYS B  2 207 ? 1.149   -54.031 2.513   1.00 0.00 ?  261 LYS B HB3  1  
ATOM   6627   H  HG2  . LYS B  2 207 ? -0.135  -55.989 1.966   1.00 0.00 ?  261 LYS B HG2  1  
ATOM   6628   H  HG3  . LYS B  2 207 ? -1.658  -55.316 2.513   1.00 0.00 ?  261 LYS B HG3  1  
ATOM   6629   H  HD2  . LYS B  2 207 ? 0.084   -54.155 0.220   1.00 0.00 ?  261 LYS B HD2  1  
ATOM   6630   H  HD3  . LYS B  2 207 ? -1.417  -55.092 -0.037  1.00 0.00 ?  261 LYS B HD3  1  
ATOM   6631   H  HE2  . LYS B  2 207 ? -1.262  -52.336 1.622   1.00 0.00 ?  261 LYS B HE2  1  
ATOM   6632   H  HE3  . LYS B  2 207 ? -1.612  -52.494 -0.106  1.00 0.00 ?  261 LYS B HE3  1  
ATOM   6633   H  HZ1  . LYS B  2 207 ? -3.610  -52.404 0.960   1.00 0.00 ?  261 LYS B HZ1  1  
ATOM   6634   H  HZ2  . LYS B  2 207 ? -3.101  -53.569 2.172   1.00 0.00 ?  261 LYS B HZ2  1  
ATOM   6635   H  HZ3  . LYS B  2 207 ? -3.442  -54.015 0.551   1.00 0.00 ?  261 LYS B HZ3  1  
ATOM   6636   N  N    . LEU B  2 208 ? 1.232   -53.528 6.004   1.00 0.00 ?  262 LEU B N    1  
ATOM   6637   C  CA   . LEU B  2 208 ? 2.180   -52.769 6.934   1.00 0.00 ?  262 LEU B CA   1  
ATOM   6638   C  C    . LEU B  2 208 ? 2.999   -53.721 7.768   1.00 0.00 ?  262 LEU B C    1  
ATOM   6639   O  O    . LEU B  2 208 ? 4.223   -53.457 7.867   1.00 0.00 ?  262 LEU B O    1  
ATOM   6640   C  CB   . LEU B  2 208 ? 1.225   -51.860 7.788   1.00 0.00 ?  262 LEU B CB   1  
ATOM   6641   C  CG   . LEU B  2 208 ? 1.870   -51.206 9.056   1.00 0.00 ?  262 LEU B CG   1  
ATOM   6642   C  CD1  . LEU B  2 208 ? 2.800   -50.045 8.603   1.00 0.00 ?  262 LEU B CD1  1  
ATOM   6643   C  CD2  . LEU B  2 208 ? 0.887   -50.599 10.144  1.00 0.00 ?  262 LEU B CD2  1  
ATOM   6644   H  H    . LEU B  2 208 ? 0.285   -53.269 6.179   1.00 0.00 ?  262 LEU B H    1  
ATOM   6645   H  HA   . LEU B  2 208 ? 2.882   -52.293 6.266   1.00 0.00 ?  262 LEU B HA   1  
ATOM   6646   H  HB2  . LEU B  2 208 ? 0.827   -51.072 7.113   1.00 0.00 ?  262 LEU B HB2  1  
ATOM   6647   H  HB3  . LEU B  2 208 ? 0.502   -52.535 8.294   1.00 0.00 ?  262 LEU B HB3  1  
ATOM   6648   H  HG   . LEU B  2 208 ? 2.479   -52.006 9.528   1.00 0.00 ?  262 LEU B HG   1  
ATOM   6649   H  HD11 . LEU B  2 208 ? 2.350   -49.399 7.820   1.00 0.00 ?  262 LEU B HD11 1  
ATOM   6650   H  HD12 . LEU B  2 208 ? 3.707   -50.503 8.154   1.00 0.00 ?  262 LEU B HD12 1  
ATOM   6651   H  HD13 . LEU B  2 208 ? 3.255   -49.420 9.401   1.00 0.00 ?  262 LEU B HD13 1  
ATOM   6652   H  HD21 . LEU B  2 208 ? 0.027   -50.103 9.644   1.00 0.00 ?  262 LEU B HD21 1  
ATOM   6653   H  HD22 . LEU B  2 208 ? 1.409   -49.975 10.900  1.00 0.00 ?  262 LEU B HD22 1  
ATOM   6654   H  HD23 . LEU B  2 208 ? 0.382   -51.434 10.675  1.00 0.00 ?  262 LEU B HD23 1  
ATOM   6655   N  N    . ASN B  2 209 ? 2.377   -54.783 8.326   1.00 0.00 ?  263 ASN B N    1  
ATOM   6656   C  CA   . ASN B  2 209 ? 2.992   -55.838 9.050   1.00 0.00 ?  263 ASN B CA   1  
ATOM   6657   C  C    . ASN B  2 209 ? 4.235   -56.436 8.465   1.00 0.00 ?  263 ASN B C    1  
ATOM   6658   O  O    . ASN B  2 209 ? 4.308   -56.722 7.261   1.00 0.00 ?  263 ASN B O    1  
ATOM   6659   C  CB   . ASN B  2 209 ? 2.052   -56.991 9.420   1.00 0.00 ?  263 ASN B CB   1  
ATOM   6660   C  CG   . ASN B  2 209 ? 0.835   -56.601 10.286  1.00 0.00 ?  263 ASN B CG   1  
ATOM   6661   O  OD1  . ASN B  2 209 ? 0.766   -55.673 11.100  1.00 0.00 ?  263 ASN B OD1  1  
ATOM   6662   N  ND2  . ASN B  2 209 ? -0.172  -57.438 10.119  1.00 0.00 ?  263 ASN B ND2  1  
ATOM   6663   H  H    . ASN B  2 209 ? 1.407   -54.893 8.125   1.00 0.00 ?  263 ASN B H    1  
ATOM   6664   H  HA   . ASN B  2 209 ? 3.385   -55.334 9.921   1.00 0.00 ?  263 ASN B HA   1  
ATOM   6665   H  HB2  . ASN B  2 209 ? 1.678   -57.437 8.474   1.00 0.00 ?  263 ASN B HB2  1  
ATOM   6666   H  HB3  . ASN B  2 209 ? 2.634   -57.781 9.940   1.00 0.00 ?  263 ASN B HB3  1  
ATOM   6667   H  HD21 . ASN B  2 209 ? -1.021  -57.357 10.641  1.00 0.00 ?  263 ASN B HD21 1  
ATOM   6668   H  HD22 . ASN B  2 209 ? -0.138  -58.245 9.530   1.00 0.00 ?  263 ASN B HD22 1  
ATOM   6669   N  N    . THR B  2 210 ? 5.185   -56.835 9.327   1.00 0.00 ?  264 THR B N    1  
ATOM   6670   C  CA   . THR B  2 210 ? 6.511   -57.331 9.067   1.00 0.00 ?  264 THR B CA   1  
ATOM   6671   C  C    . THR B  2 210 ? 6.444   -58.796 9.256   1.00 0.00 ?  264 THR B C    1  
ATOM   6672   O  O    . THR B  2 210 ? 7.476   -59.461 9.455   1.00 0.00 ?  264 THR B O    1  
ATOM   6673   C  CB   . THR B  2 210 ? 7.631   -56.624 9.897   1.00 0.00 ?  264 THR B CB   1  
ATOM   6674   O  OG1  . THR B  2 210 ? 7.466   -56.700 11.281  1.00 0.00 ?  264 THR B OG1  1  
ATOM   6675   C  CG2  . THR B  2 210 ? 7.652   -55.149 9.565   1.00 0.00 ?  264 THR B CG2  1  
ATOM   6676   H  H    . THR B  2 210 ? 4.972   -56.677 10.288  1.00 0.00 ?  264 THR B H    1  
ATOM   6677   H  HA   . THR B  2 210 ? 6.728   -57.289 8.010   1.00 0.00 ?  264 THR B HA   1  
ATOM   6678   H  HB   . THR B  2 210 ? 8.617   -57.097 9.702   1.00 0.00 ?  264 THR B HB   1  
ATOM   6679   H  HG1  . THR B  2 210 ? 7.411   -57.620 11.547  1.00 0.00 ?  264 THR B HG1  1  
ATOM   6680   H  HG21 . THR B  2 210 ? 7.677   -54.961 8.470   1.00 0.00 ?  264 THR B HG21 1  
ATOM   6681   H  HG22 . THR B  2 210 ? 8.483   -54.577 10.031  1.00 0.00 ?  264 THR B HG22 1  
ATOM   6682   H  HG23 . THR B  2 210 ? 6.699   -54.654 9.852   1.00 0.00 ?  264 THR B HG23 1  
ATOM   6683   N  N    . GLN B  2 211 ? 5.186   -59.345 9.213   1.00 0.00 ?  265 GLN B N    1  
ATOM   6684   C  CA   . GLN B  2 211 ? 4.999   -60.792 9.116   1.00 0.00 ?  265 GLN B CA   1  
ATOM   6685   C  C    . GLN B  2 211 ? 3.999   -60.876 7.930   1.00 0.00 ?  265 GLN B C    1  
ATOM   6686   O  O    . GLN B  2 211 ? 2.859   -60.422 8.139   1.00 0.00 ?  265 GLN B O    1  
ATOM   6687   C  CB   . GLN B  2 211 ? 4.229   -61.330 10.367  1.00 0.00 ?  265 GLN B CB   1  
ATOM   6688   C  CG   . GLN B  2 211 ? 4.216   -62.823 10.405  1.00 0.00 ?  265 GLN B CG   1  
ATOM   6689   C  CD   . GLN B  2 211 ? 3.523   -63.295 11.696  1.00 0.00 ?  265 GLN B CD   1  
ATOM   6690   O  OE1  . GLN B  2 211 ? 4.044   -64.139 12.410  1.00 0.00 ?  265 GLN B OE1  1  
ATOM   6691   N  NE2  . GLN B  2 211 ? 2.257   -62.804 11.923  1.00 0.00 ?  265 GLN B NE2  1  
ATOM   6692   O  OXT  . GLN B  2 211 ? 4.385   -61.327 6.818   1.00 0.00 ?  265 GLN B OXT  1  
ATOM   6693   H  H    . GLN B  2 211 ? 4.433   -58.747 8.948   1.00 0.00 ?  265 GLN B H    1  
ATOM   6694   H  HA   . GLN B  2 211 ? 5.894   -61.351 8.884   1.00 0.00 ?  265 GLN B HA   1  
ATOM   6695   H  HB2  . GLN B  2 211 ? 4.836   -61.081 11.264  1.00 0.00 ?  265 GLN B HB2  1  
ATOM   6696   H  HB3  . GLN B  2 211 ? 3.221   -60.862 10.363  1.00 0.00 ?  265 GLN B HB3  1  
ATOM   6697   H  HG2  . GLN B  2 211 ? 3.693   -63.333 9.569   1.00 0.00 ?  265 GLN B HG2  1  
ATOM   6698   H  HG3  . GLN B  2 211 ? 5.267   -63.175 10.342  1.00 0.00 ?  265 GLN B HG3  1  
ATOM   6699   H  HE21 . GLN B  2 211 ? 1.798   -62.325 11.175  1.00 0.00 ?  265 GLN B HE21 1  
ATOM   6700   H  HE22 . GLN B  2 211 ? 1.880   -62.891 12.845  1.00 0.00 ?  265 GLN B HE22 1  
ATOM   6701   N  N    . SER C  2 1   ? -18.891 -50.577 -4.516  1.00 0.00 ?  55  SER C N    1  
ATOM   6702   C  CA   . SER C  2 1   ? -18.380 -50.171 -3.134  1.00 0.00 ?  55  SER C CA   1  
ATOM   6703   C  C    . SER C  2 1   ? -19.516 -50.145 -2.123  1.00 0.00 ?  55  SER C C    1  
ATOM   6704   O  O    . SER C  2 1   ? -20.704 -50.279 -2.428  1.00 0.00 ?  55  SER C O    1  
ATOM   6705   C  CB   . SER C  2 1   ? -17.532 -48.793 -3.134  1.00 0.00 ?  55  SER C CB   1  
ATOM   6706   O  OG   . SER C  2 1   ? -18.284 -47.811 -3.870  1.00 0.00 ?  55  SER C OG   1  
ATOM   6707   H  H1   . SER C  2 1   ? -18.141 -50.891 -5.165  1.00 0.00 ?  55  SER C H1   1  
ATOM   6708   H  H2   . SER C  2 1   ? -19.479 -49.834 -4.945  1.00 0.00 ?  55  SER C H2   1  
ATOM   6709   H  H3   . SER C  2 1   ? -19.452 -51.450 -4.455  1.00 0.00 ?  55  SER C H3   1  
ATOM   6710   H  HA   . SER C  2 1   ? -17.707 -50.931 -2.764  1.00 0.00 ?  55  SER C HA   1  
ATOM   6711   H  HB2  . SER C  2 1   ? -17.327 -48.501 -2.082  1.00 0.00 ?  55  SER C HB2  1  
ATOM   6712   H  HB3  . SER C  2 1   ? -16.548 -49.109 -3.542  1.00 0.00 ?  55  SER C HB3  1  
ATOM   6713   H  HG   . SER C  2 1   ? -18.160 -47.942 -4.813  1.00 0.00 ?  55  SER C HG   1  
ATOM   6714   N  N    . THR C  2 2   ? -19.306 -49.886 -0.836  1.00 0.00 ?  56  THR C N    1  
ATOM   6715   C  CA   . THR C  2 2   ? -20.290 -49.757 0.235   1.00 0.00 ?  56  THR C CA   1  
ATOM   6716   C  C    . THR C  2 2   ? -21.226 -48.606 -0.123  1.00 0.00 ?  56  THR C C    1  
ATOM   6717   O  O    . THR C  2 2   ? -22.449 -48.689 -0.071  1.00 0.00 ?  56  THR C O    1  
ATOM   6718   C  CB   . THR C  2 2   ? -19.762 -49.525 1.607   1.00 0.00 ?  56  THR C CB   1  
ATOM   6719   O  OG1  . THR C  2 2   ? -18.893 -48.463 1.648   1.00 0.00 ?  56  THR C OG1  1  
ATOM   6720   C  CG2  . THR C  2 2   ? -18.946 -50.781 2.053   1.00 0.00 ?  56  THR C CG2  1  
ATOM   6721   H  H    . THR C  2 2   ? -18.357 -49.792 -0.546  1.00 0.00 ?  56  THR C H    1  
ATOM   6722   H  HA   . THR C  2 2   ? -20.829 -50.693 0.243   1.00 0.00 ?  56  THR C HA   1  
ATOM   6723   H  HB   . THR C  2 2   ? -20.559 -49.358 2.363   1.00 0.00 ?  56  THR C HB   1  
ATOM   6724   H  HG1  . THR C  2 2   ? -19.306 -47.752 2.144   1.00 0.00 ?  56  THR C HG1  1  
ATOM   6725   H  HG21 . THR C  2 2   ? -19.639 -51.633 2.227   1.00 0.00 ?  56  THR C HG21 1  
ATOM   6726   H  HG22 . THR C  2 2   ? -18.365 -50.634 2.988   1.00 0.00 ?  56  THR C HG22 1  
ATOM   6727   H  HG23 . THR C  2 2   ? -18.208 -51.085 1.280   1.00 0.00 ?  56  THR C HG23 1  
ATOM   6728   N  N    . PHE C  2 3   ? -20.654 -47.551 -0.670  1.00 0.00 ?  57  PHE C N    1  
ATOM   6729   C  CA   . PHE C  2 3   ? -21.354 -46.394 -1.280  1.00 0.00 ?  57  PHE C CA   1  
ATOM   6730   C  C    . PHE C  2 3   ? -22.226 -46.652 -2.486  1.00 0.00 ?  57  PHE C C    1  
ATOM   6731   O  O    . PHE C  2 3   ? -23.288 -46.030 -2.607  1.00 0.00 ?  57  PHE C O    1  
ATOM   6732   C  CB   . PHE C  2 3   ? -20.381 -45.293 -1.737  1.00 0.00 ?  57  PHE C CB   1  
ATOM   6733   C  CG   . PHE C  2 3   ? -19.599 -44.899 -0.537  1.00 0.00 ?  57  PHE C CG   1  
ATOM   6734   C  CD1  . PHE C  2 3   ? -18.383 -45.526 -0.229  1.00 0.00 ?  57  PHE C CD1  1  
ATOM   6735   C  CD2  . PHE C  2 3   ? -20.249 -44.024 0.350   1.00 0.00 ?  57  PHE C CD2  1  
ATOM   6736   C  CE1  . PHE C  2 3   ? -17.749 -45.235 1.021   1.00 0.00 ?  57  PHE C CE1  1  
ATOM   6737   C  CE2  . PHE C  2 3   ? -19.674 -43.724 1.538   1.00 0.00 ?  57  PHE C CE2  1  
ATOM   6738   C  CZ   . PHE C  2 3   ? -18.421 -44.367 1.901   1.00 0.00 ?  57  PHE C CZ   1  
ATOM   6739   H  H    . PHE C  2 3   ? -19.666 -47.421 -0.674  1.00 0.00 ?  57  PHE C H    1  
ATOM   6740   H  HA   . PHE C  2 3   ? -21.988 -46.008 -0.496  1.00 0.00 ?  57  PHE C HA   1  
ATOM   6741   H  HB2  . PHE C  2 3   ? -19.715 -45.792 -2.473  1.00 0.00 ?  57  PHE C HB2  1  
ATOM   6742   H  HB3  . PHE C  2 3   ? -20.865 -44.458 -2.288  1.00 0.00 ?  57  PHE C HB3  1  
ATOM   6743   H  HD1  . PHE C  2 3   ? -17.944 -46.222 -0.929  1.00 0.00 ?  57  PHE C HD1  1  
ATOM   6744   H  HD2  . PHE C  2 3   ? -21.151 -43.568 -0.030  1.00 0.00 ?  57  PHE C HD2  1  
ATOM   6745   H  HE1  . PHE C  2 3   ? -16.822 -45.757 1.208   1.00 0.00 ?  57  PHE C HE1  1  
ATOM   6746   H  HE2  . PHE C  2 3   ? -20.062 -42.948 2.181   1.00 0.00 ?  57  PHE C HE2  1  
ATOM   6747   H  HZ   . PHE C  2 3   ? -18.056 -44.351 2.917   1.00 0.00 ?  57  PHE C HZ   1  
ATOM   6748   N  N    . SER C  2 4   ? -21.869 -47.658 -3.314  1.00 0.00 ?  58  SER C N    1  
ATOM   6749   C  CA   . SER C  2 4   ? -22.737 -48.143 -4.438  1.00 0.00 ?  58  SER C CA   1  
ATOM   6750   C  C    . SER C  2 4   ? -24.030 -48.802 -3.896  1.00 0.00 ?  58  SER C C    1  
ATOM   6751   O  O    . SER C  2 4   ? -25.138 -48.667 -4.421  1.00 0.00 ?  58  SER C O    1  
ATOM   6752   C  CB   . SER C  2 4   ? -22.084 -49.148 -5.377  1.00 0.00 ?  58  SER C CB   1  
ATOM   6753   O  OG   . SER C  2 4   ? -20.714 -48.754 -5.700  1.00 0.00 ?  58  SER C OG   1  
ATOM   6754   H  H    . SER C  2 4   ? -20.986 -48.120 -3.343  1.00 0.00 ?  58  SER C H    1  
ATOM   6755   H  HA   . SER C  2 4   ? -23.090 -47.319 -5.040  1.00 0.00 ?  58  SER C HA   1  
ATOM   6756   H  HB2  . SER C  2 4   ? -22.076 -50.147 -4.891  1.00 0.00 ?  58  SER C HB2  1  
ATOM   6757   H  HB3  . SER C  2 4   ? -22.663 -49.375 -6.297  1.00 0.00 ?  58  SER C HB3  1  
ATOM   6758   H  HG   . SER C  2 4   ? -20.862 -48.033 -6.316  1.00 0.00 ?  58  SER C HG   1  
ATOM   6759   N  N    . LYS C  2 5   ? -23.953 -49.476 -2.728  1.00 0.00 ?  59  LYS C N    1  
ATOM   6760   C  CA   . LYS C  2 5   ? -25.061 -50.138 -2.072  1.00 0.00 ?  59  LYS C CA   1  
ATOM   6761   C  C    . LYS C  2 5   ? -25.886 -49.141 -1.267  1.00 0.00 ?  59  LYS C C    1  
ATOM   6762   O  O    . LYS C  2 5   ? -27.048 -49.256 -1.152  1.00 0.00 ?  59  LYS C O    1  
ATOM   6763   C  CB   . LYS C  2 5   ? -24.577 -51.405 -1.340  1.00 0.00 ?  59  LYS C CB   1  
ATOM   6764   C  CG   . LYS C  2 5   ? -23.783 -52.337 -2.257  1.00 0.00 ?  59  LYS C CG   1  
ATOM   6765   C  CD   . LYS C  2 5   ? -24.425 -52.884 -3.512  1.00 0.00 ?  59  LYS C CD   1  
ATOM   6766   C  CE   . LYS C  2 5   ? -23.415 -53.747 -4.312  1.00 0.00 ?  59  LYS C CE   1  
ATOM   6767   N  NZ   . LYS C  2 5   ? -23.111 -55.016 -3.590  1.00 0.00 1  59  LYS C NZ   1  
ATOM   6768   H  H    . LYS C  2 5   ? -23.063 -49.660 -2.318  1.00 0.00 ?  59  LYS C H    1  
ATOM   6769   H  HA   . LYS C  2 5   ? -25.687 -50.519 -2.865  1.00 0.00 ?  59  LYS C HA   1  
ATOM   6770   H  HB2  . LYS C  2 5   ? -23.891 -51.028 -0.551  1.00 0.00 ?  59  LYS C HB2  1  
ATOM   6771   H  HB3  . LYS C  2 5   ? -25.455 -51.950 -0.931  1.00 0.00 ?  59  LYS C HB3  1  
ATOM   6772   H  HG2  . LYS C  2 5   ? -22.867 -51.802 -2.588  1.00 0.00 ?  59  LYS C HG2  1  
ATOM   6773   H  HG3  . LYS C  2 5   ? -23.481 -53.199 -1.625  1.00 0.00 ?  59  LYS C HG3  1  
ATOM   6774   H  HD2  . LYS C  2 5   ? -25.315 -53.492 -3.240  1.00 0.00 ?  59  LYS C HD2  1  
ATOM   6775   H  HD3  . LYS C  2 5   ? -24.819 -51.979 -4.023  1.00 0.00 ?  59  LYS C HD3  1  
ATOM   6776   H  HE2  . LYS C  2 5   ? -23.745 -53.985 -5.346  1.00 0.00 ?  59  LYS C HE2  1  
ATOM   6777   H  HE3  . LYS C  2 5   ? -22.522 -53.142 -4.576  1.00 0.00 ?  59  LYS C HE3  1  
ATOM   6778   H  HZ1  . LYS C  2 5   ? -23.365 -54.832 -2.599  1.00 0.00 ?  59  LYS C HZ1  1  
ATOM   6779   H  HZ2  . LYS C  2 5   ? -22.136 -55.351 -3.733  1.00 0.00 ?  59  LYS C HZ2  1  
ATOM   6780   H  HZ3  . LYS C  2 5   ? -23.639 -55.802 -4.020  1.00 0.00 ?  59  LYS C HZ3  1  
ATOM   6781   N  N    . LEU C  2 6   ? -25.305 -48.078 -0.697  1.00 0.00 ?  60  LEU C N    1  
ATOM   6782   C  CA   . LEU C  2 6   ? -25.972 -46.895 -0.109  1.00 0.00 ?  60  LEU C CA   1  
ATOM   6783   C  C    . LEU C  2 6   ? -26.776 -46.115 -1.145  1.00 0.00 ?  60  LEU C C    1  
ATOM   6784   O  O    . LEU C  2 6   ? -27.978 -45.808 -0.909  1.00 0.00 ?  60  LEU C O    1  
ATOM   6785   C  CB   . LEU C  2 6   ? -24.940 -45.960 0.467   1.00 0.00 ?  60  LEU C CB   1  
ATOM   6786   C  CG   . LEU C  2 6   ? -25.415 -44.601 1.050   1.00 0.00 ?  60  LEU C CG   1  
ATOM   6787   C  CD1  . LEU C  2 6   ? -26.455 -44.836 2.182   1.00 0.00 ?  60  LEU C CD1  1  
ATOM   6788   C  CD2  . LEU C  2 6   ? -24.149 -43.833 1.525   1.00 0.00 ?  60  LEU C CD2  1  
ATOM   6789   H  H    . LEU C  2 6   ? -24.315 -47.967 -0.724  1.00 0.00 ?  60  LEU C H    1  
ATOM   6790   H  HA   . LEU C  2 6   ? -26.571 -47.186 0.741   1.00 0.00 ?  60  LEU C HA   1  
ATOM   6791   H  HB2  . LEU C  2 6   ? -24.408 -46.429 1.322   1.00 0.00 ?  60  LEU C HB2  1  
ATOM   6792   H  HB3  . LEU C  2 6   ? -24.200 -45.805 -0.348  1.00 0.00 ?  60  LEU C HB3  1  
ATOM   6793   H  HG   . LEU C  2 6   ? -25.994 -43.944 0.366   1.00 0.00 ?  60  LEU C HG   1  
ATOM   6794   H  HD11 . LEU C  2 6   ? -27.374 -45.280 1.741   1.00 0.00 ?  60  LEU C HD11 1  
ATOM   6795   H  HD12 . LEU C  2 6   ? -26.771 -43.934 2.748   1.00 0.00 ?  60  LEU C HD12 1  
ATOM   6796   H  HD13 . LEU C  2 6   ? -25.989 -45.466 2.969   1.00 0.00 ?  60  LEU C HD13 1  
ATOM   6797   H  HD21 . LEU C  2 6   ? -23.357 -44.009 0.766   1.00 0.00 ?  60  LEU C HD21 1  
ATOM   6798   H  HD22 . LEU C  2 6   ? -23.683 -44.093 2.500   1.00 0.00 ?  60  LEU C HD22 1  
ATOM   6799   H  HD23 . LEU C  2 6   ? -24.379 -42.756 1.678   1.00 0.00 ?  60  LEU C HD23 1  
ATOM   6800   N  N    . ARG C  2 7   ? -26.208 -45.827 -2.360  1.00 0.00 ?  61  ARG C N    1  
ATOM   6801   C  CA   . ARG C  2 7   ? -27.007 -45.243 -3.422  1.00 0.00 ?  61  ARG C CA   1  
ATOM   6802   C  C    . ARG C  2 7   ? -28.248 -46.046 -3.738  1.00 0.00 ?  61  ARG C C    1  
ATOM   6803   O  O    . ARG C  2 7   ? -29.343 -45.512 -3.973  1.00 0.00 ?  61  ARG C O    1  
ATOM   6804   C  CB   . ARG C  2 7   ? -26.189 -45.151 -4.717  1.00 0.00 ?  61  ARG C CB   1  
ATOM   6805   C  CG   . ARG C  2 7   ? -26.759 -44.446 -5.999  1.00 0.00 ?  61  ARG C CG   1  
ATOM   6806   C  CD   . ARG C  2 7   ? -27.603 -43.220 -5.719  1.00 0.00 ?  61  ARG C CD   1  
ATOM   6807   N  NE   . ARG C  2 7   ? -26.810 -42.286 -4.870  1.00 0.00 ?  61  ARG C NE   1  
ATOM   6808   C  CZ   . ARG C  2 7   ? -26.243 -41.186 -5.323  1.00 0.00 ?  61  ARG C CZ   1  
ATOM   6809   N  NH1  . ARG C  2 7   ? -25.741 -40.287 -4.510  1.00 0.00 1  61  ARG C NH1  1  
ATOM   6810   N  NH2  . ARG C  2 7   ? -26.178 -40.955 -6.626  1.00 0.00 ?  61  ARG C NH2  1  
ATOM   6811   H  H    . ARG C  2 7   ? -25.263 -46.008 -2.618  1.00 0.00 ?  61  ARG C H    1  
ATOM   6812   H  HA   . ARG C  2 7   ? -27.333 -44.244 -3.174  1.00 0.00 ?  61  ARG C HA   1  
ATOM   6813   H  HB2  . ARG C  2 7   ? -25.185 -44.712 -4.535  1.00 0.00 ?  61  ARG C HB2  1  
ATOM   6814   H  HB3  . ARG C  2 7   ? -25.719 -46.122 -4.985  1.00 0.00 ?  61  ARG C HB3  1  
ATOM   6815   H  HG2  . ARG C  2 7   ? -25.903 -44.210 -6.668  1.00 0.00 ?  61  ARG C HG2  1  
ATOM   6816   H  HG3  . ARG C  2 7   ? -27.400 -45.150 -6.572  1.00 0.00 ?  61  ARG C HG3  1  
ATOM   6817   H  HD2  . ARG C  2 7   ? -27.878 -42.932 -6.756  1.00 0.00 ?  61  ARG C HD2  1  
ATOM   6818   H  HD3  . ARG C  2 7   ? -28.574 -43.446 -5.227  1.00 0.00 ?  61  ARG C HD3  1  
ATOM   6819   H  HE   . ARG C  2 7   ? -26.570 -42.451 -3.913  1.00 0.00 ?  61  ARG C HE   1  
ATOM   6820   H  HH11 . ARG C  2 7   ? -25.877 -40.457 -3.534  1.00 0.00 ?  61  ARG C HH11 1  
ATOM   6821   H  HH12 . ARG C  2 7   ? -25.263 -39.537 -4.967  1.00 0.00 ?  61  ARG C HH12 1  
ATOM   6822   H  HH21 . ARG C  2 7   ? -25.527 -40.241 -6.883  1.00 0.00 ?  61  ARG C HH21 1  
ATOM   6823   H  HH22 . ARG C  2 7   ? -26.677 -41.554 -7.252  1.00 0.00 ?  61  ARG C HH22 1  
ATOM   6824   N  N    . GLU C  2 8   ? -28.190 -47.420 -3.670  1.00 0.00 ?  62  GLU C N    1  
ATOM   6825   C  CA   . GLU C  2 8   ? -29.273 -48.248 -4.153  1.00 0.00 ?  62  GLU C CA   1  
ATOM   6826   C  C    . GLU C  2 8   ? -30.470 -48.398 -3.149  1.00 0.00 ?  62  GLU C C    1  
ATOM   6827   O  O    . GLU C  2 8   ? -31.603 -48.475 -3.583  1.00 0.00 ?  62  GLU C O    1  
ATOM   6828   C  CB   . GLU C  2 8   ? -28.657 -49.619 -4.509  1.00 0.00 ?  62  GLU C CB   1  
ATOM   6829   C  CG   . GLU C  2 8   ? -29.655 -50.767 -4.774  1.00 0.00 ?  62  GLU C CG   1  
ATOM   6830   C  CD   . GLU C  2 8   ? -28.934 -51.910 -5.444  1.00 0.00 ?  62  GLU C CD   1  
ATOM   6831   O  OE1  . GLU C  2 8   ? -28.818 -53.057 -4.993  1.00 0.00 ?  62  GLU C OE1  1  
ATOM   6832   O  OE2  . GLU C  2 8   ? -28.333 -51.637 -6.476  1.00 0.00 -1 62  GLU C OE2  1  
ATOM   6833   H  H    . GLU C  2 8   ? -27.328 -47.822 -3.370  1.00 0.00 ?  62  GLU C H    1  
ATOM   6834   H  HA   . GLU C  2 8   ? -29.674 -47.845 -5.071  1.00 0.00 ?  62  GLU C HA   1  
ATOM   6835   H  HB2  . GLU C  2 8   ? -28.063 -49.451 -5.432  1.00 0.00 ?  62  GLU C HB2  1  
ATOM   6836   H  HB3  . GLU C  2 8   ? -28.053 -50.030 -3.672  1.00 0.00 ?  62  GLU C HB3  1  
ATOM   6837   H  HG2  . GLU C  2 8   ? -30.182 -51.127 -3.864  1.00 0.00 ?  62  GLU C HG2  1  
ATOM   6838   H  HG3  . GLU C  2 8   ? -30.349 -50.365 -5.543  1.00 0.00 ?  62  GLU C HG3  1  
ATOM   6839   N  N    . GLN C  2 9   ? -30.223 -48.374 -1.833  1.00 0.00 ?  63  GLN C N    1  
ATOM   6840   C  CA   . GLN C  2 9   ? -31.295 -48.286 -0.850  1.00 0.00 ?  63  GLN C CA   1  
ATOM   6841   C  C    . GLN C  2 9   ? -31.869 -46.878 -0.563  1.00 0.00 ?  63  GLN C C    1  
ATOM   6842   O  O    . GLN C  2 9   ? -33.072 -46.731 -0.393  1.00 0.00 ?  63  GLN C O    1  
ATOM   6843   C  CB   . GLN C  2 9   ? -30.861 -48.941 0.460   1.00 0.00 ?  63  GLN C CB   1  
ATOM   6844   C  CG   . GLN C  2 9   ? -30.701 -50.515 0.404   1.00 0.00 ?  63  GLN C CG   1  
ATOM   6845   C  CD   . GLN C  2 9   ? -31.768 -51.272 -0.411  1.00 0.00 ?  63  GLN C CD   1  
ATOM   6846   O  OE1  . GLN C  2 9   ? -32.996 -51.036 -0.444  1.00 0.00 ?  63  GLN C OE1  1  
ATOM   6847   N  NE2  . GLN C  2 9   ? -31.251 -52.302 -1.082  1.00 0.00 ?  63  GLN C NE2  1  
ATOM   6848   H  H    . GLN C  2 9   ? -29.310 -48.450 -1.438  1.00 0.00 ?  63  GLN C H    1  
ATOM   6849   H  HA   . GLN C  2 9   ? -32.161 -48.784 -1.259  1.00 0.00 ?  63  GLN C HA   1  
ATOM   6850   H  HB2  . GLN C  2 9   ? -30.002 -48.365 0.865   1.00 0.00 ?  63  GLN C HB2  1  
ATOM   6851   H  HB3  . GLN C  2 9   ? -31.614 -48.726 1.247   1.00 0.00 ?  63  GLN C HB3  1  
ATOM   6852   H  HG2  . GLN C  2 9   ? -29.662 -50.850 0.196   1.00 0.00 ?  63  GLN C HG2  1  
ATOM   6853   H  HG3  . GLN C  2 9   ? -30.956 -50.873 1.424   1.00 0.00 ?  63  GLN C HG3  1  
ATOM   6854   H  HE21 . GLN C  2 9   ? -31.801 -53.097 -1.338  1.00 0.00 ?  63  GLN C HE21 1  
ATOM   6855   H  HE22 . GLN C  2 9   ? -30.264 -52.468 -1.093  1.00 0.00 ?  63  GLN C HE22 1  
ATOM   6856   N  N    . LEU C  2 10  ? -31.057 -45.891 -0.574  1.00 0.00 ?  64  LEU C N    1  
ATOM   6857   C  CA   . LEU C  2 10  ? -31.402 -44.560 -0.131  1.00 0.00 ?  64  LEU C CA   1  
ATOM   6858   C  C    . LEU C  2 10  ? -31.584 -43.544 -1.274  1.00 0.00 ?  64  LEU C C    1  
ATOM   6859   O  O    . LEU C  2 10  ? -32.293 -42.597 -1.134  1.00 0.00 ?  64  LEU C O    1  
ATOM   6860   C  CB   . LEU C  2 10  ? -30.278 -44.008 0.791   1.00 0.00 ?  64  LEU C CB   1  
ATOM   6861   C  CG   . LEU C  2 10  ? -30.503 -42.567 1.354   1.00 0.00 ?  64  LEU C CG   1  
ATOM   6862   C  CD1  . LEU C  2 10  ? -31.907 -42.395 1.982   1.00 0.00 ?  64  LEU C CD1  1  
ATOM   6863   C  CD2  . LEU C  2 10  ? -29.461 -42.222 2.418   1.00 0.00 ?  64  LEU C CD2  1  
ATOM   6864   H  H    . LEU C  2 10  ? -30.089 -45.997 -0.790  1.00 0.00 ?  64  LEU C H    1  
ATOM   6865   H  HA   . LEU C  2 10  ? -32.405 -44.560 0.270   1.00 0.00 ?  64  LEU C HA   1  
ATOM   6866   H  HB2  . LEU C  2 10  ? -30.296 -44.720 1.644   1.00 0.00 ?  64  LEU C HB2  1  
ATOM   6867   H  HB3  . LEU C  2 10  ? -29.289 -44.094 0.293   1.00 0.00 ?  64  LEU C HB3  1  
ATOM   6868   H  HG   . LEU C  2 10  ? -30.441 -41.767 0.586   1.00 0.00 ?  64  LEU C HG   1  
ATOM   6869   H  HD11 . LEU C  2 10  ? -31.889 -42.749 3.035   1.00 0.00 ?  64  LEU C HD11 1  
ATOM   6870   H  HD12 . LEU C  2 10  ? -32.700 -42.899 1.390   1.00 0.00 ?  64  LEU C HD12 1  
ATOM   6871   H  HD13 . LEU C  2 10  ? -32.151 -41.314 2.063   1.00 0.00 ?  64  LEU C HD13 1  
ATOM   6872   H  HD21 . LEU C  2 10  ? -29.656 -42.768 3.365   1.00 0.00 ?  64  LEU C HD21 1  
ATOM   6873   H  HD22 . LEU C  2 10  ? -29.351 -41.149 2.684   1.00 0.00 ?  64  LEU C HD22 1  
ATOM   6874   H  HD23 . LEU C  2 10  ? -28.439 -42.443 2.043   1.00 0.00 ?  64  LEU C HD23 1  
ATOM   6875   N  N    . GLY C  2 11  ? -31.034 -43.841 -2.460  1.00 0.00 ?  65  GLY C N    1  
ATOM   6876   C  CA   . GLY C  2 11  ? -31.104 -43.025 -3.608  1.00 0.00 ?  65  GLY C CA   1  
ATOM   6877   C  C    . GLY C  2 11  ? -32.472 -42.908 -4.293  1.00 0.00 ?  65  GLY C C    1  
ATOM   6878   O  O    . GLY C  2 11  ? -32.788 -41.760 -4.660  1.00 0.00 ?  65  GLY C O    1  
ATOM   6879   H  H    . GLY C  2 11  ? -30.403 -44.613 -2.460  1.00 0.00 ?  65  GLY C H    1  
ATOM   6880   H  HA2  . GLY C  2 11  ? -30.706 -42.044 -3.395  1.00 0.00 ?  65  GLY C HA2  1  
ATOM   6881   H  HA3  . GLY C  2 11  ? -30.432 -43.532 -4.285  1.00 0.00 ?  65  GLY C HA3  1  
ATOM   6882   N  N    . PRO C  2 12  ? -33.350 -43.999 -4.365  1.00 0.00 ?  66  PRO C N    1  
ATOM   6883   C  CA   . PRO C  2 12  ? -34.691 -43.913 -4.845  1.00 0.00 ?  66  PRO C CA   1  
ATOM   6884   C  C    . PRO C  2 12  ? -35.488 -43.223 -3.820  1.00 0.00 ?  66  PRO C C    1  
ATOM   6885   O  O    . PRO C  2 12  ? -36.265 -42.376 -4.168  1.00 0.00 ?  66  PRO C O    1  
ATOM   6886   C  CB   . PRO C  2 12  ? -35.165 -45.388 -4.874  1.00 0.00 ?  66  PRO C CB   1  
ATOM   6887   C  CG   . PRO C  2 12  ? -33.883 -46.218 -5.047  1.00 0.00 ?  66  PRO C CG   1  
ATOM   6888   C  CD   . PRO C  2 12  ? -32.886 -45.378 -4.338  1.00 0.00 ?  66  PRO C CD   1  
ATOM   6889   H  HA   . PRO C  2 12  ? -34.754 -43.317 -5.744  1.00 0.00 ?  66  PRO C HA   1  
ATOM   6890   H  HB2  . PRO C  2 12  ? -35.677 -45.682 -3.932  1.00 0.00 ?  66  PRO C HB2  1  
ATOM   6891   H  HB3  . PRO C  2 12  ? -35.870 -45.537 -5.719  1.00 0.00 ?  66  PRO C HB3  1  
ATOM   6892   H  HG2  . PRO C  2 12  ? -34.076 -47.220 -4.607  1.00 0.00 ?  66  PRO C HG2  1  
ATOM   6893   H  HG3  . PRO C  2 12  ? -33.617 -46.166 -6.125  1.00 0.00 ?  66  PRO C HG3  1  
ATOM   6894   H  HD2  . PRO C  2 12  ? -32.782 -45.593 -3.253  1.00 0.00 ?  66  PRO C HD2  1  
ATOM   6895   H  HD3  . PRO C  2 12  ? -31.902 -45.447 -4.848  1.00 0.00 ?  66  PRO C HD3  1  
ATOM   6896   N  N    . VAL C  2 13  ? -35.269 -43.416 -2.524  1.00 0.00 ?  67  VAL C N    1  
ATOM   6897   C  CA   . VAL C  2 13  ? -35.977 -42.715 -1.450  1.00 0.00 ?  67  VAL C CA   1  
ATOM   6898   C  C    . VAL C  2 13  ? -35.671 -41.238 -1.475  1.00 0.00 ?  67  VAL C C    1  
ATOM   6899   O  O    . VAL C  2 13  ? -36.560 -40.411 -1.322  1.00 0.00 ?  67  VAL C O    1  
ATOM   6900   C  CB   . VAL C  2 13  ? -35.576 -43.370 -0.109  1.00 0.00 ?  67  VAL C CB   1  
ATOM   6901   C  CG1  . VAL C  2 13  ? -36.338 -42.795 1.021   1.00 0.00 ?  67  VAL C CG1  1  
ATOM   6902   C  CG2  . VAL C  2 13  ? -35.760 -44.920 -0.196  1.00 0.00 ?  67  VAL C CG2  1  
ATOM   6903   H  H    . VAL C  2 13  ? -34.669 -44.161 -2.242  1.00 0.00 ?  67  VAL C H    1  
ATOM   6904   H  HA   . VAL C  2 13  ? -37.045 -42.788 -1.595  1.00 0.00 ?  67  VAL C HA   1  
ATOM   6905   H  HB   . VAL C  2 13  ? -34.477 -43.278 0.023   1.00 0.00 ?  67  VAL C HB   1  
ATOM   6906   H  HG11 . VAL C  2 13  ? -37.430 -42.986 0.948   1.00 0.00 ?  67  VAL C HG11 1  
ATOM   6907   H  HG12 . VAL C  2 13  ? -36.357 -41.688 0.927   1.00 0.00 ?  67  VAL C HG12 1  
ATOM   6908   H  HG13 . VAL C  2 13  ? -36.028 -43.097 2.044   1.00 0.00 ?  67  VAL C HG13 1  
ATOM   6909   H  HG21 . VAL C  2 13  ? -35.608 -45.520 0.727   1.00 0.00 ?  67  VAL C HG21 1  
ATOM   6910   H  HG22 . VAL C  2 13  ? -35.016 -45.334 -0.911  1.00 0.00 ?  67  VAL C HG22 1  
ATOM   6911   H  HG23 . VAL C  2 13  ? -36.801 -45.138 -0.515  1.00 0.00 ?  67  VAL C HG23 1  
ATOM   6912   N  N    . THR C  2 14  ? -34.369 -40.836 -1.632  1.00 0.00 ?  68  THR C N    1  
ATOM   6913   C  CA   . THR C  2 14  ? -34.032 -39.447 -1.743  1.00 0.00 ?  68  THR C CA   1  
ATOM   6914   C  C    . THR C  2 14  ? -34.573 -38.903 -2.996  1.00 0.00 ?  68  THR C C    1  
ATOM   6915   O  O    . THR C  2 14  ? -35.004 -37.770 -3.026  1.00 0.00 ?  68  THR C O    1  
ATOM   6916   C  CB   . THR C  2 14  ? -32.487 -39.192 -1.617  1.00 0.00 ?  68  THR C CB   1  
ATOM   6917   O  OG1  . THR C  2 14  ? -32.030 -39.499 -0.312  1.00 0.00 ?  68  THR C OG1  1  
ATOM   6918   C  CG2  . THR C  2 14  ? -32.042 -37.736 -1.774  1.00 0.00 ?  68  THR C CG2  1  
ATOM   6919   H  H    . THR C  2 14  ? -33.638 -41.500 -1.771  1.00 0.00 ?  68  THR C H    1  
ATOM   6920   H  HA   . THR C  2 14  ? -34.552 -38.944 -0.941  1.00 0.00 ?  68  THR C HA   1  
ATOM   6921   H  HB   . THR C  2 14  ? -31.956 -39.860 -2.328  1.00 0.00 ?  68  THR C HB   1  
ATOM   6922   H  HG1  . THR C  2 14  ? -32.312 -40.381 -0.060  1.00 0.00 ?  68  THR C HG1  1  
ATOM   6923   H  HG21 . THR C  2 14  ? -32.107 -37.394 -2.829  1.00 0.00 ?  68  THR C HG21 1  
ATOM   6924   H  HG22 . THR C  2 14  ? -31.020 -37.574 -1.369  1.00 0.00 ?  68  THR C HG22 1  
ATOM   6925   H  HG23 . THR C  2 14  ? -32.616 -37.122 -1.047  1.00 0.00 ?  68  THR C HG23 1  
ATOM   6926   N  N    . GLN C  2 15  ? -34.592 -39.648 -4.139  1.00 0.00 ?  69  GLN C N    1  
ATOM   6927   C  CA   . GLN C  2 15  ? -35.171 -39.219 -5.447  1.00 0.00 ?  69  GLN C CA   1  
ATOM   6928   C  C    . GLN C  2 15  ? -36.658 -38.942 -5.422  1.00 0.00 ?  69  GLN C C    1  
ATOM   6929   O  O    . GLN C  2 15  ? -37.209 -37.976 -5.963  1.00 0.00 ?  69  GLN C O    1  
ATOM   6930   C  CB   . GLN C  2 15  ? -34.759 -40.055 -6.645  1.00 0.00 ?  69  GLN C CB   1  
ATOM   6931   C  CG   . GLN C  2 15  ? -33.358 -39.761 -7.240  1.00 0.00 ?  69  GLN C CG   1  
ATOM   6932   C  CD   . GLN C  2 15  ? -33.415 -38.419 -7.978  1.00 0.00 ?  69  GLN C CD   1  
ATOM   6933   O  OE1  . GLN C  2 15  ? -34.487 -37.859 -8.249  1.00 0.00 ?  69  GLN C OE1  1  
ATOM   6934   N  NE2  . GLN C  2 15  ? -32.273 -37.817 -8.197  1.00 0.00 ?  69  GLN C NE2  1  
ATOM   6935   H  H    . GLN C  2 15  ? -34.237 -40.574 -4.040  1.00 0.00 ?  69  GLN C H    1  
ATOM   6936   H  HA   . GLN C  2 15  ? -34.628 -38.317 -5.686  1.00 0.00 ?  69  GLN C HA   1  
ATOM   6937   H  HB2  . GLN C  2 15  ? -34.631 -41.116 -6.342  1.00 0.00 ?  69  GLN C HB2  1  
ATOM   6938   H  HB3  . GLN C  2 15  ? -35.476 -40.179 -7.485  1.00 0.00 ?  69  GLN C HB3  1  
ATOM   6939   H  HG2  . GLN C  2 15  ? -32.533 -39.718 -6.497  1.00 0.00 ?  69  GLN C HG2  1  
ATOM   6940   H  HG3  . GLN C  2 15  ? -33.091 -40.526 -8.000  1.00 0.00 ?  69  GLN C HG3  1  
ATOM   6941   H  HE21 . GLN C  2 15  ? -32.348 -36.882 -8.542  1.00 0.00 ?  69  GLN C HE21 1  
ATOM   6942   H  HE22 . GLN C  2 15  ? -31.400 -38.238 -7.947  1.00 0.00 ?  69  GLN C HE22 1  
ATOM   6943   N  N    . GLU C  2 16  ? -37.390 -39.839 -4.678  1.00 0.00 ?  70  GLU C N    1  
ATOM   6944   C  CA   . GLU C  2 16  ? -38.770 -39.465 -4.399  1.00 0.00 ?  70  GLU C CA   1  
ATOM   6945   C  C    . GLU C  2 16  ? -38.942 -38.258 -3.562  1.00 0.00 ?  70  GLU C C    1  
ATOM   6946   O  O    . GLU C  2 16  ? -39.755 -37.359 -3.832  1.00 0.00 ?  70  GLU C O    1  
ATOM   6947   C  CB   . GLU C  2 16  ? -39.435 -40.568 -3.486  1.00 0.00 ?  70  GLU C CB   1  
ATOM   6948   C  CG   . GLU C  2 16  ? -39.683 -41.887 -4.276  1.00 0.00 ?  70  GLU C CG   1  
ATOM   6949   C  CD   . GLU C  2 16  ? -41.103 -42.096 -4.748  1.00 0.00 ?  70  GLU C CD   1  
ATOM   6950   O  OE1  . GLU C  2 16  ? -41.889 -42.552 -3.886  1.00 0.00 ?  70  GLU C OE1  1  
ATOM   6951   O  OE2  . GLU C  2 16  ? -41.459 -41.934 -5.900  1.00 0.00 -1 70  GLU C OE2  1  
ATOM   6952   H  H    . GLU C  2 16  ? -36.955 -40.637 -4.268  1.00 0.00 ?  70  GLU C H    1  
ATOM   6953   H  HA   . GLU C  2 16  ? -39.384 -39.350 -5.280  1.00 0.00 ?  70  GLU C HA   1  
ATOM   6954   H  HB2  . GLU C  2 16  ? -38.861 -40.904 -2.596  1.00 0.00 ?  70  GLU C HB2  1  
ATOM   6955   H  HB3  . GLU C  2 16  ? -40.426 -40.231 -3.111  1.00 0.00 ?  70  GLU C HB3  1  
ATOM   6956   H  HG2  . GLU C  2 16  ? -38.874 -42.173 -4.981  1.00 0.00 ?  70  GLU C HG2  1  
ATOM   6957   H  HG3  . GLU C  2 16  ? -39.528 -42.720 -3.557  1.00 0.00 ?  70  GLU C HG3  1  
ATOM   6958   N  N    . PHE C  2 17  ? -38.178 -38.146 -2.443  1.00 0.00 ?  71  PHE C N    1  
ATOM   6959   C  CA   . PHE C  2 17  ? -38.239 -37.064 -1.477  1.00 0.00 ?  71  PHE C CA   1  
ATOM   6960   C  C    . PHE C  2 17  ? -37.961 -35.709 -2.031  1.00 0.00 ?  71  PHE C C    1  
ATOM   6961   O  O    . PHE C  2 17  ? -38.725 -34.778 -1.830  1.00 0.00 ?  71  PHE C O    1  
ATOM   6962   C  CB   . PHE C  2 17  ? -37.337 -37.322 -0.196  1.00 0.00 ?  71  PHE C CB   1  
ATOM   6963   C  CG   . PHE C  2 17  ? -36.613 -36.165 0.520   1.00 0.00 ?  71  PHE C CG   1  
ATOM   6964   C  CD1  . PHE C  2 17  ? -37.375 -35.407 1.393   1.00 0.00 ?  71  PHE C CD1  1  
ATOM   6965   C  CD2  . PHE C  2 17  ? -35.206 -35.847 0.399   1.00 0.00 ?  71  PHE C CD2  1  
ATOM   6966   C  CE1  . PHE C  2 17  ? -36.755 -34.378 2.174   1.00 0.00 ?  71  PHE C CE1  1  
ATOM   6967   C  CE2  . PHE C  2 17  ? -34.618 -34.843 1.144   1.00 0.00 ?  71  PHE C CE2  1  
ATOM   6968   C  CZ   . PHE C  2 17  ? -35.387 -33.999 2.004   1.00 0.00 ?  71  PHE C CZ   1  
ATOM   6969   H  H    . PHE C  2 17  ? -37.591 -38.920 -2.219  1.00 0.00 ?  71  PHE C H    1  
ATOM   6970   H  HA   . PHE C  2 17  ? -39.251 -37.005 -1.107  1.00 0.00 ?  71  PHE C HA   1  
ATOM   6971   H  HB2  . PHE C  2 17  ? -37.906 -37.972 0.503   1.00 0.00 ?  71  PHE C HB2  1  
ATOM   6972   H  HB3  . PHE C  2 17  ? -36.522 -38.006 -0.516  1.00 0.00 ?  71  PHE C HB3  1  
ATOM   6973   H  HD1  . PHE C  2 17  ? -38.423 -35.632 1.524   1.00 0.00 ?  71  PHE C HD1  1  
ATOM   6974   H  HD2  . PHE C  2 17  ? -34.551 -36.493 -0.167  1.00 0.00 ?  71  PHE C HD2  1  
ATOM   6975   H  HE1  . PHE C  2 17  ? -37.374 -33.815 2.857   1.00 0.00 ?  71  PHE C HE1  1  
ATOM   6976   H  HE2  . PHE C  2 17  ? -33.558 -34.638 1.123   1.00 0.00 ?  71  PHE C HE2  1  
ATOM   6977   H  HZ   . PHE C  2 17  ? -35.017 -33.157 2.569   1.00 0.00 ?  71  PHE C HZ   1  
ATOM   6978   N  N    . TRP C  2 18  ? -36.877 -35.697 -2.813  1.00 0.00 ?  72  TRP C N    1  
ATOM   6979   C  CA   . TRP C  2 18  ? -36.358 -34.495 -3.549  1.00 0.00 ?  72  TRP C CA   1  
ATOM   6980   C  C    . TRP C  2 18  ? -37.274 -34.105 -4.713  1.00 0.00 ?  72  TRP C C    1  
ATOM   6981   O  O    . TRP C  2 18  ? -37.534 -32.914 -4.889  1.00 0.00 ?  72  TRP C O    1  
ATOM   6982   C  CB   . TRP C  2 18  ? -34.850 -34.643 -3.910  1.00 0.00 ?  72  TRP C CB   1  
ATOM   6983   C  CG   . TRP C  2 18  ? -34.220 -33.451 -4.523  1.00 0.00 ?  72  TRP C CG   1  
ATOM   6984   C  CD1  . TRP C  2 18  ? -33.826 -32.279 -3.928  1.00 0.00 ?  72  TRP C CD1  1  
ATOM   6985   C  CD2  . TRP C  2 18  ? -34.191 -33.192 -5.959  1.00 0.00 ?  72  TRP C CD2  1  
ATOM   6986   N  NE1  . TRP C  2 18  ? -33.478 -31.357 -4.951  1.00 0.00 ?  72  TRP C NE1  1  
ATOM   6987   C  CE2  . TRP C  2 18  ? -33.667 -31.919 -6.140  1.00 0.00 ?  72  TRP C CE2  1  
ATOM   6988   C  CE3  . TRP C  2 18  ? -34.496 -33.950 -7.115  1.00 0.00 ?  72  TRP C CE3  1  
ATOM   6989   C  CZ2  . TRP C  2 18  ? -33.390 -31.339 -7.376  1.00 0.00 ?  72  TRP C CZ2  1  
ATOM   6990   C  CZ3  . TRP C  2 18  ? -34.150 -33.406 -8.374  1.00 0.00 ?  72  TRP C CZ3  1  
ATOM   6991   C  CH2  . TRP C  2 18  ? -33.525 -32.175 -8.494  1.00 0.00 ?  72  TRP C CH2  1  
ATOM   6992   H  H    . TRP C  2 18  ? -36.339 -36.536 -2.768  1.00 0.00 ?  72  TRP C H    1  
ATOM   6993   H  HA   . TRP C  2 18  ? -36.426 -33.697 -2.824  1.00 0.00 ?  72  TRP C HA   1  
ATOM   6994   H  HB2  . TRP C  2 18  ? -34.246 -34.911 -3.017  1.00 0.00 ?  72  TRP C HB2  1  
ATOM   6995   H  HB3  . TRP C  2 18  ? -34.745 -35.443 -4.673  1.00 0.00 ?  72  TRP C HB3  1  
ATOM   6996   H  HD1  . TRP C  2 18  ? -33.799 -32.154 -2.856  1.00 0.00 ?  72  TRP C HD1  1  
ATOM   6997   H  HE1  . TRP C  2 18  ? -33.298 -30.402 -4.859  1.00 0.00 ?  72  TRP C HE1  1  
ATOM   6998   H  HE3  . TRP C  2 18  ? -34.964 -34.922 -7.066  1.00 0.00 ?  72  TRP C HE3  1  
ATOM   6999   H  HZ2  . TRP C  2 18  ? -32.797 -30.442 -7.472  1.00 0.00 ?  72  TRP C HZ2  1  
ATOM   7000   H  HZ3  . TRP C  2 18  ? -34.359 -33.937 -9.291  1.00 0.00 ?  72  TRP C HZ3  1  
ATOM   7001   H  HH2  . TRP C  2 18  ? -33.168 -31.820 -9.449  1.00 0.00 ?  72  TRP C HH2  1  
ATOM   7002   N  N    . ASP C  2 19  ? -37.791 -35.083 -5.489  1.00 0.00 ?  73  ASP C N    1  
ATOM   7003   C  CA   . ASP C  2 19  ? -38.875 -34.738 -6.451  1.00 0.00 ?  73  ASP C CA   1  
ATOM   7004   C  C    . ASP C  2 19  ? -40.200 -34.158 -5.873  1.00 0.00 ?  73  ASP C C    1  
ATOM   7005   O  O    . ASP C  2 19  ? -40.848 -33.208 -6.351  1.00 0.00 ?  73  ASP C O    1  
ATOM   7006   C  CB   . ASP C  2 19  ? -39.219 -36.011 -7.286  1.00 0.00 ?  73  ASP C CB   1  
ATOM   7007   C  CG   . ASP C  2 19  ? -40.210 -35.669 -8.462  1.00 0.00 ?  73  ASP C CG   1  
ATOM   7008   O  OD1  . ASP C  2 19  ? -41.245 -36.384 -8.570  1.00 0.00 ?  73  ASP C OD1  1  
ATOM   7009   O  OD2  . ASP C  2 19  ? -39.851 -34.838 -9.293  1.00 0.00 -1 73  ASP C OD2  1  
ATOM   7010   H  H    . ASP C  2 19  ? -37.523 -36.038 -5.390  1.00 0.00 ?  73  ASP C H    1  
ATOM   7011   H  HA   . ASP C  2 19  ? -38.428 -33.967 -7.062  1.00 0.00 ?  73  ASP C HA   1  
ATOM   7012   H  HB2  . ASP C  2 19  ? -38.264 -36.277 -7.786  1.00 0.00 ?  73  ASP C HB2  1  
ATOM   7013   H  HB3  . ASP C  2 19  ? -39.513 -36.867 -6.641  1.00 0.00 ?  73  ASP C HB3  1  
ATOM   7014   N  N    . ASN C  2 20  ? -40.698 -34.753 -4.771  1.00 0.00 ?  74  ASN C N    1  
ATOM   7015   C  CA   . ASN C  2 20  ? -41.898 -34.258 -4.073  1.00 0.00 ?  74  ASN C CA   1  
ATOM   7016   C  C    . ASN C  2 20  ? -41.624 -32.886 -3.435  1.00 0.00 ?  74  ASN C C    1  
ATOM   7017   O  O    . ASN C  2 20  ? -42.494 -32.060 -3.404  1.00 0.00 ?  74  ASN C O    1  
ATOM   7018   C  CB   . ASN C  2 20  ? -42.541 -35.225 -2.998  1.00 0.00 ?  74  ASN C CB   1  
ATOM   7019   C  CG   . ASN C  2 20  ? -43.108 -36.479 -3.726  1.00 0.00 ?  74  ASN C CG   1  
ATOM   7020   O  OD1  . ASN C  2 20  ? -43.354 -36.404 -4.930  1.00 0.00 ?  74  ASN C OD1  1  
ATOM   7021   N  ND2  . ASN C  2 20  ? -43.283 -37.592 -3.098  1.00 0.00 ?  74  ASN C ND2  1  
ATOM   7022   H  H    . ASN C  2 20  ? -40.289 -35.617 -4.486  1.00 0.00 ?  74  ASN C H    1  
ATOM   7023   H  HA   . ASN C  2 20  ? -42.721 -34.086 -4.750  1.00 0.00 ?  74  ASN C HA   1  
ATOM   7024   H  HB2  . ASN C  2 20  ? -41.847 -35.531 -2.185  1.00 0.00 ?  74  ASN C HB2  1  
ATOM   7025   H  HB3  . ASN C  2 20  ? -43.419 -34.790 -2.474  1.00 0.00 ?  74  ASN C HB3  1  
ATOM   7026   H  HD21 . ASN C  2 20  ? -43.480 -38.464 -3.547  1.00 0.00 ?  74  ASN C HD21 1  
ATOM   7027   H  HD22 . ASN C  2 20  ? -42.954 -37.625 -2.154  1.00 0.00 ?  74  ASN C HD22 1  
ATOM   7028   N  N    . LEU C  2 21  ? -40.422 -32.669 -2.829  1.00 0.00 ?  75  LEU C N    1  
ATOM   7029   C  CA   . LEU C  2 21  ? -40.100 -31.460 -2.087  1.00 0.00 ?  75  LEU C CA   1  
ATOM   7030   C  C    . LEU C  2 21  ? -39.954 -30.284 -3.032  1.00 0.00 ?  75  LEU C C    1  
ATOM   7031   O  O    . LEU C  2 21  ? -40.430 -29.198 -2.761  1.00 0.00 ?  75  LEU C O    1  
ATOM   7032   C  CB   . LEU C  2 21  ? -38.764 -31.759 -1.361  1.00 0.00 ?  75  LEU C CB   1  
ATOM   7033   C  CG   . LEU C  2 21  ? -38.102 -30.464 -0.652  1.00 0.00 ?  75  LEU C CG   1  
ATOM   7034   C  CD1  . LEU C  2 21  ? -39.062 -29.845 0.373   1.00 0.00 ?  75  LEU C CD1  1  
ATOM   7035   C  CD2  . LEU C  2 21  ? -36.747 -30.778 -0.051  1.00 0.00 ?  75  LEU C CD2  1  
ATOM   7036   H  H    . LEU C  2 21  ? -39.797 -33.435 -2.704  1.00 0.00 ?  75  LEU C H    1  
ATOM   7037   H  HA   . LEU C  2 21  ? -40.914 -31.278 -1.402  1.00 0.00 ?  75  LEU C HA   1  
ATOM   7038   H  HB2  . LEU C  2 21  ? -38.708 -32.643 -0.691  1.00 0.00 ?  75  LEU C HB2  1  
ATOM   7039   H  HB3  . LEU C  2 21  ? -37.989 -32.083 -2.088  1.00 0.00 ?  75  LEU C HB3  1  
ATOM   7040   H  HG   . LEU C  2 21  ? -38.004 -29.697 -1.450  1.00 0.00 ?  75  LEU C HG   1  
ATOM   7041   H  HD11 . LEU C  2 21  ? -39.251 -30.600 1.166   1.00 0.00 ?  75  LEU C HD11 1  
ATOM   7042   H  HD12 . LEU C  2 21  ? -40.062 -29.514 0.020   1.00 0.00 ?  75  LEU C HD12 1  
ATOM   7043   H  HD13 . LEU C  2 21  ? -38.619 -29.009 0.956   1.00 0.00 ?  75  LEU C HD13 1  
ATOM   7044   H  HD21 . LEU C  2 21  ? -36.688 -31.377 0.882   1.00 0.00 ?  75  LEU C HD21 1  
ATOM   7045   H  HD22 . LEU C  2 21  ? -36.199 -29.821 0.090   1.00 0.00 ?  75  LEU C HD22 1  
ATOM   7046   H  HD23 . LEU C  2 21  ? -36.202 -31.283 -0.877  1.00 0.00 ?  75  LEU C HD23 1  
ATOM   7047   N  N    . GLU C  2 22  ? -39.440 -30.569 -4.219  1.00 0.00 ?  76  GLU C N    1  
ATOM   7048   C  CA   . GLU C  2 22  ? -39.450 -29.696 -5.424  1.00 0.00 ?  76  GLU C CA   1  
ATOM   7049   C  C    . GLU C  2 22  ? -40.846 -29.319 -5.959  1.00 0.00 ?  76  GLU C C    1  
ATOM   7050   O  O    . GLU C  2 22  ? -41.156 -28.167 -6.253  1.00 0.00 ?  76  GLU C O    1  
ATOM   7051   C  CB   . GLU C  2 22  ? -38.581 -30.289 -6.580  1.00 0.00 ?  76  GLU C CB   1  
ATOM   7052   C  CG   . GLU C  2 22  ? -37.106 -30.147 -6.366  1.00 0.00 ?  76  GLU C CG   1  
ATOM   7053   C  CD   . GLU C  2 22  ? -36.615 -28.787 -6.458  1.00 0.00 ?  76  GLU C CD   1  
ATOM   7054   O  OE1  . GLU C  2 22  ? -37.166 -28.064 -7.321  1.00 0.00 ?  76  GLU C OE1  1  
ATOM   7055   O  OE2  . GLU C  2 22  ? -35.702 -28.441 -5.713  1.00 0.00 -1 76  GLU C OE2  1  
ATOM   7056   H  H    . GLU C  2 22  ? -38.798 -31.330 -4.277  1.00 0.00 ?  76  GLU C H    1  
ATOM   7057   H  HA   . GLU C  2 22  ? -39.030 -28.748 -5.123  1.00 0.00 ?  76  GLU C HA   1  
ATOM   7058   H  HB2  . GLU C  2 22  ? -38.925 -31.346 -6.585  1.00 0.00 ?  76  GLU C HB2  1  
ATOM   7059   H  HB3  . GLU C  2 22  ? -38.859 -29.969 -7.607  1.00 0.00 ?  76  GLU C HB3  1  
ATOM   7060   H  HG2  . GLU C  2 22  ? -36.873 -30.568 -5.364  1.00 0.00 ?  76  GLU C HG2  1  
ATOM   7061   H  HG3  . GLU C  2 22  ? -36.586 -30.771 -7.124  1.00 0.00 ?  76  GLU C HG3  1  
ATOM   7062   N  N    . LYS C  2 23  ? -41.793 -30.327 -5.991  1.00 0.00 ?  77  LYS C N    1  
ATOM   7063   C  CA   . LYS C  2 23  ? -43.176 -30.065 -6.309  1.00 0.00 ?  77  LYS C CA   1  
ATOM   7064   C  C    . LYS C  2 23  ? -43.897 -29.176 -5.325  1.00 0.00 ?  77  LYS C C    1  
ATOM   7065   O  O    . LYS C  2 23  ? -44.676 -28.281 -5.705  1.00 0.00 ?  77  LYS C O    1  
ATOM   7066   C  CB   . LYS C  2 23  ? -43.883 -31.406 -6.528  1.00 0.00 ?  77  LYS C CB   1  
ATOM   7067   C  CG   . LYS C  2 23  ? -43.741 -31.822 -8.040  1.00 0.00 ?  77  LYS C CG   1  
ATOM   7068   C  CD   . LYS C  2 23  ? -44.517 -30.987 -9.077  1.00 0.00 ?  77  LYS C CD   1  
ATOM   7069   C  CE   . LYS C  2 23  ? -44.275 -31.342 -10.583 1.00 0.00 ?  77  LYS C CE   1  
ATOM   7070   N  NZ   . LYS C  2 23  ? -42.901 -31.260 -10.976 1.00 0.00 1  77  LYS C NZ   1  
ATOM   7071   H  H    . LYS C  2 23  ? -41.543 -31.270 -5.784  1.00 0.00 ?  77  LYS C H    1  
ATOM   7072   H  HA   . LYS C  2 23  ? -43.216 -29.494 -7.225  1.00 0.00 ?  77  LYS C HA   1  
ATOM   7073   H  HB2  . LYS C  2 23  ? -43.431 -32.227 -5.932  1.00 0.00 ?  77  LYS C HB2  1  
ATOM   7074   H  HB3  . LYS C  2 23  ? -44.944 -31.343 -6.203  1.00 0.00 ?  77  LYS C HB3  1  
ATOM   7075   H  HG2  . LYS C  2 23  ? -42.658 -31.876 -8.282  1.00 0.00 ?  77  LYS C HG2  1  
ATOM   7076   H  HG3  . LYS C  2 23  ? -44.044 -32.890 -8.068  1.00 0.00 ?  77  LYS C HG3  1  
ATOM   7077   H  HD2  . LYS C  2 23  ? -45.593 -31.026 -8.801  1.00 0.00 ?  77  LYS C HD2  1  
ATOM   7078   H  HD3  . LYS C  2 23  ? -44.215 -29.923 -8.974  1.00 0.00 ?  77  LYS C HD3  1  
ATOM   7079   H  HE2  . LYS C  2 23  ? -44.785 -32.317 -10.736 1.00 0.00 ?  77  LYS C HE2  1  
ATOM   7080   H  HE3  . LYS C  2 23  ? -44.905 -30.690 -11.224 1.00 0.00 ?  77  LYS C HE3  1  
ATOM   7081   H  HZ1  . LYS C  2 23  ? -42.457 -30.365 -10.687 1.00 0.00 ?  77  LYS C HZ1  1  
ATOM   7082   H  HZ2  . LYS C  2 23  ? -42.721 -31.508 -11.970 1.00 0.00 ?  77  LYS C HZ2  1  
ATOM   7083   H  HZ3  . LYS C  2 23  ? -42.433 -32.043 -10.476 1.00 0.00 ?  77  LYS C HZ3  1  
ATOM   7084   N  N    . GLU C  2 24  ? -43.694 -29.367 -3.969  1.00 0.00 ?  78  GLU C N    1  
ATOM   7085   C  CA   . GLU C  2 24  ? -44.389 -28.490 -3.024  1.00 0.00 ?  78  GLU C CA   1  
ATOM   7086   C  C    . GLU C  2 24  ? -43.869 -27.034 -3.129  1.00 0.00 ?  78  GLU C C    1  
ATOM   7087   O  O    . GLU C  2 24  ? -44.673 -26.129 -3.134  1.00 0.00 ?  78  GLU C O    1  
ATOM   7088   C  CB   . GLU C  2 24  ? -44.179 -29.114 -1.624  1.00 0.00 ?  78  GLU C CB   1  
ATOM   7089   C  CG   . GLU C  2 24  ? -45.106 -30.305 -1.372  1.00 0.00 ?  78  GLU C CG   1  
ATOM   7090   C  CD   . GLU C  2 24  ? -45.043 -30.690 0.053   1.00 0.00 ?  78  GLU C CD   1  
ATOM   7091   O  OE1  . GLU C  2 24  ? -44.057 -31.421 0.384   1.00 0.00 ?  78  GLU C OE1  1  
ATOM   7092   O  OE2  . GLU C  2 24  ? -45.934 -30.313 0.863   1.00 0.00 -1 78  GLU C OE2  1  
ATOM   7093   H  H    . GLU C  2 24  ? -43.049 -30.076 -3.693  1.00 0.00 ?  78  GLU C H    1  
ATOM   7094   H  HA   . GLU C  2 24  ? -45.450 -28.449 -3.223  1.00 0.00 ?  78  GLU C HA   1  
ATOM   7095   H  HB2  . GLU C  2 24  ? -43.147 -29.513 -1.520  1.00 0.00 ?  78  GLU C HB2  1  
ATOM   7096   H  HB3  . GLU C  2 24  ? -44.420 -28.367 -0.838  1.00 0.00 ?  78  GLU C HB3  1  
ATOM   7097   H  HG2  . GLU C  2 24  ? -46.166 -30.077 -1.615  1.00 0.00 ?  78  GLU C HG2  1  
ATOM   7098   H  HG3  . GLU C  2 24  ? -44.796 -31.078 -2.108  1.00 0.00 ?  78  GLU C HG3  1  
ATOM   7099   N  N    . THR C  2 25  ? -42.537 -26.767 -3.264  1.00 0.00 ?  79  THR C N    1  
ATOM   7100   C  CA   . THR C  2 25  ? -41.907 -25.456 -3.513  1.00 0.00 ?  79  THR C CA   1  
ATOM   7101   C  C    . THR C  2 25  ? -42.243 -24.725 -4.724  1.00 0.00 ?  79  THR C C    1  
ATOM   7102   O  O    . THR C  2 25  ? -42.534 -23.530 -4.698  1.00 0.00 ?  79  THR C O    1  
ATOM   7103   C  CB   . THR C  2 25  ? -40.386 -25.688 -3.427  1.00 0.00 ?  79  THR C CB   1  
ATOM   7104   O  OG1  . THR C  2 25  ? -40.097 -26.343 -2.206  1.00 0.00 ?  79  THR C OG1  1  
ATOM   7105   C  CG2  . THR C  2 25  ? -39.641 -24.367 -3.245  1.00 0.00 ?  79  THR C CG2  1  
ATOM   7106   H  H    . THR C  2 25  ? -41.967 -27.569 -3.102  1.00 0.00 ?  79  THR C H    1  
ATOM   7107   H  HA   . THR C  2 25  ? -42.267 -24.839 -2.704  1.00 0.00 ?  79  THR C HA   1  
ATOM   7108   H  HB   . THR C  2 25  ? -40.029 -26.220 -4.334  1.00 0.00 ?  79  THR C HB   1  
ATOM   7109   H  HG1  . THR C  2 25  ? -39.158 -26.514 -2.103  1.00 0.00 ?  79  THR C HG1  1  
ATOM   7110   H  HG21 . THR C  2 25  ? -39.728 -23.644 -4.084  1.00 0.00 ?  79  THR C HG21 1  
ATOM   7111   H  HG22 . THR C  2 25  ? -38.579 -24.587 -3.005  1.00 0.00 ?  79  THR C HG22 1  
ATOM   7112   H  HG23 . THR C  2 25  ? -40.079 -23.804 -2.393  1.00 0.00 ?  79  THR C HG23 1  
ATOM   7113   N  N    . GLU C  2 26  ? -42.527 -25.393 -5.832  1.00 0.00 ?  80  GLU C N    1  
ATOM   7114   C  CA   . GLU C  2 26  ? -43.175 -24.832 -6.973  1.00 0.00 ?  80  GLU C CA   1  
ATOM   7115   C  C    . GLU C  2 26  ? -44.583 -24.278 -6.793  1.00 0.00 ?  80  GLU C C    1  
ATOM   7116   O  O    . GLU C  2 26  ? -44.763 -23.128 -7.198  1.00 0.00 ?  80  GLU C O    1  
ATOM   7117   C  CB   . GLU C  2 26  ? -43.041 -25.809 -8.228  1.00 0.00 ?  80  GLU C CB   1  
ATOM   7118   C  CG   . GLU C  2 26  ? -43.938 -25.556 -9.454  1.00 0.00 ?  80  GLU C CG   1  
ATOM   7119   C  CD   . GLU C  2 26  ? -43.560 -26.385 -10.649 1.00 0.00 ?  80  GLU C CD   1  
ATOM   7120   O  OE1  . GLU C  2 26  ? -44.484 -26.830 -11.345 1.00 0.00 ?  80  GLU C OE1  1  
ATOM   7121   O  OE2  . GLU C  2 26  ? -42.351 -26.622 -10.939 1.00 0.00 -1 80  GLU C OE2  1  
ATOM   7122   H  H    . GLU C  2 26  ? -42.479 -26.388 -5.786  1.00 0.00 ?  80  GLU C H    1  
ATOM   7123   H  HA   . GLU C  2 26  ? -42.695 -23.893 -7.207  1.00 0.00 ?  80  GLU C HA   1  
ATOM   7124   H  HB2  . GLU C  2 26  ? -41.986 -25.670 -8.548  1.00 0.00 ?  80  GLU C HB2  1  
ATOM   7125   H  HB3  . GLU C  2 26  ? -43.200 -26.837 -7.838  1.00 0.00 ?  80  GLU C HB3  1  
ATOM   7126   H  HG2  . GLU C  2 26  ? -44.969 -25.764 -9.097  1.00 0.00 ?  80  GLU C HG2  1  
ATOM   7127   H  HG3  . GLU C  2 26  ? -43.714 -24.516 -9.775  1.00 0.00 ?  80  GLU C HG3  1  
ATOM   7128   N  N    . GLY C  2 27  ? -45.478 -25.047 -6.038  1.00 0.00 ?  81  GLY C N    1  
ATOM   7129   C  CA   . GLY C  2 27  ? -46.729 -24.474 -5.612  1.00 0.00 ?  81  GLY C CA   1  
ATOM   7130   C  C    . GLY C  2 27  ? -46.569 -23.368 -4.668  1.00 0.00 ?  81  GLY C C    1  
ATOM   7131   O  O    . GLY C  2 27  ? -47.317 -22.390 -4.754  1.00 0.00 ?  81  GLY C O    1  
ATOM   7132   H  H    . GLY C  2 27  ? -45.189 -25.938 -5.696  1.00 0.00 ?  81  GLY C H    1  
ATOM   7133   H  HA2  . GLY C  2 27  ? -47.295 -24.196 -6.489  1.00 0.00 ?  81  GLY C HA2  1  
ATOM   7134   H  HA3  . GLY C  2 27  ? -47.201 -25.228 -5.000  1.00 0.00 ?  81  GLY C HA3  1  
ATOM   7135   N  N    . LEU C  2 28  ? -45.587 -23.406 -3.747  1.00 0.00 ?  82  LEU C N    1  
ATOM   7136   C  CA   . LEU C  2 28  ? -45.278 -22.397 -2.789  1.00 0.00 ?  82  LEU C CA   1  
ATOM   7137   C  C    . LEU C  2 28  ? -44.941 -21.055 -3.367  1.00 0.00 ?  82  LEU C C    1  
ATOM   7138   O  O    . LEU C  2 28  ? -45.323 -19.991 -2.893  1.00 0.00 ?  82  LEU C O    1  
ATOM   7139   C  CB   . LEU C  2 28  ? -44.113 -22.844 -1.756  1.00 0.00 ?  82  LEU C CB   1  
ATOM   7140   C  CG   . LEU C  2 28  ? -43.621 -21.787 -0.773  1.00 0.00 ?  82  LEU C CG   1  
ATOM   7141   C  CD1  . LEU C  2 28  ? -44.730 -21.389 0.169   1.00 0.00 ?  82  LEU C CD1  1  
ATOM   7142   C  CD2  . LEU C  2 28  ? -42.415 -22.247 0.036   1.00 0.00 ?  82  LEU C CD2  1  
ATOM   7143   H  H    . LEU C  2 28  ? -45.079 -24.256 -3.627  1.00 0.00 ?  82  LEU C H    1  
ATOM   7144   H  HA   . LEU C  2 28  ? -46.141 -22.254 -2.155  1.00 0.00 ?  82  LEU C HA   1  
ATOM   7145   H  HB2  . LEU C  2 28  ? -44.452 -23.773 -1.249  1.00 0.00 ?  82  LEU C HB2  1  
ATOM   7146   H  HB3  . LEU C  2 28  ? -43.276 -23.148 -2.421  1.00 0.00 ?  82  LEU C HB3  1  
ATOM   7147   H  HG   . LEU C  2 28  ? -43.298 -20.913 -1.378  1.00 0.00 ?  82  LEU C HG   1  
ATOM   7148   H  HD11 . LEU C  2 28  ? -44.468 -20.661 0.967   1.00 0.00 ?  82  LEU C HD11 1  
ATOM   7149   H  HD12 . LEU C  2 28  ? -45.203 -22.301 0.594   1.00 0.00 ?  82  LEU C HD12 1  
ATOM   7150   H  HD13 . LEU C  2 28  ? -45.441 -20.765 -0.413  1.00 0.00 ?  82  LEU C HD13 1  
ATOM   7151   H  HD21 . LEU C  2 28  ? -42.552 -23.242 0.511   1.00 0.00 ?  82  LEU C HD21 1  
ATOM   7152   H  HD22 . LEU C  2 28  ? -42.325 -21.518 0.868   1.00 0.00 ?  82  LEU C HD22 1  
ATOM   7153   H  HD23 . LEU C  2 28  ? -41.530 -22.374 -0.625  1.00 0.00 ?  82  LEU C HD23 1  
ATOM   7154   N  N    . ARG C  2 29  ? -44.258 -21.053 -4.532  1.00 0.00 ?  83  ARG C N    1  
ATOM   7155   C  CA   . ARG C  2 29  ? -44.027 -19.824 -5.272  1.00 0.00 ?  83  ARG C CA   1  
ATOM   7156   C  C    . ARG C  2 29  ? -45.256 -19.062 -5.856  1.00 0.00 ?  83  ARG C C    1  
ATOM   7157   O  O    . ARG C  2 29  ? -45.426 -17.852 -5.704  1.00 0.00 ?  83  ARG C O    1  
ATOM   7158   C  CB   . ARG C  2 29  ? -43.133 -20.249 -6.467  1.00 0.00 ?  83  ARG C CB   1  
ATOM   7159   C  CG   . ARG C  2 29  ? -41.575 -20.276 -6.258  1.00 0.00 ?  83  ARG C CG   1  
ATOM   7160   C  CD   . ARG C  2 29  ? -40.922 -21.417 -6.982  1.00 0.00 ?  83  ARG C CD   1  
ATOM   7161   N  NE   . ARG C  2 29  ? -41.510 -21.633 -8.333  1.00 0.00 ?  83  ARG C NE   1  
ATOM   7162   C  CZ   . ARG C  2 29  ? -41.000 -22.536 -9.166  1.00 0.00 ?  83  ARG C CZ   1  
ATOM   7163   N  NH1  . ARG C  2 29  ? -41.490 -22.526 -10.371 1.00 0.00 1  83  ARG C NH1  1  
ATOM   7164   N  NH2  . ARG C  2 29  ? -39.967 -23.299 -8.919  1.00 0.00 ?  83  ARG C NH2  1  
ATOM   7165   H  H    . ARG C  2 29  ? -43.967 -21.852 -5.052  1.00 0.00 ?  83  ARG C H    1  
ATOM   7166   H  HA   . ARG C  2 29  ? -43.554 -19.202 -4.526  1.00 0.00 ?  83  ARG C HA   1  
ATOM   7167   H  HB2  . ARG C  2 29  ? -43.467 -21.251 -6.810  1.00 0.00 ?  83  ARG C HB2  1  
ATOM   7168   H  HB3  . ARG C  2 29  ? -43.381 -19.553 -7.297  1.00 0.00 ?  83  ARG C HB3  1  
ATOM   7169   H  HG2  . ARG C  2 29  ? -41.253 -19.233 -6.463  1.00 0.00 ?  83  ARG C HG2  1  
ATOM   7170   H  HG3  . ARG C  2 29  ? -41.447 -20.325 -5.156  1.00 0.00 ?  83  ARG C HG3  1  
ATOM   7171   H  HD2  . ARG C  2 29  ? -39.847 -21.146 -7.057  1.00 0.00 ?  83  ARG C HD2  1  
ATOM   7172   H  HD3  . ARG C  2 29  ? -41.006 -22.320 -6.341  1.00 0.00 ?  83  ARG C HD3  1  
ATOM   7173   H  HE   . ARG C  2 29  ? -42.110 -21.014 -8.839  1.00 0.00 ?  83  ARG C HE   1  
ATOM   7174   H  HH11 . ARG C  2 29  ? -42.180 -21.829 -10.567 1.00 0.00 ?  83  ARG C HH11 1  
ATOM   7175   H  HH12 . ARG C  2 29  ? -40.923 -22.858 -11.125 1.00 0.00 ?  83  ARG C HH12 1  
ATOM   7176   H  HH21 . ARG C  2 29  ? -39.536 -23.217 -8.020  1.00 0.00 ?  83  ARG C HH21 1  
ATOM   7177   H  HH22 . ARG C  2 29  ? -39.683 -24.018 -9.554  1.00 0.00 ?  83  ARG C HH22 1  
ATOM   7178   N  N    . GLN C  2 30  ? -46.077 -19.891 -6.567  1.00 0.00 ?  84  GLN C N    1  
ATOM   7179   C  CA   . GLN C  2 30  ? -47.341 -19.345 -6.988  1.00 0.00 ?  84  GLN C CA   1  
ATOM   7180   C  C    . GLN C  2 30  ? -48.232 -18.836 -5.861  1.00 0.00 ?  84  GLN C C    1  
ATOM   7181   O  O    . GLN C  2 30  ? -48.780 -17.713 -5.927  1.00 0.00 ?  84  GLN C O    1  
ATOM   7182   C  CB   . GLN C  2 30  ? -48.058 -20.375 -7.965  1.00 0.00 ?  84  GLN C CB   1  
ATOM   7183   C  CG   . GLN C  2 30  ? -49.603 -20.164 -8.318  1.00 0.00 ?  84  GLN C CG   1  
ATOM   7184   C  CD   . GLN C  2 30  ? -50.026 -18.960 -9.160  1.00 0.00 ?  84  GLN C CD   1  
ATOM   7185   O  OE1  . GLN C  2 30  ? -50.363 -19.078 -10.355 1.00 0.00 ?  84  GLN C OE1  1  
ATOM   7186   N  NE2  . GLN C  2 30  ? -49.875 -17.712 -8.621  1.00 0.00 ?  84  GLN C NE2  1  
ATOM   7187   H  H    . GLN C  2 30  ? -45.991 -20.883 -6.528  1.00 0.00 ?  84  GLN C H    1  
ATOM   7188   H  HA   . GLN C  2 30  ? -47.175 -18.461 -7.586  1.00 0.00 ?  84  GLN C HA   1  
ATOM   7189   H  HB2  . GLN C  2 30  ? -47.537 -20.315 -8.945  1.00 0.00 ?  84  GLN C HB2  1  
ATOM   7190   H  HB3  . GLN C  2 30  ? -47.980 -21.421 -7.598  1.00 0.00 ?  84  GLN C HB3  1  
ATOM   7191   H  HG2  . GLN C  2 30  ? -49.927 -21.027 -8.937  1.00 0.00 ?  84  GLN C HG2  1  
ATOM   7192   H  HG3  . GLN C  2 30  ? -50.084 -20.129 -7.317  1.00 0.00 ?  84  GLN C HG3  1  
ATOM   7193   H  HE21 . GLN C  2 30  ? -50.074 -16.854 -9.094  1.00 0.00 ?  84  GLN C HE21 1  
ATOM   7194   H  HE22 . GLN C  2 30  ? -49.493 -17.519 -7.718  1.00 0.00 ?  84  GLN C HE22 1  
ATOM   7195   N  N    . GLU C  2 31  ? -48.341 -19.571 -4.715  1.00 0.00 ?  85  GLU C N    1  
ATOM   7196   C  CA   . GLU C  2 31  ? -48.975 -19.104 -3.506  1.00 0.00 ?  85  GLU C CA   1  
ATOM   7197   C  C    . GLU C  2 31  ? -48.413 -17.856 -2.798  1.00 0.00 ?  85  GLU C C    1  
ATOM   7198   O  O    . GLU C  2 31  ? -49.125 -17.020 -2.279  1.00 0.00 ?  85  GLU C O    1  
ATOM   7199   C  CB   . GLU C  2 31  ? -49.183 -20.267 -2.484  1.00 0.00 ?  85  GLU C CB   1  
ATOM   7200   C  CG   . GLU C  2 31  ? -50.245 -21.375 -2.786  1.00 0.00 ?  85  GLU C CG   1  
ATOM   7201   C  CD   . GLU C  2 31  ? -51.162 -21.662 -1.580  1.00 0.00 ?  85  GLU C CD   1  
ATOM   7202   O  OE1  . GLU C  2 31  ? -50.826 -21.419 -0.341  1.00 0.00 ?  85  GLU C OE1  1  
ATOM   7203   O  OE2  . GLU C  2 31  ? -52.309 -22.131 -1.765  1.00 0.00 -1 85  GLU C OE2  1  
ATOM   7204   H  H    . GLU C  2 31  ? -48.038 -20.521 -4.707  1.00 0.00 ?  85  GLU C H    1  
ATOM   7205   H  HA   . GLU C  2 31  ? -50.003 -18.887 -3.759  1.00 0.00 ?  85  GLU C HA   1  
ATOM   7206   H  HB2  . GLU C  2 31  ? -48.196 -20.744 -2.303  1.00 0.00 ?  85  GLU C HB2  1  
ATOM   7207   H  HB3  . GLU C  2 31  ? -49.500 -19.777 -1.539  1.00 0.00 ?  85  GLU C HB3  1  
ATOM   7208   H  HG2  . GLU C  2 31  ? -50.919 -21.217 -3.655  1.00 0.00 ?  85  GLU C HG2  1  
ATOM   7209   H  HG3  . GLU C  2 31  ? -49.686 -22.323 -2.934  1.00 0.00 ?  85  GLU C HG3  1  
ATOM   7210   N  N    . MET C  2 32  ? -47.096 -17.670 -2.757  1.00 0.00 ?  86  MET C N    1  
ATOM   7211   C  CA   . MET C  2 32  ? -46.505 -16.393 -2.367  1.00 0.00 ?  86  MET C CA   1  
ATOM   7212   C  C    . MET C  2 32  ? -46.864 -15.249 -3.302  1.00 0.00 ?  86  MET C C    1  
ATOM   7213   O  O    . MET C  2 32  ? -47.177 -14.139 -2.937  1.00 0.00 ?  86  MET C O    1  
ATOM   7214   C  CB   . MET C  2 32  ? -44.965 -16.571 -2.244  1.00 0.00 ?  86  MET C CB   1  
ATOM   7215   C  CG   . MET C  2 32  ? -44.105 -15.275 -1.983  1.00 0.00 ?  86  MET C CG   1  
ATOM   7216   S  SD   . MET C  2 32  ? -44.074 -14.462 -0.385  1.00 0.00 ?  86  MET C SD   1  
ATOM   7217   C  CE   . MET C  2 32  ? -42.811 -13.230 -0.690  1.00 0.00 ?  86  MET C CE   1  
ATOM   7218   H  H    . MET C  2 32  ? -46.463 -18.390 -3.033  1.00 0.00 ?  86  MET C H    1  
ATOM   7219   H  HA   . MET C  2 32  ? -46.867 -16.144 -1.381  1.00 0.00 ?  86  MET C HA   1  
ATOM   7220   H  HB2  . MET C  2 32  ? -44.860 -17.330 -1.439  1.00 0.00 ?  86  MET C HB2  1  
ATOM   7221   H  HB3  . MET C  2 32  ? -44.643 -16.996 -3.219  1.00 0.00 ?  86  MET C HB3  1  
ATOM   7222   H  HG2  . MET C  2 32  ? -43.067 -15.632 -2.157  1.00 0.00 ?  86  MET C HG2  1  
ATOM   7223   H  HG3  . MET C  2 32  ? -44.297 -14.574 -2.823  1.00 0.00 ?  86  MET C HG3  1  
ATOM   7224   H  HE1  . MET C  2 32  ? -41.892 -13.818 -0.900  1.00 0.00 ?  86  MET C HE1  1  
ATOM   7225   H  HE2  . MET C  2 32  ? -42.559 -12.710 0.258   1.00 0.00 ?  86  MET C HE2  1  
ATOM   7226   H  HE3  . MET C  2 32  ? -42.890 -12.522 -1.542  1.00 0.00 ?  86  MET C HE3  1  
ATOM   7227   N  N    . SER C  2 33  ? -46.830 -15.509 -4.615  1.00 0.00 ?  87  SER C N    1  
ATOM   7228   C  CA   . SER C  2 33  ? -47.136 -14.571 -5.703  1.00 0.00 ?  87  SER C CA   1  
ATOM   7229   C  C    . SER C  2 33  ? -48.592 -14.249 -5.670  1.00 0.00 ?  87  SER C C    1  
ATOM   7230   O  O    . SER C  2 33  ? -48.885 -13.066 -5.864  1.00 0.00 ?  87  SER C O    1  
ATOM   7231   C  CB   . SER C  2 33  ? -46.828 -15.151 -7.154  1.00 0.00 ?  87  SER C CB   1  
ATOM   7232   O  OG   . SER C  2 33  ? -45.403 -15.485 -7.277  1.00 0.00 ?  87  SER C OG   1  
ATOM   7233   H  H    . SER C  2 33  ? -46.504 -16.441 -4.749  1.00 0.00 ?  87  SER C H    1  
ATOM   7234   H  HA   . SER C  2 33  ? -46.672 -13.611 -5.533  1.00 0.00 ?  87  SER C HA   1  
ATOM   7235   H  HB2  . SER C  2 33  ? -47.479 -16.021 -7.383  1.00 0.00 ?  87  SER C HB2  1  
ATOM   7236   H  HB3  . SER C  2 33  ? -47.060 -14.372 -7.911  1.00 0.00 ?  87  SER C HB3  1  
ATOM   7237   H  HG   . SER C  2 33  ? -45.197 -16.300 -6.813  1.00 0.00 ?  87  SER C HG   1  
ATOM   7238   N  N    . LYS C  2 34  ? -49.603 -15.109 -5.324  1.00 0.00 ?  88  LYS C N    1  
ATOM   7239   C  CA   . LYS C  2 34  ? -50.953 -14.660 -5.082  1.00 0.00 ?  88  LYS C CA   1  
ATOM   7240   C  C    . LYS C  2 34  ? -51.013 -13.708 -3.883  1.00 0.00 ?  88  LYS C C    1  
ATOM   7241   O  O    . LYS C  2 34  ? -51.644 -12.646 -3.925  1.00 0.00 ?  88  LYS C O    1  
ATOM   7242   C  CB   . LYS C  2 34  ? -51.990 -15.819 -4.887  1.00 0.00 ?  88  LYS C CB   1  
ATOM   7243   C  CG   . LYS C  2 34  ? -51.934 -16.925 -6.002  1.00 0.00 ?  88  LYS C CG   1  
ATOM   7244   C  CD   . LYS C  2 34  ? -53.292 -17.778 -6.027  1.00 0.00 ?  88  LYS C CD   1  
ATOM   7245   C  CE   . LYS C  2 34  ? -53.952 -18.098 -4.641  1.00 0.00 ?  88  LYS C CE   1  
ATOM   7246   N  NZ   . LYS C  2 34  ? -55.049 -19.067 -4.667  1.00 0.00 1  88  LYS C NZ   1  
ATOM   7247   H  H    . LYS C  2 34  ? -49.412 -16.078 -5.190  1.00 0.00 ?  88  LYS C H    1  
ATOM   7248   H  HA   . LYS C  2 34  ? -51.259 -14.145 -5.980  1.00 0.00 ?  88  LYS C HA   1  
ATOM   7249   H  HB2  . LYS C  2 34  ? -51.901 -16.349 -3.915  1.00 0.00 ?  88  LYS C HB2  1  
ATOM   7250   H  HB3  . LYS C  2 34  ? -52.971 -15.298 -4.921  1.00 0.00 ?  88  LYS C HB3  1  
ATOM   7251   H  HG2  . LYS C  2 34  ? -51.709 -16.518 -7.011  1.00 0.00 ?  88  LYS C HG2  1  
ATOM   7252   H  HG3  . LYS C  2 34  ? -51.045 -17.516 -5.692  1.00 0.00 ?  88  LYS C HG3  1  
ATOM   7253   H  HD2  . LYS C  2 34  ? -54.069 -17.208 -6.580  1.00 0.00 ?  88  LYS C HD2  1  
ATOM   7254   H  HD3  . LYS C  2 34  ? -53.061 -18.732 -6.546  1.00 0.00 ?  88  LYS C HD3  1  
ATOM   7255   H  HE2  . LYS C  2 34  ? -53.195 -18.626 -4.022  1.00 0.00 ?  88  LYS C HE2  1  
ATOM   7256   H  HE3  . LYS C  2 34  ? -54.294 -17.168 -4.140  1.00 0.00 ?  88  LYS C HE3  1  
ATOM   7257   H  HZ1  . LYS C  2 34  ? -55.201 -19.557 -3.763  1.00 0.00 ?  88  LYS C HZ1  1  
ATOM   7258   H  HZ2  . LYS C  2 34  ? -54.848 -19.820 -5.355  1.00 0.00 ?  88  LYS C HZ2  1  
ATOM   7259   H  HZ3  . LYS C  2 34  ? -55.970 -18.645 -4.902  1.00 0.00 ?  88  LYS C HZ3  1  
ATOM   7260   N  N    . ASP C  2 35  ? -50.339 -14.081 -2.732  1.00 0.00 ?  89  ASP C N    1  
ATOM   7261   C  CA   . ASP C  2 35  ? -50.400 -13.242 -1.557  1.00 0.00 ?  89  ASP C CA   1  
ATOM   7262   C  C    . ASP C  2 35  ? -49.867 -11.903 -1.798  1.00 0.00 ?  89  ASP C C    1  
ATOM   7263   O  O    . ASP C  2 35  ? -50.422 -10.892 -1.370  1.00 0.00 ?  89  ASP C O    1  
ATOM   7264   C  CB   . ASP C  2 35  ? -49.785 -13.883 -0.331  1.00 0.00 ?  89  ASP C CB   1  
ATOM   7265   C  CG   . ASP C  2 35  ? -50.762 -14.949 0.146   1.00 0.00 ?  89  ASP C CG   1  
ATOM   7266   O  OD1  . ASP C  2 35  ? -50.388 -15.516 1.195   1.00 0.00 ?  89  ASP C OD1  1  
ATOM   7267   O  OD2  . ASP C  2 35  ? -51.833 -15.225 -0.435  1.00 0.00 -1 89  ASP C OD2  1  
ATOM   7268   H  H    . ASP C  2 35  ? -50.057 -15.028 -2.598  1.00 0.00 ?  89  ASP C H    1  
ATOM   7269   H  HA   . ASP C  2 35  ? -51.433 -12.988 -1.369  1.00 0.00 ?  89  ASP C HA   1  
ATOM   7270   H  HB2  . ASP C  2 35  ? -48.784 -14.333 -0.504  1.00 0.00 ?  89  ASP C HB2  1  
ATOM   7271   H  HB3  . ASP C  2 35  ? -49.708 -13.103 0.457   1.00 0.00 ?  89  ASP C HB3  1  
ATOM   7272   N  N    . LEU C  2 36  ? -48.740 -11.788 -2.440  1.00 0.00 ?  90  LEU C N    1  
ATOM   7273   C  CA   . LEU C  2 36  ? -48.185 -10.458 -2.747  1.00 0.00 ?  90  LEU C CA   1  
ATOM   7274   C  C    . LEU C  2 36  ? -49.039 -9.675  -3.800  1.00 0.00 ?  90  LEU C C    1  
ATOM   7275   O  O    . LEU C  2 36  ? -49.089 -8.440  -3.768  1.00 0.00 ?  90  LEU C O    1  
ATOM   7276   C  CB   . LEU C  2 36  ? -46.779 -10.633 -3.448  1.00 0.00 ?  90  LEU C CB   1  
ATOM   7277   C  CG   . LEU C  2 36  ? -46.049 -9.288  -3.524  1.00 0.00 ?  90  LEU C CG   1  
ATOM   7278   C  CD1  . LEU C  2 36  ? -45.929 -8.544  -2.218  1.00 0.00 ?  90  LEU C CD1  1  
ATOM   7279   C  CD2  . LEU C  2 36  ? -44.613 -9.614  -3.937  1.00 0.00 ?  90  LEU C CD2  1  
ATOM   7280   H  H    . LEU C  2 36  ? -48.171 -12.545 -2.750  1.00 0.00 ?  90  LEU C H    1  
ATOM   7281   H  HA   . LEU C  2 36  ? -48.133 -9.913  -1.816  1.00 0.00 ?  90  LEU C HA   1  
ATOM   7282   H  HB2  . LEU C  2 36  ? -46.267 -11.468 -2.922  1.00 0.00 ?  90  LEU C HB2  1  
ATOM   7283   H  HB3  . LEU C  2 36  ? -46.980 -10.965 -4.489  1.00 0.00 ?  90  LEU C HB3  1  
ATOM   7284   H  HG   . LEU C  2 36  ? -46.532 -8.634  -4.280  1.00 0.00 ?  90  LEU C HG   1  
ATOM   7285   H  HD11 . LEU C  2 36  ? -45.138 -7.770  -2.321  1.00 0.00 ?  90  LEU C HD11 1  
ATOM   7286   H  HD12 . LEU C  2 36  ? -45.662 -9.285  -1.433  1.00 0.00 ?  90  LEU C HD12 1  
ATOM   7287   H  HD13 . LEU C  2 36  ? -46.844 -7.968  -1.966  1.00 0.00 ?  90  LEU C HD13 1  
ATOM   7288   H  HD21 . LEU C  2 36  ? -44.708 -10.267 -4.831  1.00 0.00 ?  90  LEU C HD21 1  
ATOM   7289   H  HD22 . LEU C  2 36  ? -44.218 -10.252 -3.118  1.00 0.00 ?  90  LEU C HD22 1  
ATOM   7290   H  HD23 . LEU C  2 36  ? -44.048 -8.728  -4.298  1.00 0.00 ?  90  LEU C HD23 1  
ATOM   7291   N  N    . GLU C  2 37  ? -49.723 -10.301 -4.743  1.00 0.00 ?  91  GLU C N    1  
ATOM   7292   C  CA   . GLU C  2 37  ? -50.585 -9.558  -5.665  1.00 0.00 ?  91  GLU C CA   1  
ATOM   7293   C  C    . GLU C  2 37  ? -51.852 -8.980  -4.865  1.00 0.00 ?  91  GLU C C    1  
ATOM   7294   O  O    . GLU C  2 37  ? -52.385 -7.875  -5.110  1.00 0.00 ?  91  GLU C O    1  
ATOM   7295   C  CB   . GLU C  2 37  ? -51.165 -10.274 -6.907  1.00 0.00 ?  91  GLU C CB   1  
ATOM   7296   C  CG   . GLU C  2 37  ? -50.108 -10.654 -7.940  1.00 0.00 ?  91  GLU C CG   1  
ATOM   7297   C  CD   . GLU C  2 37  ? -50.617 -11.432 -9.123  1.00 0.00 ?  91  GLU C CD   1  
ATOM   7298   O  OE1  . GLU C  2 37  ? -51.703 -11.142 -9.639  1.00 0.00 ?  91  GLU C OE1  1  
ATOM   7299   O  OE2  . GLU C  2 37  ? -49.880 -12.309 -9.593  1.00 0.00 -1 91  GLU C OE2  1  
ATOM   7300   H  H    . GLU C  2 37  ? -49.601 -11.271 -4.939  1.00 0.00 ?  91  GLU C H    1  
ATOM   7301   H  HA   . GLU C  2 37  ? -50.072 -8.694  -6.063  1.00 0.00 ?  91  GLU C HA   1  
ATOM   7302   H  HB2  . GLU C  2 37  ? -51.780 -11.165 -6.655  1.00 0.00 ?  91  GLU C HB2  1  
ATOM   7303   H  HB3  . GLU C  2 37  ? -51.936 -9.625  -7.375  1.00 0.00 ?  91  GLU C HB3  1  
ATOM   7304   H  HG2  . GLU C  2 37  ? -49.739 -9.685  -8.339  1.00 0.00 ?  91  GLU C HG2  1  
ATOM   7305   H  HG3  . GLU C  2 37  ? -49.295 -11.246 -7.467  1.00 0.00 ?  91  GLU C HG3  1  
ATOM   7306   N  N    . GLU C  2 38  ? -52.316 -9.683  -3.829  1.00 0.00 ?  92  GLU C N    1  
ATOM   7307   C  CA   . GLU C  2 38  ? -53.360 -9.140  -2.890  1.00 0.00 ?  92  GLU C CA   1  
ATOM   7308   C  C    . GLU C  2 38  ? -52.938 -7.999  -2.003  1.00 0.00 ?  92  GLU C C    1  
ATOM   7309   O  O    . GLU C  2 38  ? -53.690 -7.003  -1.890  1.00 0.00 ?  92  GLU C O    1  
ATOM   7310   C  CB   . GLU C  2 38  ? -54.051 -10.319 -2.140  1.00 0.00 ?  92  GLU C CB   1  
ATOM   7311   C  CG   . GLU C  2 38  ? -54.933 -10.111 -0.901  1.00 0.00 ?  92  GLU C CG   1  
ATOM   7312   C  CD   . GLU C  2 38  ? -55.487 -11.350 -0.353  1.00 0.00 ?  92  GLU C CD   1  
ATOM   7313   O  OE1  . GLU C  2 38  ? -54.625 -12.305 -0.129  1.00 0.00 ?  92  GLU C OE1  1  
ATOM   7314   O  OE2  . GLU C  2 38  ? -56.729 -11.432 -0.117  1.00 0.00 -1 92  GLU C OE2  1  
ATOM   7315   H  H    . GLU C  2 38  ? -51.946 -10.589 -3.637  1.00 0.00 ?  92  GLU C H    1  
ATOM   7316   H  HA   . GLU C  2 38  ? -54.187 -8.706  -3.432  1.00 0.00 ?  92  GLU C HA   1  
ATOM   7317   H  HB2  . GLU C  2 38  ? -54.621 -10.816 -2.954  1.00 0.00 ?  92  GLU C HB2  1  
ATOM   7318   H  HB3  . GLU C  2 38  ? -53.285 -11.079 -1.874  1.00 0.00 ?  92  GLU C HB3  1  
ATOM   7319   H  HG2  . GLU C  2 38  ? -54.243 -9.595  -0.198  1.00 0.00 ?  92  GLU C HG2  1  
ATOM   7320   H  HG3  . GLU C  2 38  ? -55.754 -9.407  -1.158  1.00 0.00 ?  92  GLU C HG3  1  
ATOM   7321   N  N    . VAL C  2 39  ? -51.727 -7.978  -1.488  1.00 0.00 ?  93  VAL C N    1  
ATOM   7322   C  CA   . VAL C  2 39  ? -51.137 -6.896  -0.798  1.00 0.00 ?  93  VAL C CA   1  
ATOM   7323   C  C    . VAL C  2 39  ? -50.910 -5.733  -1.723  1.00 0.00 ?  93  VAL C C    1  
ATOM   7324   O  O    . VAL C  2 39  ? -51.080 -4.540  -1.391  1.00 0.00 ?  93  VAL C O    1  
ATOM   7325   C  CB   . VAL C  2 39  ? -49.754 -7.337  -0.317  1.00 0.00 ?  93  VAL C CB   1  
ATOM   7326   C  CG1  . VAL C  2 39  ? -49.010 -6.151  0.319   1.00 0.00 ?  93  VAL C CG1  1  
ATOM   7327   C  CG2  . VAL C  2 39  ? -49.976 -8.261  0.882   1.00 0.00 ?  93  VAL C CG2  1  
ATOM   7328   H  H    . VAL C  2 39  ? -51.194 -8.817  -1.410  1.00 0.00 ?  93  VAL C H    1  
ATOM   7329   H  HA   . VAL C  2 39  ? -51.809 -6.629  0.005   1.00 0.00 ?  93  VAL C HA   1  
ATOM   7330   H  HB   . VAL C  2 39  ? -49.178 -7.801  -1.146  1.00 0.00 ?  93  VAL C HB   1  
ATOM   7331   H  HG11 . VAL C  2 39  ? -48.728 -5.425  -0.473  1.00 0.00 ?  93  VAL C HG11 1  
ATOM   7332   H  HG12 . VAL C  2 39  ? -48.134 -6.552  0.872   1.00 0.00 ?  93  VAL C HG12 1  
ATOM   7333   H  HG13 . VAL C  2 39  ? -49.643 -5.648  1.081   1.00 0.00 ?  93  VAL C HG13 1  
ATOM   7334   H  HG21 . VAL C  2 39  ? -50.692 -7.898  1.650   1.00 0.00 ?  93  VAL C HG21 1  
ATOM   7335   H  HG22 . VAL C  2 39  ? -48.994 -8.462  1.359   1.00 0.00 ?  93  VAL C HG22 1  
ATOM   7336   H  HG23 . VAL C  2 39  ? -50.349 -9.258  0.563   1.00 0.00 ?  93  VAL C HG23 1  
ATOM   7337   N  N    . LYS C  2 40  ? -50.549 -6.011  -3.028  1.00 0.00 ?  94  LYS C N    1  
ATOM   7338   C  CA   . LYS C  2 40  ? -50.563 -5.039  -4.101  1.00 0.00 ?  94  LYS C CA   1  
ATOM   7339   C  C    . LYS C  2 40  ? -51.922 -4.445  -4.459  1.00 0.00 ?  94  LYS C C    1  
ATOM   7340   O  O    . LYS C  2 40  ? -52.170 -3.256  -4.470  1.00 0.00 ?  94  LYS C O    1  
ATOM   7341   C  CB   . LYS C  2 40  ? -49.806 -5.621  -5.363  1.00 0.00 ?  94  LYS C CB   1  
ATOM   7342   C  CG   . LYS C  2 40  ? -49.471 -4.661  -6.554  1.00 0.00 ?  94  LYS C CG   1  
ATOM   7343   C  CD   . LYS C  2 40  ? -48.673 -5.363  -7.746  1.00 0.00 ?  94  LYS C CD   1  
ATOM   7344   C  CE   . LYS C  2 40  ? -48.344 -4.447  -8.920  1.00 0.00 ?  94  LYS C CE   1  
ATOM   7345   N  NZ   . LYS C  2 40  ? -47.596 -5.175  -9.995  1.00 0.00 1  94  LYS C NZ   1  
ATOM   7346   H  H    . LYS C  2 40  ? -50.383 -6.911  -3.422  1.00 0.00 ?  94  LYS C H    1  
ATOM   7347   H  HA   . LYS C  2 40  ? -49.943 -4.234  -3.735  1.00 0.00 ?  94  LYS C HA   1  
ATOM   7348   H  HB2  . LYS C  2 40  ? -48.799 -5.960  -5.040  1.00 0.00 ?  94  LYS C HB2  1  
ATOM   7349   H  HB3  . LYS C  2 40  ? -50.366 -6.496  -5.757  1.00 0.00 ?  94  LYS C HB3  1  
ATOM   7350   H  HG2  . LYS C  2 40  ? -50.384 -4.336  -7.098  1.00 0.00 ?  94  LYS C HG2  1  
ATOM   7351   H  HG3  . LYS C  2 40  ? -48.894 -3.759  -6.258  1.00 0.00 ?  94  LYS C HG3  1  
ATOM   7352   H  HD2  . LYS C  2 40  ? -47.726 -5.734  -7.300  1.00 0.00 ?  94  LYS C HD2  1  
ATOM   7353   H  HD3  . LYS C  2 40  ? -49.144 -6.323  -8.048  1.00 0.00 ?  94  LYS C HD3  1  
ATOM   7354   H  HE2  . LYS C  2 40  ? -49.246 -4.013  -9.402  1.00 0.00 ?  94  LYS C HE2  1  
ATOM   7355   H  HE3  . LYS C  2 40  ? -47.691 -3.725  -8.384  1.00 0.00 ?  94  LYS C HE3  1  
ATOM   7356   H  HZ1  . LYS C  2 40  ? -47.297 -4.430  -10.655 1.00 0.00 ?  94  LYS C HZ1  1  
ATOM   7357   H  HZ2  . LYS C  2 40  ? -48.194 -5.946  -10.356 1.00 0.00 ?  94  LYS C HZ2  1  
ATOM   7358   H  HZ3  . LYS C  2 40  ? -46.700 -5.524  -9.598  1.00 0.00 ?  94  LYS C HZ3  1  
ATOM   7359   N  N    . ALA C  2 41  ? -53.020 -5.197  -4.573  1.00 0.00 ?  95  ALA C N    1  
ATOM   7360   C  CA   . ALA C  2 41  ? -54.395 -4.774  -4.884  1.00 0.00 ?  95  ALA C CA   1  
ATOM   7361   C  C    . ALA C  2 41  ? -54.881 -3.791  -3.848  1.00 0.00 ?  95  ALA C C    1  
ATOM   7362   O  O    . ALA C  2 41  ? -55.379 -2.678  -4.089  1.00 0.00 ?  95  ALA C O    1  
ATOM   7363   C  CB   . ALA C  2 41  ? -55.380 -5.940  -4.999  1.00 0.00 ?  95  ALA C CB   1  
ATOM   7364   H  H    . ALA C  2 41  ? -52.987 -6.193  -4.567  1.00 0.00 ?  95  ALA C H    1  
ATOM   7365   H  HA   . ALA C  2 41  ? -54.389 -4.275  -5.842  1.00 0.00 ?  95  ALA C HA   1  
ATOM   7366   H  HB1  . ALA C  2 41  ? -56.386 -5.540  -5.250  1.00 0.00 ?  95  ALA C HB1  1  
ATOM   7367   H  HB2  . ALA C  2 41  ? -55.294 -6.483  -4.034  1.00 0.00 ?  95  ALA C HB2  1  
ATOM   7368   H  HB3  . ALA C  2 41  ? -55.120 -6.615  -5.843  1.00 0.00 ?  95  ALA C HB3  1  
ATOM   7369   N  N    . LYS C  2 42  ? -54.474 -4.075  -2.571  1.00 0.00 ?  96  LYS C N    1  
ATOM   7370   C  CA   . LYS C  2 42  ? -54.659 -3.193  -1.442  1.00 0.00 ?  96  LYS C CA   1  
ATOM   7371   C  C    . LYS C  2 42  ? -53.801 -1.891  -1.422  1.00 0.00 ?  96  LYS C C    1  
ATOM   7372   O  O    . LYS C  2 42  ? -54.306 -0.858  -0.953  1.00 0.00 ?  96  LYS C O    1  
ATOM   7373   C  CB   . LYS C  2 42  ? -54.558 -3.960  -0.123  1.00 0.00 ?  96  LYS C CB   1  
ATOM   7374   C  CG   . LYS C  2 42  ? -55.730 -4.975  0.149   1.00 0.00 ?  96  LYS C CG   1  
ATOM   7375   C  CD   . LYS C  2 42  ? -55.746 -5.664  1.493   1.00 0.00 ?  96  LYS C CD   1  
ATOM   7376   C  CE   . LYS C  2 42  ? -54.728 -6.870  1.666   1.00 0.00 ?  96  LYS C CE   1  
ATOM   7377   N  NZ   . LYS C  2 42  ? -54.689 -7.402  3.069   1.00 0.00 1  96  LYS C NZ   1  
ATOM   7378   H  H    . LYS C  2 42  ? -53.868 -4.850  -2.410  1.00 0.00 ?  96  LYS C H    1  
ATOM   7379   H  HA   . LYS C  2 42  ? -55.664 -2.838  -1.617  1.00 0.00 ?  96  LYS C HA   1  
ATOM   7380   H  HB2  . LYS C  2 42  ? -53.554 -4.401  0.056   1.00 0.00 ?  96  LYS C HB2  1  
ATOM   7381   H  HB3  . LYS C  2 42  ? -54.709 -3.266  0.731   1.00 0.00 ?  96  LYS C HB3  1  
ATOM   7382   H  HG2  . LYS C  2 42  ? -56.669 -4.383  0.125   1.00 0.00 ?  96  LYS C HG2  1  
ATOM   7383   H  HG3  . LYS C  2 42  ? -55.678 -5.799  -0.595  1.00 0.00 ?  96  LYS C HG3  1  
ATOM   7384   H  HD2  . LYS C  2 42  ? -55.530 -4.931  2.299   1.00 0.00 ?  96  LYS C HD2  1  
ATOM   7385   H  HD3  . LYS C  2 42  ? -56.765 -6.093  1.608   1.00 0.00 ?  96  LYS C HD3  1  
ATOM   7386   H  HE2  . LYS C  2 42  ? -55.049 -7.657  0.951   1.00 0.00 ?  96  LYS C HE2  1  
ATOM   7387   H  HE3  . LYS C  2 42  ? -53.783 -6.433  1.278   1.00 0.00 ?  96  LYS C HE3  1  
ATOM   7388   H  HZ1  . LYS C  2 42  ? -54.656 -6.627  3.763   1.00 0.00 ?  96  LYS C HZ1  1  
ATOM   7389   H  HZ2  . LYS C  2 42  ? -53.963 -8.144  3.134   1.00 0.00 ?  96  LYS C HZ2  1  
ATOM   7390   H  HZ3  . LYS C  2 42  ? -55.532 -7.977  3.270   1.00 0.00 ?  96  LYS C HZ3  1  
ATOM   7391   N  N    . VAL C  2 43  ? -52.555 -1.813  -1.878  1.00 0.00 ?  97  VAL C N    1  
ATOM   7392   C  CA   . VAL C  2 43  ? -51.891 -0.577  -1.807  1.00 0.00 ?  97  VAL C CA   1  
ATOM   7393   C  C    . VAL C  2 43  ? -52.058 0.257   -3.081  1.00 0.00 ?  97  VAL C C    1  
ATOM   7394   O  O    . VAL C  2 43  ? -51.642 1.424   -3.151  1.00 0.00 ?  97  VAL C O    1  
ATOM   7395   C  CB   . VAL C  2 43  ? -50.308 -0.747  -1.645  1.00 0.00 ?  97  VAL C CB   1  
ATOM   7396   C  CG1  . VAL C  2 43  ? -49.516 -0.941  -2.988  1.00 0.00 ?  97  VAL C CG1  1  
ATOM   7397   C  CG2  . VAL C  2 43  ? -49.787 0.409   -0.789  1.00 0.00 ?  97  VAL C CG2  1  
ATOM   7398   H  H    . VAL C  2 43  ? -51.970 -2.554  -2.200  1.00 0.00 ?  97  VAL C H    1  
ATOM   7399   H  HA   . VAL C  2 43  ? -52.269 0.027   -0.995  1.00 0.00 ?  97  VAL C HA   1  
ATOM   7400   H  HB   . VAL C  2 43  ? -50.151 -1.689  -1.077  1.00 0.00 ?  97  VAL C HB   1  
ATOM   7401   H  HG11 . VAL C  2 43  ? -48.523 -1.156  -2.541  1.00 0.00 ?  97  VAL C HG11 1  
ATOM   7402   H  HG12 . VAL C  2 43  ? -49.482 0.004   -3.572  1.00 0.00 ?  97  VAL C HG12 1  
ATOM   7403   H  HG13 . VAL C  2 43  ? -49.874 -1.817  -3.571  1.00 0.00 ?  97  VAL C HG13 1  
ATOM   7404   H  HG21 . VAL C  2 43  ? -50.235 0.273   0.219   1.00 0.00 ?  97  VAL C HG21 1  
ATOM   7405   H  HG22 . VAL C  2 43  ? -49.896 1.427   -1.219  1.00 0.00 ?  97  VAL C HG22 1  
ATOM   7406   H  HG23 . VAL C  2 43  ? -48.715 0.158   -0.645  1.00 0.00 ?  97  VAL C HG23 1  
ATOM   7407   N  N    . GLN C  2 44  ? -52.635 -0.362  -4.099  1.00 0.00 ?  98  GLN C N    1  
ATOM   7408   C  CA   . GLN C  2 44  ? -53.073 0.316   -5.373  1.00 0.00 ?  98  GLN C CA   1  
ATOM   7409   C  C    . GLN C  2 44  ? -53.752 1.658   -5.276  1.00 0.00 ?  98  GLN C C    1  
ATOM   7410   O  O    . GLN C  2 44  ? -53.305 2.550   -5.950  1.00 0.00 ?  98  GLN C O    1  
ATOM   7411   C  CB   . GLN C  2 44  ? -53.695 -0.743  -6.264  1.00 0.00 ?  98  GLN C CB   1  
ATOM   7412   C  CG   . GLN C  2 44  ? -52.634 -1.348  -7.093  1.00 0.00 ?  98  GLN C CG   1  
ATOM   7413   C  CD   . GLN C  2 44  ? -53.159 -2.348  -8.048  1.00 0.00 ?  98  GLN C CD   1  
ATOM   7414   O  OE1  . GLN C  2 44  ? -54.358 -2.566  -8.239  1.00 0.00 ?  98  GLN C OE1  1  
ATOM   7415   N  NE2  . GLN C  2 44  ? -52.213 -2.907  -8.762  1.00 0.00 ?  98  GLN C NE2  1  
ATOM   7416   H  H    . GLN C  2 44  ? -52.606 -1.358  -4.067  1.00 0.00 ?  98  GLN C H    1  
ATOM   7417   H  HA   . GLN C  2 44  ? -52.173 0.585   -5.906  1.00 0.00 ?  98  GLN C HA   1  
ATOM   7418   H  HB2  . GLN C  2 44  ? -54.243 -1.469  -5.626  1.00 0.00 ?  98  GLN C HB2  1  
ATOM   7419   H  HB3  . GLN C  2 44  ? -54.460 -0.260  -6.909  1.00 0.00 ?  98  GLN C HB3  1  
ATOM   7420   H  HG2  . GLN C  2 44  ? -52.084 -0.562  -7.653  1.00 0.00 ?  98  GLN C HG2  1  
ATOM   7421   H  HG3  . GLN C  2 44  ? -51.869 -1.726  -6.383  1.00 0.00 ?  98  GLN C HG3  1  
ATOM   7422   H  HE21 . GLN C  2 44  ? -51.303 -2.495  -8.786  1.00 0.00 ?  98  GLN C HE21 1  
ATOM   7423   H  HE22 . GLN C  2 44  ? -52.362 -3.570  -9.496  1.00 0.00 ?  98  GLN C HE22 1  
ATOM   7424   N  N    . PRO C  2 45  ? -54.796 1.922   -4.454  1.00 0.00 ?  99  PRO C N    1  
ATOM   7425   C  CA   . PRO C  2 45  ? -55.407 3.263   -4.377  1.00 0.00 ?  99  PRO C CA   1  
ATOM   7426   C  C    . PRO C  2 45  ? -54.554 4.287   -3.620  1.00 0.00 ?  99  PRO C C    1  
ATOM   7427   O  O    . PRO C  2 45  ? -54.287 5.404   -4.144  1.00 0.00 ?  99  PRO C O    1  
ATOM   7428   C  CB   . PRO C  2 45  ? -56.845 3.026   -3.810  1.00 0.00 ?  99  PRO C CB   1  
ATOM   7429   C  CG   . PRO C  2 45  ? -57.105 1.553   -4.099  1.00 0.00 ?  99  PRO C CG   1  
ATOM   7430   C  CD   . PRO C  2 45  ? -55.708 0.868   -4.078  1.00 0.00 ?  99  PRO C CD   1  
ATOM   7431   H  HA   . PRO C  2 45  ? -55.425 3.615   -5.398  1.00 0.00 ?  99  PRO C HA   1  
ATOM   7432   H  HB2  . PRO C  2 45  ? -56.731 3.091   -2.706  1.00 0.00 ?  99  PRO C HB2  1  
ATOM   7433   H  HB3  . PRO C  2 45  ? -57.610 3.740   -4.184  1.00 0.00 ?  99  PRO C HB3  1  
ATOM   7434   H  HG2  . PRO C  2 45  ? -57.840 0.988   -3.486  1.00 0.00 ?  99  PRO C HG2  1  
ATOM   7435   H  HG3  . PRO C  2 45  ? -57.444 1.657   -5.152  1.00 0.00 ?  99  PRO C HG3  1  
ATOM   7436   H  HD2  . PRO C  2 45  ? -55.477 0.430   -3.083  1.00 0.00 ?  99  PRO C HD2  1  
ATOM   7437   H  HD3  . PRO C  2 45  ? -55.809 0.031   -4.802  1.00 0.00 ?  99  PRO C HD3  1  
ATOM   7438   N  N    . TYR C  2 46  ? -54.012 3.977   -2.403  1.00 0.00 ?  100 TYR C N    1  
ATOM   7439   C  CA   . TYR C  2 46  ? -53.085 4.714   -1.609  1.00 0.00 ?  100 TYR C CA   1  
ATOM   7440   C  C    . TYR C  2 46  ? -51.906 5.154   -2.390  1.00 0.00 ?  100 TYR C C    1  
ATOM   7441   O  O    . TYR C  2 46  ? -51.508 6.347   -2.334  1.00 0.00 ?  100 TYR C O    1  
ATOM   7442   C  CB   . TYR C  2 46  ? -52.679 3.822   -0.339  1.00 0.00 ?  100 TYR C CB   1  
ATOM   7443   C  CG   . TYR C  2 46  ? -51.793 4.440   0.736   1.00 0.00 ?  100 TYR C CG   1  
ATOM   7444   C  CD1  . TYR C  2 46  ? -51.094 3.556   1.497   1.00 0.00 ?  100 TYR C CD1  1  
ATOM   7445   C  CD2  . TYR C  2 46  ? -51.624 5.804   1.017   1.00 0.00 ?  100 TYR C CD2  1  
ATOM   7446   C  CE1  . TYR C  2 46  ? -50.203 3.930   2.545   1.00 0.00 ?  100 TYR C CE1  1  
ATOM   7447   C  CE2  . TYR C  2 46  ? -50.683 6.221   1.989   1.00 0.00 ?  100 TYR C CE2  1  
ATOM   7448   C  CZ   . TYR C  2 46  ? -50.034 5.270   2.816   1.00 0.00 ?  100 TYR C CZ   1  
ATOM   7449   O  OH   . TYR C  2 46  ? -49.345 5.725   4.006   1.00 0.00 ?  100 TYR C OH   1  
ATOM   7450   H  H    . TYR C  2 46  ? -54.233 3.086   -2.014  1.00 0.00 ?  100 TYR C H    1  
ATOM   7451   H  HA   . TYR C  2 46  ? -53.500 5.636   -1.231  1.00 0.00 ?  100 TYR C HA   1  
ATOM   7452   H  HB2  . TYR C  2 46  ? -53.660 3.588   0.128   1.00 0.00 ?  100 TYR C HB2  1  
ATOM   7453   H  HB3  . TYR C  2 46  ? -52.314 2.813   -0.630  1.00 0.00 ?  100 TYR C HB3  1  
ATOM   7454   H  HD1  . TYR C  2 46  ? -51.222 2.494   1.345   1.00 0.00 ?  100 TYR C HD1  1  
ATOM   7455   H  HD2  . TYR C  2 46  ? -51.957 6.554   0.315   1.00 0.00 ?  100 TYR C HD2  1  
ATOM   7456   H  HE1  . TYR C  2 46  ? -49.721 3.243   3.226   1.00 0.00 ?  100 TYR C HE1  1  
ATOM   7457   H  HE2  . TYR C  2 46  ? -50.637 7.284   2.175   1.00 0.00 ?  100 TYR C HE2  1  
ATOM   7458   H  HH   . TYR C  2 46  ? -49.335 6.685   4.017   1.00 0.00 ?  100 TYR C HH   1  
ATOM   7459   N  N    . LEU C  2 47  ? -51.261 4.316   -3.272  1.00 0.00 ?  101 LEU C N    1  
ATOM   7460   C  CA   . LEU C  2 47  ? -49.998 4.591   -3.849  1.00 0.00 ?  101 LEU C CA   1  
ATOM   7461   C  C    . LEU C  2 47  ? -50.072 5.788   -4.830  1.00 0.00 ?  101 LEU C C    1  
ATOM   7462   O  O    . LEU C  2 47  ? -49.096 6.594   -4.903  1.00 0.00 ?  101 LEU C O    1  
ATOM   7463   C  CB   . LEU C  2 47  ? -49.351 3.309   -4.453  1.00 0.00 ?  101 LEU C CB   1  
ATOM   7464   C  CG   . LEU C  2 47  ? -47.940 3.492   -5.078  1.00 0.00 ?  101 LEU C CG   1  
ATOM   7465   C  CD1  . LEU C  2 47  ? -46.892 4.061   -4.034  1.00 0.00 ?  101 LEU C CD1  1  
ATOM   7466   C  CD2  . LEU C  2 47  ? -47.437 2.106   -5.556  1.00 0.00 ?  101 LEU C CD2  1  
ATOM   7467   H  H    . LEU C  2 47  ? -51.490 3.355   -3.405  1.00 0.00 ?  101 LEU C H    1  
ATOM   7468   H  HA   . LEU C  2 47  ? -49.356 4.926   -3.048  1.00 0.00 ?  101 LEU C HA   1  
ATOM   7469   H  HB2  . LEU C  2 47  ? -49.254 2.376   -3.858  1.00 0.00 ?  101 LEU C HB2  1  
ATOM   7470   H  HB3  . LEU C  2 47  ? -50.011 2.870   -5.232  1.00 0.00 ?  101 LEU C HB3  1  
ATOM   7471   H  HG   . LEU C  2 47  ? -48.064 4.162   -5.955  1.00 0.00 ?  101 LEU C HG   1  
ATOM   7472   H  HD11 . LEU C  2 47  ? -46.959 3.582   -3.034  1.00 0.00 ?  101 LEU C HD11 1  
ATOM   7473   H  HD12 . LEU C  2 47  ? -46.985 5.168   -4.006  1.00 0.00 ?  101 LEU C HD12 1  
ATOM   7474   H  HD13 . LEU C  2 47  ? -45.846 3.862   -4.353  1.00 0.00 ?  101 LEU C HD13 1  
ATOM   7475   H  HD21 . LEU C  2 47  ? -46.429 2.188   -6.015  1.00 0.00 ?  101 LEU C HD21 1  
ATOM   7476   H  HD22 . LEU C  2 47  ? -48.124 1.714   -6.336  1.00 0.00 ?  101 LEU C HD22 1  
ATOM   7477   H  HD23 . LEU C  2 47  ? -47.396 1.400   -4.699  1.00 0.00 ?  101 LEU C HD23 1  
ATOM   7478   N  N    . ASP C  2 48  ? -51.251 5.904   -5.515  1.00 0.00 ?  102 ASP C N    1  
ATOM   7479   C  CA   . ASP C  2 48  ? -51.576 7.064   -6.430  1.00 0.00 ?  102 ASP C CA   1  
ATOM   7480   C  C    . ASP C  2 48  ? -51.457 8.460   -5.791  1.00 0.00 ?  102 ASP C C    1  
ATOM   7481   O  O    . ASP C  2 48  ? -50.983 9.439   -6.456  1.00 0.00 ?  102 ASP C O    1  
ATOM   7482   C  CB   . ASP C  2 48  ? -52.934 6.886   -7.193  1.00 0.00 ?  102 ASP C CB   1  
ATOM   7483   C  CG   . ASP C  2 48  ? -52.793 5.916   -8.319  1.00 0.00 ?  102 ASP C CG   1  
ATOM   7484   O  OD1  . ASP C  2 48  ? -53.818 5.707   -9.044  1.00 0.00 ?  102 ASP C OD1  1  
ATOM   7485   O  OD2  . ASP C  2 48  ? -51.692 5.316   -8.491  1.00 0.00 -1 102 ASP C OD2  1  
ATOM   7486   H  H    . ASP C  2 48  ? -51.938 5.223   -5.277  1.00 0.00 ?  102 ASP C H    1  
ATOM   7487   H  HA   . ASP C  2 48  ? -50.852 7.071   -7.231  1.00 0.00 ?  102 ASP C HA   1  
ATOM   7488   H  HB2  . ASP C  2 48  ? -53.578 6.427   -6.412  1.00 0.00 ?  102 ASP C HB2  1  
ATOM   7489   H  HB3  . ASP C  2 48  ? -53.464 7.763   -7.622  1.00 0.00 ?  102 ASP C HB3  1  
ATOM   7490   N  N    . ASP C  2 49  ? -52.037 8.650   -4.604  1.00 0.00 ?  103 ASP C N    1  
ATOM   7491   C  CA   . ASP C  2 49  ? -52.296 9.915   -3.974  1.00 0.00 ?  103 ASP C CA   1  
ATOM   7492   C  C    . ASP C  2 49  ? -51.303 10.196  -2.782  1.00 0.00 ?  103 ASP C C    1  
ATOM   7493   O  O    . ASP C  2 49  ? -51.235 11.305  -2.259  1.00 0.00 ?  103 ASP C O    1  
ATOM   7494   C  CB   . ASP C  2 49  ? -53.652 9.924   -3.308  1.00 0.00 ?  103 ASP C CB   1  
ATOM   7495   C  CG   . ASP C  2 49  ? -54.808 9.988   -4.291  1.00 0.00 ?  103 ASP C CG   1  
ATOM   7496   O  OD1  . ASP C  2 49  ? -55.939 10.230  -3.784  1.00 0.00 ?  103 ASP C OD1  1  
ATOM   7497   O  OD2  . ASP C  2 49  ? -54.599 9.660   -5.477  1.00 0.00 -1 103 ASP C OD2  1  
ATOM   7498   H  H    . ASP C  2 49  ? -52.398 7.840   -4.149  1.00 0.00 ?  103 ASP C H    1  
ATOM   7499   H  HA   . ASP C  2 49  ? -52.308 10.726  -4.688  1.00 0.00 ?  103 ASP C HA   1  
ATOM   7500   H  HB2  . ASP C  2 49  ? -53.649 9.035   -2.641  1.00 0.00 ?  103 ASP C HB2  1  
ATOM   7501   H  HB3  . ASP C  2 49  ? -53.833 10.726  -2.560  1.00 0.00 ?  103 ASP C HB3  1  
ATOM   7502   N  N    . PHE C  2 50  ? -50.470 9.144   -2.439  1.00 0.00 ?  104 PHE C N    1  
ATOM   7503   C  CA   . PHE C  2 50  ? -49.792 8.989   -1.167  1.00 0.00 ?  104 PHE C CA   1  
ATOM   7504   C  C    . PHE C  2 50  ? -48.839 10.188  -0.809  1.00 0.00 ?  104 PHE C C    1  
ATOM   7505   O  O    . PHE C  2 50  ? -48.814 10.674  0.282   1.00 0.00 ?  104 PHE C O    1  
ATOM   7506   C  CB   . PHE C  2 50  ? -49.001 7.629   -1.136  1.00 0.00 ?  104 PHE C CB   1  
ATOM   7507   C  CG   . PHE C  2 50  ? -47.620 7.617   -0.507  1.00 0.00 ?  104 PHE C CG   1  
ATOM   7508   C  CD1  . PHE C  2 50  ? -46.482 7.556   -1.283  1.00 0.00 ?  104 PHE C CD1  1  
ATOM   7509   C  CD2  . PHE C  2 50  ? -47.518 7.417   0.842   1.00 0.00 ?  104 PHE C CD2  1  
ATOM   7510   C  CE1  . PHE C  2 50  ? -45.229 7.527   -0.790  1.00 0.00 ?  104 PHE C CE1  1  
ATOM   7511   C  CE2  . PHE C  2 50  ? -46.180 7.521   1.418   1.00 0.00 ?  104 PHE C CE2  1  
ATOM   7512   C  CZ   . PHE C  2 50  ? -45.052 7.612   0.599   1.00 0.00 ?  104 PHE C CZ   1  
ATOM   7513   H  H    . PHE C  2 50  ? -50.409 8.350   -3.039  1.00 0.00 ?  104 PHE C H    1  
ATOM   7514   H  HA   . PHE C  2 50  ? -50.510 9.079   -0.364  1.00 0.00 ?  104 PHE C HA   1  
ATOM   7515   H  HB2  . PHE C  2 50  ? -49.636 6.930   -0.551  1.00 0.00 ?  104 PHE C HB2  1  
ATOM   7516   H  HB3  . PHE C  2 50  ? -48.944 7.188   -2.155  1.00 0.00 ?  104 PHE C HB3  1  
ATOM   7517   H  HD1  . PHE C  2 50  ? -46.725 7.392   -2.323  1.00 0.00 ?  104 PHE C HD1  1  
ATOM   7518   H  HD2  . PHE C  2 50  ? -48.356 7.582   1.502   1.00 0.00 ?  104 PHE C HD2  1  
ATOM   7519   H  HE1  . PHE C  2 50  ? -44.311 7.728   -1.321  1.00 0.00 ?  104 PHE C HE1  1  
ATOM   7520   H  HE2  . PHE C  2 50  ? -46.106 7.660   2.487   1.00 0.00 ?  104 PHE C HE2  1  
ATOM   7521   H  HZ   . PHE C  2 50  ? -44.101 7.802   1.073   1.00 0.00 ?  104 PHE C HZ   1  
ATOM   7522   N  N    . GLN C  2 51  ? -48.025 10.685  -1.789  1.00 0.00 ?  105 GLN C N    1  
ATOM   7523   C  CA   . GLN C  2 51  ? -47.022 11.753  -1.496  1.00 0.00 ?  105 GLN C CA   1  
ATOM   7524   C  C    . GLN C  2 51  ? -47.461 13.215  -1.782  1.00 0.00 ?  105 GLN C C    1  
ATOM   7525   O  O    . GLN C  2 51  ? -46.852 14.242  -1.483  1.00 0.00 ?  105 GLN C O    1  
ATOM   7526   C  CB   . GLN C  2 51  ? -45.700 11.370  -2.167  1.00 0.00 ?  105 GLN C CB   1  
ATOM   7527   C  CG   . GLN C  2 51  ? -44.361 12.049  -1.800  1.00 0.00 ?  105 GLN C CG   1  
ATOM   7528   C  CD   . GLN C  2 51  ? -44.240 12.244  -0.250  1.00 0.00 ?  105 GLN C CD   1  
ATOM   7529   O  OE1  . GLN C  2 51  ? -44.867 11.590  0.578   1.00 0.00 ?  105 GLN C OE1  1  
ATOM   7530   N  NE2  . GLN C  2 51  ? -43.360 13.171  0.124   1.00 0.00 ?  105 GLN C NE2  1  
ATOM   7531   H  H    . GLN C  2 51  ? -47.928 10.127  -2.610  1.00 0.00 ?  105 GLN C H    1  
ATOM   7532   H  HA   . GLN C  2 51  ? -46.925 11.757  -0.421  1.00 0.00 ?  105 GLN C HA   1  
ATOM   7533   H  HB2  . GLN C  2 51  ? -45.600 10.283  -1.964  1.00 0.00 ?  105 GLN C HB2  1  
ATOM   7534   H  HB3  . GLN C  2 51  ? -45.866 11.412  -3.264  1.00 0.00 ?  105 GLN C HB3  1  
ATOM   7535   H  HG2  . GLN C  2 51  ? -43.540 11.410  -2.189  1.00 0.00 ?  105 GLN C HG2  1  
ATOM   7536   H  HG3  . GLN C  2 51  ? -44.178 13.006  -2.335  1.00 0.00 ?  105 GLN C HG3  1  
ATOM   7537   H  HE21 . GLN C  2 51  ? -43.237 13.233  1.115   1.00 0.00 ?  105 GLN C HE21 1  
ATOM   7538   H  HE22 . GLN C  2 51  ? -42.904 13.873  -0.424  1.00 0.00 ?  105 GLN C HE22 1  
ATOM   7539   N  N    . LYS C  2 52  ? -48.535 13.289  -2.602  1.00 0.00 ?  106 LYS C N    1  
ATOM   7540   C  CA   . LYS C  2 52  ? -48.963 14.484  -3.281  1.00 0.00 ?  106 LYS C CA   1  
ATOM   7541   C  C    . LYS C  2 52  ? -49.217 15.745  -2.469  1.00 0.00 ?  106 LYS C C    1  
ATOM   7542   O  O    . LYS C  2 52  ? -48.800 16.887  -2.838  1.00 0.00 ?  106 LYS C O    1  
ATOM   7543   C  CB   . LYS C  2 52  ? -50.183 14.238  -4.123  1.00 0.00 ?  106 LYS C CB   1  
ATOM   7544   C  CG   . LYS C  2 52  ? -50.022 13.099  -5.206  1.00 0.00 ?  106 LYS C CG   1  
ATOM   7545   C  CD   . LYS C  2 52  ? -48.660 12.982  -5.955  1.00 0.00 ?  106 LYS C CD   1  
ATOM   7546   C  CE   . LYS C  2 52  ? -48.574 11.774  -6.903  1.00 0.00 ?  106 LYS C CE   1  
ATOM   7547   N  NZ   . LYS C  2 52  ? -47.377 11.774  -7.768  1.00 0.00 1  106 LYS C NZ   1  
ATOM   7548   H  H    . LYS C  2 52  ? -49.027 12.470  -2.888  1.00 0.00 ?  106 LYS C H    1  
ATOM   7549   H  HA   . LYS C  2 52  ? -48.202 14.843  -3.958  1.00 0.00 ?  106 LYS C HA   1  
ATOM   7550   H  HB2  . LYS C  2 52  ? -51.101 13.979  -3.553  1.00 0.00 ?  106 LYS C HB2  1  
ATOM   7551   H  HB3  . LYS C  2 52  ? -50.378 15.226  -4.591  1.00 0.00 ?  106 LYS C HB3  1  
ATOM   7552   H  HG2  . LYS C  2 52  ? -50.167 12.092  -4.759  1.00 0.00 ?  106 LYS C HG2  1  
ATOM   7553   H  HG3  . LYS C  2 52  ? -50.853 13.244  -5.929  1.00 0.00 ?  106 LYS C HG3  1  
ATOM   7554   H  HD2  . LYS C  2 52  ? -48.593 13.990  -6.417  1.00 0.00 ?  106 LYS C HD2  1  
ATOM   7555   H  HD3  . LYS C  2 52  ? -47.787 12.842  -5.282  1.00 0.00 ?  106 LYS C HD3  1  
ATOM   7556   H  HE2  . LYS C  2 52  ? -48.561 10.856  -6.278  1.00 0.00 ?  106 LYS C HE2  1  
ATOM   7557   H  HE3  . LYS C  2 52  ? -49.485 11.631  -7.523  1.00 0.00 ?  106 LYS C HE3  1  
ATOM   7558   H  HZ1  . LYS C  2 52  ? -46.516 12.096  -7.281  1.00 0.00 ?  106 LYS C HZ1  1  
ATOM   7559   H  HZ2  . LYS C  2 52  ? -47.535 12.376  -8.602  1.00 0.00 ?  106 LYS C HZ2  1  
ATOM   7560   H  HZ3  . LYS C  2 52  ? -47.141 10.848  -8.178  1.00 0.00 ?  106 LYS C HZ3  1  
ATOM   7561   N  N    . LYS C  2 53  ? -49.929 15.644  -1.293  1.00 0.00 ?  107 LYS C N    1  
ATOM   7562   C  CA   . LYS C  2 53  ? -50.281 16.847  -0.539  1.00 0.00 ?  107 LYS C CA   1  
ATOM   7563   C  C    . LYS C  2 53  ? -49.121 17.228  0.448   1.00 0.00 ?  107 LYS C C    1  
ATOM   7564   O  O    . LYS C  2 53  ? -49.098 18.381  0.812   1.00 0.00 ?  107 LYS C O    1  
ATOM   7565   C  CB   . LYS C  2 53  ? -51.612 16.619  0.255   1.00 0.00 ?  107 LYS C CB   1  
ATOM   7566   C  CG   . LYS C  2 53  ? -52.790 16.505  -0.728  1.00 0.00 ?  107 LYS C CG   1  
ATOM   7567   C  CD   . LYS C  2 53  ? -53.385 17.810  -1.240  1.00 0.00 ?  107 LYS C CD   1  
ATOM   7568   C  CE   . LYS C  2 53  ? -54.308 17.648  -2.457  1.00 0.00 ?  107 LYS C CE   1  
ATOM   7569   N  NZ   . LYS C  2 53  ? -54.622 18.966  -3.045  1.00 0.00 1  107 LYS C NZ   1  
ATOM   7570   H  H    . LYS C  2 53  ? -50.289 14.730  -1.121  1.00 0.00 ?  107 LYS C H    1  
ATOM   7571   H  HA   . LYS C  2 53  ? -50.387 17.673  -1.228  1.00 0.00 ?  107 LYS C HA   1  
ATOM   7572   H  HB2  . LYS C  2 53  ? -51.630 15.706  0.888   1.00 0.00 ?  107 LYS C HB2  1  
ATOM   7573   H  HB3  . LYS C  2 53  ? -51.819 17.500  0.899   1.00 0.00 ?  107 LYS C HB3  1  
ATOM   7574   H  HG2  . LYS C  2 53  ? -52.386 15.852  -1.530  1.00 0.00 ?  107 LYS C HG2  1  
ATOM   7575   H  HG3  . LYS C  2 53  ? -53.604 15.894  -0.281  1.00 0.00 ?  107 LYS C HG3  1  
ATOM   7576   H  HD2  . LYS C  2 53  ? -53.922 18.475  -0.530  1.00 0.00 ?  107 LYS C HD2  1  
ATOM   7577   H  HD3  . LYS C  2 53  ? -52.441 18.306  -1.552  1.00 0.00 ?  107 LYS C HD3  1  
ATOM   7578   H  HE2  . LYS C  2 53  ? -53.781 17.021  -3.207  1.00 0.00 ?  107 LYS C HE2  1  
ATOM   7579   H  HE3  . LYS C  2 53  ? -55.270 17.132  -2.254  1.00 0.00 ?  107 LYS C HE3  1  
ATOM   7580   H  HZ1  . LYS C  2 53  ? -55.085 18.929  -3.976  1.00 0.00 ?  107 LYS C HZ1  1  
ATOM   7581   H  HZ2  . LYS C  2 53  ? -53.765 19.547  -3.138  1.00 0.00 ?  107 LYS C HZ2  1  
ATOM   7582   H  HZ3  . LYS C  2 53  ? -55.329 19.486  -2.487  1.00 0.00 ?  107 LYS C HZ3  1  
ATOM   7583   N  N    . TRP C  2 54  ? -48.027 16.411  0.683   1.00 0.00 ?  108 TRP C N    1  
ATOM   7584   C  CA   . TRP C  2 54  ? -46.757 16.868  1.309   1.00 0.00 ?  108 TRP C CA   1  
ATOM   7585   C  C    . TRP C  2 54  ? -46.025 17.751  0.381   1.00 0.00 ?  108 TRP C C    1  
ATOM   7586   O  O    . TRP C  2 54  ? -45.508 18.802  0.636   1.00 0.00 ?  108 TRP C O    1  
ATOM   7587   C  CB   . TRP C  2 54  ? -45.785 15.742  1.717   1.00 0.00 ?  108 TRP C CB   1  
ATOM   7588   C  CG   . TRP C  2 54  ? -44.607 16.186  2.565   1.00 0.00 ?  108 TRP C CG   1  
ATOM   7589   C  CD1  . TRP C  2 54  ? -44.169 17.439  2.980   1.00 0.00 ?  108 TRP C CD1  1  
ATOM   7590   C  CD2  . TRP C  2 54  ? -43.597 15.307  3.059   1.00 0.00 ?  108 TRP C CD2  1  
ATOM   7591   N  NE1  . TRP C  2 54  ? -42.980 17.349  3.623   1.00 0.00 ?  108 TRP C NE1  1  
ATOM   7592   C  CE2  . TRP C  2 54  ? -42.499 16.033  3.668   1.00 0.00 ?  108 TRP C CE2  1  
ATOM   7593   C  CE3  . TRP C  2 54  ? -43.546 13.907  3.142   1.00 0.00 ?  108 TRP C CE3  1  
ATOM   7594   C  CZ2  . TRP C  2 54  ? -41.408 15.418  4.238   1.00 0.00 ?  108 TRP C CZ2  1  
ATOM   7595   C  CZ3  . TRP C  2 54  ? -42.361 13.281  3.659   1.00 0.00 ?  108 TRP C CZ3  1  
ATOM   7596   C  CH2  . TRP C  2 54  ? -41.352 14.022  4.210   1.00 0.00 ?  108 TRP C CH2  1  
ATOM   7597   H  H    . TRP C  2 54  ? -48.001 15.417  0.608   1.00 0.00 ?  108 TRP C H    1  
ATOM   7598   H  HA   . TRP C  2 54  ? -47.066 17.470  2.151   1.00 0.00 ?  108 TRP C HA   1  
ATOM   7599   H  HB2  . TRP C  2 54  ? -46.450 15.144  2.375   1.00 0.00 ?  108 TRP C HB2  1  
ATOM   7600   H  HB3  . TRP C  2 54  ? -45.460 15.146  0.838   1.00 0.00 ?  108 TRP C HB3  1  
ATOM   7601   H  HD1  . TRP C  2 54  ? -44.556 18.410  2.710   1.00 0.00 ?  108 TRP C HD1  1  
ATOM   7602   H  HE1  . TRP C  2 54  ? -42.387 18.069  3.912   1.00 0.00 ?  108 TRP C HE1  1  
ATOM   7603   H  HE3  . TRP C  2 54  ? -44.286 13.233  2.736   1.00 0.00 ?  108 TRP C HE3  1  
ATOM   7604   H  HZ2  . TRP C  2 54  ? -40.622 15.978  4.721   1.00 0.00 ?  108 TRP C HZ2  1  
ATOM   7605   H  HZ3  . TRP C  2 54  ? -42.335 12.204  3.732   1.00 0.00 ?  108 TRP C HZ3  1  
ATOM   7606   H  HH2  . TRP C  2 54  ? -40.533 13.544  4.726   1.00 0.00 ?  108 TRP C HH2  1  
ATOM   7607   N  N    . GLN C  2 55  ? -46.032 17.334  -0.960  1.00 0.00 ?  109 GLN C N    1  
ATOM   7608   C  CA   . GLN C  2 55  ? -45.406 18.015  -2.168  1.00 0.00 ?  109 GLN C CA   1  
ATOM   7609   C  C    . GLN C  2 55  ? -46.148 19.345  -2.438  1.00 0.00 ?  109 GLN C C    1  
ATOM   7610   O  O    . GLN C  2 55  ? -45.457 20.392  -2.551  1.00 0.00 ?  109 GLN C O    1  
ATOM   7611   C  CB   . GLN C  2 55  ? -45.536 17.117  -3.432  1.00 0.00 ?  109 GLN C CB   1  
ATOM   7612   C  CG   . GLN C  2 55  ? -44.591 15.913  -3.680  1.00 0.00 ?  109 GLN C CG   1  
ATOM   7613   C  CD   . GLN C  2 55  ? -43.180 15.972  -2.991  1.00 0.00 ?  109 GLN C CD   1  
ATOM   7614   O  OE1  . GLN C  2 55  ? -42.937 15.468  -1.916  1.00 0.00 ?  109 GLN C OE1  1  
ATOM   7615   N  NE2  . GLN C  2 55  ? -42.255 16.690  -3.643  1.00 0.00 ?  109 GLN C NE2  1  
ATOM   7616   H  H    . GLN C  2 55  ? -46.476 16.479  -1.214  1.00 0.00 ?  109 GLN C H    1  
ATOM   7617   H  HA   . GLN C  2 55  ? -44.406 18.281  -1.862  1.00 0.00 ?  109 GLN C HA   1  
ATOM   7618   H  HB2  . GLN C  2 55  ? -46.593 16.857  -3.652  1.00 0.00 ?  109 GLN C HB2  1  
ATOM   7619   H  HB3  . GLN C  2 55  ? -45.396 17.825  -4.277  1.00 0.00 ?  109 GLN C HB3  1  
ATOM   7620   H  HG2  . GLN C  2 55  ? -45.072 15.047  -3.177  1.00 0.00 ?  109 GLN C HG2  1  
ATOM   7621   H  HG3  . GLN C  2 55  ? -44.560 15.710  -4.772  1.00 0.00 ?  109 GLN C HG3  1  
ATOM   7622   H  HE21 . GLN C  2 55  ? -41.362 16.942  -3.271  1.00 0.00 ?  109 GLN C HE21 1  
ATOM   7623   H  HE22 . GLN C  2 55  ? -42.474 16.848  -4.606  1.00 0.00 ?  109 GLN C HE22 1  
ATOM   7624   N  N    . GLU C  2 56  ? -47.469 19.459  -2.447  1.00 0.00 ?  110 GLU C N    1  
ATOM   7625   C  CA   . GLU C  2 56  ? -48.122 20.761  -2.302  1.00 0.00 ?  110 GLU C CA   1  
ATOM   7626   C  C    . GLU C  2 56  ? -47.791 21.517  -0.934  1.00 0.00 ?  110 GLU C C    1  
ATOM   7627   O  O    . GLU C  2 56  ? -47.696 22.791  -0.978  1.00 0.00 ?  110 GLU C O    1  
ATOM   7628   C  CB   . GLU C  2 56  ? -49.595 20.469  -2.464  1.00 0.00 ?  110 GLU C CB   1  
ATOM   7629   C  CG   . GLU C  2 56  ? -49.957 20.020  -3.887  1.00 0.00 ?  110 GLU C CG   1  
ATOM   7630   C  CD   . GLU C  2 56  ? -51.435 19.612  -4.109  1.00 0.00 ?  110 GLU C CD   1  
ATOM   7631   O  OE1  . GLU C  2 56  ? -51.752 18.836  -5.017  1.00 0.00 ?  110 GLU C OE1  1  
ATOM   7632   O  OE2  . GLU C  2 56  ? -52.331 20.155  -3.356  1.00 0.00 -1 110 GLU C OE2  1  
ATOM   7633   H  H    . GLU C  2 56  ? -48.032 18.640  -2.369  1.00 0.00 ?  110 GLU C H    1  
ATOM   7634   H  HA   . GLU C  2 56  ? -47.868 21.470  -3.076  1.00 0.00 ?  110 GLU C HA   1  
ATOM   7635   H  HB2  . GLU C  2 56  ? -49.907 19.710  -1.715  1.00 0.00 ?  110 GLU C HB2  1  
ATOM   7636   H  HB3  . GLU C  2 56  ? -50.161 21.391  -2.212  1.00 0.00 ?  110 GLU C HB3  1  
ATOM   7637   H  HG2  . GLU C  2 56  ? -49.728 20.807  -4.637  1.00 0.00 ?  110 GLU C HG2  1  
ATOM   7638   H  HG3  . GLU C  2 56  ? -49.340 19.204  -4.320  1.00 0.00 ?  110 GLU C HG3  1  
ATOM   7639   N  N    . GLU C  2 57  ? -47.600 20.908  0.248   1.00 0.00 ?  111 GLU C N    1  
ATOM   7640   C  CA   . GLU C  2 57  ? -47.433 21.508  1.495   1.00 0.00 ?  111 GLU C CA   1  
ATOM   7641   C  C    . GLU C  2 57  ? -46.118 22.264  1.632   1.00 0.00 ?  111 GLU C C    1  
ATOM   7642   O  O    . GLU C  2 57  ? -45.999 23.367  2.193   1.00 0.00 ?  111 GLU C O    1  
ATOM   7643   C  CB   . GLU C  2 57  ? -47.571 20.447  2.617   1.00 0.00 ?  111 GLU C CB   1  
ATOM   7644   C  CG   . GLU C  2 57  ? -47.399 20.863  4.123   1.00 0.00 ?  111 GLU C CG   1  
ATOM   7645   C  CD   . GLU C  2 57  ? -47.666 19.781  5.044   1.00 0.00 ?  111 GLU C CD   1  
ATOM   7646   O  OE1  . GLU C  2 57  ? -46.823 18.869  5.188   1.00 0.00 ?  111 GLU C OE1  1  
ATOM   7647   O  OE2  . GLU C  2 57  ? -48.747 19.883  5.701   1.00 0.00 -1 111 GLU C OE2  1  
ATOM   7648   H  H    . GLU C  2 57  ? -47.604 19.930  0.439   1.00 0.00 ?  111 GLU C H    1  
ATOM   7649   H  HA   . GLU C  2 57  ? -48.131 22.321  1.623   1.00 0.00 ?  111 GLU C HA   1  
ATOM   7650   H  HB2  . GLU C  2 57  ? -48.554 19.932  2.555   1.00 0.00 ?  111 GLU C HB2  1  
ATOM   7651   H  HB3  . GLU C  2 57  ? -46.816 19.666  2.384   1.00 0.00 ?  111 GLU C HB3  1  
ATOM   7652   H  HG2  . GLU C  2 57  ? -46.336 21.185  4.141   1.00 0.00 ?  111 GLU C HG2  1  
ATOM   7653   H  HG3  . GLU C  2 57  ? -47.986 21.785  4.321   1.00 0.00 ?  111 GLU C HG3  1  
ATOM   7654   N  N    . MET C  2 58  ? -45.060 21.702  1.027   1.00 0.00 ?  112 MET C N    1  
ATOM   7655   C  CA   . MET C  2 58  ? -43.746 22.298  0.787   1.00 0.00 ?  112 MET C CA   1  
ATOM   7656   C  C    . MET C  2 58  ? -43.790 23.479  -0.236  1.00 0.00 ?  112 MET C C    1  
ATOM   7657   O  O    . MET C  2 58  ? -43.186 24.577  -0.080  1.00 0.00 ?  112 MET C O    1  
ATOM   7658   C  CB   . MET C  2 58  ? -42.585 21.275  0.566   1.00 0.00 ?  112 MET C CB   1  
ATOM   7659   C  CG   . MET C  2 58  ? -42.635 20.363  -0.794  1.00 0.00 ?  112 MET C CG   1  
ATOM   7660   S  SD   . MET C  2 58  ? -41.121 19.356  -1.078  1.00 0.00 ?  112 MET C SD   1  
ATOM   7661   C  CE   . MET C  2 58  ? -41.556 18.101  0.106   1.00 0.00 ?  112 MET C CE   1  
ATOM   7662   H  H    . MET C  2 58  ? -45.026 20.813  0.577   1.00 0.00 ?  112 MET C H    1  
ATOM   7663   H  HA   . MET C  2 58  ? -43.468 22.796  1.705   1.00 0.00 ?  112 MET C HA   1  
ATOM   7664   H  HB2  . MET C  2 58  ? -41.715 21.951  0.421   1.00 0.00 ?  112 MET C HB2  1  
ATOM   7665   H  HB3  . MET C  2 58  ? -42.459 20.579  1.423   1.00 0.00 ?  112 MET C HB3  1  
ATOM   7666   H  HG2  . MET C  2 58  ? -43.564 19.753  -0.818  1.00 0.00 ?  112 MET C HG2  1  
ATOM   7667   H  HG3  . MET C  2 58  ? -42.672 21.142  -1.584  1.00 0.00 ?  112 MET C HG3  1  
ATOM   7668   H  HE1  . MET C  2 58  ? -42.552 17.643  -0.074  1.00 0.00 ?  112 MET C HE1  1  
ATOM   7669   H  HE2  . MET C  2 58  ? -41.449 18.533  1.124   1.00 0.00 ?  112 MET C HE2  1  
ATOM   7670   H  HE3  . MET C  2 58  ? -40.876 17.237  -0.052  1.00 0.00 ?  112 MET C HE3  1  
ATOM   7671   N  N    . GLU C  2 59  ? -44.433 23.249  -1.407  1.00 0.00 ?  113 GLU C N    1  
ATOM   7672   C  CA   . GLU C  2 59  ? -44.483 24.219  -2.547  1.00 0.00 ?  113 GLU C CA   1  
ATOM   7673   C  C    . GLU C  2 59  ? -45.119 25.538  -2.233  1.00 0.00 ?  113 GLU C C    1  
ATOM   7674   O  O    . GLU C  2 59  ? -44.504 26.576  -2.468  1.00 0.00 ?  113 GLU C O    1  
ATOM   7675   C  CB   . GLU C  2 59  ? -45.231 23.512  -3.689  1.00 0.00 ?  113 GLU C CB   1  
ATOM   7676   C  CG   . GLU C  2 59  ? -45.300 24.405  -4.922  1.00 0.00 ?  113 GLU C CG   1  
ATOM   7677   C  CD   . GLU C  2 59  ? -46.018 23.809  -6.164  1.00 0.00 ?  113 GLU C CD   1  
ATOM   7678   O  OE1  . GLU C  2 59  ? -45.557 22.748  -6.603  1.00 0.00 ?  113 GLU C OE1  1  
ATOM   7679   O  OE2  . GLU C  2 59  ? -47.044 24.444  -6.631  1.00 0.00 -1 113 GLU C OE2  1  
ATOM   7680   H  H    . GLU C  2 59  ? -44.879 22.376  -1.590  1.00 0.00 ?  113 GLU C H    1  
ATOM   7681   H  HA   . GLU C  2 59  ? -43.414 24.334  -2.648  1.00 0.00 ?  113 GLU C HA   1  
ATOM   7682   H  HB2  . GLU C  2 59  ? -44.590 22.610  -3.787  1.00 0.00 ?  113 GLU C HB2  1  
ATOM   7683   H  HB3  . GLU C  2 59  ? -46.217 23.112  -3.372  1.00 0.00 ?  113 GLU C HB3  1  
ATOM   7684   H  HG2  . GLU C  2 59  ? -45.844 25.313  -4.587  1.00 0.00 ?  113 GLU C HG2  1  
ATOM   7685   H  HG3  . GLU C  2 59  ? -44.287 24.802  -5.145  1.00 0.00 ?  113 GLU C HG3  1  
ATOM   7686   N  N    . LEU C  2 60  ? -46.353 25.512  -1.736  1.00 0.00 ?  114 LEU C N    1  
ATOM   7687   C  CA   . LEU C  2 60  ? -47.083 26.760  -1.507  1.00 0.00 ?  114 LEU C CA   1  
ATOM   7688   C  C    . LEU C  2 60  ? -46.428 27.697  -0.502  1.00 0.00 ?  114 LEU C C    1  
ATOM   7689   O  O    . LEU C  2 60  ? -46.415 28.890  -0.565  1.00 0.00 ?  114 LEU C O    1  
ATOM   7690   C  CB   . LEU C  2 60  ? -48.545 26.450  -1.150  1.00 0.00 ?  114 LEU C CB   1  
ATOM   7691   C  CG   . LEU C  2 60  ? -49.393 27.676  -0.745  1.00 0.00 ?  114 LEU C CG   1  
ATOM   7692   C  CD1  . LEU C  2 60  ? -49.489 28.757  -1.833  1.00 0.00 ?  114 LEU C CD1  1  
ATOM   7693   C  CD2  . LEU C  2 60  ? -50.814 27.184  -0.312  1.00 0.00 ?  114 LEU C CD2  1  
ATOM   7694   H  H    . LEU C  2 60  ? -46.791 24.641  -1.531  1.00 0.00 ?  114 LEU C H    1  
ATOM   7695   H  HA   . LEU C  2 60  ? -47.057 27.265  -2.462  1.00 0.00 ?  114 LEU C HA   1  
ATOM   7696   H  HB2  . LEU C  2 60  ? -49.073 25.847  -1.919  1.00 0.00 ?  114 LEU C HB2  1  
ATOM   7697   H  HB3  . LEU C  2 60  ? -48.462 25.744  -0.296  1.00 0.00 ?  114 LEU C HB3  1  
ATOM   7698   H  HG   . LEU C  2 60  ? -48.919 28.301  0.042   1.00 0.00 ?  114 LEU C HG   1  
ATOM   7699   H  HD11 . LEU C  2 60  ? -50.107 29.641  -1.567  1.00 0.00 ?  114 LEU C HD11 1  
ATOM   7700   H  HD12 . LEU C  2 60  ? -50.008 28.253  -2.676  1.00 0.00 ?  114 LEU C HD12 1  
ATOM   7701   H  HD13 . LEU C  2 60  ? -48.528 29.175  -2.202  1.00 0.00 ?  114 LEU C HD13 1  
ATOM   7702   H  HD21 . LEU C  2 60  ? -51.288 26.650  -1.163  1.00 0.00 ?  114 LEU C HD21 1  
ATOM   7703   H  HD22 . LEU C  2 60  ? -51.509 28.037  -0.158  1.00 0.00 ?  114 LEU C HD22 1  
ATOM   7704   H  HD23 . LEU C  2 60  ? -50.957 26.730  0.692   1.00 0.00 ?  114 LEU C HD23 1  
ATOM   7705   N  N    . TYR C  2 61  ? -45.885 27.041  0.520   1.00 0.00 ?  115 TYR C N    1  
ATOM   7706   C  CA   . TYR C  2 61  ? -45.068 27.753  1.526   1.00 0.00 ?  115 TYR C CA   1  
ATOM   7707   C  C    . TYR C  2 61  ? -43.863 28.465  0.930   1.00 0.00 ?  115 TYR C C    1  
ATOM   7708   O  O    . TYR C  2 61  ? -43.527 29.612  1.181   1.00 0.00 ?  115 TYR C O    1  
ATOM   7709   C  CB   . TYR C  2 61  ? -44.595 26.630  2.395   1.00 0.00 ?  115 TYR C CB   1  
ATOM   7710   C  CG   . TYR C  2 61  ? -43.748 27.115  3.616   1.00 0.00 ?  115 TYR C CG   1  
ATOM   7711   C  CD1  . TYR C  2 61  ? -42.410 26.626  3.826   1.00 0.00 ?  115 TYR C CD1  1  
ATOM   7712   C  CD2  . TYR C  2 61  ? -44.413 27.916  4.517   1.00 0.00 ?  115 TYR C CD2  1  
ATOM   7713   C  CE1  . TYR C  2 61  ? -41.821 27.028  4.974   1.00 0.00 ?  115 TYR C CE1  1  
ATOM   7714   C  CE2  . TYR C  2 61  ? -43.705 28.323  5.685   1.00 0.00 ?  115 TYR C CE2  1  
ATOM   7715   C  CZ   . TYR C  2 61  ? -42.431 27.942  5.909   1.00 0.00 ?  115 TYR C CZ   1  
ATOM   7716   O  OH   . TYR C  2 61  ? -41.703 28.555  6.982   1.00 0.00 ?  115 TYR C OH   1  
ATOM   7717   H  H    . TYR C  2 61  ? -45.936 26.047  0.576   1.00 0.00 ?  115 TYR C H    1  
ATOM   7718   H  HA   . TYR C  2 61  ? -45.647 28.442  2.123   1.00 0.00 ?  115 TYR C HA   1  
ATOM   7719   H  HB2  . TYR C  2 61  ? -45.498 26.108  2.776   1.00 0.00 ?  115 TYR C HB2  1  
ATOM   7720   H  HB3  . TYR C  2 61  ? -44.087 25.875  1.758   1.00 0.00 ?  115 TYR C HB3  1  
ATOM   7721   H  HD1  . TYR C  2 61  ? -41.934 26.158  2.977   1.00 0.00 ?  115 TYR C HD1  1  
ATOM   7722   H  HD2  . TYR C  2 61  ? -45.436 28.216  4.343   1.00 0.00 ?  115 TYR C HD2  1  
ATOM   7723   H  HE1  . TYR C  2 61  ? -40.775 26.795  5.107   1.00 0.00 ?  115 TYR C HE1  1  
ATOM   7724   H  HE2  . TYR C  2 61  ? -44.245 28.944  6.385   1.00 0.00 ?  115 TYR C HE2  1  
ATOM   7725   H  HH   . TYR C  2 61  ? -40.807 28.450  6.653   1.00 0.00 ?  115 TYR C HH   1  
ATOM   7726   N  N    . ARG C  2 62  ? -43.017 27.739  0.056   1.00 0.00 ?  116 ARG C N    1  
ATOM   7727   C  CA   . ARG C  2 62  ? -41.823 28.282  -0.479  1.00 0.00 ?  116 ARG C CA   1  
ATOM   7728   C  C    . ARG C  2 62  ? -42.038 29.335  -1.502  1.00 0.00 ?  116 ARG C C    1  
ATOM   7729   O  O    . ARG C  2 62  ? -41.284 30.239  -1.661  1.00 0.00 ?  116 ARG C O    1  
ATOM   7730   C  CB   . ARG C  2 62  ? -40.749 27.269  -0.875  1.00 0.00 ?  116 ARG C CB   1  
ATOM   7731   C  CG   . ARG C  2 62  ? -41.113 26.321  -2.039  1.00 0.00 ?  116 ARG C CG   1  
ATOM   7732   C  CD   . ARG C  2 62  ? -40.967 26.964  -3.468  1.00 0.00 ?  116 ARG C CD   1  
ATOM   7733   N  NE   . ARG C  2 62  ? -41.470 25.895  -4.410  1.00 0.00 ?  116 ARG C NE   1  
ATOM   7734   C  CZ   . ARG C  2 62  ? -41.547 26.036  -5.710  1.00 0.00 ?  116 ARG C CZ   1  
ATOM   7735   N  NH1  . ARG C  2 62  ? -41.596 24.922  -6.400  1.00 0.00 1  116 ARG C NH1  1  
ATOM   7736   N  NH2  . ARG C  2 62  ? -41.815 27.158  -6.315  1.00 0.00 ?  116 ARG C NH2  1  
ATOM   7737   H  H    . ARG C  2 62  ? -43.369 26.870  -0.284  1.00 0.00 ?  116 ARG C H    1  
ATOM   7738   H  HA   . ARG C  2 62  ? -41.336 28.767  0.354   1.00 0.00 ?  116 ARG C HA   1  
ATOM   7739   H  HB2  . ARG C  2 62  ? -39.770 27.744  -1.098  1.00 0.00 ?  116 ARG C HB2  1  
ATOM   7740   H  HB3  . ARG C  2 62  ? -40.353 26.711  0.001   1.00 0.00 ?  116 ARG C HB3  1  
ATOM   7741   H  HG2  . ARG C  2 62  ? -40.314 25.571  -1.862  1.00 0.00 ?  116 ARG C HG2  1  
ATOM   7742   H  HG3  . ARG C  2 62  ? -42.035 25.704  -1.980  1.00 0.00 ?  116 ARG C HG3  1  
ATOM   7743   H  HD2  . ARG C  2 62  ? -41.636 27.845  -3.570  1.00 0.00 ?  116 ARG C HD2  1  
ATOM   7744   H  HD3  . ARG C  2 62  ? -39.951 27.208  -3.846  1.00 0.00 ?  116 ARG C HD3  1  
ATOM   7745   H  HE   . ARG C  2 62  ? -41.280 24.956  -4.123  1.00 0.00 ?  116 ARG C HE   1  
ATOM   7746   H  HH11 . ARG C  2 62  ? -41.499 24.099  -5.840  1.00 0.00 ?  116 ARG C HH11 1  
ATOM   7747   H  HH12 . ARG C  2 62  ? -42.282 24.895  -7.127  1.00 0.00 ?  116 ARG C HH12 1  
ATOM   7748   H  HH21 . ARG C  2 62  ? -41.543 26.986  -7.261  1.00 0.00 ?  116 ARG C HH21 1  
ATOM   7749   H  HH22 . ARG C  2 62  ? -41.530 28.017  -5.889  1.00 0.00 ?  116 ARG C HH22 1  
ATOM   7750   N  N    . GLN C  2 63  ? -43.252 29.233  -2.150  1.00 0.00 ?  117 GLN C N    1  
ATOM   7751   C  CA   . GLN C  2 63  ? -43.782 30.194  -3.058  1.00 0.00 ?  117 GLN C CA   1  
ATOM   7752   C  C    . GLN C  2 63  ? -44.272 31.524  -2.319  1.00 0.00 ?  117 GLN C C    1  
ATOM   7753   O  O    . GLN C  2 63  ? -44.294 32.640  -2.900  1.00 0.00 ?  117 GLN C O    1  
ATOM   7754   C  CB   . GLN C  2 63  ? -44.933 29.667  -3.932  1.00 0.00 ?  117 GLN C CB   1  
ATOM   7755   C  CG   . GLN C  2 63  ? -44.325 28.771  -5.031  1.00 0.00 ?  117 GLN C CG   1  
ATOM   7756   C  CD   . GLN C  2 63  ? -45.425 27.898  -5.707  1.00 0.00 ?  117 GLN C CD   1  
ATOM   7757   O  OE1  . GLN C  2 63  ? -46.629 28.056  -5.358  1.00 0.00 ?  117 GLN C OE1  1  
ATOM   7758   N  NE2  . GLN C  2 63  ? -45.019 27.186  -6.699  1.00 0.00 ?  117 GLN C NE2  1  
ATOM   7759   H  H    . GLN C  2 63  ? -43.736 28.362  -2.115  1.00 0.00 ?  117 GLN C H    1  
ATOM   7760   H  HA   . GLN C  2 63  ? -42.985 30.469  -3.732  1.00 0.00 ?  117 GLN C HA   1  
ATOM   7761   H  HB2  . GLN C  2 63  ? -45.764 29.203  -3.359  1.00 0.00 ?  117 GLN C HB2  1  
ATOM   7762   H  HB3  . GLN C  2 63  ? -45.445 30.469  -4.505  1.00 0.00 ?  117 GLN C HB3  1  
ATOM   7763   H  HG2  . GLN C  2 63  ? -43.751 29.272  -5.838  1.00 0.00 ?  117 GLN C HG2  1  
ATOM   7764   H  HG3  . GLN C  2 63  ? -43.800 27.962  -4.479  1.00 0.00 ?  117 GLN C HG3  1  
ATOM   7765   H  HE21 . GLN C  2 63  ? -45.705 26.784  -7.306  1.00 0.00 ?  117 GLN C HE21 1  
ATOM   7766   H  HE22 . GLN C  2 63  ? -44.053 26.928  -6.718  1.00 0.00 ?  117 GLN C HE22 1  
ATOM   7767   N  N    . LYS C  2 64  ? -44.769 31.349  -1.121  1.00 0.00 ?  118 LYS C N    1  
ATOM   7768   C  CA   . LYS C  2 64  ? -45.194 32.371  -0.258  1.00 0.00 ?  118 LYS C CA   1  
ATOM   7769   C  C    . LYS C  2 64  ? -44.147 33.321  0.259   1.00 0.00 ?  118 LYS C C    1  
ATOM   7770   O  O    . LYS C  2 64  ? -44.309 34.516  0.270   1.00 0.00 ?  118 LYS C O    1  
ATOM   7771   C  CB   . LYS C  2 64  ? -46.037 31.798  0.960   1.00 0.00 ?  118 LYS C CB   1  
ATOM   7772   C  CG   . LYS C  2 64  ? -47.551 31.590  0.601   1.00 0.00 ?  118 LYS C CG   1  
ATOM   7773   C  CD   . LYS C  2 64  ? -48.525 31.155  1.695   1.00 0.00 ?  118 LYS C CD   1  
ATOM   7774   C  CE   . LYS C  2 64  ? -48.522 32.004  2.962   1.00 0.00 ?  118 LYS C CE   1  
ATOM   7775   N  NZ   . LYS C  2 64  ? -48.853 33.417  2.780   1.00 0.00 1  118 LYS C NZ   1  
ATOM   7776   H  H    . LYS C  2 64  ? -44.832 30.411  -0.788  1.00 0.00 ?  118 LYS C H    1  
ATOM   7777   H  HA   . LYS C  2 64  ? -45.876 33.009  -0.801  1.00 0.00 ?  118 LYS C HA   1  
ATOM   7778   H  HB2  . LYS C  2 64  ? -45.531 30.835  1.186   1.00 0.00 ?  118 LYS C HB2  1  
ATOM   7779   H  HB3  . LYS C  2 64  ? -46.010 32.604  1.724   1.00 0.00 ?  118 LYS C HB3  1  
ATOM   7780   H  HG2  . LYS C  2 64  ? -47.835 32.648  0.414   1.00 0.00 ?  118 LYS C HG2  1  
ATOM   7781   H  HG3  . LYS C  2 64  ? -47.653 30.931  -0.287  1.00 0.00 ?  118 LYS C HG3  1  
ATOM   7782   H  HD2  . LYS C  2 64  ? -49.498 31.125  1.160   1.00 0.00 ?  118 LYS C HD2  1  
ATOM   7783   H  HD3  . LYS C  2 64  ? -48.199 30.132  1.982   1.00 0.00 ?  118 LYS C HD3  1  
ATOM   7784   H  HE2  . LYS C  2 64  ? -49.356 31.598  3.573   1.00 0.00 ?  118 LYS C HE2  1  
ATOM   7785   H  HE3  . LYS C  2 64  ? -47.533 31.966  3.467   1.00 0.00 ?  118 LYS C HE3  1  
ATOM   7786   H  HZ1  . LYS C  2 64  ? -48.050 34.002  2.473   1.00 0.00 ?  118 LYS C HZ1  1  
ATOM   7787   H  HZ2  . LYS C  2 64  ? -49.242 33.700  3.703   1.00 0.00 ?  118 LYS C HZ2  1  
ATOM   7788   H  HZ3  . LYS C  2 64  ? -49.518 33.577  1.997   1.00 0.00 ?  118 LYS C HZ3  1  
ATOM   7789   N  N    . VAL C  2 65  ? -42.941 32.774  0.684   1.00 0.00 ?  119 VAL C N    1  
ATOM   7790   C  CA   . VAL C  2 65  ? -41.746 33.471  1.113   1.00 0.00 ?  119 VAL C CA   1  
ATOM   7791   C  C    . VAL C  2 65  ? -40.794 33.834  0.009   1.00 0.00 ?  119 VAL C C    1  
ATOM   7792   O  O    . VAL C  2 65  ? -39.853 34.596  0.214   1.00 0.00 ?  119 VAL C O    1  
ATOM   7793   C  CB   . VAL C  2 65  ? -41.044 32.668  2.204   1.00 0.00 ?  119 VAL C CB   1  
ATOM   7794   C  CG1  . VAL C  2 65  ? -40.125 31.575  1.414   1.00 0.00 ?  119 VAL C CG1  1  
ATOM   7795   C  CG2  . VAL C  2 65  ? -40.224 33.588  3.177   1.00 0.00 ?  119 VAL C CG2  1  
ATOM   7796   H  H    . VAL C  2 65  ? -42.905 31.785  0.569   1.00 0.00 ?  119 VAL C H    1  
ATOM   7797   H  HA   . VAL C  2 65  ? -42.045 34.431  1.508   1.00 0.00 ?  119 VAL C HA   1  
ATOM   7798   H  HB   . VAL C  2 65  ? -41.702 32.102  2.897   1.00 0.00 ?  119 VAL C HB   1  
ATOM   7799   H  HG11 . VAL C  2 65  ? -39.603 31.023  2.225   1.00 0.00 ?  119 VAL C HG11 1  
ATOM   7800   H  HG12 . VAL C  2 65  ? -39.279 31.973  0.814   1.00 0.00 ?  119 VAL C HG12 1  
ATOM   7801   H  HG13 . VAL C  2 65  ? -40.695 30.886  0.755   1.00 0.00 ?  119 VAL C HG13 1  
ATOM   7802   H  HG21 . VAL C  2 65  ? -39.372 34.134  2.718   1.00 0.00 ?  119 VAL C HG21 1  
ATOM   7803   H  HG22 . VAL C  2 65  ? -39.949 33.027  4.096   1.00 0.00 ?  119 VAL C HG22 1  
ATOM   7804   H  HG23 . VAL C  2 65  ? -40.759 34.426  3.673   1.00 0.00 ?  119 VAL C HG23 1  
ATOM   7805   N  N    . GLU C  2 66  ? -40.841 33.318  -1.169  1.00 0.00 ?  120 GLU C N    1  
ATOM   7806   C  CA   . GLU C  2 66  ? -40.101 33.678  -2.351  1.00 0.00 ?  120 GLU C CA   1  
ATOM   7807   C  C    . GLU C  2 66  ? -39.898 35.179  -2.599  1.00 0.00 ?  120 GLU C C    1  
ATOM   7808   O  O    . GLU C  2 66  ? -38.748 35.499  -2.934  1.00 0.00 ?  120 GLU C O    1  
ATOM   7809   C  CB   . GLU C  2 66  ? -40.635 32.974  -3.649  1.00 0.00 ?  120 GLU C CB   1  
ATOM   7810   C  CG   . GLU C  2 66  ? -40.332 33.742  -4.909  1.00 0.00 ?  120 GLU C CG   1  
ATOM   7811   C  CD   . GLU C  2 66  ? -40.900 33.100  -6.205  1.00 0.00 ?  120 GLU C CD   1  
ATOM   7812   O  OE1  . GLU C  2 66  ? -41.708 32.107  -6.050  1.00 0.00 ?  120 GLU C OE1  1  
ATOM   7813   O  OE2  . GLU C  2 66  ? -40.490 33.469  -7.329  1.00 0.00 -1 120 GLU C OE2  1  
ATOM   7814   H  H    . GLU C  2 66  ? -41.470 32.587  -1.420  1.00 0.00 ?  120 GLU C H    1  
ATOM   7815   H  HA   . GLU C  2 66  ? -39.083 33.470  -2.055  1.00 0.00 ?  120 GLU C HA   1  
ATOM   7816   H  HB2  . GLU C  2 66  ? -40.201 31.951  -3.639  1.00 0.00 ?  120 GLU C HB2  1  
ATOM   7817   H  HB3  . GLU C  2 66  ? -41.717 32.742  -3.550  1.00 0.00 ?  120 GLU C HB3  1  
ATOM   7818   H  HG2  . GLU C  2 66  ? -40.807 34.746  -4.875  1.00 0.00 ?  120 GLU C HG2  1  
ATOM   7819   H  HG3  . GLU C  2 66  ? -39.234 33.810  -5.067  1.00 0.00 ?  120 GLU C HG3  1  
ATOM   7820   N  N    . PRO C  2 67  ? -40.749 36.203  -2.410  1.00 0.00 ?  121 PRO C N    1  
ATOM   7821   C  CA   . PRO C  2 67  ? -40.470 37.555  -2.592  1.00 0.00 ?  121 PRO C CA   1  
ATOM   7822   C  C    . PRO C  2 67  ? -39.490 38.097  -1.543  1.00 0.00 ?  121 PRO C C    1  
ATOM   7823   O  O    . PRO C  2 67  ? -38.675 38.912  -1.902  1.00 0.00 ?  121 PRO C O    1  
ATOM   7824   C  CB   . PRO C  2 67  ? -41.778 38.390  -2.538  1.00 0.00 ?  121 PRO C CB   1  
ATOM   7825   C  CG   . PRO C  2 67  ? -42.759 37.309  -3.158  1.00 0.00 ?  121 PRO C CG   1  
ATOM   7826   C  CD   . PRO C  2 67  ? -42.244 36.031  -2.490  1.00 0.00 ?  121 PRO C CD   1  
ATOM   7827   H  HA   . PRO C  2 67  ? -39.978 37.694  -3.543  1.00 0.00 ?  121 PRO C HA   1  
ATOM   7828   H  HB2  . PRO C  2 67  ? -42.053 38.619  -1.486  1.00 0.00 ?  121 PRO C HB2  1  
ATOM   7829   H  HB3  . PRO C  2 67  ? -41.521 39.290  -3.136  1.00 0.00 ?  121 PRO C HB3  1  
ATOM   7830   H  HG2  . PRO C  2 67  ? -43.818 37.537  -2.912  1.00 0.00 ?  121 PRO C HG2  1  
ATOM   7831   H  HG3  . PRO C  2 67  ? -42.639 37.165  -4.253  1.00 0.00 ?  121 PRO C HG3  1  
ATOM   7832   H  HD2  . PRO C  2 67  ? -42.495 35.971  -1.409  1.00 0.00 ?  121 PRO C HD2  1  
ATOM   7833   H  HD3  . PRO C  2 67  ? -42.533 35.165  -3.122  1.00 0.00 ?  121 PRO C HD3  1  
ATOM   7834   N  N    . TYR C  2 68  ? -39.654 37.691  -0.278  1.00 0.00 ?  122 TYR C N    1  
ATOM   7835   C  CA   . TYR C  2 68  ? -38.849 38.015  0.857   1.00 0.00 ?  122 TYR C CA   1  
ATOM   7836   C  C    . TYR C  2 68  ? -37.456 37.396  0.726   1.00 0.00 ?  122 TYR C C    1  
ATOM   7837   O  O    . TYR C  2 68  ? -36.396 37.941  1.014   1.00 0.00 ?  122 TYR C O    1  
ATOM   7838   C  CB   . TYR C  2 68  ? -39.627 37.613  2.150   1.00 0.00 ?  122 TYR C CB   1  
ATOM   7839   C  CG   . TYR C  2 68  ? -38.942 37.996  3.432   1.00 0.00 ?  122 TYR C CG   1  
ATOM   7840   C  CD1  . TYR C  2 68  ? -39.192 37.157  4.570   1.00 0.00 ?  122 TYR C CD1  1  
ATOM   7841   C  CD2  . TYR C  2 68  ? -38.129 39.091  3.572   1.00 0.00 ?  122 TYR C CD2  1  
ATOM   7842   C  CE1  . TYR C  2 68  ? -38.529 37.442  5.766   1.00 0.00 ?  122 TYR C CE1  1  
ATOM   7843   C  CE2  . TYR C  2 68  ? -37.491 39.394  4.789   1.00 0.00 ?  122 TYR C CE2  1  
ATOM   7844   C  CZ   . TYR C  2 68  ? -37.734 38.630  5.921   1.00 0.00 ?  122 TYR C CZ   1  
ATOM   7845   O  OH   . TYR C  2 68  ? -37.190 39.023  7.138   1.00 0.00 ?  122 TYR C OH   1  
ATOM   7846   H  H    . TYR C  2 68  ? -40.296 36.947  -0.110  1.00 0.00 ?  122 TYR C H    1  
ATOM   7847   H  HA   . TYR C  2 68  ? -38.623 39.068  0.934   1.00 0.00 ?  122 TYR C HA   1  
ATOM   7848   H  HB2  . TYR C  2 68  ? -40.621 38.104  2.212   1.00 0.00 ?  122 TYR C HB2  1  
ATOM   7849   H  HB3  . TYR C  2 68  ? -39.859 36.528  2.104   1.00 0.00 ?  122 TYR C HB3  1  
ATOM   7850   H  HD1  . TYR C  2 68  ? -39.895 36.339  4.517   1.00 0.00 ?  122 TYR C HD1  1  
ATOM   7851   H  HD2  . TYR C  2 68  ? -37.930 39.712  2.711   1.00 0.00 ?  122 TYR C HD2  1  
ATOM   7852   H  HE1  . TYR C  2 68  ? -38.761 36.790  6.594   1.00 0.00 ?  122 TYR C HE1  1  
ATOM   7853   H  HE2  . TYR C  2 68  ? -36.884 40.287  4.784   1.00 0.00 ?  122 TYR C HE2  1  
ATOM   7854   H  HH   . TYR C  2 68  ? -36.635 39.787  6.963   1.00 0.00 ?  122 TYR C HH   1  
ATOM   7855   N  N    . LEU C  2 69  ? -37.316 36.170  0.236   1.00 0.00 ?  123 LEU C N    1  
ATOM   7856   C  CA   . LEU C  2 69  ? -36.041 35.538  -0.021  1.00 0.00 ?  123 LEU C CA   1  
ATOM   7857   C  C    . LEU C  2 69  ? -35.344 36.121  -1.232  1.00 0.00 ?  123 LEU C C    1  
ATOM   7858   O  O    . LEU C  2 69  ? -34.113 36.293  -1.253  1.00 0.00 ?  123 LEU C O    1  
ATOM   7859   C  CB   . LEU C  2 69  ? -36.299 34.020  -0.097  1.00 0.00 ?  123 LEU C CB   1  
ATOM   7860   C  CG   . LEU C  2 69  ? -35.140 33.138  -0.173  1.00 0.00 ?  123 LEU C CG   1  
ATOM   7861   C  CD1  . LEU C  2 69  ? -34.165 33.258  0.962   1.00 0.00 ?  123 LEU C CD1  1  
ATOM   7862   C  CD2  . LEU C  2 69  ? -35.631 31.697  -0.303  1.00 0.00 ?  123 LEU C CD2  1  
ATOM   7863   H  H    . LEU C  2 69  ? -38.095 35.560  0.112   1.00 0.00 ?  123 LEU C H    1  
ATOM   7864   H  HA   . LEU C  2 69  ? -35.407 35.618  0.850   1.00 0.00 ?  123 LEU C HA   1  
ATOM   7865   H  HB2  . LEU C  2 69  ? -36.760 33.737  0.874   1.00 0.00 ?  123 LEU C HB2  1  
ATOM   7866   H  HB3  . LEU C  2 69  ? -36.981 33.782  -0.941  1.00 0.00 ?  123 LEU C HB3  1  
ATOM   7867   H  HG   . LEU C  2 69  ? -34.574 33.374  -1.100  1.00 0.00 ?  123 LEU C HG   1  
ATOM   7868   H  HD11 . LEU C  2 69  ? -34.609 33.071  1.963   1.00 0.00 ?  123 LEU C HD11 1  
ATOM   7869   H  HD12 . LEU C  2 69  ? -33.674 34.255  0.962   1.00 0.00 ?  123 LEU C HD12 1  
ATOM   7870   H  HD13 . LEU C  2 69  ? -33.355 32.508  0.841   1.00 0.00 ?  123 LEU C HD13 1  
ATOM   7871   H  HD21 . LEU C  2 69  ? -36.482 31.544  0.394   1.00 0.00 ?  123 LEU C HD21 1  
ATOM   7872   H  HD22 . LEU C  2 69  ? -34.953 30.837  -0.113  1.00 0.00 ?  123 LEU C HD22 1  
ATOM   7873   H  HD23 . LEU C  2 69  ? -36.024 31.545  -1.331  1.00 0.00 ?  123 LEU C HD23 1  
ATOM   7874   N  N    . ASP C  2 70  ? -36.101 36.574  -2.248  1.00 0.00 ?  124 ASP C N    1  
ATOM   7875   C  CA   . ASP C  2 70  ? -35.548 37.435  -3.396  1.00 0.00 ?  124 ASP C CA   1  
ATOM   7876   C  C    . ASP C  2 70  ? -35.122 38.794  -2.889  1.00 0.00 ?  124 ASP C C    1  
ATOM   7877   O  O    . ASP C  2 70  ? -34.022 39.257  -3.300  1.00 0.00 ?  124 ASP C O    1  
ATOM   7878   C  CB   . ASP C  2 70  ? -36.530 37.442  -4.566  1.00 0.00 ?  124 ASP C CB   1  
ATOM   7879   C  CG   . ASP C  2 70  ? -36.382 36.227  -5.481  1.00 0.00 ?  124 ASP C CG   1  
ATOM   7880   O  OD1  . ASP C  2 70  ? -37.073 36.213  -6.546  1.00 0.00 ?  124 ASP C OD1  1  
ATOM   7881   O  OD2  . ASP C  2 70  ? -35.606 35.276  -5.163  1.00 0.00 -1 124 ASP C OD2  1  
ATOM   7882   H  H    . ASP C  2 70  ? -37.095 36.495  -2.269  1.00 0.00 ?  124 ASP C H    1  
ATOM   7883   H  HA   . ASP C  2 70  ? -34.569 37.020  -3.588  1.00 0.00 ?  124 ASP C HA   1  
ATOM   7884   H  HB2  . ASP C  2 70  ? -37.613 37.552  -4.346  1.00 0.00 ?  124 ASP C HB2  1  
ATOM   7885   H  HB3  . ASP C  2 70  ? -36.301 38.214  -5.331  1.00 0.00 ?  124 ASP C HB3  1  
ATOM   7886   N  N    . ASP C  2 71  ? -35.936 39.509  -2.064  1.00 0.00 ?  125 ASP C N    1  
ATOM   7887   C  CA   . ASP C  2 71  ? -35.474 40.758  -1.425  1.00 0.00 ?  125 ASP C CA   1  
ATOM   7888   C  C    . ASP C  2 71  ? -34.194 40.609  -0.607  1.00 0.00 ?  125 ASP C C    1  
ATOM   7889   O  O    . ASP C  2 71  ? -33.311 41.459  -0.588  1.00 0.00 ?  125 ASP C O    1  
ATOM   7890   C  CB   . ASP C  2 71  ? -36.699 41.348  -0.614  1.00 0.00 ?  125 ASP C CB   1  
ATOM   7891   C  CG   . ASP C  2 71  ? -36.440 42.778  -0.189  1.00 0.00 ?  125 ASP C CG   1  
ATOM   7892   O  OD1  . ASP C  2 71  ? -37.012 43.268  0.808   1.00 0.00 ?  125 ASP C OD1  1  
ATOM   7893   O  OD2  . ASP C  2 71  ? -35.713 43.500  -0.907  1.00 0.00 -1 125 ASP C OD2  1  
ATOM   7894   H  H    . ASP C  2 71  ? -36.826 39.189  -1.749  1.00 0.00 ?  125 ASP C H    1  
ATOM   7895   H  HA   . ASP C  2 71  ? -35.281 41.395  -2.276  1.00 0.00 ?  125 ASP C HA   1  
ATOM   7896   H  HB2  . ASP C  2 71  ? -37.605 41.297  -1.255  1.00 0.00 ?  125 ASP C HB2  1  
ATOM   7897   H  HB3  . ASP C  2 71  ? -36.829 40.792  0.339   1.00 0.00 ?  125 ASP C HB3  1  
ATOM   7898   N  N    . PHE C  2 72  ? -34.095 39.522  0.213   1.00 0.00 ?  126 PHE C N    1  
ATOM   7899   C  CA   . PHE C  2 72  ? -32.866 39.246  0.933   1.00 0.00 ?  126 PHE C CA   1  
ATOM   7900   C  C    . PHE C  2 72  ? -31.656 39.072  -0.007  1.00 0.00 ?  126 PHE C C    1  
ATOM   7901   O  O    . PHE C  2 72  ? -30.593 39.724  0.153   1.00 0.00 ?  126 PHE C O    1  
ATOM   7902   C  CB   . PHE C  2 72  ? -33.157 37.967  1.885   1.00 0.00 ?  126 PHE C CB   1  
ATOM   7903   C  CG   . PHE C  2 72  ? -31.823 37.685  2.606   1.00 0.00 ?  126 PHE C CG   1  
ATOM   7904   C  CD1  . PHE C  2 72  ? -31.538 38.376  3.739   1.00 0.00 ?  126 PHE C CD1  1  
ATOM   7905   C  CD2  . PHE C  2 72  ? -30.937 36.719  2.142   1.00 0.00 ?  126 PHE C CD2  1  
ATOM   7906   C  CE1  . PHE C  2 72  ? -30.360 38.058  4.466   1.00 0.00 ?  126 PHE C CE1  1  
ATOM   7907   C  CE2  . PHE C  2 72  ? -29.731 36.449  2.774   1.00 0.00 ?  126 PHE C CE2  1  
ATOM   7908   C  CZ   . PHE C  2 72  ? -29.468 37.144  3.968   1.00 0.00 ?  126 PHE C CZ   1  
ATOM   7909   H  H    . PHE C  2 72  ? -34.815 38.844  0.338   1.00 0.00 ?  126 PHE C H    1  
ATOM   7910   H  HA   . PHE C  2 72  ? -32.529 40.027  1.598   1.00 0.00 ?  126 PHE C HA   1  
ATOM   7911   H  HB2  . PHE C  2 72  ? -33.966 38.094  2.635   1.00 0.00 ?  126 PHE C HB2  1  
ATOM   7912   H  HB3  . PHE C  2 72  ? -33.463 37.165  1.180   1.00 0.00 ?  126 PHE C HB3  1  
ATOM   7913   H  HD1  . PHE C  2 72  ? -32.154 39.069  4.294   1.00 0.00 ?  126 PHE C HD1  1  
ATOM   7914   H  HD2  . PHE C  2 72  ? -31.051 36.294  1.156   1.00 0.00 ?  126 PHE C HD2  1  
ATOM   7915   H  HE1  . PHE C  2 72  ? -30.031 38.611  5.333   1.00 0.00 ?  126 PHE C HE1  1  
ATOM   7916   H  HE2  . PHE C  2 72  ? -28.991 35.718  2.482   1.00 0.00 ?  126 PHE C HE2  1  
ATOM   7917   H  HZ   . PHE C  2 72  ? -28.607 36.887  4.567   1.00 0.00 ?  126 PHE C HZ   1  
ATOM   7918   N  N    . GLN C  2 73  ? -31.705 38.213  -1.012  1.00 0.00 ?  127 GLN C N    1  
ATOM   7919   C  CA   . GLN C  2 73  ? -30.675 38.002  -2.002  1.00 0.00 ?  127 GLN C CA   1  
ATOM   7920   C  C    . GLN C  2 73  ? -30.367 39.262  -2.804  1.00 0.00 ?  127 GLN C C    1  
ATOM   7921   O  O    . GLN C  2 73  ? -29.231 39.587  -3.048  1.00 0.00 ?  127 GLN C O    1  
ATOM   7922   C  CB   . GLN C  2 73  ? -31.301 37.037  -3.029  1.00 0.00 ?  127 GLN C CB   1  
ATOM   7923   C  CG   . GLN C  2 73  ? -30.292 36.402  -4.016  1.00 0.00 ?  127 GLN C CG   1  
ATOM   7924   C  CD   . GLN C  2 73  ? -29.191 35.675  -3.306  1.00 0.00 ?  127 GLN C CD   1  
ATOM   7925   O  OE1  . GLN C  2 73  ? -28.069 35.991  -3.574  1.00 0.00 ?  127 GLN C OE1  1  
ATOM   7926   N  NE2  . GLN C  2 73  ? -29.522 34.513  -2.596  1.00 0.00 ?  127 GLN C NE2  1  
ATOM   7927   H  H    . GLN C  2 73  ? -32.571 37.748  -1.184  1.00 0.00 ?  127 GLN C H    1  
ATOM   7928   H  HA   . GLN C  2 73  ? -29.802 37.823  -1.392  1.00 0.00 ?  127 GLN C HA   1  
ATOM   7929   H  HB2  . GLN C  2 73  ? -31.713 36.196  -2.432  1.00 0.00 ?  127 GLN C HB2  1  
ATOM   7930   H  HB3  . GLN C  2 73  ? -32.179 37.321  -3.647  1.00 0.00 ?  127 GLN C HB3  1  
ATOM   7931   H  HG2  . GLN C  2 73  ? -30.822 35.663  -4.654  1.00 0.00 ?  127 GLN C HG2  1  
ATOM   7932   H  HG3  . GLN C  2 73  ? -29.916 37.191  -4.703  1.00 0.00 ?  127 GLN C HG3  1  
ATOM   7933   H  HE21 . GLN C  2 73  ? -28.714 33.987  -2.329  1.00 0.00 ?  127 GLN C HE21 1  
ATOM   7934   H  HE22 . GLN C  2 73  ? -30.450 34.165  -2.465  1.00 0.00 ?  127 GLN C HE22 1  
ATOM   7935   N  N    . LYS C  2 74  ? -31.350 40.027  -3.263  1.00 0.00 ?  128 LYS C N    1  
ATOM   7936   C  CA   . LYS C  2 74  ? -31.094 41.245  -3.999  1.00 0.00 ?  128 LYS C CA   1  
ATOM   7937   C  C    . LYS C  2 74  ? -30.382 42.341  -3.232  1.00 0.00 ?  128 LYS C C    1  
ATOM   7938   O  O    . LYS C  2 74  ? -29.429 42.998  -3.730  1.00 0.00 ?  128 LYS C O    1  
ATOM   7939   C  CB   . LYS C  2 74  ? -32.343 41.706  -4.751  1.00 0.00 ?  128 LYS C CB   1  
ATOM   7940   C  CG   . LYS C  2 74  ? -32.178 42.989  -5.555  1.00 0.00 ?  128 LYS C CG   1  
ATOM   7941   C  CD   . LYS C  2 74  ? -33.271 42.916  -6.705  1.00 0.00 ?  128 LYS C CD   1  
ATOM   7942   C  CE   . LYS C  2 74  ? -34.720 43.038  -6.241  1.00 0.00 ?  128 LYS C CE   1  
ATOM   7943   N  NZ   . LYS C  2 74  ? -34.949 44.219  -5.332  1.00 0.00 1  128 LYS C NZ   1  
ATOM   7944   H  H    . LYS C  2 74  ? -32.284 39.702  -3.136  1.00 0.00 ?  128 LYS C H    1  
ATOM   7945   H  HA   . LYS C  2 74  ? -30.594 41.016  -4.928  1.00 0.00 ?  128 LYS C HA   1  
ATOM   7946   H  HB2  . LYS C  2 74  ? -32.619 40.851  -5.405  1.00 0.00 ?  128 LYS C HB2  1  
ATOM   7947   H  HB3  . LYS C  2 74  ? -33.216 41.915  -4.097  1.00 0.00 ?  128 LYS C HB3  1  
ATOM   7948   H  HG2  . LYS C  2 74  ? -32.364 43.890  -4.931  1.00 0.00 ?  128 LYS C HG2  1  
ATOM   7949   H  HG3  . LYS C  2 74  ? -31.203 43.132  -6.068  1.00 0.00 ?  128 LYS C HG3  1  
ATOM   7950   H  HD2  . LYS C  2 74  ? -33.031 43.826  -7.297  1.00 0.00 ?  128 LYS C HD2  1  
ATOM   7951   H  HD3  . LYS C  2 74  ? -33.067 42.015  -7.322  1.00 0.00 ?  128 LYS C HD3  1  
ATOM   7952   H  HE2  . LYS C  2 74  ? -35.460 43.097  -7.067  1.00 0.00 ?  128 LYS C HE2  1  
ATOM   7953   H  HE3  . LYS C  2 74  ? -34.952 42.173  -5.583  1.00 0.00 ?  128 LYS C HE3  1  
ATOM   7954   H  HZ1  . LYS C  2 74  ? -35.917 44.537  -5.545  1.00 0.00 ?  128 LYS C HZ1  1  
ATOM   7955   H  HZ2  . LYS C  2 74  ? -34.328 45.040  -5.480  1.00 0.00 ?  128 LYS C HZ2  1  
ATOM   7956   H  HZ3  . LYS C  2 74  ? -34.746 43.986  -4.340  1.00 0.00 ?  128 LYS C HZ3  1  
ATOM   7957   N  N    . LYS C  2 75  ? -30.648 42.473  -1.899  1.00 0.00 ?  129 LYS C N    1  
ATOM   7958   C  CA   . LYS C  2 75  ? -29.886 43.245  -1.031  1.00 0.00 ?  129 LYS C CA   1  
ATOM   7959   C  C    . LYS C  2 75  ? -28.491 42.729  -0.760  1.00 0.00 ?  129 LYS C C    1  
ATOM   7960   O  O    . LYS C  2 75  ? -27.563 43.570  -0.784  1.00 0.00 ?  129 LYS C O    1  
ATOM   7961   C  CB   . LYS C  2 75  ? -30.612 43.492  0.300   1.00 0.00 ?  129 LYS C CB   1  
ATOM   7962   C  CG   . LYS C  2 75  ? -30.113 44.491  1.372   1.00 0.00 ?  129 LYS C CG   1  
ATOM   7963   C  CD   . LYS C  2 75  ? -29.742 45.835  0.756   1.00 0.00 ?  129 LYS C CD   1  
ATOM   7964   C  CE   . LYS C  2 75  ? -29.136 46.716  1.807   1.00 0.00 ?  129 LYS C CE   1  
ATOM   7965   N  NZ   . LYS C  2 75  ? -28.728 47.965  1.122   1.00 0.00 1  129 LYS C NZ   1  
ATOM   7966   H  H    . LYS C  2 75  ? -31.386 41.954  -1.475  1.00 0.00 ?  129 LYS C H    1  
ATOM   7967   H  HA   . LYS C  2 75  ? -29.719 44.187  -1.532  1.00 0.00 ?  129 LYS C HA   1  
ATOM   7968   H  HB2  . LYS C  2 75  ? -31.590 43.970  0.080   1.00 0.00 ?  129 LYS C HB2  1  
ATOM   7969   H  HB3  . LYS C  2 75  ? -30.745 42.517  0.815   1.00 0.00 ?  129 LYS C HB3  1  
ATOM   7970   H  HG2  . LYS C  2 75  ? -30.868 44.635  2.174   1.00 0.00 ?  129 LYS C HG2  1  
ATOM   7971   H  HG3  . LYS C  2 75  ? -29.159 44.095  1.782   1.00 0.00 ?  129 LYS C HG3  1  
ATOM   7972   H  HD2  . LYS C  2 75  ? -29.026 45.721  -0.085  1.00 0.00 ?  129 LYS C HD2  1  
ATOM   7973   H  HD3  . LYS C  2 75  ? -30.663 46.268  0.309   1.00 0.00 ?  129 LYS C HD3  1  
ATOM   7974   H  HE2  . LYS C  2 75  ? -29.825 47.073  2.602   1.00 0.00 ?  129 LYS C HE2  1  
ATOM   7975   H  HE3  . LYS C  2 75  ? -28.205 46.434  2.343   1.00 0.00 ?  129 LYS C HE3  1  
ATOM   7976   H  HZ1  . LYS C  2 75  ? -29.237 48.806  1.462   1.00 0.00 ?  129 LYS C HZ1  1  
ATOM   7977   H  HZ2  . LYS C  2 75  ? -29.093 47.962  0.149   1.00 0.00 ?  129 LYS C HZ2  1  
ATOM   7978   H  HZ3  . LYS C  2 75  ? -27.712 48.182  1.071   1.00 0.00 ?  129 LYS C HZ3  1  
ATOM   7979   N  N    . TRP C  2 76  ? -28.238 41.413  -0.673  1.00 0.00 ?  130 TRP C N    1  
ATOM   7980   C  CA   . TRP C  2 76  ? -26.893 40.869  -0.647  1.00 0.00 ?  130 TRP C CA   1  
ATOM   7981   C  C    . TRP C  2 76  ? -26.003 41.234  -1.860  1.00 0.00 ?  130 TRP C C    1  
ATOM   7982   O  O    . TRP C  2 76  ? -24.925 41.786  -1.735  1.00 0.00 ?  130 TRP C O    1  
ATOM   7983   C  CB   . TRP C  2 76  ? -26.903 39.357  -0.349  1.00 0.00 ?  130 TRP C CB   1  
ATOM   7984   C  CG   . TRP C  2 76  ? -25.622 38.524  -0.454  1.00 0.00 ?  130 TRP C CG   1  
ATOM   7985   C  CD1  . TRP C  2 76  ? -25.392 37.532  -1.340  1.00 0.00 ?  130 TRP C CD1  1  
ATOM   7986   C  CD2  . TRP C  2 76  ? -24.378 38.731  0.211   1.00 0.00 ?  130 TRP C CD2  1  
ATOM   7987   N  NE1  . TRP C  2 76  ? -24.073 37.083  -1.226  1.00 0.00 ?  130 TRP C NE1  1  
ATOM   7988   C  CE2  . TRP C  2 76  ? -23.475 37.790  -0.262  1.00 0.00 ?  130 TRP C CE2  1  
ATOM   7989   C  CE3  . TRP C  2 76  ? -23.985 39.686  1.156   1.00 0.00 ?  130 TRP C CE3  1  
ATOM   7990   C  CZ2  . TRP C  2 76  ? -22.242 37.642  0.266   1.00 0.00 ?  130 TRP C CZ2  1  
ATOM   7991   C  CZ3  . TRP C  2 76  ? -22.717 39.572  1.659   1.00 0.00 ?  130 TRP C CZ3  1  
ATOM   7992   C  CH2  . TRP C  2 76  ? -21.801 38.608  1.221   1.00 0.00 ?  130 TRP C CH2  1  
ATOM   7993   H  H    . TRP C  2 76  ? -28.933 40.698  -0.698  1.00 0.00 ?  130 TRP C H    1  
ATOM   7994   H  HA   . TRP C  2 76  ? -26.381 41.235  0.231   1.00 0.00 ?  130 TRP C HA   1  
ATOM   7995   H  HB2  . TRP C  2 76  ? -27.358 39.206  0.653   1.00 0.00 ?  130 TRP C HB2  1  
ATOM   7996   H  HB3  . TRP C  2 76  ? -27.665 38.919  -1.029  1.00 0.00 ?  130 TRP C HB3  1  
ATOM   7997   H  HD1  . TRP C  2 76  ? -26.166 37.016  -1.889  1.00 0.00 ?  130 TRP C HD1  1  
ATOM   7998   H  HE1  . TRP C  2 76  ? -23.501 36.549  -1.809  1.00 0.00 ?  130 TRP C HE1  1  
ATOM   7999   H  HE3  . TRP C  2 76  ? -24.744 40.399  1.441   1.00 0.00 ?  130 TRP C HE3  1  
ATOM   8000   H  HZ2  . TRP C  2 76  ? -21.537 36.874  -0.017  1.00 0.00 ?  130 TRP C HZ2  1  
ATOM   8001   H  HZ3  . TRP C  2 76  ? -22.478 40.200  2.504   1.00 0.00 ?  130 TRP C HZ3  1  
ATOM   8002   H  HH2  . TRP C  2 76  ? -20.843 38.596  1.719   1.00 0.00 ?  130 TRP C HH2  1  
ATOM   8003   N  N    . GLN C  2 77  ? -26.569 41.085  -3.066  1.00 0.00 ?  131 GLN C N    1  
ATOM   8004   C  CA   . GLN C  2 77  ? -26.086 41.459  -4.369  1.00 0.00 ?  131 GLN C CA   1  
ATOM   8005   C  C    . GLN C  2 77  ? -25.737 42.899  -4.599  1.00 0.00 ?  131 GLN C C    1  
ATOM   8006   O  O    . GLN C  2 77  ? -24.735 43.216  -5.248  1.00 0.00 ?  131 GLN C O    1  
ATOM   8007   C  CB   . GLN C  2 77  ? -27.053 41.006  -5.442  1.00 0.00 ?  131 GLN C CB   1  
ATOM   8008   C  CG   . GLN C  2 77  ? -27.091 39.475  -5.508  1.00 0.00 ?  131 GLN C CG   1  
ATOM   8009   C  CD   . GLN C  2 77  ? -28.256 39.121  -6.502  1.00 0.00 ?  131 GLN C CD   1  
ATOM   8010   O  OE1  . GLN C  2 77  ? -29.096 39.913  -6.863  1.00 0.00 ?  131 GLN C OE1  1  
ATOM   8011   N  NE2  . GLN C  2 77  ? -28.342 37.762  -6.760  1.00 0.00 ?  131 GLN C NE2  1  
ATOM   8012   H  H    . GLN C  2 77  ? -27.375 40.499  -3.044  1.00 0.00 ?  131 GLN C H    1  
ATOM   8013   H  HA   . GLN C  2 77  ? -25.178 40.894  -4.521  1.00 0.00 ?  131 GLN C HA   1  
ATOM   8014   H  HB2  . GLN C  2 77  ? -28.013 41.544  -5.293  1.00 0.00 ?  131 GLN C HB2  1  
ATOM   8015   H  HB3  . GLN C  2 77  ? -26.746 41.376  -6.443  1.00 0.00 ?  131 GLN C HB3  1  
ATOM   8016   H  HG2  . GLN C  2 77  ? -26.100 39.081  -5.819  1.00 0.00 ?  131 GLN C HG2  1  
ATOM   8017   H  HG3  . GLN C  2 77  ? -27.393 39.100  -4.506  1.00 0.00 ?  131 GLN C HG3  1  
ATOM   8018   H  HE21 . GLN C  2 77  ? -29.215 37.407  -7.093  1.00 0.00 ?  131 GLN C HE21 1  
ATOM   8019   H  HE22 . GLN C  2 77  ? -27.573 37.134  -6.638  1.00 0.00 ?  131 GLN C HE22 1  
ATOM   8020   N  N    . GLU C  2 78  ? -26.552 43.804  -3.989  1.00 0.00 ?  132 GLU C N    1  
ATOM   8021   C  CA   . GLU C  2 78  ? -26.475 45.257  -3.926  1.00 0.00 ?  132 GLU C CA   1  
ATOM   8022   C  C    . GLU C  2 78  ? -25.248 45.739  -3.237  1.00 0.00 ?  132 GLU C C    1  
ATOM   8023   O  O    . GLU C  2 78  ? -24.551 46.572  -3.791  1.00 0.00 ?  132 GLU C O    1  
ATOM   8024   C  CB   . GLU C  2 78  ? -27.815 45.782  -3.383  1.00 0.00 ?  132 GLU C CB   1  
ATOM   8025   C  CG   . GLU C  2 78  ? -27.841 47.344  -2.997  1.00 0.00 ?  132 GLU C CG   1  
ATOM   8026   C  CD   . GLU C  2 78  ? -29.197 47.819  -2.608  1.00 0.00 ?  132 GLU C CD   1  
ATOM   8027   O  OE1  . GLU C  2 78  ? -30.144 47.937  -3.413  1.00 0.00 ?  132 GLU C OE1  1  
ATOM   8028   O  OE2  . GLU C  2 78  ? -29.283 48.225  -1.416  1.00 0.00 -1 132 GLU C OE2  1  
ATOM   8029   H  H    . GLU C  2 78  ? -27.449 43.538  -3.646  1.00 0.00 ?  132 GLU C H    1  
ATOM   8030   H  HA   . GLU C  2 78  ? -26.291 45.680  -4.902  1.00 0.00 ?  132 GLU C HA   1  
ATOM   8031   H  HB2  . GLU C  2 78  ? -28.635 45.599  -4.109  1.00 0.00 ?  132 GLU C HB2  1  
ATOM   8032   H  HB3  . GLU C  2 78  ? -28.095 45.210  -2.473  1.00 0.00 ?  132 GLU C HB3  1  
ATOM   8033   H  HG2  . GLU C  2 78  ? -27.074 47.487  -2.207  1.00 0.00 ?  132 GLU C HG2  1  
ATOM   8034   H  HG3  . GLU C  2 78  ? -27.635 48.012  -3.861  1.00 0.00 ?  132 GLU C HG3  1  
ATOM   8035   N  N    . GLU C  2 79  ? -24.991 45.124  -1.994  1.00 0.00 ?  133 GLU C N    1  
ATOM   8036   C  CA   . GLU C  2 79  ? -23.800 45.452  -1.324  1.00 0.00 ?  133 GLU C CA   1  
ATOM   8037   C  C    . GLU C  2 79  ? -22.552 44.730  -1.837  1.00 0.00 ?  133 GLU C C    1  
ATOM   8038   O  O    . GLU C  2 79  ? -21.488 45.271  -1.844  1.00 0.00 ?  133 GLU C O    1  
ATOM   8039   C  CB   . GLU C  2 79  ? -24.012 45.295  0.185   1.00 0.00 ?  133 GLU C CB   1  
ATOM   8040   C  CG   . GLU C  2 79  ? -25.306 46.142  0.697   1.00 0.00 ?  133 GLU C CG   1  
ATOM   8041   C  CD   . GLU C  2 79  ? -25.216 47.698  0.449   1.00 0.00 ?  133 GLU C CD   1  
ATOM   8042   O  OE1  . GLU C  2 79  ? -24.291 48.133  -0.225  1.00 0.00 ?  133 GLU C OE1  1  
ATOM   8043   O  OE2  . GLU C  2 79  ? -26.128 48.430  0.886   1.00 0.00 -1 133 GLU C OE2  1  
ATOM   8044   H  H    . GLU C  2 79  ? -25.596 44.491  -1.518  1.00 0.00 ?  133 GLU C H    1  
ATOM   8045   H  HA   . GLU C  2 79  ? -23.589 46.508  -1.417  1.00 0.00 ?  133 GLU C HA   1  
ATOM   8046   H  HB2  . GLU C  2 79  ? -24.263 44.236  0.410   1.00 0.00 ?  133 GLU C HB2  1  
ATOM   8047   H  HB3  . GLU C  2 79  ? -23.091 45.668  0.682   1.00 0.00 ?  133 GLU C HB3  1  
ATOM   8048   H  HG2  . GLU C  2 79  ? -26.189 45.816  0.107   1.00 0.00 ?  133 GLU C HG2  1  
ATOM   8049   H  HG3  . GLU C  2 79  ? -25.479 46.051  1.791   1.00 0.00 ?  133 GLU C HG3  1  
ATOM   8050   N  N    . MET C  2 80  ? -22.668 43.484  -2.375  1.00 0.00 ?  134 MET C N    1  
ATOM   8051   C  CA   . MET C  2 80  ? -21.573 42.754  -3.002  1.00 0.00 ?  134 MET C CA   1  
ATOM   8052   C  C    . MET C  2 80  ? -21.147 43.341  -4.340  1.00 0.00 ?  134 MET C C    1  
ATOM   8053   O  O    . MET C  2 80  ? -19.955 43.441  -4.585  1.00 0.00 ?  134 MET C O    1  
ATOM   8054   C  CB   . MET C  2 80  ? -22.102 41.327  -3.329  1.00 0.00 ?  134 MET C CB   1  
ATOM   8055   C  CG   . MET C  2 80  ? -21.223 40.485  -4.375  1.00 0.00 ?  134 MET C CG   1  
ATOM   8056   S  SD   . MET C  2 80  ? -19.454 40.206  -4.215  1.00 0.00 ?  134 MET C SD   1  
ATOM   8057   C  CE   . MET C  2 80  ? -19.347 39.717  -2.500  1.00 0.00 ?  134 MET C CE   1  
ATOM   8058   H  H    . MET C  2 80  ? -23.563 43.044  -2.380  1.00 0.00 ?  134 MET C H    1  
ATOM   8059   H  HA   . MET C  2 80  ? -20.760 42.765  -2.291  1.00 0.00 ?  134 MET C HA   1  
ATOM   8060   H  HB2  . MET C  2 80  ? -22.206 40.687  -2.426  1.00 0.00 ?  134 MET C HB2  1  
ATOM   8061   H  HB3  . MET C  2 80  ? -23.054 41.563  -3.850  1.00 0.00 ?  134 MET C HB3  1  
ATOM   8062   H  HG2  . MET C  2 80  ? -21.657 39.463  -4.358  1.00 0.00 ?  134 MET C HG2  1  
ATOM   8063   H  HG3  . MET C  2 80  ? -21.385 40.768  -5.437  1.00 0.00 ?  134 MET C HG3  1  
ATOM   8064   H  HE1  . MET C  2 80  ? -19.637 40.551  -1.826  1.00 0.00 ?  134 MET C HE1  1  
ATOM   8065   H  HE2  . MET C  2 80  ? -18.367 39.366  -2.110  1.00 0.00 ?  134 MET C HE2  1  
ATOM   8066   H  HE3  . MET C  2 80  ? -20.074 38.922  -2.230  1.00 0.00 ?  134 MET C HE3  1  
ATOM   8067   N  N    . GLU C  2 81  ? -22.065 43.826  -5.197  1.00 0.00 ?  135 GLU C N    1  
ATOM   8068   C  CA   . GLU C  2 81  ? -21.816 44.538  -6.421  1.00 0.00 ?  135 GLU C CA   1  
ATOM   8069   C  C    . GLU C  2 81  ? -21.003 45.788  -6.306  1.00 0.00 ?  135 GLU C C    1  
ATOM   8070   O  O    . GLU C  2 81  ? -20.079 46.040  -7.025  1.00 0.00 ?  135 GLU C O    1  
ATOM   8071   C  CB   . GLU C  2 81  ? -23.094 44.911  -7.242  1.00 0.00 ?  135 GLU C CB   1  
ATOM   8072   C  CG   . GLU C  2 81  ? -22.859 45.703  -8.560  1.00 0.00 ?  135 GLU C CG   1  
ATOM   8073   C  CD   . GLU C  2 81  ? -24.012 45.445  -9.532  1.00 0.00 ?  135 GLU C CD   1  
ATOM   8074   O  OE1  . GLU C  2 81  ? -24.890 46.291  -9.840  1.00 0.00 ?  135 GLU C OE1  1  
ATOM   8075   O  OE2  . GLU C  2 81  ? -24.019 44.285  -10.104 1.00 0.00 -1 135 GLU C OE2  1  
ATOM   8076   H  H    . GLU C  2 81  ? -22.960 43.414  -5.042  1.00 0.00 ?  135 GLU C H    1  
ATOM   8077   H  HA   . GLU C  2 81  ? -21.219 43.750  -6.855  1.00 0.00 ?  135 GLU C HA   1  
ATOM   8078   H  HB2  . GLU C  2 81  ? -23.499 43.898  -7.450  1.00 0.00 ?  135 GLU C HB2  1  
ATOM   8079   H  HB3  . GLU C  2 81  ? -23.838 45.451  -6.619  1.00 0.00 ?  135 GLU C HB3  1  
ATOM   8080   H  HG2  . GLU C  2 81  ? -22.734 46.801  -8.440  1.00 0.00 ?  135 GLU C HG2  1  
ATOM   8081   H  HG3  . GLU C  2 81  ? -21.928 45.378  -9.072  1.00 0.00 ?  135 GLU C HG3  1  
ATOM   8082   N  N    . LEU C  2 82  ? -21.309 46.641  -5.258  1.00 0.00 ?  136 LEU C N    1  
ATOM   8083   C  CA   . LEU C  2 82  ? -20.407 47.742  -4.836  1.00 0.00 ?  136 LEU C CA   1  
ATOM   8084   C  C    . LEU C  2 82  ? -18.985 47.238  -4.466  1.00 0.00 ?  136 LEU C C    1  
ATOM   8085   O  O    . LEU C  2 82  ? -17.938 47.790  -4.767  1.00 0.00 ?  136 LEU C O    1  
ATOM   8086   C  CB   . LEU C  2 82  ? -21.133 48.406  -3.643  1.00 0.00 ?  136 LEU C CB   1  
ATOM   8087   C  CG   . LEU C  2 82  ? -20.346 49.593  -3.043  1.00 0.00 ?  136 LEU C CG   1  
ATOM   8088   C  CD1  . LEU C  2 82  ? -19.988 50.668  -4.052  1.00 0.00 ?  136 LEU C CD1  1  
ATOM   8089   C  CD2  . LEU C  2 82  ? -21.148 50.194  -1.920  1.00 0.00 ?  136 LEU C CD2  1  
ATOM   8090   H  H    . LEU C  2 82  ? -22.151 46.481  -4.749  1.00 0.00 ?  136 LEU C H    1  
ATOM   8091   H  HA   . LEU C  2 82  ? -20.359 48.348  -5.729  1.00 0.00 ?  136 LEU C HA   1  
ATOM   8092   H  HB2  . LEU C  2 82  ? -22.110 48.874  -3.887  1.00 0.00 ?  136 LEU C HB2  1  
ATOM   8093   H  HB3  . LEU C  2 82  ? -21.372 47.587  -2.931  1.00 0.00 ?  136 LEU C HB3  1  
ATOM   8094   H  HG   . LEU C  2 82  ? -19.410 49.216  -2.578  1.00 0.00 ?  136 LEU C HG   1  
ATOM   8095   H  HD11 . LEU C  2 82  ? -20.818 51.020  -4.700  1.00 0.00 ?  136 LEU C HD11 1  
ATOM   8096   H  HD12 . LEU C  2 82  ? -19.413 50.055  -4.779  1.00 0.00 ?  136 LEU C HD12 1  
ATOM   8097   H  HD13 . LEU C  2 82  ? -19.321 51.459  -3.647  1.00 0.00 ?  136 LEU C HD13 1  
ATOM   8098   H  HD21 . LEU C  2 82  ? -21.353 49.378  -1.195  1.00 0.00 ?  136 LEU C HD21 1  
ATOM   8099   H  HD22 . LEU C  2 82  ? -22.119 50.541  -2.333  1.00 0.00 ?  136 LEU C HD22 1  
ATOM   8100   H  HD23 . LEU C  2 82  ? -20.645 51.070  -1.456  1.00 0.00 ?  136 LEU C HD23 1  
ATOM   8101   N  N    . TYR C  2 83  ? -18.965 46.086  -3.652  1.00 0.00 ?  137 TYR C N    1  
ATOM   8102   C  CA   . TYR C  2 83  ? -17.752 45.444  -3.086  1.00 0.00 ?  137 TYR C CA   1  
ATOM   8103   C  C    . TYR C  2 83  ? -16.922 45.042  -4.259  1.00 0.00 ?  137 TYR C C    1  
ATOM   8104   O  O    . TYR C  2 83  ? -15.777 45.456  -4.333  1.00 0.00 ?  137 TYR C O    1  
ATOM   8105   C  CB   . TYR C  2 83  ? -18.154 44.266  -2.214  1.00 0.00 ?  137 TYR C CB   1  
ATOM   8106   C  CG   . TYR C  2 83  ? -16.806 43.724  -1.605  1.00 0.00 ?  137 TYR C CG   1  
ATOM   8107   C  CD1  . TYR C  2 83  ? -16.039 44.457  -0.713  1.00 0.00 ?  137 TYR C CD1  1  
ATOM   8108   C  CD2  . TYR C  2 83  ? -16.333 42.447  -1.989  1.00 0.00 ?  137 TYR C CD2  1  
ATOM   8109   C  CE1  . TYR C  2 83  ? -14.943 43.868  -0.039  1.00 0.00 ?  137 TYR C CE1  1  
ATOM   8110   C  CE2  . TYR C  2 83  ? -15.114 41.938  -1.516  1.00 0.00 ?  137 TYR C CE2  1  
ATOM   8111   C  CZ   . TYR C  2 83  ? -14.408 42.628  -0.515  1.00 0.00 ?  137 TYR C CZ   1  
ATOM   8112   O  OH   . TYR C  2 83  ? -13.220 42.055  0.060   1.00 0.00 ?  137 TYR C OH   1  
ATOM   8113   H  H    . TYR C  2 83  ? -19.852 45.742  -3.353  1.00 0.00 ?  137 TYR C H    1  
ATOM   8114   H  HA   . TYR C  2 83  ? -17.277 46.246  -2.540  1.00 0.00 ?  137 TYR C HA   1  
ATOM   8115   H  HB2  . TYR C  2 83  ? -18.996 44.487  -1.523  1.00 0.00 ?  137 TYR C HB2  1  
ATOM   8116   H  HB3  . TYR C  2 83  ? -18.480 43.439  -2.882  1.00 0.00 ?  137 TYR C HB3  1  
ATOM   8117   H  HD1  . TYR C  2 83  ? -16.366 45.413  -0.331  1.00 0.00 ?  137 TYR C HD1  1  
ATOM   8118   H  HD2  . TYR C  2 83  ? -16.862 41.893  -2.751  1.00 0.00 ?  137 TYR C HD2  1  
ATOM   8119   H  HE1  . TYR C  2 83  ? -14.290 44.535  0.505   1.00 0.00 ?  137 TYR C HE1  1  
ATOM   8120   H  HE2  . TYR C  2 83  ? -14.717 40.990  -1.849  1.00 0.00 ?  137 TYR C HE2  1  
ATOM   8121   H  HH   . TYR C  2 83  ? -13.053 41.176  -0.288  1.00 0.00 ?  137 TYR C HH   1  
ATOM   8122   N  N    . ARG C  2 84  ? -17.429 44.456  -5.370  1.00 0.00 ?  138 ARG C N    1  
ATOM   8123   C  CA   . ARG C  2 84  ? -16.673 44.101  -6.582  1.00 0.00 ?  138 ARG C CA   1  
ATOM   8124   C  C    . ARG C  2 84  ? -16.069 45.253  -7.312  1.00 0.00 ?  138 ARG C C    1  
ATOM   8125   O  O    . ARG C  2 84  ? -14.880 45.223  -7.735  1.00 0.00 ?  138 ARG C O    1  
ATOM   8126   C  CB   . ARG C  2 84  ? -17.506 43.280  -7.544  1.00 0.00 ?  138 ARG C CB   1  
ATOM   8127   C  CG   . ARG C  2 84  ? -18.017 41.948  -6.995  1.00 0.00 ?  138 ARG C CG   1  
ATOM   8128   C  CD   . ARG C  2 84  ? -19.382 41.536  -7.552  1.00 0.00 ?  138 ARG C CD   1  
ATOM   8129   N  NE   . ARG C  2 84  ? -19.427 39.991  -7.753  1.00 0.00 ?  138 ARG C NE   1  
ATOM   8130   C  CZ   . ARG C  2 84  ? -20.569 39.409  -8.301  1.00 0.00 ?  138 ARG C CZ   1  
ATOM   8131   N  NH1  . ARG C  2 84  ? -20.569 38.125  -8.242  1.00 0.00 1  138 ARG C NH1  1  
ATOM   8132   N  NH2  . ARG C  2 84  ? -21.572 40.129  -8.600  1.00 0.00 ?  138 ARG C NH2  1  
ATOM   8133   H  H    . ARG C  2 84  ? -18.379 44.165  -5.278  1.00 0.00 ?  138 ARG C H    1  
ATOM   8134   H  HA   . ARG C  2 84  ? -15.790 43.532  -6.329  1.00 0.00 ?  138 ARG C HA   1  
ATOM   8135   H  HB2  . ARG C  2 84  ? -18.489 43.798  -7.560  1.00 0.00 ?  138 ARG C HB2  1  
ATOM   8136   H  HB3  . ARG C  2 84  ? -17.044 43.140  -8.545  1.00 0.00 ?  138 ARG C HB3  1  
ATOM   8137   H  HG2  . ARG C  2 84  ? -17.225 41.234  -7.310  1.00 0.00 ?  138 ARG C HG2  1  
ATOM   8138   H  HG3  . ARG C  2 84  ? -17.981 41.945  -5.885  1.00 0.00 ?  138 ARG C HG3  1  
ATOM   8139   H  HD2  . ARG C  2 84  ? -20.300 41.943  -7.076  1.00 0.00 ?  138 ARG C HD2  1  
ATOM   8140   H  HD3  . ARG C  2 84  ? -19.345 42.026  -8.548  1.00 0.00 ?  138 ARG C HD3  1  
ATOM   8141   H  HE   . ARG C  2 84  ? -18.805 39.392  -7.248  1.00 0.00 ?  138 ARG C HE   1  
ATOM   8142   H  HH11 . ARG C  2 84  ? -19.678 37.679  -8.334  1.00 0.00 ?  138 ARG C HH11 1  
ATOM   8143   H  HH12 . ARG C  2 84  ? -21.331 37.784  -8.793  1.00 0.00 ?  138 ARG C HH12 1  
ATOM   8144   H  HH21 . ARG C  2 84  ? -21.383 41.070  -8.883  1.00 0.00 ?  138 ARG C HH21 1  
ATOM   8145   H  HH22 . ARG C  2 84  ? -22.277 39.642  -9.116  1.00 0.00 ?  138 ARG C HH22 1  
ATOM   8146   N  N    . GLN C  2 85  ? -16.940 46.342  -7.457  1.00 0.00 ?  139 GLN C N    1  
ATOM   8147   C  CA   . GLN C  2 85  ? -16.500 47.539  -8.131  1.00 0.00 ?  139 GLN C CA   1  
ATOM   8148   C  C    . GLN C  2 85  ? -15.311 48.323  -7.530  1.00 0.00 ?  139 GLN C C    1  
ATOM   8149   O  O    . GLN C  2 85  ? -14.319 48.663  -8.180  1.00 0.00 ?  139 GLN C O    1  
ATOM   8150   C  CB   . GLN C  2 85  ? -17.563 48.614  -8.434  1.00 0.00 ?  139 GLN C CB   1  
ATOM   8151   C  CG   . GLN C  2 85  ? -18.722 48.331  -9.462  1.00 0.00 ?  139 GLN C CG   1  
ATOM   8152   C  CD   . GLN C  2 85  ? -18.538 47.159  -10.401 1.00 0.00 ?  139 GLN C CD   1  
ATOM   8153   O  OE1  . GLN C  2 85  ? -17.618 47.086  -11.238 1.00 0.00 ?  139 GLN C OE1  1  
ATOM   8154   N  NE2  . GLN C  2 85  ? -19.479 46.151  -10.321 1.00 0.00 ?  139 GLN C NE2  1  
ATOM   8155   H  H    . GLN C  2 85  ? -17.818 46.185  -7.012  1.00 0.00 ?  139 GLN C H    1  
ATOM   8156   H  HA   . GLN C  2 85  ? -16.169 47.279  -9.126  1.00 0.00 ?  139 GLN C HA   1  
ATOM   8157   H  HB2  . GLN C  2 85  ? -17.961 48.942  -7.449  1.00 0.00 ?  139 GLN C HB2  1  
ATOM   8158   H  HB3  . GLN C  2 85  ? -17.070 49.522  -8.844  1.00 0.00 ?  139 GLN C HB3  1  
ATOM   8159   H  HG2  . GLN C  2 85  ? -19.724 48.298  -8.985  1.00 0.00 ?  139 GLN C HG2  1  
ATOM   8160   H  HG3  . GLN C  2 85  ? -18.699 49.159  -10.203 1.00 0.00 ?  139 GLN C HG3  1  
ATOM   8161   H  HE21 . GLN C  2 85  ? -19.450 45.460  -11.043 1.00 0.00 ?  139 GLN C HE21 1  
ATOM   8162   H  HE22 . GLN C  2 85  ? -20.073 46.049  -9.522  1.00 0.00 ?  139 GLN C HE22 1  
ATOM   8163   N  N    . LYS C  2 86  ? -15.367 48.532  -6.202  1.00 0.00 ?  140 LYS C N    1  
ATOM   8164   C  CA   . LYS C  2 86  ? -14.280 49.011  -5.429  1.00 0.00 ?  140 LYS C CA   1  
ATOM   8165   C  C    . LYS C  2 86  ? -13.051 48.098  -5.320  1.00 0.00 ?  140 LYS C C    1  
ATOM   8166   O  O    . LYS C  2 86  ? -11.926 48.545  -5.188  1.00 0.00 ?  140 LYS C O    1  
ATOM   8167   C  CB   . LYS C  2 86  ? -14.856 49.462  -4.108  1.00 0.00 ?  140 LYS C CB   1  
ATOM   8168   C  CG   . LYS C  2 86  ? -15.891 50.650  -4.289  1.00 0.00 ?  140 LYS C CG   1  
ATOM   8169   C  CD   . LYS C  2 86  ? -16.189 51.420  -2.988  1.00 0.00 ?  140 LYS C CD   1  
ATOM   8170   C  CE   . LYS C  2 86  ? -16.572 50.559  -1.796  1.00 0.00 ?  140 LYS C CE   1  
ATOM   8171   N  NZ   . LYS C  2 86  ? -17.000 51.433  -0.671  1.00 0.00 1  140 LYS C NZ   1  
ATOM   8172   H  H    . LYS C  2 86  ? -16.194 48.311  -5.692  1.00 0.00 ?  140 LYS C H    1  
ATOM   8173   H  HA   . LYS C  2 86  ? -13.999 49.905  -5.967  1.00 0.00 ?  140 LYS C HA   1  
ATOM   8174   H  HB2  . LYS C  2 86  ? -15.404 48.605  -3.663  1.00 0.00 ?  140 LYS C HB2  1  
ATOM   8175   H  HB3  . LYS C  2 86  ? -14.067 49.771  -3.389  1.00 0.00 ?  140 LYS C HB3  1  
ATOM   8176   H  HG2  . LYS C  2 86  ? -15.630 51.388  -5.077  1.00 0.00 ?  140 LYS C HG2  1  
ATOM   8177   H  HG3  . LYS C  2 86  ? -16.848 50.149  -4.549  1.00 0.00 ?  140 LYS C HG3  1  
ATOM   8178   H  HD2  . LYS C  2 86  ? -15.280 51.981  -2.681  1.00 0.00 ?  140 LYS C HD2  1  
ATOM   8179   H  HD3  . LYS C  2 86  ? -17.074 52.086  -3.084  1.00 0.00 ?  140 LYS C HD3  1  
ATOM   8180   H  HE2  . LYS C  2 86  ? -17.534 50.072  -2.061  1.00 0.00 ?  140 LYS C HE2  1  
ATOM   8181   H  HE3  . LYS C  2 86  ? -15.754 49.868  -1.501  1.00 0.00 ?  140 LYS C HE3  1  
ATOM   8182   H  HZ1  . LYS C  2 86  ? -17.208 50.933  0.217   1.00 0.00 ?  140 LYS C HZ1  1  
ATOM   8183   H  HZ2  . LYS C  2 86  ? -17.808 52.086  -0.727  1.00 0.00 ?  140 LYS C HZ2  1  
ATOM   8184   H  HZ3  . LYS C  2 86  ? -16.297 52.194  -0.583  1.00 0.00 ?  140 LYS C HZ3  1  
ATOM   8185   N  N    . VAL C  2 87  ? -13.188 46.742  -5.410  1.00 0.00 ?  141 VAL C N    1  
ATOM   8186   C  CA   . VAL C  2 87  ? -12.007 45.935  -5.356  1.00 0.00 ?  141 VAL C CA   1  
ATOM   8187   C  C    . VAL C  2 87  ? -11.020 45.994  -6.575  1.00 0.00 ?  141 VAL C C    1  
ATOM   8188   O  O    . VAL C  2 87  ? -9.808  46.051  -6.469  1.00 0.00 ?  141 VAL C O    1  
ATOM   8189   C  CB   . VAL C  2 87  ? -12.504 44.412  -5.224  1.00 0.00 ?  141 VAL C CB   1  
ATOM   8190   C  CG1  . VAL C  2 87  ? -11.377 43.373  -5.401  1.00 0.00 ?  141 VAL C CG1  1  
ATOM   8191   C  CG2  . VAL C  2 87  ? -12.930 44.323  -3.700  1.00 0.00 ?  141 VAL C CG2  1  
ATOM   8192   H  H    . VAL C  2 87  ? -14.094 46.328  -5.422  1.00 0.00 ?  141 VAL C H    1  
ATOM   8193   H  HA   . VAL C  2 87  ? -11.381 46.070  -4.487  1.00 0.00 ?  141 VAL C HA   1  
ATOM   8194   H  HB   . VAL C  2 87  ? -13.335 44.263  -5.946  1.00 0.00 ?  141 VAL C HB   1  
ATOM   8195   H  HG11 . VAL C  2 87  ? -10.995 43.234  -6.435  1.00 0.00 ?  141 VAL C HG11 1  
ATOM   8196   H  HG12 . VAL C  2 87  ? -11.781 42.369  -5.150  1.00 0.00 ?  141 VAL C HG12 1  
ATOM   8197   H  HG13 . VAL C  2 87  ? -10.530 43.684  -4.752  1.00 0.00 ?  141 VAL C HG13 1  
ATOM   8198   H  HG21 . VAL C  2 87  ? -13.445 43.349  -3.560  1.00 0.00 ?  141 VAL C HG21 1  
ATOM   8199   H  HG22 . VAL C  2 87  ? -13.621 45.149  -3.424  1.00 0.00 ?  141 VAL C HG22 1  
ATOM   8200   H  HG23 . VAL C  2 87  ? -12.021 44.333  -3.063  1.00 0.00 ?  141 VAL C HG23 1  
ATOM   8201   N  N    . GLU C  2 88  ? -11.524 46.135  -7.811  1.00 0.00 ?  142 GLU C N    1  
ATOM   8202   C  CA   . GLU C  2 88  ? -10.762 46.395  -8.983  1.00 0.00 ?  142 GLU C CA   1  
ATOM   8203   C  C    . GLU C  2 88  ? -9.798  47.536  -9.138  1.00 0.00 ?  142 GLU C C    1  
ATOM   8204   O  O    . GLU C  2 88  ? -8.719  47.273  -9.666  1.00 0.00 ?  142 GLU C O    1  
ATOM   8205   C  CB   . GLU C  2 88  ? -11.771 46.458  -10.243 1.00 0.00 ?  142 GLU C CB   1  
ATOM   8206   C  CG   . GLU C  2 88  ? -12.474 45.081  -10.617 1.00 0.00 ?  142 GLU C CG   1  
ATOM   8207   C  CD   . GLU C  2 88  ? -11.483 43.829  -10.595 1.00 0.00 ?  142 GLU C CD   1  
ATOM   8208   O  OE1  . GLU C  2 88  ? -10.442 43.875  -11.216 1.00 0.00 ?  142 GLU C OE1  1  
ATOM   8209   O  OE2  . GLU C  2 88  ? -11.843 42.794  -9.993  1.00 0.00 -1 142 GLU C OE2  1  
ATOM   8210   H  H    . GLU C  2 88  ? -12.510 46.153  -7.952  1.00 0.00 ?  142 GLU C H    1  
ATOM   8211   H  HA   . GLU C  2 88  ? -10.160 45.499  -8.946  1.00 0.00 ?  142 GLU C HA   1  
ATOM   8212   H  HB2  . GLU C  2 88  ? -12.638 47.110  -10.001 1.00 0.00 ?  142 GLU C HB2  1  
ATOM   8213   H  HB3  . GLU C  2 88  ? -11.264 46.710  -11.199 1.00 0.00 ?  142 GLU C HB3  1  
ATOM   8214   H  HG2  . GLU C  2 88  ? -13.206 44.870  -9.809  1.00 0.00 ?  142 GLU C HG2  1  
ATOM   8215   H  HG3  . GLU C  2 88  ? -13.072 45.211  -11.545 1.00 0.00 ?  142 GLU C HG3  1  
ATOM   8216   N  N    . PRO C  2 89  ? -10.034 48.784  -8.692  1.00 0.00 ?  143 PRO C N    1  
ATOM   8217   C  CA   . PRO C  2 89  ? -9.013  49.798  -8.704  1.00 0.00 ?  143 PRO C CA   1  
ATOM   8218   C  C    . PRO C  2 89  ? -7.907  49.441  -7.736  1.00 0.00 ?  143 PRO C C    1  
ATOM   8219   O  O    . PRO C  2 89  ? -6.742  49.642  -8.092  1.00 0.00 ?  143 PRO C O    1  
ATOM   8220   C  CB   . PRO C  2 89  ? -9.736  51.053  -8.170  1.00 0.00 ?  143 PRO C CB   1  
ATOM   8221   C  CG   . PRO C  2 89  ? -11.070 50.643  -7.640  1.00 0.00 ?  143 PRO C CG   1  
ATOM   8222   C  CD   . PRO C  2 89  ? -11.391 49.290  -8.336  1.00 0.00 ?  143 PRO C CD   1  
ATOM   8223   H  HA   . PRO C  2 89  ? -8.559  49.848  -9.683  1.00 0.00 ?  143 PRO C HA   1  
ATOM   8224   H  HB2  . PRO C  2 89  ? -9.215  51.727  -7.457  1.00 0.00 ?  143 PRO C HB2  1  
ATOM   8225   H  HB3  . PRO C  2 89  ? -9.966  51.705  -9.040  1.00 0.00 ?  143 PRO C HB3  1  
ATOM   8226   H  HG2  . PRO C  2 89  ? -10.930 50.279  -6.600  1.00 0.00 ?  143 PRO C HG2  1  
ATOM   8227   H  HG3  . PRO C  2 89  ? -11.874 51.405  -7.553  1.00 0.00 ?  143 PRO C HG3  1  
ATOM   8228   H  HD2  . PRO C  2 89  ? -11.903 48.522  -7.719  1.00 0.00 ?  143 PRO C HD2  1  
ATOM   8229   H  HD3  . PRO C  2 89  ? -11.961 49.512  -9.264  1.00 0.00 ?  143 PRO C HD3  1  
ATOM   8230   N  N    . LEU C  2 90  ? -8.253  48.968  -6.535  1.00 0.00 ?  144 LEU C N    1  
ATOM   8231   C  CA   . LEU C  2 90  ? -7.270  48.858  -5.429  1.00 0.00 ?  144 LEU C CA   1  
ATOM   8232   C  C    . LEU C  2 90  ? -6.344  47.738  -5.723  1.00 0.00 ?  144 LEU C C    1  
ATOM   8233   O  O    . LEU C  2 90  ? -5.208  47.803  -5.353  1.00 0.00 ?  144 LEU C O    1  
ATOM   8234   C  CB   . LEU C  2 90  ? -7.928  48.447  -4.098  1.00 0.00 ?  144 LEU C CB   1  
ATOM   8235   C  CG   . LEU C  2 90  ? -8.789  49.622  -3.538  1.00 0.00 ?  144 LEU C CG   1  
ATOM   8236   C  CD1  . LEU C  2 90  ? -9.743  49.231  -2.374  1.00 0.00 ?  144 LEU C CD1  1  
ATOM   8237   C  CD2  . LEU C  2 90  ? -7.862  50.814  -3.065  1.00 0.00 ?  144 LEU C CD2  1  
ATOM   8238   H  H    . LEU C  2 90  ? -9.171  48.592  -6.430  1.00 0.00 ?  144 LEU C H    1  
ATOM   8239   H  HA   . LEU C  2 90  ? -6.722  49.787  -5.482  1.00 0.00 ?  144 LEU C HA   1  
ATOM   8240   H  HB2  . LEU C  2 90  ? -8.656  47.631  -4.288  1.00 0.00 ?  144 LEU C HB2  1  
ATOM   8241   H  HB3  . LEU C  2 90  ? -7.285  48.227  -3.219  1.00 0.00 ?  144 LEU C HB3  1  
ATOM   8242   H  HG   . LEU C  2 90  ? -9.406  50.070  -4.346  1.00 0.00 ?  144 LEU C HG   1  
ATOM   8243   H  HD11 . LEU C  2 90  ? -10.567 48.627  -2.812  1.00 0.00 ?  144 LEU C HD11 1  
ATOM   8244   H  HD12 . LEU C  2 90  ? -9.996  50.155  -1.812  1.00 0.00 ?  144 LEU C HD12 1  
ATOM   8245   H  HD13 . LEU C  2 90  ? -9.202  48.605  -1.632  1.00 0.00 ?  144 LEU C HD13 1  
ATOM   8246   H  HD21 . LEU C  2 90  ? -7.153  51.173  -3.842  1.00 0.00 ?  144 LEU C HD21 1  
ATOM   8247   H  HD22 . LEU C  2 90  ? -7.248  50.713  -2.145  1.00 0.00 ?  144 LEU C HD22 1  
ATOM   8248   H  HD23 . LEU C  2 90  ? -8.587  51.629  -2.853  1.00 0.00 ?  144 LEU C HD23 1  
ATOM   8249   N  N    . ARG C  2 91  ? -6.821  46.693  -6.423  1.00 0.00 ?  145 ARG C N    1  
ATOM   8250   C  CA   . ARG C  2 91  ? -6.044  45.669  -7.062  1.00 0.00 ?  145 ARG C CA   1  
ATOM   8251   C  C    . ARG C  2 91  ? -5.132  46.154  -8.147  1.00 0.00 ?  145 ARG C C    1  
ATOM   8252   O  O    . ARG C  2 91  ? -3.953  45.675  -8.208  1.00 0.00 ?  145 ARG C O    1  
ATOM   8253   C  CB   . ARG C  2 91  ? -6.979  44.459  -7.523  1.00 0.00 ?  145 ARG C CB   1  
ATOM   8254   C  CG   . ARG C  2 91  ? -7.640  43.731  -6.382  1.00 0.00 ?  145 ARG C CG   1  
ATOM   8255   C  CD   . ARG C  2 91  ? -6.787  42.711  -5.737  1.00 0.00 ?  145 ARG C CD   1  
ATOM   8256   N  NE   . ARG C  2 91  ? -7.795  41.927  -4.923  1.00 0.00 ?  145 ARG C NE   1  
ATOM   8257   C  CZ   . ARG C  2 91  ? -8.174  42.099  -3.668  1.00 0.00 ?  145 ARG C CZ   1  
ATOM   8258   N  NH1  . ARG C  2 91  ? -9.290  41.452  -3.306  1.00 0.00 1  145 ARG C NH1  1  
ATOM   8259   N  NH2  . ARG C  2 91  ? -7.770  43.000  -2.782  1.00 0.00 ?  145 ARG C NH2  1  
ATOM   8260   H  H    . ARG C  2 91  ? -7.798  46.639  -6.614  1.00 0.00 ?  145 ARG C H    1  
ATOM   8261   H  HA   . ARG C  2 91  ? -5.331  45.371  -6.307  1.00 0.00 ?  145 ARG C HA   1  
ATOM   8262   H  HB2  . ARG C  2 91  ? -7.691  44.743  -8.327  1.00 0.00 ?  145 ARG C HB2  1  
ATOM   8263   H  HB3  . ARG C  2 91  ? -6.375  43.665  -8.012  1.00 0.00 ?  145 ARG C HB3  1  
ATOM   8264   H  HG2  . ARG C  2 91  ? -7.948  44.503  -5.644  1.00 0.00 ?  145 ARG C HG2  1  
ATOM   8265   H  HG3  . ARG C  2 91  ? -8.551  43.218  -6.758  1.00 0.00 ?  145 ARG C HG3  1  
ATOM   8266   H  HD2  . ARG C  2 91  ? -6.356  41.987  -6.461  1.00 0.00 ?  145 ARG C HD2  1  
ATOM   8267   H  HD3  . ARG C  2 91  ? -5.958  43.162  -5.151  1.00 0.00 ?  145 ARG C HD3  1  
ATOM   8268   H  HE   . ARG C  2 91  ? -8.372  41.257  -5.391  1.00 0.00 ?  145 ARG C HE   1  
ATOM   8269   H  HH11 . ARG C  2 91  ? -9.849  41.119  -4.065  1.00 0.00 ?  145 ARG C HH11 1  
ATOM   8270   H  HH12 . ARG C  2 91  ? -9.617  41.733  -2.404  1.00 0.00 ?  145 ARG C HH12 1  
ATOM   8271   H  HH21 . ARG C  2 91  ? -7.039  43.642  -3.012  1.00 0.00 ?  145 ARG C HH21 1  
ATOM   8272   H  HH22 . ARG C  2 91  ? -8.492  43.269  -2.143  1.00 0.00 ?  145 ARG C HH22 1  
ATOM   8273   N  N    . ALA C  2 92  ? -5.582  46.983  -9.086  1.00 0.00 ?  146 ALA C N    1  
ATOM   8274   C  CA   . ALA C  2 92  ? -4.784  47.543  -10.138 1.00 0.00 ?  146 ALA C CA   1  
ATOM   8275   C  C    . ALA C  2 92  ? -3.591  48.403  -9.640  1.00 0.00 ?  146 ALA C C    1  
ATOM   8276   O  O    . ALA C  2 92  ? -2.425  48.390  -10.051 1.00 0.00 ?  146 ALA C O    1  
ATOM   8277   C  CB   . ALA C  2 92  ? -5.712  48.286  -11.081 1.00 0.00 ?  146 ALA C CB   1  
ATOM   8278   H  H    . ALA C  2 92  ? -6.451  47.430  -8.891  1.00 0.00 ?  146 ALA C H    1  
ATOM   8279   H  HA   . ALA C  2 92  ? -4.343  46.817  -10.805 1.00 0.00 ?  146 ALA C HA   1  
ATOM   8280   H  HB1  . ALA C  2 92  ? -5.241  48.670  -12.011 1.00 0.00 ?  146 ALA C HB1  1  
ATOM   8281   H  HB2  . ALA C  2 92  ? -6.266  49.157  -10.671 1.00 0.00 ?  146 ALA C HB2  1  
ATOM   8282   H  HB3  . ALA C  2 92  ? -6.536  47.582  -11.326 1.00 0.00 ?  146 ALA C HB3  1  
ATOM   8283   N  N    . GLU C  2 93  ? -3.999  49.245  -8.634  1.00 0.00 ?  147 GLU C N    1  
ATOM   8284   C  CA   . GLU C  2 93  ? -3.158  50.087  -7.816  1.00 0.00 ?  147 GLU C CA   1  
ATOM   8285   C  C    . GLU C  2 93  ? -2.092  49.260  -7.033  1.00 0.00 ?  147 GLU C C    1  
ATOM   8286   O  O    . GLU C  2 93  ? -0.907  49.466  -7.183  1.00 0.00 ?  147 GLU C O    1  
ATOM   8287   C  CB   . GLU C  2 93  ? -3.985  50.899  -6.791  1.00 0.00 ?  147 GLU C CB   1  
ATOM   8288   C  CG   . GLU C  2 93  ? -3.091  51.737  -5.838  1.00 0.00 ?  147 GLU C CG   1  
ATOM   8289   C  CD   . GLU C  2 93  ? -3.818  52.430  -4.696  1.00 0.00 ?  147 GLU C CD   1  
ATOM   8290   O  OE1  . GLU C  2 93  ? -3.668  51.953  -3.565  1.00 0.00 ?  147 GLU C OE1  1  
ATOM   8291   O  OE2  . GLU C  2 93  ? -4.539  53.460  -4.913  1.00 0.00 -1 147 GLU C OE2  1  
ATOM   8292   H  H    . GLU C  2 93  ? -4.970  49.273  -8.408  1.00 0.00 ?  147 GLU C H    1  
ATOM   8293   H  HA   . GLU C  2 93  ? -2.642  50.846  -8.386  1.00 0.00 ?  147 GLU C HA   1  
ATOM   8294   H  HB2  . GLU C  2 93  ? -4.633  51.659  -7.278  1.00 0.00 ?  147 GLU C HB2  1  
ATOM   8295   H  HB3  . GLU C  2 93  ? -4.612  50.259  -6.133  1.00 0.00 ?  147 GLU C HB3  1  
ATOM   8296   H  HG2  . GLU C  2 93  ? -2.401  51.091  -5.255  1.00 0.00 ?  147 GLU C HG2  1  
ATOM   8297   H  HG3  . GLU C  2 93  ? -2.603  52.518  -6.460  1.00 0.00 ?  147 GLU C HG3  1  
ATOM   8298   N  N    . LEU C  2 94  ? -2.530  48.119  -6.292  1.00 0.00 ?  148 LEU C N    1  
ATOM   8299   C  CA   . LEU C  2 94  ? -1.667  47.201  -5.535  1.00 0.00 ?  148 LEU C CA   1  
ATOM   8300   C  C    . LEU C  2 94  ? -0.580  46.526  -6.309  1.00 0.00 ?  148 LEU C C    1  
ATOM   8301   O  O    . LEU C  2 94  ? 0.589   46.701  -5.923  1.00 0.00 ?  148 LEU C O    1  
ATOM   8302   C  CB   . LEU C  2 94  ? -2.472  46.183  -4.717  1.00 0.00 ?  148 LEU C CB   1  
ATOM   8303   C  CG   . LEU C  2 94  ? -1.715  45.126  -3.836  1.00 0.00 ?  148 LEU C CG   1  
ATOM   8304   C  CD1  . LEU C  2 94  ? -1.128  45.627  -2.510  1.00 0.00 ?  148 LEU C CD1  1  
ATOM   8305   C  CD2  . LEU C  2 94  ? -2.561  43.881  -3.563  1.00 0.00 ?  148 LEU C CD2  1  
ATOM   8306   H  H    . LEU C  2 94  ? -3.502  47.904  -6.341  1.00 0.00 ?  148 LEU C H    1  
ATOM   8307   H  HA   . LEU C  2 94  ? -1.045  47.749  -4.843  1.00 0.00 ?  148 LEU C HA   1  
ATOM   8308   H  HB2  . LEU C  2 94  ? -3.067  46.827  -4.035  1.00 0.00 ?  148 LEU C HB2  1  
ATOM   8309   H  HB3  . LEU C  2 94  ? -3.157  45.639  -5.401  1.00 0.00 ?  148 LEU C HB3  1  
ATOM   8310   H  HG   . LEU C  2 94  ? -0.886  44.722  -4.455  1.00 0.00 ?  148 LEU C HG   1  
ATOM   8311   H  HD11 . LEU C  2 94  ? -0.582  44.801  -2.006  1.00 0.00 ?  148 LEU C HD11 1  
ATOM   8312   H  HD12 . LEU C  2 94  ? -1.860  46.136  -1.846  1.00 0.00 ?  148 LEU C HD12 1  
ATOM   8313   H  HD13 . LEU C  2 94  ? -0.321  46.371  -2.680  1.00 0.00 ?  148 LEU C HD13 1  
ATOM   8314   H  HD21 . LEU C  2 94  ? -2.607  43.176  -4.421  1.00 0.00 ?  148 LEU C HD21 1  
ATOM   8315   H  HD22 . LEU C  2 94  ? -3.512  44.254  -3.126  1.00 0.00 ?  148 LEU C HD22 1  
ATOM   8316   H  HD23 . LEU C  2 94  ? -2.061  43.355  -2.722  1.00 0.00 ?  148 LEU C HD23 1  
ATOM   8317   N  N    . GLN C  2 95  ? -0.986  45.882  -7.461  1.00 0.00 ?  149 GLN C N    1  
ATOM   8318   C  CA   . GLN C  2 95  ? -0.154  45.262  -8.463  1.00 0.00 ?  149 GLN C CA   1  
ATOM   8319   C  C    . GLN C  2 95  ? 0.845   46.192  -9.060  1.00 0.00 ?  149 GLN C C    1  
ATOM   8320   O  O    . GLN C  2 95  ? 2.029   45.893  -9.201  1.00 0.00 ?  149 GLN C O    1  
ATOM   8321   C  CB   . GLN C  2 95  ? -0.914  44.562  -9.591  1.00 0.00 ?  149 GLN C CB   1  
ATOM   8322   C  CG   . GLN C  2 95  ? -1.737  43.290  -9.168  1.00 0.00 ?  149 GLN C CG   1  
ATOM   8323   C  CD   . GLN C  2 95  ? -1.026  42.420  -8.133  1.00 0.00 ?  149 GLN C CD   1  
ATOM   8324   O  OE1  . GLN C  2 95  ? -1.071  42.729  -6.953  1.00 0.00 ?  149 GLN C OE1  1  
ATOM   8325   N  NE2  . GLN C  2 95  ? -0.342  41.369  -8.615  1.00 0.00 ?  149 GLN C NE2  1  
ATOM   8326   H  H    . GLN C  2 95  ? -1.973  45.798  -7.574  1.00 0.00 ?  149 GLN C H    1  
ATOM   8327   H  HA   . GLN C  2 95  ? 0.417   44.534  -7.907  1.00 0.00 ?  149 GLN C HA   1  
ATOM   8328   H  HB2  . GLN C  2 95  ? -1.575  45.306  -10.084 1.00 0.00 ?  149 GLN C HB2  1  
ATOM   8329   H  HB3  . GLN C  2 95  ? -0.179  44.156  -10.319 1.00 0.00 ?  149 GLN C HB3  1  
ATOM   8330   H  HG2  . GLN C  2 95  ? -2.600  43.761  -8.650  1.00 0.00 ?  149 GLN C HG2  1  
ATOM   8331   H  HG3  . GLN C  2 95  ? -2.048  42.743  -10.083 1.00 0.00 ?  149 GLN C HG3  1  
ATOM   8332   H  HE21 . GLN C  2 95  ? 0.013   40.743  -7.920  1.00 0.00 ?  149 GLN C HE21 1  
ATOM   8333   H  HE22 . GLN C  2 95  ? -0.225  41.445  -9.605  1.00 0.00 ?  149 GLN C HE22 1  
ATOM   8334   N  N    . GLU C  2 96  ? 0.443   47.458  -9.461  1.00 0.00 ?  150 GLU C N    1  
ATOM   8335   C  CA   . GLU C  2 96  ? 1.392   48.451  -9.996  1.00 0.00 ?  150 GLU C CA   1  
ATOM   8336   C  C    . GLU C  2 96  ? 2.406   48.849  -8.899  1.00 0.00 ?  150 GLU C C    1  
ATOM   8337   O  O    . GLU C  2 96  ? 3.638   48.794  -9.146  1.00 0.00 ?  150 GLU C O    1  
ATOM   8338   C  CB   . GLU C  2 96  ? 0.627   49.653  -10.604 1.00 0.00 ?  150 GLU C CB   1  
ATOM   8339   C  CG   . GLU C  2 96  ? 1.505   50.861  -11.142 1.00 0.00 ?  150 GLU C CG   1  
ATOM   8340   C  CD   . GLU C  2 96  ? 0.642   51.793  -12.020 1.00 0.00 ?  150 GLU C CD   1  
ATOM   8341   O  OE1  . GLU C  2 96  ? -0.277  52.374  -11.429 1.00 0.00 ?  150 GLU C OE1  1  
ATOM   8342   O  OE2  . GLU C  2 96  ? 0.816   51.889  -13.264 1.00 0.00 -1 150 GLU C OE2  1  
ATOM   8343   H  H    . GLU C  2 96  ? -0.448  47.799  -9.170  1.00 0.00 ?  150 GLU C H    1  
ATOM   8344   H  HA   . GLU C  2 96  ? 1.928   47.979  -10.806 1.00 0.00 ?  150 GLU C HA   1  
ATOM   8345   H  HB2  . GLU C  2 96  ? -0.006  49.130  -11.352 1.00 0.00 ?  150 GLU C HB2  1  
ATOM   8346   H  HB3  . GLU C  2 96  ? -0.016  50.189  -9.873  1.00 0.00 ?  150 GLU C HB3  1  
ATOM   8347   H  HG2  . GLU C  2 96  ? 2.056   51.319  -10.293 1.00 0.00 ?  150 GLU C HG2  1  
ATOM   8348   H  HG3  . GLU C  2 96  ? 2.351   50.450  -11.734 1.00 0.00 ?  150 GLU C HG3  1  
ATOM   8349   N  N    . GLY C  2 97  ? 2.036   49.112  -7.653  1.00 0.00 ?  151 GLY C N    1  
ATOM   8350   C  CA   . GLY C  2 97  ? 2.984   49.520  -6.601  1.00 0.00 ?  151 GLY C CA   1  
ATOM   8351   C  C    . GLY C  2 97  ? 4.027   48.516  -6.231  1.00 0.00 ?  151 GLY C C    1  
ATOM   8352   O  O    . GLY C  2 97  ? 5.233   48.809  -6.024  1.00 0.00 ?  151 GLY C O    1  
ATOM   8353   H  H    . GLY C  2 97  ? 1.090   48.964  -7.376  1.00 0.00 ?  151 GLY C H    1  
ATOM   8354   H  HA2  . GLY C  2 97  ? 3.362   50.482  -6.915  1.00 0.00 ?  151 GLY C HA2  1  
ATOM   8355   H  HA3  . GLY C  2 97  ? 2.446   49.743  -5.692  1.00 0.00 ?  151 GLY C HA3  1  
ATOM   8356   N  N    . ALA C  2 98  ? 3.577   47.244  -6.172  1.00 0.00 ?  152 ALA C N    1  
ATOM   8357   C  CA   . ALA C  2 98  ? 4.395   46.139  -5.860  1.00 0.00 ?  152 ALA C CA   1  
ATOM   8358   C  C    . ALA C  2 98  ? 5.527   45.981  -6.836  1.00 0.00 ?  152 ALA C C    1  
ATOM   8359   O  O    . ALA C  2 98  ? 6.695   45.827  -6.544  1.00 0.00 ?  152 ALA C O    1  
ATOM   8360   C  CB   . ALA C  2 98  ? 3.473   44.909  -5.957  1.00 0.00 ?  152 ALA C CB   1  
ATOM   8361   H  H    . ALA C  2 98  ? 2.594   47.186  -6.329  1.00 0.00 ?  152 ALA C H    1  
ATOM   8362   H  HA   . ALA C  2 98  ? 4.916   46.263  -4.923  1.00 0.00 ?  152 ALA C HA   1  
ATOM   8363   H  HB1  . ALA C  2 98  ? 3.955   43.911  -5.882  1.00 0.00 ?  152 ALA C HB1  1  
ATOM   8364   H  HB2  . ALA C  2 98  ? 3.056   44.788  -6.979  1.00 0.00 ?  152 ALA C HB2  1  
ATOM   8365   H  HB3  . ALA C  2 98  ? 2.701   44.923  -5.158  1.00 0.00 ?  152 ALA C HB3  1  
ATOM   8366   N  N    . ARG C  2 99  ? 5.206   46.070  -8.138  1.00 0.00 ?  153 ARG C N    1  
ATOM   8367   C  CA   . ARG C  2 99  ? 6.198   46.191  -9.206  1.00 0.00 ?  153 ARG C CA   1  
ATOM   8368   C  C    . ARG C  2 99  ? 7.203   47.308  -9.142  1.00 0.00 ?  153 ARG C C    1  
ATOM   8369   O  O    . ARG C  2 99  ? 8.380   47.115  -9.359  1.00 0.00 ?  153 ARG C O    1  
ATOM   8370   C  CB   . ARG C  2 99  ? 5.476   46.010  -10.559 1.00 0.00 ?  153 ARG C CB   1  
ATOM   8371   C  CG   . ARG C  2 99  ? 4.862   44.583  -10.824 1.00 0.00 ?  153 ARG C CG   1  
ATOM   8372   C  CD   . ARG C  2 99  ? 4.515   44.151  -12.212 1.00 0.00 ?  153 ARG C CD   1  
ATOM   8373   N  NE   . ARG C  2 99  ? 5.664   44.011  -13.115 1.00 0.00 ?  153 ARG C NE   1  
ATOM   8374   C  CZ   . ARG C  2 99  ? 6.531   43.030  -13.125 1.00 0.00 ?  153 ARG C CZ   1  
ATOM   8375   N  NH1  . ARG C  2 99  ? 7.535   43.095  -13.951 1.00 0.00 1  153 ARG C NH1  1  
ATOM   8376   N  NH2  . ARG C  2 99  ? 6.463   41.992  -12.311 1.00 0.00 ?  153 ARG C NH2  1  
ATOM   8377   H  H    . ARG C  2 99  ? 4.238   46.051  -8.373  1.00 0.00 ?  153 ARG C H    1  
ATOM   8378   H  HA   . ARG C  2 99  ? 6.840   45.325  -9.143  1.00 0.00 ?  153 ARG C HA   1  
ATOM   8379   H  HB2  . ARG C  2 99  ? 4.726   46.827  -10.621 1.00 0.00 ?  153 ARG C HB2  1  
ATOM   8380   H  HB3  . ARG C  2 99  ? 6.269   46.146  -11.326 1.00 0.00 ?  153 ARG C HB3  1  
ATOM   8381   H  HG2  . ARG C  2 99  ? 5.544   43.844  -10.352 1.00 0.00 ?  153 ARG C HG2  1  
ATOM   8382   H  HG3  . ARG C  2 99  ? 3.992   44.517  -10.137 1.00 0.00 ?  153 ARG C HG3  1  
ATOM   8383   H  HD2  . ARG C  2 99  ? 3.878   43.244  -12.126 1.00 0.00 ?  153 ARG C HD2  1  
ATOM   8384   H  HD3  . ARG C  2 99  ? 3.820   44.870  -12.694 1.00 0.00 ?  153 ARG C HD3  1  
ATOM   8385   H  HE   . ARG C  2 99  ? 5.950   44.770  -13.700 1.00 0.00 ?  153 ARG C HE   1  
ATOM   8386   H  HH11 . ARG C  2 99  ? 7.521   43.812  -14.648 1.00 0.00 ?  153 ARG C HH11 1  
ATOM   8387   H  HH12 . ARG C  2 99  ? 8.113   42.282  -14.012 1.00 0.00 ?  153 ARG C HH12 1  
ATOM   8388   H  HH21 . ARG C  2 99  ? 5.823   42.054  -11.546 1.00 0.00 ?  153 ARG C HH21 1  
ATOM   8389   H  HH22 . ARG C  2 99  ? 6.983   41.147  -12.434 1.00 0.00 ?  153 ARG C HH22 1  
ATOM   8390   N  N    . GLN C  2 100 ? 6.683   48.486  -8.814  1.00 0.00 ?  154 GLN C N    1  
ATOM   8391   C  CA   . GLN C  2 100 ? 7.511   49.635  -8.657  1.00 0.00 ?  154 GLN C CA   1  
ATOM   8392   C  C    . GLN C  2 100 ? 8.587   49.396  -7.592  1.00 0.00 ?  154 GLN C C    1  
ATOM   8393   O  O    . GLN C  2 100 ? 9.813   49.480  -7.871  1.00 0.00 ?  154 GLN C O    1  
ATOM   8394   C  CB   . GLN C  2 100 ? 6.767   51.078  -8.436  1.00 0.00 ?  154 GLN C CB   1  
ATOM   8395   C  CG   . GLN C  2 100 ? 5.692   51.484  -9.497  1.00 0.00 ?  154 GLN C CG   1  
ATOM   8396   C  CD   . GLN C  2 100 ? 5.941   51.205  -11.014 1.00 0.00 ?  154 GLN C CD   1  
ATOM   8397   O  OE1  . GLN C  2 100 ? 6.633   51.956  -11.690 1.00 0.00 ?  154 GLN C OE1  1  
ATOM   8398   N  NE2  . GLN C  2 100 ? 5.250   50.196  -11.558 1.00 0.00 ?  154 GLN C NE2  1  
ATOM   8399   H  H    . GLN C  2 100 ? 5.709   48.622  -8.648  1.00 0.00 ?  154 GLN C H    1  
ATOM   8400   H  HA   . GLN C  2 100 ? 8.115   49.694  -9.550  1.00 0.00 ?  154 GLN C HA   1  
ATOM   8401   H  HB2  . GLN C  2 100 ? 6.261   51.074  -7.447  1.00 0.00 ?  154 GLN C HB2  1  
ATOM   8402   H  HB3  . GLN C  2 100 ? 7.668   51.729  -8.417  1.00 0.00 ?  154 GLN C HB3  1  
ATOM   8403   H  HG2  . GLN C  2 100 ? 4.711   51.111  -9.132  1.00 0.00 ?  154 GLN C HG2  1  
ATOM   8404   H  HG3  . GLN C  2 100 ? 5.566   52.588  -9.494  1.00 0.00 ?  154 GLN C HG3  1  
ATOM   8405   H  HE21 . GLN C  2 100 ? 5.342   50.057  -12.544 1.00 0.00 ?  154 GLN C HE21 1  
ATOM   8406   H  HE22 . GLN C  2 100 ? 4.733   49.607  -10.937 1.00 0.00 ?  154 GLN C HE22 1  
ATOM   8407   N  N    . LYS C  2 101 ? 8.210   48.889  -6.440  1.00 0.00 ?  155 LYS C N    1  
ATOM   8408   C  CA   . LYS C  2 101 ? 9.162   48.426  -5.395  1.00 0.00 ?  155 LYS C CA   1  
ATOM   8409   C  C    . LYS C  2 101 ? 10.039  47.266  -5.721  1.00 0.00 ?  155 LYS C C    1  
ATOM   8410   O  O    . LYS C  2 101 ? 11.278  47.267  -5.441  1.00 0.00 ?  155 LYS C O    1  
ATOM   8411   C  CB   . LYS C  2 101 ? 8.328   48.174  -4.048  1.00 0.00 ?  155 LYS C CB   1  
ATOM   8412   C  CG   . LYS C  2 101 ? 9.191   47.804  -2.795  1.00 0.00 ?  155 LYS C CG   1  
ATOM   8413   C  CD   . LYS C  2 101 ? 10.188  48.913  -2.372  1.00 0.00 ?  155 LYS C CD   1  
ATOM   8414   C  CE   . LYS C  2 101 ? 9.580   50.308  -1.916  1.00 0.00 ?  155 LYS C CE   1  
ATOM   8415   N  NZ   . LYS C  2 101 ? 10.526  51.354  -1.547  1.00 0.00 1  155 LYS C NZ   1  
ATOM   8416   H  H    . LYS C  2 101 ? 7.277   48.552  -6.343  1.00 0.00 ?  155 LYS C H    1  
ATOM   8417   H  HA   . LYS C  2 101 ? 9.956   49.144  -5.258  1.00 0.00 ?  155 LYS C HA   1  
ATOM   8418   H  HB2  . LYS C  2 101 ? 7.831   49.148  -3.852  1.00 0.00 ?  155 LYS C HB2  1  
ATOM   8419   H  HB3  . LYS C  2 101 ? 7.585   47.369  -4.234  1.00 0.00 ?  155 LYS C HB3  1  
ATOM   8420   H  HG2  . LYS C  2 101 ? 8.480   47.591  -1.968  1.00 0.00 ?  155 LYS C HG2  1  
ATOM   8421   H  HG3  . LYS C  2 101 ? 9.683   46.828  -2.998  1.00 0.00 ?  155 LYS C HG3  1  
ATOM   8422   H  HD2  . LYS C  2 101 ? 10.814  48.625  -1.501  1.00 0.00 ?  155 LYS C HD2  1  
ATOM   8423   H  HD3  . LYS C  2 101 ? 10.855  49.178  -3.221  1.00 0.00 ?  155 LYS C HD3  1  
ATOM   8424   H  HE2  . LYS C  2 101 ? 8.815   50.718  -2.610  1.00 0.00 ?  155 LYS C HE2  1  
ATOM   8425   H  HE3  . LYS C  2 101 ? 8.976   50.095  -1.008  1.00 0.00 ?  155 LYS C HE3  1  
ATOM   8426   H  HZ1  . LYS C  2 101 ? 9.984   52.242  -1.551  1.00 0.00 ?  155 LYS C HZ1  1  
ATOM   8427   H  HZ2  . LYS C  2 101 ? 11.200  51.583  -2.305  1.00 0.00 ?  155 LYS C HZ2  1  
ATOM   8428   H  HZ3  . LYS C  2 101 ? 11.075  51.187  -0.680  1.00 0.00 ?  155 LYS C HZ3  1  
ATOM   8429   N  N    . LEU C  2 102 ? 9.559   46.251  -6.387  1.00 0.00 ?  156 LEU C N    1  
ATOM   8430   C  CA   . LEU C  2 102 ? 10.399  45.237  -6.999  1.00 0.00 ?  156 LEU C CA   1  
ATOM   8431   C  C    . LEU C  2 102 ? 11.415  45.816  -8.032  1.00 0.00 ?  156 LEU C C    1  
ATOM   8432   O  O    . LEU C  2 102 ? 12.592  45.419  -8.041  1.00 0.00 ?  156 LEU C O    1  
ATOM   8433   C  CB   . LEU C  2 102 ? 9.530   44.220  -7.755  1.00 0.00 ?  156 LEU C CB   1  
ATOM   8434   C  CG   . LEU C  2 102 ? 10.202  42.951  -8.362  1.00 0.00 ?  156 LEU C CG   1  
ATOM   8435   C  CD1  . LEU C  2 102 ? 10.996  42.173  -7.191  1.00 0.00 ?  156 LEU C CD1  1  
ATOM   8436   C  CD2  . LEU C  2 102 ? 9.143   42.056  -9.086  1.00 0.00 ?  156 LEU C CD2  1  
ATOM   8437   H  H    . LEU C  2 102 ? 8.607   46.163  -6.670  1.00 0.00 ?  156 LEU C H    1  
ATOM   8438   H  HA   . LEU C  2 102 ? 10.873  44.689  -6.198  1.00 0.00 ?  156 LEU C HA   1  
ATOM   8439   H  HB2  . LEU C  2 102 ? 8.718   43.983  -7.034  1.00 0.00 ?  156 LEU C HB2  1  
ATOM   8440   H  HB3  . LEU C  2 102 ? 9.013   44.857  -8.504  1.00 0.00 ?  156 LEU C HB3  1  
ATOM   8441   H  HG   . LEU C  2 102 ? 10.942  43.302  -9.112  1.00 0.00 ?  156 LEU C HG   1  
ATOM   8442   H  HD11 . LEU C  2 102 ? 11.513  41.279  -7.599  1.00 0.00 ?  156 LEU C HD11 1  
ATOM   8443   H  HD12 . LEU C  2 102 ? 10.280  41.769  -6.444  1.00 0.00 ?  156 LEU C HD12 1  
ATOM   8444   H  HD13 . LEU C  2 102 ? 11.803  42.719  -6.657  1.00 0.00 ?  156 LEU C HD13 1  
ATOM   8445   H  HD21 . LEU C  2 102 ? 8.389   41.636  -8.387  1.00 0.00 ?  156 LEU C HD21 1  
ATOM   8446   H  HD22 . LEU C  2 102 ? 9.682   41.233  -9.602  1.00 0.00 ?  156 LEU C HD22 1  
ATOM   8447   H  HD23 . LEU C  2 102 ? 8.713   42.650  -9.921  1.00 0.00 ?  156 LEU C HD23 1  
ATOM   8448   N  N    . HIS C  2 103 ? 11.127  46.799  -8.885  1.00 0.00 ?  157 HIS C N    1  
ATOM   8449   C  CA   . HIS C  2 103 ? 12.104  47.422  -9.755  1.00 0.00 ?  157 HIS C CA   1  
ATOM   8450   C  C    . HIS C  2 103 ? 13.222  48.290  -9.031  1.00 0.00 ?  157 HIS C C    1  
ATOM   8451   O  O    . HIS C  2 103 ? 14.416  48.278  -9.302  1.00 0.00 ?  157 HIS C O    1  
ATOM   8452   C  CB   . HIS C  2 103 ? 11.313  48.213  -10.816 1.00 0.00 ?  157 HIS C CB   1  
ATOM   8453   C  CG   . HIS C  2 103 ? 10.517  47.265  -11.644 1.00 0.00 ?  157 HIS C CG   1  
ATOM   8454   N  ND1  . HIS C  2 103 ? 10.848  46.026  -12.160 1.00 0.00 ?  157 HIS C ND1  1  
ATOM   8455   C  CD2  . HIS C  2 103 ? 9.240   47.469  -12.128 1.00 0.00 ?  157 HIS C CD2  1  
ATOM   8456   C  CE1  . HIS C  2 103 ? 9.858   45.544  -12.965 1.00 0.00 ?  157 HIS C CE1  1  
ATOM   8457   N  NE2  . HIS C  2 103 ? 8.777   46.376  -12.839 1.00 0.00 ?  157 HIS C NE2  1  
ATOM   8458   H  H    . HIS C  2 103 ? 10.163  46.998  -9.041  1.00 0.00 ?  157 HIS C H    1  
ATOM   8459   H  HA   . HIS C  2 103 ? 12.581  46.641  -10.327 1.00 0.00 ?  157 HIS C HA   1  
ATOM   8460   H  HB2  . HIS C  2 103 ? 10.684  49.051  -10.446 1.00 0.00 ?  157 HIS C HB2  1  
ATOM   8461   H  HB3  . HIS C  2 103 ? 11.991  48.725  -11.532 1.00 0.00 ?  157 HIS C HB3  1  
ATOM   8462   H  HD1  . HIS C  2 103 ? 11.631  45.475  -11.870 1.00 0.00 ?  157 HIS C HD1  1  
ATOM   8463   H  HD2  . HIS C  2 103 ? 8.599   48.305  -11.877 1.00 0.00 ?  157 HIS C HD2  1  
ATOM   8464   H  HE1  . HIS C  2 103 ? 9.887   44.565  -13.444 1.00 0.00 ?  157 HIS C HE1  1  
ATOM   8465   N  N    . GLU C  2 104 ? 12.793  49.080  -8.059  1.00 0.00 ?  158 GLU C N    1  
ATOM   8466   C  CA   . GLU C  2 104 ? 13.613  49.831  -7.081  1.00 0.00 ?  158 GLU C CA   1  
ATOM   8467   C  C    . GLU C  2 104 ? 14.578  48.930  -6.162  1.00 0.00 ?  158 GLU C C    1  
ATOM   8468   O  O    . GLU C  2 104 ? 15.780  49.177  -6.171  1.00 0.00 ?  158 GLU C O    1  
ATOM   8469   C  CB   . GLU C  2 104 ? 12.651  50.665  -6.229  1.00 0.00 ?  158 GLU C CB   1  
ATOM   8470   C  CG   . GLU C  2 104 ? 13.260  51.406  -5.067  1.00 0.00 ?  158 GLU C CG   1  
ATOM   8471   C  CD   . GLU C  2 104 ? 12.361  52.435  -4.450  1.00 0.00 ?  158 GLU C CD   1  
ATOM   8472   O  OE1  . GLU C  2 104 ? 11.747  53.319  -5.130  1.00 0.00 ?  158 GLU C OE1  1  
ATOM   8473   O  OE2  . GLU C  2 104 ? 12.163  52.331  -3.229  1.00 0.00 -1 158 GLU C OE2  1  
ATOM   8474   H  H    . GLU C  2 104 ? 11.824  49.279  -7.930  1.00 0.00 ?  158 GLU C H    1  
ATOM   8475   H  HA   . GLU C  2 104 ? 14.332  50.484  -7.552  1.00 0.00 ?  158 GLU C HA   1  
ATOM   8476   H  HB2  . GLU C  2 104 ? 12.330  51.463  -6.932  1.00 0.00 ?  158 GLU C HB2  1  
ATOM   8477   H  HB3  . GLU C  2 104 ? 11.752  50.053  -5.998  1.00 0.00 ?  158 GLU C HB3  1  
ATOM   8478   H  HG2  . GLU C  2 104 ? 13.703  50.791  -4.255  1.00 0.00 ?  158 GLU C HG2  1  
ATOM   8479   H  HG3  . GLU C  2 104 ? 14.140  51.909  -5.523  1.00 0.00 ?  158 GLU C HG3  1  
ATOM   8480   N  N    . LEU C  2 105 ? 14.094  47.855  -5.574  1.00 0.00 ?  159 LEU C N    1  
ATOM   8481   C  CA   . LEU C  2 105 ? 14.941  46.906  -4.952  1.00 0.00 ?  159 LEU C CA   1  
ATOM   8482   C  C    . LEU C  2 105 ? 15.778  45.947  -6.009  1.00 0.00 ?  159 LEU C C    1  
ATOM   8483   O  O    . LEU C  2 105 ? 16.783  45.368  -5.607  1.00 0.00 ?  159 LEU C O    1  
ATOM   8484   C  CB   . LEU C  2 105 ? 14.253  46.042  -3.858  1.00 0.00 ?  159 LEU C CB   1  
ATOM   8485   C  CG   . LEU C  2 105 ? 13.488  46.915  -2.842  1.00 0.00 ?  159 LEU C CG   1  
ATOM   8486   C  CD1  . LEU C  2 105 ? 12.615  46.053  -1.907  1.00 0.00 ?  159 LEU C CD1  1  
ATOM   8487   C  CD2  . LEU C  2 105 ? 14.483  47.814  -2.138  1.00 0.00 ?  159 LEU C CD2  1  
ATOM   8488   H  H    . LEU C  2 105 ? 13.099  47.839  -5.517  1.00 0.00 ?  159 LEU C H    1  
ATOM   8489   H  HA   . LEU C  2 105 ? 15.718  47.441  -4.426  1.00 0.00 ?  159 LEU C HA   1  
ATOM   8490   H  HB2  . LEU C  2 105 ? 13.520  45.400  -4.391  1.00 0.00 ?  159 LEU C HB2  1  
ATOM   8491   H  HB3  . LEU C  2 105 ? 15.041  45.321  -3.552  1.00 0.00 ?  159 LEU C HB3  1  
ATOM   8492   H  HG   . LEU C  2 105 ? 12.816  47.534  -3.474  1.00 0.00 ?  159 LEU C HG   1  
ATOM   8493   H  HD11 . LEU C  2 105 ? 13.192  45.252  -1.398  1.00 0.00 ?  159 LEU C HD11 1  
ATOM   8494   H  HD12 . LEU C  2 105 ? 11.824  45.512  -2.469  1.00 0.00 ?  159 LEU C HD12 1  
ATOM   8495   H  HD13 . LEU C  2 105 ? 12.117  46.682  -1.139  1.00 0.00 ?  159 LEU C HD13 1  
ATOM   8496   H  HD21 . LEU C  2 105 ? 15.352  47.299  -1.675  1.00 0.00 ?  159 LEU C HD21 1  
ATOM   8497   H  HD22 . LEU C  2 105 ? 14.071  48.507  -1.374  1.00 0.00 ?  159 LEU C HD22 1  
ATOM   8498   H  HD23 . LEU C  2 105 ? 14.906  48.515  -2.890  1.00 0.00 ?  159 LEU C HD23 1  
ATOM   8499   N  N    . GLN C  2 106 ? 15.446  45.787  -7.297  1.00 0.00 ?  160 GLN C N    1  
ATOM   8500   C  CA   . GLN C  2 106 ? 16.227  45.193  -8.328  1.00 0.00 ?  160 GLN C CA   1  
ATOM   8501   C  C    . GLN C  2 106 ? 17.493  46.008  -8.518  1.00 0.00 ?  160 GLN C C    1  
ATOM   8502   O  O    . GLN C  2 106 ? 18.554  45.442  -8.587  1.00 0.00 ?  160 GLN C O    1  
ATOM   8503   C  CB   . GLN C  2 106 ? 15.473  45.160  -9.632  1.00 0.00 ?  160 GLN C CB   1  
ATOM   8504   C  CG   . GLN C  2 106 ? 16.171  44.340  -10.847 1.00 0.00 ?  160 GLN C CG   1  
ATOM   8505   C  CD   . GLN C  2 106 ? 17.485  44.815  -11.486 1.00 0.00 ?  160 GLN C CD   1  
ATOM   8506   O  OE1  . GLN C  2 106 ? 18.529  44.316  -11.143 1.00 0.00 ?  160 GLN C OE1  1  
ATOM   8507   N  NE2  . GLN C  2 106 ? 17.504  45.825  -12.356 1.00 0.00 ?  160 GLN C NE2  1  
ATOM   8508   H  H    . GLN C  2 106 ? 14.713  46.371  -7.637  1.00 0.00 ?  160 GLN C H    1  
ATOM   8509   H  HA   . GLN C  2 106 ? 16.517  44.245  -7.899  1.00 0.00 ?  160 GLN C HA   1  
ATOM   8510   H  HB2  . GLN C  2 106 ? 14.538  44.606  -9.400  1.00 0.00 ?  160 GLN C HB2  1  
ATOM   8511   H  HB3  . GLN C  2 106 ? 15.146  46.167  -9.969  1.00 0.00 ?  160 GLN C HB3  1  
ATOM   8512   H  HG2  . GLN C  2 106 ? 16.379  43.353  -10.380 1.00 0.00 ?  160 GLN C HG2  1  
ATOM   8513   H  HG3  . GLN C  2 106 ? 15.354  44.181  -11.582 1.00 0.00 ?  160 GLN C HG3  1  
ATOM   8514   H  HE21 . GLN C  2 106 ? 18.355  46.235  -12.685 1.00 0.00 ?  160 GLN C HE21 1  
ATOM   8515   H  HE22 . GLN C  2 106 ? 16.628  46.253  -12.579 1.00 0.00 ?  160 GLN C HE22 1  
ATOM   8516   N  N    . GLU C  2 107 ? 17.366  47.368  -8.558  1.00 0.00 ?  161 GLU C N    1  
ATOM   8517   C  CA   . GLU C  2 107 ? 18.532  48.329  -8.665  1.00 0.00 ?  161 GLU C CA   1  
ATOM   8518   C  C    . GLU C  2 107 ? 19.430  48.218  -7.436  1.00 0.00 ?  161 GLU C C    1  
ATOM   8519   O  O    . GLU C  2 107 ? 20.634  48.273  -7.543  1.00 0.00 ?  161 GLU C O    1  
ATOM   8520   C  CB   . GLU C  2 107 ? 18.124  49.841  -9.048  1.00 0.00 ?  161 GLU C CB   1  
ATOM   8521   C  CG   . GLU C  2 107 ? 17.541  49.999  -10.411 1.00 0.00 ?  161 GLU C CG   1  
ATOM   8522   C  CD   . GLU C  2 107 ? 17.272  51.457  -10.729 1.00 0.00 ?  161 GLU C CD   1  
ATOM   8523   O  OE1  . GLU C  2 107 ? 17.646  51.911  -11.881 1.00 0.00 ?  161 GLU C OE1  1  
ATOM   8524   O  OE2  . GLU C  2 107 ? 16.691  52.241  -9.938  1.00 0.00 -1 161 GLU C OE2  1  
ATOM   8525   H  H    . GLU C  2 107 ? 16.432  47.710  -8.614  1.00 0.00 ?  161 GLU C H    1  
ATOM   8526   H  HA   . GLU C  2 107 ? 19.141  47.978  -9.486  1.00 0.00 ?  161 GLU C HA   1  
ATOM   8527   H  HB2  . GLU C  2 107 ? 17.336  50.134  -8.322  1.00 0.00 ?  161 GLU C HB2  1  
ATOM   8528   H  HB3  . GLU C  2 107 ? 19.011  50.500  -8.932  1.00 0.00 ?  161 GLU C HB3  1  
ATOM   8529   H  HG2  . GLU C  2 107 ? 18.218  49.633  -11.212 1.00 0.00 ?  161 GLU C HG2  1  
ATOM   8530   H  HG3  . GLU C  2 107 ? 16.532  49.598  -10.649 1.00 0.00 ?  161 GLU C HG3  1  
ATOM   8531   N  N    . LYS C  2 108 ? 18.846  48.173  -6.224  1.00 0.00 ?  162 LYS C N    1  
ATOM   8532   C  CA   . LYS C  2 108 ? 19.532  48.231  -5.020  1.00 0.00 ?  162 LYS C CA   1  
ATOM   8533   C  C    . LYS C  2 108 ? 20.167  46.842  -4.758  1.00 0.00 ?  162 LYS C C    1  
ATOM   8534   O  O    . LYS C  2 108 ? 21.174  46.682  -4.004  1.00 0.00 ?  162 LYS C O    1  
ATOM   8535   C  CB   . LYS C  2 108 ? 18.629  48.585  -3.838  1.00 0.00 ?  162 LYS C CB   1  
ATOM   8536   C  CG   . LYS C  2 108 ? 18.032  50.017  -3.987  1.00 0.00 ?  162 LYS C CG   1  
ATOM   8537   C  CD   . LYS C  2 108 ? 19.072  51.126  -3.718  1.00 0.00 ?  162 LYS C CD   1  
ATOM   8538   C  CE   . LYS C  2 108 ? 18.375  52.500  -3.788  1.00 0.00 ?  162 LYS C CE   1  
ATOM   8539   N  NZ   . LYS C  2 108 ? 19.355  53.575  -3.505  1.00 0.00 1  162 LYS C NZ   1  
ATOM   8540   H  H    . LYS C  2 108 ? 17.857  48.107  -6.124  1.00 0.00 ?  162 LYS C H    1  
ATOM   8541   H  HA   . LYS C  2 108 ? 20.241  49.045  -5.003  1.00 0.00 ?  162 LYS C HA   1  
ATOM   8542   H  HB2  . LYS C  2 108 ? 17.777  47.874  -3.784  1.00 0.00 ?  162 LYS C HB2  1  
ATOM   8543   H  HB3  . LYS C  2 108 ? 19.236  48.438  -2.919  1.00 0.00 ?  162 LYS C HB3  1  
ATOM   8544   H  HG2  . LYS C  2 108 ? 17.784  50.369  -5.011  1.00 0.00 ?  162 LYS C HG2  1  
ATOM   8545   H  HG3  . LYS C  2 108 ? 17.172  50.277  -3.333  1.00 0.00 ?  162 LYS C HG3  1  
ATOM   8546   H  HD2  . LYS C  2 108 ? 19.580  50.957  -2.744  1.00 0.00 ?  162 LYS C HD2  1  
ATOM   8547   H  HD3  . LYS C  2 108 ? 19.780  50.989  -4.563  1.00 0.00 ?  162 LYS C HD3  1  
ATOM   8548   H  HE2  . LYS C  2 108 ? 17.922  52.609  -4.797  1.00 0.00 ?  162 LYS C HE2  1  
ATOM   8549   H  HE3  . LYS C  2 108 ? 17.547  52.426  -3.050  1.00 0.00 ?  162 LYS C HE3  1  
ATOM   8550   H  HZ1  . LYS C  2 108 ? 19.817  53.522  -2.574  1.00 0.00 ?  162 LYS C HZ1  1  
ATOM   8551   H  HZ2  . LYS C  2 108 ? 18.840  54.468  -3.639  1.00 0.00 ?  162 LYS C HZ2  1  
ATOM   8552   H  HZ3  . LYS C  2 108 ? 20.152  53.520  -4.171  1.00 0.00 ?  162 LYS C HZ3  1  
ATOM   8553   N  N    . LEU C  2 109 ? 19.564  45.802  -5.397  1.00 0.00 ?  163 LEU C N    1  
ATOM   8554   C  CA   . LEU C  2 109 ? 20.113  44.471  -5.385  1.00 0.00 ?  163 LEU C CA   1  
ATOM   8555   C  C    . LEU C  2 109 ? 21.349  44.441  -6.288  1.00 0.00 ?  163 LEU C C    1  
ATOM   8556   O  O    . LEU C  2 109 ? 22.243  43.603  -6.104  1.00 0.00 ?  163 LEU C O    1  
ATOM   8557   C  CB   . LEU C  2 109 ? 19.000  43.450  -5.655  1.00 0.00 ?  163 LEU C CB   1  
ATOM   8558   C  CG   . LEU C  2 109 ? 19.374  42.028  -5.946  1.00 0.00 ?  163 LEU C CG   1  
ATOM   8559   C  CD1  . LEU C  2 109 ? 19.997  41.334  -4.694  1.00 0.00 ?  163 LEU C CD1  1  
ATOM   8560   C  CD2  . LEU C  2 109 ? 18.144  41.233  -6.254  1.00 0.00 ?  163 LEU C CD2  1  
ATOM   8561   H  H    . LEU C  2 109 ? 18.641  45.895  -5.762  1.00 0.00 ?  163 LEU C H    1  
ATOM   8562   H  HA   . LEU C  2 109 ? 20.529  44.273  -4.408  1.00 0.00 ?  163 LEU C HA   1  
ATOM   8563   H  HB2  . LEU C  2 109 ? 18.335  43.423  -4.766  1.00 0.00 ?  163 LEU C HB2  1  
ATOM   8564   H  HB3  . LEU C  2 109 ? 18.324  43.818  -6.457  1.00 0.00 ?  163 LEU C HB3  1  
ATOM   8565   H  HG   . LEU C  2 109 ? 20.195  42.052  -6.693  1.00 0.00 ?  163 LEU C HG   1  
ATOM   8566   H  HD11 . LEU C  2 109 ? 19.314  41.369  -3.818  1.00 0.00 ?  163 LEU C HD11 1  
ATOM   8567   H  HD12 . LEU C  2 109 ? 20.943  41.852  -4.427  1.00 0.00 ?  163 LEU C HD12 1  
ATOM   8568   H  HD13 . LEU C  2 109 ? 20.240  40.254  -4.784  1.00 0.00 ?  163 LEU C HD13 1  
ATOM   8569   H  HD21 . LEU C  2 109 ? 17.542  41.840  -6.964  1.00 0.00 ?  163 LEU C HD21 1  
ATOM   8570   H  HD22 . LEU C  2 109 ? 17.443  41.052  -5.411  1.00 0.00 ?  163 LEU C HD22 1  
ATOM   8571   H  HD23 . LEU C  2 109 ? 18.225  40.199  -6.652  1.00 0.00 ?  163 LEU C HD23 1  
ATOM   8572   N  N    . SER C  2 110 ? 21.517  45.307  -7.308  1.00 0.00 ?  164 SER C N    1  
ATOM   8573   C  CA   . SER C  2 110 ? 22.576  45.228  -8.329  1.00 0.00 ?  164 SER C CA   1  
ATOM   8574   C  C    . SER C  2 110 ? 24.044  45.525  -7.831  1.00 0.00 ?  164 SER C C    1  
ATOM   8575   O  O    . SER C  2 110 ? 24.830  44.595  -8.130  1.00 0.00 ?  164 SER C O    1  
ATOM   8576   C  CB   . SER C  2 110 ? 22.193  46.096  -9.521  1.00 0.00 ?  164 SER C CB   1  
ATOM   8577   O  OG   . SER C  2 110 ? 23.095  45.780  -10.612 1.00 0.00 ?  164 SER C OG   1  
ATOM   8578   H  H    . SER C  2 110 ? 20.775  45.948  -7.488  1.00 0.00 ?  164 SER C H    1  
ATOM   8579   H  HA   . SER C  2 110 ? 22.514  44.213  -8.693  1.00 0.00 ?  164 SER C HA   1  
ATOM   8580   H  HB2  . SER C  2 110 ? 21.160  45.890  -9.875  1.00 0.00 ?  164 SER C HB2  1  
ATOM   8581   H  HB3  . SER C  2 110 ? 22.223  47.186  -9.308  1.00 0.00 ?  164 SER C HB3  1  
ATOM   8582   H  HG   . SER C  2 110 ? 23.962  46.052  -10.303 1.00 0.00 ?  164 SER C HG   1  
ATOM   8583   N  N    . PRO C  2 111 ? 24.409  46.617  -7.150  1.00 0.00 ?  165 PRO C N    1  
ATOM   8584   C  CA   . PRO C  2 111 ? 25.795  46.856  -6.613  1.00 0.00 ?  165 PRO C CA   1  
ATOM   8585   C  C    . PRO C  2 111 ? 26.018  45.968  -5.439  1.00 0.00 ?  165 PRO C C    1  
ATOM   8586   O  O    . PRO C  2 111 ? 27.176  45.620  -5.184  1.00 0.00 ?  165 PRO C O    1  
ATOM   8587   C  CB   . PRO C  2 111 ? 25.762  48.298  -6.178  1.00 0.00 ?  165 PRO C CB   1  
ATOM   8588   C  CG   . PRO C  2 111 ? 24.288  48.603  -5.828  1.00 0.00 ?  165 PRO C CG   1  
ATOM   8589   C  CD   . PRO C  2 111 ? 23.510  47.643  -6.697  1.00 0.00 ?  165 PRO C CD   1  
ATOM   8590   H  HA   . PRO C  2 111 ? 26.559  46.584  -7.326  1.00 0.00 ?  165 PRO C HA   1  
ATOM   8591   H  HB2  . PRO C  2 111 ? 26.526  48.579  -5.422  1.00 0.00 ?  165 PRO C HB2  1  
ATOM   8592   H  HB3  . PRO C  2 111 ? 26.052  48.851  -7.096  1.00 0.00 ?  165 PRO C HB3  1  
ATOM   8593   H  HG2  . PRO C  2 111 ? 24.122  48.458  -4.739  1.00 0.00 ?  165 PRO C HG2  1  
ATOM   8594   H  HG3  . PRO C  2 111 ? 24.033  49.634  -6.152  1.00 0.00 ?  165 PRO C HG3  1  
ATOM   8595   H  HD2  . PRO C  2 111 ? 22.702  47.183  -6.089  1.00 0.00 ?  165 PRO C HD2  1  
ATOM   8596   H  HD3  . PRO C  2 111 ? 23.035  48.270  -7.482  1.00 0.00 ?  165 PRO C HD3  1  
ATOM   8597   N  N    . LEU C  2 112 ? 24.933  45.373  -4.855  1.00 0.00 ?  166 LEU C N    1  
ATOM   8598   C  CA   . LEU C  2 112 ? 25.090  44.466  -3.715  1.00 0.00 ?  166 LEU C CA   1  
ATOM   8599   C  C    . LEU C  2 112 ? 25.526  43.124  -4.385  1.00 0.00 ?  166 LEU C C    1  
ATOM   8600   O  O    . LEU C  2 112 ? 26.480  42.445  -3.913  1.00 0.00 ?  166 LEU C O    1  
ATOM   8601   C  CB   . LEU C  2 112 ? 23.837  44.216  -2.869  1.00 0.00 ?  166 LEU C CB   1  
ATOM   8602   C  CG   . LEU C  2 112 ? 23.943  43.479  -1.443  1.00 0.00 ?  166 LEU C CG   1  
ATOM   8603   C  CD1  . LEU C  2 112 ? 24.056  41.948  -1.577  1.00 0.00 ?  166 LEU C CD1  1  
ATOM   8604   C  CD2  . LEU C  2 112 ? 24.991  44.077  -0.476  1.00 0.00 ?  166 LEU C CD2  1  
ATOM   8605   H  H    . LEU C  2 112 ? 23.992  45.656  -5.027  1.00 0.00 ?  166 LEU C H    1  
ATOM   8606   H  HA   . LEU C  2 112 ? 25.916  44.771  -3.089  1.00 0.00 ?  166 LEU C HA   1  
ATOM   8607   H  HB2  . LEU C  2 112 ? 23.438  45.229  -2.649  1.00 0.00 ?  166 LEU C HB2  1  
ATOM   8608   H  HB3  . LEU C  2 112 ? 23.044  43.650  -3.405  1.00 0.00 ?  166 LEU C HB3  1  
ATOM   8609   H  HG   . LEU C  2 112 ? 22.990  43.754  -0.942  1.00 0.00 ?  166 LEU C HG   1  
ATOM   8610   H  HD11 . LEU C  2 112 ? 23.074  41.699  -2.032  1.00 0.00 ?  166 LEU C HD11 1  
ATOM   8611   H  HD12 . LEU C  2 112 ? 24.087  41.556  -0.538  1.00 0.00 ?  166 LEU C HD12 1  
ATOM   8612   H  HD13 . LEU C  2 112 ? 24.966  41.599  -2.110  1.00 0.00 ?  166 LEU C HD13 1  
ATOM   8613   H  HD21 . LEU C  2 112 ? 24.855  45.179  -0.503  1.00 0.00 ?  166 LEU C HD21 1  
ATOM   8614   H  HD22 . LEU C  2 112 ? 26.016  43.852  -0.842  1.00 0.00 ?  166 LEU C HD22 1  
ATOM   8615   H  HD23 . LEU C  2 112 ? 24.905  43.702  0.567   1.00 0.00 ?  166 LEU C HD23 1  
ATOM   8616   N  N    . GLY C  2 113 ? 24.927  42.881  -5.500  1.00 0.00 ?  167 GLY C N    1  
ATOM   8617   C  CA   . GLY C  2 113 ? 25.281  41.676  -6.283  1.00 0.00 ?  167 GLY C CA   1  
ATOM   8618   C  C    . GLY C  2 113 ? 26.618  41.686  -6.853  1.00 0.00 ?  167 GLY C C    1  
ATOM   8619   O  O    . GLY C  2 113 ? 27.289  40.649  -6.767  1.00 0.00 ?  167 GLY C O    1  
ATOM   8620   H  H    . GLY C  2 113 ? 24.189  43.481  -5.798  1.00 0.00 ?  167 GLY C H    1  
ATOM   8621   H  HA2  . GLY C  2 113 ? 25.265  40.876  -5.558  1.00 0.00 ?  167 GLY C HA2  1  
ATOM   8622   H  HA3  . GLY C  2 113 ? 24.547  41.577  -7.069  1.00 0.00 ?  167 GLY C HA3  1  
ATOM   8623   N  N    . GLU C  2 114 ? 27.079  42.846  -7.412  1.00 0.00 ?  168 GLU C N    1  
ATOM   8624   C  CA   . GLU C  2 114 ? 28.408  42.996  -7.978  1.00 0.00 ?  168 GLU C CA   1  
ATOM   8625   C  C    . GLU C  2 114 ? 29.555  42.811  -7.016  1.00 0.00 ?  168 GLU C C    1  
ATOM   8626   O  O    . GLU C  2 114 ? 30.499  42.086  -7.196  1.00 0.00 ?  168 GLU C O    1  
ATOM   8627   C  CB   . GLU C  2 114 ? 28.489  44.391  -8.721  1.00 0.00 ?  168 GLU C CB   1  
ATOM   8628   C  CG   . GLU C  2 114 ? 29.892  45.000  -9.032  1.00 0.00 ?  168 GLU C CG   1  
ATOM   8629   C  CD   . GLU C  2 114 ? 29.750  46.227  -9.835  1.00 0.00 ?  168 GLU C CD   1  
ATOM   8630   O  OE1  . GLU C  2 114 ? 30.600  46.399  -10.761 1.00 0.00 ?  168 GLU C OE1  1  
ATOM   8631   O  OE2  . GLU C  2 114 ? 28.956  47.139  -9.402  1.00 0.00 -1 168 GLU C OE2  1  
ATOM   8632   H  H    . GLU C  2 114 ? 26.459  43.624  -7.352  1.00 0.00 ?  168 GLU C H    1  
ATOM   8633   H  HA   . GLU C  2 114 ? 28.507  42.116  -8.595  1.00 0.00 ?  168 GLU C HA   1  
ATOM   8634   H  HB2  . GLU C  2 114 ? 27.905  44.364  -9.665  1.00 0.00 ?  168 GLU C HB2  1  
ATOM   8635   H  HB3  . GLU C  2 114 ? 28.053  45.202  -8.100  1.00 0.00 ?  168 GLU C HB3  1  
ATOM   8636   H  HG2  . GLU C  2 114 ? 30.475  45.173  -8.102  1.00 0.00 ?  168 GLU C HG2  1  
ATOM   8637   H  HG3  . GLU C  2 114 ? 30.324  44.238  -9.716  1.00 0.00 ?  168 GLU C HG3  1  
ATOM   8638   N  N    . GLU C  2 115 ? 29.494  43.549  -5.895  1.00 0.00 ?  169 GLU C N    1  
ATOM   8639   C  CA   . GLU C  2 115 ? 30.370  43.369  -4.749  1.00 0.00 ?  169 GLU C CA   1  
ATOM   8640   C  C    . GLU C  2 115 ? 30.354  41.940  -4.205  1.00 0.00 ?  169 GLU C C    1  
ATOM   8641   O  O    . GLU C  2 115 ? 31.362  41.246  -3.900  1.00 0.00 ?  169 GLU C O    1  
ATOM   8642   C  CB   . GLU C  2 115 ? 29.985  44.375  -3.625  1.00 0.00 ?  169 GLU C CB   1  
ATOM   8643   C  CG   . GLU C  2 115 ? 30.426  45.823  -3.871  1.00 0.00 ?  169 GLU C CG   1  
ATOM   8644   C  CD   . GLU C  2 115 ? 31.984  45.922  -3.870  1.00 0.00 ?  169 GLU C CD   1  
ATOM   8645   O  OE1  . GLU C  2 115 ? 32.565  46.619  -4.731  1.00 0.00 ?  169 GLU C OE1  1  
ATOM   8646   O  OE2  . GLU C  2 115 ? 32.567  45.523  -2.838  1.00 0.00 -1 169 GLU C OE2  1  
ATOM   8647   H  H    . GLU C  2 115 ? 28.725  44.177  -5.805  1.00 0.00 ?  169 GLU C H    1  
ATOM   8648   H  HA   . GLU C  2 115 ? 31.399  43.572  -5.006  1.00 0.00 ?  169 GLU C HA   1  
ATOM   8649   H  HB2  . GLU C  2 115 ? 28.883  44.349  -3.491  1.00 0.00 ?  169 GLU C HB2  1  
ATOM   8650   H  HB3  . GLU C  2 115 ? 30.411  44.034  -2.657  1.00 0.00 ?  169 GLU C HB3  1  
ATOM   8651   H  HG2  . GLU C  2 115 ? 30.070  46.100  -4.886  1.00 0.00 ?  169 GLU C HG2  1  
ATOM   8652   H  HG3  . GLU C  2 115 ? 29.981  46.591  -3.202  1.00 0.00 ?  169 GLU C HG3  1  
ATOM   8653   N  N    . MET C  2 116 ? 29.147  41.383  -3.979  1.00 0.00 ?  170 MET C N    1  
ATOM   8654   C  CA   . MET C  2 116 ? 29.044  39.997  -3.430  1.00 0.00 ?  170 MET C CA   1  
ATOM   8655   C  C    . MET C  2 116 ? 29.550  38.907  -4.351  1.00 0.00 ?  170 MET C C    1  
ATOM   8656   O  O    . MET C  2 116 ? 30.241  37.972  -3.947  1.00 0.00 ?  170 MET C O    1  
ATOM   8657   C  CB   . MET C  2 116 ? 27.568  39.690  -3.258  1.00 0.00 ?  170 MET C CB   1  
ATOM   8658   C  CG   . MET C  2 116 ? 27.217  38.324  -2.690  1.00 0.00 ?  170 MET C CG   1  
ATOM   8659   S  SD   . MET C  2 116 ? 27.880  37.980  -1.060  1.00 0.00 ?  170 MET C SD   1  
ATOM   8660   C  CE   . MET C  2 116 ? 26.701  36.582  -0.805  1.00 0.00 ?  170 MET C CE   1  
ATOM   8661   H  H    . MET C  2 116 ? 28.260  41.839  -3.990  1.00 0.00 ?  170 MET C H    1  
ATOM   8662   H  HA   . MET C  2 116 ? 29.561  39.943  -2.483  1.00 0.00 ?  170 MET C HA   1  
ATOM   8663   H  HB2  . MET C  2 116 ? 27.324  40.527  -2.570  1.00 0.00 ?  170 MET C HB2  1  
ATOM   8664   H  HB3  . MET C  2 116 ? 27.087  39.780  -4.256  1.00 0.00 ?  170 MET C HB3  1  
ATOM   8665   H  HG2  . MET C  2 116 ? 26.112  38.217  -2.710  1.00 0.00 ?  170 MET C HG2  1  
ATOM   8666   H  HG3  . MET C  2 116 ? 27.461  37.497  -3.391  1.00 0.00 ?  170 MET C HG3  1  
ATOM   8667   H  HE1  . MET C  2 116 ? 26.671  36.032  -1.770  1.00 0.00 ?  170 MET C HE1  1  
ATOM   8668   H  HE2  . MET C  2 116 ? 25.679  36.890  -0.495  1.00 0.00 ?  170 MET C HE2  1  
ATOM   8669   H  HE3  . MET C  2 116 ? 27.022  35.866  -0.019  1.00 0.00 ?  170 MET C HE3  1  
ATOM   8670   N  N    . ARG C  2 117 ? 29.376  39.029  -5.729  1.00 0.00 ?  171 ARG C N    1  
ATOM   8671   C  CA   . ARG C  2 117 ? 29.795  38.140  -6.749  1.00 0.00 ?  171 ARG C CA   1  
ATOM   8672   C  C    . ARG C  2 117 ? 31.301  38.036  -6.871  1.00 0.00 ?  171 ARG C C    1  
ATOM   8673   O  O    . ARG C  2 117 ? 31.897  36.974  -6.986  1.00 0.00 ?  171 ARG C O    1  
ATOM   8674   C  CB   . ARG C  2 117 ? 28.975  38.546  -8.027  1.00 0.00 ?  171 ARG C CB   1  
ATOM   8675   C  CG   . ARG C  2 117 ? 29.516  37.812  -9.346  1.00 0.00 ?  171 ARG C CG   1  
ATOM   8676   C  CD   . ARG C  2 117 ? 30.637  38.500  -10.096 1.00 0.00 ?  171 ARG C CD   1  
ATOM   8677   N  NE   . ARG C  2 117 ? 30.021  39.837  -10.502 1.00 0.00 ?  171 ARG C NE   1  
ATOM   8678   C  CZ   . ARG C  2 117 ? 30.639  40.966  -10.769 1.00 0.00 ?  171 ARG C CZ   1  
ATOM   8679   N  NH1  . ARG C  2 117 ? 29.965  41.952  -11.273 1.00 0.00 1  171 ARG C NH1  1  
ATOM   8680   N  NH2  . ARG C  2 117 ? 31.947  41.084  -10.637 1.00 0.00 ?  171 ARG C NH2  1  
ATOM   8681   H  H    . ARG C  2 117 ? 28.816  39.805  -6.007  1.00 0.00 ?  171 ARG C H    1  
ATOM   8682   H  HA   . ARG C  2 117 ? 29.474  37.123  -6.578  1.00 0.00 ?  171 ARG C HA   1  
ATOM   8683   H  HB2  . ARG C  2 117 ? 27.930  38.214  -7.845  1.00 0.00 ?  171 ARG C HB2  1  
ATOM   8684   H  HB3  . ARG C  2 117 ? 28.989  39.651  -8.141  1.00 0.00 ?  171 ARG C HB3  1  
ATOM   8685   H  HG2  . ARG C  2 117 ? 29.789  36.797  -8.989  1.00 0.00 ?  171 ARG C HG2  1  
ATOM   8686   H  HG3  . ARG C  2 117 ? 28.704  37.564  -10.063 1.00 0.00 ?  171 ARG C HG3  1  
ATOM   8687   H  HD2  . ARG C  2 117 ? 31.536  38.633  -9.458  1.00 0.00 ?  171 ARG C HD2  1  
ATOM   8688   H  HD3  . ARG C  2 117 ? 30.949  37.867  -10.954 1.00 0.00 ?  171 ARG C HD3  1  
ATOM   8689   H  HE   . ARG C  2 117 ? 29.024  39.905  -10.478 1.00 0.00 ?  171 ARG C HE   1  
ATOM   8690   H  HH11 . ARG C  2 117 ? 30.331  42.818  -11.614 1.00 0.00 ?  171 ARG C HH11 1  
ATOM   8691   H  HH12 . ARG C  2 117 ? 29.151  41.747  -11.817 1.00 0.00 ?  171 ARG C HH12 1  
ATOM   8692   H  HH21 . ARG C  2 117 ? 32.581  40.322  -10.506 1.00 0.00 ?  171 ARG C HH21 1  
ATOM   8693   H  HH22 . ARG C  2 117 ? 32.239  41.977  -10.980 1.00 0.00 ?  171 ARG C HH22 1  
ATOM   8694   N  N    . ASP C  2 118 ? 31.910  39.211  -6.766  1.00 0.00 ?  172 ASP C N    1  
ATOM   8695   C  CA   . ASP C  2 118 ? 33.348  39.311  -6.639  1.00 0.00 ?  172 ASP C CA   1  
ATOM   8696   C  C    . ASP C  2 118 ? 33.916  38.763  -5.381  1.00 0.00 ?  172 ASP C C    1  
ATOM   8697   O  O    . ASP C  2 118 ? 34.913  38.054  -5.447  1.00 0.00 ?  172 ASP C O    1  
ATOM   8698   C  CB   . ASP C  2 118 ? 33.822  40.752  -6.768  1.00 0.00 ?  172 ASP C CB   1  
ATOM   8699   C  CG   . ASP C  2 118 ? 35.159  40.735  -7.445  1.00 0.00 ?  172 ASP C CG   1  
ATOM   8700   O  OD1  . ASP C  2 118 ? 35.802  41.806  -7.288  1.00 0.00 ?  172 ASP C OD1  1  
ATOM   8701   O  OD2  . ASP C  2 118 ? 35.668  39.777  -8.012  1.00 0.00 -1 172 ASP C OD2  1  
ATOM   8702   H  H    . ASP C  2 118 ? 31.386  40.029  -6.543  1.00 0.00 ?  172 ASP C H    1  
ATOM   8703   H  HA   . ASP C  2 118 ? 33.638  38.630  -7.426  1.00 0.00 ?  172 ASP C HA   1  
ATOM   8704   H  HB2  . ASP C  2 118 ? 33.196  41.321  -7.488  1.00 0.00 ?  172 ASP C HB2  1  
ATOM   8705   H  HB3  . ASP C  2 118 ? 33.866  41.276  -5.790  1.00 0.00 ?  172 ASP C HB3  1  
ATOM   8706   N  N    . ARG C  2 119 ? 33.308  39.015  -4.217  1.00 0.00 ?  173 ARG C N    1  
ATOM   8707   C  CA   . ARG C  2 119 ? 33.752  38.392  -2.927  1.00 0.00 ?  173 ARG C CA   1  
ATOM   8708   C  C    . ARG C  2 119 ? 33.759  36.857  -2.961  1.00 0.00 ?  173 ARG C C    1  
ATOM   8709   O  O    . ARG C  2 119 ? 34.569  36.164  -2.351  1.00 0.00 ?  173 ARG C O    1  
ATOM   8710   C  CB   . ARG C  2 119 ? 32.868  39.048  -1.809  1.00 0.00 ?  173 ARG C CB   1  
ATOM   8711   C  CG   . ARG C  2 119 ? 33.141  38.519  -0.434  1.00 0.00 ?  173 ARG C CG   1  
ATOM   8712   C  CD   . ARG C  2 119 ? 34.550  38.541  0.058   1.00 0.00 ?  173 ARG C CD   1  
ATOM   8713   N  NE   . ARG C  2 119 ? 34.678  37.862  1.399   1.00 0.00 ?  173 ARG C NE   1  
ATOM   8714   C  CZ   . ARG C  2 119 ? 35.793  37.729  2.091   1.00 0.00 ?  173 ARG C CZ   1  
ATOM   8715   N  NH1  . ARG C  2 119 ? 35.779  37.008  3.255   1.00 0.00 1  173 ARG C NH1  1  
ATOM   8716   N  NH2  . ARG C  2 119 ? 36.981  38.166  1.712   1.00 0.00 ?  173 ARG C NH2  1  
ATOM   8717   H  H    . ARG C  2 119 ? 32.452  39.526  -4.211  1.00 0.00 ?  173 ARG C H    1  
ATOM   8718   H  HA   . ARG C  2 119 ? 34.770  38.654  -2.677  1.00 0.00 ?  173 ARG C HA   1  
ATOM   8719   H  HB2  . ARG C  2 119 ? 32.965  40.143  -1.648  1.00 0.00 ?  173 ARG C HB2  1  
ATOM   8720   H  HB3  . ARG C  2 119 ? 31.815  39.000  -2.160  1.00 0.00 ?  173 ARG C HB3  1  
ATOM   8721   H  HG2  . ARG C  2 119 ? 32.474  38.988  0.321   1.00 0.00 ?  173 ARG C HG2  1  
ATOM   8722   H  HG3  . ARG C  2 119 ? 32.772  37.473  -0.505  1.00 0.00 ?  173 ARG C HG3  1  
ATOM   8723   H  HD2  . ARG C  2 119 ? 35.169  37.942  -0.644  1.00 0.00 ?  173 ARG C HD2  1  
ATOM   8724   H  HD3  . ARG C  2 119 ? 34.827  39.610  0.176   1.00 0.00 ?  173 ARG C HD3  1  
ATOM   8725   H  HE   . ARG C  2 119 ? 33.832  37.648  1.887   1.00 0.00 ?  173 ARG C HE   1  
ATOM   8726   H  HH11 . ARG C  2 119 ? 34.959  36.461  3.425   1.00 0.00 ?  173 ARG C HH11 1  
ATOM   8727   H  HH12 . ARG C  2 119 ? 36.658  36.686  3.606   1.00 0.00 ?  173 ARG C HH12 1  
ATOM   8728   H  HH21 . ARG C  2 119 ? 37.793  37.950  2.255   1.00 0.00 ?  173 ARG C HH21 1  
ATOM   8729   H  HH22 . ARG C  2 119 ? 37.176  38.605  0.835   1.00 0.00 ?  173 ARG C HH22 1  
ATOM   8730   N  N    . ALA C  2 120 ? 32.716  36.257  -3.570  1.00 0.00 ?  174 ALA C N    1  
ATOM   8731   C  CA   . ALA C  2 120 ? 32.651  34.840  -3.847  1.00 0.00 ?  174 ALA C CA   1  
ATOM   8732   C  C    . ALA C  2 120 ? 33.650  34.263  -4.676  1.00 0.00 ?  174 ALA C C    1  
ATOM   8733   O  O    . ALA C  2 120 ? 34.338  33.322  -4.352  1.00 0.00 ?  174 ALA C O    1  
ATOM   8734   C  CB   . ALA C  2 120 ? 31.240  34.509  -4.338  1.00 0.00 ?  174 ALA C CB   1  
ATOM   8735   H  H    . ALA C  2 120 ? 31.914  36.847  -3.630  1.00 0.00 ?  174 ALA C H    1  
ATOM   8736   H  HA   . ALA C  2 120 ? 32.710  34.287  -2.921  1.00 0.00 ?  174 ALA C HA   1  
ATOM   8737   H  HB1  . ALA C  2 120 ? 31.217  33.424  -4.577  1.00 0.00 ?  174 ALA C HB1  1  
ATOM   8738   H  HB2  . ALA C  2 120 ? 30.909  34.980  -5.288  1.00 0.00 ?  174 ALA C HB2  1  
ATOM   8739   H  HB3  . ALA C  2 120 ? 30.530  34.897  -3.576  1.00 0.00 ?  174 ALA C HB3  1  
ATOM   8740   N  N    . ARG C  2 121 ? 33.921  35.016  -5.801  1.00 0.00 ?  175 ARG C N    1  
ATOM   8741   C  CA   . ARG C  2 121 ? 34.985  34.627  -6.613  1.00 0.00 ?  175 ARG C CA   1  
ATOM   8742   C  C    . ARG C  2 121 ? 36.330  34.723  -5.870  1.00 0.00 ?  175 ARG C C    1  
ATOM   8743   O  O    . ARG C  2 121 ? 37.179  33.850  -5.964  1.00 0.00 ?  175 ARG C O    1  
ATOM   8744   C  CB   . ARG C  2 121 ? 35.015  35.587  -7.715  1.00 0.00 ?  175 ARG C CB   1  
ATOM   8745   C  CG   . ARG C  2 121 ? 36.017  35.465  -8.870  1.00 0.00 ?  175 ARG C CG   1  
ATOM   8746   C  CD   . ARG C  2 121 ? 37.427  36.001  -8.575  1.00 0.00 ?  175 ARG C CD   1  
ATOM   8747   N  NE   . ARG C  2 121 ? 37.527  37.372  -7.935  1.00 0.00 ?  175 ARG C NE   1  
ATOM   8748   C  CZ   . ARG C  2 121 ? 38.550  37.907  -7.305  1.00 0.00 ?  175 ARG C CZ   1  
ATOM   8749   N  NH1  . ARG C  2 121 ? 38.351  39.104  -6.806  1.00 0.00 1  175 ARG C NH1  1  
ATOM   8750   N  NH2  . ARG C  2 121 ? 39.689  37.301  -7.093  1.00 0.00 ?  175 ARG C NH2  1  
ATOM   8751   H  H    . ARG C  2 121 ? 33.357  35.815  -5.995  1.00 0.00 ?  175 ARG C H    1  
ATOM   8752   H  HA   . ARG C  2 121 ? 34.823  33.679  -7.105  1.00 0.00 ?  175 ARG C HA   1  
ATOM   8753   H  HB2  . ARG C  2 121 ? 33.956  35.544  -8.047  1.00 0.00 ?  175 ARG C HB2  1  
ATOM   8754   H  HB3  . ARG C  2 121 ? 34.993  36.638  -7.356  1.00 0.00 ?  175 ARG C HB3  1  
ATOM   8755   H  HG2  . ARG C  2 121 ? 35.968  34.475  -9.372  1.00 0.00 ?  175 ARG C HG2  1  
ATOM   8756   H  HG3  . ARG C  2 121 ? 35.508  36.118  -9.612  1.00 0.00 ?  175 ARG C HG3  1  
ATOM   8757   H  HD2  . ARG C  2 121 ? 37.940  35.241  -7.948  1.00 0.00 ?  175 ARG C HD2  1  
ATOM   8758   H  HD3  . ARG C  2 121 ? 37.911  36.171  -9.560  1.00 0.00 ?  175 ARG C HD3  1  
ATOM   8759   H  HE   . ARG C  2 121 ? 36.690  37.856  -7.680  1.00 0.00 ?  175 ARG C HE   1  
ATOM   8760   H  HH11 . ARG C  2 121 ? 37.462  39.484  -7.061  1.00 0.00 ?  175 ARG C HH11 1  
ATOM   8761   H  HH12 . ARG C  2 121 ? 39.166  39.674  -6.696  1.00 0.00 ?  175 ARG C HH12 1  
ATOM   8762   H  HH21 . ARG C  2 121 ? 40.332  37.759  -6.478  1.00 0.00 ?  175 ARG C HH21 1  
ATOM   8763   H  HH22 . ARG C  2 121 ? 39.673  36.309  -7.216  1.00 0.00 ?  175 ARG C HH22 1  
ATOM   8764   N  N    . ALA C  2 122 ? 36.551  35.808  -5.053  1.00 0.00 ?  176 ALA C N    1  
ATOM   8765   C  CA   . ALA C  2 122 ? 37.798  36.053  -4.334  1.00 0.00 ?  176 ALA C CA   1  
ATOM   8766   C  C    . ALA C  2 122 ? 37.968  35.046  -3.166  1.00 0.00 ?  176 ALA C C    1  
ATOM   8767   O  O    . ALA C  2 122 ? 39.055  34.640  -2.795  1.00 0.00 ?  176 ALA C O    1  
ATOM   8768   C  CB   . ALA C  2 122 ? 37.696  37.481  -3.764  1.00 0.00 ?  176 ALA C CB   1  
ATOM   8769   H  H    . ALA C  2 122 ? 35.799  36.463  -5.056  1.00 0.00 ?  176 ALA C H    1  
ATOM   8770   H  HA   . ALA C  2 122 ? 38.652  35.894  -4.975  1.00 0.00 ?  176 ALA C HA   1  
ATOM   8771   H  HB1  . ALA C  2 122 ? 37.087  37.526  -2.836  1.00 0.00 ?  176 ALA C HB1  1  
ATOM   8772   H  HB2  . ALA C  2 122 ? 37.121  38.171  -4.419  1.00 0.00 ?  176 ALA C HB2  1  
ATOM   8773   H  HB3  . ALA C  2 122 ? 38.640  38.055  -3.644  1.00 0.00 ?  176 ALA C HB3  1  
ATOM   8774   N  N    . HIS C  2 123 ? 36.881  34.421  -2.672  1.00 0.00 ?  177 HIS C N    1  
ATOM   8775   C  CA   . HIS C  2 123 ? 36.929  33.475  -1.565  1.00 0.00 ?  177 HIS C CA   1  
ATOM   8776   C  C    . HIS C  2 123 ? 37.408  32.091  -2.022  1.00 0.00 ?  177 HIS C C    1  
ATOM   8777   O  O    . HIS C  2 123 ? 38.093  31.396  -1.275  1.00 0.00 ?  177 HIS C O    1  
ATOM   8778   C  CB   . HIS C  2 123 ? 35.556  33.273  -0.743  1.00 0.00 ?  177 HIS C CB   1  
ATOM   8779   C  CG   . HIS C  2 123 ? 35.691  32.748  0.666   1.00 0.00 ?  177 HIS C CG   1  
ATOM   8780   N  ND1  . HIS C  2 123 ? 36.246  33.505  1.688   1.00 0.00 ?  177 HIS C ND1  1  
ATOM   8781   C  CD2  . HIS C  2 123 ? 34.982  31.700  1.273   1.00 0.00 ?  177 HIS C CD2  1  
ATOM   8782   C  CE1  . HIS C  2 123 ? 35.955  32.924  2.821   1.00 0.00 ?  177 HIS C CE1  1  
ATOM   8783   N  NE2  . HIS C  2 123 ? 35.206  31.856  2.664   1.00 0.00 ?  177 HIS C NE2  1  
ATOM   8784   H  H    . HIS C  2 123 ? 35.986  34.751  -2.964  1.00 0.00 ?  177 HIS C H    1  
ATOM   8785   H  HA   . HIS C  2 123 ? 37.623  33.887  -0.848  1.00 0.00 ?  177 HIS C HA   1  
ATOM   8786   H  HB2  . HIS C  2 123 ? 35.126  34.275  -0.526  1.00 0.00 ?  177 HIS C HB2  1  
ATOM   8787   H  HB3  . HIS C  2 123 ? 34.851  32.638  -1.321  1.00 0.00 ?  177 HIS C HB3  1  
ATOM   8788   H  HD1  . HIS C  2 123 ? 36.823  34.317  1.603   1.00 0.00 ?  177 HIS C HD1  1  
ATOM   8789   H  HD2  . HIS C  2 123 ? 34.465  30.870  0.809   1.00 0.00 ?  177 HIS C HD2  1  
ATOM   8790   H  HE1  . HIS C  2 123 ? 36.346  33.330  3.754   1.00 0.00 ?  177 HIS C HE1  1  
ATOM   8791   N  N    . VAL C  2 124 ? 37.013  31.782  -3.306  1.00 0.00 ?  178 VAL C N    1  
ATOM   8792   C  CA   . VAL C  2 124 ? 37.385  30.547  -3.938  1.00 0.00 ?  178 VAL C CA   1  
ATOM   8793   C  C    . VAL C  2 124 ? 38.855  30.634  -4.399  1.00 0.00 ?  178 VAL C C    1  
ATOM   8794   O  O    . VAL C  2 124 ? 39.652  29.688  -4.242  1.00 0.00 ?  178 VAL C O    1  
ATOM   8795   C  CB   . VAL C  2 124 ? 36.448  30.247  -5.086  1.00 0.00 ?  178 VAL C CB   1  
ATOM   8796   C  CG1  . VAL C  2 124 ? 36.943  29.230  -6.140  1.00 0.00 ?  178 VAL C CG1  1  
ATOM   8797   C  CG2  . VAL C  2 124 ? 35.130  29.784  -4.461  1.00 0.00 ?  178 VAL C CG2  1  
ATOM   8798   H  H    . VAL C  2 124 ? 36.404  32.335  -3.869  1.00 0.00 ?  178 VAL C H    1  
ATOM   8799   H  HA   . VAL C  2 124 ? 37.310  29.659  -3.328  1.00 0.00 ?  178 VAL C HA   1  
ATOM   8800   H  HB   . VAL C  2 124 ? 36.291  31.196  -5.643  1.00 0.00 ?  178 VAL C HB   1  
ATOM   8801   H  HG11 . VAL C  2 124 ? 37.755  29.701  -6.735  1.00 0.00 ?  178 VAL C HG11 1  
ATOM   8802   H  HG12 . VAL C  2 124 ? 36.105  29.000  -6.832  1.00 0.00 ?  178 VAL C HG12 1  
ATOM   8803   H  HG13 . VAL C  2 124 ? 37.193  28.313  -5.565  1.00 0.00 ?  178 VAL C HG13 1  
ATOM   8804   H  HG21 . VAL C  2 124 ? 35.285  28.926  -3.773  1.00 0.00 ?  178 VAL C HG21 1  
ATOM   8805   H  HG22 . VAL C  2 124 ? 34.329  29.605  -5.210  1.00 0.00 ?  178 VAL C HG22 1  
ATOM   8806   H  HG23 . VAL C  2 124 ? 34.703  30.650  -3.911  1.00 0.00 ?  178 VAL C HG23 1  
ATOM   8807   N  N    . ASP C  2 125 ? 39.356  31.792  -4.863  1.00 0.00 ?  179 ASP C N    1  
ATOM   8808   C  CA   . ASP C  2 125 ? 40.698  32.087  -5.275  1.00 0.00 ?  179 ASP C CA   1  
ATOM   8809   C  C    . ASP C  2 125 ? 41.632  32.022  -4.104  1.00 0.00 ?  179 ASP C C    1  
ATOM   8810   O  O    . ASP C  2 125 ? 42.631  31.276  -4.134  1.00 0.00 ?  179 ASP C O    1  
ATOM   8811   C  CB   . ASP C  2 125 ? 40.720  33.597  -5.787  1.00 0.00 ?  179 ASP C CB   1  
ATOM   8812   C  CG   . ASP C  2 125 ? 40.253  33.584  -7.227  1.00 0.00 ?  179 ASP C CG   1  
ATOM   8813   O  OD1  . ASP C  2 125 ? 40.282  34.718  -7.763  1.00 0.00 ?  179 ASP C OD1  1  
ATOM   8814   O  OD2  . ASP C  2 125 ? 40.039  32.531  -7.912  1.00 0.00 -1 179 ASP C OD2  1  
ATOM   8815   H  H    . ASP C  2 125 ? 38.745  32.579  -4.918  1.00 0.00 ?  179 ASP C H    1  
ATOM   8816   H  HA   . ASP C  2 125 ? 41.036  31.344  -5.982  1.00 0.00 ?  179 ASP C HA   1  
ATOM   8817   H  HB2  . ASP C  2 125 ? 40.071  34.320  -5.248  1.00 0.00 ?  179 ASP C HB2  1  
ATOM   8818   H  HB3  . ASP C  2 125 ? 41.762  33.971  -5.700  1.00 0.00 ?  179 ASP C HB3  1  
ATOM   8819   N  N    . ALA C  2 126 ? 41.356  32.706  -2.949  1.00 0.00 ?  180 ALA C N    1  
ATOM   8820   C  CA   . ALA C  2 126 ? 42.049  32.523  -1.696  1.00 0.00 ?  180 ALA C CA   1  
ATOM   8821   C  C    . ALA C  2 126 ? 41.973  31.057  -1.150  1.00 0.00 ?  180 ALA C C    1  
ATOM   8822   O  O    . ALA C  2 126 ? 43.006  30.531  -0.665  1.00 0.00 ?  180 ALA C O    1  
ATOM   8823   C  CB   . ALA C  2 126 ? 41.375  33.489  -0.613  1.00 0.00 ?  180 ALA C CB   1  
ATOM   8824   H  H    . ALA C  2 126 ? 40.626  33.376  -2.842  1.00 0.00 ?  180 ALA C H    1  
ATOM   8825   H  HA   . ALA C  2 126 ? 43.114  32.672  -1.802  1.00 0.00 ?  180 ALA C HA   1  
ATOM   8826   H  HB1  . ALA C  2 126 ? 41.378  34.550  -0.942  1.00 0.00 ?  180 ALA C HB1  1  
ATOM   8827   H  HB2  . ALA C  2 126 ? 41.964  33.310  0.312   1.00 0.00 ?  180 ALA C HB2  1  
ATOM   8828   H  HB3  . ALA C  2 126 ? 40.327  33.169  -0.429  1.00 0.00 ?  180 ALA C HB3  1  
ATOM   8829   N  N    . LEU C  2 127 ? 40.780  30.374  -1.208  1.00 0.00 ?  181 LEU C N    1  
ATOM   8830   C  CA   . LEU C  2 127 ? 40.697  28.877  -0.955  1.00 0.00 ?  181 LEU C CA   1  
ATOM   8831   C  C    . LEU C  2 127 ? 41.552  27.993  -1.787  1.00 0.00 ?  181 LEU C C    1  
ATOM   8832   O  O    . LEU C  2 127 ? 42.171  27.052  -1.307  1.00 0.00 ?  181 LEU C O    1  
ATOM   8833   C  CB   . LEU C  2 127 ? 39.179  28.383  -0.911  1.00 0.00 ?  181 LEU C CB   1  
ATOM   8834   C  CG   . LEU C  2 127 ? 38.608  28.664  0.531   1.00 0.00 ?  181 LEU C CG   1  
ATOM   8835   C  CD1  . LEU C  2 127 ? 37.153  28.273  0.588   1.00 0.00 ?  181 LEU C CD1  1  
ATOM   8836   C  CD2  . LEU C  2 127 ? 39.353  27.918  1.661   1.00 0.00 ?  181 LEU C CD2  1  
ATOM   8837   H  H    . LEU C  2 127 ? 39.976  30.829  -1.584  1.00 0.00 ?  181 LEU C H    1  
ATOM   8838   H  HA   . LEU C  2 127 ? 40.980  28.738  0.077   1.00 0.00 ?  181 LEU C HA   1  
ATOM   8839   H  HB2  . LEU C  2 127 ? 38.669  29.014  -1.670  1.00 0.00 ?  181 LEU C HB2  1  
ATOM   8840   H  HB3  . LEU C  2 127 ? 39.049  27.324  -1.220  1.00 0.00 ?  181 LEU C HB3  1  
ATOM   8841   H  HG   . LEU C  2 127 ? 38.741  29.734  0.800   1.00 0.00 ?  181 LEU C HG   1  
ATOM   8842   H  HD11 . LEU C  2 127 ? 36.620  28.762  1.431   1.00 0.00 ?  181 LEU C HD11 1  
ATOM   8843   H  HD12 . LEU C  2 127 ? 37.116  27.163  0.547   1.00 0.00 ?  181 LEU C HD12 1  
ATOM   8844   H  HD13 . LEU C  2 127 ? 36.690  28.674  -0.339  1.00 0.00 ?  181 LEU C HD13 1  
ATOM   8845   H  HD21 . LEU C  2 127 ? 40.294  28.415  1.978   1.00 0.00 ?  181 LEU C HD21 1  
ATOM   8846   H  HD22 . LEU C  2 127 ? 39.763  26.975  1.239   1.00 0.00 ?  181 LEU C HD22 1  
ATOM   8847   H  HD23 . LEU C  2 127 ? 38.665  27.657  2.493   1.00 0.00 ?  181 LEU C HD23 1  
ATOM   8848   N  N    . ARG C  2 128 ? 41.692  28.300  -3.120  1.00 0.00 ?  182 ARG C N    1  
ATOM   8849   C  CA   . ARG C  2 128 ? 42.708  27.587  -3.963  1.00 0.00 ?  182 ARG C CA   1  
ATOM   8850   C  C    . ARG C  2 128 ? 44.076  27.673  -3.456  1.00 0.00 ?  182 ARG C C    1  
ATOM   8851   O  O    . ARG C  2 128 ? 44.792  26.698  -3.326  1.00 0.00 ?  182 ARG C O    1  
ATOM   8852   C  CB   . ARG C  2 128 ? 42.518  27.873  -5.464  1.00 0.00 ?  182 ARG C CB   1  
ATOM   8853   C  CG   . ARG C  2 128 ? 41.311  27.194  -6.002  1.00 0.00 ?  182 ARG C CG   1  
ATOM   8854   C  CD   . ARG C  2 128 ? 41.066  27.505  -7.452  1.00 0.00 ?  182 ARG C CD   1  
ATOM   8855   N  NE   . ARG C  2 128 ? 39.842  26.748  -7.880  1.00 0.00 ?  182 ARG C NE   1  
ATOM   8856   C  CZ   . ARG C  2 128 ? 38.837  27.231  -8.590  1.00 0.00 ?  182 ARG C CZ   1  
ATOM   8857   N  NH1  . ARG C  2 128 ? 37.890  26.412  -8.956  1.00 0.00 1  182 ARG C NH1  1  
ATOM   8858   N  NH2  . ARG C  2 128 ? 38.771  28.474  -8.884  1.00 0.00 ?  182 ARG C NH2  1  
ATOM   8859   H  H    . ARG C  2 128 ? 41.069  28.958  -3.537  1.00 0.00 ?  182 ARG C H    1  
ATOM   8860   H  HA   . ARG C  2 128 ? 42.474  26.551  -3.766  1.00 0.00 ?  182 ARG C HA   1  
ATOM   8861   H  HB2  . ARG C  2 128 ? 42.447  28.975  -5.590  1.00 0.00 ?  182 ARG C HB2  1  
ATOM   8862   H  HB3  . ARG C  2 128 ? 43.417  27.561  -6.038  1.00 0.00 ?  182 ARG C HB3  1  
ATOM   8863   H  HG2  . ARG C  2 128 ? 41.452  26.094  -5.954  1.00 0.00 ?  182 ARG C HG2  1  
ATOM   8864   H  HG3  . ARG C  2 128 ? 40.406  27.350  -5.376  1.00 0.00 ?  182 ARG C HG3  1  
ATOM   8865   H  HD2  . ARG C  2 128 ? 40.886  28.592  -7.595  1.00 0.00 ?  182 ARG C HD2  1  
ATOM   8866   H  HD3  . ARG C  2 128 ? 41.957  27.202  -8.042  1.00 0.00 ?  182 ARG C HD3  1  
ATOM   8867   H  HE   . ARG C  2 128 ? 39.836  25.749  -7.845  1.00 0.00 ?  182 ARG C HE   1  
ATOM   8868   H  HH11 . ARG C  2 128 ? 38.093  25.434  -8.927  1.00 0.00 ?  182 ARG C HH11 1  
ATOM   8869   H  HH12 . ARG C  2 128 ? 37.156  26.828  -9.492  1.00 0.00 ?  182 ARG C HH12 1  
ATOM   8870   H  HH21 . ARG C  2 128 ? 39.505  29.127  -8.697  1.00 0.00 ?  182 ARG C HH21 1  
ATOM   8871   H  HH22 . ARG C  2 128 ? 37.964  28.836  -9.352  1.00 0.00 ?  182 ARG C HH22 1  
ATOM   8872   N  N    . THR C  2 129 ? 44.473  28.885  -3.038  1.00 0.00 ?  183 THR C N    1  
ATOM   8873   C  CA   . THR C  2 129 ? 45.858  29.032  -2.409  1.00 0.00 ?  183 THR C CA   1  
ATOM   8874   C  C    . THR C  2 129 ? 45.979  28.388  -0.997  1.00 0.00 ?  183 THR C C    1  
ATOM   8875   O  O    . THR C  2 129 ? 46.975  27.742  -0.704  1.00 0.00 ?  183 THR C O    1  
ATOM   8876   C  CB   . THR C  2 129 ? 46.130  30.507  -2.192  1.00 0.00 ?  183 THR C CB   1  
ATOM   8877   O  OG1  . THR C  2 129 ? 46.498  31.049  -3.461  1.00 0.00 ?  183 THR C OG1  1  
ATOM   8878   C  CG2  . THR C  2 129 ? 47.282  30.860  -1.229  1.00 0.00 ?  183 THR C CG2  1  
ATOM   8879   H  H    . THR C  2 129 ? 43.980  29.730  -3.230  1.00 0.00 ?  183 THR C H    1  
ATOM   8880   H  HA   . THR C  2 129 ? 46.579  28.640  -3.111  1.00 0.00 ?  183 THR C HA   1  
ATOM   8881   H  HB   . THR C  2 129 ? 45.169  30.996  -1.922  1.00 0.00 ?  183 THR C HB   1  
ATOM   8882   H  HG1  . THR C  2 129 ? 46.016  30.591  -4.155  1.00 0.00 ?  183 THR C HG1  1  
ATOM   8883   H  HG21 . THR C  2 129 ? 48.245  30.412  -1.556  1.00 0.00 ?  183 THR C HG21 1  
ATOM   8884   H  HG22 . THR C  2 129 ? 47.162  30.499  -0.186  1.00 0.00 ?  183 THR C HG22 1  
ATOM   8885   H  HG23 . THR C  2 129 ? 47.349  31.958  -1.070  1.00 0.00 ?  183 THR C HG23 1  
ATOM   8886   N  N    . HIS C  2 130 ? 44.933  28.599  -0.196  1.00 0.00 ?  184 HIS C N    1  
ATOM   8887   C  CA   . HIS C  2 130 ? 44.816  28.092  1.207   1.00 0.00 ?  184 HIS C CA   1  
ATOM   8888   C  C    . HIS C  2 130 ? 44.872  26.568  1.388   1.00 0.00 ?  184 HIS C C    1  
ATOM   8889   O  O    . HIS C  2 130 ? 45.493  26.023  2.337   1.00 0.00 ?  184 HIS C O    1  
ATOM   8890   C  CB   . HIS C  2 130 ? 43.554  28.782  1.805   1.00 0.00 ?  184 HIS C CB   1  
ATOM   8891   C  CG   . HIS C  2 130 ? 43.222  28.224  3.219   1.00 0.00 ?  184 HIS C CG   1  
ATOM   8892   N  ND1  . HIS C  2 130 ? 43.918  28.629  4.329   1.00 0.00 ?  184 HIS C ND1  1  
ATOM   8893   C  CD2  . HIS C  2 130 ? 42.461  27.238  3.636   1.00 0.00 ?  184 HIS C CD2  1  
ATOM   8894   C  CE1  . HIS C  2 130 ? 43.571  27.834  5.358   1.00 0.00 ?  184 HIS C CE1  1  
ATOM   8895   N  NE2  . HIS C  2 130 ? 42.713  26.892  4.928   1.00 0.00 ?  184 HIS C NE2  1  
ATOM   8896   H  H    . HIS C  2 130 ? 44.269  29.324  -0.363  1.00 0.00 ?  184 HIS C H    1  
ATOM   8897   H  HA   . HIS C  2 130 ? 45.770  28.410  1.603   1.00 0.00 ?  184 HIS C HA   1  
ATOM   8898   H  HB2  . HIS C  2 130 ? 43.630  29.874  1.616   1.00 0.00 ?  184 HIS C HB2  1  
ATOM   8899   H  HB3  . HIS C  2 130 ? 42.737  28.422  1.144   1.00 0.00 ?  184 HIS C HB3  1  
ATOM   8900   H  HD1  . HIS C  2 130 ? 44.641  29.303  4.185   1.00 0.00 ?  184 HIS C HD1  1  
ATOM   8901   H  HD2  . HIS C  2 130 ? 41.712  26.653  3.115   1.00 0.00 ?  184 HIS C HD2  1  
ATOM   8902   H  HE1  . HIS C  2 130 ? 43.877  28.041  6.384   1.00 0.00 ?  184 HIS C HE1  1  
ATOM   8903   N  N    . LEU C  2 131 ? 44.226  25.843  0.520   1.00 0.00 ?  185 LEU C N    1  
ATOM   8904   C  CA   . LEU C  2 131 ? 44.208  24.417  0.546   1.00 0.00 ?  185 LEU C CA   1  
ATOM   8905   C  C    . LEU C  2 131 ? 45.138  23.764  -0.450  1.00 0.00 ?  185 LEU C C    1  
ATOM   8906   O  O    . LEU C  2 131 ? 45.103  22.543  -0.754  1.00 0.00 ?  185 LEU C O    1  
ATOM   8907   C  CB   . LEU C  2 131 ? 42.813  23.914  0.174   1.00 0.00 ?  185 LEU C CB   1  
ATOM   8908   C  CG   . LEU C  2 131 ? 41.746  24.041  1.287   1.00 0.00 ?  185 LEU C CG   1  
ATOM   8909   C  CD1  . LEU C  2 131 ? 40.342  23.758  0.748   1.00 0.00 ?  185 LEU C CD1  1  
ATOM   8910   C  CD2  . LEU C  2 131 ? 41.979  23.132  2.488   1.00 0.00 ?  185 LEU C CD2  1  
ATOM   8911   H  H    . LEU C  2 131 ? 43.697  26.311  -0.184  1.00 0.00 ?  185 LEU C H    1  
ATOM   8912   H  HA   . LEU C  2 131 ? 44.434  24.048  1.535   1.00 0.00 ?  185 LEU C HA   1  
ATOM   8913   H  HB2  . LEU C  2 131 ? 42.608  24.586  -0.687  1.00 0.00 ?  185 LEU C HB2  1  
ATOM   8914   H  HB3  . LEU C  2 131 ? 42.716  22.916  -0.305  1.00 0.00 ?  185 LEU C HB3  1  
ATOM   8915   H  HG   . LEU C  2 131 ? 41.760  25.099  1.627   1.00 0.00 ?  185 LEU C HG   1  
ATOM   8916   H  HD11 . LEU C  2 131 ? 39.983  24.337  -0.130  1.00 0.00 ?  185 LEU C HD11 1  
ATOM   8917   H  HD12 . LEU C  2 131 ? 39.721  24.023  1.630   1.00 0.00 ?  185 LEU C HD12 1  
ATOM   8918   H  HD13 . LEU C  2 131 ? 40.281  22.662  0.573   1.00 0.00 ?  185 LEU C HD13 1  
ATOM   8919   H  HD21 . LEU C  2 131 ? 42.946  23.203  3.031   1.00 0.00 ?  185 LEU C HD21 1  
ATOM   8920   H  HD22 . LEU C  2 131 ? 41.767  22.091  2.162   1.00 0.00 ?  185 LEU C HD22 1  
ATOM   8921   H  HD23 . LEU C  2 131 ? 41.144  23.244  3.212   1.00 0.00 ?  185 LEU C HD23 1  
ATOM   8922   N  N    . ALA C  2 132 ? 45.958  24.559  -1.112  1.00 0.00 ?  186 ALA C N    1  
ATOM   8923   C  CA   . ALA C  2 132 ? 46.958  24.010  -2.064  1.00 0.00 ?  186 ALA C CA   1  
ATOM   8924   C  C    . ALA C  2 132 ? 47.970  23.102  -1.319  1.00 0.00 ?  186 ALA C C    1  
ATOM   8925   O  O    . ALA C  2 132 ? 48.234  22.053  -1.913  1.00 0.00 ?  186 ALA C O    1  
ATOM   8926   C  CB   . ALA C  2 132 ? 47.555  25.126  -2.997  1.00 0.00 ?  186 ALA C CB   1  
ATOM   8927   H  H    . ALA C  2 132 ? 45.969  25.529  -0.879  1.00 0.00 ?  186 ALA C H    1  
ATOM   8928   H  HA   . ALA C  2 132 ? 46.388  23.318  -2.666  1.00 0.00 ?  186 ALA C HA   1  
ATOM   8929   H  HB1  . ALA C  2 132 ? 48.016  25.961  -2.427  1.00 0.00 ?  186 ALA C HB1  1  
ATOM   8930   H  HB2  . ALA C  2 132 ? 46.805  25.647  -3.630  1.00 0.00 ?  186 ALA C HB2  1  
ATOM   8931   H  HB3  . ALA C  2 132 ? 48.385  24.723  -3.616  1.00 0.00 ?  186 ALA C HB3  1  
ATOM   8932   N  N    . PRO C  2 133 ? 48.586  23.322  -0.080  1.00 0.00 ?  187 PRO C N    1  
ATOM   8933   C  CA   . PRO C  2 133 ? 49.318  22.238  0.622   1.00 0.00 ?  187 PRO C CA   1  
ATOM   8934   C  C    . PRO C  2 133 ? 48.383  21.102  1.156   1.00 0.00 ?  187 PRO C C    1  
ATOM   8935   O  O    . PRO C  2 133 ? 48.863  20.058  1.571   1.00 0.00 ?  187 PRO C O    1  
ATOM   8936   C  CB   . PRO C  2 133 ? 49.855  22.909  1.910   1.00 0.00 ?  187 PRO C CB   1  
ATOM   8937   C  CG   . PRO C  2 133 ? 49.040  24.183  2.067   1.00 0.00 ?  187 PRO C CG   1  
ATOM   8938   C  CD   . PRO C  2 133 ? 48.795  24.602  0.585   1.00 0.00 ?  187 PRO C CD   1  
ATOM   8939   H  HA   . PRO C  2 133 ? 50.061  21.785  -0.018  1.00 0.00 ?  187 PRO C HA   1  
ATOM   8940   H  HB2  . PRO C  2 133 ? 49.757  22.242  2.793   1.00 0.00 ?  187 PRO C HB2  1  
ATOM   8941   H  HB3  . PRO C  2 133 ? 50.923  23.104  1.673   1.00 0.00 ?  187 PRO C HB3  1  
ATOM   8942   H  HG2  . PRO C  2 133 ? 48.063  23.861  2.486   1.00 0.00 ?  187 PRO C HG2  1  
ATOM   8943   H  HG3  . PRO C  2 133 ? 49.562  25.007  2.599   1.00 0.00 ?  187 PRO C HG3  1  
ATOM   8944   H  HD2  . PRO C  2 133 ? 47.930  25.294  0.498   1.00 0.00 ?  187 PRO C HD2  1  
ATOM   8945   H  HD3  . PRO C  2 133 ? 49.711  24.969  0.075   1.00 0.00 ?  187 PRO C HD3  1  
ATOM   8946   N  N    . TYR C  2 134 ? 47.047  21.335  1.228   1.00 0.00 ?  188 TYR C N    1  
ATOM   8947   C  CA   . TYR C  2 134 ? 46.142  20.254  1.511   1.00 0.00 ?  188 TYR C CA   1  
ATOM   8948   C  C    . TYR C  2 134 ? 46.048  19.322  0.316   1.00 0.00 ?  188 TYR C C    1  
ATOM   8949   O  O    . TYR C  2 134 ? 46.142  18.134  0.393   1.00 0.00 ?  188 TYR C O    1  
ATOM   8950   C  CB   . TYR C  2 134 ? 44.755  20.763  2.100   1.00 0.00 ?  188 TYR C CB   1  
ATOM   8951   C  CG   . TYR C  2 134 ? 43.996  19.593  2.714   1.00 0.00 ?  188 TYR C CG   1  
ATOM   8952   C  CD1  . TYR C  2 134 ? 44.396  18.882  3.794   1.00 0.00 ?  188 TYR C CD1  1  
ATOM   8953   C  CD2  . TYR C  2 134 ? 42.716  19.296  2.249   1.00 0.00 ?  188 TYR C CD2  1  
ATOM   8954   C  CE1  . TYR C  2 134 ? 43.659  17.879  4.465   1.00 0.00 ?  188 TYR C CE1  1  
ATOM   8955   C  CE2  . TYR C  2 134 ? 42.012  18.138  2.753   1.00 0.00 ?  188 TYR C CE2  1  
ATOM   8956   C  CZ   . TYR C  2 134 ? 42.505  17.373  3.848   1.00 0.00 ?  188 TYR C CZ   1  
ATOM   8957   O  OH   . TYR C  2 134 ? 41.736  16.288  4.264   1.00 0.00 ?  188 TYR C OH   1  
ATOM   8958   H  H    . TYR C  2 134 ? 46.818  22.302  1.149   1.00 0.00 ?  188 TYR C H    1  
ATOM   8959   H  HA   . TYR C  2 134 ? 46.469  19.652  2.346   1.00 0.00 ?  188 TYR C HA   1  
ATOM   8960   H  HB2  . TYR C  2 134 ? 44.955  21.478  2.927   1.00 0.00 ?  188 TYR C HB2  1  
ATOM   8961   H  HB3  . TYR C  2 134 ? 44.257  21.166  1.192   1.00 0.00 ?  188 TYR C HB3  1  
ATOM   8962   H  HD1  . TYR C  2 134 ? 45.342  19.095  4.270   1.00 0.00 ?  188 TYR C HD1  1  
ATOM   8963   H  HD2  . TYR C  2 134 ? 42.340  19.771  1.355   1.00 0.00 ?  188 TYR C HD2  1  
ATOM   8964   H  HE1  . TYR C  2 134 ? 44.052  17.333  5.310   1.00 0.00 ?  188 TYR C HE1  1  
ATOM   8965   H  HE2  . TYR C  2 134 ? 41.089  17.798  2.307   1.00 0.00 ?  188 TYR C HE2  1  
ATOM   8966   H  HH   . TYR C  2 134 ? 42.214  15.856  4.976   1.00 0.00 ?  188 TYR C HH   1  
ATOM   8967   N  N    . SER C  2 135 ? 46.018  19.833  -0.914  1.00 0.00 ?  189 SER C N    1  
ATOM   8968   C  CA   . SER C  2 135 ? 46.020  19.060  -2.196  1.00 0.00 ?  189 SER C CA   1  
ATOM   8969   C  C    . SER C  2 135 ? 47.301  18.246  -2.343  1.00 0.00 ?  189 SER C C    1  
ATOM   8970   O  O    . SER C  2 135 ? 47.267  17.110  -2.858  1.00 0.00 ?  189 SER C O    1  
ATOM   8971   C  CB   . SER C  2 135 ? 45.911  20.076  -3.386  1.00 0.00 ?  189 SER C CB   1  
ATOM   8972   O  OG   . SER C  2 135 ? 45.561  19.408  -4.611  1.00 0.00 ?  189 SER C OG   1  
ATOM   8973   H  H    . SER C  2 135 ? 46.077  20.827  -0.879  1.00 0.00 ?  189 SER C H    1  
ATOM   8974   H  HA   . SER C  2 135 ? 45.164  18.403  -2.238  1.00 0.00 ?  189 SER C HA   1  
ATOM   8975   H  HB2  . SER C  2 135 ? 45.147  20.830  -3.099  1.00 0.00 ?  189 SER C HB2  1  
ATOM   8976   H  HB3  . SER C  2 135 ? 46.895  20.575  -3.517  1.00 0.00 ?  189 SER C HB3  1  
ATOM   8977   H  HG   . SER C  2 135 ? 46.353  19.325  -5.148  1.00 0.00 ?  189 SER C HG   1  
ATOM   8978   N  N    . ASP C  2 136 ? 48.528  18.796  -2.003  1.00 0.00 ?  190 ASP C N    1  
ATOM   8979   C  CA   . ASP C  2 136 ? 49.785  18.122  -2.114  1.00 0.00 ?  190 ASP C CA   1  
ATOM   8980   C  C    . ASP C  2 136 ? 49.779  16.950  -1.161  1.00 0.00 ?  190 ASP C C    1  
ATOM   8981   O  O    . ASP C  2 136 ? 50.246  15.835  -1.483  1.00 0.00 ?  190 ASP C O    1  
ATOM   8982   C  CB   . ASP C  2 136 ? 50.950  19.124  -1.874  1.00 0.00 ?  190 ASP C CB   1  
ATOM   8983   C  CG   . ASP C  2 136 ? 50.959  20.046  -3.068  1.00 0.00 ?  190 ASP C CG   1  
ATOM   8984   O  OD1  . ASP C  2 136 ? 51.673  21.102  -2.992  1.00 0.00 ?  190 ASP C OD1  1  
ATOM   8985   O  OD2  . ASP C  2 136 ? 50.336  19.811  -4.110  1.00 0.00 -1 190 ASP C OD2  1  
ATOM   8986   H  H    . ASP C  2 136 ? 48.596  19.790  -2.010  1.00 0.00 ?  190 ASP C H    1  
ATOM   8987   H  HA   . ASP C  2 136 ? 49.927  17.736  -3.113  1.00 0.00 ?  190 ASP C HA   1  
ATOM   8988   H  HB2  . ASP C  2 136 ? 50.821  19.717  -0.943  1.00 0.00 ?  190 ASP C HB2  1  
ATOM   8989   H  HB3  . ASP C  2 136 ? 51.953  18.651  -1.808  1.00 0.00 ?  190 ASP C HB3  1  
ATOM   8990   N  N    . GLU C  2 137 ? 49.267  17.111  0.027   1.00 0.00 ?  191 GLU C N    1  
ATOM   8991   C  CA   . GLU C  2 137 ? 49.135  15.999  0.976   1.00 0.00 ?  191 GLU C CA   1  
ATOM   8992   C  C    . GLU C  2 137 ? 48.130  14.953  0.433   1.00 0.00 ?  191 GLU C C    1  
ATOM   8993   O  O    . GLU C  2 137 ? 48.490  13.826  0.690   1.00 0.00 ?  191 GLU C O    1  
ATOM   8994   C  CB   . GLU C  2 137 ? 48.742  16.514  2.410   1.00 0.00 ?  191 GLU C CB   1  
ATOM   8995   C  CG   . GLU C  2 137 ? 49.836  17.221  3.190   1.00 0.00 ?  191 GLU C CG   1  
ATOM   8996   C  CD   . GLU C  2 137 ? 51.211  16.614  3.168   1.00 0.00 ?  191 GLU C CD   1  
ATOM   8997   O  OE1  . GLU C  2 137 ? 52.211  17.163  2.677   1.00 0.00 ?  191 GLU C OE1  1  
ATOM   8998   O  OE2  . GLU C  2 137 ? 51.305  15.494  3.709   1.00 0.00 -1 191 GLU C OE2  1  
ATOM   8999   H  H    . GLU C  2 137 ? 48.823  17.989  0.188   1.00 0.00 ?  191 GLU C H    1  
ATOM   9000   H  HA   . GLU C  2 137 ? 50.089  15.512  1.115   1.00 0.00 ?  191 GLU C HA   1  
ATOM   9001   H  HB2  . GLU C  2 137 ? 47.821  17.126  2.309   1.00 0.00 ?  191 GLU C HB2  1  
ATOM   9002   H  HB3  . GLU C  2 137 ? 48.611  15.576  2.992   1.00 0.00 ?  191 GLU C HB3  1  
ATOM   9003   H  HG2  . GLU C  2 137 ? 49.883  18.233  2.734   1.00 0.00 ?  191 GLU C HG2  1  
ATOM   9004   H  HG3  . GLU C  2 137 ? 49.516  17.321  4.249   1.00 0.00 ?  191 GLU C HG3  1  
ATOM   9005   N  N    . LEU C  2 138 ? 46.962  15.279  -0.103  1.00 0.00 ?  192 LEU C N    1  
ATOM   9006   C  CA   . LEU C  2 138 ? 46.049  14.316  -0.846  1.00 0.00 ?  192 LEU C CA   1  
ATOM   9007   C  C    . LEU C  2 138 ? 46.766  13.537  -1.907  1.00 0.00 ?  192 LEU C C    1  
ATOM   9008   O  O    . LEU C  2 138 ? 46.507  12.362  -2.018  1.00 0.00 ?  192 LEU C O    1  
ATOM   9009   C  CB   . LEU C  2 138 ? 44.717  15.058  -1.246  1.00 0.00 ?  192 LEU C CB   1  
ATOM   9010   C  CG   . LEU C  2 138 ? 43.870  15.640  -0.109  1.00 0.00 ?  192 LEU C CG   1  
ATOM   9011   C  CD1  . LEU C  2 138 ? 42.558  16.226  -0.685  1.00 0.00 ?  192 LEU C CD1  1  
ATOM   9012   C  CD2  . LEU C  2 138 ? 43.567  14.633  1.033   1.00 0.00 ?  192 LEU C CD2  1  
ATOM   9013   H  H    . LEU C  2 138 ? 46.677  16.230  -0.020  1.00 0.00 ?  192 LEU C H    1  
ATOM   9014   H  HA   . LEU C  2 138 ? 45.886  13.571  -0.082  1.00 0.00 ?  192 LEU C HA   1  
ATOM   9015   H  HB2  . LEU C  2 138 ? 45.062  15.877  -1.913  1.00 0.00 ?  192 LEU C HB2  1  
ATOM   9016   H  HB3  . LEU C  2 138 ? 43.997  14.360  -1.725  1.00 0.00 ?  192 LEU C HB3  1  
ATOM   9017   H  HG   . LEU C  2 138 ? 44.393  16.450  0.441   1.00 0.00 ?  192 LEU C HG   1  
ATOM   9018   H  HD11 . LEU C  2 138 ? 41.796  15.439  -0.872  1.00 0.00 ?  192 LEU C HD11 1  
ATOM   9019   H  HD12 . LEU C  2 138 ? 42.742  16.925  -1.529  1.00 0.00 ?  192 LEU C HD12 1  
ATOM   9020   H  HD13 . LEU C  2 138 ? 42.069  16.947  0.005   1.00 0.00 ?  192 LEU C HD13 1  
ATOM   9021   H  HD21 . LEU C  2 138 ? 43.190  13.742  0.487   1.00 0.00 ?  192 LEU C HD21 1  
ATOM   9022   H  HD22 . LEU C  2 138 ? 42.849  15.125  1.723   1.00 0.00 ?  192 LEU C HD22 1  
ATOM   9023   H  HD23 . LEU C  2 138 ? 44.462  14.282  1.589   1.00 0.00 ?  192 LEU C HD23 1  
ATOM   9024   N  N    . ARG C  2 139 ? 47.589  14.249  -2.723  1.00 0.00 ?  193 ARG C N    1  
ATOM   9025   C  CA   . ARG C  2 139 ? 48.421  13.610  -3.778  1.00 0.00 ?  193 ARG C CA   1  
ATOM   9026   C  C    . ARG C  2 139 ? 49.346  12.542  -3.112  1.00 0.00 ?  193 ARG C C    1  
ATOM   9027   O  O    . ARG C  2 139 ? 49.395  11.418  -3.612  1.00 0.00 ?  193 ARG C O    1  
ATOM   9028   C  CB   . ARG C  2 139 ? 49.308  14.678  -4.576  1.00 0.00 ?  193 ARG C CB   1  
ATOM   9029   C  CG   . ARG C  2 139 ? 48.418  15.473  -5.529  1.00 0.00 ?  193 ARG C CG   1  
ATOM   9030   C  CD   . ARG C  2 139 ? 49.258  16.295  -6.615  1.00 0.00 ?  193 ARG C CD   1  
ATOM   9031   N  NE   . ARG C  2 139 ? 48.191  17.031  -7.388  1.00 0.00 ?  193 ARG C NE   1  
ATOM   9032   C  CZ   . ARG C  2 139 ? 47.731  16.727  -8.586  1.00 0.00 ?  193 ARG C CZ   1  
ATOM   9033   N  NH1  . ARG C  2 139 ? 46.983  17.633  -9.143  1.00 0.00 1  193 ARG C NH1  1  
ATOM   9034   N  NH2  . ARG C  2 139 ? 48.013  15.685  -9.278  1.00 0.00 ?  193 ARG C NH2  1  
ATOM   9035   H  H    . ARG C  2 139 ? 47.708  15.238  -2.756  1.00 0.00 ?  193 ARG C H    1  
ATOM   9036   H  HA   . ARG C  2 139 ? 47.785  12.979  -4.381  1.00 0.00 ?  193 ARG C HA   1  
ATOM   9037   H  HB2  . ARG C  2 139 ? 49.682  15.432  -3.850  1.00 0.00 ?  193 ARG C HB2  1  
ATOM   9038   H  HB3  . ARG C  2 139 ? 50.097  14.171  -5.171  1.00 0.00 ?  193 ARG C HB3  1  
ATOM   9039   H  HG2  . ARG C  2 139 ? 47.695  14.801  -6.039  1.00 0.00 ?  193 ARG C HG2  1  
ATOM   9040   H  HG3  . ARG C  2 139 ? 47.886  16.253  -4.944  1.00 0.00 ?  193 ARG C HG3  1  
ATOM   9041   H  HD2  . ARG C  2 139 ? 49.886  17.083  -6.147  1.00 0.00 ?  193 ARG C HD2  1  
ATOM   9042   H  HD3  . ARG C  2 139 ? 49.837  15.523  -7.167  1.00 0.00 ?  193 ARG C HD3  1  
ATOM   9043   H  HE   . ARG C  2 139 ? 47.843  17.920  -7.092  1.00 0.00 ?  193 ARG C HE   1  
ATOM   9044   H  HH11 . ARG C  2 139 ? 46.671  17.470  -10.078 1.00 0.00 ?  193 ARG C HH11 1  
ATOM   9045   H  HH12 . ARG C  2 139 ? 46.836  18.562  -8.801  1.00 0.00 ?  193 ARG C HH12 1  
ATOM   9046   H  HH21 . ARG C  2 139 ? 48.700  15.051  -8.923  1.00 0.00 ?  193 ARG C HH21 1  
ATOM   9047   H  HH22 . ARG C  2 139 ? 47.825  15.778  -10.255 1.00 0.00 ?  193 ARG C HH22 1  
ATOM   9048   N  N    . GLN C  2 140 ? 49.928  12.901  -1.917  1.00 0.00 ?  194 GLN C N    1  
ATOM   9049   C  CA   . GLN C  2 140 ? 50.596  11.892  -1.066  1.00 0.00 ?  194 GLN C CA   1  
ATOM   9050   C  C    . GLN C  2 140 ? 49.694  10.758  -0.585  1.00 0.00 ?  194 GLN C C    1  
ATOM   9051   O  O    . GLN C  2 140 ? 50.077  9.596   -0.639  1.00 0.00 ?  194 GLN C O    1  
ATOM   9052   C  CB   . GLN C  2 140 ? 51.378  12.608  0.076   1.00 0.00 ?  194 GLN C CB   1  
ATOM   9053   C  CG   . GLN C  2 140 ? 52.536  13.590  -0.266  1.00 0.00 ?  194 GLN C CG   1  
ATOM   9054   C  CD   . GLN C  2 140 ? 53.382  13.316  -1.558  1.00 0.00 ?  194 GLN C CD   1  
ATOM   9055   O  OE1  . GLN C  2 140 ? 53.792  14.271  -2.210  1.00 0.00 ?  194 GLN C OE1  1  
ATOM   9056   N  NE2  . GLN C  2 140 ? 53.737  12.057  -1.872  1.00 0.00 ?  194 GLN C NE2  1  
ATOM   9057   H  H    . GLN C  2 140 ? 50.014  13.786  -1.465  1.00 0.00 ?  194 GLN C H    1  
ATOM   9058   H  HA   . GLN C  2 140 ? 51.298  11.384  -1.711  1.00 0.00 ?  194 GLN C HA   1  
ATOM   9059   H  HB2  . GLN C  2 140 ? 50.747  13.170  0.798   1.00 0.00 ?  194 GLN C HB2  1  
ATOM   9060   H  HB3  . GLN C  2 140 ? 51.760  11.806  0.743   1.00 0.00 ?  194 GLN C HB3  1  
ATOM   9061   H  HG2  . GLN C  2 140 ? 52.137  14.619  -0.394  1.00 0.00 ?  194 GLN C HG2  1  
ATOM   9062   H  HG3  . GLN C  2 140 ? 53.255  13.651  0.579   1.00 0.00 ?  194 GLN C HG3  1  
ATOM   9063   H  HE21 . GLN C  2 140 ? 54.181  11.880  -2.751  1.00 0.00 ?  194 GLN C HE21 1  
ATOM   9064   H  HE22 . GLN C  2 140 ? 53.295  11.353  -1.316  1.00 0.00 ?  194 GLN C HE22 1  
ATOM   9065   N  N    . ARG C  2 141 ? 48.497  11.035  -0.082  1.00 0.00 ?  195 ARG C N    1  
ATOM   9066   C  CA   . ARG C  2 141 ? 47.505  10.001  0.282   1.00 0.00 ?  195 ARG C CA   1  
ATOM   9067   C  C    . ARG C  2 141 ? 47.094  9.005   -0.751  1.00 0.00 ?  195 ARG C C    1  
ATOM   9068   O  O    . ARG C  2 141 ? 47.139  7.824   -0.563  1.00 0.00 ?  195 ARG C O    1  
ATOM   9069   C  CB   . ARG C  2 141 ? 46.258  10.698  0.931   1.00 0.00 ?  195 ARG C CB   1  
ATOM   9070   C  CG   . ARG C  2 141 ? 46.482  11.443  2.291   1.00 0.00 ?  195 ARG C CG   1  
ATOM   9071   C  CD   . ARG C  2 141 ? 47.196  10.497  3.343   1.00 0.00 ?  195 ARG C CD   1  
ATOM   9072   N  NE   . ARG C  2 141 ? 48.658  10.845  3.342   1.00 0.00 ?  195 ARG C NE   1  
ATOM   9073   C  CZ   . ARG C  2 141 ? 49.683  10.048  3.254   1.00 0.00 ?  195 ARG C CZ   1  
ATOM   9074   N  NH1  . ARG C  2 141 ? 50.930  10.555  3.080   1.00 0.00 1  195 ARG C NH1  1  
ATOM   9075   N  NH2  . ARG C  2 141 ? 49.600  8.769   3.348   1.00 0.00 ?  195 ARG C NH2  1  
ATOM   9076   H  H    . ARG C  2 141 ? 48.283  11.991  0.104   1.00 0.00 ?  195 ARG C H    1  
ATOM   9077   H  HA   . ARG C  2 141 ? 47.967  9.426   1.071   1.00 0.00 ?  195 ARG C HA   1  
ATOM   9078   H  HB2  . ARG C  2 141 ? 45.816  11.358  0.155   1.00 0.00 ?  195 ARG C HB2  1  
ATOM   9079   H  HB3  . ARG C  2 141 ? 45.533  9.879   1.123   1.00 0.00 ?  195 ARG C HB3  1  
ATOM   9080   H  HG2  . ARG C  2 141 ? 46.992  12.414  2.111   1.00 0.00 ?  195 ARG C HG2  1  
ATOM   9081   H  HG3  . ARG C  2 141 ? 45.486  11.706  2.709   1.00 0.00 ?  195 ARG C HG3  1  
ATOM   9082   H  HD2  . ARG C  2 141 ? 46.934  10.720  4.399   1.00 0.00 ?  195 ARG C HD2  1  
ATOM   9083   H  HD3  . ARG C  2 141 ? 46.996  9.448   3.035   1.00 0.00 ?  195 ARG C HD3  1  
ATOM   9084   H  HE   . ARG C  2 141 ? 48.945  11.802  3.386   1.00 0.00 ?  195 ARG C HE   1  
ATOM   9085   H  HH11 . ARG C  2 141 ? 51.107  11.494  3.375   1.00 0.00 ?  195 ARG C HH11 1  
ATOM   9086   H  HH12 . ARG C  2 141 ? 51.698  9.937   2.915   1.00 0.00 ?  195 ARG C HH12 1  
ATOM   9087   H  HH21 . ARG C  2 141 ? 48.849  8.526   3.962   1.00 0.00 ?  195 ARG C HH21 1  
ATOM   9088   H  HH22 . ARG C  2 141 ? 50.501  8.389   3.556   1.00 0.00 ?  195 ARG C HH22 1  
ATOM   9089   N  N    . LEU C  2 142 ? 46.710  9.519   -1.912  1.00 0.00 ?  196 LEU C N    1  
ATOM   9090   C  CA   . LEU C  2 142 ? 46.362  8.652   -3.083  1.00 0.00 ?  196 LEU C CA   1  
ATOM   9091   C  C    . LEU C  2 142 ? 47.558  7.853   -3.490  1.00 0.00 ?  196 LEU C C    1  
ATOM   9092   O  O    . LEU C  2 142 ? 47.470  6.617   -3.670  1.00 0.00 ?  196 LEU C O    1  
ATOM   9093   C  CB   . LEU C  2 142 ? 45.789  9.463   -4.266  1.00 0.00 ?  196 LEU C CB   1  
ATOM   9094   C  CG   . LEU C  2 142 ? 44.255  9.802   -4.090  1.00 0.00 ?  196 LEU C CG   1  
ATOM   9095   C  CD1  . LEU C  2 142 ? 43.797  10.701  -5.281  1.00 0.00 ?  196 LEU C CD1  1  
ATOM   9096   C  CD2  . LEU C  2 142 ? 43.216  8.631   -4.103  1.00 0.00 ?  196 LEU C CD2  1  
ATOM   9097   H  H    . LEU C  2 142 ? 46.625  10.508  -2.004  1.00 0.00 ?  196 LEU C H    1  
ATOM   9098   H  HA   . LEU C  2 142 ? 45.556  7.972   -2.851  1.00 0.00 ?  196 LEU C HA   1  
ATOM   9099   H  HB2  . LEU C  2 142 ? 46.304  10.447  -4.302  1.00 0.00 ?  196 LEU C HB2  1  
ATOM   9100   H  HB3  . LEU C  2 142 ? 46.139  9.060   -5.240  1.00 0.00 ?  196 LEU C HB3  1  
ATOM   9101   H  HG   . LEU C  2 142 ? 44.137  10.319  -3.114  1.00 0.00 ?  196 LEU C HG   1  
ATOM   9102   H  HD11 . LEU C  2 142 ? 44.105  11.767  -5.336  1.00 0.00 ?  196 LEU C HD11 1  
ATOM   9103   H  HD12 . LEU C  2 142 ? 42.693  10.596  -5.352  1.00 0.00 ?  196 LEU C HD12 1  
ATOM   9104   H  HD13 . LEU C  2 142 ? 44.161  10.205  -6.206  1.00 0.00 ?  196 LEU C HD13 1  
ATOM   9105   H  HD21 . LEU C  2 142 ? 43.217  7.926   -4.961  1.00 0.00 ?  196 LEU C HD21 1  
ATOM   9106   H  HD22 . LEU C  2 142 ? 42.155  8.953   -4.026  1.00 0.00 ?  196 LEU C HD22 1  
ATOM   9107   H  HD23 . LEU C  2 142 ? 43.374  7.974   -3.221  1.00 0.00 ?  196 LEU C HD23 1  
ATOM   9108   N  N    . ALA C  2 143 ? 48.795  8.464   -3.485  1.00 0.00 ?  197 ALA C N    1  
ATOM   9109   C  CA   . ALA C  2 143 ? 49.987  7.748   -3.770  1.00 0.00 ?  197 ALA C CA   1  
ATOM   9110   C  C    . ALA C  2 143 ? 50.363  6.700   -2.780  1.00 0.00 ?  197 ALA C C    1  
ATOM   9111   O  O    . ALA C  2 143 ? 50.962  5.673   -3.175  1.00 0.00 ?  197 ALA C O    1  
ATOM   9112   C  CB   . ALA C  2 143 ? 51.209  8.738   -3.986  1.00 0.00 ?  197 ALA C CB   1  
ATOM   9113   H  H    . ALA C  2 143 ? 48.917  9.451   -3.417  1.00 0.00 ?  197 ALA C H    1  
ATOM   9114   H  HA   . ALA C  2 143 ? 49.994  7.180   -4.689  1.00 0.00 ?  197 ALA C HA   1  
ATOM   9115   H  HB1  . ALA C  2 143 ? 51.198  9.392   -4.884  1.00 0.00 ?  197 ALA C HB1  1  
ATOM   9116   H  HB2  . ALA C  2 143 ? 52.231  8.301   -3.983  1.00 0.00 ?  197 ALA C HB2  1  
ATOM   9117   H  HB3  . ALA C  2 143 ? 51.122  9.372   -3.077  1.00 0.00 ?  197 ALA C HB3  1  
ATOM   9118   N  N    . ALA C  2 144 ? 50.110  6.951   -1.519  1.00 0.00 ?  198 ALA C N    1  
ATOM   9119   C  CA   . ALA C  2 144 ? 50.263  6.007   -0.442  1.00 0.00 ?  198 ALA C CA   1  
ATOM   9120   C  C    . ALA C  2 144 ? 49.214  4.884   -0.436  1.00 0.00 ?  198 ALA C C    1  
ATOM   9121   O  O    . ALA C  2 144 ? 49.546  3.749   0.061   1.00 0.00 ?  198 ALA C O    1  
ATOM   9122   C  CB   . ALA C  2 144 ? 50.254  6.760   0.884   1.00 0.00 ?  198 ALA C CB   1  
ATOM   9123   H  H    . ALA C  2 144 ? 49.906  7.894   -1.268  1.00 0.00 ?  198 ALA C H    1  
ATOM   9124   H  HA   . ALA C  2 144 ? 51.235  5.544   -0.516  1.00 0.00 ?  198 ALA C HA   1  
ATOM   9125   H  HB1  . ALA C  2 144 ? 50.254  6.064   1.750   1.00 0.00 ?  198 ALA C HB1  1  
ATOM   9126   H  HB2  . ALA C  2 144 ? 49.261  7.247   0.992   1.00 0.00 ?  198 ALA C HB2  1  
ATOM   9127   H  HB3  . ALA C  2 144 ? 51.105  7.470   0.967   1.00 0.00 ?  198 ALA C HB3  1  
ATOM   9128   N  N    . ARG C  2 145 ? 47.980  5.061   -0.914  1.00 0.00 ?  199 ARG C N    1  
ATOM   9129   C  CA   . ARG C  2 145 ? 46.912  4.065   -0.966  1.00 0.00 ?  199 ARG C CA   1  
ATOM   9130   C  C    . ARG C  2 145 ? 47.401  3.082   -1.987  1.00 0.00 ?  199 ARG C C    1  
ATOM   9131   O  O    . ARG C  2 145 ? 47.536  1.893   -1.723  1.00 0.00 ?  199 ARG C O    1  
ATOM   9132   C  CB   . ARG C  2 145 ? 45.617  4.701   -1.442  1.00 0.00 ?  199 ARG C CB   1  
ATOM   9133   C  CG   . ARG C  2 145 ? 44.360  3.723   -1.349  1.00 0.00 ?  199 ARG C CG   1  
ATOM   9134   C  CD   . ARG C  2 145 ? 44.139  2.712   -2.505  1.00 0.00 ?  199 ARG C CD   1  
ATOM   9135   N  NE   . ARG C  2 145 ? 44.221  3.488   -3.777  1.00 0.00 ?  199 ARG C NE   1  
ATOM   9136   C  CZ   . ARG C  2 145 ? 44.038  2.893   -4.913  1.00 0.00 ?  199 ARG C CZ   1  
ATOM   9137   N  NH1  . ARG C  2 145 ? 44.492  3.563   -5.938  1.00 0.00 1  199 ARG C NH1  1  
ATOM   9138   N  NH2  . ARG C  2 145 ? 43.355  1.815   -5.144  1.00 0.00 ?  199 ARG C NH2  1  
ATOM   9139   H  H    . ARG C  2 145 ? 47.648  5.989   -1.060  1.00 0.00 ?  199 ARG C H    1  
ATOM   9140   H  HA   . ARG C  2 145 ? 46.760  3.570   -0.019  1.00 0.00 ?  199 ARG C HA   1  
ATOM   9141   H  HB2  . ARG C  2 145 ? 45.284  5.522   -0.771  1.00 0.00 ?  199 ARG C HB2  1  
ATOM   9142   H  HB3  . ARG C  2 145 ? 45.689  5.192   -2.436  1.00 0.00 ?  199 ARG C HB3  1  
ATOM   9143   H  HG2  . ARG C  2 145 ? 44.399  3.316   -0.316  1.00 0.00 ?  199 ARG C HG2  1  
ATOM   9144   H  HG3  . ARG C  2 145 ? 43.554  4.483   -1.425  1.00 0.00 ?  199 ARG C HG3  1  
ATOM   9145   H  HD2  . ARG C  2 145 ? 44.815  1.831   -2.475  1.00 0.00 ?  199 ARG C HD2  1  
ATOM   9146   H  HD3  . ARG C  2 145 ? 43.143  2.243   -2.356  1.00 0.00 ?  199 ARG C HD3  1  
ATOM   9147   H  HE   . ARG C  2 145 ? 44.554  4.429   -3.725  1.00 0.00 ?  199 ARG C HE   1  
ATOM   9148   H  HH11 . ARG C  2 145 ? 44.926  4.459   -5.839  1.00 0.00 ?  199 ARG C HH11 1  
ATOM   9149   H  HH12 . ARG C  2 145 ? 44.493  3.179   -6.861  1.00 0.00 ?  199 ARG C HH12 1  
ATOM   9150   H  HH21 . ARG C  2 145 ? 43.112  1.220   -4.379  1.00 0.00 ?  199 ARG C HH21 1  
ATOM   9151   H  HH22 . ARG C  2 145 ? 43.317  1.483   -6.087  1.00 0.00 ?  199 ARG C HH22 1  
ATOM   9152   N  N    . LEU C  2 146 ? 47.822  3.601   -3.142  1.00 0.00 ?  200 LEU C N    1  
ATOM   9153   C  CA   . LEU C  2 146 ? 48.411  2.811   -4.193  1.00 0.00 ?  200 LEU C CA   1  
ATOM   9154   C  C    . LEU C  2 146 ? 49.759  2.066   -3.838  1.00 0.00 ?  200 LEU C C    1  
ATOM   9155   O  O    . LEU C  2 146 ? 49.836  0.888   -4.067  1.00 0.00 ?  200 LEU C O    1  
ATOM   9156   C  CB   . LEU C  2 146 ? 48.525  3.716   -5.511  1.00 0.00 ?  200 LEU C CB   1  
ATOM   9157   C  CG   . LEU C  2 146 ? 49.097  2.923   -6.721  1.00 0.00 ?  200 LEU C CG   1  
ATOM   9158   C  CD1  . LEU C  2 146 ? 48.129  1.789   -7.155  1.00 0.00 ?  200 LEU C CD1  1  
ATOM   9159   C  CD2  . LEU C  2 146 ? 49.302  3.899   -7.831  1.00 0.00 ?  200 LEU C CD2  1  
ATOM   9160   H  H    . LEU C  2 146 ? 47.875  4.597   -3.146  1.00 0.00 ?  200 LEU C H    1  
ATOM   9161   H  HA   . LEU C  2 146 ? 47.686  2.057   -4.463  1.00 0.00 ?  200 LEU C HA   1  
ATOM   9162   H  HB2  . LEU C  2 146 ? 47.584  4.225   -5.812  1.00 0.00 ?  200 LEU C HB2  1  
ATOM   9163   H  HB3  . LEU C  2 146 ? 49.217  4.564   -5.317  1.00 0.00 ?  200 LEU C HB3  1  
ATOM   9164   H  HG   . LEU C  2 146 ? 50.065  2.442   -6.465  1.00 0.00 ?  200 LEU C HG   1  
ATOM   9165   H  HD11 . LEU C  2 146 ? 47.946  0.949   -6.452  1.00 0.00 ?  200 LEU C HD11 1  
ATOM   9166   H  HD12 . LEU C  2 146 ? 48.476  1.360   -8.120  1.00 0.00 ?  200 LEU C HD12 1  
ATOM   9167   H  HD13 . LEU C  2 146 ? 47.179  2.338   -7.331  1.00 0.00 ?  200 LEU C HD13 1  
ATOM   9168   H  HD21 . LEU C  2 146 ? 48.385  4.481   -8.066  1.00 0.00 ?  200 LEU C HD21 1  
ATOM   9169   H  HD22 . LEU C  2 146 ? 49.520  3.316   -8.752  1.00 0.00 ?  200 LEU C HD22 1  
ATOM   9170   H  HD23 . LEU C  2 146 ? 50.184  4.544   -7.632  1.00 0.00 ?  200 LEU C HD23 1  
ATOM   9171   N  N    . GLU C  2 147 ? 50.673  2.707   -3.105  1.00 0.00 ?  201 GLU C N    1  
ATOM   9172   C  CA   . GLU C  2 147 ? 51.732  2.101   -2.409  1.00 0.00 ?  201 GLU C CA   1  
ATOM   9173   C  C    . GLU C  2 147 ? 51.492  0.976   -1.494  1.00 0.00 ?  201 GLU C C    1  
ATOM   9174   O  O    . GLU C  2 147 ? 52.217  -0.033  -1.696  1.00 0.00 ?  201 GLU C O    1  
ATOM   9175   C  CB   . GLU C  2 147 ? 52.699  3.162   -1.700  1.00 0.00 ?  201 GLU C CB   1  
ATOM   9176   C  CG   . GLU C  2 147 ? 53.825  2.574   -0.865  1.00 0.00 ?  201 GLU C CG   1  
ATOM   9177   C  CD   . GLU C  2 147 ? 54.567  3.528   0.096   1.00 0.00 ?  201 GLU C CD   1  
ATOM   9178   O  OE1  . GLU C  2 147 ? 55.769  3.812   -0.083  1.00 0.00 ?  201 GLU C OE1  1  
ATOM   9179   O  OE2  . GLU C  2 147 ? 53.958  4.025   1.057   1.00 0.00 -1 201 GLU C OE2  1  
ATOM   9180   H  H    . GLU C  2 147 ? 50.526  3.673   -2.904  1.00 0.00 ?  201 GLU C H    1  
ATOM   9181   H  HA   . GLU C  2 147 ? 52.336  1.716   -3.218  1.00 0.00 ?  201 GLU C HA   1  
ATOM   9182   H  HB2  . GLU C  2 147 ? 53.063  3.840   -2.502  1.00 0.00 ?  201 GLU C HB2  1  
ATOM   9183   H  HB3  . GLU C  2 147 ? 52.041  3.774   -1.048  1.00 0.00 ?  201 GLU C HB3  1  
ATOM   9184   H  HG2  . GLU C  2 147 ? 53.605  1.655   -0.281  1.00 0.00 ?  201 GLU C HG2  1  
ATOM   9185   H  HG3  . GLU C  2 147 ? 54.575  2.361   -1.657  1.00 0.00 ?  201 GLU C HG3  1  
ATOM   9186   N  N    . ALA C  2 148 ? 50.538  1.014   -0.581  1.00 0.00 ?  202 ALA C N    1  
ATOM   9187   C  CA   . ALA C  2 148 ? 50.066  -0.138  0.228   1.00 0.00 ?  202 ALA C CA   1  
ATOM   9188   C  C    . ALA C  2 148 ? 49.780  -1.400  -0.529  1.00 0.00 ?  202 ALA C C    1  
ATOM   9189   O  O    . ALA C  2 148 ? 50.095  -2.476  -0.050  1.00 0.00 ?  202 ALA C O    1  
ATOM   9190   C  CB   . ALA C  2 148 ? 48.842  0.218   1.121   1.00 0.00 ?  202 ALA C CB   1  
ATOM   9191   H  H    . ALA C  2 148 ? 50.004  1.853   -0.515  1.00 0.00 ?  202 ALA C H    1  
ATOM   9192   H  HA   . ALA C  2 148 ? 50.874  -0.286  0.928   1.00 0.00 ?  202 ALA C HA   1  
ATOM   9193   H  HB1  . ALA C  2 148 ? 48.056  0.443   0.369   1.00 0.00 ?  202 ALA C HB1  1  
ATOM   9194   H  HB2  . ALA C  2 148 ? 49.104  1.072   1.782   1.00 0.00 ?  202 ALA C HB2  1  
ATOM   9195   H  HB3  . ALA C  2 148 ? 48.533  -0.591  1.817   1.00 0.00 ?  202 ALA C HB3  1  
ATOM   9196   N  N    . LEU C  2 149 ? 49.176  -1.416  -1.757  1.00 0.00 ?  203 LEU C N    1  
ATOM   9197   C  CA   . LEU C  2 149 ? 48.749  -2.568  -2.506  1.00 0.00 ?  203 LEU C CA   1  
ATOM   9198   C  C    . LEU C  2 149 ? 49.908  -3.380  -3.079  1.00 0.00 ?  203 LEU C C    1  
ATOM   9199   O  O    . LEU C  2 149 ? 49.761  -4.566  -3.325  1.00 0.00 ?  203 LEU C O    1  
ATOM   9200   C  CB   . LEU C  2 149 ? 47.770  -2.174  -3.659  1.00 0.00 ?  203 LEU C CB   1  
ATOM   9201   C  CG   . LEU C  2 149 ? 46.759  -1.087  -3.587  1.00 0.00 ?  203 LEU C CG   1  
ATOM   9202   C  CD1  . LEU C  2 149 ? 45.979  -0.935  -4.848  1.00 0.00 ?  203 LEU C CD1  1  
ATOM   9203   C  CD2  . LEU C  2 149 ? 45.809  -1.106  -2.298  1.00 0.00 ?  203 LEU C CD2  1  
ATOM   9204   H  H    . LEU C  2 149 ? 49.146  -0.551  -2.253  1.00 0.00 ?  203 LEU C H    1  
ATOM   9205   H  HA   . LEU C  2 149 ? 48.236  -3.232  -1.826  1.00 0.00 ?  203 LEU C HA   1  
ATOM   9206   H  HB2  . LEU C  2 149 ? 48.376  -1.927  -4.557  1.00 0.00 ?  203 LEU C HB2  1  
ATOM   9207   H  HB3  . LEU C  2 149 ? 47.244  -3.102  -3.971  1.00 0.00 ?  203 LEU C HB3  1  
ATOM   9208   H  HG   . LEU C  2 149 ? 47.382  -0.171  -3.501  1.00 0.00 ?  203 LEU C HG   1  
ATOM   9209   H  HD11 . LEU C  2 149 ? 45.689  -1.953  -5.183  1.00 0.00 ?  203 LEU C HD11 1  
ATOM   9210   H  HD12 . LEU C  2 149 ? 46.659  -0.678  -5.688  1.00 0.00 ?  203 LEU C HD12 1  
ATOM   9211   H  HD13 . LEU C  2 149 ? 45.127  -0.249  -4.651  1.00 0.00 ?  203 LEU C HD13 1  
ATOM   9212   H  HD21 . LEU C  2 149 ? 44.991  -0.355  -2.339  1.00 0.00 ?  203 LEU C HD21 1  
ATOM   9213   H  HD22 . LEU C  2 149 ? 46.383  -1.015  -1.351  1.00 0.00 ?  203 LEU C HD22 1  
ATOM   9214   H  HD23 . LEU C  2 149 ? 45.338  -2.099  -2.460  1.00 0.00 ?  203 LEU C HD23 1  
ATOM   9215   N  N    . LYS C  2 150 ? 51.024  -2.699  -3.430  1.00 0.00 ?  204 LYS C N    1  
ATOM   9216   C  CA   . LYS C  2 150 ? 52.222  -3.255  -3.956  1.00 0.00 ?  204 LYS C CA   1  
ATOM   9217   C  C    . LYS C  2 150 ? 53.143  -3.669  -2.815  1.00 0.00 ?  204 LYS C C    1  
ATOM   9218   O  O    . LYS C  2 150 ? 53.688  -4.798  -2.936  1.00 0.00 ?  204 LYS C O    1  
ATOM   9219   C  CB   . LYS C  2 150 ? 52.799  -2.289  -4.994  1.00 0.00 ?  204 LYS C CB   1  
ATOM   9220   C  CG   . LYS C  2 150 ? 51.733  -2.006  -6.177  1.00 0.00 ?  204 LYS C CG   1  
ATOM   9221   C  CD   . LYS C  2 150 ? 52.439  -1.536  -7.467  1.00 0.00 ?  204 LYS C CD   1  
ATOM   9222   C  CE   . LYS C  2 150 ? 51.520  -0.484  -8.119  1.00 0.00 ?  204 LYS C CE   1  
ATOM   9223   N  NZ   . LYS C  2 150 ? 50.442  -1.088  -8.965  1.00 0.00 1  204 LYS C NZ   1  
ATOM   9224   H  H    . LYS C  2 150 ? 50.940  -1.711  -3.322  1.00 0.00 ?  204 LYS C H    1  
ATOM   9225   H  HA   . LYS C  2 150 ? 51.947  -4.169  -4.462  1.00 0.00 ?  204 LYS C HA   1  
ATOM   9226   H  HB2  . LYS C  2 150 ? 53.144  -1.336  -4.539  1.00 0.00 ?  204 LYS C HB2  1  
ATOM   9227   H  HB3  . LYS C  2 150 ? 53.719  -2.609  -5.529  1.00 0.00 ?  204 LYS C HB3  1  
ATOM   9228   H  HG2  . LYS C  2 150 ? 51.184  -2.968  -6.257  1.00 0.00 ?  204 LYS C HG2  1  
ATOM   9229   H  HG3  . LYS C  2 150 ? 51.033  -1.245  -5.770  1.00 0.00 ?  204 LYS C HG3  1  
ATOM   9230   H  HD2  . LYS C  2 150 ? 53.330  -0.929  -7.201  1.00 0.00 ?  204 LYS C HD2  1  
ATOM   9231   H  HD3  . LYS C  2 150 ? 52.717  -2.253  -8.270  1.00 0.00 ?  204 LYS C HD3  1  
ATOM   9232   H  HE2  . LYS C  2 150 ? 51.063  0.261   -7.434  1.00 0.00 ?  204 LYS C HE2  1  
ATOM   9233   H  HE3  . LYS C  2 150 ? 52.062  0.135   -8.866  1.00 0.00 ?  204 LYS C HE3  1  
ATOM   9234   H  HZ1  . LYS C  2 150 ? 50.232  -0.478  -9.781  1.00 0.00 ?  204 LYS C HZ1  1  
ATOM   9235   H  HZ2  . LYS C  2 150 ? 49.569  -1.302  -8.441  1.00 0.00 ?  204 LYS C HZ2  1  
ATOM   9236   H  HZ3  . LYS C  2 150 ? 50.955  -1.933  -9.289  1.00 0.00 ?  204 LYS C HZ3  1  
ATOM   9237   N  N    . GLU C  2 151 ? 53.433  -2.762  -1.871  1.00 0.00 ?  205 GLU C N    1  
ATOM   9238   C  CA   . GLU C  2 151 ? 54.405  -2.907  -0.789  1.00 0.00 ?  205 GLU C CA   1  
ATOM   9239   C  C    . GLU C  2 151 ? 54.082  -4.021  0.106   1.00 0.00 ?  205 GLU C C    1  
ATOM   9240   O  O    . GLU C  2 151 ? 54.934  -4.903  0.329   1.00 0.00 ?  205 GLU C O    1  
ATOM   9241   C  CB   . GLU C  2 151 ? 54.581  -1.570  0.034   1.00 0.00 ?  205 GLU C CB   1  
ATOM   9242   C  CG   . GLU C  2 151 ? 55.367  -1.740  1.345   1.00 0.00 ?  205 GLU C CG   1  
ATOM   9243   C  CD   . GLU C  2 151 ? 55.653  -0.325  1.934   1.00 0.00 ?  205 GLU C CD   1  
ATOM   9244   O  OE1  . GLU C  2 151 ? 54.723  0.267   2.580   1.00 0.00 ?  205 GLU C OE1  1  
ATOM   9245   O  OE2  . GLU C  2 151 ? 56.813  0.172   1.694   1.00 0.00 -1 205 GLU C OE2  1  
ATOM   9246   H  H    . GLU C  2 151 ? 53.021  -1.859  -1.972  1.00 0.00 ?  205 GLU C H    1  
ATOM   9247   H  HA   . GLU C  2 151 ? 55.339  -3.129  -1.285  1.00 0.00 ?  205 GLU C HA   1  
ATOM   9248   H  HB2  . GLU C  2 151 ? 55.044  -0.850  -0.673  1.00 0.00 ?  205 GLU C HB2  1  
ATOM   9249   H  HB3  . GLU C  2 151 ? 53.536  -1.236  0.211   1.00 0.00 ?  205 GLU C HB3  1  
ATOM   9250   H  HG2  . GLU C  2 151 ? 54.809  -2.325  2.106   1.00 0.00 ?  205 GLU C HG2  1  
ATOM   9251   H  HG3  . GLU C  2 151 ? 56.392  -2.166  1.291   1.00 0.00 ?  205 GLU C HG3  1  
ATOM   9252   N  N    . ASN C  2 152 ? 52.815  -4.257  0.613   1.00 0.00 ?  206 ASN C N    1  
ATOM   9253   C  CA   . ASN C  2 152 ? 52.387  -5.415  1.447   1.00 0.00 ?  206 ASN C CA   1  
ATOM   9254   C  C    . ASN C  2 152 ? 51.747  -6.465  0.553   1.00 0.00 ?  206 ASN C C    1  
ATOM   9255   O  O    . ASN C  2 152 ? 50.840  -7.211  1.016   1.00 0.00 ?  206 ASN C O    1  
ATOM   9256   C  CB   . ASN C  2 152 ? 51.552  -4.952  2.600   1.00 0.00 ?  206 ASN C CB   1  
ATOM   9257   C  CG   . ASN C  2 152 ? 52.255  -3.754  3.305   1.00 0.00 ?  206 ASN C CG   1  
ATOM   9258   O  OD1  . ASN C  2 152 ? 53.340  -3.753  3.889   1.00 0.00 ?  206 ASN C OD1  1  
ATOM   9259   N  ND2  . ASN C  2 152 ? 51.613  -2.600  3.060   1.00 0.00 ?  206 ASN C ND2  1  
ATOM   9260   H  H    . ASN C  2 152 ? 52.130  -3.553  0.443   1.00 0.00 ?  206 ASN C H    1  
ATOM   9261   H  HA   . ASN C  2 152 ? 53.282  -5.964  1.700   1.00 0.00 ?  206 ASN C HA   1  
ATOM   9262   H  HB2  . ASN C  2 152 ? 50.472  -4.783  2.402   1.00 0.00 ?  206 ASN C HB2  1  
ATOM   9263   H  HB3  . ASN C  2 152 ? 51.569  -5.709  3.413   1.00 0.00 ?  206 ASN C HB3  1  
ATOM   9264   H  HD21 . ASN C  2 152 ? 51.947  -1.773  3.512   1.00 0.00 ?  206 ASN C HD21 1  
ATOM   9265   H  HD22 . ASN C  2 152 ? 50.824  -2.597  2.446   1.00 0.00 ?  206 ASN C HD22 1  
ATOM   9266   N  N    . GLY C  2 153 ? 52.048  -6.538  -0.715  1.00 0.00 ?  207 GLY C N    1  
ATOM   9267   C  CA   . GLY C  2 153 ? 51.625  -7.627  -1.592  1.00 0.00 ?  207 GLY C CA   1  
ATOM   9268   C  C    . GLY C  2 153 ? 52.194  -8.955  -1.233  1.00 0.00 ?  207 GLY C C    1  
ATOM   9269   O  O    . GLY C  2 153 ? 51.572  -9.973  -1.582  1.00 0.00 ?  207 GLY C O    1  
ATOM   9270   H  H    . GLY C  2 153 ? 52.764  -5.990  -1.141  1.00 0.00 ?  207 GLY C H    1  
ATOM   9271   H  HA2  . GLY C  2 153 ? 50.546  -7.665  -1.633  1.00 0.00 ?  207 GLY C HA2  1  
ATOM   9272   H  HA3  . GLY C  2 153 ? 51.923  -7.313  -2.581  1.00 0.00 ?  207 GLY C HA3  1  
ATOM   9273   N  N    . GLY C  2 154 ? 53.452  -9.027  -0.660  1.00 0.00 ?  208 GLY C N    1  
ATOM   9274   C  CA   . GLY C  2 154 ? 54.035  -10.214 -0.042  1.00 0.00 ?  208 GLY C CA   1  
ATOM   9275   C  C    . GLY C  2 154 ? 53.130  -10.797 1.050   1.00 0.00 ?  208 GLY C C    1  
ATOM   9276   O  O    . GLY C  2 154 ? 52.812  -12.001 1.026   1.00 0.00 ?  208 GLY C O    1  
ATOM   9277   H  H    . GLY C  2 154 ? 53.944  -8.175  -0.503  1.00 0.00 ?  208 GLY C H    1  
ATOM   9278   H  HA2  . GLY C  2 154 ? 54.319  -10.979 -0.749  1.00 0.00 ?  208 GLY C HA2  1  
ATOM   9279   H  HA3  . GLY C  2 154 ? 54.991  -9.981  0.403   1.00 0.00 ?  208 GLY C HA3  1  
ATOM   9280   N  N    . ALA C  2 155 ? 52.607  -9.851  1.881   1.00 0.00 ?  209 ALA C N    1  
ATOM   9281   C  CA   . ALA C  2 155 ? 51.715  -10.167 3.028   1.00 0.00 ?  209 ALA C CA   1  
ATOM   9282   C  C    . ALA C  2 155 ? 50.371  -10.803 2.626   1.00 0.00 ?  209 ALA C C    1  
ATOM   9283   O  O    . ALA C  2 155 ? 49.945  -11.839 3.096   1.00 0.00 ?  209 ALA C O    1  
ATOM   9284   C  CB   . ALA C  2 155 ? 51.573  -9.002  3.975   1.00 0.00 ?  209 ALA C CB   1  
ATOM   9285   H  H    . ALA C  2 155 ? 52.819  -8.881  1.790   1.00 0.00 ?  209 ALA C H    1  
ATOM   9286   H  HA   . ALA C  2 155 ? 52.232  -10.942 3.575   1.00 0.00 ?  209 ALA C HA   1  
ATOM   9287   H  HB1  . ALA C  2 155 ? 51.159  -8.182  3.350   1.00 0.00 ?  209 ALA C HB1  1  
ATOM   9288   H  HB2  . ALA C  2 155 ? 52.547  -8.657  4.383   1.00 0.00 ?  209 ALA C HB2  1  
ATOM   9289   H  HB3  . ALA C  2 155 ? 50.903  -9.206  4.837   1.00 0.00 ?  209 ALA C HB3  1  
ATOM   9290   N  N    . ARG C  2 156 ? 49.714  -9.975  1.773   1.00 0.00 ?  210 ARG C N    1  
ATOM   9291   C  CA   . ARG C  2 156 ? 48.556  -10.316 0.960   1.00 0.00 ?  210 ARG C CA   1  
ATOM   9292   C  C    . ARG C  2 156 ? 48.593  -11.673 0.293   1.00 0.00 ?  210 ARG C C    1  
ATOM   9293   O  O    . ARG C  2 156 ? 47.569  -12.334 0.504   1.00 0.00 ?  210 ARG C O    1  
ATOM   9294   C  CB   . ARG C  2 156 ? 48.241  -9.110  -0.084  1.00 0.00 ?  210 ARG C CB   1  
ATOM   9295   C  CG   . ARG C  2 156 ? 47.093  -9.339  -1.094  1.00 0.00 ?  210 ARG C CG   1  
ATOM   9296   C  CD   . ARG C  2 156 ? 47.491  -9.974  -2.422  1.00 0.00 ?  210 ARG C CD   1  
ATOM   9297   N  NE   . ARG C  2 156 ? 46.295  -10.403 -3.244  1.00 0.00 ?  210 ARG C NE   1  
ATOM   9298   C  CZ   . ARG C  2 156 ? 45.448  -9.683  -3.946  1.00 0.00 ?  210 ARG C CZ   1  
ATOM   9299   N  NH1  . ARG C  2 156 ? 44.344  -10.129 -4.544  1.00 0.00 1  210 ARG C NH1  1  
ATOM   9300   N  NH2  . ARG C  2 156 ? 45.627  -8.398  -4.078  1.00 0.00 ?  210 ARG C NH2  1  
ATOM   9301   H  H    . ARG C  2 156 ? 50.202  -9.114  1.653   1.00 0.00 ?  210 ARG C H    1  
ATOM   9302   H  HA   . ARG C  2 156 ? 47.644  -10.326 1.538   1.00 0.00 ?  210 ARG C HA   1  
ATOM   9303   H  HB2  . ARG C  2 156 ? 47.860  -8.372  0.653   1.00 0.00 ?  210 ARG C HB2  1  
ATOM   9304   H  HB3  . ARG C  2 156 ? 49.149  -8.769  -0.625  1.00 0.00 ?  210 ARG C HB3  1  
ATOM   9305   H  HG2  . ARG C  2 156 ? 46.371  -9.977  -0.541  1.00 0.00 ?  210 ARG C HG2  1  
ATOM   9306   H  HG3  . ARG C  2 156 ? 46.593  -8.349  -1.168  1.00 0.00 ?  210 ARG C HG3  1  
ATOM   9307   H  HD2  . ARG C  2 156 ? 48.110  -9.261  -3.007  1.00 0.00 ?  210 ARG C HD2  1  
ATOM   9308   H  HD3  . ARG C  2 156 ? 48.103  -10.894 -2.307  1.00 0.00 ?  210 ARG C HD3  1  
ATOM   9309   H  HE   . ARG C  2 156 ? 46.066  -11.366 -3.385  1.00 0.00 ?  210 ARG C HE   1  
ATOM   9310   H  HH11 . ARG C  2 156 ? 44.173  -11.109 -4.441  1.00 0.00 ?  210 ARG C HH11 1  
ATOM   9311   H  HH12 . ARG C  2 156 ? 43.736  -9.405  -4.869  1.00 0.00 ?  210 ARG C HH12 1  
ATOM   9312   H  HH21 . ARG C  2 156 ? 44.841  -7.866  -4.392  1.00 0.00 ?  210 ARG C HH21 1  
ATOM   9313   H  HH22 . ARG C  2 156 ? 46.487  -7.909  -3.932  1.00 0.00 ?  210 ARG C HH22 1  
ATOM   9314   N  N    . LEU C  2 157 ? 49.635  -12.008 -0.492  1.00 0.00 ?  211 LEU C N    1  
ATOM   9315   C  CA   . LEU C  2 157 ? 49.774  -13.267 -1.132  1.00 0.00 ?  211 LEU C CA   1  
ATOM   9316   C  C    . LEU C  2 157 ? 49.796  -14.385 -0.125  1.00 0.00 ?  211 LEU C C    1  
ATOM   9317   O  O    . LEU C  2 157 ? 49.067  -15.404 -0.319  1.00 0.00 ?  211 LEU C O    1  
ATOM   9318   C  CB   . LEU C  2 157 ? 51.118  -13.342 -2.026  1.00 0.00 ?  211 LEU C CB   1  
ATOM   9319   C  CG   . LEU C  2 157 ? 51.503  -14.676 -2.637  1.00 0.00 ?  211 LEU C CG   1  
ATOM   9320   C  CD1  . LEU C  2 157 ? 50.426  -15.104 -3.658  1.00 0.00 ?  211 LEU C CD1  1  
ATOM   9321   C  CD2  . LEU C  2 157 ? 52.857  -14.505 -3.455  1.00 0.00 ?  211 LEU C CD2  1  
ATOM   9322   H  H    . LEU C  2 157 ? 50.434  -11.443 -0.679  1.00 0.00 ?  211 LEU C H    1  
ATOM   9323   H  HA   . LEU C  2 157 ? 48.970  -13.423 -1.836  1.00 0.00 ?  211 LEU C HA   1  
ATOM   9324   H  HB2  . LEU C  2 157 ? 50.993  -12.682 -2.910  1.00 0.00 ?  211 LEU C HB2  1  
ATOM   9325   H  HB3  . LEU C  2 157 ? 52.048  -12.876 -1.635  1.00 0.00 ?  211 LEU C HB3  1  
ATOM   9326   H  HG   . LEU C  2 157 ? 51.610  -15.521 -1.922  1.00 0.00 ?  211 LEU C HG   1  
ATOM   9327   H  HD11 . LEU C  2 157 ? 50.168  -14.313 -4.394  1.00 0.00 ?  211 LEU C HD11 1  
ATOM   9328   H  HD12 . LEU C  2 157 ? 49.510  -15.487 -3.159  1.00 0.00 ?  211 LEU C HD12 1  
ATOM   9329   H  HD13 . LEU C  2 157 ? 50.938  -15.913 -4.223  1.00 0.00 ?  211 LEU C HD13 1  
ATOM   9330   H  HD21 . LEU C  2 157 ? 52.759  -13.740 -4.254  1.00 0.00 ?  211 LEU C HD21 1  
ATOM   9331   H  HD22 . LEU C  2 157 ? 52.992  -15.501 -3.928  1.00 0.00 ?  211 LEU C HD22 1  
ATOM   9332   H  HD23 . LEU C  2 157 ? 53.690  -14.193 -2.790  1.00 0.00 ?  211 LEU C HD23 1  
ATOM   9333   N  N    . ALA C  2 158 ? 50.533  -14.356 0.993   1.00 0.00 ?  212 ALA C N    1  
ATOM   9334   C  CA   . ALA C  2 158 ? 50.395  -15.411 2.021   1.00 0.00 ?  212 ALA C CA   1  
ATOM   9335   C  C    . ALA C  2 158 ? 49.010  -15.517 2.676   1.00 0.00 ?  212 ALA C C    1  
ATOM   9336   O  O    . ALA C  2 158 ? 48.327  -16.527 2.513   1.00 0.00 ?  212 ALA C O    1  
ATOM   9337   C  CB   . ALA C  2 158 ? 51.456  -15.256 3.181   1.00 0.00 ?  212 ALA C CB   1  
ATOM   9338   H  H    . ALA C  2 158 ? 51.027  -13.541 1.286   1.00 0.00 ?  212 ALA C H    1  
ATOM   9339   H  HA   . ALA C  2 158 ? 50.464  -16.364 1.518   1.00 0.00 ?  212 ALA C HA   1  
ATOM   9340   H  HB1  . ALA C  2 158 ? 51.150  -14.513 3.949   1.00 0.00 ?  212 ALA C HB1  1  
ATOM   9341   H  HB2  . ALA C  2 158 ? 52.449  -15.003 2.751   1.00 0.00 ?  212 ALA C HB2  1  
ATOM   9342   H  HB3  . ALA C  2 158 ? 51.552  -16.266 3.633   1.00 0.00 ?  212 ALA C HB3  1  
ATOM   9343   N  N    . GLU C  2 159 ? 48.552  -14.346 3.102   1.00 0.00 ?  213 GLU C N    1  
ATOM   9344   C  CA   . GLU C  2 159 ? 47.450  -14.243 3.971   1.00 0.00 ?  213 GLU C CA   1  
ATOM   9345   C  C    . GLU C  2 159 ? 46.136  -14.805 3.333   1.00 0.00 ?  213 GLU C C    1  
ATOM   9346   O  O    . GLU C  2 159 ? 45.292  -15.469 4.032   1.00 0.00 ?  213 GLU C O    1  
ATOM   9347   C  CB   . GLU C  2 159 ? 47.283  -12.799 4.483   1.00 0.00 ?  213 GLU C CB   1  
ATOM   9348   C  CG   . GLU C  2 159 ? 46.325  -12.560 5.593   1.00 0.00 ?  213 GLU C CG   1  
ATOM   9349   C  CD   . GLU C  2 159 ? 46.639  -13.449 6.811   1.00 0.00 ?  213 GLU C CD   1  
ATOM   9350   O  OE1  . GLU C  2 159 ? 47.790  -13.499 7.255   1.00 0.00 ?  213 GLU C OE1  1  
ATOM   9351   O  OE2  . GLU C  2 159 ? 45.658  -13.996 7.445   1.00 0.00 -1 213 GLU C OE2  1  
ATOM   9352   H  H    . GLU C  2 159 ? 49.105  -13.529 2.954   1.00 0.00 ?  213 GLU C H    1  
ATOM   9353   H  HA   . GLU C  2 159 ? 47.604  -14.760 4.907   1.00 0.00 ?  213 GLU C HA   1  
ATOM   9354   H  HB2  . GLU C  2 159 ? 48.287  -12.487 4.841   1.00 0.00 ?  213 GLU C HB2  1  
ATOM   9355   H  HB3  . GLU C  2 159 ? 47.060  -12.081 3.666   1.00 0.00 ?  213 GLU C HB3  1  
ATOM   9356   H  HG2  . GLU C  2 159 ? 46.323  -11.542 6.038   1.00 0.00 ?  213 GLU C HG2  1  
ATOM   9357   H  HG3  . GLU C  2 159 ? 45.260  -12.717 5.317   1.00 0.00 ?  213 GLU C HG3  1  
ATOM   9358   N  N    . TYR C  2 160 ? 45.902  -14.560 2.007   1.00 0.00 ?  214 TYR C N    1  
ATOM   9359   C  CA   . TYR C  2 160 ? 44.837  -15.233 1.244   1.00 0.00 ?  214 TYR C CA   1  
ATOM   9360   C  C    . TYR C  2 160 ? 44.870  -16.757 1.147   1.00 0.00 ?  214 TYR C C    1  
ATOM   9361   O  O    . TYR C  2 160 ? 43.860  -17.393 1.479   1.00 0.00 ?  214 TYR C O    1  
ATOM   9362   C  CB   . TYR C  2 160 ? 44.625  -14.625 -0.196  1.00 0.00 ?  214 TYR C CB   1  
ATOM   9363   C  CG   . TYR C  2 160 ? 43.611  -15.320 -1.162  1.00 0.00 ?  214 TYR C CG   1  
ATOM   9364   C  CD1  . TYR C  2 160 ? 44.064  -16.131 -2.210  1.00 0.00 ?  214 TYR C CD1  1  
ATOM   9365   C  CD2  . TYR C  2 160 ? 42.272  -14.926 -1.154  1.00 0.00 ?  214 TYR C CD2  1  
ATOM   9366   C  CE1  . TYR C  2 160 ? 43.106  -16.760 -3.042  1.00 0.00 ?  214 TYR C CE1  1  
ATOM   9367   C  CE2  . TYR C  2 160 ? 41.364  -15.405 -2.141  1.00 0.00 ?  214 TYR C CE2  1  
ATOM   9368   C  CZ   . TYR C  2 160 ? 41.771  -16.362 -2.994  1.00 0.00 ?  214 TYR C CZ   1  
ATOM   9369   O  OH   . TYR C  2 160 ? 40.741  -16.886 -3.703  1.00 0.00 ?  214 TYR C OH   1  
ATOM   9370   H  H    . TYR C  2 160 ? 46.604  -14.089 1.479   1.00 0.00 ?  214 TYR C H    1  
ATOM   9371   H  HA   . TYR C  2 160 ? 43.948  -14.966 1.796   1.00 0.00 ?  214 TYR C HA   1  
ATOM   9372   H  HB2  . TYR C  2 160 ? 44.164  -13.643 0.043   1.00 0.00 ?  214 TYR C HB2  1  
ATOM   9373   H  HB3  . TYR C  2 160 ? 45.584  -14.562 -0.754  1.00 0.00 ?  214 TYR C HB3  1  
ATOM   9374   H  HD1  . TYR C  2 160 ? 45.115  -16.371 -2.280  1.00 0.00 ?  214 TYR C HD1  1  
ATOM   9375   H  HD2  . TYR C  2 160 ? 41.974  -14.208 -0.404  1.00 0.00 ?  214 TYR C HD2  1  
ATOM   9376   H  HE1  . TYR C  2 160 ? 43.407  -17.485 -3.784  1.00 0.00 ?  214 TYR C HE1  1  
ATOM   9377   H  HE2  . TYR C  2 160 ? 40.333  -15.100 -2.040  1.00 0.00 ?  214 TYR C HE2  1  
ATOM   9378   H  HH   . TYR C  2 160 ? 41.090  -17.522 -4.332  1.00 0.00 ?  214 TYR C HH   1  
ATOM   9379   N  N    . HIS C  2 161 ? 46.005  -17.391 0.750   1.00 0.00 ?  215 HIS C N    1  
ATOM   9380   C  CA   . HIS C  2 161 ? 46.071  -18.858 0.798   1.00 0.00 ?  215 HIS C CA   1  
ATOM   9381   C  C    . HIS C  2 161 ? 46.017  -19.513 2.127   1.00 0.00 ?  215 HIS C C    1  
ATOM   9382   O  O    . HIS C  2 161 ? 45.629  -20.677 2.158   1.00 0.00 ?  215 HIS C O    1  
ATOM   9383   C  CB   . HIS C  2 161 ? 47.338  -19.211 0.044   1.00 0.00 ?  215 HIS C CB   1  
ATOM   9384   C  CG   . HIS C  2 161 ? 47.399  -18.869 -1.437  1.00 0.00 ?  215 HIS C CG   1  
ATOM   9385   N  ND1  . HIS C  2 161 ? 46.712  -19.410 -2.403  1.00 0.00 ?  215 HIS C ND1  1  
ATOM   9386   C  CD2  . HIS C  2 161 ? 48.277  -18.007 -2.078  1.00 0.00 ?  215 HIS C CD2  1  
ATOM   9387   C  CE1  . HIS C  2 161 ? 47.086  -18.875 -3.610  1.00 0.00 ?  215 HIS C CE1  1  
ATOM   9388   N  NE2  . HIS C  2 161 ? 48.040  -18.011 -3.463  1.00 0.00 ?  215 HIS C NE2  1  
ATOM   9389   H  H    . HIS C  2 161 ? 46.876  -16.910 0.686   1.00 0.00 ?  215 HIS C H    1  
ATOM   9390   H  HA   . HIS C  2 161 ? 45.238  -19.286 0.259   1.00 0.00 ?  215 HIS C HA   1  
ATOM   9391   H  HB2  . HIS C  2 161 ? 48.136  -18.705 0.628   1.00 0.00 ?  215 HIS C HB2  1  
ATOM   9392   H  HB3  . HIS C  2 161 ? 47.485  -20.313 0.050   1.00 0.00 ?  215 HIS C HB3  1  
ATOM   9393   H  HD1  . HIS C  2 161 ? 45.959  -20.058 -2.288  1.00 0.00 ?  215 HIS C HD1  1  
ATOM   9394   H  HD2  . HIS C  2 161 ? 49.024  -17.282 -1.782  1.00 0.00 ?  215 HIS C HD2  1  
ATOM   9395   H  HE1  . HIS C  2 161 ? 46.593  -19.092 -4.557  1.00 0.00 ?  215 HIS C HE1  1  
ATOM   9396   N  N    . ALA C  2 162 ? 46.498  -18.828 3.217   1.00 0.00 ?  216 ALA C N    1  
ATOM   9397   C  CA   . ALA C  2 162 ? 46.523  -19.430 4.525   1.00 0.00 ?  216 ALA C CA   1  
ATOM   9398   C  C    . ALA C  2 162 ? 45.139  -19.494 5.127   1.00 0.00 ?  216 ALA C C    1  
ATOM   9399   O  O    . ALA C  2 162 ? 44.886  -20.191 6.140   1.00 0.00 ?  216 ALA C O    1  
ATOM   9400   C  CB   . ALA C  2 162 ? 47.482  -18.582 5.372   1.00 0.00 ?  216 ALA C CB   1  
ATOM   9401   H  H    . ALA C  2 162 ? 46.899  -17.919 3.143   1.00 0.00 ?  216 ALA C H    1  
ATOM   9402   H  HA   . ALA C  2 162 ? 46.839  -20.460 4.452   1.00 0.00 ?  216 ALA C HA   1  
ATOM   9403   H  HB1  . ALA C  2 162 ? 47.275  -17.507 5.182   1.00 0.00 ?  216 ALA C HB1  1  
ATOM   9404   H  HB2  . ALA C  2 162 ? 48.521  -18.948 5.226   1.00 0.00 ?  216 ALA C HB2  1  
ATOM   9405   H  HB3  . ALA C  2 162 ? 47.348  -18.772 6.459   1.00 0.00 ?  216 ALA C HB3  1  
ATOM   9406   N  N    . LYS C  2 163 ? 44.135  -18.732 4.531   1.00 0.00 ?  217 LYS C N    1  
ATOM   9407   C  CA   . LYS C  2 163 ? 42.777  -18.945 4.583   1.00 0.00 ?  217 LYS C CA   1  
ATOM   9408   C  C    . LYS C  2 163 ? 42.274  -19.876 3.501   1.00 0.00 ?  217 LYS C C    1  
ATOM   9409   O  O    . LYS C  2 163 ? 41.960  -21.050 3.791   1.00 0.00 ?  217 LYS C O    1  
ATOM   9410   C  CB   . LYS C  2 163 ? 41.906  -17.627 4.681   1.00 0.00 ?  217 LYS C CB   1  
ATOM   9411   C  CG   . LYS C  2 163 ? 41.845  -16.944 6.045   1.00 0.00 ?  217 LYS C CG   1  
ATOM   9412   C  CD   . LYS C  2 163 ? 43.154  -16.743 6.786   1.00 0.00 ?  217 LYS C CD   1  
ATOM   9413   C  CE   . LYS C  2 163 ? 43.164  -15.852 8.050   1.00 0.00 ?  217 LYS C CE   1  
ATOM   9414   N  NZ   . LYS C  2 163 ? 44.435  -15.949 8.680   1.00 0.00 1  217 LYS C NZ   1  
ATOM   9415   H  H    . LYS C  2 163 ? 44.535  -17.967 4.031   1.00 0.00 ?  217 LYS C H    1  
ATOM   9416   H  HA   . LYS C  2 163 ? 42.547  -19.483 5.491   1.00 0.00 ?  217 LYS C HA   1  
ATOM   9417   H  HB2  . LYS C  2 163 ? 42.432  -16.885 4.043   1.00 0.00 ?  217 LYS C HB2  1  
ATOM   9418   H  HB3  . LYS C  2 163 ? 40.867  -17.768 4.314   1.00 0.00 ?  217 LYS C HB3  1  
ATOM   9419   H  HG2  . LYS C  2 163 ? 41.481  -15.912 5.854   1.00 0.00 ?  217 LYS C HG2  1  
ATOM   9420   H  HG3  . LYS C  2 163 ? 41.050  -17.446 6.637   1.00 0.00 ?  217 LYS C HG3  1  
ATOM   9421   H  HD2  . LYS C  2 163 ? 43.403  -17.752 7.181   1.00 0.00 ?  217 LYS C HD2  1  
ATOM   9422   H  HD3  . LYS C  2 163 ? 44.017  -16.341 6.214   1.00 0.00 ?  217 LYS C HD3  1  
ATOM   9423   H  HE2  . LYS C  2 163 ? 42.879  -14.855 7.651   1.00 0.00 ?  217 LYS C HE2  1  
ATOM   9424   H  HE3  . LYS C  2 163 ? 42.389  -16.036 8.825   1.00 0.00 ?  217 LYS C HE3  1  
ATOM   9425   H  HZ1  . LYS C  2 163 ? 44.502  -15.573 9.648   1.00 0.00 ?  217 LYS C HZ1  1  
ATOM   9426   H  HZ2  . LYS C  2 163 ? 45.096  -15.367 8.126   1.00 0.00 ?  217 LYS C HZ2  1  
ATOM   9427   H  HZ3  . LYS C  2 163 ? 44.810  -16.903 8.857   1.00 0.00 ?  217 LYS C HZ3  1  
ATOM   9428   N  N    . ALA C  2 164 ? 42.016  -19.283 2.256   1.00 0.00 ?  218 ALA C N    1  
ATOM   9429   C  CA   . ALA C  2 164 ? 41.209  -19.891 1.150   1.00 0.00 ?  218 ALA C CA   1  
ATOM   9430   C  C    . ALA C  2 164 ? 41.605  -21.341 0.825   1.00 0.00 ?  218 ALA C C    1  
ATOM   9431   O  O    . ALA C  2 164 ? 40.803  -22.225 0.805   1.00 0.00 ?  218 ALA C O    1  
ATOM   9432   C  CB   . ALA C  2 164 ? 41.371  -18.981 -0.182  1.00 0.00 ?  218 ALA C CB   1  
ATOM   9433   H  H    . ALA C  2 164 ? 42.355  -18.378 2.013   1.00 0.00 ?  218 ALA C H    1  
ATOM   9434   H  HA   . ALA C  2 164 ? 40.155  -19.885 1.383   1.00 0.00 ?  218 ALA C HA   1  
ATOM   9435   H  HB1  . ALA C  2 164 ? 42.430  -18.917 -0.511  1.00 0.00 ?  218 ALA C HB1  1  
ATOM   9436   H  HB2  . ALA C  2 164 ? 41.062  -17.937 0.044   1.00 0.00 ?  218 ALA C HB2  1  
ATOM   9437   H  HB3  . ALA C  2 164 ? 40.762  -19.531 -0.930  1.00 0.00 ?  218 ALA C HB3  1  
ATOM   9438   N  N    . THR C  2 165 ? 42.898  -21.509 0.608   1.00 0.00 ?  219 THR C N    1  
ATOM   9439   C  CA   . THR C  2 165 ? 43.516  -22.795 0.185   1.00 0.00 ?  219 THR C CA   1  
ATOM   9440   C  C    . THR C  2 165 ? 43.590  -23.760 1.333   1.00 0.00 ?  219 THR C C    1  
ATOM   9441   O  O    . THR C  2 165 ? 43.102  -24.876 1.232   1.00 0.00 ?  219 THR C O    1  
ATOM   9442   C  CB   . THR C  2 165 ? 44.927  -22.520 -0.305  1.00 0.00 ?  219 THR C CB   1  
ATOM   9443   O  OG1  . THR C  2 165 ? 44.942  -21.345 -1.149  1.00 0.00 ?  219 THR C OG1  1  
ATOM   9444   C  CG2  . THR C  2 165 ? 45.340  -23.726 -1.175  1.00 0.00 ?  219 THR C CG2  1  
ATOM   9445   H  H    . THR C  2 165 ? 43.558  -20.797 0.837   1.00 0.00 ?  219 THR C H    1  
ATOM   9446   H  HA   . THR C  2 165 ? 42.933  -23.263 -0.594  1.00 0.00 ?  219 THR C HA   1  
ATOM   9447   H  HB   . THR C  2 165 ? 45.699  -22.425 0.489   1.00 0.00 ?  219 THR C HB   1  
ATOM   9448   H  HG1  . THR C  2 165 ? 44.188  -21.561 -1.703  1.00 0.00 ?  219 THR C HG1  1  
ATOM   9449   H  HG21 . THR C  2 165 ? 46.271  -23.490 -1.734  1.00 0.00 ?  219 THR C HG21 1  
ATOM   9450   H  HG22 . THR C  2 165 ? 44.508  -23.901 -1.889  1.00 0.00 ?  219 THR C HG22 1  
ATOM   9451   H  HG23 . THR C  2 165 ? 45.434  -24.634 -0.541  1.00 0.00 ?  219 THR C HG23 1  
ATOM   9452   N  N    . GLU C  2 166 ? 44.112  -23.265 2.476   1.00 0.00 ?  220 GLU C N    1  
ATOM   9453   C  CA   . GLU C  2 166 ? 44.214  -24.145 3.689   1.00 0.00 ?  220 GLU C CA   1  
ATOM   9454   C  C    . GLU C  2 166 ? 42.814  -24.728 4.127   1.00 0.00 ?  220 GLU C C    1  
ATOM   9455   O  O    . GLU C  2 166 ? 42.657  -25.939 4.321   1.00 0.00 ?  220 GLU C O    1  
ATOM   9456   C  CB   . GLU C  2 166 ? 44.837  -23.422 4.821   1.00 0.00 ?  220 GLU C CB   1  
ATOM   9457   C  CG   . GLU C  2 166 ? 46.401  -23.243 4.764   1.00 0.00 ?  220 GLU C CG   1  
ATOM   9458   C  CD   . GLU C  2 166 ? 47.235  -24.459 5.126   1.00 0.00 ?  220 GLU C CD   1  
ATOM   9459   O  OE1  . GLU C  2 166 ? 48.026  -24.951 4.315   1.00 0.00 ?  220 GLU C OE1  1  
ATOM   9460   O  OE2  . GLU C  2 166 ? 47.099  -24.952 6.279   1.00 0.00 -1 220 GLU C OE2  1  
ATOM   9461   H  H    . GLU C  2 166 ? 44.662  -22.433 2.467   1.00 0.00 ?  220 GLU C H    1  
ATOM   9462   H  HA   . GLU C  2 166 ? 44.806  -25.035 3.530   1.00 0.00 ?  220 GLU C HA   1  
ATOM   9463   H  HB2  . GLU C  2 166 ? 44.527  -22.356 4.834   1.00 0.00 ?  220 GLU C HB2  1  
ATOM   9464   H  HB3  . GLU C  2 166 ? 44.521  -23.916 5.765   1.00 0.00 ?  220 GLU C HB3  1  
ATOM   9465   H  HG2  . GLU C  2 166 ? 46.858  -22.923 3.803   1.00 0.00 ?  220 GLU C HG2  1  
ATOM   9466   H  HG3  . GLU C  2 166 ? 46.549  -22.419 5.494   1.00 0.00 ?  220 GLU C HG3  1  
ATOM   9467   N  N    . HIS C  2 167 ? 41.762  -23.841 4.223   1.00 0.00 ?  221 HIS C N    1  
ATOM   9468   C  CA   . HIS C  2 167 ? 40.380  -24.071 4.596   1.00 0.00 ?  221 HIS C CA   1  
ATOM   9469   C  C    . HIS C  2 167 ? 39.662  -24.931 3.540   1.00 0.00 ?  221 HIS C C    1  
ATOM   9470   O  O    . HIS C  2 167 ? 39.122  -25.965 3.893   1.00 0.00 ?  221 HIS C O    1  
ATOM   9471   C  CB   . HIS C  2 167 ? 39.695  -22.683 4.905   1.00 0.00 ?  221 HIS C CB   1  
ATOM   9472   C  CG   . HIS C  2 167 ? 40.230  -22.080 6.172   1.00 0.00 ?  221 HIS C CG   1  
ATOM   9473   N  ND1  . HIS C  2 167 ? 41.169  -22.677 7.024   1.00 0.00 ?  221 HIS C ND1  1  
ATOM   9474   C  CD2  . HIS C  2 167 ? 39.942  -20.862 6.691   1.00 0.00 ?  221 HIS C CD2  1  
ATOM   9475   C  CE1  . HIS C  2 167 ? 41.454  -21.759 7.998   1.00 0.00 ?  221 HIS C CE1  1  
ATOM   9476   N  NE2  . HIS C  2 167 ? 40.706  -20.609 7.826   1.00 0.00 ?  221 HIS C NE2  1  
ATOM   9477   H  H    . HIS C  2 167 ? 42.076  -22.895 4.212   1.00 0.00 ?  221 HIS C H    1  
ATOM   9478   H  HA   . HIS C  2 167 ? 40.295  -24.745 5.436   1.00 0.00 ?  221 HIS C HA   1  
ATOM   9479   H  HB2  . HIS C  2 167 ? 39.874  -22.005 4.043   1.00 0.00 ?  221 HIS C HB2  1  
ATOM   9480   H  HB3  . HIS C  2 167 ? 38.598  -22.803 5.029   1.00 0.00 ?  221 HIS C HB3  1  
ATOM   9481   H  HD1  . HIS C  2 167 ? 41.411  -23.639 7.149   1.00 0.00 ?  221 HIS C HD1  1  
ATOM   9482   H  HD2  . HIS C  2 167 ? 39.174  -20.136 6.452   1.00 0.00 ?  221 HIS C HD2  1  
ATOM   9483   H  HE1  . HIS C  2 167 ? 42.194  -21.928 8.780   1.00 0.00 ?  221 HIS C HE1  1  
ATOM   9484   N  N    . LEU C  2 168 ? 39.862  -24.646 2.218   1.00 0.00 ?  222 LEU C N    1  
ATOM   9485   C  CA   . LEU C  2 168 ? 39.428  -25.577 1.152   1.00 0.00 ?  222 LEU C CA   1  
ATOM   9486   C  C    . LEU C  2 168 ? 39.974  -26.987 1.068   1.00 0.00 ?  222 LEU C C    1  
ATOM   9487   O  O    . LEU C  2 168 ? 39.212  -27.987 0.999   1.00 0.00 ?  222 LEU C O    1  
ATOM   9488   C  CB   . LEU C  2 168 ? 39.612  -24.929 -0.290  1.00 0.00 ?  222 LEU C CB   1  
ATOM   9489   C  CG   . LEU C  2 168 ? 39.326  -25.753 -1.573  1.00 0.00 ?  222 LEU C CG   1  
ATOM   9490   C  CD1  . LEU C  2 168 ? 37.983  -26.420 -1.741  1.00 0.00 ?  222 LEU C CD1  1  
ATOM   9491   C  CD2  . LEU C  2 168 ? 39.638  -24.835 -2.762  1.00 0.00 ?  222 LEU C CD2  1  
ATOM   9492   H  H    . LEU C  2 168 ? 40.362  -23.793 2.090   1.00 0.00 ?  222 LEU C H    1  
ATOM   9493   H  HA   . LEU C  2 168 ? 38.377  -25.742 1.339   1.00 0.00 ?  222 LEU C HA   1  
ATOM   9494   H  HB2  . LEU C  2 168 ? 38.844  -24.137 -0.419  1.00 0.00 ?  222 LEU C HB2  1  
ATOM   9495   H  HB3  . LEU C  2 168 ? 40.643  -24.521 -0.359  1.00 0.00 ?  222 LEU C HB3  1  
ATOM   9496   H  HG   . LEU C  2 168 ? 40.070  -26.577 -1.614  1.00 0.00 ?  222 LEU C HG   1  
ATOM   9497   H  HD11 . LEU C  2 168 ? 37.892  -27.160 -0.918  1.00 0.00 ?  222 LEU C HD11 1  
ATOM   9498   H  HD12 . LEU C  2 168 ? 37.980  -27.077 -2.637  1.00 0.00 ?  222 LEU C HD12 1  
ATOM   9499   H  HD13 . LEU C  2 168 ? 37.079  -25.775 -1.701  1.00 0.00 ?  222 LEU C HD13 1  
ATOM   9500   H  HD21 . LEU C  2 168 ? 40.634  -24.356 -2.652  1.00 0.00 ?  222 LEU C HD21 1  
ATOM   9501   H  HD22 . LEU C  2 168 ? 38.814  -24.095 -2.859  1.00 0.00 ?  222 LEU C HD22 1  
ATOM   9502   H  HD23 . LEU C  2 168 ? 39.659  -25.509 -3.645  1.00 0.00 ?  222 LEU C HD23 1  
ATOM   9503   N  N    . SER C  2 169 ? 41.352  -27.090 1.197   1.00 0.00 ?  223 SER C N    1  
ATOM   9504   C  CA   . SER C  2 169 ? 42.178  -28.250 1.101   1.00 0.00 ?  223 SER C CA   1  
ATOM   9505   C  C    . SER C  2 169 ? 41.918  -29.131 2.338   1.00 0.00 ?  223 SER C C    1  
ATOM   9506   O  O    . SER C  2 169 ? 41.935  -30.315 2.162   1.00 0.00 ?  223 SER C O    1  
ATOM   9507   C  CB   . SER C  2 169 ? 43.715  -27.975 1.031   1.00 0.00 ?  223 SER C CB   1  
ATOM   9508   O  OG   . SER C  2 169 ? 44.487  -29.163 0.722   1.00 0.00 ?  223 SER C OG   1  
ATOM   9509   H  H    . SER C  2 169 ? 41.807  -26.203 1.187   1.00 0.00 ?  223 SER C H    1  
ATOM   9510   H  HA   . SER C  2 169 ? 41.948  -28.827 0.218   1.00 0.00 ?  223 SER C HA   1  
ATOM   9511   H  HB2  . SER C  2 169 ? 43.842  -27.266 0.186   1.00 0.00 ?  223 SER C HB2  1  
ATOM   9512   H  HB3  . SER C  2 169 ? 44.078  -27.460 1.947   1.00 0.00 ?  223 SER C HB3  1  
ATOM   9513   H  HG   . SER C  2 169 ? 45.424  -29.055 0.902   1.00 0.00 ?  223 SER C HG   1  
ATOM   9514   N  N    . THR C  2 170 ? 41.843  -28.559 3.582   1.00 0.00 ?  224 THR C N    1  
ATOM   9515   C  CA   . THR C  2 170 ? 41.475  -29.237 4.806   1.00 0.00 ?  224 THR C CA   1  
ATOM   9516   C  C    . THR C  2 170 ? 40.134  -29.978 4.713   1.00 0.00 ?  224 THR C C    1  
ATOM   9517   O  O    . THR C  2 170 ? 39.959  -31.148 5.072   1.00 0.00 ?  224 THR C O    1  
ATOM   9518   C  CB   . THR C  2 170 ? 41.504  -28.392 6.097   1.00 0.00 ?  224 THR C CB   1  
ATOM   9519   O  OG1  . THR C  2 170 ? 42.789  -27.751 6.361   1.00 0.00 ?  224 THR C OG1  1  
ATOM   9520   C  CG2  . THR C  2 170 ? 41.274  -29.300 7.356   1.00 0.00 ?  224 THR C CG2  1  
ATOM   9521   H  H    . THR C  2 170 ? 41.826  -27.563 3.572   1.00 0.00 ?  224 THR C H    1  
ATOM   9522   H  HA   . THR C  2 170 ? 42.229  -29.989 4.986   1.00 0.00 ?  224 THR C HA   1  
ATOM   9523   H  HB   . THR C  2 170 ? 40.683  -27.652 5.984   1.00 0.00 ?  224 THR C HB   1  
ATOM   9524   H  HG1  . THR C  2 170 ? 42.842  -27.227 5.559   1.00 0.00 ?  224 THR C HG1  1  
ATOM   9525   H  HG21 . THR C  2 170 ? 40.398  -29.974 7.241   1.00 0.00 ?  224 THR C HG21 1  
ATOM   9526   H  HG22 . THR C  2 170 ? 41.191  -28.637 8.244   1.00 0.00 ?  224 THR C HG22 1  
ATOM   9527   H  HG23 . THR C  2 170 ? 42.118  -29.986 7.583   1.00 0.00 ?  224 THR C HG23 1  
ATOM   9528   N  N    . LEU C  2 171 ? 39.094  -29.304 4.083   1.00 0.00 ?  225 LEU C N    1  
ATOM   9529   C  CA   . LEU C  2 171 ? 37.888  -29.991 3.728   1.00 0.00 ?  225 LEU C CA   1  
ATOM   9530   C  C    . LEU C  2 171 ? 38.093  -31.073 2.678   1.00 0.00 ?  225 LEU C C    1  
ATOM   9531   O  O    . LEU C  2 171 ? 37.540  -32.142 2.805   1.00 0.00 ?  225 LEU C O    1  
ATOM   9532   C  CB   . LEU C  2 171 ? 36.795  -28.997 3.305   1.00 0.00 ?  225 LEU C CB   1  
ATOM   9533   C  CG   . LEU C  2 171 ? 35.526  -29.519 2.463   1.00 0.00 ?  225 LEU C CG   1  
ATOM   9534   C  CD1  . LEU C  2 171 ? 34.626  -30.329 3.367   1.00 0.00 ?  225 LEU C CD1  1  
ATOM   9535   C  CD2  . LEU C  2 171 ? 34.902  -28.373 1.734   1.00 0.00 ?  225 LEU C CD2  1  
ATOM   9536   H  H    . LEU C  2 171 ? 39.253  -28.401 3.693   1.00 0.00 ?  225 LEU C H    1  
ATOM   9537   H  HA   . LEU C  2 171 ? 37.703  -30.512 4.656   1.00 0.00 ?  225 LEU C HA   1  
ATOM   9538   H  HB2  . LEU C  2 171 ? 36.344  -28.696 4.274   1.00 0.00 ?  225 LEU C HB2  1  
ATOM   9539   H  HB3  . LEU C  2 171 ? 37.091  -28.079 2.755   1.00 0.00 ?  225 LEU C HB3  1  
ATOM   9540   H  HG   . LEU C  2 171 ? 35.844  -30.226 1.667   1.00 0.00 ?  225 LEU C HG   1  
ATOM   9541   H  HD11 . LEU C  2 171 ? 33.931  -29.745 4.006   1.00 0.00 ?  225 LEU C HD11 1  
ATOM   9542   H  HD12 . LEU C  2 171 ? 35.224  -30.930 4.085   1.00 0.00 ?  225 LEU C HD12 1  
ATOM   9543   H  HD13 . LEU C  2 171 ? 33.941  -30.930 2.731   1.00 0.00 ?  225 LEU C HD13 1  
ATOM   9544   H  HD21 . LEU C  2 171 ? 34.360  -27.706 2.438   1.00 0.00 ?  225 LEU C HD21 1  
ATOM   9545   H  HD22 . LEU C  2 171 ? 34.207  -28.676 0.921   1.00 0.00 ?  225 LEU C HD22 1  
ATOM   9546   H  HD23 . LEU C  2 171 ? 35.607  -27.772 1.121   1.00 0.00 ?  225 LEU C HD23 1  
ATOM   9547   N  N    . SER C  2 172 ? 38.871  -30.749 1.600   1.00 0.00 ?  226 SER C N    1  
ATOM   9548   C  CA   . SER C  2 172 ? 39.009  -31.630 0.494   1.00 0.00 ?  226 SER C CA   1  
ATOM   9549   C  C    . SER C  2 172 ? 39.766  -32.877 0.753   1.00 0.00 ?  226 SER C C    1  
ATOM   9550   O  O    . SER C  2 172 ? 39.409  -33.983 0.343   1.00 0.00 ?  226 SER C O    1  
ATOM   9551   C  CB   . SER C  2 172 ? 39.768  -30.906 -0.704  1.00 0.00 ?  226 SER C CB   1  
ATOM   9552   O  OG   . SER C  2 172 ? 39.885  -31.514 -1.990  1.00 0.00 ?  226 SER C OG   1  
ATOM   9553   H  H    . SER C  2 172 ? 39.312  -29.871 1.433   1.00 0.00 ?  226 SER C H    1  
ATOM   9554   H  HA   . SER C  2 172 ? 38.037  -31.890 0.101   1.00 0.00 ?  226 SER C HA   1  
ATOM   9555   H  HB2  . SER C  2 172 ? 39.163  -29.995 -0.900  1.00 0.00 ?  226 SER C HB2  1  
ATOM   9556   H  HB3  . SER C  2 172 ? 40.750  -30.484 -0.403  1.00 0.00 ?  226 SER C HB3  1  
ATOM   9557   H  HG   . SER C  2 172 ? 40.344  -32.351 -1.890  1.00 0.00 ?  226 SER C HG   1  
ATOM   9558   N  N    . GLU C  2 173 ? 40.828  -32.860 1.654   1.00 0.00 ?  227 GLU C N    1  
ATOM   9559   C  CA   . GLU C  2 173 ? 41.466  -33.895 2.327   1.00 0.00 ?  227 GLU C CA   1  
ATOM   9560   C  C    . GLU C  2 173 ? 40.639  -34.687 3.245   1.00 0.00 ?  227 GLU C C    1  
ATOM   9561   O  O    . GLU C  2 173 ? 40.626  -35.909 3.141   1.00 0.00 ?  227 GLU C O    1  
ATOM   9562   C  CB   . GLU C  2 173 ? 42.768  -33.354 2.990   1.00 0.00 ?  227 GLU C CB   1  
ATOM   9563   C  CG   . GLU C  2 173 ? 43.764  -34.389 3.637   1.00 0.00 ?  227 GLU C CG   1  
ATOM   9564   C  CD   . GLU C  2 173 ? 44.872  -34.585 2.668   1.00 0.00 ?  227 GLU C CD   1  
ATOM   9565   O  OE1  . GLU C  2 173 ? 45.060  -35.780 2.163   1.00 0.00 ?  227 GLU C OE1  1  
ATOM   9566   O  OE2  . GLU C  2 173 ? 45.558  -33.569 2.415   1.00 0.00 -1 227 GLU C OE2  1  
ATOM   9567   H  H    . GLU C  2 173 ? 41.129  -31.930 1.850   1.00 0.00 ?  227 GLU C H    1  
ATOM   9568   H  HA   . GLU C  2 173 ? 41.760  -34.593 1.557   1.00 0.00 ?  227 GLU C HA   1  
ATOM   9569   H  HB2  . GLU C  2 173 ? 43.249  -32.629 2.298   1.00 0.00 ?  227 GLU C HB2  1  
ATOM   9570   H  HB3  . GLU C  2 173 ? 42.337  -32.842 3.877   1.00 0.00 ?  227 GLU C HB3  1  
ATOM   9571   H  HG2  . GLU C  2 173 ? 44.195  -33.977 4.574   1.00 0.00 ?  227 GLU C HG2  1  
ATOM   9572   H  HG3  . GLU C  2 173 ? 43.322  -35.393 3.814   1.00 0.00 ?  227 GLU C HG3  1  
ATOM   9573   N  N    . LYS C  2 174 ? 39.789  -34.105 4.112   1.00 0.00 ?  228 LYS C N    1  
ATOM   9574   C  CA   . LYS C  2 174 ? 38.861  -34.780 4.942   1.00 0.00 ?  228 LYS C CA   1  
ATOM   9575   C  C    . LYS C  2 174 ? 37.720  -35.442 4.184   1.00 0.00 ?  228 LYS C C    1  
ATOM   9576   O  O    . LYS C  2 174 ? 37.245  -36.524 4.581   1.00 0.00 ?  228 LYS C O    1  
ATOM   9577   C  CB   . LYS C  2 174 ? 38.536  -34.009 6.272   1.00 0.00 ?  228 LYS C CB   1  
ATOM   9578   C  CG   . LYS C  2 174 ? 37.183  -34.320 6.944   1.00 0.00 ?  228 LYS C CG   1  
ATOM   9579   C  CD   . LYS C  2 174 ? 36.915  -33.672 8.281   1.00 0.00 ?  228 LYS C CD   1  
ATOM   9580   C  CE   . LYS C  2 174 ? 36.643  -32.138 8.111   1.00 0.00 ?  228 LYS C CE   1  
ATOM   9581   N  NZ   . LYS C  2 174 ? 36.369  -31.441 9.420   1.00 0.00 1  228 LYS C NZ   1  
ATOM   9582   H  H    . LYS C  2 174 ? 39.842  -33.134 4.334   1.00 0.00 ?  228 LYS C H    1  
ATOM   9583   H  HA   . LYS C  2 174 ? 39.384  -35.658 5.293   1.00 0.00 ?  228 LYS C HA   1  
ATOM   9584   H  HB2  . LYS C  2 174 ? 39.360  -34.444 6.877   1.00 0.00 ?  228 LYS C HB2  1  
ATOM   9585   H  HB3  . LYS C  2 174 ? 38.646  -32.919 6.091   1.00 0.00 ?  228 LYS C HB3  1  
ATOM   9586   H  HG2  . LYS C  2 174 ? 36.301  -34.107 6.303   1.00 0.00 ?  228 LYS C HG2  1  
ATOM   9587   H  HG3  . LYS C  2 174 ? 37.163  -35.413 7.144   1.00 0.00 ?  228 LYS C HG3  1  
ATOM   9588   H  HD2  . LYS C  2 174 ? 35.940  -34.022 8.683   1.00 0.00 ?  228 LYS C HD2  1  
ATOM   9589   H  HD3  . LYS C  2 174 ? 37.810  -33.798 8.927   1.00 0.00 ?  228 LYS C HD3  1  
ATOM   9590   H  HE2  . LYS C  2 174 ? 37.546  -31.715 7.621   1.00 0.00 ?  228 LYS C HE2  1  
ATOM   9591   H  HE3  . LYS C  2 174 ? 35.805  -32.001 7.396   1.00 0.00 ?  228 LYS C HE3  1  
ATOM   9592   H  HZ1  . LYS C  2 174 ? 37.110  -31.893 9.992   1.00 0.00 ?  228 LYS C HZ1  1  
ATOM   9593   H  HZ2  . LYS C  2 174 ? 35.429  -31.748 9.743   1.00 0.00 ?  228 LYS C HZ2  1  
ATOM   9594   H  HZ3  . LYS C  2 174 ? 36.496  -30.409 9.379   1.00 0.00 ?  228 LYS C HZ3  1  
ATOM   9595   N  N    . ALA C  2 175 ? 37.203  -34.744 3.131   1.00 0.00 ?  229 ALA C N    1  
ATOM   9596   C  CA   . ALA C  2 175 ? 36.127  -35.151 2.292   1.00 0.00 ?  229 ALA C CA   1  
ATOM   9597   C  C    . ALA C  2 175 ? 36.331  -36.313 1.334   1.00 0.00 ?  229 ALA C C    1  
ATOM   9598   O  O    . ALA C  2 175 ? 35.409  -37.119 1.139   1.00 0.00 ?  229 ALA C O    1  
ATOM   9599   C  CB   . ALA C  2 175 ? 35.692  -34.067 1.368   1.00 0.00 ?  229 ALA C CB   1  
ATOM   9600   H  H    . ALA C  2 175 ? 37.374  -33.771 2.996   1.00 0.00 ?  229 ALA C H    1  
ATOM   9601   H  HA   . ALA C  2 175 ? 35.271  -35.488 2.858   1.00 0.00 ?  229 ALA C HA   1  
ATOM   9602   H  HB1  . ALA C  2 175 ? 35.531  -33.102 1.896   1.00 0.00 ?  229 ALA C HB1  1  
ATOM   9603   H  HB2  . ALA C  2 175 ? 34.792  -34.241 0.741   1.00 0.00 ?  229 ALA C HB2  1  
ATOM   9604   H  HB3  . ALA C  2 175 ? 36.508  -33.848 0.647   1.00 0.00 ?  229 ALA C HB3  1  
ATOM   9605   N  N    . LYS C  2 176 ? 37.530  -36.385 0.690   1.00 0.00 ?  230 LYS C N    1  
ATOM   9606   C  CA   . LYS C  2 176 ? 37.918  -37.352 -0.296  1.00 0.00 ?  230 LYS C CA   1  
ATOM   9607   C  C    . LYS C  2 176 ? 37.436  -38.846 -0.205  1.00 0.00 ?  230 LYS C C    1  
ATOM   9608   O  O    . LYS C  2 176 ? 36.579  -39.297 -0.967  1.00 0.00 ?  230 LYS C O    1  
ATOM   9609   C  CB   . LYS C  2 176 ? 39.382  -37.140 -0.669  1.00 0.00 ?  230 LYS C CB   1  
ATOM   9610   C  CG   . LYS C  2 176 ? 40.134  -38.195 -1.408  1.00 0.00 ?  230 LYS C CG   1  
ATOM   9611   C  CD   . LYS C  2 176 ? 41.698  -38.094 -1.360  1.00 0.00 ?  230 LYS C CD   1  
ATOM   9612   C  CE   . LYS C  2 176 ? 42.267  -36.695 -1.665  1.00 0.00 ?  230 LYS C CE   1  
ATOM   9613   N  NZ   . LYS C  2 176 ? 43.713  -36.751 -1.999  1.00 0.00 1  230 LYS C NZ   1  
ATOM   9614   H  H    . LYS C  2 176 ? 38.219  -35.725 0.980   1.00 0.00 ?  230 LYS C H    1  
ATOM   9615   H  HA   . LYS C  2 176 ? 37.448  -37.021 -1.211  1.00 0.00 ?  230 LYS C HA   1  
ATOM   9616   H  HB2  . LYS C  2 176 ? 39.519  -36.203 -1.250  1.00 0.00 ?  230 LYS C HB2  1  
ATOM   9617   H  HB3  . LYS C  2 176 ? 39.890  -36.765 0.246   1.00 0.00 ?  230 LYS C HB3  1  
ATOM   9618   H  HG2  . LYS C  2 176 ? 39.828  -39.247 -1.219  1.00 0.00 ?  230 LYS C HG2  1  
ATOM   9619   H  HG3  . LYS C  2 176 ? 39.915  -38.110 -2.493  1.00 0.00 ?  230 LYS C HG3  1  
ATOM   9620   H  HD2  . LYS C  2 176 ? 42.057  -38.507 -0.394  1.00 0.00 ?  230 LYS C HD2  1  
ATOM   9621   H  HD3  . LYS C  2 176 ? 42.024  -38.751 -2.195  1.00 0.00 ?  230 LYS C HD3  1  
ATOM   9622   H  HE2  . LYS C  2 176 ? 41.705  -36.178 -2.471  1.00 0.00 ?  230 LYS C HE2  1  
ATOM   9623   H  HE3  . LYS C  2 176 ? 42.178  -36.077 -0.746  1.00 0.00 ?  230 LYS C HE3  1  
ATOM   9624   H  HZ1  . LYS C  2 176 ? 44.347  -36.063 -1.543  1.00 0.00 ?  230 LYS C HZ1  1  
ATOM   9625   H  HZ2  . LYS C  2 176 ? 43.786  -36.664 -3.032  1.00 0.00 ?  230 LYS C HZ2  1  
ATOM   9626   H  HZ3  . LYS C  2 176 ? 44.123  -37.685 -1.797  1.00 0.00 ?  230 LYS C HZ3  1  
ATOM   9627   N  N    . PRO C  2 177 ? 37.878  -39.611 0.822   1.00 0.00 ?  231 PRO C N    1  
ATOM   9628   C  CA   . PRO C  2 177 ? 37.502  -40.985 0.806   1.00 0.00 ?  231 PRO C CA   1  
ATOM   9629   C  C    . PRO C  2 177 ? 36.191  -41.284 1.427   1.00 0.00 ?  231 PRO C C    1  
ATOM   9630   O  O    . PRO C  2 177 ? 35.764  -42.417 1.229   1.00 0.00 ?  231 PRO C O    1  
ATOM   9631   C  CB   . PRO C  2 177 ? 38.578  -41.649 1.631   1.00 0.00 ?  231 PRO C CB   1  
ATOM   9632   C  CG   . PRO C  2 177 ? 39.054  -40.559 2.641   1.00 0.00 ?  231 PRO C CG   1  
ATOM   9633   C  CD   . PRO C  2 177 ? 38.779  -39.284 1.911   1.00 0.00 ?  231 PRO C CD   1  
ATOM   9634   H  HA   . PRO C  2 177 ? 37.470  -41.365 -0.204  1.00 0.00 ?  231 PRO C HA   1  
ATOM   9635   H  HB2  . PRO C  2 177 ? 38.321  -42.617 2.112   1.00 0.00 ?  231 PRO C HB2  1  
ATOM   9636   H  HB3  . PRO C  2 177 ? 39.470  -41.932 1.032   1.00 0.00 ?  231 PRO C HB3  1  
ATOM   9637   H  HG2  . PRO C  2 177 ? 38.437  -40.483 3.562   1.00 0.00 ?  231 PRO C HG2  1  
ATOM   9638   H  HG3  . PRO C  2 177 ? 40.125  -40.726 2.887   1.00 0.00 ?  231 PRO C HG3  1  
ATOM   9639   H  HD2  . PRO C  2 177 ? 38.222  -38.517 2.489   1.00 0.00 ?  231 PRO C HD2  1  
ATOM   9640   H  HD3  . PRO C  2 177 ? 39.723  -38.856 1.512   1.00 0.00 ?  231 PRO C HD3  1  
ATOM   9641   N  N    . ALA C  2 178 ? 35.484  -40.258 1.969   1.00 0.00 ?  232 ALA C N    1  
ATOM   9642   C  CA   . ALA C  2 178 ? 34.159  -40.472 2.486   1.00 0.00 ?  232 ALA C CA   1  
ATOM   9643   C  C    . ALA C  2 178 ? 33.085  -39.904 1.590   1.00 0.00 ?  232 ALA C C    1  
ATOM   9644   O  O    . ALA C  2 178 ? 31.946  -39.697 1.990   1.00 0.00 ?  232 ALA C O    1  
ATOM   9645   C  CB   . ALA C  2 178 ? 34.074  -39.753 3.790   1.00 0.00 ?  232 ALA C CB   1  
ATOM   9646   H  H    . ALA C  2 178 ? 35.909  -39.356 1.975   1.00 0.00 ?  232 ALA C H    1  
ATOM   9647   H  HA   . ALA C  2 178 ? 33.987  -41.520 2.678   1.00 0.00 ?  232 ALA C HA   1  
ATOM   9648   H  HB1  . ALA C  2 178 ? 34.167  -38.647 3.748   1.00 0.00 ?  232 ALA C HB1  1  
ATOM   9649   H  HB2  . ALA C  2 178 ? 34.905  -40.101 4.441   1.00 0.00 ?  232 ALA C HB2  1  
ATOM   9650   H  HB3  . ALA C  2 178 ? 33.084  -39.995 4.232   1.00 0.00 ?  232 ALA C HB3  1  
ATOM   9651   N  N    . LEU C  2 179 ? 33.428  -39.594 0.326   1.00 0.00 ?  233 LEU C N    1  
ATOM   9652   C  CA   . LEU C  2 179 ? 32.423  -39.040 -0.559  1.00 0.00 ?  233 LEU C CA   1  
ATOM   9653   C  C    . LEU C  2 179 ? 31.562  -40.102 -1.235  1.00 0.00 ?  233 LEU C C    1  
ATOM   9654   O  O    . LEU C  2 179 ? 30.363  -39.972 -1.293  1.00 0.00 ?  233 LEU C O    1  
ATOM   9655   C  CB   . LEU C  2 179 ? 33.168  -38.191 -1.567  1.00 0.00 ?  233 LEU C CB   1  
ATOM   9656   C  CG   . LEU C  2 179 ? 32.244  -37.288 -2.360  1.00 0.00 ?  233 LEU C CG   1  
ATOM   9657   C  CD1  . LEU C  2 179 ? 31.665  -36.165 -1.567  1.00 0.00 ?  233 LEU C CD1  1  
ATOM   9658   C  CD2  . LEU C  2 179 ? 32.929  -36.879 -3.665  1.00 0.00 ?  233 LEU C CD2  1  
ATOM   9659   H  H    . LEU C  2 179 ? 34.318  -39.814 -0.066  1.00 0.00 ?  233 LEU C H    1  
ATOM   9660   H  HA   . LEU C  2 179 ? 31.683  -38.461 -0.025  1.00 0.00 ?  233 LEU C HA   1  
ATOM   9661   H  HB2  . LEU C  2 179 ? 33.963  -37.598 -1.066  1.00 0.00 ?  233 LEU C HB2  1  
ATOM   9662   H  HB3  . LEU C  2 179 ? 33.716  -38.812 -2.308  1.00 0.00 ?  233 LEU C HB3  1  
ATOM   9663   H  HG   . LEU C  2 179 ? 31.439  -37.954 -2.738  1.00 0.00 ?  233 LEU C HG   1  
ATOM   9664   H  HD11 . LEU C  2 179 ? 31.138  -35.430 -2.213  1.00 0.00 ?  233 LEU C HD11 1  
ATOM   9665   H  HD12 . LEU C  2 179 ? 32.524  -35.691 -1.044  1.00 0.00 ?  233 LEU C HD12 1  
ATOM   9666   H  HD13 . LEU C  2 179 ? 30.931  -36.526 -0.816  1.00 0.00 ?  233 LEU C HD13 1  
ATOM   9667   H  HD21 . LEU C  2 179 ? 33.786  -36.214 -3.427  1.00 0.00 ?  233 LEU C HD21 1  
ATOM   9668   H  HD22 . LEU C  2 179 ? 32.297  -36.442 -4.467  1.00 0.00 ?  233 LEU C HD22 1  
ATOM   9669   H  HD23 . LEU C  2 179 ? 33.311  -37.762 -4.220  1.00 0.00 ?  233 LEU C HD23 1  
ATOM   9670   N  N    . GLU C  2 180 ? 32.077  -41.369 -1.508  1.00 0.00 ?  234 GLU C N    1  
ATOM   9671   C  CA   . GLU C  2 180 ? 31.313  -42.622 -1.638  1.00 0.00 ?  234 GLU C CA   1  
ATOM   9672   C  C    . GLU C  2 180 ? 30.633  -43.097 -0.331  1.00 0.00 ?  234 GLU C C    1  
ATOM   9673   O  O    . GLU C  2 180 ? 29.474  -43.481 -0.288  1.00 0.00 ?  234 GLU C O    1  
ATOM   9674   C  CB   . GLU C  2 180 ? 32.109  -43.586 -2.495  1.00 0.00 ?  234 GLU C CB   1  
ATOM   9675   C  CG   . GLU C  2 180 ? 33.117  -44.438 -1.662  1.00 0.00 ?  234 GLU C CG   1  
ATOM   9676   C  CD   . GLU C  2 180 ? 33.911  -45.244 -2.689  1.00 0.00 ?  234 GLU C CD   1  
ATOM   9677   O  OE1  . GLU C  2 180 ? 35.074  -44.941 -2.882  1.00 0.00 ?  234 GLU C OE1  1  
ATOM   9678   O  OE2  . GLU C  2 180 ? 33.362  -46.182 -3.287  1.00 0.00 -1 234 GLU C OE2  1  
ATOM   9679   H  H    . GLU C  2 180 ? 33.059  -41.538 -1.484  1.00 0.00 ?  234 GLU C H    1  
ATOM   9680   H  HA   . GLU C  2 180 ? 30.472  -42.305 -2.236  1.00 0.00 ?  234 GLU C HA   1  
ATOM   9681   H  HB2  . GLU C  2 180 ? 31.327  -44.235 -2.942  1.00 0.00 ?  234 GLU C HB2  1  
ATOM   9682   H  HB3  . GLU C  2 180 ? 32.609  -43.075 -3.345  1.00 0.00 ?  234 GLU C HB3  1  
ATOM   9683   H  HG2  . GLU C  2 180 ? 33.839  -43.838 -1.067  1.00 0.00 ?  234 GLU C HG2  1  
ATOM   9684   H  HG3  . GLU C  2 180 ? 32.511  -45.062 -0.971  1.00 0.00 ?  234 GLU C HG3  1  
ATOM   9685   N  N    . ASP C  2 181 ? 31.320  -42.972 0.855   1.00 0.00 ?  235 ASP C N    1  
ATOM   9686   C  CA   . ASP C  2 181 ? 30.600  -43.138 2.091   1.00 0.00 ?  235 ASP C CA   1  
ATOM   9687   C  C    . ASP C  2 181 ? 29.300  -42.252 2.268   1.00 0.00 ?  235 ASP C C    1  
ATOM   9688   O  O    . ASP C  2 181 ? 28.301  -42.801 2.810   1.00 0.00 ?  235 ASP C O    1  
ATOM   9689   C  CB   . ASP C  2 181 ? 31.552  -43.028 3.393   1.00 0.00 ?  235 ASP C CB   1  
ATOM   9690   C  CG   . ASP C  2 181 ? 32.731  -44.014 3.348   1.00 0.00 ?  235 ASP C CG   1  
ATOM   9691   O  OD1  . ASP C  2 181 ? 32.896  -44.751 2.349   1.00 0.00 ?  235 ASP C OD1  1  
ATOM   9692   O  OD2  . ASP C  2 181 ? 33.634  -43.904 4.202   1.00 0.00 -1 235 ASP C OD2  1  
ATOM   9693   H  H    . ASP C  2 181 ? 32.307  -43.044 0.973   1.00 0.00 ?  235 ASP C H    1  
ATOM   9694   H  HA   . ASP C  2 181 ? 30.233  -44.153 2.071   1.00 0.00 ?  235 ASP C HA   1  
ATOM   9695   H  HB2  . ASP C  2 181 ? 31.841  -41.958 3.465   1.00 0.00 ?  235 ASP C HB2  1  
ATOM   9696   H  HB3  . ASP C  2 181 ? 30.910  -43.436 4.202   1.00 0.00 ?  235 ASP C HB3  1  
ATOM   9697   N  N    . LEU C  2 182 ? 29.287  -40.936 1.845   1.00 0.00 ?  236 LEU C N    1  
ATOM   9698   C  CA   . LEU C  2 182 ? 28.136  -40.014 2.072   1.00 0.00 ?  236 LEU C CA   1  
ATOM   9699   C  C    . LEU C  2 182 ? 27.068  -40.562 1.063   1.00 0.00 ?  236 LEU C C    1  
ATOM   9700   O  O    . LEU C  2 182 ? 25.859  -40.682 1.377   1.00 0.00 ?  236 LEU C O    1  
ATOM   9701   C  CB   . LEU C  2 182 ? 28.654  -38.600 1.757   1.00 0.00 ?  236 LEU C CB   1  
ATOM   9702   C  CG   . LEU C  2 182 ? 27.696  -37.254 1.953   1.00 0.00 ?  236 LEU C CG   1  
ATOM   9703   C  CD1  . LEU C  2 182 ? 26.853  -37.008 0.732   1.00 0.00 ?  236 LEU C CD1  1  
ATOM   9704   C  CD2  . LEU C  2 182 ? 26.603  -37.406 3.147   1.00 0.00 ?  236 LEU C CD2  1  
ATOM   9705   H  H    . LEU C  2 182 ? 30.163  -40.542 1.577   1.00 0.00 ?  236 LEU C H    1  
ATOM   9706   H  HA   . LEU C  2 182 ? 27.894  -40.168 3.113   1.00 0.00 ?  236 LEU C HA   1  
ATOM   9707   H  HB2  . LEU C  2 182 ? 29.581  -38.467 2.356   1.00 0.00 ?  236 LEU C HB2  1  
ATOM   9708   H  HB3  . LEU C  2 182 ? 28.958  -38.525 0.691   1.00 0.00 ?  236 LEU C HB3  1  
ATOM   9709   H  HG   . LEU C  2 182 ? 28.354  -36.380 2.143   1.00 0.00 ?  236 LEU C HG   1  
ATOM   9710   H  HD11 . LEU C  2 182 ? 26.309  -37.959 0.548   1.00 0.00 ?  236 LEU C HD11 1  
ATOM   9711   H  HD12 . LEU C  2 182 ? 27.527  -36.695 -0.094  1.00 0.00 ?  236 LEU C HD12 1  
ATOM   9712   H  HD13 . LEU C  2 182 ? 26.105  -36.196 0.856   1.00 0.00 ?  236 LEU C HD13 1  
ATOM   9713   H  HD21 . LEU C  2 182 ? 26.007  -38.332 2.998   1.00 0.00 ?  236 LEU C HD21 1  
ATOM   9714   H  HD22 . LEU C  2 182 ? 25.877  -36.569 3.056   1.00 0.00 ?  236 LEU C HD22 1  
ATOM   9715   H  HD23 . LEU C  2 182 ? 27.104  -37.550 4.128   1.00 0.00 ?  236 LEU C HD23 1  
ATOM   9716   N  N    . ARG C  2 183 ? 27.422  -40.924 -0.239  1.00 0.00 ?  237 ARG C N    1  
ATOM   9717   C  CA   . ARG C  2 183 ? 26.469  -41.495 -1.282  1.00 0.00 ?  237 ARG C CA   1  
ATOM   9718   C  C    . ARG C  2 183 ? 25.741  -42.710 -0.869  1.00 0.00 ?  237 ARG C C    1  
ATOM   9719   O  O    . ARG C  2 183 ? 24.535  -42.816 -1.068  1.00 0.00 ?  237 ARG C O    1  
ATOM   9720   C  CB   . ARG C  2 183 ? 27.207  -41.812 -2.646  1.00 0.00 ?  237 ARG C CB   1  
ATOM   9721   C  CG   . ARG C  2 183 ? 26.331  -42.032 -3.856  1.00 0.00 ?  237 ARG C CG   1  
ATOM   9722   C  CD   . ARG C  2 183 ? 27.184  -42.254 -5.116  1.00 0.00 ?  237 ARG C CD   1  
ATOM   9723   N  NE   . ARG C  2 183 ? 27.573  -43.680 -4.958  1.00 0.00 ?  237 ARG C NE   1  
ATOM   9724   C  CZ   . ARG C  2 183 ? 28.675  -44.225 -5.398  1.00 0.00 ?  237 ARG C CZ   1  
ATOM   9725   N  NH1  . ARG C  2 183 ? 28.983  -45.390 -4.909  1.00 0.00 1  237 ARG C NH1  1  
ATOM   9726   N  NH2  . ARG C  2 183 ? 29.550  -43.587 -6.105  1.00 0.00 ?  237 ARG C NH2  1  
ATOM   9727   H  H    . ARG C  2 183 ? 28.374  -40.717 -0.452  1.00 0.00 ?  237 ARG C H    1  
ATOM   9728   H  HA   . ARG C  2 183 ? 25.712  -40.726 -1.327  1.00 0.00 ?  237 ARG C HA   1  
ATOM   9729   H  HB2  . ARG C  2 183 ? 27.817  -40.905 -2.847  1.00 0.00 ?  237 ARG C HB2  1  
ATOM   9730   H  HB3  . ARG C  2 183 ? 27.954  -42.623 -2.507  1.00 0.00 ?  237 ARG C HB3  1  
ATOM   9731   H  HG2  . ARG C  2 183 ? 25.611  -42.853 -3.654  1.00 0.00 ?  237 ARG C HG2  1  
ATOM   9732   H  HG3  . ARG C  2 183 ? 25.710  -41.116 -3.958  1.00 0.00 ?  237 ARG C HG3  1  
ATOM   9733   H  HD2  . ARG C  2 183 ? 26.657  -42.212 -6.093  1.00 0.00 ?  237 ARG C HD2  1  
ATOM   9734   H  HD3  . ARG C  2 183 ? 28.115  -41.652 -5.197  1.00 0.00 ?  237 ARG C HD3  1  
ATOM   9735   H  HE   . ARG C  2 183 ? 27.078  -44.225 -4.281  1.00 0.00 ?  237 ARG C HE   1  
ATOM   9736   H  HH11 . ARG C  2 183 ? 28.309  -45.772 -4.277  1.00 0.00 ?  237 ARG C HH11 1  
ATOM   9737   H  HH12 . ARG C  2 183 ? 29.869  -45.765 -5.182  1.00 0.00 ?  237 ARG C HH12 1  
ATOM   9738   H  HH21 . ARG C  2 183 ? 29.316  -42.708 -6.523  1.00 0.00 ?  237 ARG C HH21 1  
ATOM   9739   H  HH22 . ARG C  2 183 ? 30.215  -44.138 -6.610  1.00 0.00 ?  237 ARG C HH22 1  
ATOM   9740   N  N    . GLN C  2 184 ? 26.458  -43.685 -0.301  1.00 0.00 ?  238 GLN C N    1  
ATOM   9741   C  CA   . GLN C  2 184 ? 25.956  -44.971 0.165   1.00 0.00 ?  238 GLN C CA   1  
ATOM   9742   C  C    . GLN C  2 184 ? 25.286  -44.761 1.418   1.00 0.00 ?  238 GLN C C    1  
ATOM   9743   O  O    . GLN C  2 184 ? 24.477  -45.553 1.844   1.00 0.00 ?  238 GLN C O    1  
ATOM   9744   C  CB   . GLN C  2 184 ? 27.231  -45.907 0.327   1.00 0.00 ?  238 GLN C CB   1  
ATOM   9745   C  CG   . GLN C  2 184 ? 26.915  -47.382 0.652   1.00 0.00 ?  238 GLN C CG   1  
ATOM   9746   C  CD   . GLN C  2 184 ? 25.931  -48.069 -0.270  1.00 0.00 ?  238 GLN C CD   1  
ATOM   9747   O  OE1  . GLN C  2 184 ? 26.177  -48.057 -1.469  1.00 0.00 ?  238 GLN C OE1  1  
ATOM   9748   N  NE2  . GLN C  2 184 ? 24.792  -48.615 0.293   1.00 0.00 ?  238 GLN C NE2  1  
ATOM   9749   H  H    . GLN C  2 184 ? 27.423  -43.529 -0.104  1.00 0.00 ?  238 GLN C H    1  
ATOM   9750   H  HA   . GLN C  2 184 ? 25.382  -45.396 -0.645  1.00 0.00 ?  238 GLN C HA   1  
ATOM   9751   H  HB2  . GLN C  2 184 ? 27.721  -45.844 -0.668  1.00 0.00 ?  238 GLN C HB2  1  
ATOM   9752   H  HB3  . GLN C  2 184 ? 27.996  -45.470 1.005   1.00 0.00 ?  238 GLN C HB3  1  
ATOM   9753   H  HG2  . GLN C  2 184 ? 27.882  -47.920 0.550   1.00 0.00 ?  238 GLN C HG2  1  
ATOM   9754   H  HG3  . GLN C  2 184 ? 26.573  -47.414 1.708   1.00 0.00 ?  238 GLN C HG3  1  
ATOM   9755   H  HE21 . GLN C  2 184 ? 24.016  -48.927 -0.257  1.00 0.00 ?  238 GLN C HE21 1  
ATOM   9756   H  HE22 . GLN C  2 184 ? 24.706  -48.592 1.289   1.00 0.00 ?  238 GLN C HE22 1  
ATOM   9757   N  N    . GLY C  2 185 ? 25.539  -43.626 2.082   1.00 0.00 ?  239 GLY C N    1  
ATOM   9758   C  CA   . GLY C  2 185 ? 24.877  -43.126 3.278   1.00 0.00 ?  239 GLY C CA   1  
ATOM   9759   C  C    . GLY C  2 185 ? 23.432  -42.702 3.115   1.00 0.00 ?  239 GLY C C    1  
ATOM   9760   O  O    . GLY C  2 185 ? 22.567  -42.972 3.890   1.00 0.00 ?  239 GLY C O    1  
ATOM   9761   H  H    . GLY C  2 185 ? 26.352  -43.078 1.900   1.00 0.00 ?  239 GLY C H    1  
ATOM   9762   H  HA2  . GLY C  2 185 ? 25.074  -43.801 4.097   1.00 0.00 ?  239 GLY C HA2  1  
ATOM   9763   H  HA3  . GLY C  2 185 ? 25.457  -42.222 3.386   1.00 0.00 ?  239 GLY C HA3  1  
ATOM   9764   N  N    . LEU C  2 186 ? 23.087  -41.982 2.044   1.00 0.00 ?  240 LEU C N    1  
ATOM   9765   C  CA   . LEU C  2 186 ? 21.722  -41.526 1.745   1.00 0.00 ?  240 LEU C CA   1  
ATOM   9766   C  C    . LEU C  2 186 ? 20.977  -42.337 0.790   1.00 0.00 ?  240 LEU C C    1  
ATOM   9767   O  O    . LEU C  2 186 ? 19.856  -42.067 0.421   1.00 0.00 ?  240 LEU C O    1  
ATOM   9768   C  CB   . LEU C  2 186 ? 21.685  -40.048 1.253   1.00 0.00 ?  240 LEU C CB   1  
ATOM   9769   C  CG   . LEU C  2 186 ? 22.244  -38.987 2.228   1.00 0.00 ?  240 LEU C CG   1  
ATOM   9770   C  CD1  . LEU C  2 186 ? 22.253  -37.597 1.635   1.00 0.00 ?  240 LEU C CD1  1  
ATOM   9771   C  CD2  . LEU C  2 186 ? 21.445  -38.962 3.610   1.00 0.00 ?  240 LEU C CD2  1  
ATOM   9772   H  H    . LEU C  2 186 ? 23.856  -41.671 1.492   1.00 0.00 ?  240 LEU C H    1  
ATOM   9773   H  HA   . LEU C  2 186 ? 21.108  -41.726 2.610   1.00 0.00 ?  240 LEU C HA   1  
ATOM   9774   H  HB2  . LEU C  2 186 ? 22.077  -40.147 0.218   1.00 0.00 ?  240 LEU C HB2  1  
ATOM   9775   H  HB3  . LEU C  2 186 ? 20.637  -39.684 1.196   1.00 0.00 ?  240 LEU C HB3  1  
ATOM   9776   H  HG   . LEU C  2 186 ? 23.249  -39.366 2.510   1.00 0.00 ?  240 LEU C HG   1  
ATOM   9777   H  HD11 . LEU C  2 186 ? 21.212  -37.432 1.286   1.00 0.00 ?  240 LEU C HD11 1  
ATOM   9778   H  HD12 . LEU C  2 186 ? 22.828  -37.575 0.684   1.00 0.00 ?  240 LEU C HD12 1  
ATOM   9779   H  HD13 . LEU C  2 186 ? 22.541  -36.794 2.347   1.00 0.00 ?  240 LEU C HD13 1  
ATOM   9780   H  HD21 . LEU C  2 186 ? 20.414  -38.564 3.497   1.00 0.00 ?  240 LEU C HD21 1  
ATOM   9781   H  HD22 . LEU C  2 186 ? 21.972  -38.246 4.275   1.00 0.00 ?  240 LEU C HD22 1  
ATOM   9782   H  HD23 . LEU C  2 186 ? 21.385  -40.020 3.946   1.00 0.00 ?  240 LEU C HD23 1  
ATOM   9783   N  N    . LEU C  2 187 ? 21.636  -43.339 0.209   1.00 0.00 ?  241 LEU C N    1  
ATOM   9784   C  CA   . LEU C  2 187 ? 20.958  -44.285 -0.669  1.00 0.00 ?  241 LEU C CA   1  
ATOM   9785   C  C    . LEU C  2 187 ? 19.816  -45.159 -0.060  1.00 0.00 ?  241 LEU C C    1  
ATOM   9786   O  O    . LEU C  2 187 ? 18.771  -45.325 -0.662  1.00 0.00 ?  241 LEU C O    1  
ATOM   9787   C  CB   . LEU C  2 187 ? 22.032  -45.153 -1.403  1.00 0.00 ?  241 LEU C CB   1  
ATOM   9788   C  CG   . LEU C  2 187 ? 21.556  -46.159 -2.380  1.00 0.00 ?  241 LEU C CG   1  
ATOM   9789   C  CD1  . LEU C  2 187 ? 20.931  -45.533 -3.609  1.00 0.00 ?  241 LEU C CD1  1  
ATOM   9790   C  CD2  . LEU C  2 187 ? 22.739  -46.940 -2.875  1.00 0.00 ?  241 LEU C CD2  1  
ATOM   9791   H  H    . LEU C  2 187 ? 22.553  -43.505 0.563   1.00 0.00 ?  241 LEU C H    1  
ATOM   9792   H  HA   . LEU C  2 187 ? 20.451  -43.681 -1.408  1.00 0.00 ?  241 LEU C HA   1  
ATOM   9793   H  HB2  . LEU C  2 187 ? 22.661  -44.406 -1.932  1.00 0.00 ?  241 LEU C HB2  1  
ATOM   9794   H  HB3  . LEU C  2 187 ? 22.594  -45.632 -0.573  1.00 0.00 ?  241 LEU C HB3  1  
ATOM   9795   H  HG   . LEU C  2 187 ? 20.860  -46.881 -1.901  1.00 0.00 ?  241 LEU C HG   1  
ATOM   9796   H  HD11 . LEU C  2 187 ? 20.004  -44.949 -3.424  1.00 0.00 ?  241 LEU C HD11 1  
ATOM   9797   H  HD12 . LEU C  2 187 ? 20.777  -46.312 -4.386  1.00 0.00 ?  241 LEU C HD12 1  
ATOM   9798   H  HD13 . LEU C  2 187 ? 21.643  -44.818 -4.075  1.00 0.00 ?  241 LEU C HD13 1  
ATOM   9799   H  HD21 . LEU C  2 187 ? 23.115  -47.662 -2.119  1.00 0.00 ?  241 LEU C HD21 1  
ATOM   9800   H  HD22 . LEU C  2 187 ? 23.565  -46.248 -3.144  1.00 0.00 ?  241 LEU C HD22 1  
ATOM   9801   H  HD23 . LEU C  2 187 ? 22.437  -47.530 -3.767  1.00 0.00 ?  241 LEU C HD23 1  
ATOM   9802   N  N    . PRO C  2 188 ? 19.874  -45.656 1.114   1.00 0.00 ?  242 PRO C N    1  
ATOM   9803   C  CA   . PRO C  2 188 ? 18.703  -46.278 1.798   1.00 0.00 ?  242 PRO C CA   1  
ATOM   9804   C  C    . PRO C  2 188 ? 17.547  -45.232 1.953   1.00 0.00 ?  242 PRO C C    1  
ATOM   9805   O  O    . PRO C  2 188 ? 16.428  -45.748 2.050   1.00 0.00 ?  242 PRO C O    1  
ATOM   9806   C  CB   . PRO C  2 188 ? 19.223  -46.864 3.092   1.00 0.00 ?  242 PRO C CB   1  
ATOM   9807   C  CG   . PRO C  2 188 ? 20.627  -47.168 2.703   1.00 0.00 ?  242 PRO C CG   1  
ATOM   9808   C  CD   . PRO C  2 188 ? 21.058  -45.849 1.899   1.00 0.00 ?  242 PRO C CD   1  
ATOM   9809   H  HA   . PRO C  2 188 ? 18.385  -47.067 1.133   1.00 0.00 ?  242 PRO C HA   1  
ATOM   9810   H  HB2  . PRO C  2 188 ? 19.078  -46.134 3.917   1.00 0.00 ?  242 PRO C HB2  1  
ATOM   9811   H  HB3  . PRO C  2 188 ? 18.604  -47.737 3.391   1.00 0.00 ?  242 PRO C HB3  1  
ATOM   9812   H  HG2  . PRO C  2 188 ? 21.312  -47.083 3.574   1.00 0.00 ?  242 PRO C HG2  1  
ATOM   9813   H  HG3  . PRO C  2 188 ? 20.732  -47.991 1.963   1.00 0.00 ?  242 PRO C HG3  1  
ATOM   9814   H  HD2  . PRO C  2 188 ? 21.234  -44.948 2.524   1.00 0.00 ?  242 PRO C HD2  1  
ATOM   9815   H  HD3  . PRO C  2 188 ? 22.011  -46.053 1.364   1.00 0.00 ?  242 PRO C HD3  1  
ATOM   9816   N  N    . VAL C  2 189 ? 17.761  -43.876 2.025   1.00 0.00 ?  243 VAL C N    1  
ATOM   9817   C  CA   . VAL C  2 189 ? 16.681  -42.857 1.983   1.00 0.00 ?  243 VAL C CA   1  
ATOM   9818   C  C    . VAL C  2 189 ? 15.898  -42.938 0.627   1.00 0.00 ?  243 VAL C C    1  
ATOM   9819   O  O    . VAL C  2 189 ? 14.655  -42.933 0.579   1.00 0.00 ?  243 VAL C O    1  
ATOM   9820   C  CB   . VAL C  2 189 ? 17.168  -41.380 2.121   1.00 0.00 ?  243 VAL C CB   1  
ATOM   9821   C  CG1  . VAL C  2 189 ? 15.983  -40.385 2.213   1.00 0.00 ?  243 VAL C CG1  1  
ATOM   9822   C  CG2  . VAL C  2 189 ? 17.952  -41.178 3.472   1.00 0.00 ?  243 VAL C CG2  1  
ATOM   9823   H  H    . VAL C  2 189 ? 18.690  -43.538 1.903   1.00 0.00 ?  243 VAL C H    1  
ATOM   9824   H  HA   . VAL C  2 189 ? 16.017  -43.026 2.818   1.00 0.00 ?  243 VAL C HA   1  
ATOM   9825   H  HB   . VAL C  2 189 ? 17.762  -41.193 1.201   1.00 0.00 ?  243 VAL C HB   1  
ATOM   9826   H  HG11 . VAL C  2 189 ? 15.190  -40.473 1.440   1.00 0.00 ?  243 VAL C HG11 1  
ATOM   9827   H  HG12 . VAL C  2 189 ? 16.386  -39.355 2.108   1.00 0.00 ?  243 VAL C HG12 1  
ATOM   9828   H  HG13 . VAL C  2 189 ? 15.357  -40.461 3.128   1.00 0.00 ?  243 VAL C HG13 1  
ATOM   9829   H  HG21 . VAL C  2 189 ? 18.808  -41.873 3.334   1.00 0.00 ?  243 VAL C HG21 1  
ATOM   9830   H  HG22 . VAL C  2 189 ? 17.279  -41.390 4.330   1.00 0.00 ?  243 VAL C HG22 1  
ATOM   9831   H  HG23 . VAL C  2 189 ? 18.384  -40.168 3.637   1.00 0.00 ?  243 VAL C HG23 1  
ATOM   9832   N  N    . LEU C  2 190 ? 16.604  -43.119 -0.507  1.00 0.00 ?  244 LEU C N    1  
ATOM   9833   C  CA   . LEU C  2 190 ? 16.010  -43.250 -1.807  1.00 0.00 ?  244 LEU C CA   1  
ATOM   9834   C  C    . LEU C  2 190 ? 15.119  -44.449 -1.942  1.00 0.00 ?  244 LEU C C    1  
ATOM   9835   O  O    . LEU C  2 190 ? 14.002  -44.452 -2.441  1.00 0.00 ?  244 LEU C O    1  
ATOM   9836   C  CB   . LEU C  2 190 ? 17.066  -43.215 -2.930  1.00 0.00 ?  244 LEU C CB   1  
ATOM   9837   C  CG   . LEU C  2 190 ? 16.502  -43.145 -4.342  1.00 0.00 ?  244 LEU C CG   1  
ATOM   9838   C  CD1  . LEU C  2 190 ? 15.759  -41.796 -4.534  1.00 0.00 ?  244 LEU C CD1  1  
ATOM   9839   C  CD2  . LEU C  2 190 ? 17.617  -43.285 -5.443  1.00 0.00 ?  244 LEU C CD2  1  
ATOM   9840   H  H    . LEU C  2 190 ? 17.588  -43.280 -0.496  1.00 0.00 ?  244 LEU C H    1  
ATOM   9841   H  HA   . LEU C  2 190 ? 15.468  -42.317 -1.837  1.00 0.00 ?  244 LEU C HA   1  
ATOM   9842   H  HB2  . LEU C  2 190 ? 17.728  -42.333 -2.791  1.00 0.00 ?  244 LEU C HB2  1  
ATOM   9843   H  HB3  . LEU C  2 190 ? 17.657  -44.152 -3.012  1.00 0.00 ?  244 LEU C HB3  1  
ATOM   9844   H  HG   . LEU C  2 190 ? 15.842  -43.986 -4.644  1.00 0.00 ?  244 LEU C HG   1  
ATOM   9845   H  HD11 . LEU C  2 190 ? 15.304  -41.696 -5.542  1.00 0.00 ?  244 LEU C HD11 1  
ATOM   9846   H  HD12 . LEU C  2 190 ? 16.498  -41.003 -4.286  1.00 0.00 ?  244 LEU C HD12 1  
ATOM   9847   H  HD13 . LEU C  2 190 ? 14.942  -41.677 -3.791  1.00 0.00 ?  244 LEU C HD13 1  
ATOM   9848   H  HD21 . LEU C  2 190 ? 18.368  -42.473 -5.543  1.00 0.00 ?  244 LEU C HD21 1  
ATOM   9849   H  HD22 . LEU C  2 190 ? 17.058  -43.090 -6.383  1.00 0.00 ?  244 LEU C HD22 1  
ATOM   9850   H  HD23 . LEU C  2 190 ? 18.021  -44.317 -5.521  1.00 0.00 ?  244 LEU C HD23 1  
ATOM   9851   N  N    . GLU C  2 191 ? 15.657  -45.580 -1.383  1.00 0.00 ?  245 GLU C N    1  
ATOM   9852   C  CA   . GLU C  2 191 ? 15.056  -46.843 -1.436  1.00 0.00 ?  245 GLU C CA   1  
ATOM   9853   C  C    . GLU C  2 191 ? 13.686  -46.914 -0.687  1.00 0.00 ?  245 GLU C C    1  
ATOM   9854   O  O    . GLU C  2 191 ? 12.751  -47.499 -1.280  1.00 0.00 ?  245 GLU C O    1  
ATOM   9855   C  CB   . GLU C  2 191 ? 15.925  -47.915 -0.699  1.00 0.00 ?  245 GLU C CB   1  
ATOM   9856   C  CG   . GLU C  2 191 ? 15.519  -49.384 -0.922  1.00 0.00 ?  245 GLU C CG   1  
ATOM   9857   C  CD   . GLU C  2 191 ? 16.626  -50.203 -0.397  1.00 0.00 ?  245 GLU C CD   1  
ATOM   9858   O  OE1  . GLU C  2 191 ? 16.720  -50.264 0.900   1.00 0.00 ?  245 GLU C OE1  1  
ATOM   9859   O  OE2  . GLU C  2 191 ? 17.457  -50.810 -1.154  1.00 0.00 -1 245 GLU C OE2  1  
ATOM   9860   H  H    . GLU C  2 191 ? 16.554  -45.622 -0.951  1.00 0.00 ?  245 GLU C H    1  
ATOM   9861   H  HA   . GLU C  2 191 ? 14.776  -47.066 -2.455  1.00 0.00 ?  245 GLU C HA   1  
ATOM   9862   H  HB2  . GLU C  2 191 ? 16.920  -47.714 -1.151  1.00 0.00 ?  245 GLU C HB2  1  
ATOM   9863   H  HB3  . GLU C  2 191 ? 16.000  -47.524 0.338   1.00 0.00 ?  245 GLU C HB3  1  
ATOM   9864   H  HG2  . GLU C  2 191 ? 14.635  -49.736 -0.349  1.00 0.00 ?  245 GLU C HG2  1  
ATOM   9865   H  HG3  . GLU C  2 191 ? 15.458  -49.589 -2.012  1.00 0.00 ?  245 GLU C HG3  1  
ATOM   9866   N  N    . SER C  2 192 ? 13.572  -46.264 0.543   1.00 0.00 ?  246 SER C N    1  
ATOM   9867   C  CA   . SER C  2 192 ? 12.333  -46.233 1.260   1.00 0.00 ?  246 SER C CA   1  
ATOM   9868   C  C    . SER C  2 192 ? 11.320  -45.479 0.547   1.00 0.00 ?  246 SER C C    1  
ATOM   9869   O  O    . SER C  2 192 ? 10.167  -45.822 0.410   1.00 0.00 ?  246 SER C O    1  
ATOM   9870   C  CB   . SER C  2 192 ? 12.568  -45.714 2.733   1.00 0.00 ?  246 SER C CB   1  
ATOM   9871   O  OG   . SER C  2 192 ? 11.425  -45.823 3.478   1.00 0.00 ?  246 SER C OG   1  
ATOM   9872   H  H    . SER C  2 192 ? 14.412  -45.824 0.852   1.00 0.00 ?  246 SER C H    1  
ATOM   9873   H  HA   . SER C  2 192 ? 12.011  -47.263 1.289   1.00 0.00 ?  246 SER C HA   1  
ATOM   9874   H  HB2  . SER C  2 192 ? 13.311  -46.388 3.211   1.00 0.00 ?  246 SER C HB2  1  
ATOM   9875   H  HB3  . SER C  2 192 ? 12.869  -44.645 2.758   1.00 0.00 ?  246 SER C HB3  1  
ATOM   9876   H  HG   . SER C  2 192 ? 11.220  -46.760 3.506   1.00 0.00 ?  246 SER C HG   1  
ATOM   9877   N  N    . PHE C  2 193 ? 11.764  -44.371 -0.173  1.00 0.00 ?  247 PHE C N    1  
ATOM   9878   C  CA   . PHE C  2 193 ? 10.939  -43.731 -1.133  1.00 0.00 ?  247 PHE C CA   1  
ATOM   9879   C  C    . PHE C  2 193 ? 10.470  -44.515 -2.303  1.00 0.00 ?  247 PHE C C    1  
ATOM   9880   O  O    . PHE C  2 193 ? 9.277   -44.630 -2.575  1.00 0.00 ?  247 PHE C O    1  
ATOM   9881   C  CB   . PHE C  2 193 ? 11.535  -42.270 -1.472  1.00 0.00 ?  247 PHE C CB   1  
ATOM   9882   C  CG   . PHE C  2 193 ? 10.939  -41.639 -2.635  1.00 0.00 ?  247 PHE C CG   1  
ATOM   9883   C  CD1  . PHE C  2 193 ? 9.931   -40.662 -2.507  1.00 0.00 ?  247 PHE C CD1  1  
ATOM   9884   C  CD2  . PHE C  2 193 ? 11.521  -41.874 -3.943  1.00 0.00 ?  247 PHE C CD2  1  
ATOM   9885   C  CE1  . PHE C  2 193 ? 9.404   -39.969 -3.563  1.00 0.00 ?  247 PHE C CE1  1  
ATOM   9886   C  CE2  . PHE C  2 193 ? 11.041  -41.055 -5.050  1.00 0.00 ?  247 PHE C CE2  1  
ATOM   9887   C  CZ   . PHE C  2 193 ? 9.989   -40.154 -4.839  1.00 0.00 ?  247 PHE C CZ   1  
ATOM   9888   H  H    . PHE C  2 193 ? 12.646  -43.935 -0.009  1.00 0.00 ?  247 PHE C H    1  
ATOM   9889   H  HA   . PHE C  2 193 ? 10.109  -43.377 -0.541  1.00 0.00 ?  247 PHE C HA   1  
ATOM   9890   H  HB2  . PHE C  2 193 ? 11.546  -41.603 -0.584  1.00 0.00 ?  247 PHE C HB2  1  
ATOM   9891   H  HB3  . PHE C  2 193 ? 12.580  -42.595 -1.661  1.00 0.00 ?  247 PHE C HB3  1  
ATOM   9892   H  HD1  . PHE C  2 193 ? 9.589   -40.640 -1.483  1.00 0.00 ?  247 PHE C HD1  1  
ATOM   9893   H  HD2  . PHE C  2 193 ? 12.312  -42.598 -4.072  1.00 0.00 ?  247 PHE C HD2  1  
ATOM   9894   H  HE1  . PHE C  2 193 ? 8.626   -39.239 -3.393  1.00 0.00 ?  247 PHE C HE1  1  
ATOM   9895   H  HE2  . PHE C  2 193 ? 11.394  -41.241 -6.053  1.00 0.00 ?  247 PHE C HE2  1  
ATOM   9896   H  HZ   . PHE C  2 193 ? 9.478   -39.573 -5.592  1.00 0.00 ?  247 PHE C HZ   1  
ATOM   9897   N  N    . LYS C  2 194 ? 11.408  -45.239 -2.973  1.00 0.00 ?  248 LYS C N    1  
ATOM   9898   C  CA   . LYS C  2 194 ? 11.056  -46.245 -3.934  1.00 0.00 ?  248 LYS C CA   1  
ATOM   9899   C  C    . LYS C  2 194 ? 10.148  -47.437 -3.505  1.00 0.00 ?  248 LYS C C    1  
ATOM   9900   O  O    . LYS C  2 194 ? 9.228   -47.815 -4.196  1.00 0.00 ?  248 LYS C O    1  
ATOM   9901   C  CB   . LYS C  2 194 ? 12.306  -46.787 -4.613  1.00 0.00 ?  248 LYS C CB   1  
ATOM   9902   C  CG   . LYS C  2 194 ? 13.019  -45.795 -5.524  1.00 0.00 ?  248 LYS C CG   1  
ATOM   9903   C  CD   . LYS C  2 194 ? 14.356  -46.426 -6.011  1.00 0.00 ?  248 LYS C CD   1  
ATOM   9904   C  CE   . LYS C  2 194 ? 14.834  -45.943 -7.374  1.00 0.00 ?  248 LYS C CE   1  
ATOM   9905   N  NZ   . LYS C  2 194 ? 14.107  -46.537 -8.466  1.00 0.00 1  248 LYS C NZ   1  
ATOM   9906   H  H    . LYS C  2 194 ? 12.375  -45.252 -2.730  1.00 0.00 ?  248 LYS C H    1  
ATOM   9907   H  HA   . LYS C  2 194 ? 10.560  -45.784 -4.775  1.00 0.00 ?  248 LYS C HA   1  
ATOM   9908   H  HB2  . LYS C  2 194 ? 13.027  -46.971 -3.789  1.00 0.00 ?  248 LYS C HB2  1  
ATOM   9909   H  HB3  . LYS C